data_4WFH
# 
_entry.id   4WFH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WFH         
WWPDB D_1000203725 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4WFE unspecified 
PDB . 4WFF unspecified 
PDB . 4WFG unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WFH 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brohawn, S.G.' 1 
'MacKinnon, R.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            516 
_citation.language                  ? 
_citation.page_first                126 
_citation.page_last                 130 
_citation.title                     'Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature14013 
_citation.pdbx_database_id_PubMed   25471887 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brohawn, S.G.'  1 
primary 'Campbell, E.B.' 2 
primary 'MacKinnon, R.'  3 
# 
_cell.entry_id           4WFH 
_cell.length_a           80.972 
_cell.length_b           138.755 
_cell.length_c           96.759 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.64 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4WFH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Potassium channel subfamily K member 4'            32569.650 2   ? 'N104Q, N108Q' ? ? 
2 polymer     man 'ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT LIGHT CHAIN' 23038.404 2   ? ?              ? ? 
3 polymer     man 'ANTI-TRAAK ANTIBODY 13E9 FAB FRAGMENT HEAVY CHAIN' 23474.381 2   ? ?              ? ? 
4 non-polymer syn 'THALLIUM (I) ION'                                  204.383   7   ? ?              ? ? 
5 non-polymer syn 'CALCIUM ION'                                       40.078    3   ? ?              ? ? 
6 non-polymer syn DECANE                                              142.282   1   ? ?              ? ? 
7 water       nat water                                               18.015    184 ? ?              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;TWIK-related arachidonic acid-stimulated potassium channel protein,TRAAK,Two pore potassium channel KT4.1,Two pore K(+) channel KT4.1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVS
DQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGIL
LAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTSNSLEVLFQ
;
;MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVS
DQELGLLIKEVADALGGGADPETQSTSQSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGIL
LAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRTSNSLEVLFQ
;
A,B ? 
2 'polypeptide(L)' no no 
;QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAE
DAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLN
SWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
;
;QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAE
DAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLN
SWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
;
D,F ? 
3 'polypeptide(L)' no no 
;EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAY
MELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSG
SLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
;
;EVQLQQSGPELVKPGASMKTSCKVSGYSFTGYIMNWVKQRHGKNLEWIGLINPNTGYTTYNQKFKGKATLTVDKSSSTAY
MELLSLTSEDSAIYYCTRGNYVFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSG
SLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
;
E,G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   THR n 
1 4   ALA n 
1 5   PRO n 
1 6   GLN n 
1 7   GLU n 
1 8   PRO n 
1 9   PRO n 
1 10  ALA n 
1 11  ARG n 
1 12  PRO n 
1 13  LEU n 
1 14  GLN n 
1 15  ALA n 
1 16  GLY n 
1 17  SER n 
1 18  GLY n 
1 19  ALA n 
1 20  GLY n 
1 21  PRO n 
1 22  ALA n 
1 23  PRO n 
1 24  GLY n 
1 25  ARG n 
1 26  ALA n 
1 27  MET n 
1 28  ARG n 
1 29  SER n 
1 30  THR n 
1 31  THR n 
1 32  LEU n 
1 33  LEU n 
1 34  ALA n 
1 35  LEU n 
1 36  LEU n 
1 37  ALA n 
1 38  LEU n 
1 39  VAL n 
1 40  LEU n 
1 41  LEU n 
1 42  TYR n 
1 43  LEU n 
1 44  VAL n 
1 45  SER n 
1 46  GLY n 
1 47  ALA n 
1 48  LEU n 
1 49  VAL n 
1 50  PHE n 
1 51  ARG n 
1 52  ALA n 
1 53  LEU n 
1 54  GLU n 
1 55  GLN n 
1 56  PRO n 
1 57  HIS n 
1 58  GLU n 
1 59  GLN n 
1 60  GLN n 
1 61  ALA n 
1 62  GLN n 
1 63  ARG n 
1 64  GLU n 
1 65  LEU n 
1 66  GLY n 
1 67  GLU n 
1 68  VAL n 
1 69  ARG n 
1 70  GLU n 
1 71  LYS n 
1 72  PHE n 
1 73  LEU n 
1 74  ARG n 
1 75  ALA n 
1 76  HIS n 
1 77  PRO n 
1 78  CYS n 
1 79  VAL n 
1 80  SER n 
1 81  ASP n 
1 82  GLN n 
1 83  GLU n 
1 84  LEU n 
1 85  GLY n 
1 86  LEU n 
1 87  LEU n 
1 88  ILE n 
1 89  LYS n 
1 90  GLU n 
1 91  VAL n 
1 92  ALA n 
1 93  ASP n 
1 94  ALA n 
1 95  LEU n 
1 96  GLY n 
1 97  GLY n 
1 98  GLY n 
1 99  ALA n 
1 100 ASP n 
1 101 PRO n 
1 102 GLU n 
1 103 THR n 
1 104 GLN n 
1 105 SER n 
1 106 THR n 
1 107 SER n 
1 108 GLN n 
1 109 SER n 
1 110 SER n 
1 111 HIS n 
1 112 SER n 
1 113 ALA n 
1 114 TRP n 
1 115 ASP n 
1 116 LEU n 
1 117 GLY n 
1 118 SER n 
1 119 ALA n 
1 120 PHE n 
1 121 PHE n 
1 122 PHE n 
1 123 SER n 
1 124 GLY n 
1 125 THR n 
1 126 ILE n 
1 127 ILE n 
1 128 THR n 
1 129 THR n 
1 130 ILE n 
1 131 GLY n 
1 132 TYR n 
1 133 GLY n 
1 134 ASN n 
1 135 VAL n 
1 136 ALA n 
1 137 LEU n 
1 138 ARG n 
1 139 THR n 
1 140 ASP n 
1 141 ALA n 
1 142 GLY n 
1 143 ARG n 
1 144 LEU n 
1 145 PHE n 
1 146 CYS n 
1 147 ILE n 
1 148 PHE n 
1 149 TYR n 
1 150 ALA n 
1 151 LEU n 
1 152 VAL n 
1 153 GLY n 
1 154 ILE n 
1 155 PRO n 
1 156 LEU n 
1 157 PHE n 
1 158 GLY n 
1 159 ILE n 
1 160 LEU n 
1 161 LEU n 
1 162 ALA n 
1 163 GLY n 
1 164 VAL n 
1 165 GLY n 
1 166 ASP n 
1 167 ARG n 
1 168 LEU n 
1 169 GLY n 
1 170 SER n 
1 171 SER n 
1 172 LEU n 
1 173 ARG n 
1 174 HIS n 
1 175 GLY n 
1 176 ILE n 
1 177 GLY n 
1 178 HIS n 
1 179 ILE n 
1 180 GLU n 
1 181 ALA n 
1 182 ILE n 
1 183 PHE n 
1 184 LEU n 
1 185 LYS n 
1 186 TRP n 
1 187 HIS n 
1 188 VAL n 
1 189 PRO n 
1 190 PRO n 
1 191 GLU n 
1 192 LEU n 
1 193 VAL n 
1 194 ARG n 
1 195 VAL n 
1 196 LEU n 
1 197 SER n 
1 198 ALA n 
1 199 MET n 
1 200 LEU n 
1 201 PHE n 
1 202 LEU n 
1 203 LEU n 
1 204 ILE n 
1 205 GLY n 
1 206 CYS n 
1 207 LEU n 
1 208 LEU n 
1 209 PHE n 
1 210 VAL n 
1 211 LEU n 
1 212 THR n 
1 213 PRO n 
1 214 THR n 
1 215 PHE n 
1 216 VAL n 
1 217 PHE n 
1 218 CYS n 
1 219 TYR n 
1 220 MET n 
1 221 GLU n 
1 222 ASP n 
1 223 TRP n 
1 224 SER n 
1 225 LYS n 
1 226 LEU n 
1 227 GLU n 
1 228 ALA n 
1 229 ILE n 
1 230 TYR n 
1 231 PHE n 
1 232 VAL n 
1 233 ILE n 
1 234 VAL n 
1 235 THR n 
1 236 LEU n 
1 237 THR n 
1 238 THR n 
1 239 VAL n 
1 240 GLY n 
1 241 PHE n 
1 242 GLY n 
1 243 ASP n 
1 244 TYR n 
1 245 VAL n 
1 246 ALA n 
1 247 GLY n 
1 248 ALA n 
1 249 ASP n 
1 250 PRO n 
1 251 ARG n 
1 252 GLN n 
1 253 ASP n 
1 254 SER n 
1 255 PRO n 
1 256 ALA n 
1 257 TYR n 
1 258 GLN n 
1 259 PRO n 
1 260 LEU n 
1 261 VAL n 
1 262 TRP n 
1 263 PHE n 
1 264 TRP n 
1 265 ILE n 
1 266 LEU n 
1 267 LEU n 
1 268 GLY n 
1 269 LEU n 
1 270 ALA n 
1 271 TYR n 
1 272 PHE n 
1 273 ALA n 
1 274 SER n 
1 275 VAL n 
1 276 LEU n 
1 277 THR n 
1 278 THR n 
1 279 ILE n 
1 280 GLY n 
1 281 ASN n 
1 282 TRP n 
1 283 LEU n 
1 284 ARG n 
1 285 VAL n 
1 286 VAL n 
1 287 SER n 
1 288 ARG n 
1 289 ARG n 
1 290 THR n 
1 291 SER n 
1 292 ASN n 
1 293 SER n 
1 294 LEU n 
1 295 GLU n 
1 296 VAL n 
1 297 LEU n 
1 298 PHE n 
1 299 GLN n 
2 1   GLN n 
2 2   ILE n 
2 3   VAL n 
2 4   LEU n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ALA n 
2 10  ILE n 
2 11  MET n 
2 12  SER n 
2 13  ALA n 
2 14  SER n 
2 15  PRO n 
2 16  GLY n 
2 17  GLU n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  MET n 
2 22  THR n 
2 23  CYS n 
2 24  SER n 
2 25  ALA n 
2 26  SER n 
2 27  SER n 
2 28  SER n 
2 29  VAL n 
2 30  SER n 
2 31  TYR n 
2 32  MET n 
2 33  HIS n 
2 34  TRP n 
2 35  TYR n 
2 36  GLN n 
2 37  GLN n 
2 38  LYS n 
2 39  SER n 
2 40  GLY n 
2 41  THR n 
2 42  SER n 
2 43  PRO n 
2 44  LYS n 
2 45  ARG n 
2 46  TRP n 
2 47  ILE n 
2 48  TYR n 
2 49  ASP n 
2 50  THR n 
2 51  SER n 
2 52  LYS n 
2 53  LEU n 
2 54  ALA n 
2 55  SER n 
2 56  GLY n 
2 57  VAL n 
2 58  PRO n 
2 59  ALA n 
2 60  ARG n 
2 61  PHE n 
2 62  SER n 
2 63  GLY n 
2 64  SER n 
2 65  GLY n 
2 66  SER n 
2 67  GLY n 
2 68  THR n 
2 69  SER n 
2 70  TYR n 
2 71  SER n 
2 72  LEU n 
2 73  THR n 
2 74  ILE n 
2 75  SER n 
2 76  SER n 
2 77  MET n 
2 78  GLU n 
2 79  ALA n 
2 80  GLU n 
2 81  ASP n 
2 82  ALA n 
2 83  ALA n 
2 84  THR n 
2 85  TYR n 
2 86  TYR n 
2 87  CYS n 
2 88  GLN n 
2 89  GLN n 
2 90  TRP n 
2 91  SER n 
2 92  ASN n 
2 93  SER n 
2 94  PRO n 
2 95  PRO n 
2 96  THR n 
2 97  PHE n 
2 98  GLY n 
2 99  ALA n 
2 100 GLY n 
2 101 ALA n 
2 102 LYS n 
2 103 LEU n 
2 104 GLU n 
2 105 LEU n 
2 106 LYS n 
2 107 ARG n 
2 108 ALA n 
2 109 ASP n 
2 110 ALA n 
2 111 ALA n 
2 112 PRO n 
2 113 THR n 
2 114 VAL n 
2 115 SER n 
2 116 ILE n 
2 117 PHE n 
2 118 PRO n 
2 119 PRO n 
2 120 SER n 
2 121 SER n 
2 122 GLU n 
2 123 GLN n 
2 124 LEU n 
2 125 THR n 
2 126 SER n 
2 127 GLY n 
2 128 GLY n 
2 129 ALA n 
2 130 SER n 
2 131 VAL n 
2 132 VAL n 
2 133 CYS n 
2 134 PHE n 
2 135 LEU n 
2 136 ASN n 
2 137 ASN n 
2 138 PHE n 
2 139 TYR n 
2 140 PRO n 
2 141 LYS n 
2 142 ASP n 
2 143 ILE n 
2 144 ASN n 
2 145 VAL n 
2 146 LYS n 
2 147 TRP n 
2 148 LYS n 
2 149 ILE n 
2 150 ASP n 
2 151 GLY n 
2 152 SER n 
2 153 GLU n 
2 154 ARG n 
2 155 GLN n 
2 156 ASN n 
2 157 GLY n 
2 158 VAL n 
2 159 LEU n 
2 160 ASN n 
2 161 SER n 
2 162 TRP n 
2 163 THR n 
2 164 ASP n 
2 165 GLN n 
2 166 ASP n 
2 167 SER n 
2 168 LYS n 
2 169 ASP n 
2 170 SER n 
2 171 THR n 
2 172 TYR n 
2 173 SER n 
2 174 MET n 
2 175 SER n 
2 176 SER n 
2 177 THR n 
2 178 LEU n 
2 179 THR n 
2 180 LEU n 
2 181 THR n 
2 182 LYS n 
2 183 ASP n 
2 184 GLU n 
2 185 TYR n 
2 186 GLU n 
2 187 ARG n 
2 188 HIS n 
2 189 ASN n 
2 190 SER n 
2 191 TYR n 
2 192 THR n 
2 193 CYS n 
2 194 GLU n 
2 195 ALA n 
2 196 THR n 
2 197 HIS n 
2 198 LYS n 
2 199 THR n 
2 200 SER n 
2 201 THR n 
2 202 SER n 
2 203 PRO n 
2 204 ILE n 
2 205 VAL n 
2 206 LYS n 
2 207 SER n 
2 208 PHE n 
2 209 ASN n 
2 210 ARG n 
2 211 ASN n 
3 1   GLU n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   GLN n 
3 6   GLN n 
3 7   SER n 
3 8   GLY n 
3 9   PRO n 
3 10  GLU n 
3 11  LEU n 
3 12  VAL n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  ALA n 
3 17  SER n 
3 18  MET n 
3 19  LYS n 
3 20  THR n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  VAL n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  SER n 
3 29  PHE n 
3 30  THR n 
3 31  GLY n 
3 32  TYR n 
3 33  ILE n 
3 34  MET n 
3 35  ASN n 
3 36  TRP n 
3 37  VAL n 
3 38  LYS n 
3 39  GLN n 
3 40  ARG n 
3 41  HIS n 
3 42  GLY n 
3 43  LYS n 
3 44  ASN n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  ILE n 
3 49  GLY n 
3 50  LEU n 
3 51  ILE n 
3 52  ASN n 
3 53  PRO n 
3 54  ASN n 
3 55  THR n 
3 56  GLY n 
3 57  TYR n 
3 58  THR n 
3 59  THR n 
3 60  TYR n 
3 61  ASN n 
3 62  GLN n 
3 63  LYS n 
3 64  PHE n 
3 65  LYS n 
3 66  GLY n 
3 67  LYS n 
3 68  ALA n 
3 69  THR n 
3 70  LEU n 
3 71  THR n 
3 72  VAL n 
3 73  ASP n 
3 74  LYS n 
3 75  SER n 
3 76  SER n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  MET n 
3 82  GLU n 
3 83  LEU n 
3 84  LEU n 
3 85  SER n 
3 86  LEU n 
3 87  THR n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  SER n 
3 92  ALA n 
3 93  ILE n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  THR n 
3 98  ARG n 
3 99  GLY n 
3 100 ASN n 
3 101 TYR n 
3 102 VAL n 
3 103 PHE n 
3 104 ASP n 
3 105 TYR n 
3 106 TRP n 
3 107 GLY n 
3 108 GLN n 
3 109 GLY n 
3 110 THR n 
3 111 THR n 
3 112 LEU n 
3 113 THR n 
3 114 VAL n 
3 115 SER n 
3 116 SER n 
3 117 ALA n 
3 118 LYS n 
3 119 THR n 
3 120 THR n 
3 121 PRO n 
3 122 PRO n 
3 123 SER n 
3 124 VAL n 
3 125 TYR n 
3 126 PRO n 
3 127 LEU n 
3 128 ALA n 
3 129 PRO n 
3 130 GLY n 
3 131 SER n 
3 132 ALA n 
3 133 ALA n 
3 134 GLN n 
3 135 THR n 
3 136 ASN n 
3 137 SER n 
3 138 MET n 
3 139 VAL n 
3 140 THR n 
3 141 LEU n 
3 142 GLY n 
3 143 CYS n 
3 144 LEU n 
3 145 VAL n 
3 146 LYS n 
3 147 GLY n 
3 148 TYR n 
3 149 PHE n 
3 150 PRO n 
3 151 GLU n 
3 152 PRO n 
3 153 VAL n 
3 154 THR n 
3 155 VAL n 
3 156 THR n 
3 157 TRP n 
3 158 ASN n 
3 159 SER n 
3 160 GLY n 
3 161 SER n 
3 162 LEU n 
3 163 SER n 
3 164 SER n 
3 165 GLY n 
3 166 VAL n 
3 167 HIS n 
3 168 THR n 
3 169 PHE n 
3 170 PRO n 
3 171 ALA n 
3 172 VAL n 
3 173 LEU n 
3 174 GLN n 
3 175 SER n 
3 176 ASP n 
3 177 LEU n 
3 178 TYR n 
3 179 THR n 
3 180 LEU n 
3 181 SER n 
3 182 SER n 
3 183 SER n 
3 184 VAL n 
3 185 THR n 
3 186 VAL n 
3 187 PRO n 
3 188 SER n 
3 189 SER n 
3 190 SER n 
3 191 TRP n 
3 192 PRO n 
3 193 SER n 
3 194 GLU n 
3 195 THR n 
3 196 VAL n 
3 197 THR n 
3 198 CYS n 
3 199 ASN n 
3 200 VAL n 
3 201 ALA n 
3 202 HIS n 
3 203 PRO n 
3 204 ALA n 
3 205 SER n 
3 206 SER n 
3 207 THR n 
3 208 LYS n 
3 209 VAL n 
3 210 ASP n 
3 211 LYS n 
3 212 LYS n 
3 213 ILE n 
3 214 VAL n 
3 215 PRO n 
3 216 ARG n 
3 217 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 299 Human ? 'KCNK4, TRAAK' ? ? ? ? ? ? 'Homo sapiens' 9606  ? ? ? ? ? ? ? ? 
'Komagataella pastoris' 4922  ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 211 mouse ? ?              ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Mus musculus' 
10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 217 mouse ? ?              ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Mus musculus' 
10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP KCNK4_HUMAN Q9NYG8 Q9NYG8-2 1 
;MTTAPQEPPARPLQAGSGAGPAPGRAMRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVS
DQELGLLIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVGIPLFGIL
LAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVG
FGDYVAGADPRQDSPAYQPLVWFWILLGLAYFASVLTTIGNWLRVVSRRT
;
1 
2 PDB 4WFH        4WFH   ?        2 ? 1 
3 PDB 4WFH        4WFH   ?        3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WFH A 1 ? 290 ? Q9NYG8 1 ? 290 ? 1 290 
2 1 4WFH B 1 ? 290 ? Q9NYG8 1 ? 290 ? 1 290 
3 2 4WFH D 1 ? 211 ? 4WFH   1 ? 211 ? 1 211 
4 3 4WFH E 1 ? 217 ? 4WFH   1 ? 217 ? 1 217 
5 2 4WFH F 1 ? 211 ? 4WFH   1 ? 211 ? 1 211 
6 3 4WFH G 1 ? 217 ? 4WFH   1 ? 217 ? 1 217 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4WFH GLN A 104 ? UNP Q9NYG8 ASN 104 'engineered mutation' 104 1  
1 4WFH GLN A 108 ? UNP Q9NYG8 ASN 108 'engineered mutation' 108 2  
1 4WFH SER A 291 ? UNP Q9NYG8 ?   ?   'expression tag'      291 3  
1 4WFH ASN A 292 ? UNP Q9NYG8 ?   ?   'expression tag'      292 4  
1 4WFH SER A 293 ? UNP Q9NYG8 ?   ?   'expression tag'      293 5  
1 4WFH LEU A 294 ? UNP Q9NYG8 ?   ?   'expression tag'      294 6  
1 4WFH GLU A 295 ? UNP Q9NYG8 ?   ?   'expression tag'      295 7  
1 4WFH VAL A 296 ? UNP Q9NYG8 ?   ?   'expression tag'      296 8  
1 4WFH LEU A 297 ? UNP Q9NYG8 ?   ?   'expression tag'      297 9  
1 4WFH PHE A 298 ? UNP Q9NYG8 ?   ?   'expression tag'      298 10 
1 4WFH GLN A 299 ? UNP Q9NYG8 ?   ?   'expression tag'      299 11 
2 4WFH GLN B 104 ? UNP Q9NYG8 ASN 104 'engineered mutation' 104 12 
2 4WFH GLN B 108 ? UNP Q9NYG8 ASN 108 'engineered mutation' 108 13 
2 4WFH SER B 291 ? UNP Q9NYG8 ?   ?   'expression tag'      291 14 
2 4WFH ASN B 292 ? UNP Q9NYG8 ?   ?   'expression tag'      292 15 
2 4WFH SER B 293 ? UNP Q9NYG8 ?   ?   'expression tag'      293 16 
2 4WFH LEU B 294 ? UNP Q9NYG8 ?   ?   'expression tag'      294 17 
2 4WFH GLU B 295 ? UNP Q9NYG8 ?   ?   'expression tag'      295 18 
2 4WFH VAL B 296 ? UNP Q9NYG8 ?   ?   'expression tag'      296 19 
2 4WFH LEU B 297 ? UNP Q9NYG8 ?   ?   'expression tag'      297 20 
2 4WFH PHE B 298 ? UNP Q9NYG8 ?   ?   'expression tag'      298 21 
2 4WFH GLN B 299 ? UNP Q9NYG8 ?   ?   'expression tag'      299 22 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'      ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
D10 non-polymer         . DECANE             ? 'C10 H22'        142.282 
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TL  non-polymer         . 'THALLIUM (I) ION' ? 'Tl 1'           204.383 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WFH 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;50 MM TRIS PH 8.8, 200 MM CA(NO3)2, 27-30%
 (VOL/VOL) PEG400
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-04-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9781 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9781 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4WFH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3 
_reflns.d_resolution_low                 48.2 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       39746 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3 
_reflns_shell.d_res_low                   3.05 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             10.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.54 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            3.38 
_refine.aniso_B[2][2]                            -3.27 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            3.22 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               112.451 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.906 
_refine.correlation_coeff_Fo_to_Fc_free          0.917 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4WFH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.01 
_refine.ls_d_res_low                             48.2 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     39746 
_refine.ls_number_reflns_R_free                  2098 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.00 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20502 
_refine.ls_R_factor_R_free                       0.23850 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.20321 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.377 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             47.469 
_refine.overall_SU_ML                            0.392 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        10302 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             184 
_refine_hist.number_atoms_total               10506 
_refine_hist.d_res_high                       3.01 
_refine_hist.d_res_low                        48.2 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  0.020  10580 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  9860  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 0.908  1.955  14415 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.608  3.000  22756 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.707  5.000  1328  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 33.475 23.731 402   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.735 15.000 1676  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.320 15.000 41    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.053  0.200  1642  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  11839 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  2392  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 4.923  5.264  5345  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.922  5.264  5344  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 7.563  7.892  6662  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 7.562  7.893  6663  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.637  5.674  5235  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.637  5.676  5236  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 8.686  8.342  7754  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 13.568 50.719 43753 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 13.569 50.721 43754 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.14 0.05 ? ? A 12265 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.14 0.05 ? ? B 12265 'interatomic distance' 
'X-RAY DIFFRACTION' 1 2 3 ? 0.10 0.05 ? ? D 11182 'interatomic distance' 
'X-RAY DIFFRACTION' 2 2 4 ? 0.10 0.05 ? ? F 11182 'interatomic distance' 
'X-RAY DIFFRACTION' 1 3 5 ? 0.10 0.05 ? ? E 11473 'interatomic distance' 
'X-RAY DIFFRACTION' 2 3 6 ? 0.10 0.05 ? ? G 11473 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.010 
_refine_ls_shell.d_res_low                        3.088 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             130 
_refine_ls_shell.number_reflns_R_work             2602 
_refine_ls_shell.percent_reflns_obs               87.73 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.347 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.371 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
1 D 2 
2 F 2 
1 E 3 
2 G 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 28 A 273 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 28 B 273 0 0 ? ? ? ? ? ? ? ? 1 ? 
1 D 1  D 211 0 0 ? ? ? ? ? ? ? ? 2 ? 
2 F 1  F 211 0 0 ? ? ? ? ? ? ? ? 2 ? 
1 E 1  E 215 0 0 ? ? ? ? ? ? ? ? 3 ? 
2 G 1  G 215 0 0 ? ? ? ? ? ? ? ? 3 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     4WFH 
_struct.title                        'Human TRAAK K+ channel in a Tl+ bound nonconductive conformation' 
_struct.pdbx_descriptor              'TRAAK (K2P4.1), ANTIBODY FAB FRAGMENT LIGHT CHAIN, ANTIBODY FAB FRAGMENT HEAVY CHAIN' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4WFH 
_struct_keywords.text            
'Mechanosensitive ion channel, two-pore domain potassium ion channel, membrane protein, METAL TRANSPORT' 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 6 ? 
Q N N 5 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 28  ? GLN A 55  ? ARG A 28  GLN A 55  1 ? 28 
HELX_P HELX_P2  AA2 PRO A 56  ? GLU A 58  ? PRO A 56  GLU A 58  5 ? 3  
HELX_P HELX_P3  AA3 GLN A 59  ? HIS A 76  ? GLN A 59  HIS A 76  1 ? 18 
HELX_P HELX_P4  AA4 SER A 80  ? GLY A 97  ? SER A 80  GLY A 97  1 ? 18 
HELX_P HELX_P5  AA5 ASP A 115 ? THR A 128 ? ASP A 115 THR A 128 1 ? 14 
HELX_P HELX_P6  AA6 THR A 139 ? TRP A 186 ? THR A 139 TRP A 186 1 ? 48 
HELX_P HELX_P7  AA7 PRO A 189 ? VAL A 210 ? PRO A 189 VAL A 210 1 ? 22 
HELX_P HELX_P8  AA8 VAL A 210 ? ASP A 222 ? VAL A 210 ASP A 222 1 ? 13 
HELX_P HELX_P9  AA9 SER A 224 ? THR A 237 ? SER A 224 THR A 237 1 ? 14 
HELX_P HELX_P10 AB1 ALA A 256 ? VAL A 286 ? ALA A 256 VAL A 286 1 ? 31 
HELX_P HELX_P11 AB2 SER B 29  ? HIS B 76  ? SER B 29  HIS B 76  1 ? 48 
HELX_P HELX_P12 AB3 SER B 80  ? GLY B 97  ? SER B 80  GLY B 97  1 ? 18 
HELX_P HELX_P13 AB4 ASP B 115 ? THR B 128 ? ASP B 115 THR B 128 1 ? 14 
HELX_P HELX_P14 AB5 THR B 139 ? TRP B 186 ? THR B 139 TRP B 186 1 ? 48 
HELX_P HELX_P15 AB6 PRO B 189 ? VAL B 210 ? PRO B 189 VAL B 210 1 ? 22 
HELX_P HELX_P16 AB7 VAL B 210 ? ASP B 222 ? VAL B 210 ASP B 222 1 ? 13 
HELX_P HELX_P17 AB8 SER B 224 ? THR B 237 ? SER B 224 THR B 237 1 ? 14 
HELX_P HELX_P18 AB9 ALA B 256 ? SER B 274 ? ALA B 256 SER B 274 1 ? 19 
HELX_P HELX_P19 AC1 GLU C 78  ? ALA C 82  ? GLU D 78  ALA D 82  5 ? 5  
HELX_P HELX_P20 AC2 SER C 120 ? THR C 125 ? SER D 120 THR D 125 1 ? 6  
HELX_P HELX_P21 AC3 LYS C 182 ? HIS C 188 ? LYS D 182 HIS D 188 1 ? 7  
HELX_P HELX_P22 AC4 SER D 28  ? TYR D 32  ? SER E 28  TYR E 32  5 ? 5  
HELX_P HELX_P23 AC5 GLN D 62  ? LYS D 65  ? GLN E 62  LYS E 65  5 ? 4  
HELX_P HELX_P24 AC6 THR D 87  ? SER D 91  ? THR E 87  SER E 91  5 ? 5  
HELX_P HELX_P25 AC7 SER D 159 ? SER D 161 ? SER E 159 SER E 161 5 ? 3  
HELX_P HELX_P26 AC8 PRO D 203 ? SER D 206 ? PRO E 203 SER E 206 5 ? 4  
HELX_P HELX_P27 AC9 GLU E 78  ? ALA E 82  ? GLU F 78  ALA F 82  5 ? 5  
HELX_P HELX_P28 AD1 SER E 120 ? SER E 126 ? SER F 120 SER F 126 1 ? 7  
HELX_P HELX_P29 AD2 LYS E 182 ? HIS E 188 ? LYS F 182 HIS F 188 1 ? 7  
HELX_P HELX_P30 AD3 SER F 28  ? TYR F 32  ? SER G 28  TYR G 32  5 ? 5  
HELX_P HELX_P31 AD4 GLN F 62  ? LYS F 65  ? GLN G 62  LYS G 65  5 ? 4  
HELX_P HELX_P32 AD5 THR F 87  ? SER F 91  ? THR G 87  SER G 91  5 ? 5  
HELX_P HELX_P33 AD6 SER F 159 ? SER F 161 ? SER G 159 SER G 161 5 ? 3  
HELX_P HELX_P34 AD7 PRO F 203 ? SER F 206 ? PRO G 203 SER G 206 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 78  SG  ? ? ? 1_555 B CYS 78  SG ? ? A CYS 78  B CYS 78  1_555 ? ? ? ? ? ? ? 2.067 ?    
disulf2  disulf ? ? C CYS 23  SG  ? ? ? 1_555 C CYS 87  SG ? ? D CYS 23  D CYS 87  1_555 ? ? ? ? ? ? ? 2.037 ?    
disulf3  disulf ? ? C CYS 133 SG  ? ? ? 1_555 C CYS 193 SG ? ? D CYS 133 D CYS 193 1_555 ? ? ? ? ? ? ? 2.028 ?    
disulf4  disulf ? ? D CYS 22  SG  ? ? ? 1_555 D CYS 96  SG ? ? E CYS 22  E CYS 96  1_555 ? ? ? ? ? ? ? 2.037 ?    
disulf5  disulf ? ? D CYS 143 SG  ? ? ? 1_555 D CYS 198 SG ? ? E CYS 143 E CYS 198 1_555 ? ? ? ? ? ? ? 2.009 ?    
disulf6  disulf ? ? E CYS 23  SG  ? ? ? 1_555 E CYS 87  SG ? ? F CYS 23  F CYS 87  1_555 ? ? ? ? ? ? ? 2.059 ?    
disulf7  disulf ? ? E CYS 133 SG  ? ? ? 1_555 E CYS 193 SG ? ? F CYS 133 F CYS 193 1_555 ? ? ? ? ? ? ? 2.024 ?    
disulf8  disulf ? ? F CYS 22  SG  ? ? ? 1_555 F CYS 96  SG ? ? G CYS 22  G CYS 96  1_555 ? ? ? ? ? ? ? 2.049 ?    
disulf9  disulf ? ? F CYS 143 SG  ? ? ? 1_555 F CYS 198 SG ? ? G CYS 143 G CYS 198 1_555 ? ? ? ? ? ? ? 2.017 ?    
metalc1  metalc ? ? A GLY 98  O   ? ? ? 1_555 L CA  .   CA ? ? A GLY 98  A CA  306 1_555 ? ? ? ? ? ? ? 2.472 ?    
metalc2  metalc ? ? A ASP 100 OD2 ? ? ? 1_555 L CA  .   CA ? ? A ASP 100 A CA  306 1_555 ? ? ? ? ? ? ? 2.901 ?    
metalc3  metalc ? ? A HIS 111 O   ? ? ? 1_555 L CA  .   CA ? ? A HIS 111 A CA  306 1_555 ? ? ? ? ? ? ? 3.188 ?    
metalc4  metalc ? ? A SER 112 O   ? ? ? 1_555 K CA  .   CA ? ? A SER 112 A CA  305 1_555 ? ? ? ? ? ? ? 2.395 ?    
metalc5  metalc ? ? A ASP 115 OD1 ? ? ? 1_555 K CA  .   CA ? ? A ASP 115 A CA  305 1_555 ? ? ? ? ? ? ? 2.886 ?    
metalc6  metalc ? ? A ASP 115 OD2 ? ? ? 1_555 K CA  .   CA ? ? A ASP 115 A CA  305 1_555 ? ? ? ? ? ? ? 2.186 ?    
metalc7  metalc ? ? A SER 118 OG  ? ? ? 1_555 K CA  .   CA ? ? A SER 118 A CA  305 1_555 ? ? ? ? ? ? ? 2.826 ?    
metalc8  metalc ? ? A THR 129 O   ? ? ? 1_555 I TL  .   TL ? ? A THR 129 A TL  303 1_555 ? ? ? ? ? ? ? 2.923 ?    
metalc9  metalc ? ? A THR 129 O   ? ? ? 1_555 J TL  .   TL ? ? A THR 129 A TL  304 1_555 ? ? ? ? ? ? ? 3.160 ?    
metalc10 metalc ? ? A THR 129 OG1 ? ? ? 1_555 J TL  .   TL ? ? A THR 129 A TL  304 1_555 ? ? ? ? ? ? ? 2.905 ?    
metalc11 metalc ? ? A ILE 130 O   ? ? ? 1_555 I TL  .   TL ? ? A ILE 130 A TL  303 1_555 ? ? ? ? ? ? ? 2.852 ?    
metalc12 metalc ? ? A ILE 130 O   ? ? ? 1_555 H TL  .   TL ? ? A ILE 130 A TL  302 1_555 ? ? ? ? ? ? ? 3.111 ?    
metalc13 metalc ? ? A GLY 131 O   ? ? ? 1_555 H TL  .   TL ? ? A GLY 131 A TL  302 1_555 ? ? ? ? ? ? ? 2.886 ?    
metalc14 metalc ? ? A GLY 131 O   ? ? ? 1_555 M TL  .   TL ? ? A GLY 131 A TL  307 1_555 ? ? ? ? ? ? ? 3.311 ?    
metalc15 metalc ? ? A TYR 132 O   ? ? ? 1_555 M TL  .   TL ? ? A TYR 132 A TL  307 1_555 ? ? ? ? ? ? ? 2.934 ?    
metalc16 metalc ? ? A CYS 218 O   ? ? ? 1_555 G TL  .   TL ? ? A CYS 218 A TL  301 1_555 ? ? ? ? ? ? ? 3.010 ?    
metalc17 metalc ? ? A TRP 223 O   ? ? ? 1_555 G TL  .   TL ? ? A TRP 223 A TL  301 1_555 ? ? ? ? ? ? ? 2.635 ?    
metalc18 metalc ? ? A THR 238 O   ? ? ? 1_555 I TL  .   TL ? ? A THR 238 A TL  303 1_555 ? ? ? ? ? ? ? 2.636 ?    
metalc19 metalc ? ? A THR 238 O   ? ? ? 1_555 J TL  .   TL ? ? A THR 238 A TL  304 1_555 ? ? ? ? ? ? ? 2.909 ?    
metalc20 metalc ? ? A THR 238 OG1 ? ? ? 1_555 J TL  .   TL ? ? A THR 238 A TL  304 1_555 ? ? ? ? ? ? ? 2.360 ?    
metalc21 metalc ? ? A VAL 239 O   ? ? ? 1_555 I TL  .   TL ? ? A VAL 239 A TL  303 1_555 ? ? ? ? ? ? ? 2.713 ?    
metalc22 metalc ? ? A VAL 239 O   ? ? ? 1_555 H TL  .   TL ? ? A VAL 239 A TL  302 1_555 ? ? ? ? ? ? ? 2.774 ?    
metalc23 metalc ? ? A GLY 240 O   ? ? ? 1_555 H TL  .   TL ? ? A GLY 240 A TL  302 1_555 ? ? ? ? ? ? ? 2.483 ?    
metalc24 metalc ? ? A GLY 240 O   ? ? ? 1_555 M TL  .   TL ? ? A GLY 240 A TL  307 1_555 ? ? ? ? ? ? ? 3.067 ?    
metalc25 metalc ? ? A PHE 241 O   ? ? ? 1_555 M TL  .   TL ? ? A PHE 241 A TL  307 1_555 ? ? ? ? ? ? ? 2.508 ?    
metalc26 metalc ? ? A ASP 249 OD1 ? ? ? 1_555 K CA  .   CA ? ? A ASP 249 A CA  305 1_555 ? ? ? ? ? ? ? 2.478 ?    
metalc27 metalc ? ? A ASP 249 OD2 ? ? ? 1_555 K CA  .   CA ? ? A ASP 249 A CA  305 1_555 ? ? ? ? ? ? ? 2.957 ?    
metalc28 metalc ? ? B GLU 58  OE2 ? ? ? 1_555 L CA  .   CA ? ? B GLU 58  A CA  306 1_555 ? ? ? ? ? ? ? 2.840 ?    
metalc29 metalc ? ? B THR 129 O   ? ? ? 1_555 I TL  .   TL ? ? B THR 129 A TL  303 1_555 ? ? ? ? ? ? ? 2.906 ?    
metalc30 metalc ? ? B THR 129 O   ? ? ? 1_555 J TL  .   TL ? ? B THR 129 A TL  304 1_555 ? ? ? ? ? ? ? 3.044 ?    
metalc31 metalc ? ? B THR 129 OG1 ? ? ? 1_555 J TL  .   TL ? ? B THR 129 A TL  304 1_555 ? ? ? ? ? ? ? 2.879 ?    
metalc32 metalc ? ? B ILE 130 O   ? ? ? 1_555 I TL  .   TL ? ? B ILE 130 A TL  303 1_555 ? ? ? ? ? ? ? 2.747 ?    
metalc33 metalc ? ? B ILE 130 O   ? ? ? 1_555 H TL  .   TL ? ? B ILE 130 A TL  302 1_555 ? ? ? ? ? ? ? 3.162 ?    
metalc34 metalc ? ? B GLY 131 O   ? ? ? 1_555 H TL  .   TL ? ? B GLY 131 A TL  302 1_555 ? ? ? ? ? ? ? 2.808 ?    
metalc35 metalc ? ? B GLY 131 O   ? ? ? 1_555 M TL  .   TL ? ? B GLY 131 A TL  307 1_555 ? ? ? ? ? ? ? 3.188 ?    
metalc36 metalc ? ? B TYR 132 O   ? ? ? 1_555 M TL  .   TL ? ? B TYR 132 A TL  307 1_555 ? ? ? ? ? ? ? 2.682 ?    
metalc37 metalc ? ? B CYS 218 O   ? ? ? 1_555 O TL  .   TL ? ? B CYS 218 B TL  302 1_555 ? ? ? ? ? ? ? 2.982 ?    
metalc38 metalc ? ? B TRP 223 O   ? ? ? 1_555 O TL  .   TL ? ? B TRP 223 B TL  302 1_555 ? ? ? ? ? ? ? 2.761 ?    
metalc39 metalc ? ? B THR 238 O   ? ? ? 1_555 I TL  .   TL ? ? B THR 238 A TL  303 1_555 ? ? ? ? ? ? ? 2.799 ?    
metalc40 metalc ? ? B THR 238 O   ? ? ? 1_555 J TL  .   TL ? ? B THR 238 A TL  304 1_555 ? ? ? ? ? ? ? 2.916 ?    
metalc41 metalc ? ? B THR 238 OG1 ? ? ? 1_555 J TL  .   TL ? ? B THR 238 A TL  304 1_555 ? ? ? ? ? ? ? 2.550 ?    
metalc42 metalc ? ? B VAL 239 O   ? ? ? 1_555 I TL  .   TL ? ? B VAL 239 A TL  303 1_555 ? ? ? ? ? ? ? 2.689 ?    
metalc43 metalc ? ? B VAL 239 O   ? ? ? 1_555 H TL  .   TL ? ? B VAL 239 A TL  302 1_555 ? ? ? ? ? ? ? 2.953 ?    
metalc44 metalc ? ? B GLY 240 O   ? ? ? 1_555 H TL  .   TL ? ? B GLY 240 A TL  302 1_555 ? ? ? ? ? ? ? 2.466 ?    
metalc45 metalc ? ? B GLY 240 O   ? ? ? 1_555 M TL  .   TL ? ? B GLY 240 A TL  307 1_555 ? ? ? ? ? ? ? 3.164 ?    
metalc46 metalc ? ? B PHE 241 O   ? ? ? 1_555 M TL  .   TL ? ? B PHE 241 A TL  307 1_555 ? ? ? ? ? ? ? 2.503 ?    
metalc47 metalc ? ? F GLU 10  OE1 ? ? ? 1_555 Q CA  .   CA ? ? G GLU 10  G CA  301 1_555 ? ? ? ? ? ? ? 2.259 ?    
metalc48 metalc ? ? F GLU 10  OE2 ? ? ? 1_555 Q CA  .   CA ? ? G GLU 10  G CA  301 1_555 ? ? ? ? ? ? ? 2.722 ?    
metalc49 metalc ? ? F LYS 19  O   ? ? ? 1_555 Q CA  .   CA ? ? G LYS 19  G CA  301 1_555 ? ? ? ? ? ? ? 2.963 ?    
metalc50 metalc ? ? L CA  .   CA  ? ? ? 1_555 R HOH .   O  ? ? A CA  306 A HOH 417 1_555 ? ? ? ? ? ? ? 2.600 ?    
metalc51 metalc ? ? L CA  .   CA  ? ? ? 1_555 S HOH .   O  ? ? A CA  306 B HOH 414 1_555 ? ? ? ? ? ? ? 2.889 ?    
metalc52 metalc ? ? Q CA  .   CA  ? ? ? 1_555 W HOH .   O  ? ? G CA  301 G HOH 407 1_555 ? ? ? ? ? ? ? 2.725 ?    
metalc53 metalc ? ? D GLU 194 OE2 ? ? ? 1_555 Q CA  .   CA ? ? E GLU 194 G CA  301 2_556 ? ? ? ? ? ? ? 1.525 sing 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 7   C . ? SER 7   D PRO 8   C ? PRO 8   D 1 -0.49 
2  SER 93  C . ? SER 93  D PRO 94  C ? PRO 94  D 1 -2.82 
3  TYR 139 C . ? TYR 139 D PRO 140 C ? PRO 140 D 1 6.33  
4  PHE 149 D . ? PHE 149 E PRO 150 D ? PRO 150 E 1 -0.60 
5  GLU 151 D . ? GLU 151 E PRO 152 D ? PRO 152 E 1 -2.48 
6  TRP 191 D . ? TRP 191 E PRO 192 D ? PRO 192 E 1 9.84  
7  SER 7   E . ? SER 7   F PRO 8   E ? PRO 8   F 1 -2.13 
8  SER 93  E . ? SER 93  F PRO 94  E ? PRO 94  F 1 -0.27 
9  TYR 139 E . ? TYR 139 F PRO 140 E ? PRO 140 F 1 6.95  
10 PHE 149 F . ? PHE 149 G PRO 150 F ? PRO 150 G 1 -2.41 
11 GLU 151 F . ? GLU 151 G PRO 152 F ? PRO 152 G 1 -2.43 
12 TRP 191 F . ? TRP 191 G PRO 192 F ? PRO 192 G 1 7.38  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 6 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 6 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 6 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 4 ? 
AC4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB4 5 6 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? parallel      
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU C 4   ? THR C 5   ? LEU D 4   THR D 5   
AA1 2 VAL C 19  ? ALA C 25  ? VAL D 19  ALA D 25  
AA1 3 SER C 69  ? ILE C 74  ? SER D 69  ILE D 74  
AA1 4 PHE C 61  ? SER C 66  ? PHE D 61  SER D 66  
AA2 1 ILE C 10  ? ALA C 13  ? ILE D 10  ALA D 13  
AA2 2 ALA C 101 ? LEU C 105 ? ALA D 101 LEU D 105 
AA2 3 ALA C 83  ? GLN C 89  ? ALA D 83  GLN D 89  
AA2 4 HIS C 33  ? GLN C 37  ? HIS D 33  GLN D 37  
AA2 5 LYS C 44  ? TYR C 48  ? LYS D 44  TYR D 48  
AA2 6 LYS C 52  ? LEU C 53  ? LYS D 52  LEU D 53  
AA3 1 ILE C 10  ? ALA C 13  ? ILE D 10  ALA D 13  
AA3 2 ALA C 101 ? LEU C 105 ? ALA D 101 LEU D 105 
AA3 3 ALA C 83  ? GLN C 89  ? ALA D 83  GLN D 89  
AA3 4 THR C 96  ? PHE C 97  ? THR D 96  PHE D 97  
AA4 1 THR C 113 ? PHE C 117 ? THR D 113 PHE D 117 
AA4 2 GLY C 128 ? PHE C 138 ? GLY D 128 PHE D 138 
AA4 3 TYR C 172 ? THR C 181 ? TYR D 172 THR D 181 
AA4 4 VAL C 158 ? TRP C 162 ? VAL D 158 TRP D 162 
AA5 1 SER C 152 ? ARG C 154 ? SER D 152 ARG D 154 
AA5 2 ILE C 143 ? ILE C 149 ? ILE D 143 ILE D 149 
AA5 3 SER C 190 ? HIS C 197 ? SER D 190 HIS D 197 
AA5 4 ILE C 204 ? ASN C 209 ? ILE D 204 ASN D 209 
AA6 1 GLN D 3   ? GLN D 6   ? GLN E 3   GLN E 6   
AA6 2 MET D 18  ? SER D 25  ? MET E 18  SER E 25  
AA6 3 THR D 78  ? LEU D 83  ? THR E 78  LEU E 83  
AA6 4 ALA D 68  ? ASP D 73  ? ALA E 68  ASP E 73  
AA7 1 GLU D 10  ? VAL D 12  ? GLU E 10  VAL E 12  
AA7 2 THR D 110 ? VAL D 114 ? THR E 110 VAL E 114 
AA7 3 ALA D 92  ? ARG D 98  ? ALA E 92  ARG E 98  
AA7 4 MET D 34  ? GLN D 39  ? MET E 34  GLN E 39  
AA7 5 LEU D 45  ? ILE D 51  ? LEU E 45  ILE E 51  
AA7 6 THR D 58  ? TYR D 60  ? THR E 58  TYR E 60  
AA8 1 GLU D 10  ? VAL D 12  ? GLU E 10  VAL E 12  
AA8 2 THR D 110 ? VAL D 114 ? THR E 110 VAL E 114 
AA8 3 ALA D 92  ? ARG D 98  ? ALA E 92  ARG E 98  
AA8 4 TYR D 105 ? TRP D 106 ? TYR E 105 TRP E 106 
AA9 1 SER D 123 ? LEU D 127 ? SER E 123 LEU E 127 
AA9 2 MET D 138 ? TYR D 148 ? MET E 138 TYR E 148 
AA9 3 LEU D 177 ? PRO D 187 ? LEU E 177 PRO E 187 
AA9 4 VAL D 166 ? THR D 168 ? VAL E 166 THR E 168 
AB1 1 SER D 123 ? LEU D 127 ? SER E 123 LEU E 127 
AB1 2 MET D 138 ? TYR D 148 ? MET E 138 TYR E 148 
AB1 3 LEU D 177 ? PRO D 187 ? LEU E 177 PRO E 187 
AB1 4 VAL D 172 ? GLN D 174 ? VAL E 172 GLN E 174 
AB2 1 THR D 154 ? TRP D 157 ? THR E 154 TRP E 157 
AB2 2 THR D 197 ? HIS D 202 ? THR E 197 HIS E 202 
AB2 3 THR D 207 ? LYS D 212 ? THR E 207 LYS E 212 
AB3 1 LEU E 4   ? THR E 5   ? LEU F 4   THR F 5   
AB3 2 VAL E 19  ? ALA E 25  ? VAL F 19  ALA F 25  
AB3 3 SER E 69  ? ILE E 74  ? SER F 69  ILE F 74  
AB3 4 PHE E 61  ? SER E 66  ? PHE F 61  SER F 66  
AB4 1 ILE E 10  ? ALA E 13  ? ILE F 10  ALA F 13  
AB4 2 ALA E 101 ? LEU E 105 ? ALA F 101 LEU F 105 
AB4 3 ALA E 83  ? GLN E 89  ? ALA F 83  GLN F 89  
AB4 4 HIS E 33  ? GLN E 37  ? HIS F 33  GLN F 37  
AB4 5 LYS E 44  ? TYR E 48  ? LYS F 44  TYR F 48  
AB4 6 LYS E 52  ? LEU E 53  ? LYS F 52  LEU F 53  
AB5 1 ILE E 10  ? ALA E 13  ? ILE F 10  ALA F 13  
AB5 2 ALA E 101 ? LEU E 105 ? ALA F 101 LEU F 105 
AB5 3 ALA E 83  ? GLN E 89  ? ALA F 83  GLN F 89  
AB5 4 THR E 96  ? PHE E 97  ? THR F 96  PHE F 97  
AB6 1 THR E 113 ? PHE E 117 ? THR F 113 PHE F 117 
AB6 2 GLY E 128 ? PHE E 138 ? GLY F 128 PHE F 138 
AB6 3 TYR E 172 ? THR E 181 ? TYR F 172 THR F 181 
AB6 4 VAL E 158 ? TRP E 162 ? VAL F 158 TRP F 162 
AB7 1 SER E 152 ? ARG E 154 ? SER F 152 ARG F 154 
AB7 2 ASN E 144 ? ILE E 149 ? ASN F 144 ILE F 149 
AB7 3 SER E 190 ? THR E 196 ? SER F 190 THR F 196 
AB7 4 ILE E 204 ? ASN E 209 ? ILE F 204 ASN F 209 
AB8 1 GLN F 3   ? GLN F 6   ? GLN G 3   GLN G 6   
AB8 2 MET F 18  ? SER F 25  ? MET G 18  SER G 25  
AB8 3 THR F 78  ? LEU F 83  ? THR G 78  LEU G 83  
AB8 4 ALA F 68  ? ASP F 73  ? ALA G 68  ASP G 73  
AB9 1 GLU F 10  ? VAL F 12  ? GLU G 10  VAL G 12  
AB9 2 THR F 110 ? VAL F 114 ? THR G 110 VAL G 114 
AB9 3 ALA F 92  ? ARG F 98  ? ALA G 92  ARG G 98  
AB9 4 MET F 34  ? GLN F 39  ? MET G 34  GLN G 39  
AB9 5 LEU F 45  ? ILE F 51  ? LEU G 45  ILE G 51  
AB9 6 THR F 58  ? TYR F 60  ? THR G 58  TYR G 60  
AC1 1 GLU F 10  ? VAL F 12  ? GLU G 10  VAL G 12  
AC1 2 THR F 110 ? VAL F 114 ? THR G 110 VAL G 114 
AC1 3 ALA F 92  ? ARG F 98  ? ALA G 92  ARG G 98  
AC1 4 TYR F 105 ? TRP F 106 ? TYR G 105 TRP G 106 
AC2 1 SER F 123 ? LEU F 127 ? SER G 123 LEU G 127 
AC2 2 MET F 138 ? TYR F 148 ? MET G 138 TYR G 148 
AC2 3 LEU F 177 ? PRO F 187 ? LEU G 177 PRO G 187 
AC2 4 VAL F 166 ? THR F 168 ? VAL G 166 THR G 168 
AC3 1 SER F 123 ? LEU F 127 ? SER G 123 LEU G 127 
AC3 2 MET F 138 ? TYR F 148 ? MET G 138 TYR G 148 
AC3 3 LEU F 177 ? PRO F 187 ? LEU G 177 PRO G 187 
AC3 4 VAL F 172 ? GLN F 174 ? VAL G 172 GLN G 174 
AC4 1 THR F 154 ? TRP F 157 ? THR G 154 TRP G 157 
AC4 2 THR F 197 ? HIS F 202 ? THR G 197 HIS G 202 
AC4 3 THR F 207 ? LYS F 212 ? THR G 207 LYS G 212 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR C 5   ? N THR D 5   O SER C 24  ? O SER D 24  
AA1 2 3 N VAL C 19  ? N VAL D 19  O ILE C 74  ? O ILE D 74  
AA1 3 4 O SER C 71  ? O SER D 71  N SER C 64  ? N SER D 64  
AA2 1 2 N MET C 11  ? N MET D 11  O GLU C 104 ? O GLU D 104 
AA2 2 3 O LEU C 103 ? O LEU D 103 N ALA C 83  ? N ALA D 83  
AA2 3 4 O GLN C 88  ? O GLN D 88  N HIS C 33  ? N HIS D 33  
AA2 4 5 N TRP C 34  ? N TRP D 34  O ILE C 47  ? O ILE D 47  
AA2 5 6 N TYR C 48  ? N TYR D 48  O LYS C 52  ? O LYS D 52  
AA3 1 2 N MET C 11  ? N MET D 11  O GLU C 104 ? O GLU D 104 
AA3 2 3 O LEU C 103 ? O LEU D 103 N ALA C 83  ? N ALA D 83  
AA3 3 4 N GLN C 89  ? N GLN D 89  O THR C 96  ? O THR D 96  
AA4 1 2 N THR C 113 ? N THR D 113 O ASN C 136 ? O ASN D 136 
AA4 2 3 N VAL C 131 ? N VAL D 131 O LEU C 178 ? O LEU D 178 
AA4 3 4 O THR C 177 ? O THR D 177 N LEU C 159 ? N LEU D 159 
AA5 1 2 O SER C 152 ? O SER D 152 N ILE C 149 ? N ILE D 149 
AA5 2 3 N ASN C 144 ? N ASN D 144 O THR C 196 ? O THR D 196 
AA5 3 4 N ALA C 195 ? N ALA D 195 O ILE C 204 ? O ILE D 204 
AA6 1 2 N GLN D 3   ? N GLN E 3   O SER D 25  ? O SER E 25  
AA6 2 3 N MET D 18  ? N MET E 18  O LEU D 83  ? O LEU E 83  
AA6 3 4 O TYR D 80  ? O TYR E 80  N THR D 71  ? N THR E 71  
AA7 1 2 N GLU D 10  ? N GLU E 10  O THR D 113 ? O THR E 113 
AA7 2 3 O LEU D 112 ? O LEU E 112 N ALA D 92  ? N ALA E 92  
AA7 3 4 O THR D 97  ? O THR E 97  N ASN D 35  ? N ASN E 35  
AA7 4 5 N TRP D 36  ? N TRP E 36  O ILE D 48  ? O ILE E 48  
AA7 5 6 N LEU D 50  ? N LEU E 50  O THR D 59  ? O THR E 59  
AA8 1 2 N GLU D 10  ? N GLU E 10  O THR D 113 ? O THR E 113 
AA8 2 3 O LEU D 112 ? O LEU E 112 N ALA D 92  ? N ALA E 92  
AA8 3 4 N ARG D 98  ? N ARG E 98  O TYR D 105 ? O TYR E 105 
AA9 1 2 N TYR D 125 ? N TYR E 125 O LEU D 144 ? O LEU E 144 
AA9 2 3 N VAL D 139 ? N VAL E 139 O VAL D 186 ? O VAL E 186 
AA9 3 4 O SER D 183 ? O SER E 183 N HIS D 167 ? N HIS E 167 
AB1 1 2 N TYR D 125 ? N TYR E 125 O LEU D 144 ? O LEU E 144 
AB1 2 3 N VAL D 139 ? N VAL E 139 O VAL D 186 ? O VAL E 186 
AB1 3 4 O LEU D 177 ? O LEU E 177 N GLN D 174 ? N GLN E 174 
AB2 1 2 N THR D 156 ? N THR E 156 O ASN D 199 ? O ASN E 199 
AB2 2 3 N VAL D 200 ? N VAL E 200 O VAL D 209 ? O VAL E 209 
AB3 1 2 N THR E 5   ? N THR F 5   O SER E 24  ? O SER F 24  
AB3 2 3 N MET E 21  ? N MET F 21  O LEU E 72  ? O LEU F 72  
AB3 3 4 O SER E 71  ? O SER F 71  N SER E 64  ? N SER F 64  
AB4 1 2 N MET E 11  ? N MET F 11  O GLU E 104 ? O GLU F 104 
AB4 2 3 O LEU E 103 ? O LEU F 103 N ALA E 83  ? N ALA F 83  
AB4 3 4 O THR E 84  ? O THR F 84  N GLN E 37  ? N GLN F 37  
AB4 4 5 N TRP E 34  ? N TRP F 34  O ILE E 47  ? O ILE F 47  
AB4 5 6 N TYR E 48  ? N TYR F 48  O LYS E 52  ? O LYS F 52  
AB5 1 2 N MET E 11  ? N MET F 11  O GLU E 104 ? O GLU F 104 
AB5 2 3 O LEU E 103 ? O LEU F 103 N ALA E 83  ? N ALA F 83  
AB5 3 4 N GLN E 89  ? N GLN F 89  O THR E 96  ? O THR F 96  
AB6 1 2 N PHE E 117 ? N PHE F 117 O VAL E 132 ? O VAL F 132 
AB6 2 3 N VAL E 131 ? N VAL F 131 O LEU E 178 ? O LEU F 178 
AB6 3 4 O THR E 177 ? O THR F 177 N LEU E 159 ? N LEU F 159 
AB7 1 2 O SER E 152 ? O SER F 152 N ILE E 149 ? N ILE F 149 
AB7 2 3 N ASN E 144 ? N ASN F 144 O THR E 196 ? O THR F 196 
AB7 3 4 N ALA E 195 ? N ALA F 195 O ILE E 204 ? O ILE F 204 
AB8 1 2 N GLN F 5   ? N GLN G 5   O LYS F 23  ? O LYS G 23  
AB8 2 3 N CYS F 22  ? N CYS G 22  O ALA F 79  ? O ALA G 79  
AB8 3 4 O TYR F 80  ? O TYR G 80  N THR F 71  ? N THR G 71  
AB9 1 2 N GLU F 10  ? N GLU G 10  O THR F 113 ? O THR G 113 
AB9 2 3 O LEU F 112 ? O LEU G 112 N ALA F 92  ? N ALA G 92  
AB9 3 4 O THR F 97  ? O THR G 97  N ASN F 35  ? N ASN G 35  
AB9 4 5 N TRP F 36  ? N TRP G 36  O ILE F 48  ? O ILE G 48  
AB9 5 6 N LEU F 50  ? N LEU G 50  O THR F 59  ? O THR G 59  
AC1 1 2 N GLU F 10  ? N GLU G 10  O THR F 113 ? O THR G 113 
AC1 2 3 O LEU F 112 ? O LEU G 112 N ALA F 92  ? N ALA G 92  
AC1 3 4 N ARG F 98  ? N ARG G 98  O TYR F 105 ? O TYR G 105 
AC2 1 2 N TYR F 125 ? N TYR G 125 O LEU F 144 ? O LEU G 144 
AC2 2 3 N VAL F 139 ? N VAL G 139 O VAL F 186 ? O VAL G 186 
AC2 3 4 O SER F 183 ? O SER G 183 N HIS F 167 ? N HIS G 167 
AC3 1 2 N TYR F 125 ? N TYR G 125 O LEU F 144 ? O LEU G 144 
AC3 2 3 N VAL F 139 ? N VAL G 139 O VAL F 186 ? O VAL G 186 
AC3 3 4 O LEU F 177 ? O LEU G 177 N GLN F 174 ? N GLN G 174 
AC4 1 2 N THR F 156 ? N THR G 156 O ASN F 199 ? O ASN G 199 
AC4 2 3 N VAL F 200 ? N VAL G 200 O VAL F 209 ? O VAL G 209 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A TL  301 ? 2  'binding site for residue TL A 301'  
AC2 Software A TL  302 ? 10 'binding site for residue TL A 302'  
AC3 Software A TL  303 ? 10 'binding site for residue TL A 303'  
AC4 Software A TL  304 ? 5  'binding site for residue TL A 304'  
AC5 Software A CA  305 ? 4  'binding site for residue CA A 305'  
AC6 Software A CA  306 ? 6  'binding site for residue CA A 306'  
AC7 Software A TL  307 ? 9  'binding site for residue TL A 307'  
AC8 Software B TL  302 ? 2  'binding site for residue TL B 302'  
AC9 Software B D10 303 ? 1  'binding site for residue D10 B 303' 
AD1 Software G CA  301 ? 3  'binding site for residue CA G 301'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  CYS A 218 ? CYS A 218 . ? 1_555 ? 
2  AC1 2  TRP A 223 ? TRP A 223 . ? 1_555 ? 
3  AC2 10 ILE A 130 ? ILE A 130 . ? 1_555 ? 
4  AC2 10 GLY A 131 ? GLY A 131 . ? 1_555 ? 
5  AC2 10 VAL A 239 ? VAL A 239 . ? 1_555 ? 
6  AC2 10 GLY A 240 ? GLY A 240 . ? 1_555 ? 
7  AC2 10 TL  I .   ? TL  A 303 . ? 1_555 ? 
8  AC2 10 TL  M .   ? TL  A 307 . ? 1_555 ? 
9  AC2 10 ILE B 130 ? ILE B 130 . ? 1_555 ? 
10 AC2 10 GLY B 131 ? GLY B 131 . ? 1_555 ? 
11 AC2 10 VAL B 239 ? VAL B 239 . ? 1_555 ? 
12 AC2 10 GLY B 240 ? GLY B 240 . ? 1_555 ? 
13 AC3 10 THR A 129 ? THR A 129 . ? 1_555 ? 
14 AC3 10 ILE A 130 ? ILE A 130 . ? 1_555 ? 
15 AC3 10 THR A 238 ? THR A 238 . ? 1_555 ? 
16 AC3 10 VAL A 239 ? VAL A 239 . ? 1_555 ? 
17 AC3 10 TL  H .   ? TL  A 302 . ? 1_555 ? 
18 AC3 10 TL  J .   ? TL  A 304 . ? 1_555 ? 
19 AC3 10 THR B 129 ? THR B 129 . ? 1_555 ? 
20 AC3 10 ILE B 130 ? ILE B 130 . ? 1_555 ? 
21 AC3 10 THR B 238 ? THR B 238 . ? 1_555 ? 
22 AC3 10 VAL B 239 ? VAL B 239 . ? 1_555 ? 
23 AC4 5  THR A 129 ? THR A 129 . ? 1_555 ? 
24 AC4 5  THR A 238 ? THR A 238 . ? 1_555 ? 
25 AC4 5  TL  I .   ? TL  A 303 . ? 1_555 ? 
26 AC4 5  THR B 129 ? THR B 129 . ? 1_555 ? 
27 AC4 5  THR B 238 ? THR B 238 . ? 1_555 ? 
28 AC5 4  SER A 112 ? SER A 112 . ? 1_555 ? 
29 AC5 4  ASP A 115 ? ASP A 115 . ? 1_555 ? 
30 AC5 4  SER A 118 ? SER A 118 . ? 1_555 ? 
31 AC5 4  ASP A 249 ? ASP A 249 . ? 1_555 ? 
32 AC6 6  GLY A 98  ? GLY A 98  . ? 1_555 ? 
33 AC6 6  ASP A 100 ? ASP A 100 . ? 1_555 ? 
34 AC6 6  HIS A 111 ? HIS A 111 . ? 1_555 ? 
35 AC6 6  HOH R .   ? HOH A 417 . ? 1_555 ? 
36 AC6 6  GLU B 58  ? GLU B 58  . ? 1_555 ? 
37 AC6 6  HOH S .   ? HOH B 414 . ? 1_555 ? 
38 AC7 9  GLY A 131 ? GLY A 131 . ? 1_555 ? 
39 AC7 9  TYR A 132 ? TYR A 132 . ? 1_555 ? 
40 AC7 9  GLY A 240 ? GLY A 240 . ? 1_555 ? 
41 AC7 9  PHE A 241 ? PHE A 241 . ? 1_555 ? 
42 AC7 9  TL  H .   ? TL  A 302 . ? 1_555 ? 
43 AC7 9  GLY B 131 ? GLY B 131 . ? 1_555 ? 
44 AC7 9  TYR B 132 ? TYR B 132 . ? 1_555 ? 
45 AC7 9  GLY B 240 ? GLY B 240 . ? 1_555 ? 
46 AC7 9  PHE B 241 ? PHE B 241 . ? 1_555 ? 
47 AC8 2  CYS B 218 ? CYS B 218 . ? 1_555 ? 
48 AC8 2  TRP B 223 ? TRP B 223 . ? 1_555 ? 
49 AC9 1  PHE B 272 ? PHE B 272 . ? 1_555 ? 
50 AD1 3  GLU F 10  ? GLU G 10  . ? 1_555 ? 
51 AD1 3  LYS F 19  ? LYS G 19  . ? 1_555 ? 
52 AD1 3  HOH W .   ? HOH G 407 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4WFH 
_atom_sites.fract_transf_matrix[1][1]   0.012350 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001002 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007207 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010369 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
TL 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ARG A 1 28  ? 69.495  5.331   -19.811 1.00 169.96 ? 28  ARG A N   1 
ATOM   2     C  CA  . ARG A 1 28  ? 69.839  6.777   -19.664 1.00 181.45 ? 28  ARG A CA  1 
ATOM   3     C  C   . ARG A 1 28  ? 69.405  7.353   -18.324 1.00 190.68 ? 28  ARG A C   1 
ATOM   4     O  O   . ARG A 1 28  ? 68.234  7.267   -17.955 1.00 208.86 ? 28  ARG A O   1 
ATOM   5     C  CB  . ARG A 1 28  ? 69.175  7.596   -20.768 1.00 187.43 ? 28  ARG A CB  1 
ATOM   6     C  CG  . ARG A 1 28  ? 69.654  7.273   -22.171 1.00 192.89 ? 28  ARG A CG  1 
ATOM   7     C  CD  . ARG A 1 28  ? 69.134  8.298   -23.164 1.00 202.45 ? 28  ARG A CD  1 
ATOM   8     N  NE  . ARG A 1 28  ? 70.066  8.532   -24.260 1.00 210.27 ? 28  ARG A NE  1 
ATOM   9     C  CZ  . ARG A 1 28  ? 69.978  9.552   -25.109 1.00 227.83 ? 28  ARG A CZ  1 
ATOM   10    N  NH1 . ARG A 1 28  ? 68.992  10.436  -24.997 1.00 232.28 ? 28  ARG A NH1 1 
ATOM   11    N  NH2 . ARG A 1 28  ? 70.876  9.692   -26.075 1.00 237.53 ? 28  ARG A NH2 1 
ATOM   12    N  N   . SER A 1 29  ? 70.341  7.996   -17.629 1.00 197.26 ? 29  SER A N   1 
ATOM   13    C  CA  . SER A 1 29  ? 70.046  8.660   -16.357 1.00 196.73 ? 29  SER A CA  1 
ATOM   14    C  C   . SER A 1 29  ? 68.961  9.735   -16.495 1.00 198.39 ? 29  SER A C   1 
ATOM   15    O  O   . SER A 1 29  ? 68.109  9.876   -15.619 1.00 193.32 ? 29  SER A O   1 
ATOM   16    C  CB  . SER A 1 29  ? 71.317  9.271   -15.764 1.00 196.63 ? 29  SER A CB  1 
ATOM   17    O  OG  . SER A 1 29  ? 72.113  8.274   -15.145 1.00 190.24 ? 29  SER A OG  1 
ATOM   18    N  N   . THR A 1 30  ? 69.001  10.495  -17.587 1.00 200.20 ? 30  THR A N   1 
ATOM   19    C  CA  . THR A 1 30  ? 67.964  11.491  -17.868 1.00 198.22 ? 30  THR A CA  1 
ATOM   20    C  C   . THR A 1 30  ? 66.579  10.845  -17.920 1.00 190.38 ? 30  THR A C   1 
ATOM   21    O  O   . THR A 1 30  ? 65.630  11.326  -17.294 1.00 185.40 ? 30  THR A O   1 
ATOM   22    C  CB  . THR A 1 30  ? 68.234  12.251  -19.190 1.00 201.56 ? 30  THR A CB  1 
ATOM   23    O  OG1 . THR A 1 30  ? 67.117  13.094  -19.498 1.00 202.02 ? 30  THR A OG1 1 
ATOM   24    C  CG2 . THR A 1 30  ? 68.469  11.292  -20.355 1.00 197.32 ? 30  THR A CG2 1 
ATOM   25    N  N   . THR A 1 31  ? 66.483  9.730   -18.637 1.00 187.67 ? 31  THR A N   1 
ATOM   26    C  CA  . THR A 1 31  ? 65.207  9.051   -18.842 1.00 184.91 ? 31  THR A CA  1 
ATOM   27    C  C   . THR A 1 31  ? 64.706  8.419   -17.543 1.00 184.93 ? 31  THR A C   1 
ATOM   28    O  O   . THR A 1 31  ? 63.509  8.447   -17.250 1.00 186.50 ? 31  THR A O   1 
ATOM   29    C  CB  . THR A 1 31  ? 65.322  7.950   -19.914 1.00 177.88 ? 31  THR A CB  1 
ATOM   30    O  OG1 . THR A 1 31  ? 66.234  6.940   -19.469 1.00 180.23 ? 31  THR A OG1 1 
ATOM   31    C  CG2 . THR A 1 31  ? 65.820  8.527   -21.225 1.00 180.36 ? 31  THR A CG2 1 
ATOM   32    N  N   . LEU A 1 32  ? 65.620  7.838   -16.772 1.00 182.36 ? 32  LEU A N   1 
ATOM   33    C  CA  . LEU A 1 32  ? 65.251  7.219   -15.505 1.00 172.73 ? 32  LEU A CA  1 
ATOM   34    C  C   . LEU A 1 32  ? 64.689  8.240   -14.523 1.00 169.47 ? 32  LEU A C   1 
ATOM   35    O  O   . LEU A 1 32  ? 63.799  7.922   -13.741 1.00 169.84 ? 32  LEU A O   1 
ATOM   36    C  CB  . LEU A 1 32  ? 66.431  6.473   -14.883 1.00 172.75 ? 32  LEU A CB  1 
ATOM   37    C  CG  . LEU A 1 32  ? 66.787  5.158   -15.577 1.00 174.13 ? 32  LEU A CG  1 
ATOM   38    C  CD1 . LEU A 1 32  ? 67.936  4.481   -14.848 1.00 179.23 ? 32  LEU A CD1 1 
ATOM   39    C  CD2 . LEU A 1 32  ? 65.588  4.225   -15.660 1.00 169.00 ? 32  LEU A CD2 1 
ATOM   40    N  N   . LEU A 1 33  ? 65.208  9.463   -14.568 1.00 172.30 ? 33  LEU A N   1 
ATOM   41    C  CA  . LEU A 1 33  ? 64.650  10.562  -13.788 1.00 181.02 ? 33  LEU A CA  1 
ATOM   42    C  C   . LEU A 1 33  ? 63.217  10.846  -14.234 1.00 185.47 ? 33  LEU A C   1 
ATOM   43    O  O   . LEU A 1 33  ? 62.334  11.100  -13.409 1.00 187.82 ? 33  LEU A O   1 
ATOM   44    C  CB  . LEU A 1 33  ? 65.507  11.816  -13.959 1.00 188.60 ? 33  LEU A CB  1 
ATOM   45    C  CG  . LEU A 1 33  ? 65.424  12.866  -12.848 1.00 193.01 ? 33  LEU A CG  1 
ATOM   46    C  CD1 . LEU A 1 33  ? 66.539  13.888  -13.033 1.00 198.06 ? 33  LEU A CD1 1 
ATOM   47    C  CD2 . LEU A 1 33  ? 64.060  13.549  -12.803 1.00 192.59 ? 33  LEU A CD2 1 
ATOM   48    N  N   . ALA A 1 34  ? 62.998  10.816  -15.546 1.00 182.56 ? 34  ALA A N   1 
ATOM   49    C  CA  . ALA A 1 34  ? 61.652  10.923  -16.111 1.00 177.46 ? 34  ALA A CA  1 
ATOM   50    C  C   . ALA A 1 34  ? 60.758  9.794   -15.598 1.00 174.32 ? 34  ALA A C   1 
ATOM   51    O  O   . ALA A 1 34  ? 59.621  10.022  -15.175 1.00 173.24 ? 34  ALA A O   1 
ATOM   52    C  CB  . ALA A 1 34  ? 61.712  10.898  -17.628 1.00 174.38 ? 34  ALA A CB  1 
ATOM   53    N  N   . LEU A 1 35  ? 61.291  8.577   -15.615 1.00 169.64 ? 35  LEU A N   1 
ATOM   54    C  CA  . LEU A 1 35  ? 60.536  7.404   -15.177 1.00 160.20 ? 35  LEU A CA  1 
ATOM   55    C  C   . LEU A 1 35  ? 60.154  7.506   -13.696 1.00 154.37 ? 35  LEU A C   1 
ATOM   56    O  O   . LEU A 1 35  ? 59.018  7.221   -13.322 1.00 150.90 ? 35  LEU A O   1 
ATOM   57    C  CB  . LEU A 1 35  ? 61.349  6.133   -15.431 1.00 154.75 ? 35  LEU A CB  1 
ATOM   58    C  CG  . LEU A 1 35  ? 60.553  4.870   -15.781 1.00 150.35 ? 35  LEU A CG  1 
ATOM   59    C  CD1 . LEU A 1 35  ? 59.468  5.166   -16.806 1.00 150.09 ? 35  LEU A CD1 1 
ATOM   60    C  CD2 . LEU A 1 35  ? 61.487  3.778   -16.281 1.00 146.21 ? 35  LEU A CD2 1 
ATOM   61    N  N   . LEU A 1 36  ? 61.105  7.925   -12.867 1.00 154.42 ? 36  LEU A N   1 
ATOM   62    C  CA  . LEU A 1 36  ? 60.830  8.227   -11.464 1.00 157.20 ? 36  LEU A CA  1 
ATOM   63    C  C   . LEU A 1 36  ? 59.629  9.160   -11.340 1.00 163.49 ? 36  LEU A C   1 
ATOM   64    O  O   . LEU A 1 36  ? 58.711  8.911   -10.558 1.00 158.86 ? 36  LEU A O   1 
ATOM   65    C  CB  . LEU A 1 36  ? 62.044  8.895   -10.805 1.00 159.83 ? 36  LEU A CB  1 
ATOM   66    C  CG  . LEU A 1 36  ? 61.789  9.469   -9.404  1.00 160.49 ? 36  LEU A CG  1 
ATOM   67    C  CD1 . LEU A 1 36  ? 61.603  8.353   -8.389  1.00 153.47 ? 36  LEU A CD1 1 
ATOM   68    C  CD2 . LEU A 1 36  ? 62.918  10.401  -8.984  1.00 163.16 ? 36  LEU A CD2 1 
ATOM   69    N  N   . ALA A 1 37  ? 59.657  10.251  -12.100 1.00 170.54 ? 37  ALA A N   1 
ATOM   70    C  CA  . ALA A 1 37  ? 58.613  11.266  -12.018 1.00 171.93 ? 37  ALA A CA  1 
ATOM   71    C  C   . ALA A 1 37  ? 57.268  10.699  -12.462 1.00 167.37 ? 37  ALA A C   1 
ATOM   72    O  O   . ALA A 1 37  ? 56.226  11.022  -11.894 1.00 165.34 ? 37  ALA A O   1 
ATOM   73    C  CB  . ALA A 1 37  ? 58.989  12.475  -12.860 1.00 176.02 ? 37  ALA A CB  1 
ATOM   74    N  N   . LEU A 1 38  ? 57.298  9.842   -13.475 1.00 162.65 ? 38  LEU A N   1 
ATOM   75    C  CA  . LEU A 1 38  ? 56.086  9.184   -13.942 1.00 159.73 ? 38  LEU A CA  1 
ATOM   76    C  C   . LEU A 1 38  ? 55.482  8.327   -12.832 1.00 146.76 ? 38  LEU A C   1 
ATOM   77    O  O   . LEU A 1 38  ? 54.353  8.552   -12.398 1.00 147.47 ? 38  LEU A O   1 
ATOM   78    C  CB  . LEU A 1 38  ? 56.398  8.322   -15.166 1.00 161.82 ? 38  LEU A CB  1 
ATOM   79    C  CG  . LEU A 1 38  ? 55.210  7.554   -15.749 1.00 161.90 ? 38  LEU A CG  1 
ATOM   80    C  CD1 . LEU A 1 38  ? 54.084  8.500   -16.145 1.00 166.08 ? 38  LEU A CD1 1 
ATOM   81    C  CD2 . LEU A 1 38  ? 55.646  6.713   -16.937 1.00 159.39 ? 38  LEU A CD2 1 
ATOM   82    N  N   . VAL A 1 39  ? 56.249  7.351   -12.373 1.00 138.02 ? 39  VAL A N   1 
ATOM   83    C  CA  . VAL A 1 39  ? 55.841  6.533   -11.251 1.00 134.22 ? 39  VAL A CA  1 
ATOM   84    C  C   . VAL A 1 39  ? 55.269  7.412   -10.144 1.00 135.20 ? 39  VAL A C   1 
ATOM   85    O  O   . VAL A 1 39  ? 54.136  7.212   -9.702  1.00 132.29 ? 39  VAL A O   1 
ATOM   86    C  CB  . VAL A 1 39  ? 57.033  5.720   -10.717 1.00 133.18 ? 39  VAL A CB  1 
ATOM   87    C  CG1 . VAL A 1 39  ? 56.816  5.315   -9.268  1.00 132.65 ? 39  VAL A CG1 1 
ATOM   88    C  CG2 . VAL A 1 39  ? 57.265  4.500   -11.596 1.00 132.93 ? 39  VAL A CG2 1 
ATOM   89    N  N   . LEU A 1 40  ? 56.055  8.390   -9.705  1.00 138.55 ? 40  LEU A N   1 
ATOM   90    C  CA  . LEU A 1 40  ? 55.608  9.328   -8.673  1.00 140.79 ? 40  LEU A CA  1 
ATOM   91    C  C   . LEU A 1 40  ? 54.182  9.815   -8.936  1.00 143.53 ? 40  LEU A C   1 
ATOM   92    O  O   . LEU A 1 40  ? 53.363  9.875   -8.023  1.00 140.99 ? 40  LEU A O   1 
ATOM   93    C  CB  . LEU A 1 40  ? 56.553  10.526  -8.588  1.00 145.48 ? 40  LEU A CB  1 
ATOM   94    C  CG  . LEU A 1 40  ? 57.861  10.312  -7.826  1.00 146.48 ? 40  LEU A CG  1 
ATOM   95    C  CD1 . LEU A 1 40  ? 58.551  11.647  -7.563  1.00 150.63 ? 40  LEU A CD1 1 
ATOM   96    C  CD2 . LEU A 1 40  ? 57.605  9.561   -6.526  1.00 142.06 ? 40  LEU A CD2 1 
ATOM   97    N  N   . LEU A 1 41  ? 53.890  10.146  -10.192 1.00 149.84 ? 41  LEU A N   1 
ATOM   98    C  CA  . LEU A 1 41  ? 52.557  10.612  -10.585 1.00 150.30 ? 41  LEU A CA  1 
ATOM   99    C  C   . LEU A 1 41  ? 51.528  9.493   -10.541 1.00 146.04 ? 41  LEU A C   1 
ATOM   100   O  O   . LEU A 1 41  ? 50.366  9.725   -10.213 1.00 147.47 ? 41  LEU A O   1 
ATOM   101   C  CB  . LEU A 1 41  ? 52.589  11.211  -11.993 1.00 154.63 ? 41  LEU A CB  1 
ATOM   102   C  CG  . LEU A 1 41  ? 53.285  12.566  -12.111 1.00 161.22 ? 41  LEU A CG  1 
ATOM   103   C  CD1 . LEU A 1 41  ? 53.280  13.031  -13.558 1.00 164.92 ? 41  LEU A CD1 1 
ATOM   104   C  CD2 . LEU A 1 41  ? 52.630  13.603  -11.203 1.00 163.98 ? 41  LEU A CD2 1 
ATOM   105   N  N   . TYR A 1 42  ? 51.960  8.286   -10.893 1.00 144.72 ? 42  TYR A N   1 
ATOM   106   C  CA  . TYR A 1 42  ? 51.119  7.098   -10.789 1.00 141.56 ? 42  TYR A CA  1 
ATOM   107   C  C   . TYR A 1 42  ? 50.723  6.829   -9.340  1.00 137.39 ? 42  TYR A C   1 
ATOM   108   O  O   . TYR A 1 42  ? 49.611  6.379   -9.062  1.00 131.15 ? 42  TYR A O   1 
ATOM   109   C  CB  . TYR A 1 42  ? 51.855  5.882   -11.356 1.00 140.45 ? 42  TYR A CB  1 
ATOM   110   C  CG  . TYR A 1 42  ? 50.953  4.694   -11.585 1.00 139.74 ? 42  TYR A CG  1 
ATOM   111   C  CD1 . TYR A 1 42  ? 50.050  4.680   -12.632 1.00 142.76 ? 42  TYR A CD1 1 
ATOM   112   C  CD2 . TYR A 1 42  ? 50.991  3.596   -10.742 1.00 137.96 ? 42  TYR A CD2 1 
ATOM   113   C  CE1 . TYR A 1 42  ? 49.216  3.600   -12.840 1.00 141.12 ? 42  TYR A CE1 1 
ATOM   114   C  CE2 . TYR A 1 42  ? 50.161  2.513   -10.941 1.00 135.82 ? 42  TYR A CE2 1 
ATOM   115   C  CZ  . TYR A 1 42  ? 49.276  2.521   -11.992 1.00 136.72 ? 42  TYR A CZ  1 
ATOM   116   O  OH  . TYR A 1 42  ? 48.452  1.443   -12.194 1.00 134.99 ? 42  TYR A OH  1 
ATOM   117   N  N   . LEU A 1 43  ? 51.644  7.104   -8.423  1.00 136.90 ? 43  LEU A N   1 
ATOM   118   C  CA  . LEU A 1 43  ? 51.378  6.952   -7.002  1.00 133.92 ? 43  LEU A CA  1 
ATOM   119   C  C   . LEU A 1 43  ? 50.428  8.032   -6.522  1.00 135.79 ? 43  LEU A C   1 
ATOM   120   O  O   . LEU A 1 43  ? 49.418  7.743   -5.884  1.00 140.61 ? 43  LEU A O   1 
ATOM   121   C  CB  . LEU A 1 43  ? 52.679  7.030   -6.207  1.00 134.56 ? 43  LEU A CB  1 
ATOM   122   C  CG  . LEU A 1 43  ? 53.632  5.847   -6.384  1.00 133.59 ? 43  LEU A CG  1 
ATOM   123   C  CD1 . LEU A 1 43  ? 54.989  6.168   -5.780  1.00 136.65 ? 43  LEU A CD1 1 
ATOM   124   C  CD2 . LEU A 1 43  ? 53.047  4.592   -5.755  1.00 129.18 ? 43  LEU A CD2 1 
ATOM   125   N  N   . VAL A 1 44  ? 50.758  9.281   -6.820  1.00 138.44 ? 44  VAL A N   1 
ATOM   126   C  CA  . VAL A 1 44  ? 49.948  10.386  -6.349  1.00 143.62 ? 44  VAL A CA  1 
ATOM   127   C  C   . VAL A 1 44  ? 48.534  10.235  -6.884  1.00 144.68 ? 44  VAL A C   1 
ATOM   128   O  O   . VAL A 1 44  ? 47.566  10.454  -6.156  1.00 152.58 ? 44  VAL A O   1 
ATOM   129   C  CB  . VAL A 1 44  ? 50.517  11.751  -6.775  1.00 150.00 ? 44  VAL A CB  1 
ATOM   130   C  CG1 . VAL A 1 44  ? 49.570  12.868  -6.359  1.00 150.20 ? 44  VAL A CG1 1 
ATOM   131   C  CG2 . VAL A 1 44  ? 51.891  11.967  -6.156  1.00 151.93 ? 44  VAL A CG2 1 
ATOM   132   N  N   . SER A 1 45  ? 48.412  9.836   -8.146  1.00 141.59 ? 45  SER A N   1 
ATOM   133   C  CA  . SER A 1 45  ? 47.095  9.642   -8.743  1.00 141.23 ? 45  SER A CA  1 
ATOM   134   C  C   . SER A 1 45  ? 46.354  8.506   -8.035  1.00 134.84 ? 45  SER A C   1 
ATOM   135   O  O   . SER A 1 45  ? 45.180  8.632   -7.688  1.00 131.56 ? 45  SER A O   1 
ATOM   136   C  CB  . SER A 1 45  ? 47.212  9.365   -10.243 1.00 143.23 ? 45  SER A CB  1 
ATOM   137   O  OG  . SER A 1 45  ? 47.912  8.160   -10.489 1.00 146.09 ? 45  SER A OG  1 
ATOM   138   N  N   . GLY A 1 46  ? 47.053  7.406   -7.786  1.00 132.98 ? 46  GLY A N   1 
ATOM   139   C  CA  . GLY A 1 46  ? 46.485  6.327   -6.989  1.00 131.53 ? 46  GLY A CA  1 
ATOM   140   C  C   . GLY A 1 46  ? 45.999  6.818   -5.636  1.00 132.84 ? 46  GLY A C   1 
ATOM   141   O  O   . GLY A 1 46  ? 44.871  6.538   -5.230  1.00 132.53 ? 46  GLY A O   1 
ATOM   142   N  N   . ALA A 1 47  ? 46.860  7.555   -4.940  1.00 135.85 ? 47  ALA A N   1 
ATOM   143   C  CA  . ALA A 1 47  ? 46.540  8.068   -3.615  1.00 136.06 ? 47  ALA A CA  1 
ATOM   144   C  C   . ALA A 1 47  ? 45.235  8.855   -3.638  1.00 136.90 ? 47  ALA A C   1 
ATOM   145   O  O   . ALA A 1 47  ? 44.362  8.653   -2.793  1.00 136.90 ? 47  ALA A O   1 
ATOM   146   C  CB  . ALA A 1 47  ? 47.677  8.939   -3.099  1.00 138.45 ? 47  ALA A CB  1 
ATOM   147   N  N   . LEU A 1 48  ? 45.099  9.737   -4.621  1.00 138.30 ? 48  LEU A N   1 
ATOM   148   C  CA  . LEU A 1 48  ? 43.913  10.579  -4.729  1.00 143.76 ? 48  LEU A CA  1 
ATOM   149   C  C   . LEU A 1 48  ? 42.653  9.740   -4.841  1.00 138.77 ? 48  LEU A C   1 
ATOM   150   O  O   . LEU A 1 48  ? 41.636  10.044  -4.219  1.00 141.76 ? 48  LEU A O   1 
ATOM   151   C  CB  . LEU A 1 48  ? 44.008  11.481  -5.957  1.00 152.36 ? 48  LEU A CB  1 
ATOM   152   C  CG  . LEU A 1 48  ? 45.072  12.575  -5.930  1.00 155.19 ? 48  LEU A CG  1 
ATOM   153   C  CD1 . LEU A 1 48  ? 45.256  13.163  -7.320  1.00 158.12 ? 48  LEU A CD1 1 
ATOM   154   C  CD2 . LEU A 1 48  ? 44.691  13.650  -4.929  1.00 157.22 ? 48  LEU A CD2 1 
ATOM   155   N  N   . VAL A 1 49  ? 42.730  8.681   -5.638  1.00 131.89 ? 49  VAL A N   1 
ATOM   156   C  CA  . VAL A 1 49  ? 41.565  7.856   -5.933  1.00 129.26 ? 49  VAL A CA  1 
ATOM   157   C  C   . VAL A 1 49  ? 41.161  7.009   -4.714  1.00 126.58 ? 49  VAL A C   1 
ATOM   158   O  O   . VAL A 1 49  ? 39.992  6.971   -4.319  1.00 119.57 ? 49  VAL A O   1 
ATOM   159   C  CB  . VAL A 1 49  ? 41.851  6.937   -7.140  1.00 125.97 ? 49  VAL A CB  1 
ATOM   160   C  CG1 . VAL A 1 49  ? 40.682  6.003   -7.407  1.00 125.66 ? 49  VAL A CG1 1 
ATOM   161   C  CG2 . VAL A 1 49  ? 42.156  7.764   -8.370  1.00 127.92 ? 49  VAL A CG2 1 
ATOM   162   N  N   . PHE A 1 50  ? 42.135  6.329   -4.118  1.00 127.43 ? 50  PHE A N   1 
ATOM   163   C  CA  . PHE A 1 50  ? 41.862  5.486   -2.968  1.00 124.84 ? 50  PHE A CA  1 
ATOM   164   C  C   . PHE A 1 50  ? 41.304  6.322   -1.834  1.00 122.92 ? 50  PHE A C   1 
ATOM   165   O  O   . PHE A 1 50  ? 40.383  5.901   -1.142  1.00 123.60 ? 50  PHE A O   1 
ATOM   166   C  CB  . PHE A 1 50  ? 43.130  4.762   -2.503  1.00 124.85 ? 50  PHE A CB  1 
ATOM   167   C  CG  . PHE A 1 50  ? 43.525  3.612   -3.379  1.00 124.17 ? 50  PHE A CG  1 
ATOM   168   C  CD1 . PHE A 1 50  ? 42.619  2.603   -3.672  1.00 123.03 ? 50  PHE A CD1 1 
ATOM   169   C  CD2 . PHE A 1 50  ? 44.805  3.531   -3.903  1.00 126.08 ? 50  PHE A CD2 1 
ATOM   170   C  CE1 . PHE A 1 50  ? 42.981  1.541   -4.478  1.00 122.86 ? 50  PHE A CE1 1 
ATOM   171   C  CE2 . PHE A 1 50  ? 45.175  2.465   -4.704  1.00 126.09 ? 50  PHE A CE2 1 
ATOM   172   C  CZ  . PHE A 1 50  ? 44.262  1.470   -4.993  1.00 123.60 ? 50  PHE A CZ  1 
ATOM   173   N  N   . ARG A 1 51  ? 41.870  7.503   -1.633  1.00 122.72 ? 51  ARG A N   1 
ATOM   174   C  CA  . ARG A 1 51  ? 41.392  8.369   -0.578  1.00 124.50 ? 51  ARG A CA  1 
ATOM   175   C  C   . ARG A 1 51  ? 39.941  8.758   -0.846  1.00 122.50 ? 51  ARG A C   1 
ATOM   176   O  O   . ARG A 1 51  ? 39.106  8.756   0.060   1.00 118.99 ? 51  ARG A O   1 
ATOM   177   C  CB  . ARG A 1 51  ? 42.271  9.605   -0.469  1.00 131.78 ? 51  ARG A CB  1 
ATOM   178   C  CG  . ARG A 1 51  ? 41.727  10.644  0.494   1.00 139.75 ? 51  ARG A CG  1 
ATOM   179   C  CD  . ARG A 1 51  ? 42.774  11.706  0.801   1.00 143.99 ? 51  ARG A CD  1 
ATOM   180   N  NE  . ARG A 1 51  ? 43.188  12.417  -0.405  1.00 144.71 ? 51  ARG A NE  1 
ATOM   181   C  CZ  . ARG A 1 51  ? 42.520  13.438  -0.928  1.00 145.62 ? 51  ARG A CZ  1 
ATOM   182   N  NH1 . ARG A 1 51  ? 41.402  13.866  -0.357  1.00 146.87 ? 51  ARG A NH1 1 
ATOM   183   N  NH2 . ARG A 1 51  ? 42.962  14.022  -2.032  1.00 146.08 ? 51  ARG A NH2 1 
ATOM   184   N  N   . ALA A 1 52  ? 39.639  9.054   -2.103  1.00 121.62 ? 52  ALA A N   1 
ATOM   185   C  CA  . ALA A 1 52  ? 38.293  9.449   -2.491  1.00 124.11 ? 52  ALA A CA  1 
ATOM   186   C  C   . ALA A 1 52  ? 37.296  8.324   -2.284  1.00 121.03 ? 52  ALA A C   1 
ATOM   187   O  O   . ALA A 1 52  ? 36.138  8.553   -1.945  1.00 123.42 ? 52  ALA A O   1 
ATOM   188   C  CB  . ALA A 1 52  ? 38.282  9.882   -3.941  1.00 129.27 ? 52  ALA A CB  1 
ATOM   189   N  N   . LEU A 1 53  ? 37.758  7.101   -2.484  1.00 121.36 ? 53  LEU A N   1 
ATOM   190   C  CA  . LEU A 1 53  ? 36.890  5.934   -2.428  1.00 119.65 ? 53  LEU A CA  1 
ATOM   191   C  C   . LEU A 1 53  ? 36.759  5.315   -1.028  1.00 115.43 ? 53  LEU A C   1 
ATOM   192   O  O   . LEU A 1 53  ? 35.786  4.625   -0.750  1.00 109.85 ? 53  LEU A O   1 
ATOM   193   C  CB  . LEU A 1 53  ? 37.411  4.878   -3.405  1.00 117.26 ? 53  LEU A CB  1 
ATOM   194   C  CG  . LEU A 1 53  ? 37.302  5.242   -4.883  1.00 118.26 ? 53  LEU A CG  1 
ATOM   195   C  CD1 . LEU A 1 53  ? 38.079  4.245   -5.727  1.00 115.61 ? 53  LEU A CD1 1 
ATOM   196   C  CD2 . LEU A 1 53  ? 35.844  5.299   -5.309  1.00 119.33 ? 53  LEU A CD2 1 
ATOM   197   N  N   . GLU A 1 54  ? 37.741  5.540   -0.160  1.00 118.26 ? 54  GLU A N   1 
ATOM   198   C  CA  . GLU A 1 54  ? 37.851  4.762   1.074   1.00 120.87 ? 54  GLU A CA  1 
ATOM   199   C  C   . GLU A 1 54  ? 37.748  5.592   2.353   1.00 122.42 ? 54  GLU A C   1 
ATOM   200   O  O   . GLU A 1 54  ? 37.299  5.094   3.394   1.00 120.58 ? 54  GLU A O   1 
ATOM   201   C  CB  . GLU A 1 54  ? 39.161  3.970   1.079   1.00 120.07 ? 54  GLU A CB  1 
ATOM   202   C  CG  . GLU A 1 54  ? 39.223  2.881   0.018   1.00 120.05 ? 54  GLU A CG  1 
ATOM   203   C  CD  . GLU A 1 54  ? 38.197  1.775   0.229   1.00 119.96 ? 54  GLU A CD  1 
ATOM   204   O  OE1 . GLU A 1 54  ? 37.853  1.464   1.397   1.00 112.91 ? 54  GLU A OE1 1 
ATOM   205   O  OE2 . GLU A 1 54  ? 37.732  1.212   -0.785  1.00 122.08 ? 54  GLU A OE2 1 
ATOM   206   N  N   . GLN A 1 55  ? 38.165  6.850   2.274   1.00 124.96 ? 55  GLN A N   1 
ATOM   207   C  CA  . GLN A 1 55  ? 38.140  7.736   3.430   1.00 124.12 ? 55  GLN A CA  1 
ATOM   208   C  C   . GLN A 1 55  ? 36.758  7.820   4.069   1.00 118.40 ? 55  GLN A C   1 
ATOM   209   O  O   . GLN A 1 55  ? 36.651  7.812   5.291   1.00 115.68 ? 55  GLN A O   1 
ATOM   210   C  CB  . GLN A 1 55  ? 38.618  9.134   3.045   1.00 133.00 ? 55  GLN A CB  1 
ATOM   211   C  CG  . GLN A 1 55  ? 38.682  10.096  4.214   1.00 138.75 ? 55  GLN A CG  1 
ATOM   212   C  CD  . GLN A 1 55  ? 39.570  11.282  3.920   1.00 147.22 ? 55  GLN A CD  1 
ATOM   213   O  OE1 . GLN A 1 55  ? 39.391  11.968  2.916   1.00 152.87 ? 55  GLN A OE1 1 
ATOM   214   N  NE2 . GLN A 1 55  ? 40.544  11.522  4.786   1.00 154.06 ? 55  GLN A NE2 1 
ATOM   215   N  N   . PRO A 1 56  ? 35.695  7.884   3.248   1.00 117.19 ? 56  PRO A N   1 
ATOM   216   C  CA  . PRO A 1 56  ? 34.330  7.955   3.793   1.00 118.33 ? 56  PRO A CA  1 
ATOM   217   C  C   . PRO A 1 56  ? 33.926  6.746   4.659   1.00 120.07 ? 56  PRO A C   1 
ATOM   218   O  O   . PRO A 1 56  ? 32.942  6.823   5.390   1.00 120.36 ? 56  PRO A O   1 
ATOM   219   C  CB  . PRO A 1 56  ? 33.438  8.034   2.543   1.00 119.45 ? 56  PRO A CB  1 
ATOM   220   C  CG  . PRO A 1 56  ? 34.342  8.290   1.391   1.00 121.95 ? 56  PRO A CG  1 
ATOM   221   C  CD  . PRO A 1 56  ? 35.716  7.849   1.775   1.00 119.04 ? 56  PRO A CD  1 
ATOM   222   N  N   . HIS A 1 57  ? 34.665  5.642   4.560   1.00 122.40 ? 57  HIS A N   1 
ATOM   223   C  CA  . HIS A 1 57  ? 34.361  4.438   5.327   1.00 116.18 ? 57  HIS A CA  1 
ATOM   224   C  C   . HIS A 1 57  ? 35.474  4.033   6.286   1.00 117.46 ? 57  HIS A C   1 
ATOM   225   O  O   . HIS A 1 57  ? 35.434  2.943   6.840   1.00 136.28 ? 57  HIS A O   1 
ATOM   226   C  CB  . HIS A 1 57  ? 34.095  3.277   4.380   1.00 118.17 ? 57  HIS A CB  1 
ATOM   227   C  CG  . HIS A 1 57  ? 33.042  3.557   3.358   1.00 123.84 ? 57  HIS A CG  1 
ATOM   228   N  ND1 . HIS A 1 57  ? 33.220  4.464   2.335   1.00 130.96 ? 57  HIS A ND1 1 
ATOM   229   C  CD2 . HIS A 1 57  ? 31.814  3.021   3.174   1.00 125.75 ? 57  HIS A CD2 1 
ATOM   230   C  CE1 . HIS A 1 57  ? 32.139  4.489   1.577   1.00 131.06 ? 57  HIS A CE1 1 
ATOM   231   N  NE2 . HIS A 1 57  ? 31.273  3.619   2.061   1.00 131.78 ? 57  HIS A NE2 1 
ATOM   232   N  N   . GLU A 1 58  ? 36.462  4.897   6.489   1.00 119.06 ? 58  GLU A N   1 
ATOM   233   C  CA  . GLU A 1 58  ? 37.519  4.647   7.472   1.00 121.38 ? 58  GLU A CA  1 
ATOM   234   C  C   . GLU A 1 58  ? 36.988  4.120   8.792   1.00 124.29 ? 58  GLU A C   1 
ATOM   235   O  O   . GLU A 1 58  ? 37.631  3.301   9.443   1.00 152.92 ? 58  GLU A O   1 
ATOM   236   C  CB  . GLU A 1 58  ? 38.258  5.945   7.778   1.00 132.06 ? 58  GLU A CB  1 
ATOM   237   C  CG  . GLU A 1 58  ? 39.621  6.064   7.132   1.00 140.97 ? 58  GLU A CG  1 
ATOM   238   C  CD  . GLU A 1 58  ? 40.335  7.332   7.541   1.00 145.03 ? 58  GLU A CD  1 
ATOM   239   O  OE1 . GLU A 1 58  ? 39.658  8.373   7.643   1.00 141.69 ? 58  GLU A OE1 1 
ATOM   240   O  OE2 . GLU A 1 58  ? 41.568  7.289   7.752   1.00 151.12 ? 58  GLU A OE2 1 
ATOM   241   N  N   . GLN A 1 59  ? 35.833  4.626   9.204   1.00 125.79 ? 59  GLN A N   1 
ATOM   242   C  CA  . GLN A 1 59  ? 35.390  4.493   10.577  1.00 120.56 ? 59  GLN A CA  1 
ATOM   243   C  C   . GLN A 1 59  ? 34.332  3.435   10.764  1.00 112.25 ? 59  GLN A C   1 
ATOM   244   O  O   . GLN A 1 59  ? 33.815  3.290   11.856  1.00 118.11 ? 59  GLN A O   1 
ATOM   245   C  CB  . GLN A 1 59  ? 34.863  5.845   11.067  1.00 132.17 ? 59  GLN A CB  1 
ATOM   246   C  CG  . GLN A 1 59  ? 35.965  6.761   11.563  1.00 134.17 ? 59  GLN A CG  1 
ATOM   247   C  CD  . GLN A 1 59  ? 36.903  6.033   12.506  1.00 132.30 ? 59  GLN A CD  1 
ATOM   248   O  OE1 . GLN A 1 59  ? 36.528  5.705   13.632  1.00 129.21 ? 59  GLN A OE1 1 
ATOM   249   N  NE2 . GLN A 1 59  ? 38.122  5.755   12.046  1.00 131.36 ? 59  GLN A NE2 1 
ATOM   250   N  N   . GLN A 1 60  ? 34.012  2.684   9.719   1.00 114.63 ? 60  GLN A N   1 
ATOM   251   C  CA  . GLN A 1 60  ? 32.849  1.804   9.775   1.00 126.86 ? 60  GLN A CA  1 
ATOM   252   C  C   . GLN A 1 60  ? 32.982  0.756   10.870  1.00 113.17 ? 60  GLN A C   1 
ATOM   253   O  O   . GLN A 1 60  ? 32.037  0.501   11.620  1.00 126.44 ? 60  GLN A O   1 
ATOM   254   C  CB  . GLN A 1 60  ? 32.606  1.118   8.428   1.00 137.15 ? 60  GLN A CB  1 
ATOM   255   C  CG  . GLN A 1 60  ? 31.277  0.374   8.352   1.00 156.92 ? 60  GLN A CG  1 
ATOM   256   C  CD  . GLN A 1 60  ? 30.107  1.192   8.886   1.00 177.77 ? 60  GLN A CD  1 
ATOM   257   O  OE1 . GLN A 1 60  ? 30.041  2.408   8.688   1.00 181.07 ? 60  GLN A OE1 1 
ATOM   258   N  NE2 . GLN A 1 60  ? 29.181  0.530   9.577   1.00 176.18 ? 60  GLN A NE2 1 
ATOM   259   N  N   . ALA A 1 61  ? 34.162  0.168   10.976  1.00 98.68  ? 61  ALA A N   1 
ATOM   260   C  CA  . ALA A 1 61  ? 34.389  -0.879  11.951  1.00 94.01  ? 61  ALA A CA  1 
ATOM   261   C  C   . ALA A 1 61  ? 34.206  -0.370  13.375  1.00 92.31  ? 61  ALA A C   1 
ATOM   262   O  O   . ALA A 1 61  ? 33.580  -1.035  14.203  1.00 95.76  ? 61  ALA A O   1 
ATOM   263   C  CB  . ALA A 1 61  ? 35.778  -1.455  11.777  1.00 94.59  ? 61  ALA A CB  1 
ATOM   264   N  N   . GLN A 1 62  ? 34.763  0.796   13.669  1.00 90.70  ? 62  GLN A N   1 
ATOM   265   C  CA  . GLN A 1 62  ? 34.532  1.410   14.964  1.00 92.42  ? 62  GLN A CA  1 
ATOM   266   C  C   . GLN A 1 62  ? 33.044  1.527   15.204  1.00 96.18  ? 62  GLN A C   1 
ATOM   267   O  O   . GLN A 1 62  ? 32.534  1.113   16.240  1.00 105.17 ? 62  GLN A O   1 
ATOM   268   C  CB  . GLN A 1 62  ? 35.152  2.792   15.021  1.00 97.09  ? 62  GLN A CB  1 
ATOM   269   C  CG  . GLN A 1 62  ? 36.571  2.794   15.540  1.00 98.01  ? 62  GLN A CG  1 
ATOM   270   C  CD  . GLN A 1 62  ? 36.683  2.406   17.004  1.00 95.58  ? 62  GLN A CD  1 
ATOM   271   O  OE1 . GLN A 1 62  ? 37.777  2.397   17.558  1.00 100.63 ? 62  GLN A OE1 1 
ATOM   272   N  NE2 . GLN A 1 62  ? 35.557  2.139   17.651  1.00 95.00  ? 62  GLN A NE2 1 
ATOM   273   N  N   . ARG A 1 63  ? 32.336  2.074   14.230  1.00 100.73 ? 63  ARG A N   1 
ATOM   274   C  CA  . ARG A 1 63  ? 30.918  2.299   14.406  1.00 110.51 ? 63  ARG A CA  1 
ATOM   275   C  C   . ARG A 1 63  ? 30.229  0.983   14.756  1.00 103.19 ? 63  ARG A C   1 
ATOM   276   O  O   . ARG A 1 63  ? 29.464  0.918   15.713  1.00 99.50  ? 63  ARG A O   1 
ATOM   277   C  CB  . ARG A 1 63  ? 30.308  2.966   13.169  1.00 126.64 ? 63  ARG A CB  1 
ATOM   278   C  CG  . ARG A 1 63  ? 30.503  4.486   13.163  1.00 145.28 ? 63  ARG A CG  1 
ATOM   279   C  CD  . ARG A 1 63  ? 29.376  5.247   12.468  1.00 155.11 ? 63  ARG A CD  1 
ATOM   280   N  NE  . ARG A 1 63  ? 29.222  4.871   11.066  1.00 170.05 ? 63  ARG A NE  1 
ATOM   281   C  CZ  . ARG A 1 63  ? 28.390  3.929   10.629  1.00 176.78 ? 63  ARG A CZ  1 
ATOM   282   N  NH1 . ARG A 1 63  ? 27.627  3.258   11.484  1.00 185.01 ? 63  ARG A NH1 1 
ATOM   283   N  NH2 . ARG A 1 63  ? 28.319  3.653   9.333   1.00 177.87 ? 63  ARG A NH2 1 
ATOM   284   N  N   . GLU A 1 64  ? 30.577  -0.082  14.044  1.00 99.24  ? 64  GLU A N   1 
ATOM   285   C  CA  . GLU A 1 64  ? 29.984  -1.386  14.302  1.00 95.62  ? 64  GLU A CA  1 
ATOM   286   C  C   . GLU A 1 64  ? 30.329  -1.904  15.690  1.00 87.90  ? 64  GLU A C   1 
ATOM   287   O  O   . GLU A 1 64  ? 29.468  -2.432  16.383  1.00 98.95  ? 64  GLU A O   1 
ATOM   288   C  CB  . GLU A 1 64  ? 30.411  -2.395  13.240  1.00 105.13 ? 64  GLU A CB  1 
ATOM   289   C  CG  . GLU A 1 64  ? 29.631  -2.250  11.941  1.00 119.70 ? 64  GLU A CG  1 
ATOM   290   C  CD  . GLU A 1 64  ? 30.289  -2.933  10.748  1.00 127.68 ? 64  GLU A CD  1 
ATOM   291   O  OE1 . GLU A 1 64  ? 31.372  -3.540  10.912  1.00 136.05 ? 64  GLU A OE1 1 
ATOM   292   O  OE2 . GLU A 1 64  ? 29.721  -2.855  9.634   1.00 127.37 ? 64  GLU A OE2 1 
ATOM   293   N  N   . LEU A 1 65  ? 31.577  -1.749  16.109  1.00 81.65  ? 65  LEU A N   1 
ATOM   294   C  CA  . LEU A 1 65  ? 31.959  -2.167  17.452  1.00 78.27  ? 65  LEU A CA  1 
ATOM   295   C  C   . LEU A 1 65  ? 31.118  -1.450  18.501  1.00 77.67  ? 65  LEU A C   1 
ATOM   296   O  O   . LEU A 1 65  ? 30.620  -2.059  19.446  1.00 81.59  ? 65  LEU A O   1 
ATOM   297   C  CB  . LEU A 1 65  ? 33.432  -1.894  17.708  1.00 77.50  ? 65  LEU A CB  1 
ATOM   298   C  CG  . LEU A 1 65  ? 33.896  -2.352  19.094  1.00 78.25  ? 65  LEU A CG  1 
ATOM   299   C  CD1 . LEU A 1 65  ? 33.802  -3.862  19.206  1.00 77.55  ? 65  LEU A CD1 1 
ATOM   300   C  CD2 . LEU A 1 65  ? 35.314  -1.888  19.385  1.00 83.88  ? 65  LEU A CD2 1 
ATOM   301   N  N   . GLY A 1 66  ? 30.953  -0.152  18.327  1.00 77.98  ? 66  GLY A N   1 
ATOM   302   C  CA  . GLY A 1 66  ? 30.155  0.622   19.252  1.00 80.61  ? 66  GLY A CA  1 
ATOM   303   C  C   . GLY A 1 66  ? 28.707  0.200   19.261  1.00 78.66  ? 66  GLY A C   1 
ATOM   304   O  O   . GLY A 1 66  ? 28.064  0.217   20.307  1.00 85.73  ? 66  GLY A O   1 
ATOM   305   N  N   . GLU A 1 67  ? 28.187  -0.154  18.095  1.00 79.15  ? 67  GLU A N   1 
ATOM   306   C  CA  . GLU A 1 67  ? 26.824  -0.633  18.000  1.00 87.18  ? 67  GLU A CA  1 
ATOM   307   C  C   . GLU A 1 67  ? 26.674  -1.936  18.778  1.00 82.75  ? 67  GLU A C   1 
ATOM   308   O  O   . GLU A 1 67  ? 25.712  -2.135  19.513  1.00 81.89  ? 67  GLU A O   1 
ATOM   309   C  CB  . GLU A 1 67  ? 26.420  -0.826  16.534  1.00 103.12 ? 67  GLU A CB  1 
ATOM   310   C  CG  . GLU A 1 67  ? 26.107  0.482   15.805  1.00 125.75 ? 67  GLU A CG  1 
ATOM   311   C  CD  . GLU A 1 67  ? 26.177  0.372   14.283  1.00 137.70 ? 67  GLU A CD  1 
ATOM   312   O  OE1 . GLU A 1 67  ? 26.287  -0.758  13.758  1.00 152.94 ? 67  GLU A OE1 1 
ATOM   313   O  OE2 . GLU A 1 67  ? 26.130  1.422   13.608  1.00 138.20 ? 67  GLU A OE2 1 
ATOM   314   N  N   . VAL A 1 68  ? 27.648  -2.813  18.631  1.00 81.05  ? 68  VAL A N   1 
ATOM   315   C  CA  . VAL A 1 68  ? 27.646  -4.049  19.362  1.00 81.22  ? 68  VAL A CA  1 
ATOM   316   C  C   . VAL A 1 68  ? 27.671  -3.800  20.858  1.00 79.49  ? 68  VAL A C   1 
ATOM   317   O  O   . VAL A 1 68  ? 26.933  -4.439  21.588  1.00 86.04  ? 68  VAL A O   1 
ATOM   318   C  CB  . VAL A 1 68  ? 28.847  -4.906  18.971  1.00 89.97  ? 68  VAL A CB  1 
ATOM   319   C  CG1 . VAL A 1 68  ? 29.073  -6.009  19.990  1.00 94.72  ? 68  VAL A CG1 1 
ATOM   320   C  CG2 . VAL A 1 68  ? 28.631  -5.484  17.583  1.00 93.07  ? 68  VAL A CG2 1 
ATOM   321   N  N   . ARG A 1 69  ? 28.493  -2.868  21.327  1.00 79.70  ? 69  ARG A N   1 
ATOM   322   C  CA  . ARG A 1 69  ? 28.514  -2.567  22.758  1.00 82.86  ? 69  ARG A CA  1 
ATOM   323   C  C   . ARG A 1 69  ? 27.143  -2.089  23.250  1.00 81.44  ? 69  ARG A C   1 
ATOM   324   O  O   . ARG A 1 69  ? 26.581  -2.601  24.224  1.00 77.68  ? 69  ARG A O   1 
ATOM   325   C  CB  . ARG A 1 69  ? 29.545  -1.493  23.082  1.00 86.04  ? 69  ARG A CB  1 
ATOM   326   C  CG  . ARG A 1 69  ? 30.977  -1.961  22.973  1.00 97.36  ? 69  ARG A CG  1 
ATOM   327   C  CD  . ARG A 1 69  ? 31.941  -1.052  23.717  1.00 103.70 ? 69  ARG A CD  1 
ATOM   328   N  NE  . ARG A 1 69  ? 31.706  0.341   23.362  1.00 124.41 ? 69  ARG A NE  1 
ATOM   329   C  CZ  . ARG A 1 69  ? 30.900  1.152   24.040  1.00 143.76 ? 69  ARG A CZ  1 
ATOM   330   N  NH1 . ARG A 1 69  ? 30.293  0.703   25.135  1.00 152.07 ? 69  ARG A NH1 1 
ATOM   331   N  NH2 . ARG A 1 69  ? 30.710  2.410   23.640  1.00 134.56 ? 69  ARG A NH2 1 
ATOM   332   N  N   . GLU A 1 70  ? 26.614  -1.089  22.573  1.00 78.57  ? 70  GLU A N   1 
ATOM   333   C  CA  . GLU A 1 70  ? 25.424  -0.440  23.043  1.00 81.30  ? 70  GLU A CA  1 
ATOM   334   C  C   . GLU A 1 70  ? 24.260  -1.397  23.026  1.00 75.79  ? 70  GLU A C   1 
ATOM   335   O  O   . GLU A 1 70  ? 23.379  -1.330  23.884  1.00 72.42  ? 70  GLU A O   1 
ATOM   336   C  CB  . GLU A 1 70  ? 25.114  0.763   22.172  1.00 92.74  ? 70  GLU A CB  1 
ATOM   337   C  CG  . GLU A 1 70  ? 26.050  1.921   22.415  1.00 98.25  ? 70  GLU A CG  1 
ATOM   338   C  CD  . GLU A 1 70  ? 25.662  3.107   21.574  1.00 114.92 ? 70  GLU A CD  1 
ATOM   339   O  OE1 . GLU A 1 70  ? 25.855  3.027   20.337  1.00 122.55 ? 70  GLU A OE1 1 
ATOM   340   O  OE2 . GLU A 1 70  ? 25.136  4.095   22.148  1.00 125.14 ? 70  GLU A OE2 1 
ATOM   341   N  N   . LYS A 1 71  ? 24.261  -2.277  22.035  1.00 74.77  ? 71  LYS A N   1 
ATOM   342   C  CA  . LYS A 1 71  ? 23.211  -3.266  21.896  1.00 75.95  ? 71  LYS A CA  1 
ATOM   343   C  C   . LYS A 1 71  ? 23.263  -4.243  23.064  1.00 69.49  ? 71  LYS A C   1 
ATOM   344   O  O   . LYS A 1 71  ? 22.229  -4.628  23.617  1.00 66.45  ? 71  LYS A O   1 
ATOM   345   C  CB  . LYS A 1 71  ? 23.372  -4.007  20.577  1.00 83.18  ? 71  LYS A CB  1 
ATOM   346   C  CG  . LYS A 1 71  ? 22.075  -4.580  20.056  1.00 102.23 ? 71  LYS A CG  1 
ATOM   347   C  CD  . LYS A 1 71  ? 22.277  -5.828  19.196  1.00 130.34 ? 71  LYS A CD  1 
ATOM   348   C  CE  . LYS A 1 71  ? 21.122  -6.827  19.368  1.00 148.99 ? 71  LYS A CE  1 
ATOM   349   N  NZ  . LYS A 1 71  ? 20.705  -7.477  18.091  1.00 165.70 ? 71  LYS A NZ  1 
ATOM   350   N  N   . PHE A 1 72  ? 24.479  -4.602  23.456  1.00 68.18  ? 72  PHE A N   1 
ATOM   351   C  CA  . PHE A 1 72  ? 24.706  -5.550  24.535  1.00 70.83  ? 72  PHE A CA  1 
ATOM   352   C  C   . PHE A 1 72  ? 24.269  -4.961  25.872  1.00 71.78  ? 72  PHE A C   1 
ATOM   353   O  O   . PHE A 1 72  ? 23.688  -5.652  26.716  1.00 74.22  ? 72  PHE A O   1 
ATOM   354   C  CB  . PHE A 1 72  ? 26.193  -5.936  24.600  1.00 69.16  ? 72  PHE A CB  1 
ATOM   355   C  CG  . PHE A 1 72  ? 26.453  -7.226  25.304  1.00 65.45  ? 72  PHE A CG  1 
ATOM   356   C  CD1 . PHE A 1 72  ? 26.194  -8.424  24.680  1.00 66.84  ? 72  PHE A CD1 1 
ATOM   357   C  CD2 . PHE A 1 72  ? 26.965  -7.234  26.583  1.00 63.67  ? 72  PHE A CD2 1 
ATOM   358   C  CE1 . PHE A 1 72  ? 26.426  -9.620  25.325  1.00 69.41  ? 72  PHE A CE1 1 
ATOM   359   C  CE2 . PHE A 1 72  ? 27.195  -8.422  27.239  1.00 66.79  ? 72  PHE A CE2 1 
ATOM   360   C  CZ  . PHE A 1 72  ? 26.933  -9.620  26.609  1.00 68.04  ? 72  PHE A CZ  1 
ATOM   361   N  N   . LEU A 1 73  ? 24.591  -3.697  26.086  1.00 70.15  ? 73  LEU A N   1 
ATOM   362   C  CA  . LEU A 1 73  ? 24.243  -3.056  27.335  1.00 69.87  ? 73  LEU A CA  1 
ATOM   363   C  C   . LEU A 1 73  ? 22.738  -3.026  27.504  1.00 73.05  ? 73  LEU A C   1 
ATOM   364   O  O   . LEU A 1 73  ? 22.213  -3.273  28.587  1.00 81.67  ? 73  LEU A O   1 
ATOM   365   C  CB  . LEU A 1 73  ? 24.802  -1.648  27.359  1.00 67.65  ? 73  LEU A CB  1 
ATOM   366   C  CG  . LEU A 1 73  ? 26.310  -1.635  27.536  1.00 66.28  ? 73  LEU A CG  1 
ATOM   367   C  CD1 . LEU A 1 73  ? 26.830  -0.216  27.443  1.00 66.59  ? 73  LEU A CD1 1 
ATOM   368   C  CD2 . LEU A 1 73  ? 26.689  -2.251  28.872  1.00 66.11  ? 73  LEU A CD2 1 
ATOM   369   N  N   . ARG A 1 74  ? 22.040  -2.743  26.417  1.00 72.71  ? 74  ARG A N   1 
ATOM   370   C  CA  . ARG A 1 74  ? 20.602  -2.665  26.464  1.00 72.05  ? 74  ARG A CA  1 
ATOM   371   C  C   . ARG A 1 74  ? 19.994  -4.017  26.754  1.00 70.74  ? 74  ARG A C   1 
ATOM   372   O  O   . ARG A 1 74  ? 18.943  -4.104  27.355  1.00 75.56  ? 74  ARG A O   1 
ATOM   373   C  CB  . ARG A 1 74  ? 20.064  -2.110  25.149  1.00 75.25  ? 74  ARG A CB  1 
ATOM   374   C  CG  . ARG A 1 74  ? 19.998  -0.594  25.148  1.00 75.60  ? 74  ARG A CG  1 
ATOM   375   C  CD  . ARG A 1 74  ? 20.077  -0.003  23.764  1.00 75.62  ? 74  ARG A CD  1 
ATOM   376   N  NE  . ARG A 1 74  ? 20.184  1.447   23.865  1.00 77.85  ? 74  ARG A NE  1 
ATOM   377   C  CZ  . ARG A 1 74  ? 21.294  2.090   24.213  1.00 78.20  ? 74  ARG A CZ  1 
ATOM   378   N  NH1 . ARG A 1 74  ? 22.402  1.425   24.491  1.00 77.36  ? 74  ARG A NH1 1 
ATOM   379   N  NH2 . ARG A 1 74  ? 21.307  3.409   24.267  1.00 82.98  ? 74  ARG A NH2 1 
ATOM   380   N  N   . ALA A 1 75  ? 20.671  -5.079  26.361  1.00 69.82  ? 75  ALA A N   1 
ATOM   381   C  CA  . ALA A 1 75  ? 20.161  -6.412  26.622  1.00 69.97  ? 75  ALA A CA  1 
ATOM   382   C  C   . ALA A 1 75  ? 20.596  -6.981  27.964  1.00 67.47  ? 75  ALA A C   1 
ATOM   383   O  O   . ALA A 1 75  ? 20.039  -7.972  28.403  1.00 68.97  ? 75  ALA A O   1 
ATOM   384   C  CB  . ALA A 1 75  ? 20.585  -7.356  25.517  1.00 72.11  ? 75  ALA A CB  1 
ATOM   385   N  N   . HIS A 1 76  ? 21.616  -6.409  28.592  1.00 66.42  ? 76  HIS A N   1 
ATOM   386   C  CA  . HIS A 1 76  ? 22.186  -7.019  29.794  1.00 66.30  ? 76  HIS A CA  1 
ATOM   387   C  C   . HIS A 1 76  ? 22.436  -6.011  30.909  1.00 68.13  ? 76  HIS A C   1 
ATOM   388   O  O   . HIS A 1 76  ? 23.562  -5.545  31.101  1.00 71.28  ? 76  HIS A O   1 
ATOM   389   C  CB  . HIS A 1 76  ? 23.466  -7.760  29.442  1.00 63.56  ? 76  HIS A CB  1 
ATOM   390   C  CG  . HIS A 1 76  ? 23.271  -8.796  28.392  1.00 63.43  ? 76  HIS A CG  1 
ATOM   391   N  ND1 . HIS A 1 76  ? 22.562  -9.955  28.620  1.00 64.82  ? 76  HIS A ND1 1 
ATOM   392   C  CD2 . HIS A 1 76  ? 23.660  -8.837  27.098  1.00 64.02  ? 76  HIS A CD2 1 
ATOM   393   C  CE1 . HIS A 1 76  ? 22.538  -10.678 27.514  1.00 66.38  ? 76  HIS A CE1 1 
ATOM   394   N  NE2 . HIS A 1 76  ? 23.199  -10.023 26.576  1.00 66.61  ? 76  HIS A NE2 1 
ATOM   395   N  N   . PRO A 1 77  ? 21.377  -5.680  31.661  1.00 67.94  ? 77  PRO A N   1 
ATOM   396   C  CA  . PRO A 1 77  ? 21.417  -4.669  32.701  1.00 68.03  ? 77  PRO A CA  1 
ATOM   397   C  C   . PRO A 1 77  ? 22.422  -4.935  33.795  1.00 69.93  ? 77  PRO A C   1 
ATOM   398   O  O   . PRO A 1 77  ? 22.752  -4.021  34.543  1.00 76.20  ? 77  PRO A O   1 
ATOM   399   C  CB  . PRO A 1 77  ? 20.010  -4.705  33.299  1.00 67.14  ? 77  PRO A CB  1 
ATOM   400   C  CG  . PRO A 1 77  ? 19.359  -5.904  32.731  1.00 68.68  ? 77  PRO A CG  1 
ATOM   401   C  CD  . PRO A 1 77  ? 20.009  -6.143  31.415  1.00 68.35  ? 77  PRO A CD  1 
ATOM   402   N  N   . CYS A 1 78  ? 22.926  -6.157  33.895  1.00 71.80  ? 78  CYS A N   1 
ATOM   403   C  CA  . CYS A 1 78  ? 23.896  -6.450  34.941  1.00 74.62  ? 78  CYS A CA  1 
ATOM   404   C  C   . CYS A 1 78  ? 25.338  -6.065  34.556  1.00 73.09  ? 78  CYS A C   1 
ATOM   405   O  O   . CYS A 1 78  ? 26.261  -6.238  35.341  1.00 78.13  ? 78  CYS A O   1 
ATOM   406   C  CB  . CYS A 1 78  ? 23.771  -7.903  35.396  1.00 77.40  ? 78  CYS A CB  1 
ATOM   407   S  SG  . CYS A 1 78  ? 24.306  -9.174  34.234  1.00 90.96  ? 78  CYS A SG  1 
ATOM   408   N  N   . VAL A 1 79  ? 25.497  -5.399  33.415  1.00 69.14  ? 79  VAL A N   1 
ATOM   409   C  CA  . VAL A 1 79  ? 26.814  -5.042  32.894  1.00 65.10  ? 79  VAL A CA  1 
ATOM   410   C  C   . VAL A 1 79  ? 26.967  -3.534  32.713  1.00 66.17  ? 79  VAL A C   1 
ATOM   411   O  O   . VAL A 1 79  ? 26.222  -2.919  31.960  1.00 68.37  ? 79  VAL A O   1 
ATOM   412   C  CB  . VAL A 1 79  ? 27.027  -5.668  31.503  1.00 63.90  ? 79  VAL A CB  1 
ATOM   413   C  CG1 . VAL A 1 79  ? 28.438  -5.413  31.012  1.00 63.93  ? 79  VAL A CG1 1 
ATOM   414   C  CG2 . VAL A 1 79  ? 26.732  -7.157  31.526  1.00 63.63  ? 79  VAL A CG2 1 
ATOM   415   N  N   . SER A 1 80  ? 27.986  -2.952  33.329  1.00 66.19  ? 80  SER A N   1 
ATOM   416   C  CA  . SER A 1 80  ? 28.330  -1.569  33.048  1.00 67.39  ? 80  SER A CA  1 
ATOM   417   C  C   . SER A 1 80  ? 29.069  -1.433  31.731  1.00 67.72  ? 80  SER A C   1 
ATOM   418   O  O   . SER A 1 80  ? 29.731  -2.349  31.296  1.00 65.47  ? 80  SER A O   1 
ATOM   419   C  CB  . SER A 1 80  ? 29.175  -0.980  34.180  1.00 70.00  ? 80  SER A CB  1 
ATOM   420   O  OG  . SER A 1 80  ? 30.420  -1.624  34.288  1.00 69.62  ? 80  SER A OG  1 
ATOM   421   N  N   . ASP A 1 81  ? 28.947  -0.272  31.102  1.00 77.05  ? 81  ASP A N   1 
ATOM   422   C  CA  . ASP A 1 81  ? 29.728  0.050   29.912  1.00 84.64  ? 81  ASP A CA  1 
ATOM   423   C  C   . ASP A 1 81  ? 31.206  -0.189  30.169  1.00 85.04  ? 81  ASP A C   1 
ATOM   424   O  O   . ASP A 1 81  ? 31.906  -0.746  29.337  1.00 85.66  ? 81  ASP A O   1 
ATOM   425   C  CB  . ASP A 1 81  ? 29.526  1.517   29.532  1.00 94.21  ? 81  ASP A CB  1 
ATOM   426   C  CG  . ASP A 1 81  ? 30.259  1.897   28.257  1.00 102.03 ? 81  ASP A CG  1 
ATOM   427   O  OD1 . ASP A 1 81  ? 30.502  0.996   27.426  1.00 99.28  ? 81  ASP A OD1 1 
ATOM   428   O  OD2 . ASP A 1 81  ? 30.555  3.103   28.067  1.00 105.46 ? 81  ASP A OD2 1 
ATOM   429   N  N   . GLN A 1 82  ? 31.672  0.230   31.336  1.00 84.66  ? 82  GLN A N   1 
ATOM   430   C  CA  . GLN A 1 82  ? 33.089  0.184   31.646  1.00 84.02  ? 82  GLN A CA  1 
ATOM   431   C  C   . GLN A 1 82  ? 33.560  -1.251  31.827  1.00 74.37  ? 82  GLN A C   1 
ATOM   432   O  O   . GLN A 1 82  ? 34.667  -1.598  31.456  1.00 74.95  ? 82  GLN A O   1 
ATOM   433   C  CB  . GLN A 1 82  ? 33.372  0.997   32.899  1.00 90.69  ? 82  GLN A CB  1 
ATOM   434   C  CG  . GLN A 1 82  ? 33.135  2.488   32.717  1.00 104.61 ? 82  GLN A CG  1 
ATOM   435   C  CD  . GLN A 1 82  ? 31.670  2.907   32.861  1.00 113.93 ? 82  GLN A CD  1 
ATOM   436   O  OE1 . GLN A 1 82  ? 30.752  2.103   32.673  1.00 114.68 ? 82  GLN A OE1 1 
ATOM   437   N  NE2 . GLN A 1 82  ? 31.449  4.186   33.190  1.00 109.77 ? 82  GLN A NE2 1 
ATOM   438   N  N   . GLU A 1 83  ? 32.706  -2.090  32.384  1.00 71.79  ? 83  GLU A N   1 
ATOM   439   C  CA  . GLU A 1 83  ? 33.023  -3.506  32.536  1.00 69.62  ? 83  GLU A CA  1 
ATOM   440   C  C   . GLU A 1 83  ? 33.095  -4.168  31.169  1.00 69.12  ? 83  GLU A C   1 
ATOM   441   O  O   . GLU A 1 83  ? 33.995  -4.951  30.903  1.00 73.22  ? 83  GLU A O   1 
ATOM   442   C  CB  . GLU A 1 83  ? 31.985  -4.199  33.424  1.00 68.37  ? 83  GLU A CB  1 
ATOM   443   C  CG  . GLU A 1 83  ? 32.234  -3.996  34.917  1.00 71.58  ? 83  GLU A CG  1 
ATOM   444   C  CD  . GLU A 1 83  ? 31.082  -4.457  35.795  1.00 73.28  ? 83  GLU A CD  1 
ATOM   445   O  OE1 . GLU A 1 83  ? 29.950  -3.955  35.629  1.00 80.46  ? 83  GLU A OE1 1 
ATOM   446   O  OE2 . GLU A 1 83  ? 31.310  -5.311  36.672  1.00 73.51  ? 83  GLU A OE2 1 
ATOM   447   N  N   . LEU A 1 84  ? 32.160  -3.829  30.293  1.00 70.71  ? 84  LEU A N   1 
ATOM   448   C  CA  . LEU A 1 84  ? 32.146  -4.362  28.938  1.00 72.35  ? 84  LEU A CA  1 
ATOM   449   C  C   . LEU A 1 84  ? 33.394  -3.903  28.213  1.00 72.39  ? 84  LEU A C   1 
ATOM   450   O  O   . LEU A 1 84  ? 33.938  -4.590  27.359  1.00 74.99  ? 84  LEU A O   1 
ATOM   451   C  CB  . LEU A 1 84  ? 30.910  -3.855  28.203  1.00 77.66  ? 84  LEU A CB  1 
ATOM   452   C  CG  . LEU A 1 84  ? 30.679  -4.352  26.781  1.00 81.88  ? 84  LEU A CG  1 
ATOM   453   C  CD1 . LEU A 1 84  ? 30.723  -5.865  26.761  1.00 81.36  ? 84  LEU A CD1 1 
ATOM   454   C  CD2 . LEU A 1 84  ? 29.334  -3.864  26.264  1.00 91.31  ? 84  LEU A CD2 1 
ATOM   455   N  N   . GLY A 1 85  ? 33.854  -2.721  28.563  1.00 74.31  ? 85  GLY A N   1 
ATOM   456   C  CA  . GLY A 1 85  ? 35.071  -2.202  27.971  1.00 79.41  ? 85  GLY A CA  1 
ATOM   457   C  C   . GLY A 1 85  ? 36.252  -3.104  28.231  1.00 74.48  ? 85  GLY A C   1 
ATOM   458   O  O   . GLY A 1 85  ? 37.005  -3.410  27.322  1.00 81.61  ? 85  GLY A O   1 
ATOM   459   N  N   . LEU A 1 86  ? 36.422  -3.513  29.480  1.00 71.70  ? 86  LEU A N   1 
ATOM   460   C  CA  . LEU A 1 86  ? 37.554  -4.343  29.854  1.00 73.01  ? 86  LEU A CA  1 
ATOM   461   C  C   . LEU A 1 86  ? 37.458  -5.672  29.158  1.00 72.20  ? 86  LEU A C   1 
ATOM   462   O  O   . LEU A 1 86  ? 38.465  -6.226  28.738  1.00 72.28  ? 86  LEU A O   1 
ATOM   463   C  CB  . LEU A 1 86  ? 37.605  -4.578  31.356  1.00 75.70  ? 86  LEU A CB  1 
ATOM   464   C  CG  . LEU A 1 86  ? 37.742  -3.301  32.164  1.00 85.05  ? 86  LEU A CG  1 
ATOM   465   C  CD1 . LEU A 1 86  ? 37.611  -3.573  33.654  1.00 90.47  ? 86  LEU A CD1 1 
ATOM   466   C  CD2 . LEU A 1 86  ? 39.060  -2.626  31.845  1.00 94.18  ? 86  LEU A CD2 1 
ATOM   467   N  N   . LEU A 1 87  ? 36.249  -6.201  29.053  1.00 74.94  ? 87  LEU A N   1 
ATOM   468   C  CA  . LEU A 1 87  ? 36.067  -7.477  28.399  1.00 76.49  ? 87  LEU A CA  1 
ATOM   469   C  C   . LEU A 1 87  ? 36.631  -7.355  26.993  1.00 79.73  ? 87  LEU A C   1 
ATOM   470   O  O   . LEU A 1 87  ? 37.364  -8.226  26.525  1.00 88.84  ? 87  LEU A O   1 
ATOM   471   C  CB  . LEU A 1 87  ? 34.592  -7.855  28.335  1.00 73.63  ? 87  LEU A CB  1 
ATOM   472   C  CG  . LEU A 1 87  ? 34.306  -9.048  27.428  1.00 73.44  ? 87  LEU A CG  1 
ATOM   473   C  CD1 . LEU A 1 87  ? 34.861  -10.301 28.064  1.00 75.78  ? 87  LEU A CD1 1 
ATOM   474   C  CD2 . LEU A 1 87  ? 32.818  -9.217  27.173  1.00 74.44  ? 87  LEU A CD2 1 
ATOM   475   N  N   . ILE A 1 88  ? 36.296  -6.260  26.324  1.00 77.80  ? 88  ILE A N   1 
ATOM   476   C  CA  . ILE A 1 88  ? 36.652  -6.100  24.926  1.00 78.22  ? 88  ILE A CA  1 
ATOM   477   C  C   . ILE A 1 88  ? 38.158  -5.924  24.755  1.00 76.02  ? 88  ILE A C   1 
ATOM   478   O  O   . ILE A 1 88  ? 38.730  -6.396  23.784  1.00 76.64  ? 88  ILE A O   1 
ATOM   479   C  CB  . ILE A 1 88  ? 35.889  -4.934  24.280  1.00 80.13  ? 88  ILE A CB  1 
ATOM   480   C  CG1 . ILE A 1 88  ? 34.436  -5.318  24.028  1.00 78.36  ? 88  ILE A CG1 1 
ATOM   481   C  CG2 . ILE A 1 88  ? 36.510  -4.576  22.948  1.00 84.43  ? 88  ILE A CG2 1 
ATOM   482   C  CD1 . ILE A 1 88  ? 33.552  -4.124  23.788  1.00 79.05  ? 88  ILE A CD1 1 
ATOM   483   N  N   . LYS A 1 89  ? 38.800  -5.248  25.698  1.00 77.74  ? 89  LYS A N   1 
ATOM   484   C  CA  . LYS A 1 89  ? 40.267  -5.185  25.732  1.00 80.22  ? 89  LYS A CA  1 
ATOM   485   C  C   . LYS A 1 89  ? 40.876  -6.561  25.902  1.00 79.97  ? 89  LYS A C   1 
ATOM   486   O  O   . LYS A 1 89  ? 41.807  -6.932  25.199  1.00 82.97  ? 89  LYS A O   1 
ATOM   487   C  CB  . LYS A 1 89  ? 40.750  -4.338  26.902  1.00 88.89  ? 89  LYS A CB  1 
ATOM   488   C  CG  . LYS A 1 89  ? 40.880  -2.854  26.611  1.00 103.72 ? 89  LYS A CG  1 
ATOM   489   C  CD  . LYS A 1 89  ? 40.982  -2.046  27.900  1.00 123.75 ? 89  LYS A CD  1 
ATOM   490   C  CE  . LYS A 1 89  ? 40.774  -0.558  27.651  1.00 138.20 ? 89  LYS A CE  1 
ATOM   491   N  NZ  . LYS A 1 89  ? 40.617  0.206   28.921  1.00 142.47 ? 89  LYS A NZ  1 
ATOM   492   N  N   . GLU A 1 90  ? 40.375  -7.304  26.876  1.00 78.96  ? 90  GLU A N   1 
ATOM   493   C  CA  . GLU A 1 90  ? 40.932  -8.612  27.172  1.00 77.38  ? 90  GLU A CA  1 
ATOM   494   C  C   . GLU A 1 90  ? 40.724  -9.546  26.003  1.00 73.22  ? 90  GLU A C   1 
ATOM   495   O  O   . GLU A 1 90  ? 41.601  -10.326 25.666  1.00 73.90  ? 90  GLU A O   1 
ATOM   496   C  CB  . GLU A 1 90  ? 40.310  -9.197  28.429  1.00 83.10  ? 90  GLU A CB  1 
ATOM   497   C  CG  . GLU A 1 90  ? 40.896  -8.632  29.713  1.00 95.13  ? 90  GLU A CG  1 
ATOM   498   C  CD  . GLU A 1 90  ? 40.212  -9.169  30.962  1.00 105.71 ? 90  GLU A CD  1 
ATOM   499   O  OE1 . GLU A 1 90  ? 40.800  -10.051 31.618  1.00 125.91 ? 90  GLU A OE1 1 
ATOM   500   O  OE2 . GLU A 1 90  ? 39.090  -8.721  31.293  1.00 113.46 ? 90  GLU A OE2 1 
ATOM   501   N  N   . VAL A 1 91  ? 39.568  -9.460  25.368  1.00 73.04  ? 91  VAL A N   1 
ATOM   502   C  CA  . VAL A 1 91  ? 39.322  -10.267 24.189  1.00 76.81  ? 91  VAL A CA  1 
ATOM   503   C  C   . VAL A 1 91  ? 40.322  -9.907  23.102  1.00 74.77  ? 91  VAL A C   1 
ATOM   504   O  O   . VAL A 1 91  ? 40.904  -10.769 22.469  1.00 79.30  ? 91  VAL A O   1 
ATOM   505   C  CB  . VAL A 1 91  ? 37.888  -10.081 23.656  1.00 79.63  ? 91  VAL A CB  1 
ATOM   506   C  CG1 . VAL A 1 91  ? 37.794  -10.495 22.191  1.00 79.16  ? 91  VAL A CG1 1 
ATOM   507   C  CG2 . VAL A 1 91  ? 36.910  -10.883 24.506  1.00 83.44  ? 91  VAL A CG2 1 
ATOM   508   N  N   . ALA A 1 92  ? 40.512  -8.625  22.878  1.00 75.01  ? 92  ALA A N   1 
ATOM   509   C  CA  . ALA A 1 92  ? 41.424  -8.190  21.839  1.00 80.72  ? 92  ALA A CA  1 
ATOM   510   C  C   . ALA A 1 92  ? 42.835  -8.749  22.051  1.00 83.82  ? 92  ALA A C   1 
ATOM   511   O  O   . ALA A 1 92  ? 43.469  -9.192  21.103  1.00 84.53  ? 92  ALA A O   1 
ATOM   512   C  CB  . ALA A 1 92  ? 41.448  -6.669  21.776  1.00 82.04  ? 92  ALA A CB  1 
ATOM   513   N  N   . ASP A 1 93  ? 43.328  -8.711  23.286  1.00 88.55  ? 93  ASP A N   1 
ATOM   514   C  CA  . ASP A 1 93  ? 44.667  -9.224  23.593  1.00 91.74  ? 93  ASP A CA  1 
ATOM   515   C  C   . ASP A 1 93  ? 44.799  -10.691 23.233  1.00 88.69  ? 93  ASP A C   1 
ATOM   516   O  O   . ASP A 1 93  ? 45.775  -11.110 22.620  1.00 90.34  ? 93  ASP A O   1 
ATOM   517   C  CB  . ASP A 1 93  ? 44.997  -9.037  25.073  1.00 100.72 ? 93  ASP A CB  1 
ATOM   518   C  CG  . ASP A 1 93  ? 45.168  -7.579  25.450  1.00 118.69 ? 93  ASP A CG  1 
ATOM   519   O  OD1 . ASP A 1 93  ? 45.326  -6.734  24.537  1.00 133.98 ? 93  ASP A OD1 1 
ATOM   520   O  OD2 . ASP A 1 93  ? 45.138  -7.274  26.662  1.00 132.37 ? 93  ASP A OD2 1 
ATOM   521   N  N   . ALA A 1 94  ? 43.808  -11.479 23.611  1.00 84.61  ? 94  ALA A N   1 
ATOM   522   C  CA  . ALA A 1 94  ? 43.841  -12.884 23.302  1.00 79.84  ? 94  ALA A CA  1 
ATOM   523   C  C   . ALA A 1 94  ? 43.780  -13.108 21.798  1.00 78.29  ? 94  ALA A C   1 
ATOM   524   O  O   . ALA A 1 94  ? 44.473  -13.964 21.287  1.00 86.97  ? 94  ALA A O   1 
ATOM   525   C  CB  . ALA A 1 94  ? 42.700  -13.597 23.990  1.00 80.83  ? 94  ALA A CB  1 
ATOM   526   N  N   . LEU A 1 95  ? 42.942  -12.367 21.087  1.00 78.29  ? 95  LEU A N   1 
ATOM   527   C  CA  . LEU A 1 95  ? 42.832  -12.549 19.644  1.00 81.14  ? 95  LEU A CA  1 
ATOM   528   C  C   . LEU A 1 95  ? 44.160  -12.196 19.032  1.00 79.78  ? 95  LEU A C   1 
ATOM   529   O  O   . LEU A 1 95  ? 44.639  -12.856 18.117  1.00 83.22  ? 95  LEU A O   1 
ATOM   530   C  CB  . LEU A 1 95  ? 41.733  -11.662 19.050  1.00 85.07  ? 95  LEU A CB  1 
ATOM   531   C  CG  . LEU A 1 95  ? 40.314  -11.969 19.538  1.00 92.08  ? 95  LEU A CG  1 
ATOM   532   C  CD1 . LEU A 1 95  ? 39.348  -10.855 19.160  1.00 99.26  ? 95  LEU A CD1 1 
ATOM   533   C  CD2 . LEU A 1 95  ? 39.824  -13.310 19.010  1.00 93.50  ? 95  LEU A CD2 1 
ATOM   534   N  N   . GLY A 1 96  ? 44.766  -11.150 19.566  1.00 81.12  ? 96  GLY A N   1 
ATOM   535   C  CA  . GLY A 1 96  ? 46.058  -10.693 19.088  1.00 81.82  ? 96  GLY A CA  1 
ATOM   536   C  C   . GLY A 1 96  ? 47.139  -11.721 19.298  1.00 80.06  ? 96  GLY A C   1 
ATOM   537   O  O   . GLY A 1 96  ? 48.121  -11.741 18.574  1.00 82.51  ? 96  GLY A O   1 
ATOM   538   N  N   . GLY A 1 97  ? 46.956  -12.571 20.302  1.00 83.09  ? 97  GLY A N   1 
ATOM   539   C  CA  . GLY A 1 97  ? 47.845  -13.716 20.524  1.00 84.47  ? 97  GLY A CA  1 
ATOM   540   C  C   . GLY A 1 97  ? 47.498  -14.937 19.669  1.00 85.41  ? 97  GLY A C   1 
ATOM   541   O  O   . GLY A 1 97  ? 48.207  -15.943 19.705  1.00 82.46  ? 97  GLY A O   1 
ATOM   542   N  N   . GLY A 1 98  ? 46.415  -14.841 18.890  1.00 85.85  ? 98  GLY A N   1 
ATOM   543   C  CA  . GLY A 1 98  ? 46.039  -15.867 17.919  1.00 82.28  ? 98  GLY A CA  1 
ATOM   544   C  C   . GLY A 1 98  ? 44.891  -16.747 18.360  1.00 82.75  ? 98  GLY A C   1 
ATOM   545   O  O   . GLY A 1 98  ? 44.699  -17.837 17.818  1.00 84.85  ? 98  GLY A O   1 
ATOM   546   N  N   . ALA A 1 99  ? 44.128  -16.292 19.348  1.00 83.45  ? 99  ALA A N   1 
ATOM   547   C  CA  . ALA A 1 99  ? 42.918  -17.001 19.748  1.00 87.28  ? 99  ALA A CA  1 
ATOM   548   C  C   . ALA A 1 99  ? 41.852  -16.835 18.677  1.00 92.02  ? 99  ALA A C   1 
ATOM   549   O  O   . ALA A 1 99  ? 41.841  -15.851 17.936  1.00 92.27  ? 99  ALA A O   1 
ATOM   550   C  CB  . ALA A 1 99  ? 42.400  -16.487 21.080  1.00 86.15  ? 99  ALA A CB  1 
ATOM   551   N  N   . ASP A 1 100 ? 40.970  -17.819 18.583  1.00 102.35 ? 100 ASP A N   1 
ATOM   552   C  CA  . ASP A 1 100 ? 39.836  -17.739 17.685  1.00 110.35 ? 100 ASP A CA  1 
ATOM   553   C  C   . ASP A 1 100 ? 38.560  -17.888 18.478  1.00 105.42 ? 100 ASP A C   1 
ATOM   554   O  O   . ASP A 1 100 ? 38.480  -18.703 19.391  1.00 107.11 ? 100 ASP A O   1 
ATOM   555   C  CB  . ASP A 1 100 ? 39.910  -18.832 16.621  1.00 124.24 ? 100 ASP A CB  1 
ATOM   556   C  CG  . ASP A 1 100 ? 40.788  -18.442 15.444  1.00 138.33 ? 100 ASP A CG  1 
ATOM   557   O  OD1 . ASP A 1 100 ? 40.706  -17.279 14.984  1.00 129.65 ? 100 ASP A OD1 1 
ATOM   558   O  OD2 . ASP A 1 100 ? 41.562  -19.308 14.979  1.00 174.30 ? 100 ASP A OD2 1 
ATOM   559   N  N   . PRO A 1 101 ? 37.560  -17.078 18.138  1.00 103.29 ? 101 PRO A N   1 
ATOM   560   C  CA  . PRO A 1 101 ? 36.231  -17.181 18.722  1.00 102.91 ? 101 PRO A CA  1 
ATOM   561   C  C   . PRO A 1 101 ? 35.619  -18.549 18.481  1.00 103.91 ? 101 PRO A C   1 
ATOM   562   O  O   . PRO A 1 101 ? 35.458  -18.950 17.332  1.00 98.35  ? 101 PRO A O   1 
ATOM   563   C  CB  . PRO A 1 101 ? 35.451  -16.102 17.981  1.00 103.21 ? 101 PRO A CB  1 
ATOM   564   C  CG  . PRO A 1 101 ? 36.488  -15.094 17.599  1.00 99.57  ? 101 PRO A CG  1 
ATOM   565   C  CD  . PRO A 1 101 ? 37.708  -15.890 17.279  1.00 97.66  ? 101 PRO A CD  1 
ATOM   566   N  N   . GLU A 1 102 ? 35.289  -19.256 19.560  1.00 119.02 ? 102 GLU A N   1 
ATOM   567   C  CA  . GLU A 1 102 ? 34.754  -20.612 19.463  1.00 142.52 ? 102 GLU A CA  1 
ATOM   568   C  C   . GLU A 1 102 ? 33.239  -20.676 19.733  1.00 160.29 ? 102 GLU A C   1 
ATOM   569   O  O   . GLU A 1 102 ? 32.733  -20.090 20.702  1.00 152.48 ? 102 GLU A O   1 
ATOM   570   C  CB  . GLU A 1 102 ? 35.523  -21.569 20.394  1.00 156.86 ? 102 GLU A CB  1 
ATOM   571   C  CG  . GLU A 1 102 ? 35.321  -21.355 21.896  1.00 163.17 ? 102 GLU A CG  1 
ATOM   572   C  CD  . GLU A 1 102 ? 36.146  -22.315 22.752  1.00 163.51 ? 102 GLU A CD  1 
ATOM   573   O  OE1 . GLU A 1 102 ? 36.867  -23.160 22.179  1.00 153.59 ? 102 GLU A OE1 1 
ATOM   574   O  OE2 . GLU A 1 102 ? 36.071  -22.235 24.001  1.00 158.48 ? 102 GLU A OE2 1 
ATOM   575   N  N   . THR A 1 103 ? 32.527  -21.345 18.826  1.00 173.44 ? 103 THR A N   1 
ATOM   576   C  CA  . THR A 1 103 ? 31.123  -21.700 19.017  1.00 172.92 ? 103 THR A CA  1 
ATOM   577   C  C   . THR A 1 103 ? 30.866  -23.018 18.282  1.00 149.69 ? 103 THR A C   1 
ATOM   578   O  O   . THR A 1 103 ? 29.723  -23.395 18.031  1.00 146.70 ? 103 THR A O   1 
ATOM   579   C  CB  . THR A 1 103 ? 30.161  -20.601 18.492  1.00 177.69 ? 103 THR A CB  1 
ATOM   580   O  OG1 . THR A 1 103 ? 30.434  -20.328 17.112  1.00 196.04 ? 103 THR A OG1 1 
ATOM   581   C  CG2 . THR A 1 103 ? 30.287  -19.297 19.296  1.00 159.53 ? 103 THR A CG2 1 
ATOM   582   N  N   . SER A 1 110 ? 41.082  -27.862 16.130  1.00 172.07 ? 110 SER A N   1 
ATOM   583   C  CA  . SER A 1 110 ? 40.374  -27.697 14.867  1.00 175.68 ? 110 SER A CA  1 
ATOM   584   C  C   . SER A 1 110 ? 40.682  -26.356 14.188  1.00 179.29 ? 110 SER A C   1 
ATOM   585   O  O   . SER A 1 110 ? 40.715  -26.273 12.958  1.00 183.25 ? 110 SER A O   1 
ATOM   586   C  CB  . SER A 1 110 ? 38.864  -27.830 15.089  1.00 163.28 ? 110 SER A CB  1 
ATOM   587   N  N   . HIS A 1 111 ? 40.906  -25.314 14.989  1.00 177.27 ? 111 HIS A N   1 
ATOM   588   C  CA  . HIS A 1 111 ? 41.121  -23.955 14.466  1.00 166.79 ? 111 HIS A CA  1 
ATOM   589   C  C   . HIS A 1 111 ? 42.543  -23.436 14.743  1.00 158.94 ? 111 HIS A C   1 
ATOM   590   O  O   . HIS A 1 111 ? 42.765  -22.215 14.806  1.00 130.19 ? 111 HIS A O   1 
ATOM   591   C  CB  . HIS A 1 111 ? 40.092  -22.980 15.060  1.00 153.02 ? 111 HIS A CB  1 
ATOM   592   N  N   . SER A 1 112 ? 43.502  -24.359 14.880  1.00 142.14 ? 112 SER A N   1 
ATOM   593   C  CA  . SER A 1 112 ? 44.880  -23.981 15.223  1.00 116.56 ? 112 SER A CA  1 
ATOM   594   C  C   . SER A 1 112 ? 45.674  -23.543 13.998  1.00 109.41 ? 112 SER A C   1 
ATOM   595   O  O   . SER A 1 112 ? 45.813  -24.291 13.029  1.00 104.59 ? 112 SER A O   1 
ATOM   596   C  CB  . SER A 1 112 ? 45.626  -25.107 15.941  1.00 113.81 ? 112 SER A CB  1 
ATOM   597   O  OG  . SER A 1 112 ? 46.858  -24.621 16.455  1.00 110.72 ? 112 SER A OG  1 
ATOM   598   N  N   . ALA A 1 113 ? 46.211  -22.329 14.071  1.00 100.53 ? 113 ALA A N   1 
ATOM   599   C  CA  . ALA A 1 113 ? 46.943  -21.721 12.974  1.00 94.76  ? 113 ALA A CA  1 
ATOM   600   C  C   . ALA A 1 113 ? 48.420  -22.099 12.979  1.00 95.71  ? 113 ALA A C   1 
ATOM   601   O  O   . ALA A 1 113 ? 49.159  -21.765 12.042  1.00 92.84  ? 113 ALA A O   1 
ATOM   602   C  CB  . ALA A 1 113 ? 46.797  -20.220 13.050  1.00 94.71  ? 113 ALA A CB  1 
ATOM   603   N  N   . TRP A 1 114 ? 48.853  -22.807 14.020  1.00 100.51 ? 114 TRP A N   1 
ATOM   604   C  CA  . TRP A 1 114 ? 50.211  -23.347 14.038  1.00 104.18 ? 114 TRP A CA  1 
ATOM   605   C  C   . TRP A 1 114 ? 50.277  -24.861 14.153  1.00 109.42 ? 114 TRP A C   1 
ATOM   606   O  O   . TRP A 1 114 ? 51.315  -25.405 14.517  1.00 110.63 ? 114 TRP A O   1 
ATOM   607   C  CB  . TRP A 1 114 ? 51.032  -22.703 15.143  1.00 102.29 ? 114 TRP A CB  1 
ATOM   608   C  CG  . TRP A 1 114 ? 51.178  -21.249 14.919  1.00 100.22 ? 114 TRP A CG  1 
ATOM   609   C  CD1 . TRP A 1 114 ? 50.551  -20.255 15.595  1.00 99.03  ? 114 TRP A CD1 1 
ATOM   610   C  CD2 . TRP A 1 114 ? 51.942  -20.616 13.893  1.00 98.61  ? 114 TRP A CD2 1 
ATOM   611   N  NE1 . TRP A 1 114 ? 50.908  -19.036 15.082  1.00 98.01  ? 114 TRP A NE1 1 
ATOM   612   C  CE2 . TRP A 1 114 ? 51.757  -19.234 14.027  1.00 97.09  ? 114 TRP A CE2 1 
ATOM   613   C  CE3 . TRP A 1 114 ? 52.790  -21.083 12.892  1.00 103.43 ? 114 TRP A CE3 1 
ATOM   614   C  CZ2 . TRP A 1 114 ? 52.384  -18.312 13.193  1.00 96.94  ? 114 TRP A CZ2 1 
ATOM   615   C  CZ3 . TRP A 1 114 ? 53.415  -20.164 12.071  1.00 100.51 ? 114 TRP A CZ3 1 
ATOM   616   C  CH2 . TRP A 1 114 ? 53.206  -18.799 12.225  1.00 96.44  ? 114 TRP A CH2 1 
ATOM   617   N  N   . ASP A 1 115 ? 49.184  -25.539 13.812  1.00 115.40 ? 115 ASP A N   1 
ATOM   618   C  CA  . ASP A 1 115 ? 49.241  -26.975 13.553  1.00 117.68 ? 115 ASP A CA  1 
ATOM   619   C  C   . ASP A 1 115 ? 50.042  -27.236 12.276  1.00 112.59 ? 115 ASP A C   1 
ATOM   620   O  O   . ASP A 1 115 ? 50.325  -26.313 11.517  1.00 103.04 ? 115 ASP A O   1 
ATOM   621   C  CB  . ASP A 1 115 ? 47.833  -27.599 13.476  1.00 122.92 ? 115 ASP A CB  1 
ATOM   622   C  CG  . ASP A 1 115 ? 46.930  -26.929 12.447  1.00 122.39 ? 115 ASP A CG  1 
ATOM   623   O  OD1 . ASP A 1 115 ? 47.437  -26.298 11.495  1.00 117.60 ? 115 ASP A OD1 1 
ATOM   624   O  OD2 . ASP A 1 115 ? 45.693  -27.059 12.587  1.00 127.69 ? 115 ASP A OD2 1 
ATOM   625   N  N   . LEU A 1 116 ? 50.411  -28.490 12.050  1.00 113.61 ? 116 LEU A N   1 
ATOM   626   C  CA  . LEU A 1 116 ? 51.344  -28.821 10.978  1.00 113.67 ? 116 LEU A CA  1 
ATOM   627   C  C   . LEU A 1 116 ? 50.909  -28.254 9.626   1.00 109.85 ? 116 LEU A C   1 
ATOM   628   O  O   . LEU A 1 116 ? 51.728  -27.716 8.877   1.00 107.44 ? 116 LEU A O   1 
ATOM   629   C  CB  . LEU A 1 116 ? 51.527  -30.343 10.879  1.00 118.92 ? 116 LEU A CB  1 
ATOM   630   C  CG  . LEU A 1 116 ? 52.916  -30.910 11.188  1.00 121.99 ? 116 LEU A CG  1 
ATOM   631   C  CD1 . LEU A 1 116 ? 52.997  -32.331 10.654  1.00 126.41 ? 116 LEU A CD1 1 
ATOM   632   C  CD2 . LEU A 1 116 ? 54.033  -30.054 10.608  1.00 119.37 ? 116 LEU A CD2 1 
ATOM   633   N  N   . GLY A 1 117 ? 49.621  -28.376 9.322   1.00 108.26 ? 117 GLY A N   1 
ATOM   634   C  CA  . GLY A 1 117 ? 49.099  -27.988 8.015   1.00 107.07 ? 117 GLY A CA  1 
ATOM   635   C  C   . GLY A 1 117 ? 49.106  -26.494 7.804   1.00 106.81 ? 117 GLY A C   1 
ATOM   636   O  O   . GLY A 1 117 ? 49.446  -26.012 6.716   1.00 107.52 ? 117 GLY A O   1 
ATOM   637   N  N   . SER A 1 118 ? 48.727  -25.758 8.848   1.00 106.01 ? 118 SER A N   1 
ATOM   638   C  CA  . SER A 1 118 ? 48.690  -24.304 8.776   1.00 104.08 ? 118 SER A CA  1 
ATOM   639   C  C   . SER A 1 118 ? 50.095  -23.714 8.796   1.00 100.41 ? 118 SER A C   1 
ATOM   640   O  O   . SER A 1 118 ? 50.349  -22.702 8.147   1.00 98.47  ? 118 SER A O   1 
ATOM   641   C  CB  . SER A 1 118 ? 47.861  -23.720 9.922   1.00 105.19 ? 118 SER A CB  1 
ATOM   642   O  OG  . SER A 1 118 ? 46.506  -24.122 9.816   1.00 108.74 ? 118 SER A OG  1 
ATOM   643   N  N   . ALA A 1 119 ? 51.006  -24.351 9.525   1.00 100.51 ? 119 ALA A N   1 
ATOM   644   C  CA  . ALA A 1 119 ? 52.398  -23.910 9.556   1.00 99.58  ? 119 ALA A CA  1 
ATOM   645   C  C   . ALA A 1 119 ? 53.067  -24.154 8.208   1.00 99.77  ? 119 ALA A C   1 
ATOM   646   O  O   . ALA A 1 119 ? 53.870  -23.339 7.757   1.00 99.11  ? 119 ALA A O   1 
ATOM   647   C  CB  . ALA A 1 119 ? 53.160  -24.620 10.665  1.00 102.57 ? 119 ALA A CB  1 
ATOM   648   N  N   . PHE A 1 120 ? 52.741  -25.280 7.576   1.00 100.55 ? 120 PHE A N   1 
ATOM   649   C  CA  . PHE A 1 120 ? 53.190  -25.559 6.216   1.00 102.99 ? 120 PHE A CA  1 
ATOM   650   C  C   . PHE A 1 120 ? 52.754  -24.429 5.294   1.00 100.29 ? 120 PHE A C   1 
ATOM   651   O  O   . PHE A 1 120 ? 53.578  -23.791 4.631   1.00 93.50  ? 120 PHE A O   1 
ATOM   652   C  CB  . PHE A 1 120 ? 52.601  -26.884 5.735   1.00 108.38 ? 120 PHE A CB  1 
ATOM   653   C  CG  . PHE A 1 120 ? 53.043  -27.292 4.348   1.00 110.69 ? 120 PHE A CG  1 
ATOM   654   C  CD1 . PHE A 1 120 ? 54.252  -27.943 4.149   1.00 111.45 ? 120 PHE A CD1 1 
ATOM   655   C  CD2 . PHE A 1 120 ? 52.222  -27.070 3.251   1.00 110.22 ? 120 PHE A CD2 1 
ATOM   656   C  CE1 . PHE A 1 120 ? 54.645  -28.338 2.883   1.00 112.03 ? 120 PHE A CE1 1 
ATOM   657   C  CE2 . PHE A 1 120 ? 52.608  -27.472 1.984   1.00 109.29 ? 120 PHE A CE2 1 
ATOM   658   C  CZ  . PHE A 1 120 ? 53.826  -28.097 1.798   1.00 110.42 ? 120 PHE A CZ  1 
ATOM   659   N  N   . PHE A 1 121 ? 51.452  -24.164 5.290   1.00 102.81 ? 121 PHE A N   1 
ATOM   660   C  CA  . PHE A 1 121 ? 50.891  -23.053 4.518   1.00 103.67 ? 121 PHE A CA  1 
ATOM   661   C  C   . PHE A 1 121 ? 51.612  -21.736 4.788   1.00 98.33  ? 121 PHE A C   1 
ATOM   662   O  O   . PHE A 1 121 ? 51.979  -21.014 3.865   1.00 95.19  ? 121 PHE A O   1 
ATOM   663   C  CB  . PHE A 1 121 ? 49.413  -22.872 4.838   1.00 104.48 ? 121 PHE A CB  1 
ATOM   664   C  CG  . PHE A 1 121 ? 48.748  -21.788 4.025   1.00 109.21 ? 121 PHE A CG  1 
ATOM   665   C  CD1 . PHE A 1 121 ? 48.369  -22.016 2.708   1.00 117.15 ? 121 PHE A CD1 1 
ATOM   666   C  CD2 . PHE A 1 121 ? 48.499  -20.541 4.576   1.00 112.39 ? 121 PHE A CD2 1 
ATOM   667   C  CE1 . PHE A 1 121 ? 47.744  -21.029 1.960   1.00 118.71 ? 121 PHE A CE1 1 
ATOM   668   C  CE2 . PHE A 1 121 ? 47.868  -19.548 3.834   1.00 116.91 ? 121 PHE A CE2 1 
ATOM   669   C  CZ  . PHE A 1 121 ? 47.489  -19.794 2.526   1.00 117.85 ? 121 PHE A CZ  1 
ATOM   670   N  N   . PHE A 1 122 ? 51.786  -21.416 6.063   1.00 97.27  ? 122 PHE A N   1 
ATOM   671   C  CA  . PHE A 1 122 ? 52.430  -20.172 6.447   1.00 94.53  ? 122 PHE A CA  1 
ATOM   672   C  C   . PHE A 1 122 ? 53.821  -20.080 5.828   1.00 95.95  ? 122 PHE A C   1 
ATOM   673   O  O   . PHE A 1 122 ? 54.220  -19.020 5.343   1.00 93.44  ? 122 PHE A O   1 
ATOM   674   C  CB  . PHE A 1 122 ? 52.526  -20.058 7.973   1.00 94.25  ? 122 PHE A CB  1 
ATOM   675   C  CG  . PHE A 1 122 ? 53.332  -18.880 8.440   1.00 91.49  ? 122 PHE A CG  1 
ATOM   676   C  CD1 . PHE A 1 122 ? 52.784  -17.616 8.448   1.00 90.97  ? 122 PHE A CD1 1 
ATOM   677   C  CD2 . PHE A 1 122 ? 54.643  -19.037 8.845   1.00 90.81  ? 122 PHE A CD2 1 
ATOM   678   C  CE1 . PHE A 1 122 ? 53.526  -16.531 8.861   1.00 89.22  ? 122 PHE A CE1 1 
ATOM   679   C  CE2 . PHE A 1 122 ? 55.386  -17.963 9.265   1.00 88.25  ? 122 PHE A CE2 1 
ATOM   680   C  CZ  . PHE A 1 122 ? 54.829  -16.707 9.274   1.00 87.65  ? 122 PHE A CZ  1 
ATOM   681   N  N   . SER A 1 123 ? 54.556  -21.191 5.855   1.00 97.83  ? 123 SER A N   1 
ATOM   682   C  CA  . SER A 1 123 ? 55.895  -21.238 5.283   1.00 96.85  ? 123 SER A CA  1 
ATOM   683   C  C   . SER A 1 123 ? 55.837  -20.983 3.781   1.00 95.90  ? 123 SER A C   1 
ATOM   684   O  O   . SER A 1 123 ? 56.661  -20.251 3.235   1.00 94.34  ? 123 SER A O   1 
ATOM   685   C  CB  . SER A 1 123 ? 56.545  -22.583 5.571   1.00 98.91  ? 123 SER A CB  1 
ATOM   686   O  OG  . SER A 1 123 ? 56.609  -22.817 6.969   1.00 97.12  ? 123 SER A OG  1 
ATOM   687   N  N   . GLY A 1 124 ? 54.829  -21.550 3.130   1.00 95.33  ? 124 GLY A N   1 
ATOM   688   C  CA  . GLY A 1 124 ? 54.560  -21.247 1.732   1.00 99.20  ? 124 GLY A CA  1 
ATOM   689   C  C   . GLY A 1 124 ? 54.399  -19.759 1.464   1.00 101.56 ? 124 GLY A C   1 
ATOM   690   O  O   . GLY A 1 124 ? 54.937  -19.235 0.485   1.00 101.10 ? 124 GLY A O   1 
ATOM   691   N  N   . THR A 1 125 ? 53.664  -19.073 2.338   1.00 102.74 ? 125 THR A N   1 
ATOM   692   C  CA  . THR A 1 125 ? 53.393  -17.646 2.160   1.00 101.43 ? 125 THR A CA  1 
ATOM   693   C  C   . THR A 1 125 ? 54.674  -16.835 2.219   1.00 100.37 ? 125 THR A C   1 
ATOM   694   O  O   . THR A 1 125 ? 54.693  -15.690 1.765   1.00 102.83 ? 125 THR A O   1 
ATOM   695   C  CB  . THR A 1 125 ? 52.429  -17.077 3.230   1.00 104.39 ? 125 THR A CB  1 
ATOM   696   O  OG1 . THR A 1 125 ? 53.043  -17.127 4.525   1.00 108.66 ? 125 THR A OG1 1 
ATOM   697   C  CG2 . THR A 1 125 ? 51.111  -17.835 3.244   1.00 105.23 ? 125 THR A CG2 1 
ATOM   698   N  N   . ILE A 1 126 ? 55.723  -17.407 2.817   1.00 99.81  ? 126 ILE A N   1 
ATOM   699   C  CA  . ILE A 1 126 ? 57.011  -16.726 2.944   1.00 97.38  ? 126 ILE A CA  1 
ATOM   700   C  C   . ILE A 1 126 ? 57.821  -16.838 1.661   1.00 100.95 ? 126 ILE A C   1 
ATOM   701   O  O   . ILE A 1 126 ? 58.198  -15.833 1.065   1.00 101.28 ? 126 ILE A O   1 
ATOM   702   C  CB  . ILE A 1 126 ? 57.858  -17.296 4.097   1.00 94.13  ? 126 ILE A CB  1 
ATOM   703   C  CG1 . ILE A 1 126 ? 57.115  -17.165 5.419   1.00 92.26  ? 126 ILE A CG1 1 
ATOM   704   C  CG2 . ILE A 1 126 ? 59.186  -16.562 4.192   1.00 95.79  ? 126 ILE A CG2 1 
ATOM   705   C  CD1 . ILE A 1 126 ? 57.928  -17.610 6.613   1.00 93.12  ? 126 ILE A CD1 1 
ATOM   706   N  N   . ILE A 1 127 ? 58.094  -18.065 1.240   1.00 107.42 ? 127 ILE A N   1 
ATOM   707   C  CA  . ILE A 1 127 ? 59.005  -18.289 0.125   1.00 111.50 ? 127 ILE A CA  1 
ATOM   708   C  C   . ILE A 1 127 ? 58.390  -17.809 -1.186  1.00 109.59 ? 127 ILE A C   1 
ATOM   709   O  O   . ILE A 1 127 ? 59.110  -17.437 -2.109  1.00 120.46 ? 127 ILE A O   1 
ATOM   710   C  CB  . ILE A 1 127 ? 59.418  -19.768 0.018   1.00 116.68 ? 127 ILE A CB  1 
ATOM   711   C  CG1 . ILE A 1 127 ? 58.203  -20.648 -0.294  1.00 120.41 ? 127 ILE A CG1 1 
ATOM   712   C  CG2 . ILE A 1 127 ? 60.093  -20.213 1.311   1.00 120.43 ? 127 ILE A CG2 1 
ATOM   713   C  CD1 . ILE A 1 127 ? 58.530  -22.121 -0.426  1.00 124.83 ? 127 ILE A CD1 1 
ATOM   714   N  N   . THR A 1 128 ? 57.062  -17.779 -1.249  1.00 102.67 ? 128 THR A N   1 
ATOM   715   C  CA  . THR A 1 128 ? 56.354  -17.191 -2.383  1.00 102.06 ? 128 THR A CA  1 
ATOM   716   C  C   . THR A 1 128 ? 56.374  -15.666 -2.315  1.00 103.06 ? 128 THR A C   1 
ATOM   717   O  O   . THR A 1 128 ? 55.950  -14.986 -3.249  1.00 101.66 ? 128 THR A O   1 
ATOM   718   C  CB  . THR A 1 128 ? 54.876  -17.611 -2.387  1.00 102.86 ? 128 THR A CB  1 
ATOM   719   O  OG1 . THR A 1 128 ? 54.289  -17.277 -1.126  1.00 106.58 ? 128 THR A OG1 1 
ATOM   720   C  CG2 . THR A 1 128 ? 54.731  -19.095 -2.616  1.00 105.50 ? 128 THR A CG2 1 
ATOM   721   N  N   . THR A 1 129 ? 56.817  -15.138 -1.178  1.00 107.10 ? 129 THR A N   1 
ATOM   722   C  CA  . THR A 1 129 ? 56.764  -13.699 -0.883  1.00 108.75 ? 129 THR A CA  1 
ATOM   723   C  C   . THR A 1 129 ? 55.344  -13.114 -0.836  1.00 107.10 ? 129 THR A C   1 
ATOM   724   O  O   . THR A 1 129 ? 55.184  -11.893 -0.795  1.00 112.16 ? 129 THR A O   1 
ATOM   725   C  CB  . THR A 1 129 ? 57.594  -12.867 -1.880  1.00 105.62 ? 129 THR A CB  1 
ATOM   726   O  OG1 . THR A 1 129 ? 56.837  -12.672 -3.079  1.00 105.86 ? 129 THR A OG1 1 
ATOM   727   C  CG2 . THR A 1 129 ? 58.921  -13.549 -2.197  1.00 105.33 ? 129 THR A CG2 1 
ATOM   728   N  N   . ILE A 1 130 ? 54.325  -13.972 -0.817  1.00 102.68 ? 130 ILE A N   1 
ATOM   729   C  CA  . ILE A 1 130 ? 52.942  -13.506 -0.806  1.00 100.41 ? 130 ILE A CA  1 
ATOM   730   C  C   . ILE A 1 130 ? 52.620  -12.824 0.506   1.00 100.03 ? 130 ILE A C   1 
ATOM   731   O  O   . ILE A 1 130 ? 52.092  -11.710 0.514   1.00 98.94  ? 130 ILE A O   1 
ATOM   732   C  CB  . ILE A 1 130 ? 51.954  -14.657 -1.019  1.00 101.12 ? 130 ILE A CB  1 
ATOM   733   C  CG1 . ILE A 1 130 ? 51.996  -15.105 -2.471  1.00 107.53 ? 130 ILE A CG1 1 
ATOM   734   C  CG2 . ILE A 1 130 ? 50.540  -14.218 -0.675  1.00 100.99 ? 130 ILE A CG2 1 
ATOM   735   C  CD1 . ILE A 1 130 ? 51.252  -16.398 -2.726  1.00 116.51 ? 130 ILE A CD1 1 
ATOM   736   N  N   . GLY A 1 131 ? 52.900  -13.527 1.602   1.00 102.28 ? 131 GLY A N   1 
ATOM   737   C  CA  . GLY A 1 131 ? 52.881  -12.960 2.953   1.00 102.56 ? 131 GLY A CA  1 
ATOM   738   C  C   . GLY A 1 131 ? 51.531  -12.454 3.432   1.00 100.48 ? 131 GLY A C   1 
ATOM   739   O  O   . GLY A 1 131 ? 51.434  -11.331 3.917   1.00 109.82 ? 131 GLY A O   1 
ATOM   740   N  N   . TYR A 1 132 ? 50.496  -13.281 3.318   1.00 98.28  ? 132 TYR A N   1 
ATOM   741   C  CA  . TYR A 1 132 ? 49.142  -12.872 3.694   1.00 97.60  ? 132 TYR A CA  1 
ATOM   742   C  C   . TYR A 1 132 ? 49.114  -12.240 5.074   1.00 100.74 ? 132 TYR A C   1 
ATOM   743   O  O   . TYR A 1 132 ? 48.517  -11.184 5.265   1.00 102.84 ? 132 TYR A O   1 
ATOM   744   C  CB  . TYR A 1 132 ? 48.211  -14.070 3.694   1.00 97.15  ? 132 TYR A CB  1 
ATOM   745   C  CG  . TYR A 1 132 ? 47.818  -14.543 2.326   1.00 100.11 ? 132 TYR A CG  1 
ATOM   746   C  CD1 . TYR A 1 132 ? 47.215  -13.681 1.422   1.00 101.11 ? 132 TYR A CD1 1 
ATOM   747   C  CD2 . TYR A 1 132 ? 48.010  -15.866 1.949   1.00 104.55 ? 132 TYR A CD2 1 
ATOM   748   C  CE1 . TYR A 1 132 ? 46.823  -14.119 0.171   1.00 103.30 ? 132 TYR A CE1 1 
ATOM   749   C  CE2 . TYR A 1 132 ? 47.619  -16.315 0.702   1.00 106.53 ? 132 TYR A CE2 1 
ATOM   750   C  CZ  . TYR A 1 132 ? 47.027  -15.435 -0.185  1.00 105.12 ? 132 TYR A CZ  1 
ATOM   751   O  OH  . TYR A 1 132 ? 46.625  -15.868 -1.426  1.00 104.68 ? 132 TYR A OH  1 
ATOM   752   N  N   . GLY A 1 133 ? 49.737  -12.911 6.039   1.00 107.05 ? 133 GLY A N   1 
ATOM   753   C  CA  . GLY A 1 133 ? 49.968  -12.328 7.358   1.00 105.74 ? 133 GLY A CA  1 
ATOM   754   C  C   . GLY A 1 133 ? 48.725  -12.255 8.219   1.00 101.04 ? 133 GLY A C   1 
ATOM   755   O  O   . GLY A 1 133 ? 48.712  -11.563 9.233   1.00 98.83  ? 133 GLY A O   1 
ATOM   756   N  N   . ASN A 1 134 ? 47.687  -12.985 7.821   1.00 104.34 ? 134 ASN A N   1 
ATOM   757   C  CA  . ASN A 1 134 ? 46.470  -13.088 8.611   1.00 103.84 ? 134 ASN A CA  1 
ATOM   758   C  C   . ASN A 1 134 ? 46.746  -13.805 9.925   1.00 102.09 ? 134 ASN A C   1 
ATOM   759   O  O   . ASN A 1 134 ? 45.912  -13.809 10.831  1.00 101.82 ? 134 ASN A O   1 
ATOM   760   C  CB  . ASN A 1 134 ? 45.369  -13.809 7.823   1.00 104.97 ? 134 ASN A CB  1 
ATOM   761   C  CG  . ASN A 1 134 ? 45.815  -15.162 7.286   1.00 113.73 ? 134 ASN A CG  1 
ATOM   762   O  OD1 . ASN A 1 134 ? 46.953  -15.333 6.840   1.00 108.78 ? 134 ASN A OD1 1 
ATOM   763   N  ND2 . ASN A 1 134 ? 44.904  -16.126 7.304   1.00 122.01 ? 134 ASN A ND2 1 
ATOM   764   N  N   . VAL A 1 135 ? 47.921  -14.420 10.017  1.00 103.31 ? 135 VAL A N   1 
ATOM   765   C  CA  . VAL A 1 135 ? 48.419  -14.930 11.280  1.00 106.18 ? 135 VAL A CA  1 
ATOM   766   C  C   . VAL A 1 135 ? 49.843  -14.428 11.472  1.00 99.62  ? 135 VAL A C   1 
ATOM   767   O  O   . VAL A 1 135 ? 50.714  -14.722 10.669  1.00 104.92 ? 135 VAL A O   1 
ATOM   768   C  CB  . VAL A 1 135 ? 48.405  -16.470 11.305  1.00 114.52 ? 135 VAL A CB  1 
ATOM   769   C  CG1 . VAL A 1 135 ? 49.010  -16.984 12.600  1.00 122.50 ? 135 VAL A CG1 1 
ATOM   770   C  CG2 . VAL A 1 135 ? 46.983  -16.990 11.142  1.00 119.18 ? 135 VAL A CG2 1 
ATOM   771   N  N   . ALA A 1 136 ? 50.085  -13.693 12.550  1.00 94.97  ? 136 ALA A N   1 
ATOM   772   C  CA  . ALA A 1 136 ? 51.402  -13.104 12.798  1.00 94.55  ? 136 ALA A CA  1 
ATOM   773   C  C   . ALA A 1 136 ? 52.222  -13.982 13.727  1.00 92.40  ? 136 ALA A C   1 
ATOM   774   O  O   . ALA A 1 136 ? 51.669  -14.692 14.556  1.00 95.57  ? 136 ALA A O   1 
ATOM   775   C  CB  . ALA A 1 136 ? 51.252  -11.717 13.399  1.00 96.71  ? 136 ALA A CB  1 
ATOM   776   N  N   . LEU A 1 137 ? 53.542  -13.934 13.571  1.00 91.64  ? 137 LEU A N   1 
ATOM   777   C  CA  . LEU A 1 137 ? 54.465  -14.551 14.527  1.00 95.03  ? 137 LEU A CA  1 
ATOM   778   C  C   . LEU A 1 137 ? 54.484  -13.743 15.811  1.00 97.96  ? 137 LEU A C   1 
ATOM   779   O  O   . LEU A 1 137 ? 54.538  -12.516 15.780  1.00 98.87  ? 137 LEU A O   1 
ATOM   780   C  CB  . LEU A 1 137 ? 55.884  -14.599 13.956  1.00 96.60  ? 137 LEU A CB  1 
ATOM   781   C  CG  . LEU A 1 137 ? 56.045  -15.392 12.665  1.00 94.75  ? 137 LEU A CG  1 
ATOM   782   C  CD1 . LEU A 1 137 ? 57.284  -14.944 11.913  1.00 94.94  ? 137 LEU A CD1 1 
ATOM   783   C  CD2 . LEU A 1 137 ? 56.090  -16.881 12.968  1.00 94.64  ? 137 LEU A CD2 1 
ATOM   784   N  N   . ARG A 1 138 ? 54.453  -14.437 16.942  1.00 104.17 ? 138 ARG A N   1 
ATOM   785   C  CA  . ARG A 1 138 ? 54.311  -13.782 18.230  1.00 108.18 ? 138 ARG A CA  1 
ATOM   786   C  C   . ARG A 1 138 ? 55.614  -13.819 19.008  1.00 108.18 ? 138 ARG A C   1 
ATOM   787   O  O   . ARG A 1 138 ? 55.795  -13.043 19.936  1.00 111.36 ? 138 ARG A O   1 
ATOM   788   C  CB  . ARG A 1 138 ? 53.193  -14.448 19.040  1.00 117.11 ? 138 ARG A CB  1 
ATOM   789   C  CG  . ARG A 1 138 ? 51.831  -14.494 18.345  1.00 123.89 ? 138 ARG A CG  1 
ATOM   790   C  CD  . ARG A 1 138 ? 51.092  -13.167 18.418  1.00 126.47 ? 138 ARG A CD  1 
ATOM   791   N  NE  . ARG A 1 138 ? 51.844  -12.066 17.811  1.00 126.34 ? 138 ARG A NE  1 
ATOM   792   C  CZ  . ARG A 1 138 ? 51.742  -10.793 18.186  1.00 122.91 ? 138 ARG A CZ  1 
ATOM   793   N  NH1 . ARG A 1 138 ? 50.916  -10.442 19.168  1.00 121.45 ? 138 ARG A NH1 1 
ATOM   794   N  NH2 . ARG A 1 138 ? 52.478  -9.870  17.583  1.00 122.90 ? 138 ARG A NH2 1 
ATOM   795   N  N   . THR A 1 139 ? 56.525  -14.707 18.615  1.00 110.64 ? 139 THR A N   1 
ATOM   796   C  CA  . THR A 1 139 ? 57.774  -14.908 19.344  1.00 112.37 ? 139 THR A CA  1 
ATOM   797   C  C   . THR A 1 139 ? 58.970  -14.345 18.590  1.00 116.87 ? 139 THR A C   1 
ATOM   798   O  O   . THR A 1 139 ? 59.002  -14.352 17.355  1.00 116.38 ? 139 THR A O   1 
ATOM   799   C  CB  . THR A 1 139 ? 58.041  -16.403 19.604  1.00 111.61 ? 139 THR A CB  1 
ATOM   800   O  OG1 . THR A 1 139 ? 58.277  -17.083 18.364  1.00 104.03 ? 139 THR A OG1 1 
ATOM   801   C  CG2 . THR A 1 139 ? 56.856  -17.035 20.305  1.00 114.61 ? 139 THR A CG2 1 
ATOM   802   N  N   . ASP A 1 140 ? 59.964  -13.885 19.347  1.00 122.95 ? 140 ASP A N   1 
ATOM   803   C  CA  . ASP A 1 140 ? 61.211  -13.380 18.770  1.00 124.23 ? 140 ASP A CA  1 
ATOM   804   C  C   . ASP A 1 140 ? 61.951  -14.476 18.014  1.00 115.44 ? 140 ASP A C   1 
ATOM   805   O  O   . ASP A 1 140 ? 62.568  -14.220 16.982  1.00 116.58 ? 140 ASP A O   1 
ATOM   806   C  CB  . ASP A 1 140 ? 62.125  -12.807 19.859  1.00 133.92 ? 140 ASP A CB  1 
ATOM   807   C  CG  . ASP A 1 140 ? 61.680  -11.434 20.346  1.00 141.14 ? 140 ASP A CG  1 
ATOM   808   O  OD1 . ASP A 1 140 ? 60.743  -10.842 19.761  1.00 147.05 ? 140 ASP A OD1 1 
ATOM   809   O  OD2 . ASP A 1 140 ? 62.284  -10.943 21.322  1.00 142.81 ? 140 ASP A OD2 1 
ATOM   810   N  N   . ALA A 1 141 ? 61.911  -15.691 18.542  1.00 110.69 ? 141 ALA A N   1 
ATOM   811   C  CA  . ALA A 1 141 ? 62.509  -16.827 17.854  1.00 111.18 ? 141 ALA A CA  1 
ATOM   812   C  C   . ALA A 1 141 ? 61.821  -17.033 16.512  1.00 109.99 ? 141 ALA A C   1 
ATOM   813   O  O   . ALA A 1 141 ? 62.472  -17.251 15.494  1.00 109.59 ? 141 ALA A O   1 
ATOM   814   C  CB  . ALA A 1 141 ? 62.397  -18.082 18.707  1.00 112.40 ? 141 ALA A CB  1 
ATOM   815   N  N   . GLY A 1 142 ? 60.496  -16.960 16.514  1.00 112.92 ? 142 GLY A N   1 
ATOM   816   C  CA  . GLY A 1 142 ? 59.731  -17.094 15.284  1.00 111.37 ? 142 GLY A CA  1 
ATOM   817   C  C   . GLY A 1 142 ? 60.216  -16.110 14.242  1.00 108.62 ? 142 GLY A C   1 
ATOM   818   O  O   . GLY A 1 142 ? 60.452  -16.479 13.093  1.00 105.60 ? 142 GLY A O   1 
ATOM   819   N  N   . ARG A 1 143 ? 60.365  -14.854 14.659  1.00 107.06 ? 143 ARG A N   1 
ATOM   820   C  CA  . ARG A 1 143 ? 60.802  -13.782 13.770  1.00 106.88 ? 143 ARG A CA  1 
ATOM   821   C  C   . ARG A 1 143 ? 62.218  -14.026 13.278  1.00 108.87 ? 143 ARG A C   1 
ATOM   822   O  O   . ARG A 1 143 ? 62.511  -13.926 12.086  1.00 109.93 ? 143 ARG A O   1 
ATOM   823   C  CB  . ARG A 1 143 ? 60.757  -12.440 14.499  1.00 108.02 ? 143 ARG A CB  1 
ATOM   824   C  CG  . ARG A 1 143 ? 59.367  -11.855 14.640  1.00 109.83 ? 143 ARG A CG  1 
ATOM   825   C  CD  . ARG A 1 143 ? 59.203  -11.083 15.938  1.00 112.29 ? 143 ARG A CD  1 
ATOM   826   N  NE  . ARG A 1 143 ? 57.834  -10.585 16.066  1.00 113.49 ? 143 ARG A NE  1 
ATOM   827   C  CZ  . ARG A 1 143 ? 57.240  -10.304 17.220  1.00 116.95 ? 143 ARG A CZ  1 
ATOM   828   N  NH1 . ARG A 1 143 ? 57.904  -10.445 18.365  1.00 120.88 ? 143 ARG A NH1 1 
ATOM   829   N  NH2 . ARG A 1 143 ? 55.980  -9.883  17.228  1.00 113.39 ? 143 ARG A NH2 1 
ATOM   830   N  N   . LEU A 1 144 ? 63.107  -14.318 14.216  1.00 109.52 ? 144 LEU A N   1 
ATOM   831   C  CA  . LEU A 1 144 ? 64.502  -14.538 13.889  1.00 107.02 ? 144 LEU A CA  1 
ATOM   832   C  C   . LEU A 1 144 ? 64.620  -15.655 12.857  1.00 104.16 ? 144 LEU A C   1 
ATOM   833   O  O   . LEU A 1 144 ? 65.257  -15.496 11.819  1.00 102.36 ? 144 LEU A O   1 
ATOM   834   C  CB  . LEU A 1 144 ? 65.274  -14.895 15.157  1.00 108.45 ? 144 LEU A CB  1 
ATOM   835   C  CG  . LEU A 1 144 ? 66.755  -15.190 14.964  1.00 111.38 ? 144 LEU A CG  1 
ATOM   836   C  CD1 . LEU A 1 144 ? 67.435  -14.038 14.240  1.00 110.59 ? 144 LEU A CD1 1 
ATOM   837   C  CD2 . LEU A 1 144 ? 67.399  -15.465 16.314  1.00 114.92 ? 144 LEU A CD2 1 
ATOM   838   N  N   . PHE A 1 145 ? 63.991  -16.788 13.150  1.00 104.08 ? 145 PHE A N   1 
ATOM   839   C  CA  . PHE A 1 145 ? 64.063  -17.947 12.272  1.00 103.73 ? 145 PHE A CA  1 
ATOM   840   C  C   . PHE A 1 145 ? 63.505  -17.586 10.907  1.00 101.96 ? 145 PHE A C   1 
ATOM   841   O  O   . PHE A 1 145 ? 64.032  -17.999 9.870   1.00 99.75  ? 145 PHE A O   1 
ATOM   842   C  CB  . PHE A 1 145 ? 63.282  -19.128 12.864  1.00 101.71 ? 145 PHE A CB  1 
ATOM   843   C  CG  . PHE A 1 145 ? 63.193  -20.302 11.943  1.00 100.89 ? 145 PHE A CG  1 
ATOM   844   C  CD1 . PHE A 1 145 ? 64.294  -21.112 11.723  1.00 101.43 ? 145 PHE A CD1 1 
ATOM   845   C  CD2 . PHE A 1 145 ? 62.027  -20.562 11.253  1.00 100.00 ? 145 PHE A CD2 1 
ATOM   846   C  CE1 . PHE A 1 145 ? 64.222  -22.176 10.855  1.00 101.19 ? 145 PHE A CE1 1 
ATOM   847   C  CE2 . PHE A 1 145 ? 61.950  -21.618 10.369  1.00 100.53 ? 145 PHE A CE2 1 
ATOM   848   C  CZ  . PHE A 1 145 ? 63.050  -22.426 10.172  1.00 101.97 ? 145 PHE A CZ  1 
ATOM   849   N  N   . CYS A 1 146 ? 62.429  -16.808 10.931  1.00 102.31 ? 146 CYS A N   1 
ATOM   850   C  CA  . CYS A 1 146 ? 61.712  -16.447 9.728   1.00 101.98 ? 146 CYS A CA  1 
ATOM   851   C  C   . CYS A 1 146 ? 62.614  -15.689 8.768   1.00 106.03 ? 146 CYS A C   1 
ATOM   852   O  O   . CYS A 1 146 ? 62.526  -15.864 7.559   1.00 111.01 ? 146 CYS A O   1 
ATOM   853   C  CB  . CYS A 1 146 ? 60.505  -15.598 10.082  1.00 98.10  ? 146 CYS A CB  1 
ATOM   854   S  SG  . CYS A 1 146 ? 59.650  -14.995 8.629   1.00 101.98 ? 146 CYS A SG  1 
ATOM   855   N  N   . ILE A 1 147 ? 63.494  -14.858 9.312   1.00 112.35 ? 147 ILE A N   1 
ATOM   856   C  CA  . ILE A 1 147 ? 64.471  -14.123 8.501   1.00 113.91 ? 147 ILE A CA  1 
ATOM   857   C  C   . ILE A 1 147 ? 65.325  -15.059 7.641   1.00 112.90 ? 147 ILE A C   1 
ATOM   858   O  O   . ILE A 1 147 ? 65.374  -14.925 6.414   1.00 103.36 ? 147 ILE A O   1 
ATOM   859   C  CB  . ILE A 1 147 ? 65.401  -13.280 9.397   1.00 115.63 ? 147 ILE A CB  1 
ATOM   860   C  CG1 . ILE A 1 147 ? 64.660  -12.042 9.908   1.00 117.09 ? 147 ILE A CG1 1 
ATOM   861   C  CG2 . ILE A 1 147 ? 66.653  -12.875 8.638   1.00 114.63 ? 147 ILE A CG2 1 
ATOM   862   C  CD1 . ILE A 1 147 ? 65.266  -11.436 11.157  1.00 120.34 ? 147 ILE A CD1 1 
ATOM   863   N  N   . PHE A 1 148 ? 65.996  -16.005 8.292   1.00 113.98 ? 148 PHE A N   1 
ATOM   864   C  CA  . PHE A 1 148 ? 66.894  -16.912 7.588   1.00 113.48 ? 148 PHE A CA  1 
ATOM   865   C  C   . PHE A 1 148 ? 66.102  -17.852 6.704   1.00 105.51 ? 148 PHE A C   1 
ATOM   866   O  O   . PHE A 1 148 ? 66.574  -18.256 5.642   1.00 107.48 ? 148 PHE A O   1 
ATOM   867   C  CB  . PHE A 1 148 ? 67.744  -17.717 8.572   1.00 120.00 ? 148 PHE A CB  1 
ATOM   868   C  CG  . PHE A 1 148 ? 68.576  -16.866 9.486   1.00 131.73 ? 148 PHE A CG  1 
ATOM   869   C  CD1 . PHE A 1 148 ? 69.547  -16.013 8.968   1.00 134.30 ? 148 PHE A CD1 1 
ATOM   870   C  CD2 . PHE A 1 148 ? 68.395  -16.916 10.866  1.00 138.01 ? 148 PHE A CD2 1 
ATOM   871   C  CE1 . PHE A 1 148 ? 70.316  -15.223 9.806   1.00 135.63 ? 148 PHE A CE1 1 
ATOM   872   C  CE2 . PHE A 1 148 ? 69.163  -16.132 11.711  1.00 140.87 ? 148 PHE A CE2 1 
ATOM   873   C  CZ  . PHE A 1 148 ? 70.122  -15.281 11.179  1.00 141.42 ? 148 PHE A CZ  1 
ATOM   874   N  N   . TYR A 1 149 ? 64.910  -18.225 7.159   1.00 126.12 ? 149 TYR A N   1 
ATOM   875   C  CA  . TYR A 1 149 ? 64.078  -19.148 6.408   1.00 120.54 ? 149 TYR A CA  1 
ATOM   876   C  C   . TYR A 1 149 ? 63.745  -18.534 5.060   1.00 117.65 ? 149 TYR A C   1 
ATOM   877   O  O   . TYR A 1 149 ? 63.703  -19.222 4.045   1.00 116.94 ? 149 TYR A O   1 
ATOM   878   C  CB  . TYR A 1 149 ? 62.799  -19.490 7.185   1.00 116.04 ? 149 TYR A CB  1 
ATOM   879   C  CG  . TYR A 1 149 ? 61.981  -20.579 6.539   1.00 114.23 ? 149 TYR A CG  1 
ATOM   880   C  CD1 . TYR A 1 149 ? 62.280  -21.911 6.755   1.00 115.47 ? 149 TYR A CD1 1 
ATOM   881   C  CD2 . TYR A 1 149 ? 60.926  -20.270 5.683   1.00 112.18 ? 149 TYR A CD2 1 
ATOM   882   C  CE1 . TYR A 1 149 ? 61.553  -22.911 6.139   1.00 116.22 ? 149 TYR A CE1 1 
ATOM   883   C  CE2 . TYR A 1 149 ? 60.189  -21.261 5.066   1.00 112.19 ? 149 TYR A CE2 1 
ATOM   884   C  CZ  . TYR A 1 149 ? 60.508  -22.578 5.294   1.00 114.49 ? 149 TYR A CZ  1 
ATOM   885   O  OH  . TYR A 1 149 ? 59.775  -23.559 4.670   1.00 115.65 ? 149 TYR A OH  1 
ATOM   886   N  N   . ALA A 1 150 ? 63.541  -17.225 5.053   1.00 115.93 ? 150 ALA A N   1 
ATOM   887   C  CA  . ALA A 1 150 ? 63.137  -16.531 3.842   1.00 116.22 ? 150 ALA A CA  1 
ATOM   888   C  C   . ALA A 1 150 ? 64.332  -16.293 2.928   1.00 120.13 ? 150 ALA A C   1 
ATOM   889   O  O   . ALA A 1 150 ? 64.269  -16.589 1.731   1.00 121.10 ? 150 ALA A O   1 
ATOM   890   C  CB  . ALA A 1 150 ? 62.462  -15.212 4.188   1.00 114.66 ? 150 ALA A CB  1 
ATOM   891   N  N   . LEU A 1 151 ? 65.418  -15.759 3.490   1.00 121.96 ? 151 LEU A N   1 
ATOM   892   C  CA  . LEU A 1 151 ? 66.632  -15.472 2.713   1.00 124.04 ? 151 LEU A CA  1 
ATOM   893   C  C   . LEU A 1 151 ? 67.046  -16.689 1.896   1.00 124.63 ? 151 LEU A C   1 
ATOM   894   O  O   . LEU A 1 151 ? 67.378  -16.571 0.722   1.00 124.90 ? 151 LEU A O   1 
ATOM   895   C  CB  . LEU A 1 151 ? 67.778  -15.049 3.637   1.00 127.22 ? 151 LEU A CB  1 
ATOM   896   C  CG  . LEU A 1 151 ? 67.629  -13.656 4.250   1.00 126.77 ? 151 LEU A CG  1 
ATOM   897   C  CD1 . LEU A 1 151 ? 68.731  -13.359 5.257   1.00 130.01 ? 151 LEU A CD1 1 
ATOM   898   C  CD2 . LEU A 1 151 ? 67.600  -12.607 3.148   1.00 127.49 ? 151 LEU A CD2 1 
ATOM   899   N  N   . VAL A 1 152 ? 66.992  -17.860 2.523   1.00 123.81 ? 152 VAL A N   1 
ATOM   900   C  CA  . VAL A 1 152 ? 67.321  -19.117 1.859   1.00 124.99 ? 152 VAL A CA  1 
ATOM   901   C  C   . VAL A 1 152 ? 66.140  -19.666 1.042   1.00 121.93 ? 152 VAL A C   1 
ATOM   902   O  O   . VAL A 1 152 ? 66.338  -20.269 -0.010  1.00 123.37 ? 152 VAL A O   1 
ATOM   903   C  CB  . VAL A 1 152 ? 67.753  -20.176 2.894   1.00 126.10 ? 152 VAL A CB  1 
ATOM   904   C  CG1 . VAL A 1 152 ? 67.981  -21.521 2.223   1.00 128.34 ? 152 VAL A CG1 1 
ATOM   905   C  CG2 . VAL A 1 152 ? 68.999  -19.718 3.638   1.00 129.48 ? 152 VAL A CG2 1 
ATOM   906   N  N   . GLY A 1 153 ? 64.917  -19.452 1.525   1.00 117.69 ? 153 GLY A N   1 
ATOM   907   C  CA  . GLY A 1 153 ? 63.733  -20.078 0.940   1.00 114.93 ? 153 GLY A CA  1 
ATOM   908   C  C   . GLY A 1 153 ? 63.269  -19.445 -0.356  1.00 113.72 ? 153 GLY A C   1 
ATOM   909   O  O   . GLY A 1 153 ? 62.847  -20.138 -1.280  1.00 113.36 ? 153 GLY A O   1 
ATOM   910   N  N   . ILE A 1 154 ? 63.312  -18.119 -0.414  1.00 113.31 ? 154 ILE A N   1 
ATOM   911   C  CA  . ILE A 1 154 ? 62.747  -17.383 -1.546  1.00 112.52 ? 154 ILE A CA  1 
ATOM   912   C  C   . ILE A 1 154 ? 63.511  -17.649 -2.831  1.00 115.17 ? 154 ILE A C   1 
ATOM   913   O  O   . ILE A 1 154 ? 62.900  -17.955 -3.854  1.00 114.31 ? 154 ILE A O   1 
ATOM   914   C  CB  . ILE A 1 154 ? 62.701  -15.859 -1.288  1.00 111.88 ? 154 ILE A CB  1 
ATOM   915   C  CG1 . ILE A 1 154 ? 61.743  -15.549 -0.132  1.00 108.85 ? 154 ILE A CG1 1 
ATOM   916   C  CG2 . ILE A 1 154 ? 62.260  -15.122 -2.547  1.00 111.06 ? 154 ILE A CG2 1 
ATOM   917   C  CD1 . ILE A 1 154 ? 61.872  -14.149 0.424   1.00 108.62 ? 154 ILE A CD1 1 
ATOM   918   N  N   . PRO A 1 155 ? 64.848  -17.512 -2.792  1.00 118.72 ? 155 PRO A N   1 
ATOM   919   C  CA  . PRO A 1 155 ? 65.608  -17.789 -4.003  1.00 121.61 ? 155 PRO A CA  1 
ATOM   920   C  C   . PRO A 1 155 ? 65.476  -19.251 -4.415  1.00 122.22 ? 155 PRO A C   1 
ATOM   921   O  O   . PRO A 1 155 ? 65.344  -19.549 -5.600  1.00 122.28 ? 155 PRO A O   1 
ATOM   922   C  CB  . PRO A 1 155 ? 67.045  -17.451 -3.606  1.00 125.72 ? 155 PRO A CB  1 
ATOM   923   C  CG  . PRO A 1 155 ? 67.082  -17.593 -2.127  1.00 125.03 ? 155 PRO A CG  1 
ATOM   924   C  CD  . PRO A 1 155 ? 65.721  -17.194 -1.648  1.00 120.34 ? 155 PRO A CD  1 
ATOM   925   N  N   . LEU A 1 156 ? 65.490  -20.151 -3.436  1.00 122.56 ? 156 LEU A N   1 
ATOM   926   C  CA  . LEU A 1 156 ? 65.283  -21.565 -3.707  1.00 123.98 ? 156 LEU A CA  1 
ATOM   927   C  C   . LEU A 1 156 ? 63.966  -21.757 -4.443  1.00 122.31 ? 156 LEU A C   1 
ATOM   928   O  O   . LEU A 1 156 ? 63.886  -22.530 -5.397  1.00 124.21 ? 156 LEU A O   1 
ATOM   929   C  CB  . LEU A 1 156 ? 65.273  -22.370 -2.407  1.00 123.61 ? 156 LEU A CB  1 
ATOM   930   C  CG  . LEU A 1 156 ? 64.712  -23.789 -2.525  1.00 123.74 ? 156 LEU A CG  1 
ATOM   931   C  CD1 . LEU A 1 156 ? 65.555  -24.621 -3.476  1.00 128.13 ? 156 LEU A CD1 1 
ATOM   932   C  CD2 . LEU A 1 156 ? 64.619  -24.453 -1.160  1.00 123.45 ? 156 LEU A CD2 1 
ATOM   933   N  N   . PHE A 1 157 ? 62.932  -21.052 -3.997  1.00 120.18 ? 157 PHE A N   1 
ATOM   934   C  CA  . PHE A 1 157 ? 61.615  -21.167 -4.615  1.00 119.21 ? 157 PHE A CA  1 
ATOM   935   C  C   . PHE A 1 157 ? 61.605  -20.537 -6.001  1.00 120.49 ? 157 PHE A C   1 
ATOM   936   O  O   . PHE A 1 157 ? 61.015  -21.087 -6.934  1.00 121.20 ? 157 PHE A O   1 
ATOM   937   C  CB  . PHE A 1 157 ? 60.539  -20.508 -3.748  1.00 116.04 ? 157 PHE A CB  1 
ATOM   938   C  CG  . PHE A 1 157 ? 59.141  -20.663 -4.298  1.00 114.21 ? 157 PHE A CG  1 
ATOM   939   C  CD1 . PHE A 1 157 ? 58.442  -21.852 -4.142  1.00 113.94 ? 157 PHE A CD1 1 
ATOM   940   C  CD2 . PHE A 1 157 ? 58.537  -19.630 -4.998  1.00 112.91 ? 157 PHE A CD2 1 
ATOM   941   C  CE1 . PHE A 1 157 ? 57.165  -22.004 -4.666  1.00 111.87 ? 157 PHE A CE1 1 
ATOM   942   C  CE2 . PHE A 1 157 ? 57.262  -19.777 -5.522  1.00 110.98 ? 157 PHE A CE2 1 
ATOM   943   C  CZ  . PHE A 1 157 ? 56.578  -20.967 -5.361  1.00 110.21 ? 157 PHE A CZ  1 
ATOM   944   N  N   . GLY A 1 158 ? 62.249  -19.380 -6.125  1.00 121.88 ? 158 GLY A N   1 
ATOM   945   C  CA  . GLY A 1 158 ? 62.366  -18.695 -7.407  1.00 123.63 ? 158 GLY A CA  1 
ATOM   946   C  C   . GLY A 1 158 ? 62.911  -19.617 -8.478  1.00 128.08 ? 158 GLY A C   1 
ATOM   947   O  O   . GLY A 1 158 ? 62.403  -19.642 -9.598  1.00 126.94 ? 158 GLY A O   1 
ATOM   948   N  N   . ILE A 1 159 ? 63.933  -20.394 -8.117  1.00 134.06 ? 159 ILE A N   1 
ATOM   949   C  CA  . ILE A 1 159 ? 64.517  -21.403 -9.016  1.00 138.99 ? 159 ILE A CA  1 
ATOM   950   C  C   . ILE A 1 159 ? 63.471  -22.417 -9.485  1.00 138.05 ? 159 ILE A C   1 
ATOM   951   O  O   . ILE A 1 159 ? 63.322  -22.659 -10.680 1.00 135.94 ? 159 ILE A O   1 
ATOM   952   C  CB  . ILE A 1 159 ? 65.670  -22.183 -8.335  1.00 142.42 ? 159 ILE A CB  1 
ATOM   953   C  CG1 . ILE A 1 159 ? 66.824  -21.246 -7.958  1.00 144.83 ? 159 ILE A CG1 1 
ATOM   954   C  CG2 . ILE A 1 159 ? 66.175  -23.294 -9.242  1.00 145.08 ? 159 ILE A CG2 1 
ATOM   955   C  CD1 . ILE A 1 159 ? 67.330  -20.390 -9.098  1.00 147.01 ? 159 ILE A CD1 1 
ATOM   956   N  N   . LEU A 1 160 ? 62.752  -23.010 -8.536  1.00 138.25 ? 160 LEU A N   1 
ATOM   957   C  CA  . LEU A 1 160 ? 61.715  -23.982 -8.865  1.00 138.03 ? 160 LEU A CA  1 
ATOM   958   C  C   . LEU A 1 160 ? 60.651  -23.347 -9.740  1.00 136.02 ? 160 LEU A C   1 
ATOM   959   O  O   . LEU A 1 160 ? 60.061  -24.012 -10.587 1.00 132.26 ? 160 LEU A O   1 
ATOM   960   C  CB  . LEU A 1 160 ? 61.053  -24.524 -7.597  1.00 136.62 ? 160 LEU A CB  1 
ATOM   961   C  CG  . LEU A 1 160 ? 59.955  -25.556 -7.903  1.00 135.72 ? 160 LEU A CG  1 
ATOM   962   C  CD1 . LEU A 1 160 ? 59.963  -26.697 -6.899  1.00 137.51 ? 160 LEU A CD1 1 
ATOM   963   C  CD2 . LEU A 1 160 ? 58.586  -24.906 -7.948  1.00 131.52 ? 160 LEU A CD2 1 
ATOM   964   N  N   . LEU A 1 161 ? 60.385  -22.067 -9.490  1.00 138.08 ? 161 LEU A N   1 
ATOM   965   C  CA  . LEU A 1 161 ? 59.322  -21.348 -10.175 1.00 139.35 ? 161 LEU A CA  1 
ATOM   966   C  C   . LEU A 1 161 ? 59.705  -21.097 -11.628 1.00 140.79 ? 161 LEU A C   1 
ATOM   967   O  O   . LEU A 1 161 ? 58.928  -21.371 -12.537 1.00 136.77 ? 161 LEU A O   1 
ATOM   968   C  CB  . LEU A 1 161 ? 59.038  -20.020 -9.474  1.00 140.54 ? 161 LEU A CB  1 
ATOM   969   C  CG  . LEU A 1 161 ? 57.691  -19.374 -9.809  1.00 139.27 ? 161 LEU A CG  1 
ATOM   970   C  CD1 . LEU A 1 161 ? 56.523  -20.237 -9.349  1.00 135.95 ? 161 LEU A CD1 1 
ATOM   971   C  CD2 . LEU A 1 161 ? 57.613  -17.984 -9.194  1.00 136.97 ? 161 LEU A CD2 1 
ATOM   972   N  N   . ALA A 1 162 ? 60.908  -20.575 -11.839 1.00 144.86 ? 162 ALA A N   1 
ATOM   973   C  CA  . ALA A 1 162 ? 61.480  -20.489 -13.179 1.00 151.83 ? 162 ALA A CA  1 
ATOM   974   C  C   . ALA A 1 162 ? 61.353  -21.839 -13.891 1.00 153.99 ? 162 ALA A C   1 
ATOM   975   O  O   . ALA A 1 162 ? 60.923  -21.914 -15.042 1.00 149.19 ? 162 ALA A O   1 
ATOM   976   C  CB  . ALA A 1 162 ? 62.943  -20.073 -13.102 1.00 156.35 ? 162 ALA A CB  1 
ATOM   977   N  N   . GLY A 1 163 ? 61.741  -22.901 -13.192 1.00 156.84 ? 163 GLY A N   1 
ATOM   978   C  CA  . GLY A 1 163 ? 61.657  -24.252 -13.730 1.00 159.38 ? 163 GLY A CA  1 
ATOM   979   C  C   . GLY A 1 163 ? 60.250  -24.611 -14.159 1.00 156.74 ? 163 GLY A C   1 
ATOM   980   O  O   . GLY A 1 163 ? 60.032  -25.052 -15.284 1.00 160.08 ? 163 GLY A O   1 
ATOM   981   N  N   . VAL A 1 164 ? 59.290  -24.418 -13.262 1.00 152.86 ? 164 VAL A N   1 
ATOM   982   C  CA  . VAL A 1 164 ? 57.898  -24.741 -13.559 1.00 150.09 ? 164 VAL A CA  1 
ATOM   983   C  C   . VAL A 1 164 ? 57.341  -23.788 -14.614 1.00 149.54 ? 164 VAL A C   1 
ATOM   984   O  O   . VAL A 1 164 ? 56.507  -24.175 -15.429 1.00 145.65 ? 164 VAL A O   1 
ATOM   985   C  CB  . VAL A 1 164 ? 57.016  -24.671 -12.299 1.00 146.28 ? 164 VAL A CB  1 
ATOM   986   C  CG1 . VAL A 1 164 ? 55.564  -24.965 -12.651 1.00 142.96 ? 164 VAL A CG1 1 
ATOM   987   C  CG2 . VAL A 1 164 ? 57.526  -25.637 -11.236 1.00 147.90 ? 164 VAL A CG2 1 
ATOM   988   N  N   . GLY A 1 165 ? 57.809  -22.542 -14.592 1.00 152.80 ? 165 GLY A N   1 
ATOM   989   C  CA  . GLY A 1 165 ? 57.430  -21.555 -15.600 1.00 155.39 ? 165 GLY A CA  1 
ATOM   990   C  C   . GLY A 1 165 ? 57.819  -21.984 -17.003 1.00 160.90 ? 165 GLY A C   1 
ATOM   991   O  O   . GLY A 1 165 ? 57.017  -21.889 -17.929 1.00 159.00 ? 165 GLY A O   1 
ATOM   992   N  N   . ASP A 1 166 ? 59.050  -22.462 -17.160 1.00 167.39 ? 166 ASP A N   1 
ATOM   993   C  CA  . ASP A 1 166 ? 59.528  -22.956 -18.451 1.00 170.57 ? 166 ASP A CA  1 
ATOM   994   C  C   . ASP A 1 166 ? 58.784  -24.232 -18.864 1.00 169.90 ? 166 ASP A C   1 
ATOM   995   O  O   . ASP A 1 166 ? 58.409  -24.385 -20.022 1.00 166.19 ? 166 ASP A O   1 
ATOM   996   C  CB  . ASP A 1 166 ? 61.039  -23.219 -18.406 1.00 177.53 ? 166 ASP A CB  1 
ATOM   997   C  CG  . ASP A 1 166 ? 61.862  -21.938 -18.309 1.00 177.96 ? 166 ASP A CG  1 
ATOM   998   O  OD1 . ASP A 1 166 ? 61.315  -20.846 -18.576 1.00 174.94 ? 166 ASP A OD1 1 
ATOM   999   O  OD2 . ASP A 1 166 ? 63.064  -22.027 -17.976 1.00 180.66 ? 166 ASP A OD2 1 
ATOM   1000  N  N   . ARG A 1 167 ? 58.563  -25.133 -17.910 1.00 172.14 ? 167 ARG A N   1 
ATOM   1001  C  CA  . ARG A 1 167 ? 57.890  -26.412 -18.175 1.00 174.86 ? 167 ARG A CA  1 
ATOM   1002  C  C   . ARG A 1 167 ? 56.403  -26.216 -18.473 1.00 171.91 ? 167 ARG A C   1 
ATOM   1003  O  O   . ARG A 1 167 ? 55.841  -26.898 -19.326 1.00 168.01 ? 167 ARG A O   1 
ATOM   1004  C  CB  . ARG A 1 167 ? 58.061  -27.350 -16.974 1.00 176.45 ? 167 ARG A CB  1 
ATOM   1005  C  CG  . ARG A 1 167 ? 57.545  -28.770 -17.161 1.00 177.96 ? 167 ARG A CG  1 
ATOM   1006  C  CD  . ARG A 1 167 ? 58.516  -29.652 -17.936 1.00 181.09 ? 167 ARG A CD  1 
ATOM   1007  N  NE  . ARG A 1 167 ? 58.424  -31.053 -17.510 1.00 186.52 ? 167 ARG A NE  1 
ATOM   1008  C  CZ  . ARG A 1 167 ? 58.055  -32.071 -18.289 1.00 190.94 ? 167 ARG A CZ  1 
ATOM   1009  N  NH1 . ARG A 1 167 ? 57.754  -31.875 -19.568 1.00 190.62 ? 167 ARG A NH1 1 
ATOM   1010  N  NH2 . ARG A 1 167 ? 58.007  -33.301 -17.791 1.00 194.06 ? 167 ARG A NH2 1 
ATOM   1011  N  N   . LEU A 1 168 ? 55.769  -25.283 -17.769 1.00 173.67 ? 168 LEU A N   1 
ATOM   1012  C  CA  . LEU A 1 168 ? 54.355  -24.981 -17.992 1.00 172.31 ? 168 LEU A CA  1 
ATOM   1013  C  C   . LEU A 1 168 ? 54.158  -24.263 -19.321 1.00 172.09 ? 168 LEU A C   1 
ATOM   1014  O  O   . LEU A 1 168 ? 53.243  -24.581 -20.076 1.00 167.27 ? 168 LEU A O   1 
ATOM   1015  C  CB  . LEU A 1 168 ? 53.802  -24.105 -16.868 1.00 170.56 ? 168 LEU A CB  1 
ATOM   1016  C  CG  . LEU A 1 168 ? 52.369  -23.611 -17.096 1.00 169.67 ? 168 LEU A CG  1 
ATOM   1017  C  CD1 . LEU A 1 168 ? 51.389  -24.774 -17.097 1.00 170.04 ? 168 LEU A CD1 1 
ATOM   1018  C  CD2 . LEU A 1 168 ? 51.976  -22.572 -16.059 1.00 170.34 ? 168 LEU A CD2 1 
ATOM   1019  N  N   . GLY A 1 169 ? 55.012  -23.275 -19.583 1.00 175.08 ? 169 GLY A N   1 
ATOM   1020  C  CA  . GLY A 1 169 ? 55.012  -22.553 -20.849 1.00 176.88 ? 169 GLY A CA  1 
ATOM   1021  C  C   . GLY A 1 169 ? 55.281  -23.478 -22.021 1.00 181.89 ? 169 GLY A C   1 
ATOM   1022  O  O   . GLY A 1 169 ? 54.654  -23.354 -23.071 1.00 189.00 ? 169 GLY A O   1 
ATOM   1023  N  N   . SER A 1 170 ? 56.222  -24.403 -21.843 1.00 179.91 ? 170 SER A N   1 
ATOM   1024  C  CA  . SER A 1 170 ? 56.484  -25.447 -22.831 1.00 177.18 ? 170 SER A CA  1 
ATOM   1025  C  C   . SER A 1 170 ? 55.213  -26.228 -23.157 1.00 174.64 ? 170 SER A C   1 
ATOM   1026  O  O   . SER A 1 170 ? 54.843  -26.347 -24.318 1.00 173.58 ? 170 SER A O   1 
ATOM   1027  C  CB  . SER A 1 170 ? 57.564  -26.405 -22.321 1.00 179.69 ? 170 SER A CB  1 
ATOM   1028  O  OG  . SER A 1 170 ? 57.461  -27.666 -22.956 1.00 182.02 ? 170 SER A OG  1 
ATOM   1029  N  N   . SER A 1 171 ? 54.551  -26.752 -22.128 1.00 175.58 ? 171 SER A N   1 
ATOM   1030  C  CA  . SER A 1 171 ? 53.303  -27.503 -22.305 1.00 176.22 ? 171 SER A CA  1 
ATOM   1031  C  C   . SER A 1 171 ? 52.242  -26.678 -23.029 1.00 175.28 ? 171 SER A C   1 
ATOM   1032  O  O   . SER A 1 171 ? 51.568  -27.171 -23.932 1.00 172.13 ? 171 SER A O   1 
ATOM   1033  C  CB  . SER A 1 171 ? 52.739  -27.939 -20.945 1.00 174.03 ? 171 SER A CB  1 
ATOM   1034  O  OG  . SER A 1 171 ? 53.628  -28.802 -20.265 1.00 176.39 ? 171 SER A OG  1 
ATOM   1035  N  N   . LEU A 1 172 ? 52.075  -25.432 -22.597 1.00 177.56 ? 172 LEU A N   1 
ATOM   1036  C  CA  . LEU A 1 172 ? 51.094  -24.532 -23.199 1.00 175.09 ? 172 LEU A CA  1 
ATOM   1037  C  C   . LEU A 1 172 ? 51.459  -24.227 -24.647 1.00 174.77 ? 172 LEU A C   1 
ATOM   1038  O  O   . LEU A 1 172 ? 50.642  -24.415 -25.543 1.00 174.36 ? 172 LEU A O   1 
ATOM   1039  C  CB  . LEU A 1 172 ? 50.993  -23.224 -22.404 1.00 172.07 ? 172 LEU A CB  1 
ATOM   1040  C  CG  . LEU A 1 172 ? 50.204  -23.240 -21.091 1.00 171.41 ? 172 LEU A CG  1 
ATOM   1041  C  CD1 . LEU A 1 172 ? 50.141  -21.837 -20.501 1.00 169.51 ? 172 LEU A CD1 1 
ATOM   1042  C  CD2 . LEU A 1 172 ? 48.802  -23.796 -21.298 1.00 172.27 ? 172 LEU A CD2 1 
ATOM   1043  N  N   . ARG A 1 173 ? 52.689  -23.765 -24.865 1.00 175.62 ? 173 ARG A N   1 
ATOM   1044  C  CA  . ARG A 1 173 ? 53.157  -23.398 -26.200 1.00 176.87 ? 173 ARG A CA  1 
ATOM   1045  C  C   . ARG A 1 173 ? 53.101  -24.605 -27.144 1.00 183.47 ? 173 ARG A C   1 
ATOM   1046  O  O   . ARG A 1 173 ? 52.780  -24.455 -28.321 1.00 187.49 ? 173 ARG A O   1 
ATOM   1047  C  CB  . ARG A 1 173 ? 54.572  -22.799 -26.145 1.00 178.72 ? 173 ARG A CB  1 
ATOM   1048  C  CG  . ARG A 1 173 ? 54.602  -21.311 -25.800 1.00 181.07 ? 173 ARG A CG  1 
ATOM   1049  C  CD  . ARG A 1 173 ? 55.855  -20.900 -25.035 1.00 192.71 ? 173 ARG A CD  1 
ATOM   1050  N  NE  . ARG A 1 173 ? 55.739  -19.554 -24.462 1.00 201.24 ? 173 ARG A NE  1 
ATOM   1051  C  CZ  . ARG A 1 173 ? 56.460  -19.096 -23.438 1.00 198.87 ? 173 ARG A CZ  1 
ATOM   1052  N  NH1 . ARG A 1 173 ? 57.369  -19.868 -22.852 1.00 205.32 ? 173 ARG A NH1 1 
ATOM   1053  N  NH2 . ARG A 1 173 ? 56.274  -17.857 -22.994 1.00 185.84 ? 173 ARG A NH2 1 
ATOM   1054  N  N   . HIS A 1 174 ? 53.366  -25.800 -26.614 1.00 186.73 ? 174 HIS A N   1 
ATOM   1055  C  CA  . HIS A 1 174 ? 53.292  -27.039 -27.396 1.00 190.32 ? 174 HIS A CA  1 
ATOM   1056  C  C   . HIS A 1 174 ? 51.857  -27.338 -27.839 1.00 191.39 ? 174 HIS A C   1 
ATOM   1057  O  O   . HIS A 1 174 ? 51.617  -27.687 -28.993 1.00 193.30 ? 174 HIS A O   1 
ATOM   1058  C  CB  . HIS A 1 174 ? 53.843  -28.222 -26.586 1.00 192.86 ? 174 HIS A CB  1 
ATOM   1059  C  CG  . HIS A 1 174 ? 53.665  -29.552 -27.252 1.00 197.77 ? 174 HIS A CG  1 
ATOM   1060  N  ND1 . HIS A 1 174 ? 52.463  -30.227 -27.260 1.00 197.84 ? 174 HIS A ND1 1 
ATOM   1061  C  CD2 . HIS A 1 174 ? 54.543  -30.339 -27.917 1.00 200.89 ? 174 HIS A CD2 1 
ATOM   1062  C  CE1 . HIS A 1 174 ? 52.605  -31.368 -27.911 1.00 200.72 ? 174 HIS A CE1 1 
ATOM   1063  N  NE2 . HIS A 1 174 ? 53.858  -31.461 -28.318 1.00 202.78 ? 174 HIS A NE2 1 
ATOM   1064  N  N   . GLY A 1 175 ? 50.910  -27.213 -26.913 1.00 189.84 ? 175 GLY A N   1 
ATOM   1065  C  CA  . GLY A 1 175 ? 49.497  -27.399 -27.234 1.00 186.47 ? 175 GLY A CA  1 
ATOM   1066  C  C   . GLY A 1 175 ? 49.006  -26.346 -28.208 1.00 181.59 ? 175 GLY A C   1 
ATOM   1067  O  O   . GLY A 1 175 ? 48.299  -26.649 -29.169 1.00 176.45 ? 175 GLY A O   1 
ATOM   1068  N  N   . ILE A 1 176 ? 49.390  -25.099 -27.950 1.00 179.12 ? 176 ILE A N   1 
ATOM   1069  C  CA  . ILE A 1 176 ? 49.048  -23.987 -28.814 1.00 174.63 ? 176 ILE A CA  1 
ATOM   1070  C  C   . ILE A 1 176 ? 49.683  -24.193 -30.186 1.00 177.32 ? 176 ILE A C   1 
ATOM   1071  O  O   . ILE A 1 176 ? 49.119  -23.784 -31.192 1.00 179.36 ? 176 ILE A O   1 
ATOM   1072  C  CB  . ILE A 1 176 ? 49.522  -22.648 -28.205 1.00 172.26 ? 176 ILE A CB  1 
ATOM   1073  C  CG1 . ILE A 1 176 ? 48.728  -22.323 -26.939 1.00 168.26 ? 176 ILE A CG1 1 
ATOM   1074  C  CG2 . ILE A 1 176 ? 49.370  -21.505 -29.198 1.00 174.12 ? 176 ILE A CG2 1 
ATOM   1075  C  CD1 . ILE A 1 176 ? 49.385  -21.304 -26.035 1.00 163.51 ? 176 ILE A CD1 1 
ATOM   1076  N  N   . GLY A 1 177 ? 50.849  -24.836 -30.222 1.00 182.91 ? 177 GLY A N   1 
ATOM   1077  C  CA  . GLY A 1 177 ? 51.511  -25.188 -31.478 1.00 188.34 ? 177 GLY A CA  1 
ATOM   1078  C  C   . GLY A 1 177 ? 50.642  -26.039 -32.392 1.00 193.59 ? 177 GLY A C   1 
ATOM   1079  O  O   . GLY A 1 177 ? 50.709  -25.908 -33.614 1.00 189.65 ? 177 GLY A O   1 
ATOM   1080  N  N   . HIS A 1 178 ? 49.832  -26.918 -31.803 1.00 198.03 ? 178 HIS A N   1 
ATOM   1081  C  CA  . HIS A 1 178 ? 48.903  -27.751 -32.573 1.00 198.17 ? 178 HIS A CA  1 
ATOM   1082  C  C   . HIS A 1 178 ? 47.835  -26.887 -33.236 1.00 191.82 ? 178 HIS A C   1 
ATOM   1083  O  O   . HIS A 1 178 ? 47.473  -27.115 -34.389 1.00 183.18 ? 178 HIS A O   1 
ATOM   1084  C  CB  . HIS A 1 178 ? 48.244  -28.814 -31.684 1.00 204.16 ? 178 HIS A CB  1 
ATOM   1085  C  CG  . HIS A 1 178 ? 49.154  -29.948 -31.319 1.00 214.06 ? 178 HIS A CG  1 
ATOM   1086  N  ND1 . HIS A 1 178 ? 49.680  -30.810 -32.258 1.00 219.99 ? 178 HIS A ND1 1 
ATOM   1087  C  CD2 . HIS A 1 178 ? 49.609  -30.377 -30.118 1.00 215.75 ? 178 HIS A CD2 1 
ATOM   1088  C  CE1 . HIS A 1 178 ? 50.432  -31.712 -31.652 1.00 224.83 ? 178 HIS A CE1 1 
ATOM   1089  N  NE2 . HIS A 1 178 ? 50.407  -31.470 -30.353 1.00 224.46 ? 178 HIS A NE2 1 
ATOM   1090  N  N   . ILE A 1 179 ? 47.345  -25.889 -32.501 1.00 193.86 ? 179 ILE A N   1 
ATOM   1091  C  CA  . ILE A 1 179 ? 46.378  -24.927 -33.042 1.00 190.96 ? 179 ILE A CA  1 
ATOM   1092  C  C   . ILE A 1 179 ? 47.049  -23.958 -34.024 1.00 186.28 ? 179 ILE A C   1 
ATOM   1093  O  O   . ILE A 1 179 ? 46.421  -23.514 -34.984 1.00 180.79 ? 179 ILE A O   1 
ATOM   1094  C  CB  . ILE A 1 179 ? 45.686  -24.109 -31.924 1.00 188.15 ? 179 ILE A CB  1 
ATOM   1095  C  CG1 . ILE A 1 179 ? 44.946  -25.034 -30.948 1.00 186.51 ? 179 ILE A CG1 1 
ATOM   1096  C  CG2 . ILE A 1 179 ? 44.717  -23.100 -32.527 1.00 185.22 ? 179 ILE A CG2 1 
ATOM   1097  C  CD1 . ILE A 1 179 ? 44.538  -24.364 -29.651 1.00 178.19 ? 179 ILE A CD1 1 
ATOM   1098  N  N   . GLU A 1 180 ? 48.321  -23.636 -33.775 1.00 182.36 ? 180 GLU A N   1 
ATOM   1099  C  CA  . GLU A 1 180 ? 49.120  -22.817 -34.694 1.00 176.44 ? 180 GLU A CA  1 
ATOM   1100  C  C   . GLU A 1 180 ? 49.216  -23.466 -36.078 1.00 178.71 ? 180 GLU A C   1 
ATOM   1101  O  O   . GLU A 1 180 ? 49.214  -22.773 -37.096 1.00 172.87 ? 180 GLU A O   1 
ATOM   1102  C  CB  . GLU A 1 180 ? 50.535  -22.586 -34.140 1.00 173.87 ? 180 GLU A CB  1 
ATOM   1103  C  CG  . GLU A 1 180 ? 50.634  -21.538 -33.038 1.00 167.81 ? 180 GLU A CG  1 
ATOM   1104  C  CD  . GLU A 1 180 ? 51.903  -21.678 -32.203 1.00 163.78 ? 180 GLU A CD  1 
ATOM   1105  O  OE1 . GLU A 1 180 ? 53.011  -21.530 -32.753 1.00 161.71 ? 180 GLU A OE1 1 
ATOM   1106  O  OE2 . GLU A 1 180 ? 51.800  -21.932 -30.988 1.00 158.80 ? 180 GLU A OE2 1 
ATOM   1107  N  N   . ALA A 1 181 ? 49.309  -24.794 -36.107 1.00 185.31 ? 181 ALA A N   1 
ATOM   1108  C  CA  . ALA A 1 181 ? 49.335  -25.541 -37.365 1.00 189.90 ? 181 ALA A CA  1 
ATOM   1109  C  C   . ALA A 1 181 ? 48.133  -25.180 -38.235 1.00 191.63 ? 181 ALA A C   1 
ATOM   1110  O  O   . ALA A 1 181 ? 48.257  -25.042 -39.453 1.00 189.16 ? 181 ALA A O   1 
ATOM   1111  C  CB  . ALA A 1 181 ? 49.357  -27.038 -37.094 1.00 192.60 ? 181 ALA A CB  1 
ATOM   1112  N  N   . ILE A 1 182 ? 46.974  -25.019 -37.599 1.00 191.93 ? 182 ILE A N   1 
ATOM   1113  C  CA  . ILE A 1 182 ? 45.741  -24.680 -38.304 1.00 190.04 ? 182 ILE A CA  1 
ATOM   1114  C  C   . ILE A 1 182 ? 45.810  -23.279 -38.911 1.00 186.06 ? 182 ILE A C   1 
ATOM   1115  O  O   . ILE A 1 182 ? 45.408  -23.083 -40.056 1.00 182.47 ? 182 ILE A O   1 
ATOM   1116  C  CB  . ILE A 1 182 ? 44.511  -24.767 -37.372 1.00 192.67 ? 182 ILE A CB  1 
ATOM   1117  C  CG1 . ILE A 1 182 ? 44.289  -26.209 -36.905 1.00 198.01 ? 182 ILE A CG1 1 
ATOM   1118  C  CG2 . ILE A 1 182 ? 43.266  -24.258 -38.083 1.00 192.92 ? 182 ILE A CG2 1 
ATOM   1119  C  CD1 . ILE A 1 182 ? 43.322  -26.340 -35.746 1.00 198.20 ? 182 ILE A CD1 1 
ATOM   1120  N  N   . PHE A 1 183 ? 46.306  -22.311 -38.140 1.00 185.75 ? 183 PHE A N   1 
ATOM   1121  C  CA  . PHE A 1 183 ? 46.421  -20.927 -38.611 1.00 185.54 ? 183 PHE A CA  1 
ATOM   1122  C  C   . PHE A 1 183 ? 47.352  -20.816 -39.822 1.00 185.32 ? 183 PHE A C   1 
ATOM   1123  O  O   . PHE A 1 183 ? 47.067  -20.075 -40.761 1.00 182.30 ? 183 PHE A O   1 
ATOM   1124  C  CB  . PHE A 1 183 ? 46.949  -19.997 -37.506 1.00 186.20 ? 183 PHE A CB  1 
ATOM   1125  C  CG  . PHE A 1 183 ? 46.014  -19.815 -36.336 1.00 184.65 ? 183 PHE A CG  1 
ATOM   1126  C  CD1 . PHE A 1 183 ? 44.645  -19.688 -36.515 1.00 181.55 ? 183 PHE A CD1 1 
ATOM   1127  C  CD2 . PHE A 1 183 ? 46.527  -19.703 -35.051 1.00 186.64 ? 183 PHE A CD2 1 
ATOM   1128  C  CE1 . PHE A 1 183 ? 43.803  -19.499 -35.432 1.00 180.28 ? 183 PHE A CE1 1 
ATOM   1129  C  CE2 . PHE A 1 183 ? 45.692  -19.511 -33.965 1.00 186.07 ? 183 PHE A CE2 1 
ATOM   1130  C  CZ  . PHE A 1 183 ? 44.327  -19.412 -34.156 1.00 183.06 ? 183 PHE A CZ  1 
ATOM   1131  N  N   . LEU A 1 184 ? 48.478  -21.524 -39.778 1.00 189.57 ? 184 LEU A N   1 
ATOM   1132  C  CA  . LEU A 1 184 ? 49.478  -21.451 -40.844 1.00 193.35 ? 184 LEU A CA  1 
ATOM   1133  C  C   . LEU A 1 184 ? 48.940  -22.022 -42.149 1.00 191.06 ? 184 LEU A C   1 
ATOM   1134  O  O   . LEU A 1 184 ? 49.283  -21.545 -43.230 1.00 186.59 ? 184 LEU A O   1 
ATOM   1135  C  CB  . LEU A 1 184 ? 50.752  -22.197 -40.445 1.00 206.64 ? 184 LEU A CB  1 
ATOM   1136  C  CG  . LEU A 1 184 ? 51.607  -21.496 -39.389 1.00 216.68 ? 184 LEU A CG  1 
ATOM   1137  C  CD1 . LEU A 1 184 ? 52.640  -22.449 -38.807 1.00 223.02 ? 184 LEU A CD1 1 
ATOM   1138  C  CD2 . LEU A 1 184 ? 52.268  -20.258 -39.979 1.00 217.82 ? 184 LEU A CD2 1 
ATOM   1139  N  N   . LYS A 1 185 ? 48.104  -23.050 -42.042 1.00 193.50 ? 185 LYS A N   1 
ATOM   1140  C  CA  . LYS A 1 185 ? 47.434  -23.619 -43.207 1.00 195.43 ? 185 LYS A CA  1 
ATOM   1141  C  C   . LYS A 1 185 ? 46.393  -22.651 -43.768 1.00 190.58 ? 185 LYS A C   1 
ATOM   1142  O  O   . LYS A 1 185 ? 46.214  -22.570 -44.983 1.00 190.86 ? 185 LYS A O   1 
ATOM   1143  C  CB  . LYS A 1 185 ? 46.801  -24.969 -42.858 1.00 198.66 ? 185 LYS A CB  1 
ATOM   1144  C  CG  . LYS A 1 185 ? 47.839  -26.054 -42.610 1.00 204.35 ? 185 LYS A CG  1 
ATOM   1145  C  CD  . LYS A 1 185 ? 47.228  -27.422 -42.358 1.00 206.72 ? 185 LYS A CD  1 
ATOM   1146  C  CE  . LYS A 1 185 ? 48.276  -28.517 -42.515 1.00 204.83 ? 185 LYS A CE  1 
ATOM   1147  N  NZ  . LYS A 1 185 ? 47.729  -29.876 -42.256 1.00 206.59 ? 185 LYS A NZ  1 
ATOM   1148  N  N   . TRP A 1 186 ? 45.741  -21.896 -42.884 1.00 184.16 ? 186 TRP A N   1 
ATOM   1149  C  CA  . TRP A 1 186 ? 44.819  -20.826 -43.290 1.00 177.79 ? 186 TRP A CA  1 
ATOM   1150  C  C   . TRP A 1 186 ? 45.552  -19.608 -43.861 1.00 175.53 ? 186 TRP A C   1 
ATOM   1151  O  O   . TRP A 1 186 ? 44.949  -18.552 -44.060 1.00 169.70 ? 186 TRP A O   1 
ATOM   1152  C  CB  . TRP A 1 186 ? 43.939  -20.385 -42.112 1.00 172.32 ? 186 TRP A CB  1 
ATOM   1153  C  CG  . TRP A 1 186 ? 42.865  -21.354 -41.756 1.00 173.04 ? 186 TRP A CG  1 
ATOM   1154  C  CD1 . TRP A 1 186 ? 42.391  -22.374 -42.527 1.00 177.06 ? 186 TRP A CD1 1 
ATOM   1155  C  CD2 . TRP A 1 186 ? 42.095  -21.374 -40.547 1.00 173.27 ? 186 TRP A CD2 1 
ATOM   1156  N  NE1 . TRP A 1 186 ? 41.389  -23.042 -41.866 1.00 179.47 ? 186 TRP A NE1 1 
ATOM   1157  C  CE2 . TRP A 1 186 ? 41.185  -22.446 -40.649 1.00 178.49 ? 186 TRP A CE2 1 
ATOM   1158  C  CE3 . TRP A 1 186 ? 42.095  -20.599 -39.383 1.00 170.32 ? 186 TRP A CE3 1 
ATOM   1159  C  CZ2 . TRP A 1 186 ? 40.281  -22.762 -39.630 1.00 179.43 ? 186 TRP A CZ2 1 
ATOM   1160  C  CZ3 . TRP A 1 186 ? 41.193  -20.914 -38.371 1.00 169.41 ? 186 TRP A CZ3 1 
ATOM   1161  C  CH2 . TRP A 1 186 ? 40.302  -21.985 -38.502 1.00 173.51 ? 186 TRP A CH2 1 
ATOM   1162  N  N   . HIS A 1 187 ? 46.852  -19.757 -44.103 1.00 178.00 ? 187 HIS A N   1 
ATOM   1163  C  CA  . HIS A 1 187 ? 47.649  -18.736 -44.784 1.00 176.47 ? 187 HIS A CA  1 
ATOM   1164  C  C   . HIS A 1 187 ? 47.650  -17.397 -44.039 1.00 166.62 ? 187 HIS A C   1 
ATOM   1165  O  O   . HIS A 1 187 ? 47.921  -16.355 -44.629 1.00 162.64 ? 187 HIS A O   1 
ATOM   1166  C  CB  . HIS A 1 187 ? 47.176  -18.554 -46.233 1.00 184.47 ? 187 HIS A CB  1 
ATOM   1167  C  CG  . HIS A 1 187 ? 47.480  -19.724 -47.122 1.00 200.62 ? 187 HIS A CG  1 
ATOM   1168  N  ND1 . HIS A 1 187 ? 46.601  -20.772 -47.306 1.00 209.11 ? 187 HIS A ND1 1 
ATOM   1169  C  CD2 . HIS A 1 187 ? 48.567  -20.012 -47.878 1.00 206.97 ? 187 HIS A CD2 1 
ATOM   1170  C  CE1 . HIS A 1 187 ? 47.133  -21.653 -48.135 1.00 208.16 ? 187 HIS A CE1 1 
ATOM   1171  N  NE2 . HIS A 1 187 ? 48.326  -21.216 -48.497 1.00 209.34 ? 187 HIS A NE2 1 
ATOM   1172  N  N   . VAL A 1 188 ? 47.375  -17.437 -42.737 1.00 161.86 ? 188 VAL A N   1 
ATOM   1173  C  CA  . VAL A 1 188 ? 47.577  -16.282 -41.871 1.00 158.64 ? 188 VAL A CA  1 
ATOM   1174  C  C   . VAL A 1 188 ? 49.085  -16.127 -41.662 1.00 158.88 ? 188 VAL A C   1 
ATOM   1175  O  O   . VAL A 1 188 ? 49.776  -17.107 -41.372 1.00 158.40 ? 188 VAL A O   1 
ATOM   1176  C  CB  . VAL A 1 188 ? 46.872  -16.455 -40.501 1.00 156.82 ? 188 VAL A CB  1 
ATOM   1177  C  CG1 . VAL A 1 188 ? 47.027  -15.205 -39.644 1.00 153.96 ? 188 VAL A CG1 1 
ATOM   1178  C  CG2 . VAL A 1 188 ? 45.397  -16.777 -40.693 1.00 157.18 ? 188 VAL A CG2 1 
ATOM   1179  N  N   . PRO A 1 189 ? 49.605  -14.900 -41.826 1.00 159.23 ? 189 PRO A N   1 
ATOM   1180  C  CA  . PRO A 1 189 ? 51.044  -14.665 -41.726 1.00 157.91 ? 189 PRO A CA  1 
ATOM   1181  C  C   . PRO A 1 189 ? 51.654  -15.257 -40.457 1.00 158.19 ? 189 PRO A C   1 
ATOM   1182  O  O   . PRO A 1 189 ? 51.066  -15.146 -39.381 1.00 156.80 ? 189 PRO A O   1 
ATOM   1183  C  CB  . PRO A 1 189 ? 51.152  -13.138 -41.705 1.00 157.69 ? 189 PRO A CB  1 
ATOM   1184  C  CG  . PRO A 1 189 ? 49.936  -12.658 -42.413 1.00 160.00 ? 189 PRO A CG  1 
ATOM   1185  C  CD  . PRO A 1 189 ? 48.858  -13.667 -42.138 1.00 160.95 ? 189 PRO A CD  1 
ATOM   1186  N  N   . PRO A 1 190 ? 52.840  -15.873 -40.577 1.00 162.68 ? 190 PRO A N   1 
ATOM   1187  C  CA  . PRO A 1 190 ? 53.523  -16.454 -39.416 1.00 163.16 ? 190 PRO A CA  1 
ATOM   1188  C  C   . PRO A 1 190 ? 53.785  -15.455 -38.275 1.00 162.49 ? 190 PRO A C   1 
ATOM   1189  O  O   . PRO A 1 190 ? 53.909  -15.868 -37.123 1.00 160.24 ? 190 PRO A O   1 
ATOM   1190  C  CB  . PRO A 1 190 ? 54.842  -16.984 -39.998 1.00 164.14 ? 190 PRO A CB  1 
ATOM   1191  C  CG  . PRO A 1 190 ? 54.998  -16.315 -41.320 1.00 164.31 ? 190 PRO A CG  1 
ATOM   1192  C  CD  . PRO A 1 190 ? 53.620  -16.025 -41.817 1.00 163.34 ? 190 PRO A CD  1 
ATOM   1193  N  N   . GLU A 1 191 ? 53.854  -14.160 -38.587 1.00 162.72 ? 191 GLU A N   1 
ATOM   1194  C  CA  . GLU A 1 191 ? 54.020  -13.133 -37.553 1.00 160.59 ? 191 GLU A CA  1 
ATOM   1195  C  C   . GLU A 1 191 ? 52.765  -12.979 -36.692 1.00 163.63 ? 191 GLU A C   1 
ATOM   1196  O  O   . GLU A 1 191 ? 52.862  -12.818 -35.474 1.00 169.63 ? 191 GLU A O   1 
ATOM   1197  C  CB  . GLU A 1 191 ? 54.374  -11.773 -38.162 1.00 158.68 ? 191 GLU A CB  1 
ATOM   1198  C  CG  . GLU A 1 191 ? 55.805  -11.648 -38.643 1.00 158.98 ? 191 GLU A CG  1 
ATOM   1199  C  CD  . GLU A 1 191 ? 55.985  -12.151 -40.056 1.00 162.02 ? 191 GLU A CD  1 
ATOM   1200  O  OE1 . GLU A 1 191 ? 54.977  -12.515 -40.701 1.00 160.06 ? 191 GLU A OE1 1 
ATOM   1201  O  OE2 . GLU A 1 191 ? 57.140  -12.176 -40.526 1.00 167.02 ? 191 GLU A OE2 1 
ATOM   1202  N  N   . LEU A 1 192 ? 51.594  -12.984 -37.330 1.00 162.41 ? 192 LEU A N   1 
ATOM   1203  C  CA  . LEU A 1 192 ? 50.324  -12.847 -36.612 1.00 158.61 ? 192 LEU A CA  1 
ATOM   1204  C  C   . LEU A 1 192 ? 49.995  -14.123 -35.852 1.00 154.00 ? 192 LEU A C   1 
ATOM   1205  O  O   . LEU A 1 192 ? 49.492  -14.078 -34.731 1.00 149.28 ? 192 LEU A O   1 
ATOM   1206  C  CB  . LEU A 1 192 ? 49.186  -12.510 -37.579 1.00 159.81 ? 192 LEU A CB  1 
ATOM   1207  C  CG  . LEU A 1 192 ? 49.296  -11.161 -38.290 1.00 163.24 ? 192 LEU A CG  1 
ATOM   1208  C  CD1 . LEU A 1 192 ? 48.096  -10.944 -39.197 1.00 164.39 ? 192 LEU A CD1 1 
ATOM   1209  C  CD2 . LEU A 1 192 ? 49.429  -10.017 -37.290 1.00 161.77 ? 192 LEU A CD2 1 
ATOM   1210  N  N   . VAL A 1 193 ? 50.297  -15.260 -36.465 1.00 152.97 ? 193 VAL A N   1 
ATOM   1211  C  CA  . VAL A 1 193 ? 50.089  -16.543 -35.818 1.00 153.21 ? 193 VAL A CA  1 
ATOM   1212  C  C   . VAL A 1 193 ? 50.847  -16.609 -34.492 1.00 153.88 ? 193 VAL A C   1 
ATOM   1213  O  O   . VAL A 1 193 ? 50.355  -17.177 -33.514 1.00 155.21 ? 193 VAL A O   1 
ATOM   1214  C  CB  . VAL A 1 193 ? 50.532  -17.705 -36.721 1.00 155.19 ? 193 VAL A CB  1 
ATOM   1215  C  CG1 . VAL A 1 193 ? 50.354  -19.028 -35.996 1.00 156.22 ? 193 VAL A CG1 1 
ATOM   1216  C  CG2 . VAL A 1 193 ? 49.740  -17.698 -38.024 1.00 157.57 ? 193 VAL A CG2 1 
ATOM   1217  N  N   . ARG A 1 194 ? 52.041  -16.023 -34.458 1.00 156.91 ? 194 ARG A N   1 
ATOM   1218  C  CA  . ARG A 1 194 ? 52.805  -15.920 -33.215 1.00 158.69 ? 194 ARG A CA  1 
ATOM   1219  C  C   . ARG A 1 194 ? 52.049  -15.049 -32.214 1.00 154.49 ? 194 ARG A C   1 
ATOM   1220  O  O   . ARG A 1 194 ? 52.007  -15.350 -31.020 1.00 158.15 ? 194 ARG A O   1 
ATOM   1221  C  CB  . ARG A 1 194 ? 54.198  -15.327 -33.463 1.00 163.18 ? 194 ARG A CB  1 
ATOM   1222  C  CG  . ARG A 1 194 ? 55.082  -16.100 -34.436 1.00 169.71 ? 194 ARG A CG  1 
ATOM   1223  C  CD  . ARG A 1 194 ? 55.598  -17.418 -33.877 1.00 171.52 ? 194 ARG A CD  1 
ATOM   1224  N  NE  . ARG A 1 194 ? 56.611  -18.012 -34.755 1.00 173.95 ? 194 ARG A NE  1 
ATOM   1225  C  CZ  . ARG A 1 194 ? 56.356  -18.672 -35.884 1.00 173.15 ? 194 ARG A CZ  1 
ATOM   1226  N  NH1 . ARG A 1 194 ? 57.359  -19.158 -36.599 1.00 174.76 ? 194 ARG A NH1 1 
ATOM   1227  N  NH2 . ARG A 1 194 ? 55.109  -18.858 -36.300 1.00 172.16 ? 194 ARG A NH2 1 
ATOM   1228  N  N   . VAL A 1 195 ? 51.449  -13.968 -32.707 1.00 150.30 ? 195 VAL A N   1 
ATOM   1229  C  CA  . VAL A 1 195 ? 50.677  -13.071 -31.854 1.00 147.58 ? 195 VAL A CA  1 
ATOM   1230  C  C   . VAL A 1 195 ? 49.411  -13.762 -31.344 1.00 147.87 ? 195 VAL A C   1 
ATOM   1231  O  O   . VAL A 1 195 ? 49.154  -13.779 -30.140 1.00 154.14 ? 195 VAL A O   1 
ATOM   1232  C  CB  . VAL A 1 195 ? 50.313  -11.760 -32.582 1.00 145.42 ? 195 VAL A CB  1 
ATOM   1233  C  CG1 . VAL A 1 195 ? 49.358  -10.923 -31.745 1.00 143.74 ? 195 VAL A CG1 1 
ATOM   1234  C  CG2 . VAL A 1 195 ? 51.571  -10.966 -32.895 1.00 145.57 ? 195 VAL A CG2 1 
ATOM   1235  N  N   . LEU A 1 196 ? 48.633  -14.343 -32.252 1.00 145.64 ? 196 LEU A N   1 
ATOM   1236  C  CA  . LEU A 1 196 ? 47.414  -15.054 -31.868 1.00 143.23 ? 196 LEU A CA  1 
ATOM   1237  C  C   . LEU A 1 196 ? 47.697  -16.107 -30.801 1.00 143.33 ? 196 LEU A C   1 
ATOM   1238  O  O   . LEU A 1 196 ? 46.895  -16.310 -29.891 1.00 142.85 ? 196 LEU A O   1 
ATOM   1239  C  CB  . LEU A 1 196 ? 46.771  -15.721 -33.085 1.00 142.36 ? 196 LEU A CB  1 
ATOM   1240  C  CG  . LEU A 1 196 ? 46.206  -14.795 -34.161 1.00 142.01 ? 196 LEU A CG  1 
ATOM   1241  C  CD1 . LEU A 1 196 ? 45.403  -15.610 -35.163 1.00 143.00 ? 196 LEU A CD1 1 
ATOM   1242  C  CD2 . LEU A 1 196 ? 45.352  -13.690 -33.554 1.00 141.55 ? 196 LEU A CD2 1 
ATOM   1243  N  N   . SER A 1 197 ? 48.838  -16.776 -30.921 1.00 146.29 ? 197 SER A N   1 
ATOM   1244  C  CA  . SER A 1 197 ? 49.223  -17.815 -29.971 1.00 149.01 ? 197 SER A CA  1 
ATOM   1245  C  C   . SER A 1 197 ? 49.543  -17.247 -28.583 1.00 147.25 ? 197 SER A C   1 
ATOM   1246  O  O   . SER A 1 197 ? 49.220  -17.855 -27.567 1.00 145.68 ? 197 SER A O   1 
ATOM   1247  C  CB  . SER A 1 197 ? 50.419  -18.601 -30.511 1.00 151.59 ? 197 SER A CB  1 
ATOM   1248  O  OG  . SER A 1 197 ? 51.557  -17.771 -30.636 1.00 154.10 ? 197 SER A OG  1 
ATOM   1249  N  N   . ALA A 1 198 ? 50.176  -16.081 -28.546 1.00 149.02 ? 198 ALA A N   1 
ATOM   1250  C  CA  . ALA A 1 198 ? 50.437  -15.386 -27.282 1.00 150.92 ? 198 ALA A CA  1 
ATOM   1251  C  C   . ALA A 1 198 ? 49.125  -14.964 -26.604 1.00 157.57 ? 198 ALA A C   1 
ATOM   1252  O  O   . ALA A 1 198 ? 48.939  -15.167 -25.399 1.00 163.74 ? 198 ALA A O   1 
ATOM   1253  C  CB  . ALA A 1 198 ? 51.325  -14.176 -27.524 1.00 147.50 ? 198 ALA A CB  1 
ATOM   1254  N  N   . MET A 1 199 ? 48.223  -14.371 -27.384 1.00 160.18 ? 199 MET A N   1 
ATOM   1255  C  CA  . MET A 1 199 ? 46.875  -14.063 -26.912 1.00 159.01 ? 199 MET A CA  1 
ATOM   1256  C  C   . MET A 1 199 ? 46.234  -15.327 -26.355 1.00 154.18 ? 199 MET A C   1 
ATOM   1257  O  O   . MET A 1 199 ? 45.701  -15.330 -25.246 1.00 157.53 ? 199 MET A O   1 
ATOM   1258  C  CB  . MET A 1 199 ? 46.011  -13.517 -28.053 1.00 165.84 ? 199 MET A CB  1 
ATOM   1259  C  CG  . MET A 1 199 ? 46.357  -12.100 -28.493 1.00 174.12 ? 199 MET A CG  1 
ATOM   1260  S  SD  . MET A 1 199 ? 45.045  -11.285 -29.435 1.00 188.78 ? 199 MET A SD  1 
ATOM   1261  C  CE  . MET A 1 199 ? 43.951  -10.761 -28.115 1.00 176.43 ? 199 MET A CE  1 
ATOM   1262  N  N   . LEU A 1 200 ? 46.288  -16.400 -27.136 1.00 151.28 ? 200 LEU A N   1 
ATOM   1263  C  CA  . LEU A 1 200 ? 45.771  -17.689 -26.690 1.00 153.50 ? 200 LEU A CA  1 
ATOM   1264  C  C   . LEU A 1 200 ? 46.520  -18.159 -25.451 1.00 158.48 ? 200 LEU A C   1 
ATOM   1265  O  O   . LEU A 1 200 ? 45.909  -18.613 -24.485 1.00 157.86 ? 200 LEU A O   1 
ATOM   1266  C  CB  . LEU A 1 200 ? 45.901  -18.743 -27.794 1.00 153.95 ? 200 LEU A CB  1 
ATOM   1267  C  CG  . LEU A 1 200 ? 44.784  -18.782 -28.842 1.00 152.66 ? 200 LEU A CG  1 
ATOM   1268  C  CD1 . LEU A 1 200 ? 45.199  -19.602 -30.055 1.00 151.59 ? 200 LEU A CD1 1 
ATOM   1269  C  CD2 . LEU A 1 200 ? 43.500  -19.329 -28.237 1.00 151.83 ? 200 LEU A CD2 1 
ATOM   1270  N  N   . PHE A 1 201 ? 47.847  -18.044 -25.498 1.00 169.00 ? 201 PHE A N   1 
ATOM   1271  C  CA  . PHE A 1 201 ? 48.731  -18.450 -24.399 1.00 176.15 ? 201 PHE A CA  1 
ATOM   1272  C  C   . PHE A 1 201 ? 48.258  -17.879 -23.059 1.00 174.24 ? 201 PHE A C   1 
ATOM   1273  O  O   . PHE A 1 201 ? 48.050  -18.622 -22.095 1.00 172.79 ? 201 PHE A O   1 
ATOM   1274  C  CB  . PHE A 1 201 ? 50.175  -18.014 -24.730 1.00 177.84 ? 201 PHE A CB  1 
ATOM   1275  C  CG  . PHE A 1 201 ? 51.128  -18.022 -23.562 1.00 180.84 ? 201 PHE A CG  1 
ATOM   1276  C  CD1 . PHE A 1 201 ? 51.229  -19.120 -22.720 1.00 183.82 ? 201 PHE A CD1 1 
ATOM   1277  C  CD2 . PHE A 1 201 ? 51.987  -16.949 -23.359 1.00 178.10 ? 201 PHE A CD2 1 
ATOM   1278  C  CE1 . PHE A 1 201 ? 52.129  -19.124 -21.667 1.00 183.36 ? 201 PHE A CE1 1 
ATOM   1279  C  CE2 . PHE A 1 201 ? 52.890  -16.950 -22.313 1.00 180.33 ? 201 PHE A CE2 1 
ATOM   1280  C  CZ  . PHE A 1 201 ? 52.962  -18.040 -21.466 1.00 181.74 ? 201 PHE A CZ  1 
ATOM   1281  N  N   . LEU A 1 202 ? 48.048  -16.569 -23.010 1.00 167.30 ? 202 LEU A N   1 
ATOM   1282  C  CA  . LEU A 1 202 ? 47.589  -15.935 -21.781 1.00 163.21 ? 202 LEU A CA  1 
ATOM   1283  C  C   . LEU A 1 202 ? 46.094  -16.170 -21.556 1.00 164.68 ? 202 LEU A C   1 
ATOM   1284  O  O   . LEU A 1 202 ? 45.654  -16.385 -20.422 1.00 172.86 ? 202 LEU A O   1 
ATOM   1285  C  CB  . LEU A 1 202 ? 47.921  -14.438 -21.790 1.00 157.64 ? 202 LEU A CB  1 
ATOM   1286  C  CG  . LEU A 1 202 ? 47.166  -13.525 -22.757 1.00 152.26 ? 202 LEU A CG  1 
ATOM   1287  C  CD1 . LEU A 1 202 ? 45.831  -13.085 -22.169 1.00 149.82 ? 202 LEU A CD1 1 
ATOM   1288  C  CD2 . LEU A 1 202 ? 48.019  -12.312 -23.091 1.00 149.04 ? 202 LEU A CD2 1 
ATOM   1289  N  N   . LEU A 1 203 ? 45.314  -16.145 -22.632 1.00 160.07 ? 203 LEU A N   1 
ATOM   1290  C  CA  . LEU A 1 203 ? 43.860  -16.279 -22.504 1.00 159.84 ? 203 LEU A CA  1 
ATOM   1291  C  C   . LEU A 1 203 ? 43.479  -17.622 -21.885 1.00 159.32 ? 203 LEU A C   1 
ATOM   1292  O  O   . LEU A 1 203 ? 42.591  -17.698 -21.031 1.00 157.64 ? 203 LEU A O   1 
ATOM   1293  C  CB  . LEU A 1 203 ? 43.159  -16.103 -23.857 1.00 159.43 ? 203 LEU A CB  1 
ATOM   1294  C  CG  . LEU A 1 203 ? 42.822  -14.664 -24.283 1.00 156.49 ? 203 LEU A CG  1 
ATOM   1295  C  CD1 . LEU A 1 203 ? 42.022  -14.673 -25.576 1.00 153.05 ? 203 LEU A CD1 1 
ATOM   1296  C  CD2 . LEU A 1 203 ? 42.065  -13.908 -23.198 1.00 153.92 ? 203 LEU A CD2 1 
ATOM   1297  N  N   . ILE A 1 204 ? 44.156  -18.680 -22.313 1.00 161.62 ? 204 ILE A N   1 
ATOM   1298  C  CA  . ILE A 1 204 ? 43.887  -20.008 -21.776 1.00 164.06 ? 204 ILE A CA  1 
ATOM   1299  C  C   . ILE A 1 204 ? 44.387  -20.119 -20.338 1.00 164.00 ? 204 ILE A C   1 
ATOM   1300  O  O   . ILE A 1 204 ? 43.696  -20.664 -19.473 1.00 159.11 ? 204 ILE A O   1 
ATOM   1301  C  CB  . ILE A 1 204 ? 44.510  -21.120 -22.646 1.00 165.98 ? 204 ILE A CB  1 
ATOM   1302  C  CG1 . ILE A 1 204 ? 44.082  -22.493 -22.123 1.00 168.31 ? 204 ILE A CG1 1 
ATOM   1303  C  CG2 . ILE A 1 204 ? 46.030  -21.015 -22.674 1.00 168.11 ? 204 ILE A CG2 1 
ATOM   1304  C  CD1 . ILE A 1 204 ? 44.341  -23.624 -23.092 1.00 170.72 ? 204 ILE A CD1 1 
ATOM   1305  N  N   . GLY A 1 205 ? 45.577  -19.583 -20.081 1.00 168.97 ? 205 GLY A N   1 
ATOM   1306  C  CA  . GLY A 1 205 ? 46.090  -19.508 -18.724 1.00 170.04 ? 205 GLY A CA  1 
ATOM   1307  C  C   . GLY A 1 205 ? 45.126  -18.730 -17.853 1.00 168.48 ? 205 GLY A C   1 
ATOM   1308  O  O   . GLY A 1 205 ? 44.669  -19.223 -16.823 1.00 172.18 ? 205 GLY A O   1 
ATOM   1309  N  N   . CYS A 1 206 ? 44.822  -17.505 -18.271 1.00 160.09 ? 206 CYS A N   1 
ATOM   1310  C  CA  . CYS A 1 206 ? 43.813  -16.700 -17.608 1.00 152.77 ? 206 CYS A CA  1 
ATOM   1311  C  C   . CYS A 1 206 ? 42.599  -17.554 -17.263 1.00 151.60 ? 206 CYS A C   1 
ATOM   1312  O  O   . CYS A 1 206 ? 42.171  -17.612 -16.111 1.00 158.77 ? 206 CYS A O   1 
ATOM   1313  C  CB  . CYS A 1 206 ? 43.410  -15.523 -18.495 1.00 151.21 ? 206 CYS A CB  1 
ATOM   1314  S  SG  . CYS A 1 206 ? 42.136  -14.463 -17.763 1.00 156.45 ? 206 CYS A SG  1 
ATOM   1315  N  N   . LEU A 1 207 ? 42.062  -18.247 -18.255 1.00 150.63 ? 207 LEU A N   1 
ATOM   1316  C  CA  . LEU A 1 207 ? 40.904  -19.106 -18.021 1.00 156.13 ? 207 LEU A CA  1 
ATOM   1317  C  C   . LEU A 1 207 ? 41.155  -20.128 -16.900 1.00 153.69 ? 207 LEU A C   1 
ATOM   1318  O  O   . LEU A 1 207 ? 40.306  -20.338 -16.025 1.00 151.21 ? 207 LEU A O   1 
ATOM   1319  C  CB  . LEU A 1 207 ? 40.535  -19.826 -19.315 1.00 163.64 ? 207 LEU A CB  1 
ATOM   1320  C  CG  . LEU A 1 207 ? 39.417  -20.866 -19.216 1.00 171.22 ? 207 LEU A CG  1 
ATOM   1321  C  CD1 . LEU A 1 207 ? 38.081  -20.213 -18.883 1.00 174.34 ? 207 LEU A CD1 1 
ATOM   1322  C  CD2 . LEU A 1 207 ? 39.331  -21.661 -20.510 1.00 173.11 ? 207 LEU A CD2 1 
ATOM   1323  N  N   . LEU A 1 208 ? 42.325  -20.759 -16.932 1.00 153.43 ? 208 LEU A N   1 
ATOM   1324  C  CA  . LEU A 1 208 ? 42.636  -21.848 -16.007 1.00 152.46 ? 208 LEU A CA  1 
ATOM   1325  C  C   . LEU A 1 208 ? 43.055  -21.352 -14.627 1.00 151.54 ? 208 LEU A C   1 
ATOM   1326  O  O   . LEU A 1 208 ? 42.813  -22.023 -13.626 1.00 153.10 ? 208 LEU A O   1 
ATOM   1327  C  CB  . LEU A 1 208 ? 43.756  -22.721 -16.581 1.00 152.07 ? 208 LEU A CB  1 
ATOM   1328  C  CG  . LEU A 1 208 ? 43.362  -23.631 -17.742 1.00 154.99 ? 208 LEU A CG  1 
ATOM   1329  C  CD1 . LEU A 1 208 ? 44.603  -24.262 -18.356 1.00 156.52 ? 208 LEU A CD1 1 
ATOM   1330  C  CD2 . LEU A 1 208 ? 42.378  -24.698 -17.281 1.00 154.56 ? 208 LEU A CD2 1 
ATOM   1331  N  N   . PHE A 1 209 ? 43.705  -20.194 -14.577 1.00 149.98 ? 209 PHE A N   1 
ATOM   1332  C  CA  . PHE A 1 209 ? 44.357  -19.744 -13.353 1.00 146.90 ? 209 PHE A CA  1 
ATOM   1333  C  C   . PHE A 1 209 ? 43.741  -18.482 -12.764 1.00 142.06 ? 209 PHE A C   1 
ATOM   1334  O  O   . PHE A 1 209 ? 43.971  -18.171 -11.599 1.00 141.85 ? 209 PHE A O   1 
ATOM   1335  C  CB  . PHE A 1 209 ? 45.851  -19.526 -13.602 1.00 150.47 ? 209 PHE A CB  1 
ATOM   1336  C  CG  . PHE A 1 209 ? 46.562  -20.742 -14.125 1.00 156.24 ? 209 PHE A CG  1 
ATOM   1337  C  CD1 . PHE A 1 209 ? 46.222  -22.014 -13.675 1.00 157.60 ? 209 PHE A CD1 1 
ATOM   1338  C  CD2 . PHE A 1 209 ? 47.585  -20.612 -15.048 1.00 156.75 ? 209 PHE A CD2 1 
ATOM   1339  C  CE1 . PHE A 1 209 ? 46.879  -23.131 -14.152 1.00 158.45 ? 209 PHE A CE1 1 
ATOM   1340  C  CE2 . PHE A 1 209 ? 48.243  -21.726 -15.530 1.00 161.24 ? 209 PHE A CE2 1 
ATOM   1341  C  CZ  . PHE A 1 209 ? 47.890  -22.986 -15.080 1.00 162.14 ? 209 PHE A CZ  1 
ATOM   1342  N  N   . VAL A 1 210 ? 42.981  -17.744 -13.564 1.00 141.15 ? 210 VAL A N   1 
ATOM   1343  C  CA  . VAL A 1 210 ? 42.253  -16.590 -13.055 1.00 139.10 ? 210 VAL A CA  1 
ATOM   1344  C  C   . VAL A 1 210 ? 40.764  -16.907 -12.967 1.00 139.08 ? 210 VAL A C   1 
ATOM   1345  O  O   . VAL A 1 210 ? 40.210  -16.980 -11.878 1.00 137.33 ? 210 VAL A O   1 
ATOM   1346  C  CB  . VAL A 1 210 ? 42.475  -15.333 -13.924 1.00 139.35 ? 210 VAL A CB  1 
ATOM   1347  C  CG1 . VAL A 1 210 ? 41.611  -14.186 -13.428 1.00 138.96 ? 210 VAL A CG1 1 
ATOM   1348  C  CG2 . VAL A 1 210 ? 43.945  -14.936 -13.914 1.00 139.91 ? 210 VAL A CG2 1 
ATOM   1349  N  N   . LEU A 1 211 ? 40.133  -17.141 -14.115 1.00 141.35 ? 211 LEU A N   1 
ATOM   1350  C  CA  . LEU A 1 211 ? 38.677  -17.318 -14.181 1.00 142.35 ? 211 LEU A CA  1 
ATOM   1351  C  C   . LEU A 1 211 ? 38.187  -18.547 -13.431 1.00 140.52 ? 211 LEU A C   1 
ATOM   1352  O  O   . LEU A 1 211 ? 37.242  -18.474 -12.646 1.00 140.56 ? 211 LEU A O   1 
ATOM   1353  C  CB  . LEU A 1 211 ? 38.212  -17.412 -15.640 1.00 146.07 ? 211 LEU A CB  1 
ATOM   1354  C  CG  . LEU A 1 211 ? 37.552  -16.152 -16.197 1.00 147.99 ? 211 LEU A CG  1 
ATOM   1355  C  CD1 . LEU A 1 211 ? 38.590  -15.053 -16.408 1.00 146.67 ? 211 LEU A CD1 1 
ATOM   1356  C  CD2 . LEU A 1 211 ? 36.826  -16.478 -17.492 1.00 149.14 ? 211 LEU A CD2 1 
ATOM   1357  N  N   . THR A 1 212 ? 38.815  -19.683 -13.698 1.00 138.57 ? 212 THR A N   1 
ATOM   1358  C  CA  . THR A 1 212 ? 38.377  -20.933 -13.098 1.00 138.70 ? 212 THR A CA  1 
ATOM   1359  C  C   . THR A 1 212 ? 38.392  -20.840 -11.565 1.00 136.55 ? 212 THR A C   1 
ATOM   1360  O  O   . THR A 1 212 ? 37.391  -21.143 -10.922 1.00 135.95 ? 212 THR A O   1 
ATOM   1361  C  CB  . THR A 1 212 ? 39.236  -22.123 -13.578 1.00 138.75 ? 212 THR A CB  1 
ATOM   1362  O  OG1 . THR A 1 212 ? 39.241  -22.180 -15.014 1.00 137.80 ? 212 THR A OG1 1 
ATOM   1363  C  CG2 . THR A 1 212 ? 38.698  -23.429 -13.003 1.00 139.68 ? 212 THR A CG2 1 
ATOM   1364  N  N   . PRO A 1 213 ? 39.524  -20.407 -10.975 1.00 134.26 ? 213 PRO A N   1 
ATOM   1365  C  CA  . PRO A 1 213 ? 39.631  -20.282 -9.515  1.00 131.45 ? 213 PRO A CA  1 
ATOM   1366  C  C   . PRO A 1 213 ? 38.615  -19.334 -8.909  1.00 129.73 ? 213 PRO A C   1 
ATOM   1367  O  O   . PRO A 1 213 ? 38.054  -19.630 -7.861  1.00 130.66 ? 213 PRO A O   1 
ATOM   1368  C  CB  . PRO A 1 213 ? 41.039  -19.722 -9.308  1.00 130.57 ? 213 PRO A CB  1 
ATOM   1369  C  CG  . PRO A 1 213 ? 41.801  -20.195 -10.493 1.00 133.70 ? 213 PRO A CG  1 
ATOM   1370  C  CD  . PRO A 1 213 ? 40.824  -20.190 -11.636 1.00 134.66 ? 213 PRO A CD  1 
ATOM   1371  N  N   . THR A 1 214 ? 38.402  -18.189 -9.549  1.00 128.71 ? 214 THR A N   1 
ATOM   1372  C  CA  . THR A 1 214 ? 37.471  -17.191 -9.028  1.00 128.74 ? 214 THR A CA  1 
ATOM   1373  C  C   . THR A 1 214 ? 36.085  -17.786 -8.891  1.00 132.64 ? 214 THR A C   1 
ATOM   1374  O  O   . THR A 1 214 ? 35.413  -17.577 -7.886  1.00 132.30 ? 214 THR A O   1 
ATOM   1375  C  CB  . THR A 1 214 ? 37.377  -15.960 -9.941  1.00 128.20 ? 214 THR A CB  1 
ATOM   1376  O  OG1 . THR A 1 214 ? 37.047  -16.376 -11.271 1.00 128.98 ? 214 THR A OG1 1 
ATOM   1377  C  CG2 . THR A 1 214 ? 38.699  -15.199 -9.944  1.00 126.33 ? 214 THR A CG2 1 
ATOM   1378  N  N   . PHE A 1 215 ? 35.663  -18.530 -9.908  1.00 137.37 ? 215 PHE A N   1 
ATOM   1379  C  CA  . PHE A 1 215 ? 34.386  -19.232 -9.856  1.00 142.44 ? 215 PHE A CA  1 
ATOM   1380  C  C   . PHE A 1 215 ? 34.405  -20.306 -8.770  1.00 141.20 ? 215 PHE A C   1 
ATOM   1381  O  O   . PHE A 1 215 ? 33.422  -20.502 -8.066  1.00 141.81 ? 215 PHE A O   1 
ATOM   1382  C  CB  . PHE A 1 215 ? 34.053  -19.857 -11.215 1.00 147.52 ? 215 PHE A CB  1 
ATOM   1383  C  CG  . PHE A 1 215 ? 33.229  -18.970 -12.106 1.00 151.88 ? 215 PHE A CG  1 
ATOM   1384  C  CD1 . PHE A 1 215 ? 33.840  -18.034 -12.932 1.00 150.76 ? 215 PHE A CD1 1 
ATOM   1385  C  CD2 . PHE A 1 215 ? 31.843  -19.082 -12.130 1.00 156.27 ? 215 PHE A CD2 1 
ATOM   1386  C  CE1 . PHE A 1 215 ? 33.081  -17.219 -13.755 1.00 152.86 ? 215 PHE A CE1 1 
ATOM   1387  C  CE2 . PHE A 1 215 ? 31.081  -18.271 -12.952 1.00 158.50 ? 215 PHE A CE2 1 
ATOM   1388  C  CZ  . PHE A 1 215 ? 31.701  -17.337 -13.764 1.00 156.78 ? 215 PHE A CZ  1 
ATOM   1389  N  N   . VAL A 1 216 ? 35.531  -20.999 -8.640  1.00 139.42 ? 216 VAL A N   1 
ATOM   1390  C  CA  . VAL A 1 216 ? 35.695  -21.993 -7.586  1.00 139.10 ? 216 VAL A CA  1 
ATOM   1391  C  C   . VAL A 1 216 ? 35.515  -21.360 -6.206  1.00 137.95 ? 216 VAL A C   1 
ATOM   1392  O  O   . VAL A 1 216 ? 34.721  -21.837 -5.406  1.00 138.94 ? 216 VAL A O   1 
ATOM   1393  C  CB  . VAL A 1 216 ? 37.080  -22.669 -7.649  1.00 136.28 ? 216 VAL A CB  1 
ATOM   1394  C  CG1 . VAL A 1 216 ? 37.254  -23.627 -6.479  1.00 136.68 ? 216 VAL A CG1 1 
ATOM   1395  C  CG2 . VAL A 1 216 ? 37.270  -23.400 -8.972  1.00 137.23 ? 216 VAL A CG2 1 
ATOM   1396  N  N   . PHE A 1 217 ? 36.250  -20.283 -5.936  1.00 136.88 ? 217 PHE A N   1 
ATOM   1397  C  CA  . PHE A 1 217 ? 36.285  -19.679 -4.601  1.00 136.48 ? 217 PHE A CA  1 
ATOM   1398  C  C   . PHE A 1 217 ? 34.961  -19.027 -4.254  1.00 138.40 ? 217 PHE A C   1 
ATOM   1399  O  O   . PHE A 1 217 ? 34.536  -19.047 -3.101  1.00 135.96 ? 217 PHE A O   1 
ATOM   1400  C  CB  . PHE A 1 217 ? 37.390  -18.628 -4.511  1.00 136.05 ? 217 PHE A CB  1 
ATOM   1401  C  CG  . PHE A 1 217 ? 38.770  -19.200 -4.555  1.00 136.10 ? 217 PHE A CG  1 
ATOM   1402  C  CD1 . PHE A 1 217 ? 39.163  -20.155 -3.636  1.00 137.83 ? 217 PHE A CD1 1 
ATOM   1403  C  CD2 . PHE A 1 217 ? 39.678  -18.774 -5.509  1.00 136.74 ? 217 PHE A CD2 1 
ATOM   1404  C  CE1 . PHE A 1 217 ? 40.431  -20.690 -3.676  1.00 140.66 ? 217 PHE A CE1 1 
ATOM   1405  C  CE2 . PHE A 1 217 ? 40.949  -19.303 -5.559  1.00 137.65 ? 217 PHE A CE2 1 
ATOM   1406  C  CZ  . PHE A 1 217 ? 41.327  -20.261 -4.639  1.00 141.64 ? 217 PHE A CZ  1 
ATOM   1407  N  N   . CYS A 1 218 ? 34.344  -18.416 -5.261  1.00 141.93 ? 218 CYS A N   1 
ATOM   1408  C  CA  . CYS A 1 218 ? 32.978  -17.914 -5.169  1.00 148.04 ? 218 CYS A CA  1 
ATOM   1409  C  C   . CYS A 1 218 ? 32.133  -18.913 -4.390  1.00 155.08 ? 218 CYS A C   1 
ATOM   1410  O  O   . CYS A 1 218 ? 31.577  -18.587 -3.345  1.00 159.07 ? 218 CYS A O   1 
ATOM   1411  C  CB  . CYS A 1 218 ? 32.400  -17.734 -6.583  1.00 149.86 ? 218 CYS A CB  1 
ATOM   1412  S  SG  . CYS A 1 218 ? 31.004  -16.601 -6.791  1.00 148.04 ? 218 CYS A SG  1 
ATOM   1413  N  N   . TYR A 1 219 ? 32.077  -20.142 -4.895  1.00 158.57 ? 219 TYR A N   1 
ATOM   1414  C  CA  . TYR A 1 219 ? 31.206  -21.179 -4.346  1.00 164.36 ? 219 TYR A CA  1 
ATOM   1415  C  C   . TYR A 1 219 ? 31.735  -21.752 -3.033  1.00 161.54 ? 219 TYR A C   1 
ATOM   1416  O  O   . TYR A 1 219 ? 30.964  -22.084 -2.140  1.00 162.58 ? 219 TYR A O   1 
ATOM   1417  C  CB  . TYR A 1 219 ? 31.050  -22.301 -5.373  1.00 169.19 ? 219 TYR A CB  1 
ATOM   1418  C  CG  . TYR A 1 219 ? 29.994  -23.323 -5.041  1.00 177.88 ? 219 TYR A CG  1 
ATOM   1419  C  CD1 . TYR A 1 219 ? 28.652  -22.971 -4.997  1.00 184.94 ? 219 TYR A CD1 1 
ATOM   1420  C  CD2 . TYR A 1 219 ? 30.333  -24.653 -4.815  1.00 179.46 ? 219 TYR A CD2 1 
ATOM   1421  C  CE1 . TYR A 1 219 ? 27.679  -23.909 -4.711  1.00 191.63 ? 219 TYR A CE1 1 
ATOM   1422  C  CE2 . TYR A 1 219 ? 29.367  -25.598 -4.534  1.00 185.43 ? 219 TYR A CE2 1 
ATOM   1423  C  CZ  . TYR A 1 219 ? 28.042  -25.220 -4.483  1.00 192.15 ? 219 TYR A CZ  1 
ATOM   1424  O  OH  . TYR A 1 219 ? 27.076  -26.157 -4.204  1.00 199.17 ? 219 TYR A OH  1 
ATOM   1425  N  N   . MET A 1 220 ? 33.053  -21.865 -2.924  1.00 140.34 ? 220 MET A N   1 
ATOM   1426  C  CA  . MET A 1 220 ? 33.681  -22.546 -1.795  1.00 140.83 ? 220 MET A CA  1 
ATOM   1427  C  C   . MET A 1 220 ? 33.804  -21.663 -0.560  1.00 137.41 ? 220 MET A C   1 
ATOM   1428  O  O   . MET A 1 220 ? 33.681  -22.149 0.559   1.00 135.74 ? 220 MET A O   1 
ATOM   1429  C  CB  . MET A 1 220 ? 35.074  -23.043 -2.192  1.00 142.44 ? 220 MET A CB  1 
ATOM   1430  C  CG  . MET A 1 220 ? 35.063  -24.299 -3.044  1.00 147.48 ? 220 MET A CG  1 
ATOM   1431  S  SD  . MET A 1 220 ? 34.712  -25.786 -2.080  1.00 149.62 ? 220 MET A SD  1 
ATOM   1432  C  CE  . MET A 1 220 ? 34.233  -26.920 -3.384  1.00 154.80 ? 220 MET A CE  1 
ATOM   1433  N  N   . GLU A 1 221 ? 34.091  -20.380 -0.759  1.00 136.55 ? 221 GLU A N   1 
ATOM   1434  C  CA  . GLU A 1 221 ? 34.383  -19.483 0.356   1.00 138.52 ? 221 GLU A CA  1 
ATOM   1435  C  C   . GLU A 1 221 ? 33.196  -18.578 0.689   1.00 144.04 ? 221 GLU A C   1 
ATOM   1436  O  O   . GLU A 1 221 ? 33.241  -17.808 1.660   1.00 141.46 ? 221 GLU A O   1 
ATOM   1437  C  CB  . GLU A 1 221 ? 35.610  -18.630 0.031   1.00 136.29 ? 221 GLU A CB  1 
ATOM   1438  C  CG  . GLU A 1 221 ? 36.900  -19.426 -0.048  1.00 137.34 ? 221 GLU A CG  1 
ATOM   1439  C  CD  . GLU A 1 221 ? 37.330  -19.977 1.297   1.00 138.37 ? 221 GLU A CD  1 
ATOM   1440  O  OE1 . GLU A 1 221 ? 37.058  -19.323 2.328   1.00 135.25 ? 221 GLU A OE1 1 
ATOM   1441  O  OE2 . GLU A 1 221 ? 37.940  -21.068 1.322   1.00 141.97 ? 221 GLU A OE2 1 
ATOM   1442  N  N   . ASP A 1 222 ? 32.129  -18.701 -0.099  1.00 145.12 ? 222 ASP A N   1 
ATOM   1443  C  CA  . ASP A 1 222 ? 31.008  -17.768 -0.050  1.00 142.84 ? 222 ASP A CA  1 
ATOM   1444  C  C   . ASP A 1 222 ? 31.513  -16.328 -0.140  1.00 134.71 ? 222 ASP A C   1 
ATOM   1445  O  O   . ASP A 1 222 ? 31.185  -15.486 0.688   1.00 131.12 ? 222 ASP A O   1 
ATOM   1446  C  CB  . ASP A 1 222 ? 30.178  -17.987 1.219   1.00 150.03 ? 222 ASP A CB  1 
ATOM   1447  C  CG  . ASP A 1 222 ? 28.697  -17.735 1.002   1.00 160.63 ? 222 ASP A CG  1 
ATOM   1448  O  OD1 . ASP A 1 222 ? 28.217  -17.942 -0.131  1.00 169.93 ? 222 ASP A OD1 1 
ATOM   1449  O  OD2 . ASP A 1 222 ? 28.007  -17.356 1.972   1.00 168.22 ? 222 ASP A OD2 1 
ATOM   1450  N  N   . TRP A 1 223 ? 32.354  -16.072 -1.134  1.00 132.32 ? 223 TRP A N   1 
ATOM   1451  C  CA  . TRP A 1 223 ? 32.749  -14.721 -1.499  1.00 126.71 ? 223 TRP A CA  1 
ATOM   1452  C  C   . TRP A 1 223 ? 31.932  -14.336 -2.718  1.00 131.00 ? 223 TRP A C   1 
ATOM   1453  O  O   . TRP A 1 223 ? 31.397  -15.206 -3.400  1.00 142.38 ? 223 TRP A O   1 
ATOM   1454  C  CB  . TRP A 1 223 ? 34.232  -14.686 -1.865  1.00 124.03 ? 223 TRP A CB  1 
ATOM   1455  C  CG  . TRP A 1 223 ? 35.166  -14.980 -0.726  1.00 121.67 ? 223 TRP A CG  1 
ATOM   1456  C  CD1 . TRP A 1 223 ? 34.907  -14.844 0.605   1.00 121.61 ? 223 TRP A CD1 1 
ATOM   1457  C  CD2 . TRP A 1 223 ? 36.529  -15.417 -0.826  1.00 118.63 ? 223 TRP A CD2 1 
ATOM   1458  N  NE1 . TRP A 1 223 ? 36.015  -15.188 1.342   1.00 118.42 ? 223 TRP A NE1 1 
ATOM   1459  C  CE2 . TRP A 1 223 ? 37.026  -15.543 0.488   1.00 116.65 ? 223 TRP A CE2 1 
ATOM   1460  C  CE3 . TRP A 1 223 ? 37.373  -15.719 -1.900  1.00 117.49 ? 223 TRP A CE3 1 
ATOM   1461  C  CZ2 . TRP A 1 223 ? 38.332  -15.957 0.758   1.00 114.76 ? 223 TRP A CZ2 1 
ATOM   1462  C  CZ3 . TRP A 1 223 ? 38.663  -16.129 -1.633  1.00 116.01 ? 223 TRP A CZ3 1 
ATOM   1463  C  CH2 . TRP A 1 223 ? 39.133  -16.243 -0.312  1.00 115.31 ? 223 TRP A CH2 1 
ATOM   1464  N  N   . SER A 1 224 ? 31.837  -13.043 -3.003  1.00 127.55 ? 224 SER A N   1 
ATOM   1465  C  CA  . SER A 1 224 ? 31.252  -12.596 -4.264  1.00 128.01 ? 224 SER A CA  1 
ATOM   1466  C  C   . SER A 1 224 ? 32.264  -12.797 -5.389  1.00 127.39 ? 224 SER A C   1 
ATOM   1467  O  O   . SER A 1 224 ? 33.458  -12.975 -5.139  1.00 117.59 ? 224 SER A O   1 
ATOM   1468  C  CB  . SER A 1 224 ? 30.839  -11.126 -4.179  1.00 126.09 ? 224 SER A CB  1 
ATOM   1469  O  OG  . SER A 1 224 ? 31.972  -10.289 -4.045  1.00 124.39 ? 224 SER A OG  1 
ATOM   1470  N  N   . LYS A 1 225 ? 31.789  -12.770 -6.628  1.00 134.89 ? 225 LYS A N   1 
ATOM   1471  C  CA  . LYS A 1 225 ? 32.691  -12.864 -7.756  1.00 140.00 ? 225 LYS A CA  1 
ATOM   1472  C  C   . LYS A 1 225 ? 33.795  -11.819 -7.599  1.00 139.76 ? 225 LYS A C   1 
ATOM   1473  O  O   . LYS A 1 225 ? 34.974  -12.137 -7.722  1.00 144.28 ? 225 LYS A O   1 
ATOM   1474  C  CB  . LYS A 1 225 ? 31.946  -12.692 -9.085  1.00 152.72 ? 225 LYS A CB  1 
ATOM   1475  C  CG  . LYS A 1 225 ? 31.318  -11.320 -9.308  1.00 167.41 ? 225 LYS A CG  1 
ATOM   1476  C  CD  . LYS A 1 225 ? 30.455  -11.308 -10.566 1.00 178.48 ? 225 LYS A CD  1 
ATOM   1477  C  CE  . LYS A 1 225 ? 30.078  -9.896  -10.999 1.00 176.69 ? 225 LYS A CE  1 
ATOM   1478  N  NZ  . LYS A 1 225 ? 28.782  -9.445  -10.425 1.00 175.65 ? 225 LYS A NZ  1 
ATOM   1479  N  N   . LEU A 1 226 ? 33.417  -10.584 -7.273  1.00 139.96 ? 226 LEU A N   1 
ATOM   1480  C  CA  . LEU A 1 226 ? 34.382  -9.486  -7.183  1.00 134.60 ? 226 LEU A CA  1 
ATOM   1481  C  C   . LEU A 1 226 ? 35.402  -9.727  -6.076  1.00 130.38 ? 226 LEU A C   1 
ATOM   1482  O  O   . LEU A 1 226 ? 36.587  -9.429  -6.239  1.00 133.49 ? 226 LEU A O   1 
ATOM   1483  C  CB  . LEU A 1 226 ? 33.664  -8.149  -6.959  1.00 133.17 ? 226 LEU A CB  1 
ATOM   1484  C  CG  . LEU A 1 226 ? 34.546  -6.898  -7.038  1.00 129.71 ? 226 LEU A CG  1 
ATOM   1485  C  CD1 . LEU A 1 226 ? 33.783  -5.738  -7.658  1.00 131.59 ? 226 LEU A CD1 1 
ATOM   1486  C  CD2 . LEU A 1 226 ? 35.089  -6.507  -5.670  1.00 125.90 ? 226 LEU A CD2 1 
ATOM   1487  N  N   . GLU A 1 227 ? 34.936  -10.256 -4.950  1.00 128.99 ? 227 GLU A N   1 
ATOM   1488  C  CA  . GLU A 1 227 ? 35.825  -10.589 -3.844  1.00 128.88 ? 227 GLU A CA  1 
ATOM   1489  C  C   . GLU A 1 227 ? 36.814  -11.667 -4.280  1.00 132.94 ? 227 GLU A C   1 
ATOM   1490  O  O   . GLU A 1 227 ? 38.008  -11.591 -3.975  1.00 136.58 ? 227 GLU A O   1 
ATOM   1491  C  CB  . GLU A 1 227 ? 35.017  -11.065 -2.636  1.00 131.94 ? 227 GLU A CB  1 
ATOM   1492  C  CG  . GLU A 1 227 ? 34.335  -9.944  -1.862  1.00 134.55 ? 227 GLU A CG  1 
ATOM   1493  C  CD  . GLU A 1 227 ? 33.406  -10.448 -0.767  1.00 134.40 ? 227 GLU A CD  1 
ATOM   1494  O  OE1 . GLU A 1 227 ? 32.529  -11.291 -1.057  1.00 134.10 ? 227 GLU A OE1 1 
ATOM   1495  O  OE2 . GLU A 1 227 ? 33.534  -9.985  0.386   1.00 130.81 ? 227 GLU A OE2 1 
ATOM   1496  N  N   . ALA A 1 228 ? 36.312  -12.642 -5.036  1.00 133.24 ? 228 ALA A N   1 
ATOM   1497  C  CA  . ALA A 1 228 ? 37.115  -13.776 -5.481  1.00 129.02 ? 228 ALA A CA  1 
ATOM   1498  C  C   . ALA A 1 228 ? 38.226  -13.362 -6.446  1.00 125.77 ? 228 ALA A C   1 
ATOM   1499  O  O   . ALA A 1 228 ? 39.375  -13.789 -6.292  1.00 124.34 ? 228 ALA A O   1 
ATOM   1500  C  CB  . ALA A 1 228 ? 36.223  -14.824 -6.122  1.00 131.84 ? 228 ALA A CB  1 
ATOM   1501  N  N   . ILE A 1 229 ? 37.886  -12.542 -7.440  1.00 120.27 ? 229 ILE A N   1 
ATOM   1502  C  CA  . ILE A 1 229 ? 38.884  -12.051 -8.388  1.00 117.23 ? 229 ILE A CA  1 
ATOM   1503  C  C   . ILE A 1 229 ? 39.893  -11.182 -7.658  1.00 112.75 ? 229 ILE A C   1 
ATOM   1504  O  O   . ILE A 1 229 ? 41.102  -11.308 -7.862  1.00 118.79 ? 229 ILE A O   1 
ATOM   1505  C  CB  . ILE A 1 229 ? 38.261  -11.233 -9.530  1.00 117.93 ? 229 ILE A CB  1 
ATOM   1506  C  CG1 . ILE A 1 229 ? 37.311  -12.108 -10.351 1.00 126.34 ? 229 ILE A CG1 1 
ATOM   1507  C  CG2 . ILE A 1 229 ? 39.355  -10.688 -10.436 1.00 115.75 ? 229 ILE A CG2 1 
ATOM   1508  C  CD1 . ILE A 1 229 ? 36.410  -11.343 -11.303 1.00 130.99 ? 229 ILE A CD1 1 
ATOM   1509  N  N   . TYR A 1 230 ? 39.388  -10.310 -6.796  1.00 109.36 ? 230 TYR A N   1 
ATOM   1510  C  CA  . TYR A 1 230 ? 40.244  -9.502  -5.945  1.00 105.66 ? 230 TYR A CA  1 
ATOM   1511  C  C   . TYR A 1 230 ? 41.277  -10.401 -5.260  1.00 108.02 ? 230 TYR A C   1 
ATOM   1512  O  O   . TYR A 1 230 ? 42.486  -10.168 -5.355  1.00 101.16 ? 230 TYR A O   1 
ATOM   1513  C  CB  . TYR A 1 230 ? 39.396  -8.762  -4.911  1.00 101.65 ? 230 TYR A CB  1 
ATOM   1514  C  CG  . TYR A 1 230 ? 40.200  -7.997  -3.895  1.00 99.48  ? 230 TYR A CG  1 
ATOM   1515  C  CD1 . TYR A 1 230 ? 40.828  -6.808  -4.235  1.00 101.15 ? 230 TYR A CD1 1 
ATOM   1516  C  CD2 . TYR A 1 230 ? 40.323  -8.456  -2.586  1.00 99.11  ? 230 TYR A CD2 1 
ATOM   1517  C  CE1 . TYR A 1 230 ? 41.568  -6.102  -3.304  1.00 103.91 ? 230 TYR A CE1 1 
ATOM   1518  C  CE2 . TYR A 1 230 ? 41.054  -7.754  -1.644  1.00 99.42  ? 230 TYR A CE2 1 
ATOM   1519  C  CZ  . TYR A 1 230 ? 41.680  -6.580  -2.007  1.00 102.51 ? 230 TYR A CZ  1 
ATOM   1520  O  OH  . TYR A 1 230 ? 42.417  -5.881  -1.078  1.00 100.53 ? 230 TYR A OH  1 
ATOM   1521  N  N   . PHE A 1 231 ? 40.794  -11.454 -4.607  1.00 113.46 ? 231 PHE A N   1 
ATOM   1522  C  CA  . PHE A 1 231 ? 41.666  -12.387 -3.901  1.00 113.76 ? 231 PHE A CA  1 
ATOM   1523  C  C   . PHE A 1 231 ? 42.673  -13.020 -4.841  1.00 111.52 ? 231 PHE A C   1 
ATOM   1524  O  O   . PHE A 1 231 ? 43.884  -12.957 -4.610  1.00 113.69 ? 231 PHE A O   1 
ATOM   1525  C  CB  . PHE A 1 231 ? 40.854  -13.499 -3.246  1.00 117.74 ? 231 PHE A CB  1 
ATOM   1526  C  CG  . PHE A 1 231 ? 41.693  -14.652 -2.786  1.00 117.75 ? 231 PHE A CG  1 
ATOM   1527  C  CD1 . PHE A 1 231 ? 42.609  -14.485 -1.758  1.00 113.79 ? 231 PHE A CD1 1 
ATOM   1528  C  CD2 . PHE A 1 231 ? 41.587  -15.894 -3.395  1.00 120.82 ? 231 PHE A CD2 1 
ATOM   1529  C  CE1 . PHE A 1 231 ? 43.392  -15.540 -1.329  1.00 116.74 ? 231 PHE A CE1 1 
ATOM   1530  C  CE2 . PHE A 1 231 ? 42.364  -16.955 -2.967  1.00 122.32 ? 231 PHE A CE2 1 
ATOM   1531  C  CZ  . PHE A 1 231 ? 43.271  -16.777 -1.934  1.00 119.02 ? 231 PHE A CZ  1 
ATOM   1532  N  N   . VAL A 1 232 ? 42.157  -13.654 -5.888  1.00 109.60 ? 232 VAL A N   1 
ATOM   1533  C  CA  . VAL A 1 232 ? 42.996  -14.291 -6.892  1.00 108.35 ? 232 VAL A CA  1 
ATOM   1534  C  C   . VAL A 1 232 ? 44.168  -13.401 -7.296  1.00 108.25 ? 232 VAL A C   1 
ATOM   1535  O  O   . VAL A 1 232 ? 45.331  -13.813 -7.212  1.00 101.40 ? 232 VAL A O   1 
ATOM   1536  C  CB  . VAL A 1 232 ? 42.184  -14.626 -8.152  1.00 107.22 ? 232 VAL A CB  1 
ATOM   1537  C  CG1 . VAL A 1 232 ? 43.091  -14.674 -9.369  1.00 107.48 ? 232 VAL A CG1 1 
ATOM   1538  C  CG2 . VAL A 1 232 ? 41.452  -15.944 -7.963  1.00 109.57 ? 232 VAL A CG2 1 
ATOM   1539  N  N   . ILE A 1 233 ? 43.856  -12.177 -7.720  1.00 107.96 ? 233 ILE A N   1 
ATOM   1540  C  CA  . ILE A 1 233 ? 44.867  -11.293 -8.278  1.00 105.49 ? 233 ILE A CA  1 
ATOM   1541  C  C   . ILE A 1 233 ? 45.798  -10.735 -7.213  1.00 102.74 ? 233 ILE A C   1 
ATOM   1542  O  O   . ILE A 1 233 ? 47.014  -10.729 -7.399  1.00 106.76 ? 233 ILE A O   1 
ATOM   1543  C  CB  . ILE A 1 233 ? 44.234  -10.160 -9.083  1.00 106.65 ? 233 ILE A CB  1 
ATOM   1544  C  CG1 . ILE A 1 233 ? 43.871  -10.683 -10.470 1.00 114.24 ? 233 ILE A CG1 1 
ATOM   1545  C  CG2 . ILE A 1 233 ? 45.190  -8.985  -9.196  1.00 105.78 ? 233 ILE A CG2 1 
ATOM   1546  C  CD1 . ILE A 1 233 ? 43.364  -9.611  -11.410 1.00 122.71 ? 233 ILE A CD1 1 
ATOM   1547  N  N   . VAL A 1 234 ? 45.245  -10.327 -6.076  1.00 99.40  ? 234 VAL A N   1 
ATOM   1548  C  CA  . VAL A 1 234 ? 46.083  -9.932  -4.947  1.00 100.48 ? 234 VAL A CA  1 
ATOM   1549  C  C   . VAL A 1 234 ? 47.085  -11.038 -4.613  1.00 100.27 ? 234 VAL A C   1 
ATOM   1550  O  O   . VAL A 1 234 ? 48.205  -10.766 -4.159  1.00 97.08  ? 234 VAL A O   1 
ATOM   1551  C  CB  . VAL A 1 234 ? 45.249  -9.625  -3.688  1.00 102.62 ? 234 VAL A CB  1 
ATOM   1552  C  CG1 . VAL A 1 234 ? 46.160  -9.452  -2.474  1.00 102.84 ? 234 VAL A CG1 1 
ATOM   1553  C  CG2 . VAL A 1 234 ? 44.403  -8.380  -3.901  1.00 104.12 ? 234 VAL A CG2 1 
ATOM   1554  N  N   . THR A 1 235 ? 46.675  -12.280 -4.857  1.00 102.16 ? 235 THR A N   1 
ATOM   1555  C  CA  . THR A 1 235 ? 47.491  -13.442 -4.540  1.00 105.66 ? 235 THR A CA  1 
ATOM   1556  C  C   . THR A 1 235 ? 48.580  -13.675 -5.585  1.00 106.50 ? 235 THR A C   1 
ATOM   1557  O  O   . THR A 1 235 ? 49.757  -13.829 -5.245  1.00 107.15 ? 235 THR A O   1 
ATOM   1558  C  CB  . THR A 1 235 ? 46.630  -14.714 -4.434  1.00 107.41 ? 235 THR A CB  1 
ATOM   1559  O  OG1 . THR A 1 235 ? 45.548  -14.492 -3.525  1.00 104.22 ? 235 THR A OG1 1 
ATOM   1560  C  CG2 . THR A 1 235 ? 47.471  -15.890 -3.952  1.00 110.66 ? 235 THR A CG2 1 
ATOM   1561  N  N   . LEU A 1 236 ? 48.190  -13.696 -6.854  1.00 106.07 ? 236 LEU A N   1 
ATOM   1562  C  CA  . LEU A 1 236 ? 49.112  -14.079 -7.916  1.00 111.19 ? 236 LEU A CA  1 
ATOM   1563  C  C   . LEU A 1 236 ? 50.136  -12.985 -8.207  1.00 110.65 ? 236 LEU A C   1 
ATOM   1564  O  O   . LEU A 1 236 ? 51.218  -13.258 -8.718  1.00 115.76 ? 236 LEU A O   1 
ATOM   1565  C  CB  . LEU A 1 236 ? 48.344  -14.450 -9.182  1.00 116.16 ? 236 LEU A CB  1 
ATOM   1566  C  CG  . LEU A 1 236 ? 47.427  -15.675 -9.049  1.00 118.42 ? 236 LEU A CG  1 
ATOM   1567  C  CD1 . LEU A 1 236 ? 46.877  -16.092 -10.406 1.00 121.68 ? 236 LEU A CD1 1 
ATOM   1568  C  CD2 . LEU A 1 236 ? 48.150  -16.843 -8.388  1.00 119.00 ? 236 LEU A CD2 1 
ATOM   1569  N  N   . THR A 1 237 ? 49.804  -11.755 -7.841  1.00 106.56 ? 237 THR A N   1 
ATOM   1570  C  CA  . THR A 1 237 ? 50.756  -10.654 -7.891  1.00 107.04 ? 237 THR A CA  1 
ATOM   1571  C  C   . THR A 1 237 ? 51.724  -10.689 -6.706  1.00 104.74 ? 237 THR A C   1 
ATOM   1572  O  O   . THR A 1 237 ? 52.684  -9.919  -6.655  1.00 108.84 ? 237 THR A O   1 
ATOM   1573  C  CB  . THR A 1 237 ? 50.012  -9.317  -7.863  1.00 107.46 ? 237 THR A CB  1 
ATOM   1574  O  OG1 . THR A 1 237 ? 49.002  -9.363  -6.847  1.00 111.90 ? 237 THR A OG1 1 
ATOM   1575  C  CG2 . THR A 1 237 ? 49.356  -9.057  -9.199  1.00 109.15 ? 237 THR A CG2 1 
ATOM   1576  N  N   . THR A 1 238 ? 51.456  -11.582 -5.758  1.00 101.97 ? 238 THR A N   1 
ATOM   1577  C  CA  . THR A 1 238 ? 52.236  -11.698 -4.521  1.00 101.22 ? 238 THR A CA  1 
ATOM   1578  C  C   . THR A 1 238 ? 52.124  -10.470 -3.624  1.00 95.24  ? 238 THR A C   1 
ATOM   1579  O  O   . THR A 1 238 ? 52.964  -10.250 -2.752  1.00 87.25  ? 238 THR A O   1 
ATOM   1580  C  CB  . THR A 1 238 ? 53.733  -11.968 -4.782  1.00 104.78 ? 238 THR A CB  1 
ATOM   1581  O  OG1 . THR A 1 238 ? 54.430  -10.722 -4.951  1.00 97.48  ? 238 THR A OG1 1 
ATOM   1582  C  CG2 . THR A 1 238 ? 53.921  -12.870 -6.007  1.00 108.83 ? 238 THR A CG2 1 
ATOM   1583  N  N   . VAL A 1 239 ? 51.071  -9.687  -3.814  1.00 94.53  ? 239 VAL A N   1 
ATOM   1584  C  CA  . VAL A 1 239 ? 50.820  -8.578  -2.918  1.00 97.57  ? 239 VAL A CA  1 
ATOM   1585  C  C   . VAL A 1 239 ? 50.440  -9.132  -1.556  1.00 97.32  ? 239 VAL A C   1 
ATOM   1586  O  O   . VAL A 1 239 ? 51.019  -8.758  -0.539  1.00 96.01  ? 239 VAL A O   1 
ATOM   1587  C  CB  . VAL A 1 239 ? 49.692  -7.671  -3.420  1.00 100.83 ? 239 VAL A CB  1 
ATOM   1588  C  CG1 . VAL A 1 239 ? 49.525  -6.487  -2.478  1.00 101.83 ? 239 VAL A CG1 1 
ATOM   1589  C  CG2 . VAL A 1 239 ? 49.985  -7.184  -4.830  1.00 105.16 ? 239 VAL A CG2 1 
ATOM   1590  N  N   . GLY A 1 240 ? 49.467  -10.036 -1.540  1.00 96.00  ? 240 GLY A N   1 
ATOM   1591  C  CA  . GLY A 1 240 ? 49.132  -10.759 -0.322  1.00 96.79  ? 240 GLY A CA  1 
ATOM   1592  C  C   . GLY A 1 240 ? 48.732  -9.845  0.816   1.00 92.90  ? 240 GLY A C   1 
ATOM   1593  O  O   . GLY A 1 240 ? 49.352  -9.846  1.881   1.00 87.25  ? 240 GLY A O   1 
ATOM   1594  N  N   . PHE A 1 241 ? 47.690  -9.057  0.588   1.00 93.69  ? 241 PHE A N   1 
ATOM   1595  C  CA  . PHE A 1 241 ? 47.164  -8.190  1.626   1.00 95.27  ? 241 PHE A CA  1 
ATOM   1596  C  C   . PHE A 1 241 ? 46.828  -9.011  2.855   1.00 94.34  ? 241 PHE A C   1 
ATOM   1597  O  O   . PHE A 1 241 ? 47.334  -8.747  3.941   1.00 93.20  ? 241 PHE A O   1 
ATOM   1598  C  CB  . PHE A 1 241 ? 45.912  -7.471  1.136   1.00 97.49  ? 241 PHE A CB  1 
ATOM   1599  C  CG  . PHE A 1 241 ? 46.193  -6.252  0.301   1.00 103.56 ? 241 PHE A CG  1 
ATOM   1600  C  CD1 . PHE A 1 241 ? 47.182  -5.346  0.671   1.00 106.10 ? 241 PHE A CD1 1 
ATOM   1601  C  CD2 . PHE A 1 241 ? 45.430  -5.979  -0.828  1.00 105.98 ? 241 PHE A CD2 1 
ATOM   1602  C  CE1 . PHE A 1 241 ? 47.423  -4.212  -0.087  1.00 107.62 ? 241 PHE A CE1 1 
ATOM   1603  C  CE2 . PHE A 1 241 ? 45.662  -4.844  -1.586  1.00 105.12 ? 241 PHE A CE2 1 
ATOM   1604  C  CZ  . PHE A 1 241 ? 46.663  -3.962  -1.217  1.00 107.02 ? 241 PHE A CZ  1 
ATOM   1605  N  N   . GLY A 1 242 ? 45.979  -10.018 2.672   1.00 96.24  ? 242 GLY A N   1 
ATOM   1606  C  CA  . GLY A 1 242 ? 45.573  -10.889 3.767   1.00 99.47  ? 242 GLY A CA  1 
ATOM   1607  C  C   . GLY A 1 242 ? 44.164  -10.626 4.267   1.00 99.44  ? 242 GLY A C   1 
ATOM   1608  O  O   . GLY A 1 242 ? 43.711  -11.263 5.216   1.00 103.73 ? 242 GLY A O   1 
ATOM   1609  N  N   . ASP A 1 243 ? 43.470  -9.683  3.639   1.00 101.44 ? 243 ASP A N   1 
ATOM   1610  C  CA  . ASP A 1 243 ? 42.051  -9.473  3.924   1.00 106.18 ? 243 ASP A CA  1 
ATOM   1611  C  C   . ASP A 1 243 ? 41.192  -10.631 3.377   1.00 108.29 ? 243 ASP A C   1 
ATOM   1612  O  O   . ASP A 1 243 ? 40.057  -10.855 3.821   1.00 107.54 ? 243 ASP A O   1 
ATOM   1613  C  CB  . ASP A 1 243 ? 41.571  -8.113  3.384   1.00 107.11 ? 243 ASP A CB  1 
ATOM   1614  C  CG  . ASP A 1 243 ? 42.025  -7.841  1.955   1.00 107.10 ? 243 ASP A CG  1 
ATOM   1615  O  OD1 . ASP A 1 243 ? 42.660  -8.731  1.346   1.00 112.92 ? 243 ASP A OD1 1 
ATOM   1616  O  OD2 . ASP A 1 243 ? 41.734  -6.736  1.443   1.00 100.22 ? 243 ASP A OD2 1 
ATOM   1617  N  N   . TYR A 1 244 ? 41.740  -11.365 2.414   1.00 105.70 ? 244 TYR A N   1 
ATOM   1618  C  CA  . TYR A 1 244 ? 41.118  -12.596 1.941   1.00 106.66 ? 244 TYR A CA  1 
ATOM   1619  C  C   . TYR A 1 244 ? 42.153  -13.716 1.812   1.00 105.66 ? 244 TYR A C   1 
ATOM   1620  O  O   . TYR A 1 244 ? 43.223  -13.516 1.242   1.00 103.26 ? 244 TYR A O   1 
ATOM   1621  C  CB  . TYR A 1 244 ? 40.444  -12.352 0.596   1.00 105.56 ? 244 TYR A CB  1 
ATOM   1622  C  CG  . TYR A 1 244 ? 39.225  -11.466 0.681   1.00 106.60 ? 244 TYR A CG  1 
ATOM   1623  C  CD1 . TYR A 1 244 ? 39.345  -10.105 0.909   1.00 107.43 ? 244 TYR A CD1 1 
ATOM   1624  C  CD2 . TYR A 1 244 ? 37.950  -11.990 0.510   1.00 112.51 ? 244 TYR A CD2 1 
ATOM   1625  C  CE1 . TYR A 1 244 ? 38.227  -9.289  0.968   1.00 110.64 ? 244 TYR A CE1 1 
ATOM   1626  C  CE2 . TYR A 1 244 ? 36.827  -11.182 0.563   1.00 112.25 ? 244 TYR A CE2 1 
ATOM   1627  C  CZ  . TYR A 1 244 ? 36.973  -9.833  0.795   1.00 109.92 ? 244 TYR A CZ  1 
ATOM   1628  O  OH  . TYR A 1 244 ? 35.867  -9.023  0.853   1.00 106.55 ? 244 TYR A OH  1 
ATOM   1629  N  N   . VAL A 1 245 ? 41.819  -14.892 2.340   1.00 103.04 ? 245 VAL A N   1 
ATOM   1630  C  CA  . VAL A 1 245 ? 42.723  -16.033 2.345   1.00 101.27 ? 245 VAL A CA  1 
ATOM   1631  C  C   . VAL A 1 245 ? 41.915  -17.317 2.195   1.00 105.68 ? 245 VAL A C   1 
ATOM   1632  O  O   . VAL A 1 245 ? 40.952  -17.519 2.928   1.00 109.04 ? 245 VAL A O   1 
ATOM   1633  C  CB  . VAL A 1 245 ? 43.521  -16.099 3.661   1.00 101.20 ? 245 VAL A CB  1 
ATOM   1634  C  CG1 . VAL A 1 245 ? 44.566  -17.208 3.605   1.00 106.91 ? 245 VAL A CG1 1 
ATOM   1635  C  CG2 . VAL A 1 245 ? 44.182  -14.760 3.957   1.00 98.33  ? 245 VAL A CG2 1 
ATOM   1636  N  N   . ALA A 1 246 ? 42.309  -18.175 1.249   1.00 112.11 ? 246 ALA A N   1 
ATOM   1637  C  CA  . ALA A 1 246 ? 41.601  -19.435 0.976   1.00 118.44 ? 246 ALA A CA  1 
ATOM   1638  C  C   . ALA A 1 246 ? 42.106  -20.640 1.780   1.00 122.19 ? 246 ALA A C   1 
ATOM   1639  O  O   . ALA A 1 246 ? 41.376  -21.181 2.617   1.00 120.97 ? 246 ALA A O   1 
ATOM   1640  C  CB  . ALA A 1 246 ? 41.665  -19.771 -0.508  1.00 119.11 ? 246 ALA A CB  1 
ATOM   1641  N  N   . GLY A 1 247 ? 43.337  -21.077 1.497   1.00 121.54 ? 247 GLY A N   1 
ATOM   1642  C  CA  . GLY A 1 247 ? 43.738  -22.472 1.734   1.00 124.97 ? 247 GLY A CA  1 
ATOM   1643  C  C   . GLY A 1 247 ? 44.481  -22.778 3.025   1.00 125.91 ? 247 GLY A C   1 
ATOM   1644  O  O   . GLY A 1 247 ? 45.142  -23.811 3.131   1.00 120.70 ? 247 GLY A O   1 
ATOM   1645  N  N   . ALA A 1 248 ? 44.348  -21.900 4.015   1.00 129.82 ? 248 ALA A N   1 
ATOM   1646  C  CA  . ALA A 1 248 ? 45.060  -22.034 5.289   1.00 135.94 ? 248 ALA A CA  1 
ATOM   1647  C  C   . ALA A 1 248 ? 44.655  -23.278 6.099   1.00 148.10 ? 248 ALA A C   1 
ATOM   1648  O  O   . ALA A 1 248 ? 45.482  -23.839 6.826   1.00 144.92 ? 248 ALA A O   1 
ATOM   1649  C  CB  . ALA A 1 248 ? 44.869  -20.770 6.121   1.00 135.91 ? 248 ALA A CB  1 
ATOM   1650  N  N   . ASP A 1 249 ? 43.389  -23.690 5.979   1.00 163.85 ? 249 ASP A N   1 
ATOM   1651  C  CA  . ASP A 1 249 ? 42.865  -24.885 6.667   1.00 174.08 ? 249 ASP A CA  1 
ATOM   1652  C  C   . ASP A 1 249 ? 42.056  -25.799 5.727   1.00 174.63 ? 249 ASP A C   1 
ATOM   1653  O  O   . ASP A 1 249 ? 41.424  -25.321 4.778   1.00 162.64 ? 249 ASP A O   1 
ATOM   1654  C  CB  . ASP A 1 249 ? 41.993  -24.471 7.865   1.00 174.17 ? 249 ASP A CB  1 
ATOM   1655  C  CG  . ASP A 1 249 ? 42.695  -24.659 9.199   1.00 178.34 ? 249 ASP A CG  1 
ATOM   1656  O  OD1 . ASP A 1 249 ? 43.936  -24.525 9.244   1.00 174.66 ? 249 ASP A OD1 1 
ATOM   1657  O  OD2 . ASP A 1 249 ? 42.005  -24.944 10.204  1.00 183.78 ? 249 ASP A OD2 1 
ATOM   1658  N  N   . PRO A 1 250 ? 42.074  -27.121 6.000   1.00 177.69 ? 250 PRO A N   1 
ATOM   1659  C  CA  . PRO A 1 250 ? 41.396  -28.119 5.179   1.00 176.77 ? 250 PRO A CA  1 
ATOM   1660  C  C   . PRO A 1 250 ? 39.902  -28.165 5.460   1.00 178.46 ? 250 PRO A C   1 
ATOM   1661  O  O   . PRO A 1 250 ? 39.472  -27.835 6.568   1.00 177.32 ? 250 PRO A O   1 
ATOM   1662  C  CB  . PRO A 1 250 ? 42.061  -29.433 5.595   1.00 178.63 ? 250 PRO A CB  1 
ATOM   1663  C  CG  . PRO A 1 250 ? 42.540  -29.207 6.987   1.00 179.37 ? 250 PRO A CG  1 
ATOM   1664  C  CD  . PRO A 1 250 ? 42.709  -27.724 7.184   1.00 177.91 ? 250 PRO A CD  1 
ATOM   1665  N  N   . ARG A 1 251 ? 39.125  -28.569 4.459   1.00 180.11 ? 251 ARG A N   1 
ATOM   1666  C  CA  . ARG A 1 251 ? 37.673  -28.574 4.559   1.00 181.27 ? 251 ARG A CA  1 
ATOM   1667  C  C   . ARG A 1 251 ? 37.126  -29.994 4.527   1.00 180.07 ? 251 ARG A C   1 
ATOM   1668  O  O   . ARG A 1 251 ? 37.276  -30.703 3.533   1.00 188.80 ? 251 ARG A O   1 
ATOM   1669  C  CB  . ARG A 1 251 ? 37.064  -27.762 3.416   1.00 183.46 ? 251 ARG A CB  1 
ATOM   1670  C  CG  . ARG A 1 251 ? 35.567  -27.520 3.561   1.00 189.62 ? 251 ARG A CG  1 
ATOM   1671  C  CD  . ARG A 1 251 ? 35.271  -26.120 4.092   1.00 185.53 ? 251 ARG A CD  1 
ATOM   1672  N  NE  . ARG A 1 251 ? 35.485  -25.100 3.069   1.00 180.91 ? 251 ARG A NE  1 
ATOM   1673  C  CZ  . ARG A 1 251 ? 34.693  -24.920 2.015   1.00 184.68 ? 251 ARG A CZ  1 
ATOM   1674  N  NH1 . ARG A 1 251 ? 33.623  -25.689 1.842   1.00 193.64 ? 251 ARG A NH1 1 
ATOM   1675  N  NH2 . ARG A 1 251 ? 34.968  -23.970 1.131   1.00 176.02 ? 251 ARG A NH2 1 
ATOM   1676  N  N   . GLN A 1 252 ? 36.495  -30.406 5.621   1.00 177.68 ? 252 GLN A N   1 
ATOM   1677  C  CA  . GLN A 1 252 ? 35.803  -31.689 5.668   1.00 183.73 ? 252 GLN A CA  1 
ATOM   1678  C  C   . GLN A 1 252 ? 34.664  -31.720 4.638   1.00 189.35 ? 252 GLN A C   1 
ATOM   1679  O  O   . GLN A 1 252 ? 33.942  -30.733 4.462   1.00 185.18 ? 252 GLN A O   1 
ATOM   1680  C  CB  . GLN A 1 252 ? 35.268  -31.948 7.078   1.00 185.09 ? 252 GLN A CB  1 
ATOM   1681  C  CG  . GLN A 1 252 ? 33.951  -31.251 7.381   1.00 184.73 ? 252 GLN A CG  1 
ATOM   1682  C  CD  . GLN A 1 252 ? 33.312  -31.751 8.655   1.00 190.30 ? 252 GLN A CD  1 
ATOM   1683  O  OE1 . GLN A 1 252 ? 33.891  -32.563 9.374   1.00 195.67 ? 252 GLN A OE1 1 
ATOM   1684  N  NE2 . GLN A 1 252 ? 32.102  -31.283 8.933   1.00 191.91 ? 252 GLN A NE2 1 
ATOM   1685  N  N   . ASP A 1 253 ? 34.535  -32.849 3.941   1.00 197.50 ? 253 ASP A N   1 
ATOM   1686  C  CA  . ASP A 1 253 ? 33.526  -33.036 2.885   1.00 200.86 ? 253 ASP A CA  1 
ATOM   1687  C  C   . ASP A 1 253 ? 34.044  -32.567 1.523   1.00 190.24 ? 253 ASP A C   1 
ATOM   1688  O  O   . ASP A 1 253 ? 33.338  -32.636 0.516   1.00 186.80 ? 253 ASP A O   1 
ATOM   1689  C  CB  . ASP A 1 253 ? 32.216  -32.313 3.220   1.00 205.47 ? 253 ASP A CB  1 
ATOM   1690  C  CG  . ASP A 1 253 ? 31.691  -32.659 4.607   1.00 210.67 ? 253 ASP A CG  1 
ATOM   1691  O  OD1 . ASP A 1 253 ? 31.700  -33.855 4.974   1.00 209.31 ? 253 ASP A OD1 1 
ATOM   1692  O  OD2 . ASP A 1 253 ? 31.263  -31.730 5.326   1.00 210.04 ? 253 ASP A OD2 1 
ATOM   1693  N  N   . SER A 1 254 ? 35.277  -32.073 1.509   1.00 182.27 ? 254 SER A N   1 
ATOM   1694  C  CA  . SER A 1 254 ? 35.973  -31.749 0.272   1.00 178.07 ? 254 SER A CA  1 
ATOM   1695  C  C   . SER A 1 254 ? 37.488  -31.785 0.498   1.00 174.23 ? 254 SER A C   1 
ATOM   1696  O  O   . SER A 1 254 ? 38.119  -30.740 0.705   1.00 165.57 ? 254 SER A O   1 
ATOM   1697  C  CB  . SER A 1 254 ? 35.545  -30.373 -0.222  1.00 173.29 ? 254 SER A CB  1 
ATOM   1698  O  OG  . SER A 1 254 ? 34.221  -30.423 -0.723  1.00 176.87 ? 254 SER A OG  1 
ATOM   1699  N  N   . PRO A 1 255 ? 38.074  -32.996 0.476   1.00 175.11 ? 255 PRO A N   1 
ATOM   1700  C  CA  . PRO A 1 255 ? 39.491  -33.185 0.800   1.00 170.22 ? 255 PRO A CA  1 
ATOM   1701  C  C   . PRO A 1 255 ? 40.428  -32.577 -0.245  1.00 166.77 ? 255 PRO A C   1 
ATOM   1702  O  O   . PRO A 1 255 ? 41.404  -31.914 0.112   1.00 164.76 ? 255 PRO A O   1 
ATOM   1703  C  CB  . PRO A 1 255 ? 39.644  -34.708 0.847   1.00 177.17 ? 255 PRO A CB  1 
ATOM   1704  C  CG  . PRO A 1 255 ? 38.522  -35.246 0.025   1.00 182.64 ? 255 PRO A CG  1 
ATOM   1705  C  CD  . PRO A 1 255 ? 37.399  -34.264 0.135   1.00 180.42 ? 255 PRO A CD  1 
ATOM   1706  N  N   . ALA A 1 256 ? 40.120  -32.798 -1.521  1.00 167.32 ? 256 ALA A N   1 
ATOM   1707  C  CA  . ALA A 1 256 ? 40.948  -32.308 -2.628  1.00 164.01 ? 256 ALA A CA  1 
ATOM   1708  C  C   . ALA A 1 256 ? 41.099  -30.775 -2.668  1.00 161.82 ? 256 ALA A C   1 
ATOM   1709  O  O   . ALA A 1 256 ? 42.032  -30.253 -3.291  1.00 158.05 ? 256 ALA A O   1 
ATOM   1710  C  CB  . ALA A 1 256 ? 40.391  -32.823 -3.949  1.00 165.29 ? 256 ALA A CB  1 
ATOM   1711  N  N   . TYR A 1 257 ? 40.184  -30.060 -2.014  1.00 162.84 ? 257 TYR A N   1 
ATOM   1712  C  CA  . TYR A 1 257 ? 40.197  -28.594 -2.001  1.00 160.46 ? 257 TYR A CA  1 
ATOM   1713  C  C   . TYR A 1 257 ? 41.568  -28.018 -1.627  1.00 156.68 ? 257 TYR A C   1 
ATOM   1714  O  O   . TYR A 1 257 ? 42.219  -27.360 -2.449  1.00 150.84 ? 257 TYR A O   1 
ATOM   1715  C  CB  . TYR A 1 257 ? 39.109  -28.065 -1.048  1.00 161.66 ? 257 TYR A CB  1 
ATOM   1716  C  CG  . TYR A 1 257 ? 39.016  -26.545 -0.952  1.00 158.06 ? 257 TYR A CG  1 
ATOM   1717  C  CD1 . TYR A 1 257 ? 38.478  -25.787 -1.992  1.00 153.57 ? 257 TYR A CD1 1 
ATOM   1718  C  CD2 . TYR A 1 257 ? 39.450  -25.871 0.187   1.00 155.36 ? 257 TYR A CD2 1 
ATOM   1719  C  CE1 . TYR A 1 257 ? 38.397  -24.406 -1.908  1.00 147.43 ? 257 TYR A CE1 1 
ATOM   1720  C  CE2 . TYR A 1 257 ? 39.370  -24.491 0.281   1.00 148.94 ? 257 TYR A CE2 1 
ATOM   1721  C  CZ  . TYR A 1 257 ? 38.842  -23.762 -0.768  1.00 146.71 ? 257 TYR A CZ  1 
ATOM   1722  O  OH  . TYR A 1 257 ? 38.760  -22.389 -0.677  1.00 136.61 ? 257 TYR A OH  1 
ATOM   1723  N  N   . GLN A 1 258 ? 42.006  -28.275 -0.397  1.00 156.62 ? 258 GLN A N   1 
ATOM   1724  C  CA  . GLN A 1 258 ? 43.151  -27.564 0.182   1.00 157.22 ? 258 GLN A CA  1 
ATOM   1725  C  C   . GLN A 1 258 ? 44.448  -27.769 -0.593  1.00 157.51 ? 258 GLN A C   1 
ATOM   1726  O  O   . GLN A 1 258 ? 45.223  -26.821 -0.772  1.00 155.55 ? 258 GLN A O   1 
ATOM   1727  C  CB  . GLN A 1 258 ? 43.363  -27.976 1.644   1.00 164.71 ? 258 GLN A CB  1 
ATOM   1728  C  CG  . GLN A 1 258 ? 44.692  -27.504 2.230   1.00 166.37 ? 258 GLN A CG  1 
ATOM   1729  C  CD  . GLN A 1 258 ? 44.661  -27.342 3.740   1.00 174.17 ? 258 GLN A CD  1 
ATOM   1730  O  OE1 . GLN A 1 258 ? 44.585  -28.323 4.480   1.00 172.63 ? 258 GLN A OE1 1 
ATOM   1731  N  NE2 . GLN A 1 258 ? 44.747  -26.099 4.205   1.00 179.51 ? 258 GLN A NE2 1 
ATOM   1732  N  N   . PRO A 1 259 ? 44.716  -29.016 -1.014  1.00 160.50 ? 259 PRO A N   1 
ATOM   1733  C  CA  . PRO A 1 259 ? 45.904  -29.241 -1.837  1.00 156.87 ? 259 PRO A CA  1 
ATOM   1734  C  C   . PRO A 1 259 ? 45.780  -28.570 -3.201  1.00 151.62 ? 259 PRO A C   1 
ATOM   1735  O  O   . PRO A 1 259 ? 46.702  -27.877 -3.632  1.00 154.19 ? 259 PRO A O   1 
ATOM   1736  C  CB  . PRO A 1 259 ? 45.981  -30.767 -1.985  1.00 160.69 ? 259 PRO A CB  1 
ATOM   1737  C  CG  . PRO A 1 259 ? 44.804  -31.339 -1.277  1.00 163.98 ? 259 PRO A CG  1 
ATOM   1738  C  CD  . PRO A 1 259 ? 44.089  -30.260 -0.537  1.00 162.10 ? 259 PRO A CD  1 
ATOM   1739  N  N   . LEU A 1 260 ? 44.635  -28.740 -3.852  1.00 147.13 ? 260 LEU A N   1 
ATOM   1740  C  CA  . LEU A 1 260 ? 44.433  -28.166 -5.171  1.00 148.46 ? 260 LEU A CA  1 
ATOM   1741  C  C   . LEU A 1 260 ? 44.705  -26.660 -5.155  1.00 146.10 ? 260 LEU A C   1 
ATOM   1742  O  O   . LEU A 1 260 ? 45.282  -26.112 -6.104  1.00 146.68 ? 260 LEU A O   1 
ATOM   1743  C  CB  . LEU A 1 260 ? 43.022  -28.455 -5.672  1.00 152.03 ? 260 LEU A CB  1 
ATOM   1744  C  CG  . LEU A 1 260 ? 42.805  -28.047 -7.131  1.00 157.53 ? 260 LEU A CG  1 
ATOM   1745  C  CD1 . LEU A 1 260 ? 43.645  -28.918 -8.059  1.00 156.90 ? 260 LEU A CD1 1 
ATOM   1746  C  CD2 . LEU A 1 260 ? 41.334  -28.096 -7.514  1.00 160.69 ? 260 LEU A CD2 1 
ATOM   1747  N  N   . VAL A 1 261 ? 44.322  -25.998 -4.066  1.00 143.11 ? 261 VAL A N   1 
ATOM   1748  C  CA  . VAL A 1 261 ? 44.620  -24.577 -3.896  1.00 139.28 ? 261 VAL A CA  1 
ATOM   1749  C  C   . VAL A 1 261 ? 46.122  -24.294 -3.888  1.00 138.53 ? 261 VAL A C   1 
ATOM   1750  O  O   . VAL A 1 261 ? 46.575  -23.354 -4.542  1.00 142.72 ? 261 VAL A O   1 
ATOM   1751  C  CB  . VAL A 1 261 ? 44.002  -24.008 -2.607  1.00 137.15 ? 261 VAL A CB  1 
ATOM   1752  C  CG1 . VAL A 1 261 ? 44.477  -22.576 -2.369  1.00 133.04 ? 261 VAL A CG1 1 
ATOM   1753  C  CG2 . VAL A 1 261 ? 42.486  -24.051 -2.701  1.00 139.42 ? 261 VAL A CG2 1 
ATOM   1754  N  N   . TRP A 1 262 ? 46.889  -25.102 -3.157  1.00 136.92 ? 262 TRP A N   1 
ATOM   1755  C  CA  . TRP A 1 262 ? 48.346  -24.965 -3.147  1.00 132.87 ? 262 TRP A CA  1 
ATOM   1756  C  C   . TRP A 1 262 ? 48.878  -25.196 -4.552  1.00 134.58 ? 262 TRP A C   1 
ATOM   1757  O  O   . TRP A 1 262 ? 49.658  -24.396 -5.085  1.00 134.69 ? 262 TRP A O   1 
ATOM   1758  C  CB  . TRP A 1 262 ? 48.997  -25.985 -2.210  1.00 133.91 ? 262 TRP A CB  1 
ATOM   1759  C  CG  . TRP A 1 262 ? 48.567  -25.898 -0.789  1.00 132.28 ? 262 TRP A CG  1 
ATOM   1760  C  CD1 . TRP A 1 262 ? 48.016  -24.823 -0.164  1.00 129.36 ? 262 TRP A CD1 1 
ATOM   1761  C  CD2 . TRP A 1 262 ? 48.689  -26.925 0.205   1.00 135.37 ? 262 TRP A CD2 1 
ATOM   1762  N  NE1 . TRP A 1 262 ? 47.765  -25.121 1.155   1.00 130.03 ? 262 TRP A NE1 1 
ATOM   1763  C  CE2 . TRP A 1 262 ? 48.172  -26.405 1.407   1.00 134.74 ? 262 TRP A CE2 1 
ATOM   1764  C  CE3 . TRP A 1 262 ? 49.178  -28.237 0.193   1.00 139.96 ? 262 TRP A CE3 1 
ATOM   1765  C  CZ2 . TRP A 1 262 ? 48.127  -27.149 2.586   1.00 137.99 ? 262 TRP A CZ2 1 
ATOM   1766  C  CZ3 . TRP A 1 262 ? 49.129  -28.977 1.364   1.00 142.77 ? 262 TRP A CZ3 1 
ATOM   1767  C  CH2 . TRP A 1 262 ? 48.606  -28.431 2.543   1.00 141.85 ? 262 TRP A CH2 1 
ATOM   1768  N  N   . PHE A 1 263 ? 48.473  -26.324 -5.130  1.00 138.64 ? 263 PHE A N   1 
ATOM   1769  C  CA  . PHE A 1 263 ? 48.832  -26.658 -6.495  1.00 143.83 ? 263 PHE A CA  1 
ATOM   1770  C  C   . PHE A 1 263 ? 48.504  -25.480 -7.403  1.00 137.83 ? 263 PHE A C   1 
ATOM   1771  O  O   . PHE A 1 263 ? 49.311  -25.089 -8.245  1.00 137.08 ? 263 PHE A O   1 
ATOM   1772  C  CB  . PHE A 1 263 ? 48.084  -27.916 -6.951  1.00 150.79 ? 263 PHE A CB  1 
ATOM   1773  C  CG  . PHE A 1 263 ? 48.767  -28.655 -8.069  1.00 155.99 ? 263 PHE A CG  1 
ATOM   1774  C  CD1 . PHE A 1 263 ? 50.126  -28.933 -8.010  1.00 154.86 ? 263 PHE A CD1 1 
ATOM   1775  C  CD2 . PHE A 1 263 ? 48.049  -29.068 -9.184  1.00 160.55 ? 263 PHE A CD2 1 
ATOM   1776  C  CE1 . PHE A 1 263 ? 50.754  -29.604 -9.045  1.00 162.88 ? 263 PHE A CE1 1 
ATOM   1777  C  CE2 . PHE A 1 263 ? 48.672  -29.738 -10.222 1.00 165.23 ? 263 PHE A CE2 1 
ATOM   1778  C  CZ  . PHE A 1 263 ? 50.026  -30.007 -10.152 1.00 167.06 ? 263 PHE A CZ  1 
ATOM   1779  N  N   . TRP A 1 264 ? 47.335  -24.887 -7.191  1.00 132.32 ? 264 TRP A N   1 
ATOM   1780  C  CA  . TRP A 1 264 ? 46.919  -23.735 -7.977  1.00 129.77 ? 264 TRP A CA  1 
ATOM   1781  C  C   . TRP A 1 264 ? 47.871  -22.537 -7.837  1.00 129.54 ? 264 TRP A C   1 
ATOM   1782  O  O   . TRP A 1 264 ? 48.294  -21.955 -8.837  1.00 130.57 ? 264 TRP A O   1 
ATOM   1783  C  CB  . TRP A 1 264 ? 45.504  -23.302 -7.593  1.00 123.16 ? 264 TRP A CB  1 
ATOM   1784  C  CG  . TRP A 1 264 ? 45.204  -21.938 -8.087  1.00 117.36 ? 264 TRP A CG  1 
ATOM   1785  C  CD1 . TRP A 1 264 ? 45.095  -21.551 -9.386  1.00 119.12 ? 264 TRP A CD1 1 
ATOM   1786  C  CD2 . TRP A 1 264 ? 45.049  -20.754 -7.300  1.00 113.64 ? 264 TRP A CD2 1 
ATOM   1787  N  NE1 . TRP A 1 264 ? 44.863  -20.203 -9.460  1.00 117.77 ? 264 TRP A NE1 1 
ATOM   1788  C  CE2 . TRP A 1 264 ? 44.822  -19.690 -8.192  1.00 112.81 ? 264 TRP A CE2 1 
ATOM   1789  C  CE3 . TRP A 1 264 ? 45.066  -20.491 -5.927  1.00 112.51 ? 264 TRP A CE3 1 
ATOM   1790  C  CZ2 . TRP A 1 264 ? 44.607  -18.386 -7.761  1.00 110.24 ? 264 TRP A CZ2 1 
ATOM   1791  C  CZ3 . TRP A 1 264 ? 44.852  -19.194 -5.498  1.00 106.16 ? 264 TRP A CZ3 1 
ATOM   1792  C  CH2 . TRP A 1 264 ? 44.622  -18.158 -6.413  1.00 107.42 ? 264 TRP A CH2 1 
ATOM   1793  N  N   . ILE A 1 265 ? 48.190  -22.160 -6.602  1.00 126.81 ? 265 ILE A N   1 
ATOM   1794  C  CA  . ILE A 1 265 ? 49.082  -21.027 -6.365  1.00 125.65 ? 265 ILE A CA  1 
ATOM   1795  C  C   . ILE A 1 265 ? 50.404  -21.248 -7.083  1.00 123.16 ? 265 ILE A C   1 
ATOM   1796  O  O   . ILE A 1 265 ? 50.922  -20.346 -7.739  1.00 121.15 ? 265 ILE A O   1 
ATOM   1797  C  CB  . ILE A 1 265 ? 49.362  -20.807 -4.864  1.00 129.27 ? 265 ILE A CB  1 
ATOM   1798  C  CG1 . ILE A 1 265 ? 48.076  -20.398 -4.148  1.00 129.90 ? 265 ILE A CG1 1 
ATOM   1799  C  CG2 . ILE A 1 265 ? 50.428  -19.731 -4.658  1.00 128.21 ? 265 ILE A CG2 1 
ATOM   1800  C  CD1 . ILE A 1 265 ? 48.305  -19.895 -2.740  1.00 129.23 ? 265 ILE A CD1 1 
ATOM   1801  N  N   . LEU A 1 266 ? 50.944  -22.453 -6.955  1.00 124.53 ? 266 LEU A N   1 
ATOM   1802  C  CA  . LEU A 1 266 ? 52.207  -22.787 -7.600  1.00 129.59 ? 266 LEU A CA  1 
ATOM   1803  C  C   . LEU A 1 266 ? 52.123  -22.564 -9.103  1.00 134.98 ? 266 LEU A C   1 
ATOM   1804  O  O   . LEU A 1 266 ? 52.905  -21.796 -9.670  1.00 134.58 ? 266 LEU A O   1 
ATOM   1805  C  CB  . LEU A 1 266 ? 52.585  -24.240 -7.321  1.00 131.62 ? 266 LEU A CB  1 
ATOM   1806  C  CG  . LEU A 1 266 ? 53.826  -24.747 -8.058  1.00 134.20 ? 266 LEU A CG  1 
ATOM   1807  C  CD1 . LEU A 1 266 ? 55.018  -23.831 -7.803  1.00 129.96 ? 266 LEU A CD1 1 
ATOM   1808  C  CD2 . LEU A 1 266 ? 54.135  -26.178 -7.643  1.00 139.02 ? 266 LEU A CD2 1 
ATOM   1809  N  N   . LEU A 1 267 ? 51.163  -23.233 -9.738  1.00 139.59 ? 267 LEU A N   1 
ATOM   1810  C  CA  . LEU A 1 267 ? 51.000  -23.152 -11.185 1.00 141.36 ? 267 LEU A CA  1 
ATOM   1811  C  C   . LEU A 1 267 ? 50.662  -21.727 -11.621 1.00 141.36 ? 267 LEU A C   1 
ATOM   1812  O  O   . LEU A 1 267 ? 51.231  -21.216 -12.589 1.00 140.86 ? 267 LEU A O   1 
ATOM   1813  C  CB  . LEU A 1 267 ? 49.915  -24.120 -11.656 1.00 140.95 ? 267 LEU A CB  1 
ATOM   1814  C  CG  . LEU A 1 267 ? 50.237  -25.591 -11.398 1.00 144.73 ? 267 LEU A CG  1 
ATOM   1815  C  CD1 . LEU A 1 267 ? 49.076  -26.488 -11.803 1.00 150.49 ? 267 LEU A CD1 1 
ATOM   1816  C  CD2 . LEU A 1 267 ? 51.506  -25.995 -12.127 1.00 147.11 ? 267 LEU A CD2 1 
ATOM   1817  N  N   . GLY A 1 268 ? 49.758  -21.083 -10.883 1.00 136.50 ? 268 GLY A N   1 
ATOM   1818  C  CA  . GLY A 1 268 ? 49.326  -19.728 -11.199 1.00 132.42 ? 268 GLY A CA  1 
ATOM   1819  C  C   . GLY A 1 268 ? 50.459  -18.720 -11.143 1.00 130.02 ? 268 GLY A C   1 
ATOM   1820  O  O   . GLY A 1 268 ? 50.571  -17.850 -12.009 1.00 130.21 ? 268 GLY A O   1 
ATOM   1821  N  N   . LEU A 1 269 ? 51.310  -18.839 -10.130 1.00 126.30 ? 269 LEU A N   1 
ATOM   1822  C  CA  . LEU A 1 269 ? 52.419  -17.915 -9.969  1.00 125.83 ? 269 LEU A CA  1 
ATOM   1823  C  C   . LEU A 1 269 ? 53.359  -18.004 -11.149 1.00 128.12 ? 269 LEU A C   1 
ATOM   1824  O  O   . LEU A 1 269 ? 53.855  -16.987 -11.635 1.00 129.50 ? 269 LEU A O   1 
ATOM   1825  C  CB  . LEU A 1 269 ? 53.183  -18.204 -8.677  1.00 127.74 ? 269 LEU A CB  1 
ATOM   1826  C  CG  . LEU A 1 269 ? 52.592  -17.540 -7.431  1.00 125.96 ? 269 LEU A CG  1 
ATOM   1827  C  CD1 . LEU A 1 269 ? 53.128  -18.198 -6.169  1.00 122.32 ? 269 LEU A CD1 1 
ATOM   1828  C  CD2 . LEU A 1 269 ? 52.877  -16.040 -7.431  1.00 128.53 ? 269 LEU A CD2 1 
ATOM   1829  N  N   . ALA A 1 270 ? 53.625  -19.227 -11.587 1.00 132.50 ? 270 ALA A N   1 
ATOM   1830  C  CA  . ALA A 1 270 ? 54.549  -19.454 -12.686 1.00 140.15 ? 270 ALA A CA  1 
ATOM   1831  C  C   . ALA A 1 270 ? 53.986  -18.906 -13.998 1.00 141.19 ? 270 ALA A C   1 
ATOM   1832  O  O   . ALA A 1 270 ? 54.718  -18.341 -14.817 1.00 142.14 ? 270 ALA A O   1 
ATOM   1833  C  CB  . ALA A 1 270 ? 54.862  -20.936 -12.803 1.00 146.54 ? 270 ALA A CB  1 
ATOM   1834  N  N   . TYR A 1 271 ? 52.680  -19.064 -14.176 1.00 141.62 ? 271 TYR A N   1 
ATOM   1835  C  CA  . TYR A 1 271 ? 51.985  -18.502 -15.331 1.00 150.22 ? 271 TYR A CA  1 
ATOM   1836  C  C   . TYR A 1 271 ? 52.043  -16.976 -15.315 1.00 150.55 ? 271 TYR A C   1 
ATOM   1837  O  O   . TYR A 1 271 ? 52.348  -16.341 -16.331 1.00 153.99 ? 271 TYR A O   1 
ATOM   1838  C  CB  . TYR A 1 271 ? 50.525  -18.958 -15.349 1.00 153.98 ? 271 TYR A CB  1 
ATOM   1839  C  CG  . TYR A 1 271 ? 49.669  -18.203 -16.341 1.00 160.79 ? 271 TYR A CG  1 
ATOM   1840  C  CD1 . TYR A 1 271 ? 49.763  -18.457 -17.709 1.00 170.87 ? 271 TYR A CD1 1 
ATOM   1841  C  CD2 . TYR A 1 271 ? 48.770  -17.232 -15.914 1.00 154.23 ? 271 TYR A CD2 1 
ATOM   1842  C  CE1 . TYR A 1 271 ? 48.984  -17.765 -18.621 1.00 172.94 ? 271 TYR A CE1 1 
ATOM   1843  C  CE2 . TYR A 1 271 ? 47.982  -16.541 -16.817 1.00 157.46 ? 271 TYR A CE2 1 
ATOM   1844  C  CZ  . TYR A 1 271 ? 48.096  -16.807 -18.169 1.00 167.91 ? 271 TYR A CZ  1 
ATOM   1845  O  OH  . TYR A 1 271 ? 47.319  -16.122 -19.075 1.00 174.12 ? 271 TYR A OH  1 
ATOM   1846  N  N   . PHE A 1 272 ? 51.742  -16.395 -14.157 1.00 149.86 ? 272 PHE A N   1 
ATOM   1847  C  CA  . PHE A 1 272 ? 51.817  -14.944 -13.981 1.00 153.34 ? 272 PHE A CA  1 
ATOM   1848  C  C   . PHE A 1 272 ? 53.239  -14.423 -14.197 1.00 154.19 ? 272 PHE A C   1 
ATOM   1849  O  O   . PHE A 1 272 ? 53.432  -13.369 -14.798 1.00 157.37 ? 272 PHE A O   1 
ATOM   1850  C  CB  . PHE A 1 272 ? 51.314  -14.540 -12.588 1.00 153.38 ? 272 PHE A CB  1 
ATOM   1851  C  CG  . PHE A 1 272 ? 50.096  -13.662 -12.609 1.00 156.80 ? 272 PHE A CG  1 
ATOM   1852  C  CD1 . PHE A 1 272 ? 48.822  -14.215 -12.610 1.00 153.89 ? 272 PHE A CD1 1 
ATOM   1853  C  CD2 . PHE A 1 272 ? 50.227  -12.283 -12.610 1.00 160.42 ? 272 PHE A CD2 1 
ATOM   1854  C  CE1 . PHE A 1 272 ? 47.703  -13.406 -12.623 1.00 151.79 ? 272 PHE A CE1 1 
ATOM   1855  C  CE2 . PHE A 1 272 ? 49.112  -11.468 -12.625 1.00 158.33 ? 272 PHE A CE2 1 
ATOM   1856  C  CZ  . PHE A 1 272 ? 47.849  -12.031 -12.630 1.00 156.71 ? 272 PHE A CZ  1 
ATOM   1857  N  N   . ALA A 1 273 ? 54.226  -15.168 -13.707 1.00 158.62 ? 273 ALA A N   1 
ATOM   1858  C  CA  . ALA A 1 273 ? 55.629  -14.771 -13.810 1.00 158.61 ? 273 ALA A CA  1 
ATOM   1859  C  C   . ALA A 1 273 ? 56.062  -14.664 -15.261 1.00 167.77 ? 273 ALA A C   1 
ATOM   1860  O  O   . ALA A 1 273 ? 56.664  -13.669 -15.662 1.00 174.95 ? 273 ALA A O   1 
ATOM   1861  C  CB  . ALA A 1 273 ? 56.514  -15.766 -13.080 1.00 155.57 ? 273 ALA A CB  1 
ATOM   1862  N  N   . SER A 1 274 ? 55.750  -15.695 -16.041 1.00 175.59 ? 274 SER A N   1 
ATOM   1863  C  CA  . SER A 1 274 ? 56.108  -15.733 -17.456 1.00 180.71 ? 274 SER A CA  1 
ATOM   1864  C  C   . SER A 1 274 ? 55.513  -14.544 -18.210 1.00 174.94 ? 274 SER A C   1 
ATOM   1865  O  O   . SER A 1 274 ? 56.167  -13.959 -19.080 1.00 184.86 ? 274 SER A O   1 
ATOM   1866  C  CB  . SER A 1 274 ? 55.636  -17.046 -18.086 1.00 188.51 ? 274 SER A CB  1 
ATOM   1867  O  OG  . SER A 1 274 ? 56.146  -18.163 -17.374 1.00 185.32 ? 274 SER A OG  1 
ATOM   1868  N  N   . VAL A 1 275 ? 54.280  -14.187 -17.859 1.00 160.18 ? 275 VAL A N   1 
ATOM   1869  C  CA  . VAL A 1 275 ? 53.618  -13.015 -18.426 1.00 158.31 ? 275 VAL A CA  1 
ATOM   1870  C  C   . VAL A 1 275 ? 54.384  -11.728 -18.107 1.00 165.44 ? 275 VAL A C   1 
ATOM   1871  O  O   . VAL A 1 275 ? 54.606  -10.894 -18.989 1.00 170.39 ? 275 VAL A O   1 
ATOM   1872  C  CB  . VAL A 1 275 ? 52.180  -12.890 -17.891 1.00 148.80 ? 275 VAL A CB  1 
ATOM   1873  C  CG1 . VAL A 1 275 ? 51.566  -11.556 -18.290 1.00 144.03 ? 275 VAL A CG1 1 
ATOM   1874  C  CG2 . VAL A 1 275 ? 51.337  -14.054 -18.385 1.00 151.41 ? 275 VAL A CG2 1 
ATOM   1875  N  N   . LEU A 1 276 ? 54.792  -11.585 -16.847 1.00 170.98 ? 276 LEU A N   1 
ATOM   1876  C  CA  . LEU A 1 276 ? 55.493  -10.387 -16.379 1.00 169.12 ? 276 LEU A CA  1 
ATOM   1877  C  C   . LEU A 1 276 ? 56.889  -10.249 -16.980 1.00 174.72 ? 276 LEU A C   1 
ATOM   1878  O  O   . LEU A 1 276 ? 57.301  -9.151  -17.365 1.00 167.97 ? 276 LEU A O   1 
ATOM   1879  C  CB  . LEU A 1 276 ? 55.585  -10.385 -14.852 1.00 162.40 ? 276 LEU A CB  1 
ATOM   1880  C  CG  . LEU A 1 276 ? 54.401  -9.718  -14.146 1.00 166.79 ? 276 LEU A CG  1 
ATOM   1881  C  CD1 . LEU A 1 276 ? 54.425  -8.217  -14.397 1.00 174.08 ? 276 LEU A CD1 1 
ATOM   1882  C  CD2 . LEU A 1 276 ? 53.065  -10.313 -14.576 1.00 163.95 ? 276 LEU A CD2 1 
ATOM   1883  N  N   . THR A 1 277 ? 57.614  -11.362 -17.057 1.00 186.40 ? 277 THR A N   1 
ATOM   1884  C  CA  . THR A 1 277 ? 58.965  -11.346 -17.607 1.00 193.17 ? 277 THR A CA  1 
ATOM   1885  C  C   . THR A 1 277 ? 58.945  -10.899 -19.069 1.00 203.47 ? 277 THR A C   1 
ATOM   1886  O  O   . THR A 1 277 ? 59.767  -10.078 -19.467 1.00 224.77 ? 277 THR A O   1 
ATOM   1887  C  CB  . THR A 1 277 ? 59.662  -12.720 -17.499 1.00 192.14 ? 277 THR A CB  1 
ATOM   1888  O  OG1 . THR A 1 277 ? 58.967  -13.683 -18.302 1.00 204.56 ? 277 THR A OG1 1 
ATOM   1889  C  CG2 . THR A 1 277 ? 59.718  -13.197 -16.047 1.00 179.47 ? 277 THR A CG2 1 
ATOM   1890  N  N   . THR A 1 278 ? 57.999  -11.414 -19.856 1.00 202.40 ? 278 THR A N   1 
ATOM   1891  C  CA  . THR A 1 278 ? 57.911  -11.062 -21.280 1.00 200.85 ? 278 THR A CA  1 
ATOM   1892  C  C   . THR A 1 278 ? 57.308  -9.665  -21.494 1.00 197.73 ? 278 THR A C   1 
ATOM   1893  O  O   . THR A 1 278 ? 57.764  -8.918  -22.364 1.00 194.09 ? 278 THR A O   1 
ATOM   1894  C  CB  . THR A 1 278 ? 57.107  -12.098 -22.097 1.00 196.50 ? 278 THR A CB  1 
ATOM   1895  O  OG1 . THR A 1 278 ? 55.759  -12.150 -21.620 1.00 195.61 ? 278 THR A OG1 1 
ATOM   1896  C  CG2 . THR A 1 278 ? 57.740  -13.481 -21.999 1.00 192.30 ? 278 THR A CG2 1 
ATOM   1897  N  N   . ILE A 1 279 ? 56.291  -9.309  -20.709 1.00 189.54 ? 279 ILE A N   1 
ATOM   1898  C  CA  . ILE A 1 279 ? 55.759  -7.942  -20.743 1.00 185.40 ? 279 ILE A CA  1 
ATOM   1899  C  C   . ILE A 1 279 ? 56.774  -6.974  -20.133 1.00 184.60 ? 279 ILE A C   1 
ATOM   1900  O  O   . ILE A 1 279 ? 56.901  -5.840  -20.585 1.00 190.29 ? 279 ILE A O   1 
ATOM   1901  C  CB  . ILE A 1 279 ? 54.390  -7.808  -20.032 1.00 175.49 ? 279 ILE A CB  1 
ATOM   1902  C  CG1 . ILE A 1 279 ? 53.780  -6.428  -20.303 1.00 164.68 ? 279 ILE A CG1 1 
ATOM   1903  C  CG2 . ILE A 1 279 ? 54.529  -8.024  -18.532 1.00 176.97 ? 279 ILE A CG2 1 
ATOM   1904  C  CD1 . ILE A 1 279 ? 52.473  -6.181  -19.581 1.00 153.46 ? 279 ILE A CD1 1 
ATOM   1905  N  N   . GLY A 1 280 ? 57.508  -7.427  -19.120 1.00 179.07 ? 280 GLY A N   1 
ATOM   1906  C  CA  . GLY A 1 280 ? 58.697  -6.711  -18.670 1.00 181.28 ? 280 GLY A CA  1 
ATOM   1907  C  C   . GLY A 1 280 ? 59.719  -6.667  -19.794 1.00 195.80 ? 280 GLY A C   1 
ATOM   1908  O  O   . GLY A 1 280 ? 60.341  -5.633  -20.050 1.00 196.16 ? 280 GLY A O   1 
ATOM   1909  N  N   . ASN A 1 281 ? 59.868  -7.800  -20.478 1.00 205.22 ? 281 ASN A N   1 
ATOM   1910  C  CA  . ASN A 1 281 ? 60.786  -7.933  -21.606 1.00 199.92 ? 281 ASN A CA  1 
ATOM   1911  C  C   . ASN A 1 281 ? 60.466  -6.942  -22.720 1.00 206.03 ? 281 ASN A C   1 
ATOM   1912  O  O   . ASN A 1 281 ? 61.359  -6.283  -23.252 1.00 206.86 ? 281 ASN A O   1 
ATOM   1913  C  CB  . ASN A 1 281 ? 60.719  -9.359  -22.154 1.00 196.28 ? 281 ASN A CB  1 
ATOM   1914  C  CG  . ASN A 1 281 ? 61.911  -9.712  -23.002 1.00 199.36 ? 281 ASN A CG  1 
ATOM   1915  O  OD1 . ASN A 1 281 ? 62.691  -8.844  -23.385 1.00 205.20 ? 281 ASN A OD1 1 
ATOM   1916  N  ND2 . ASN A 1 281 ? 62.059  -10.993 -23.303 1.00 202.96 ? 281 ASN A ND2 1 
ATOM   1917  N  N   . TRP A 1 282 ? 59.188  -6.844  -23.072 1.00 207.79 ? 282 TRP A N   1 
ATOM   1918  C  CA  . TRP A 1 282 ? 58.742  -5.891  -24.083 1.00 212.69 ? 282 TRP A CA  1 
ATOM   1919  C  C   . TRP A 1 282 ? 58.973  -4.452  -23.624 1.00 210.67 ? 282 TRP A C   1 
ATOM   1920  O  O   . TRP A 1 282 ? 59.338  -3.589  -24.421 1.00 213.36 ? 282 TRP A O   1 
ATOM   1921  C  CB  . TRP A 1 282 ? 57.258  -6.097  -24.399 1.00 211.25 ? 282 TRP A CB  1 
ATOM   1922  C  CG  . TRP A 1 282 ? 56.659  -4.964  -25.168 1.00 211.32 ? 282 TRP A CG  1 
ATOM   1923  C  CD1 . TRP A 1 282 ? 56.860  -4.675  -26.486 1.00 215.40 ? 282 TRP A CD1 1 
ATOM   1924  C  CD2 . TRP A 1 282 ? 55.775  -3.951  -24.663 1.00 206.40 ? 282 TRP A CD2 1 
ATOM   1925  N  NE1 . TRP A 1 282 ? 56.153  -3.550  -26.834 1.00 220.24 ? 282 TRP A NE1 1 
ATOM   1926  C  CE2 . TRP A 1 282 ? 55.479  -3.086  -25.734 1.00 214.00 ? 282 TRP A CE2 1 
ATOM   1927  C  CE3 . TRP A 1 282 ? 55.201  -3.696  -23.410 1.00 192.23 ? 282 TRP A CE3 1 
ATOM   1928  C  CZ2 . TRP A 1 282 ? 54.633  -1.983  -25.592 1.00 210.11 ? 282 TRP A CZ2 1 
ATOM   1929  C  CZ3 . TRP A 1 282 ? 54.359  -2.603  -23.273 1.00 187.64 ? 282 TRP A CZ3 1 
ATOM   1930  C  CH2 . TRP A 1 282 ? 54.083  -1.761  -24.357 1.00 197.00 ? 282 TRP A CH2 1 
ATOM   1931  N  N   . LEU A 1 283 ? 58.762  -4.203  -22.336 1.00 204.75 ? 283 LEU A N   1 
ATOM   1932  C  CA  . LEU A 1 283 ? 58.768  -2.844  -21.802 1.00 200.37 ? 283 LEU A CA  1 
ATOM   1933  C  C   . LEU A 1 283 ? 60.160  -2.208  -21.787 1.00 198.45 ? 283 LEU A C   1 
ATOM   1934  O  O   . LEU A 1 283 ? 60.313  -1.050  -22.174 1.00 195.23 ? 283 LEU A O   1 
ATOM   1935  C  CB  . LEU A 1 283 ? 58.178  -2.830  -20.388 1.00 194.92 ? 283 LEU A CB  1 
ATOM   1936  C  CG  . LEU A 1 283 ? 56.651  -2.893  -20.296 1.00 188.81 ? 283 LEU A CG  1 
ATOM   1937  C  CD1 . LEU A 1 283 ? 56.202  -3.310  -18.902 1.00 184.32 ? 283 LEU A CD1 1 
ATOM   1938  C  CD2 . LEU A 1 283 ? 56.040  -1.557  -20.691 1.00 184.27 ? 283 LEU A CD2 1 
ATOM   1939  N  N   . ARG A 1 284 ? 61.167  -2.951  -21.331 1.00 193.85 ? 284 ARG A N   1 
ATOM   1940  C  CA  . ARG A 1 284 ? 62.495  -2.369  -21.117 1.00 191.75 ? 284 ARG A CA  1 
ATOM   1941  C  C   . ARG A 1 284 ? 63.135  -1.909  -22.428 1.00 198.85 ? 284 ARG A C   1 
ATOM   1942  O  O   . ARG A 1 284 ? 63.792  -0.869  -22.464 1.00 203.93 ? 284 ARG A O   1 
ATOM   1943  C  CB  . ARG A 1 284 ? 63.422  -3.336  -20.368 1.00 189.09 ? 284 ARG A CB  1 
ATOM   1944  C  CG  . ARG A 1 284 ? 63.811  -4.584  -21.144 1.00 195.99 ? 284 ARG A CG  1 
ATOM   1945  C  CD  . ARG A 1 284 ? 64.964  -5.322  -20.480 1.00 197.20 ? 284 ARG A CD  1 
ATOM   1946  N  NE  . ARG A 1 284 ? 66.263  -4.933  -21.034 1.00 204.44 ? 284 ARG A NE  1 
ATOM   1947  C  CZ  . ARG A 1 284 ? 67.414  -5.542  -20.757 1.00 200.36 ? 284 ARG A CZ  1 
ATOM   1948  N  NH1 . ARG A 1 284 ? 67.445  -6.573  -19.922 1.00 198.52 ? 284 ARG A NH1 1 
ATOM   1949  N  NH2 . ARG A 1 284 ? 68.542  -5.119  -21.312 1.00 200.94 ? 284 ARG A NH2 1 
ATOM   1950  N  N   . VAL A 1 285 ? 62.930  -2.672  -23.501 1.00 200.41 ? 285 VAL A N   1 
ATOM   1951  C  CA  . VAL A 1 285 ? 63.415  -2.273  -24.828 1.00 203.79 ? 285 VAL A CA  1 
ATOM   1952  C  C   . VAL A 1 285 ? 62.687  -1.024  -25.344 1.00 203.93 ? 285 VAL A C   1 
ATOM   1953  O  O   . VAL A 1 285 ? 63.293  -0.175  -25.998 1.00 205.55 ? 285 VAL A O   1 
ATOM   1954  C  CB  . VAL A 1 285 ? 63.308  -3.422  -25.861 1.00 204.58 ? 285 VAL A CB  1 
ATOM   1955  C  CG1 . VAL A 1 285 ? 64.255  -4.556  -25.495 1.00 201.68 ? 285 VAL A CG1 1 
ATOM   1956  C  CG2 . VAL A 1 285 ? 61.880  -3.934  -25.976 1.00 200.38 ? 285 VAL A CG2 1 
ATOM   1957  N  N   . VAL A 1 286 ? 61.396  -0.909  -25.029 1.00 198.72 ? 286 VAL A N   1 
ATOM   1958  C  CA  . VAL A 1 286 ? 60.608  0.286   -25.358 1.00 197.24 ? 286 VAL A CA  1 
ATOM   1959  C  C   . VAL A 1 286 ? 61.206  1.521   -24.691 1.00 193.56 ? 286 VAL A C   1 
ATOM   1960  O  O   . VAL A 1 286 ? 62.102  2.161   -25.238 1.00 195.55 ? 286 VAL A O   1 
ATOM   1961  C  CB  . VAL A 1 286 ? 59.135  0.143   -24.899 1.00 190.99 ? 286 VAL A CB  1 
ATOM   1962  C  CG1 . VAL A 1 286 ? 58.420  1.487   -24.935 1.00 189.59 ? 286 VAL A CG1 1 
ATOM   1963  C  CG2 . VAL A 1 286 ? 58.396  -0.880  -25.752 1.00 194.29 ? 286 VAL A CG2 1 
ATOM   1964  N  N   . ARG B 1 28  ? 65.338  -29.476 -17.152 1.00 168.58 ? 28  ARG B N   1 
ATOM   1965  C  CA  . ARG B 1 28  ? 65.661  -30.915 -16.950 1.00 179.02 ? 28  ARG B CA  1 
ATOM   1966  C  C   . ARG B 1 28  ? 64.590  -31.546 -16.067 1.00 189.84 ? 28  ARG B C   1 
ATOM   1967  O  O   . ARG B 1 28  ? 64.510  -31.256 -14.869 1.00 220.16 ? 28  ARG B O   1 
ATOM   1968  C  CB  . ARG B 1 28  ? 67.035  -31.071 -16.297 1.00 181.51 ? 28  ARG B CB  1 
ATOM   1969  C  CG  . ARG B 1 28  ? 68.194  -30.517 -17.108 1.00 187.39 ? 28  ARG B CG  1 
ATOM   1970  C  CD  . ARG B 1 28  ? 69.525  -30.877 -16.461 1.00 190.37 ? 28  ARG B CD  1 
ATOM   1971  N  NE  . ARG B 1 28  ? 70.590  -31.064 -17.443 1.00 192.46 ? 28  ARG B NE  1 
ATOM   1972  C  CZ  . ARG B 1 28  ? 71.781  -31.585 -17.163 1.00 194.78 ? 28  ARG B CZ  1 
ATOM   1973  N  NH1 . ARG B 1 28  ? 72.070  -31.972 -15.927 1.00 192.85 ? 28  ARG B NH1 1 
ATOM   1974  N  NH2 . ARG B 1 28  ? 72.688  -31.722 -18.122 1.00 204.70 ? 28  ARG B NH2 1 
ATOM   1975  N  N   . SER B 1 29  ? 63.760  -32.400 -16.659 1.00 195.00 ? 29  SER B N   1 
ATOM   1976  C  CA  . SER B 1 29  ? 62.592  -32.941 -15.958 1.00 200.46 ? 29  SER B CA  1 
ATOM   1977  C  C   . SER B 1 29  ? 62.969  -33.651 -14.656 1.00 200.32 ? 29  SER B C   1 
ATOM   1978  O  O   . SER B 1 29  ? 62.256  -33.556 -13.650 1.00 186.33 ? 29  SER B O   1 
ATOM   1979  C  CB  . SER B 1 29  ? 61.825  -33.903 -16.868 1.00 208.96 ? 29  SER B CB  1 
ATOM   1980  O  OG  . SER B 1 29  ? 61.035  -33.196 -17.807 1.00 211.83 ? 29  SER B OG  1 
ATOM   1981  N  N   . THR B 1 30  ? 64.082  -34.377 -14.688 1.00 208.14 ? 30  THR B N   1 
ATOM   1982  C  CA  . THR B 1 30  ? 64.586  -35.054 -13.499 1.00 200.40 ? 30  THR B CA  1 
ATOM   1983  C  C   . THR B 1 30  ? 64.837  -34.054 -12.376 1.00 185.34 ? 30  THR B C   1 
ATOM   1984  O  O   . THR B 1 30  ? 64.400  -34.262 -11.247 1.00 177.42 ? 30  THR B O   1 
ATOM   1985  C  CB  . THR B 1 30  ? 65.877  -35.860 -13.791 1.00 206.73 ? 30  THR B CB  1 
ATOM   1986  O  OG1 . THR B 1 30  ? 66.407  -36.377 -12.566 1.00 203.20 ? 30  THR B OG1 1 
ATOM   1987  C  CG2 . THR B 1 30  ? 66.943  -35.001 -14.473 1.00 207.96 ? 30  THR B CG2 1 
ATOM   1988  N  N   . THR B 1 31  ? 65.511  -32.956 -12.703 1.00 180.66 ? 31  THR B N   1 
ATOM   1989  C  CA  . THR B 1 31  ? 65.905  -31.969 -11.704 1.00 179.26 ? 31  THR B CA  1 
ATOM   1990  C  C   . THR B 1 31  ? 64.691  -31.218 -11.160 1.00 170.97 ? 31  THR B C   1 
ATOM   1991  O  O   . THR B 1 31  ? 64.611  -30.930 -9.969  1.00 162.00 ? 31  THR B O   1 
ATOM   1992  C  CB  . THR B 1 31  ? 66.888  -30.939 -12.290 1.00 179.01 ? 31  THR B CB  1 
ATOM   1993  O  OG1 . THR B 1 31  ? 66.239  -30.194 -13.329 1.00 200.22 ? 31  THR B OG1 1 
ATOM   1994  C  CG2 . THR B 1 31  ? 68.128  -31.622 -12.845 1.00 177.01 ? 31  THR B CG2 1 
ATOM   1995  N  N   . LEU B 1 32  ? 63.753  -30.895 -12.042 1.00 166.96 ? 32  LEU B N   1 
ATOM   1996  C  CA  . LEU B 1 32  ? 62.532  -30.223 -11.641 1.00 161.88 ? 32  LEU B CA  1 
ATOM   1997  C  C   . LEU B 1 32  ? 61.838  -31.015 -10.534 1.00 168.32 ? 32  LEU B C   1 
ATOM   1998  O  O   . LEU B 1 32  ? 61.417  -30.451 -9.518  1.00 168.49 ? 32  LEU B O   1 
ATOM   1999  C  CB  . LEU B 1 32  ? 61.606  -30.099 -12.851 1.00 162.92 ? 32  LEU B CB  1 
ATOM   2000  C  CG  . LEU B 1 32  ? 60.258  -29.404 -12.634 1.00 164.83 ? 32  LEU B CG  1 
ATOM   2001  C  CD1 . LEU B 1 32  ? 60.433  -27.910 -12.838 1.00 163.14 ? 32  LEU B CD1 1 
ATOM   2002  C  CD2 . LEU B 1 32  ? 59.176  -29.943 -13.560 1.00 169.98 ? 32  LEU B CD2 1 
ATOM   2003  N  N   . LEU B 1 33  ? 61.737  -32.329 -10.728 1.00 176.22 ? 33  LEU B N   1 
ATOM   2004  C  CA  . LEU B 1 33  ? 61.071  -33.202 -9.754  1.00 171.68 ? 33  LEU B CA  1 
ATOM   2005  C  C   . LEU B 1 33  ? 61.843  -33.274 -8.443  1.00 165.73 ? 33  LEU B C   1 
ATOM   2006  O  O   . LEU B 1 33  ? 61.246  -33.248 -7.367  1.00 158.69 ? 33  LEU B O   1 
ATOM   2007  C  CB  . LEU B 1 33  ? 60.869  -34.613 -10.318 1.00 174.20 ? 33  LEU B CB  1 
ATOM   2008  C  CG  . LEU B 1 33  ? 59.502  -34.890 -10.950 1.00 173.68 ? 33  LEU B CG  1 
ATOM   2009  C  CD1 . LEU B 1 33  ? 58.362  -34.312 -10.117 1.00 164.70 ? 33  LEU B CD1 1 
ATOM   2010  C  CD2 . LEU B 1 33  ? 59.467  -34.352 -12.375 1.00 175.74 ? 33  LEU B CD2 1 
ATOM   2011  N  N   . ALA B 1 34  ? 63.167  -33.366 -8.540  1.00 164.26 ? 34  ALA B N   1 
ATOM   2012  C  CA  . ALA B 1 34  ? 64.024  -33.328 -7.362  1.00 161.55 ? 34  ALA B CA  1 
ATOM   2013  C  C   . ALA B 1 34  ? 63.822  -32.012 -6.621  1.00 158.75 ? 34  ALA B C   1 
ATOM   2014  O  O   . ALA B 1 34  ? 63.665  -31.988 -5.401  1.00 154.68 ? 34  ALA B O   1 
ATOM   2015  C  CB  . ALA B 1 34  ? 65.484  -33.484 -7.762  1.00 161.05 ? 34  ALA B CB  1 
ATOM   2016  N  N   . LEU B 1 35  ? 63.818  -30.919 -7.376  1.00 157.20 ? 35  LEU B N   1 
ATOM   2017  C  CA  . LEU B 1 35  ? 63.718  -29.587 -6.802  1.00 146.31 ? 35  LEU B CA  1 
ATOM   2018  C  C   . LEU B 1 35  ? 62.397  -29.436 -6.071  1.00 133.48 ? 35  LEU B C   1 
ATOM   2019  O  O   . LEU B 1 35  ? 62.354  -28.929 -4.957  1.00 128.11 ? 35  LEU B O   1 
ATOM   2020  C  CB  . LEU B 1 35  ? 63.852  -28.529 -7.903  1.00 146.94 ? 35  LEU B CB  1 
ATOM   2021  C  CG  . LEU B 1 35  ? 64.503  -27.206 -7.499  1.00 147.16 ? 35  LEU B CG  1 
ATOM   2022  C  CD1 . LEU B 1 35  ? 65.736  -27.431 -6.631  1.00 151.92 ? 35  LEU B CD1 1 
ATOM   2023  C  CD2 . LEU B 1 35  ? 64.857  -26.401 -8.743  1.00 143.58 ? 35  LEU B CD2 1 
ATOM   2024  N  N   . LEU B 1 36  ? 61.323  -29.881 -6.712  1.00 129.91 ? 36  LEU B N   1 
ATOM   2025  C  CA  . LEU B 1 36  ? 60.008  -29.896 -6.092  1.00 127.60 ? 36  LEU B CA  1 
ATOM   2026  C  C   . LEU B 1 36  ? 60.046  -30.627 -4.744  1.00 128.46 ? 36  LEU B C   1 
ATOM   2027  O  O   . LEU B 1 36  ? 59.549  -30.121 -3.735  1.00 129.10 ? 36  LEU B O   1 
ATOM   2028  C  CB  . LEU B 1 36  ? 59.001  -30.539 -7.051  1.00 129.27 ? 36  LEU B CB  1 
ATOM   2029  C  CG  . LEU B 1 36  ? 57.523  -30.583 -6.639  1.00 128.27 ? 36  LEU B CG  1 
ATOM   2030  C  CD1 . LEU B 1 36  ? 56.913  -29.187 -6.629  1.00 125.83 ? 36  LEU B CD1 1 
ATOM   2031  C  CD2 . LEU B 1 36  ? 56.732  -31.497 -7.563  1.00 131.94 ? 36  LEU B CD2 1 
ATOM   2032  N  N   . ALA B 1 37  ? 60.673  -31.797 -4.720  1.00 132.90 ? 37  ALA B N   1 
ATOM   2033  C  CA  . ALA B 1 37  ? 60.761  -32.588 -3.497  1.00 133.25 ? 37  ALA B CA  1 
ATOM   2034  C  C   . ALA B 1 37  ? 61.588  -31.869 -2.437  1.00 130.62 ? 37  ALA B C   1 
ATOM   2035  O  O   . ALA B 1 37  ? 61.269  -31.920 -1.249  1.00 127.40 ? 37  ALA B O   1 
ATOM   2036  C  CB  . ALA B 1 37  ? 61.356  -33.954 -3.795  1.00 137.02 ? 37  ALA B CB  1 
ATOM   2037  N  N   . LEU B 1 38  ? 62.656  -31.207 -2.871  1.00 130.83 ? 38  LEU B N   1 
ATOM   2038  C  CA  . LEU B 1 38  ? 63.504  -30.452 -1.959  1.00 131.58 ? 38  LEU B CA  1 
ATOM   2039  C  C   . LEU B 1 38  ? 62.671  -29.353 -1.291  1.00 131.53 ? 38  LEU B C   1 
ATOM   2040  O  O   . LEU B 1 38  ? 62.512  -29.334 -0.069  1.00 131.20 ? 38  LEU B O   1 
ATOM   2041  C  CB  . LEU B 1 38  ? 64.697  -29.855 -2.719  1.00 128.55 ? 38  LEU B CB  1 
ATOM   2042  C  CG  . LEU B 1 38  ? 65.725  -29.056 -1.915  1.00 127.10 ? 38  LEU B CG  1 
ATOM   2043  C  CD1 . LEU B 1 38  ? 66.994  -28.858 -2.727  1.00 126.99 ? 38  LEU B CD1 1 
ATOM   2044  C  CD2 . LEU B 1 38  ? 65.157  -27.712 -1.490  1.00 126.96 ? 38  LEU B CD2 1 
ATOM   2045  N  N   . VAL B 1 39  ? 62.134  -28.448 -2.106  1.00 129.15 ? 39  VAL B N   1 
ATOM   2046  C  CA  . VAL B 1 39  ? 61.248  -27.396 -1.625  1.00 123.38 ? 39  VAL B CA  1 
ATOM   2047  C  C   . VAL B 1 39  ? 60.238  -27.971 -0.648  1.00 118.68 ? 39  VAL B C   1 
ATOM   2048  O  O   . VAL B 1 39  ? 60.151  -27.538 0.496   1.00 115.08 ? 39  VAL B O   1 
ATOM   2049  C  CB  . VAL B 1 39  ? 60.502  -26.724 -2.795  1.00 121.75 ? 39  VAL B CB  1 
ATOM   2050  C  CG1 . VAL B 1 39  ? 59.212  -26.072 -2.320  1.00 117.74 ? 39  VAL B CG1 1 
ATOM   2051  C  CG2 . VAL B 1 39  ? 61.410  -25.710 -3.473  1.00 121.08 ? 39  VAL B CG2 1 
ATOM   2052  N  N   . LEU B 1 40  ? 59.504  -28.976 -1.100  1.00 118.28 ? 40  LEU B N   1 
ATOM   2053  C  CA  . LEU B 1 40  ? 58.551  -29.654 -0.252  1.00 123.00 ? 40  LEU B CA  1 
ATOM   2054  C  C   . LEU B 1 40  ? 59.139  -29.935 1.138   1.00 127.43 ? 40  LEU B C   1 
ATOM   2055  O  O   . LEU B 1 40  ? 58.477  -29.717 2.158   1.00 128.67 ? 40  LEU B O   1 
ATOM   2056  C  CB  . LEU B 1 40  ? 58.112  -30.957 -0.919  1.00 129.04 ? 40  LEU B CB  1 
ATOM   2057  C  CG  . LEU B 1 40  ? 56.771  -31.515 -0.433  1.00 131.90 ? 40  LEU B CG  1 
ATOM   2058  C  CD1 . LEU B 1 40  ? 55.633  -30.635 -0.933  1.00 125.92 ? 40  LEU B CD1 1 
ATOM   2059  C  CD2 . LEU B 1 40  ? 56.582  -32.962 -0.876  1.00 138.83 ? 40  LEU B CD2 1 
ATOM   2060  N  N   . LEU B 1 41  ? 60.379  -30.417 1.178   1.00 130.52 ? 41  LEU B N   1 
ATOM   2061  C  CA  . LEU B 1 41  ? 61.048  -30.724 2.447   1.00 130.92 ? 41  LEU B CA  1 
ATOM   2062  C  C   . LEU B 1 41  ? 61.420  -29.459 3.205   1.00 125.45 ? 41  LEU B C   1 
ATOM   2063  O  O   . LEU B 1 41  ? 61.396  -29.435 4.437   1.00 124.44 ? 41  LEU B O   1 
ATOM   2064  C  CB  . LEU B 1 41  ? 62.309  -31.562 2.208   1.00 136.76 ? 41  LEU B CB  1 
ATOM   2065  C  CG  . LEU B 1 41  ? 62.079  -33.023 1.806   1.00 137.91 ? 41  LEU B CG  1 
ATOM   2066  C  CD1 . LEU B 1 41  ? 63.408  -33.719 1.571   1.00 137.56 ? 41  LEU B CD1 1 
ATOM   2067  C  CD2 . LEU B 1 41  ? 61.254  -33.758 2.858   1.00 136.56 ? 41  LEU B CD2 1 
ATOM   2068  N  N   . TYR B 1 42  ? 61.788  -28.421 2.459   1.00 123.05 ? 42  TYR B N   1 
ATOM   2069  C  CA  . TYR B 1 42  ? 62.066  -27.113 3.034   1.00 119.69 ? 42  TYR B CA  1 
ATOM   2070  C  C   . TYR B 1 42  ? 60.827  -26.540 3.719   1.00 115.00 ? 42  TYR B C   1 
ATOM   2071  O  O   . TYR B 1 42  ? 60.927  -25.872 4.746   1.00 111.83 ? 42  TYR B O   1 
ATOM   2072  C  CB  . TYR B 1 42  ? 62.544  -26.152 1.950   1.00 120.00 ? 42  TYR B CB  1 
ATOM   2073  C  CG  . TYR B 1 42  ? 63.186  -24.910 2.503   1.00 120.37 ? 42  TYR B CG  1 
ATOM   2074  C  CD1 . TYR B 1 42  ? 64.446  -24.961 3.075   1.00 124.60 ? 42  TYR B CD1 1 
ATOM   2075  C  CD2 . TYR B 1 42  ? 62.534  -23.690 2.467   1.00 118.78 ? 42  TYR B CD2 1 
ATOM   2076  C  CE1 . TYR B 1 42  ? 65.045  -23.833 3.594   1.00 121.99 ? 42  TYR B CE1 1 
ATOM   2077  C  CE2 . TYR B 1 42  ? 63.130  -22.555 2.980   1.00 118.56 ? 42  TYR B CE2 1 
ATOM   2078  C  CZ  . TYR B 1 42  ? 64.385  -22.636 3.544   1.00 117.98 ? 42  TYR B CZ  1 
ATOM   2079  O  OH  . TYR B 1 42  ? 64.984  -21.517 4.065   1.00 114.74 ? 42  TYR B OH  1 
ATOM   2080  N  N   . LEU B 1 43  ? 59.661  -26.804 3.136   1.00 113.68 ? 43  LEU B N   1 
ATOM   2081  C  CA  . LEU B 1 43  ? 58.395  -26.363 3.708   1.00 110.58 ? 43  LEU B CA  1 
ATOM   2082  C  C   . LEU B 1 43  ? 58.077  -27.165 4.953   1.00 111.01 ? 43  LEU B C   1 
ATOM   2083  O  O   . LEU B 1 43  ? 57.764  -26.607 6.003   1.00 109.31 ? 43  LEU B O   1 
ATOM   2084  C  CB  . LEU B 1 43  ? 57.255  -26.533 2.699   1.00 108.87 ? 43  LEU B CB  1 
ATOM   2085  C  CG  . LEU B 1 43  ? 57.282  -25.588 1.502   1.00 108.86 ? 43  LEU B CG  1 
ATOM   2086  C  CD1 . LEU B 1 43  ? 56.282  -26.037 0.449   1.00 107.09 ? 43  LEU B CD1 1 
ATOM   2087  C  CD2 . LEU B 1 43  ? 57.002  -24.160 1.940   1.00 109.73 ? 43  LEU B CD2 1 
ATOM   2088  N  N   . VAL B 1 44  ? 58.123  -28.484 4.821   1.00 114.97 ? 44  VAL B N   1 
ATOM   2089  C  CA  . VAL B 1 44  ? 57.763  -29.344 5.927   1.00 117.72 ? 44  VAL B CA  1 
ATOM   2090  C  C   . VAL B 1 44  ? 58.688  -29.046 7.097   1.00 116.44 ? 44  VAL B C   1 
ATOM   2091  O  O   . VAL B 1 44  ? 58.246  -28.985 8.241   1.00 110.53 ? 44  VAL B O   1 
ATOM   2092  C  CB  . VAL B 1 44  ? 57.845  -30.831 5.556   1.00 123.90 ? 44  VAL B CB  1 
ATOM   2093  C  CG1 . VAL B 1 44  ? 57.590  -31.686 6.788   1.00 126.50 ? 44  VAL B CG1 1 
ATOM   2094  C  CG2 . VAL B 1 44  ? 56.840  -31.163 4.461   1.00 123.26 ? 44  VAL B CG2 1 
ATOM   2095  N  N   . SER B 1 45  ? 59.968  -28.830 6.805   1.00 117.05 ? 45  SER B N   1 
ATOM   2096  C  CA  . SER B 1 45  ? 60.926  -28.500 7.855   1.00 116.11 ? 45  SER B CA  1 
ATOM   2097  C  C   . SER B 1 45  ? 60.572  -27.147 8.477   1.00 108.17 ? 45  SER B C   1 
ATOM   2098  O  O   . SER B 1 45  ? 60.536  -27.009 9.699   1.00 105.77 ? 45  SER B O   1 
ATOM   2099  C  CB  . SER B 1 45  ? 62.360  -28.508 7.323   1.00 115.53 ? 45  SER B CB  1 
ATOM   2100  O  OG  . SER B 1 45  ? 62.534  -27.505 6.349   1.00 117.76 ? 45  SER B OG  1 
ATOM   2101  N  N   . GLY B 1 46  ? 60.261  -26.164 7.641   1.00 101.17 ? 46  GLY B N   1 
ATOM   2102  C  CA  . GLY B 1 46  ? 59.745  -24.890 8.141   1.00 99.29  ? 46  GLY B CA  1 
ATOM   2103  C  C   . GLY B 1 46  ? 58.535  -25.076 9.045   1.00 98.12  ? 46  GLY B C   1 
ATOM   2104  O  O   . GLY B 1 46  ? 58.490  -24.550 10.159  1.00 96.52  ? 46  GLY B O   1 
ATOM   2105  N  N   . ALA B 1 47  ? 57.559  -25.842 8.568   1.00 97.38  ? 47  ALA B N   1 
ATOM   2106  C  CA  . ALA B 1 47  ? 56.343  -26.100 9.329   1.00 96.79  ? 47  ALA B CA  1 
ATOM   2107  C  C   . ALA B 1 47  ? 56.663  -26.639 10.725  1.00 99.57  ? 47  ALA B C   1 
ATOM   2108  O  O   . ALA B 1 47  ? 56.114  -26.174 11.723  1.00 106.00 ? 47  ALA B O   1 
ATOM   2109  C  CB  . ALA B 1 47  ? 55.445  -27.067 8.575   1.00 95.53  ? 47  ALA B CB  1 
ATOM   2110  N  N   . LEU B 1 48  ? 57.556  -27.617 10.792  1.00 103.36 ? 48  LEU B N   1 
ATOM   2111  C  CA  . LEU B 1 48  ? 57.913  -28.245 12.064  1.00 105.55 ? 48  LEU B CA  1 
ATOM   2112  C  C   . LEU B 1 48  ? 58.447  -27.204 13.040  1.00 100.64 ? 48  LEU B C   1 
ATOM   2113  O  O   . LEU B 1 48  ? 58.137  -27.232 14.232  1.00 96.61  ? 48  LEU B O   1 
ATOM   2114  C  CB  . LEU B 1 48  ? 58.978  -29.331 11.845  1.00 111.38 ? 48  LEU B CB  1 
ATOM   2115  C  CG  . LEU B 1 48  ? 58.549  -30.589 11.085  1.00 110.15 ? 48  LEU B CG  1 
ATOM   2116  C  CD1 . LEU B 1 48  ? 59.761  -31.401 10.669  1.00 111.45 ? 48  LEU B CD1 1 
ATOM   2117  C  CD2 . LEU B 1 48  ? 57.602  -31.421 11.933  1.00 110.54 ? 48  LEU B CD2 1 
ATOM   2118  N  N   . VAL B 1 49  ? 59.267  -26.298 12.523  1.00 97.02  ? 49  VAL B N   1 
ATOM   2119  C  CA  . VAL B 1 49  ? 59.955  -25.327 13.356  1.00 98.27  ? 49  VAL B CA  1 
ATOM   2120  C  C   . VAL B 1 49  ? 58.985  -24.266 13.866  1.00 97.89  ? 49  VAL B C   1 
ATOM   2121  O  O   . VAL B 1 49  ? 58.947  -23.955 15.061  1.00 97.49  ? 49  VAL B O   1 
ATOM   2122  C  CB  . VAL B 1 49  ? 61.099  -24.653 12.568  1.00 98.87  ? 49  VAL B CB  1 
ATOM   2123  C  CG1 . VAL B 1 49  ? 61.763  -23.553 13.385  1.00 98.45  ? 49  VAL B CG1 1 
ATOM   2124  C  CG2 . VAL B 1 49  ? 62.122  -25.691 12.151  1.00 101.09 ? 49  VAL B CG2 1 
ATOM   2125  N  N   . PHE B 1 50  ? 58.205  -23.699 12.953  1.00 97.56  ? 50  PHE B N   1 
ATOM   2126  C  CA  . PHE B 1 50  ? 57.259  -22.666 13.325  1.00 90.80  ? 50  PHE B CA  1 
ATOM   2127  C  C   . PHE B 1 50  ? 56.267  -23.221 14.326  1.00 88.16  ? 50  PHE B C   1 
ATOM   2128  O  O   . PHE B 1 50  ? 55.914  -22.539 15.279  1.00 92.44  ? 50  PHE B O   1 
ATOM   2129  C  CB  . PHE B 1 50  ? 56.522  -22.140 12.099  1.00 88.85  ? 50  PHE B CB  1 
ATOM   2130  C  CG  . PHE B 1 50  ? 57.336  -21.197 11.251  1.00 88.99  ? 50  PHE B CG  1 
ATOM   2131  C  CD1 . PHE B 1 50  ? 57.934  -20.075 11.807  1.00 86.49  ? 50  PHE B CD1 1 
ATOM   2132  C  CD2 . PHE B 1 50  ? 57.444  -21.397 9.879   1.00 89.20  ? 50  PHE B CD2 1 
ATOM   2133  C  CE1 . PHE B 1 50  ? 58.634  -19.183 11.016  1.00 87.10  ? 50  PHE B CE1 1 
ATOM   2134  C  CE2 . PHE B 1 50  ? 58.144  -20.507 9.083   1.00 87.45  ? 50  PHE B CE2 1 
ATOM   2135  C  CZ  . PHE B 1 50  ? 58.741  -19.399 9.652   1.00 86.48  ? 50  PHE B CZ  1 
ATOM   2136  N  N   . ARG B 1 51  ? 55.813  -24.454 14.111  1.00 86.17  ? 51  ARG B N   1 
ATOM   2137  C  CA  . ARG B 1 51  ? 54.873  -25.064 15.033  1.00 86.20  ? 51  ARG B CA  1 
ATOM   2138  C  C   . ARG B 1 51  ? 55.510  -25.172 16.407  1.00 88.10  ? 51  ARG B C   1 
ATOM   2139  O  O   . ARG B 1 51  ? 54.889  -24.869 17.419  1.00 89.37  ? 51  ARG B O   1 
ATOM   2140  C  CB  . ARG B 1 51  ? 54.429  -26.445 14.562  1.00 88.97  ? 51  ARG B CB  1 
ATOM   2141  C  CG  . ARG B 1 51  ? 53.608  -27.180 15.614  1.00 92.02  ? 51  ARG B CG  1 
ATOM   2142  C  CD  . ARG B 1 51  ? 52.949  -28.432 15.086  1.00 99.18  ? 51  ARG B CD  1 
ATOM   2143  N  NE  . ARG B 1 51  ? 53.933  -29.475 14.812  1.00 111.60 ? 51  ARG B NE  1 
ATOM   2144  C  CZ  . ARG B 1 51  ? 53.648  -30.770 14.783  1.00 118.47 ? 51  ARG B CZ  1 
ATOM   2145  N  NH1 . ARG B 1 51  ? 54.605  -31.650 14.523  1.00 124.43 ? 51  ARG B NH1 1 
ATOM   2146  N  NH2 . ARG B 1 51  ? 52.404  -31.184 15.001  1.00 120.71 ? 51  ARG B NH2 1 
ATOM   2147  N  N   . ALA B 1 52  ? 56.767  -25.584 16.434  1.00 93.77  ? 52  ALA B N   1 
ATOM   2148  C  CA  . ALA B 1 52  ? 57.485  -25.763 17.690  1.00 98.05  ? 52  ALA B CA  1 
ATOM   2149  C  C   . ALA B 1 52  ? 57.654  -24.443 18.435  1.00 97.11  ? 52  ALA B C   1 
ATOM   2150  O  O   . ALA B 1 52  ? 57.645  -24.412 19.670  1.00 94.47  ? 52  ALA B O   1 
ATOM   2151  C  CB  . ALA B 1 52  ? 58.842  -26.383 17.416  1.00 100.99 ? 52  ALA B CB  1 
ATOM   2152  N  N   . LEU B 1 53  ? 57.811  -23.365 17.667  1.00 95.16  ? 53  LEU B N   1 
ATOM   2153  C  CA  . LEU B 1 53  ? 58.098  -22.043 18.212  1.00 93.61  ? 53  LEU B CA  1 
ATOM   2154  C  C   . LEU B 1 53  ? 56.859  -21.183 18.511  1.00 94.06  ? 53  LEU B C   1 
ATOM   2155  O  O   . LEU B 1 53  ? 56.937  -20.238 19.291  1.00 95.35  ? 53  LEU B O   1 
ATOM   2156  C  CB  . LEU B 1 53  ? 58.977  -21.285 17.232  1.00 92.69  ? 53  LEU B CB  1 
ATOM   2157  C  CG  . LEU B 1 53  ? 60.394  -21.825 17.058  1.00 94.97  ? 53  LEU B CG  1 
ATOM   2158  C  CD1 . LEU B 1 53  ? 61.074  -21.133 15.886  1.00 95.56  ? 53  LEU B CD1 1 
ATOM   2159  C  CD2 . LEU B 1 53  ? 61.196  -21.639 18.336  1.00 95.65  ? 53  LEU B CD2 1 
ATOM   2160  N  N   . GLU B 1 54  ? 55.723  -21.503 17.901  1.00 93.07  ? 54  GLU B N   1 
ATOM   2161  C  CA  . GLU B 1 54  ? 54.566  -20.616 17.953  1.00 87.32  ? 54  GLU B CA  1 
ATOM   2162  C  C   . GLU B 1 54  ? 53.341  -21.233 18.591  1.00 86.16  ? 54  GLU B C   1 
ATOM   2163  O  O   . GLU B 1 54  ? 52.570  -20.540 19.257  1.00 85.82  ? 54  GLU B O   1 
ATOM   2164  C  CB  . GLU B 1 54  ? 54.221  -20.132 16.551  1.00 85.91  ? 54  GLU B CB  1 
ATOM   2165  C  CG  . GLU B 1 54  ? 55.294  -19.238 15.952  1.00 90.88  ? 54  GLU B CG  1 
ATOM   2166  C  CD  . GLU B 1 54  ? 55.434  -17.903 16.670  1.00 93.98  ? 54  GLU B CD  1 
ATOM   2167  O  OE1 . GLU B 1 54  ? 54.402  -17.360 17.132  1.00 95.38  ? 54  GLU B OE1 1 
ATOM   2168  O  OE2 . GLU B 1 54  ? 56.570  -17.381 16.751  1.00 94.66  ? 54  GLU B OE2 1 
ATOM   2169  N  N   . GLN B 1 55  ? 53.152  -22.529 18.388  1.00 87.65  ? 55  GLN B N   1 
ATOM   2170  C  CA  . GLN B 1 55  ? 51.928  -23.177 18.824  1.00 87.29  ? 55  GLN B CA  1 
ATOM   2171  C  C   . GLN B 1 55  ? 51.679  -22.998 20.317  1.00 87.41  ? 55  GLN B C   1 
ATOM   2172  O  O   . GLN B 1 55  ? 50.549  -22.738 20.728  1.00 94.19  ? 55  GLN B O   1 
ATOM   2173  C  CB  . GLN B 1 55  ? 51.946  -24.659 18.480  1.00 89.29  ? 55  GLN B CB  1 
ATOM   2174  C  CG  . GLN B 1 55  ? 50.642  -25.355 18.798  1.00 90.84  ? 55  GLN B CG  1 
ATOM   2175  C  CD  . GLN B 1 55  ? 50.447  -26.608 17.986  1.00 97.11  ? 55  GLN B CD  1 
ATOM   2176  O  OE1 . GLN B 1 55  ? 51.286  -27.509 18.012  1.00 104.78 ? 55  GLN B OE1 1 
ATOM   2177  N  NE2 . GLN B 1 55  ? 49.333  -26.679 17.256  1.00 98.10  ? 55  GLN B NE2 1 
ATOM   2178  N  N   . PRO B 1 56  ? 52.729  -23.137 21.139  1.00 88.15  ? 56  PRO B N   1 
ATOM   2179  C  CA  . PRO B 1 56  ? 52.525  -23.038 22.590  1.00 88.84  ? 56  PRO B CA  1 
ATOM   2180  C  C   . PRO B 1 56  ? 51.968  -21.682 23.014  1.00 87.81  ? 56  PRO B C   1 
ATOM   2181  O  O   . PRO B 1 56  ? 51.195  -21.597 23.962  1.00 81.96  ? 56  PRO B O   1 
ATOM   2182  C  CB  . PRO B 1 56  ? 53.928  -23.228 23.171  1.00 88.78  ? 56  PRO B CB  1 
ATOM   2183  C  CG  . PRO B 1 56  ? 54.785  -23.721 22.060  1.00 88.09  ? 56  PRO B CG  1 
ATOM   2184  C  CD  . PRO B 1 56  ? 54.140  -23.347 20.772  1.00 86.92  ? 56  PRO B CD  1 
ATOM   2185  N  N   . HIS B 1 57  ? 52.370  -20.640 22.295  1.00 95.39  ? 57  HIS B N   1 
ATOM   2186  C  CA  . HIS B 1 57  ? 51.962  -19.289 22.599  1.00 101.57 ? 57  HIS B CA  1 
ATOM   2187  C  C   . HIS B 1 57  ? 50.489  -19.169 22.202  1.00 92.85  ? 57  HIS B C   1 
ATOM   2188  O  O   . HIS B 1 57  ? 49.669  -18.615 22.944  1.00 88.17  ? 57  HIS B O   1 
ATOM   2189  C  CB  . HIS B 1 57  ? 52.834  -18.287 21.822  1.00 110.66 ? 57  HIS B CB  1 
ATOM   2190  C  CG  . HIS B 1 57  ? 52.510  -16.851 22.107  1.00 134.17 ? 57  HIS B CG  1 
ATOM   2191  N  ND1 . HIS B 1 57  ? 51.333  -16.254 21.700  1.00 144.68 ? 57  HIS B ND1 1 
ATOM   2192  C  CD2 . HIS B 1 57  ? 53.212  -15.889 22.753  1.00 142.76 ? 57  HIS B CD2 1 
ATOM   2193  C  CE1 . HIS B 1 57  ? 51.322  -14.991 22.090  1.00 138.90 ? 57  HIS B CE1 1 
ATOM   2194  N  NE2 . HIS B 1 57  ? 52.452  -14.742 22.728  1.00 137.05 ? 57  HIS B NE2 1 
ATOM   2195  N  N   . GLU B 1 58  ? 50.162  -19.711 21.033  1.00 85.13  ? 58  GLU B N   1 
ATOM   2196  C  CA  . GLU B 1 58  ? 48.801  -19.673 20.532  1.00 79.92  ? 58  GLU B CA  1 
ATOM   2197  C  C   . GLU B 1 58  ? 47.868  -20.454 21.437  1.00 80.50  ? 58  GLU B C   1 
ATOM   2198  O  O   . GLU B 1 58  ? 46.789  -19.990 21.781  1.00 83.16  ? 58  GLU B O   1 
ATOM   2199  C  CB  . GLU B 1 58  ? 48.723  -20.244 19.130  1.00 80.80  ? 58  GLU B CB  1 
ATOM   2200  C  CG  . GLU B 1 58  ? 47.313  -20.265 18.572  1.00 81.56  ? 58  GLU B CG  1 
ATOM   2201  C  CD  . GLU B 1 58  ? 47.161  -21.243 17.430  1.00 89.30  ? 58  GLU B CD  1 
ATOM   2202  O  OE1 . GLU B 1 58  ? 47.613  -22.406 17.569  1.00 97.41  ? 58  GLU B OE1 1 
ATOM   2203  O  OE2 . GLU B 1 58  ? 46.584  -20.851 16.395  1.00 92.72  ? 58  GLU B OE2 1 
ATOM   2204  N  N   . GLN B 1 59  ? 48.270  -21.649 21.828  1.00 83.94  ? 59  GLN B N   1 
ATOM   2205  C  CA  . GLN B 1 59  ? 47.390  -22.458 22.642  1.00 89.65  ? 59  GLN B CA  1 
ATOM   2206  C  C   . GLN B 1 59  ? 47.108  -21.732 23.953  1.00 87.54  ? 59  GLN B C   1 
ATOM   2207  O  O   . GLN B 1 59  ? 46.019  -21.839 24.499  1.00 92.61  ? 59  GLN B O   1 
ATOM   2208  C  CB  . GLN B 1 59  ? 47.996  -23.828 22.903  1.00 99.20  ? 59  GLN B CB  1 
ATOM   2209  C  CG  . GLN B 1 59  ? 47.778  -24.803 21.765  1.00 106.33 ? 59  GLN B CG  1 
ATOM   2210  C  CD  . GLN B 1 59  ? 48.666  -26.026 21.870  1.00 119.83 ? 59  GLN B CD  1 
ATOM   2211  O  OE1 . GLN B 1 59  ? 49.610  -26.070 22.666  1.00 120.77 ? 59  GLN B OE1 1 
ATOM   2212  N  NE2 . GLN B 1 59  ? 48.372  -27.027 21.052  1.00 137.65 ? 59  GLN B NE2 1 
ATOM   2213  N  N   . GLN B 1 60  ? 48.083  -20.969 24.435  1.00 85.74  ? 60  GLN B N   1 
ATOM   2214  C  CA  . GLN B 1 60  ? 47.909  -20.179 25.650  1.00 86.42  ? 60  GLN B CA  1 
ATOM   2215  C  C   . GLN B 1 60  ? 46.868  -19.083 25.460  1.00 89.32  ? 60  GLN B C   1 
ATOM   2216  O  O   . GLN B 1 60  ? 46.021  -18.863 26.321  1.00 90.31  ? 60  GLN B O   1 
ATOM   2217  C  CB  . GLN B 1 60  ? 49.227  -19.540 26.086  1.00 89.60  ? 60  GLN B CB  1 
ATOM   2218  C  CG  . GLN B 1 60  ? 49.164  -18.877 27.458  1.00 91.21  ? 60  GLN B CG  1 
ATOM   2219  C  CD  . GLN B 1 60  ? 48.472  -19.747 28.494  1.00 93.80  ? 60  GLN B CD  1 
ATOM   2220  O  OE1 . GLN B 1 60  ? 48.639  -20.963 28.501  1.00 108.21 ? 60  GLN B OE1 1 
ATOM   2221  N  NE2 . GLN B 1 60  ? 47.702  -19.128 29.382  1.00 91.21  ? 60  GLN B NE2 1 
ATOM   2222  N  N   . ALA B 1 61  ? 46.944  -18.381 24.336  1.00 91.03  ? 61  ALA B N   1 
ATOM   2223  C  CA  . ALA B 1 61  ? 46.007  -17.307 24.054  1.00 85.23  ? 61  ALA B CA  1 
ATOM   2224  C  C   . ALA B 1 61  ? 44.585  -17.851 24.022  1.00 81.60  ? 61  ALA B C   1 
ATOM   2225  O  O   . ALA B 1 61  ? 43.652  -17.253 24.575  1.00 81.45  ? 61  ALA B O   1 
ATOM   2226  C  CB  . ALA B 1 61  ? 46.351  -16.645 22.728  1.00 84.95  ? 61  ALA B CB  1 
ATOM   2227  N  N   . GLN B 1 62  ? 44.419  -18.975 23.343  1.00 74.54  ? 62  GLN B N   1 
ATOM   2228  C  CA  . GLN B 1 62  ? 43.136  -19.602 23.259  1.00 72.29  ? 62  GLN B CA  1 
ATOM   2229  C  C   . GLN B 1 62  ? 42.641  -19.854 24.669  1.00 72.96  ? 62  GLN B C   1 
ATOM   2230  O  O   . GLN B 1 62  ? 41.489  -19.583 24.976  1.00 79.92  ? 62  GLN B O   1 
ATOM   2231  C  CB  . GLN B 1 62  ? 43.271  -20.900 22.488  1.00 75.96  ? 62  GLN B CB  1 
ATOM   2232  C  CG  . GLN B 1 62  ? 41.968  -21.451 21.962  1.00 78.52  ? 62  GLN B CG  1 
ATOM   2233  C  CD  . GLN B 1 62  ? 41.192  -20.410 21.223  1.00 79.72  ? 62  GLN B CD  1 
ATOM   2234  O  OE1 . GLN B 1 62  ? 41.641  -19.890 20.209  1.00 87.96  ? 62  GLN B OE1 1 
ATOM   2235  N  NE2 . GLN B 1 62  ? 40.038  -20.061 21.752  1.00 88.06  ? 62  GLN B NE2 1 
ATOM   2236  N  N   . ARG B 1 63  ? 43.514  -20.339 25.543  1.00 74.97  ? 63  ARG B N   1 
ATOM   2237  C  CA  . ARG B 1 63  ? 43.127  -20.587 26.927  1.00 78.72  ? 63  ARG B CA  1 
ATOM   2238  C  C   . ARG B 1 63  ? 42.701  -19.321 27.604  1.00 75.85  ? 63  ARG B C   1 
ATOM   2239  O  O   . ARG B 1 63  ? 41.700  -19.305 28.313  1.00 83.13  ? 63  ARG B O   1 
ATOM   2240  C  CB  . ARG B 1 63  ? 44.261  -21.205 27.737  1.00 86.67  ? 63  ARG B CB  1 
ATOM   2241  C  CG  . ARG B 1 63  ? 44.280  -22.720 27.710  1.00 93.51  ? 63  ARG B CG  1 
ATOM   2242  C  CD  . ARG B 1 63  ? 45.264  -23.278 28.723  1.00 100.72 ? 63  ARG B CD  1 
ATOM   2243  N  NE  . ARG B 1 63  ? 46.640  -22.922 28.378  1.00 105.95 ? 63  ARG B NE  1 
ATOM   2244  C  CZ  . ARG B 1 63  ? 47.405  -23.606 27.529  1.00 108.67 ? 63  ARG B CZ  1 
ATOM   2245  N  NH1 . ARG B 1 63  ? 46.941  -24.698 26.933  1.00 115.83 ? 63  ARG B NH1 1 
ATOM   2246  N  NH2 . ARG B 1 63  ? 48.641  -23.197 27.271  1.00 109.47 ? 63  ARG B NH2 1 
ATOM   2247  N  N   . GLU B 1 64  ? 43.465  -18.260 27.402  1.00 74.88  ? 64  GLU B N   1 
ATOM   2248  C  CA  . GLU B 1 64  ? 43.168  -17.003 28.061  1.00 77.51  ? 64  GLU B CA  1 
ATOM   2249  C  C   . GLU B 1 64  ? 41.822  -16.448 27.628  1.00 73.48  ? 64  GLU B C   1 
ATOM   2250  O  O   . GLU B 1 64  ? 41.058  -15.975 28.461  1.00 74.13  ? 64  GLU B O   1 
ATOM   2251  C  CB  . GLU B 1 64  ? 44.292  -16.002 27.845  1.00 85.83  ? 64  GLU B CB  1 
ATOM   2252  C  CG  . GLU B 1 64  ? 45.466  -16.242 28.790  1.00 98.56  ? 64  GLU B CG  1 
ATOM   2253  C  CD  . GLU B 1 64  ? 46.761  -15.574 28.352  1.00 109.65 ? 64  GLU B CD  1 
ATOM   2254  O  OE1 . GLU B 1 64  ? 46.767  -14.901 27.297  1.00 137.57 ? 64  GLU B OE1 1 
ATOM   2255  O  OE2 . GLU B 1 64  ? 47.780  -15.721 29.071  1.00 102.33 ? 64  GLU B OE2 1 
ATOM   2256  N  N   . LEU B 1 65  ? 41.498  -16.560 26.345  1.00 72.50  ? 65  LEU B N   1 
ATOM   2257  C  CA  . LEU B 1 65  ? 40.173  -16.145 25.876  1.00 73.09  ? 65  LEU B CA  1 
ATOM   2258  C  C   . LEU B 1 65  ? 39.061  -16.858 26.642  1.00 73.69  ? 65  LEU B C   1 
ATOM   2259  O  O   . LEU B 1 65  ? 38.097  -16.239 27.101  1.00 76.74  ? 65  LEU B O   1 
ATOM   2260  C  CB  . LEU B 1 65  ? 40.014  -16.410 24.375  1.00 72.31  ? 65  LEU B CB  1 
ATOM   2261  C  CG  . LEU B 1 65  ? 38.671  -15.926 23.826  1.00 73.32  ? 65  LEU B CG  1 
ATOM   2262  C  CD1 . LEU B 1 65  ? 38.587  -14.411 23.960  1.00 74.98  ? 65  LEU B CD1 1 
ATOM   2263  C  CD2 . LEU B 1 65  ? 38.461  -16.347 22.383  1.00 72.58  ? 65  LEU B CD2 1 
ATOM   2264  N  N   . GLY B 1 66  ? 39.196  -18.169 26.768  1.00 73.07  ? 66  GLY B N   1 
ATOM   2265  C  CA  . GLY B 1 66  ? 38.215  -18.960 27.483  1.00 76.27  ? 66  GLY B CA  1 
ATOM   2266  C  C   . GLY B 1 66  ? 38.120  -18.613 28.957  1.00 75.32  ? 66  GLY B C   1 
ATOM   2267  O  O   . GLY B 1 66  ? 37.040  -18.682 29.534  1.00 77.94  ? 66  GLY B O   1 
ATOM   2268  N  N   . GLU B 1 67  ? 39.251  -18.263 29.569  1.00 73.45  ? 67  GLU B N   1 
ATOM   2269  C  CA  . GLU B 1 67  ? 39.273  -17.837 30.970  1.00 75.67  ? 67  GLU B CA  1 
ATOM   2270  C  C   . GLU B 1 67  ? 38.529  -16.512 31.130  1.00 77.80  ? 67  GLU B C   1 
ATOM   2271  O  O   . GLU B 1 67  ? 37.770  -16.304 32.083  1.00 80.13  ? 67  GLU B O   1 
ATOM   2272  C  CB  . GLU B 1 67  ? 40.711  -17.689 31.454  1.00 80.60  ? 67  GLU B CB  1 
ATOM   2273  C  CG  . GLU B 1 67  ? 41.402  -19.016 31.733  1.00 90.72  ? 67  GLU B CG  1 
ATOM   2274  C  CD  . GLU B 1 67  ? 42.926  -18.929 31.702  1.00 103.12 ? 67  GLU B CD  1 
ATOM   2275  O  OE1 . GLU B 1 67  ? 43.471  -17.803 31.639  1.00 108.29 ? 67  GLU B OE1 1 
ATOM   2276  O  OE2 . GLU B 1 67  ? 43.586  -19.996 31.735  1.00 113.99 ? 67  GLU B OE2 1 
ATOM   2277  N  N   . VAL B 1 68  ? 38.719  -15.628 30.165  1.00 75.91  ? 68  VAL B N   1 
ATOM   2278  C  CA  . VAL B 1 68  ? 38.000  -14.386 30.158  1.00 75.81  ? 68  VAL B CA  1 
ATOM   2279  C  C   . VAL B 1 68  ? 36.495  -14.639 30.078  1.00 73.99  ? 68  VAL B C   1 
ATOM   2280  O  O   . VAL B 1 68  ? 35.723  -13.995 30.782  1.00 76.54  ? 68  VAL B O   1 
ATOM   2281  C  CB  . VAL B 1 68  ? 38.465  -13.505 28.996  1.00 78.42  ? 68  VAL B CB  1 
ATOM   2282  C  CG1 . VAL B 1 68  ? 37.475  -12.386 28.744  1.00 87.95  ? 68  VAL B CG1 1 
ATOM   2283  C  CG2 . VAL B 1 68  ? 39.833  -12.940 29.311  1.00 80.68  ? 68  VAL B CG2 1 
ATOM   2284  N  N   . ARG B 1 69  ? 36.065  -15.541 29.205  1.00 69.77  ? 69  ARG B N   1 
ATOM   2285  C  CA  . ARG B 1 69  ? 34.639  -15.813 29.086  1.00 71.60  ? 69  ARG B CA  1 
ATOM   2286  C  C   . ARG B 1 69  ? 34.089  -16.314 30.404  1.00 70.95  ? 69  ARG B C   1 
ATOM   2287  O  O   . ARG B 1 69  ? 33.090  -15.818 30.912  1.00 78.76  ? 69  ARG B O   1 
ATOM   2288  C  CB  . ARG B 1 69  ? 34.365  -16.853 28.008  1.00 76.94  ? 69  ARG B CB  1 
ATOM   2289  C  CG  . ARG B 1 69  ? 34.563  -16.336 26.604  1.00 89.85  ? 69  ARG B CG  1 
ATOM   2290  C  CD  . ARG B 1 69  ? 33.854  -17.199 25.573  1.00 95.02  ? 69  ARG B CD  1 
ATOM   2291  N  NE  . ARG B 1 69  ? 34.174  -18.597 25.770  1.00 108.50 ? 69  ARG B NE  1 
ATOM   2292  C  CZ  . ARG B 1 69  ? 33.441  -19.423 26.506  1.00 133.56 ? 69  ARG B CZ  1 
ATOM   2293  N  NH1 . ARG B 1 69  ? 32.329  -18.982 27.077  1.00 119.48 ? 69  ARG B NH1 1 
ATOM   2294  N  NH2 . ARG B 1 69  ? 33.818  -20.692 26.664  1.00 150.46 ? 69  ARG B NH2 1 
ATOM   2295  N  N   . GLU B 1 70  ? 34.741  -17.319 30.954  1.00 72.97  ? 70  GLU B N   1 
ATOM   2296  C  CA  . GLU B 1 70  ? 34.209  -18.007 32.098  1.00 75.59  ? 70  GLU B CA  1 
ATOM   2297  C  C   . GLU B 1 70  ? 34.167  -17.081 33.285  1.00 74.27  ? 70  GLU B C   1 
ATOM   2298  O  O   . GLU B 1 70  ? 33.264  -17.162 34.110  1.00 74.97  ? 70  GLU B O   1 
ATOM   2299  C  CB  . GLU B 1 70  ? 35.059  -19.227 32.401  1.00 86.50  ? 70  GLU B CB  1 
ATOM   2300  C  CG  . GLU B 1 70  ? 34.840  -20.364 31.413  1.00 95.29  ? 70  GLU B CG  1 
ATOM   2301  C  CD  . GLU B 1 70  ? 35.683  -21.584 31.735  1.00 106.19 ? 70  GLU B CD  1 
ATOM   2302  O  OE1 . GLU B 1 70  ? 36.903  -21.557 31.431  1.00 107.08 ? 70  GLU B OE1 1 
ATOM   2303  O  OE2 . GLU B 1 70  ? 35.121  -22.561 32.293  1.00 99.00  ? 70  GLU B OE2 1 
ATOM   2304  N  N   . LYS B 1 71  ? 35.126  -16.169 33.341  1.00 75.71  ? 71  LYS B N   1 
ATOM   2305  C  CA  . LYS B 1 71  ? 35.178  -15.163 34.405  1.00 76.46  ? 71  LYS B CA  1 
ATOM   2306  C  C   . LYS B 1 71  ? 34.003  -14.178 34.320  1.00 69.94  ? 71  LYS B C   1 
ATOM   2307  O  O   . LYS B 1 71  ? 33.405  -13.809 35.334  1.00 62.61  ? 71  LYS B O   1 
ATOM   2308  C  CB  . LYS B 1 71  ? 36.502  -14.416 34.318  1.00 80.82  ? 71  LYS B CB  1 
ATOM   2309  C  CG  . LYS B 1 71  ? 36.977  -13.838 35.625  1.00 93.62  ? 71  LYS B CG  1 
ATOM   2310  C  CD  . LYS B 1 71  ? 38.028  -12.774 35.357  1.00 114.64 ? 71  LYS B CD  1 
ATOM   2311  C  CE  . LYS B 1 71  ? 38.365  -11.986 36.611  1.00 130.10 ? 71  LYS B CE  1 
ATOM   2312  N  NZ  . LYS B 1 71  ? 39.415  -12.671 37.413  1.00 135.25 ? 71  LYS B NZ  1 
ATOM   2313  N  N   . PHE B 1 72  ? 33.678  -13.787 33.091  1.00 69.17  ? 72  PHE B N   1 
ATOM   2314  C  CA  . PHE B 1 72  ? 32.604  -12.833 32.809  1.00 66.66  ? 72  PHE B CA  1 
ATOM   2315  C  C   . PHE B 1 72  ? 31.263  -13.443 33.145  1.00 63.30  ? 72  PHE B C   1 
ATOM   2316  O  O   . PHE B 1 72  ? 30.394  -12.777 33.684  1.00 63.75  ? 72  PHE B O   1 
ATOM   2317  C  CB  . PHE B 1 72  ? 32.621  -12.428 31.327  1.00 67.25  ? 72  PHE B CB  1 
ATOM   2318  C  CG  . PHE B 1 72  ? 31.911  -11.128 31.039  1.00 68.14  ? 72  PHE B CG  1 
ATOM   2319  C  CD1 . PHE B 1 72  ? 32.508  -9.915  31.335  1.00 70.13  ? 72  PHE B CD1 1 
ATOM   2320  C  CD2 . PHE B 1 72  ? 30.665  -11.121 30.455  1.00 71.46  ? 72  PHE B CD2 1 
ATOM   2321  C  CE1 . PHE B 1 72  ? 31.866  -8.722  31.072  1.00 70.19  ? 72  PHE B CE1 1 
ATOM   2322  C  CE2 . PHE B 1 72  ? 30.014  -9.926  30.181  1.00 72.63  ? 72  PHE B CE2 1 
ATOM   2323  C  CZ  . PHE B 1 72  ? 30.613  -8.727  30.501  1.00 71.22  ? 72  PHE B CZ  1 
ATOM   2324  N  N   . LEU B 1 73  ? 31.092  -14.713 32.815  1.00 61.65  ? 73  LEU B N   1 
ATOM   2325  C  CA  . LEU B 1 73  ? 29.847  -15.384 33.098  1.00 62.07  ? 73  LEU B CA  1 
ATOM   2326  C  C   . LEU B 1 73  ? 29.608  -15.433 34.592  1.00 63.61  ? 73  LEU B C   1 
ATOM   2327  O  O   . LEU B 1 73  ? 28.496  -15.219 35.069  1.00 67.21  ? 73  LEU B O   1 
ATOM   2328  C  CB  . LEU B 1 73  ? 29.859  -16.794 32.529  1.00 60.99  ? 73  LEU B CB  1 
ATOM   2329  C  CG  . LEU B 1 73  ? 29.751  -16.795 31.015  1.00 63.28  ? 73  LEU B CG  1 
ATOM   2330  C  CD1 . LEU B 1 73  ? 29.875  -18.208 30.501  1.00 67.15  ? 73  LEU B CD1 1 
ATOM   2331  C  CD2 . LEU B 1 73  ? 28.434  -16.201 30.563  1.00 67.34  ? 73  LEU B CD2 1 
ATOM   2332  N  N   . ARG B 1 74  ? 30.654  -15.723 35.340  1.00 63.54  ? 74  ARG B N   1 
ATOM   2333  C  CA  . ARG B 1 74  ? 30.506  -15.855 36.766  1.00 64.50  ? 74  ARG B CA  1 
ATOM   2334  C  C   . ARG B 1 74  ? 30.149  -14.517 37.376  1.00 66.27  ? 74  ARG B C   1 
ATOM   2335  O  O   . ARG B 1 74  ? 29.515  -14.479 38.416  1.00 69.86  ? 74  ARG B O   1 
ATOM   2336  C  CB  . ARG B 1 74  ? 31.788  -16.422 37.377  1.00 67.39  ? 74  ARG B CB  1 
ATOM   2337  C  CG  . ARG B 1 74  ? 31.823  -17.943 37.403  1.00 69.23  ? 74  ARG B CG  1 
ATOM   2338  C  CD  . ARG B 1 74  ? 33.233  -18.509 37.367  1.00 70.49  ? 74  ARG B CD  1 
ATOM   2339  N  NE  . ARG B 1 74  ? 33.217  -19.962 37.222  1.00 71.60  ? 74  ARG B NE  1 
ATOM   2340  C  CZ  . ARG B 1 74  ? 32.960  -20.596 36.081  1.00 70.35  ? 74  ARG B CZ  1 
ATOM   2341  N  NH1 . ARG B 1 74  ? 32.694  -19.913 34.978  1.00 67.42  ? 74  ARG B NH1 1 
ATOM   2342  N  NH2 . ARG B 1 74  ? 32.961  -21.919 36.046  1.00 72.74  ? 74  ARG B NH2 1 
ATOM   2343  N  N   . ALA B 1 75  ? 30.545  -13.420 36.727  1.00 69.07  ? 75  ALA B N   1 
ATOM   2344  C  CA  . ALA B 1 75  ? 30.259  -12.061 37.234  1.00 69.69  ? 75  ALA B CA  1 
ATOM   2345  C  C   . ALA B 1 75  ? 28.961  -11.450 36.701  1.00 71.69  ? 75  ALA B C   1 
ATOM   2346  O  O   . ALA B 1 75  ? 28.498  -10.433 37.214  1.00 75.90  ? 75  ALA B O   1 
ATOM   2347  C  CB  . ALA B 1 75  ? 31.406  -11.127 36.902  1.00 69.92  ? 75  ALA B CB  1 
ATOM   2348  N  N   . HIS B 1 76  ? 28.399  -12.033 35.649  1.00 70.29  ? 76  HIS B N   1 
ATOM   2349  C  CA  . HIS B 1 76  ? 27.220  -11.453 35.014  1.00 66.13  ? 76  HIS B CA  1 
ATOM   2350  C  C   . HIS B 1 76  ? 26.177  -12.507 34.673  1.00 63.32  ? 76  HIS B C   1 
ATOM   2351  O  O   . HIS B 1 76  ? 26.065  -12.946 33.527  1.00 63.54  ? 76  HIS B O   1 
ATOM   2352  C  CB  . HIS B 1 76  ? 27.637  -10.687 33.774  1.00 65.52  ? 76  HIS B CB  1 
ATOM   2353  C  CG  . HIS B 1 76  ? 28.670  -9.647  34.047  1.00 65.77  ? 76  HIS B CG  1 
ATOM   2354  N  ND1 . HIS B 1 76  ? 28.417  -8.540  34.823  1.00 68.75  ? 76  HIS B ND1 1 
ATOM   2355  C  CD2 . HIS B 1 76  ? 29.974  -9.575  33.701  1.00 65.99  ? 76  HIS B CD2 1 
ATOM   2356  C  CE1 . HIS B 1 76  ? 29.511  -7.803  34.903  1.00 69.60  ? 76  HIS B CE1 1 
ATOM   2357  N  NE2 . HIS B 1 76  ? 30.470  -8.409  34.231  1.00 67.90  ? 76  HIS B NE2 1 
ATOM   2358  N  N   . PRO B 1 77  ? 25.401  -12.911 35.680  1.00 60.62  ? 77  PRO B N   1 
ATOM   2359  C  CA  . PRO B 1 77  ? 24.428  -13.974 35.524  1.00 61.29  ? 77  PRO B CA  1 
ATOM   2360  C  C   . PRO B 1 77  ? 23.397  -13.713 34.445  1.00 63.93  ? 77  PRO B C   1 
ATOM   2361  O  O   . PRO B 1 77  ? 22.754  -14.653 33.993  1.00 66.50  ? 77  PRO B O   1 
ATOM   2362  C  CB  . PRO B 1 77  ? 23.754  -14.051 36.899  1.00 60.63  ? 77  PRO B CB  1 
ATOM   2363  C  CG  . PRO B 1 77  ? 24.240  -12.874 37.661  1.00 61.06  ? 77  PRO B CG  1 
ATOM   2364  C  CD  . PRO B 1 77  ? 25.552  -12.503 37.081  1.00 59.69  ? 77  PRO B CD  1 
ATOM   2365  N  N   . CYS B 1 78  ? 23.228  -12.460 34.035  1.00 67.50  ? 78  CYS B N   1 
ATOM   2366  C  CA  . CYS B 1 78  ? 22.202  -12.143 33.059  1.00 71.75  ? 78  CYS B CA  1 
ATOM   2367  C  C   . CYS B 1 78  ? 22.638  -12.531 31.640  1.00 68.47  ? 78  CYS B C   1 
ATOM   2368  O  O   . CYS B 1 78  ? 21.923  -12.310 30.677  1.00 70.71  ? 78  CYS B O   1 
ATOM   2369  C  CB  . CYS B 1 78  ? 21.749  -10.675 33.193  1.00 80.47  ? 78  CYS B CB  1 
ATOM   2370  S  SG  . CYS B 1 78  ? 22.892  -9.330  32.734  1.00 98.49  ? 78  CYS B SG  1 
ATOM   2371  N  N   . VAL B 1 79  ? 23.782  -13.193 31.531  1.00 67.68  ? 79  VAL B N   1 
ATOM   2372  C  CA  . VAL B 1 79  ? 24.383  -13.486 30.233  1.00 68.06  ? 79  VAL B CA  1 
ATOM   2373  C  C   . VAL B 1 79  ? 24.618  -14.976 30.052  1.00 68.42  ? 79  VAL B C   1 
ATOM   2374  O  O   . VAL B 1 79  ? 25.341  -15.581 30.833  1.00 67.59  ? 79  VAL B O   1 
ATOM   2375  C  CB  . VAL B 1 79  ? 25.767  -12.825 30.110  1.00 65.40  ? 79  VAL B CB  1 
ATOM   2376  C  CG1 . VAL B 1 79  ? 26.313  -13.048 28.723  1.00 66.86  ? 79  VAL B CG1 1 
ATOM   2377  C  CG2 . VAL B 1 79  ? 25.706  -11.341 30.413  1.00 66.57  ? 79  VAL B CG2 1 
ATOM   2378  N  N   . SER B 1 80  ? 24.053  -15.565 29.006  1.00 69.99  ? 80  SER B N   1 
ATOM   2379  C  CA  . SER B 1 80  ? 24.348  -16.957 28.692  1.00 69.52  ? 80  SER B CA  1 
ATOM   2380  C  C   . SER B 1 80  ? 25.709  -17.069 28.033  1.00 71.00  ? 80  SER B C   1 
ATOM   2381  O  O   . SER B 1 80  ? 26.156  -16.139 27.381  1.00 73.01  ? 80  SER B O   1 
ATOM   2382  C  CB  . SER B 1 80  ? 23.276  -17.557 27.779  1.00 71.06  ? 80  SER B CB  1 
ATOM   2383  O  OG  . SER B 1 80  ? 23.243  -16.931 26.509  1.00 70.55  ? 80  SER B OG  1 
ATOM   2384  N  N   . ASP B 1 81  ? 26.362  -18.213 28.206  1.00 75.27  ? 81  ASP B N   1 
ATOM   2385  C  CA  . ASP B 1 81  ? 27.594  -18.518 27.493  1.00 75.39  ? 81  ASP B CA  1 
ATOM   2386  C  C   . ASP B 1 81  ? 27.405  -18.268 26.007  1.00 72.74  ? 81  ASP B C   1 
ATOM   2387  O  O   . ASP B 1 81  ? 28.233  -17.649 25.365  1.00 71.34  ? 81  ASP B O   1 
ATOM   2388  C  CB  . ASP B 1 81  ? 27.977  -19.983 27.725  1.00 86.78  ? 81  ASP B CB  1 
ATOM   2389  C  CG  . ASP B 1 81  ? 29.333  -20.354 27.123  1.00 100.68 ? 81  ASP B CG  1 
ATOM   2390  O  OD1 . ASP B 1 81  ? 30.143  -19.443 26.840  1.00 125.87 ? 81  ASP B OD1 1 
ATOM   2391  O  OD2 . ASP B 1 81  ? 29.604  -21.568 26.968  1.00 102.69 ? 81  ASP B OD2 1 
ATOM   2392  N  N   . GLN B 1 82  ? 26.293  -18.734 25.466  1.00 74.92  ? 82  GLN B N   1 
ATOM   2393  C  CA  . GLN B 1 82  ? 26.082  -18.696 24.035  1.00 76.85  ? 82  GLN B CA  1 
ATOM   2394  C  C   . GLN B 1 82  ? 25.934  -17.262 23.568  1.00 74.70  ? 82  GLN B C   1 
ATOM   2395  O  O   . GLN B 1 82  ? 26.402  -16.905 22.493  1.00 78.55  ? 82  GLN B O   1 
ATOM   2396  C  CB  . GLN B 1 82  ? 24.844  -19.513 23.671  1.00 83.04  ? 82  GLN B CB  1 
ATOM   2397  C  CG  . GLN B 1 82  ? 25.004  -21.012 23.908  1.00 87.48  ? 82  GLN B CG  1 
ATOM   2398  C  CD  . GLN B 1 82  ? 24.764  -21.452 25.352  1.00 90.72  ? 82  GLN B CD  1 
ATOM   2399  O  OE1 . GLN B 1 82  ? 24.892  -20.665 26.296  1.00 93.40  ? 82  GLN B OE1 1 
ATOM   2400  N  NE2 . GLN B 1 82  ? 24.450  -22.732 25.530  1.00 91.90  ? 82  GLN B NE2 1 
ATOM   2401  N  N   . GLU B 1 83  ? 25.288  -16.436 24.382  1.00 73.95  ? 83  GLU B N   1 
ATOM   2402  C  CA  . GLU B 1 83  ? 25.136  -15.022 24.061  1.00 73.62  ? 83  GLU B CA  1 
ATOM   2403  C  C   . GLU B 1 83  ? 26.495  -14.316 24.069  1.00 72.16  ? 83  GLU B C   1 
ATOM   2404  O  O   . GLU B 1 83  ? 26.796  -13.520 23.186  1.00 76.38  ? 83  GLU B O   1 
ATOM   2405  C  CB  . GLU B 1 83  ? 24.179  -14.343 25.045  1.00 74.32  ? 83  GLU B CB  1 
ATOM   2406  C  CG  . GLU B 1 83  ? 22.698  -14.526 24.721  1.00 78.12  ? 83  GLU B CG  1 
ATOM   2407  C  CD  . GLU B 1 83  ? 21.791  -14.021 25.834  1.00 80.56  ? 83  GLU B CD  1 
ATOM   2408  O  OE1 . GLU B 1 83  ? 21.886  -14.550 26.959  1.00 86.13  ? 83  GLU B OE1 1 
ATOM   2409  O  OE2 . GLU B 1 83  ? 20.994  -13.087 25.597  1.00 80.42  ? 83  GLU B OE2 1 
ATOM   2410  N  N   . LEU B 1 84  ? 27.316  -14.622 25.065  1.00 67.32  ? 84  LEU B N   1 
ATOM   2411  C  CA  . LEU B 1 84  ? 28.647  -14.051 25.172  1.00 63.78  ? 84  LEU B CA  1 
ATOM   2412  C  C   . LEU B 1 84  ? 29.484  -14.481 23.982  1.00 66.87  ? 84  LEU B C   1 
ATOM   2413  O  O   . LEU B 1 84  ? 30.354  -13.760 23.499  1.00 66.30  ? 84  LEU B O   1 
ATOM   2414  C  CB  . LEU B 1 84  ? 29.297  -14.544 26.453  1.00 61.90  ? 84  LEU B CB  1 
ATOM   2415  C  CG  . LEU B 1 84  ? 30.684  -14.016 26.768  1.00 62.35  ? 84  LEU B CG  1 
ATOM   2416  C  CD1 . LEU B 1 84  ? 30.681  -12.503 26.741  1.00 65.98  ? 84  LEU B CD1 1 
ATOM   2417  C  CD2 . LEU B 1 84  ? 31.125  -14.516 28.131  1.00 62.52  ? 84  LEU B CD2 1 
ATOM   2418  N  N   . GLY B 1 85  ? 29.209  -15.678 23.499  1.00 71.89  ? 85  GLY B N   1 
ATOM   2419  C  CA  . GLY B 1 85  ? 29.895  -16.183 22.323  1.00 77.37  ? 85  GLY B CA  1 
ATOM   2420  C  C   . GLY B 1 85  ? 29.678  -15.303 21.113  1.00 78.05  ? 85  GLY B C   1 
ATOM   2421  O  O   . GLY B 1 85  ? 30.633  -14.943 20.427  1.00 79.15  ? 85  GLY B O   1 
ATOM   2422  N  N   . LEU B 1 86  ? 28.424  -14.938 20.861  1.00 79.06  ? 86  LEU B N   1 
ATOM   2423  C  CA  . LEU B 1 86  ? 28.100  -14.092 19.718  1.00 79.66  ? 86  LEU B CA  1 
ATOM   2424  C  C   . LEU B 1 86  ? 28.777  -12.737 19.871  1.00 79.05  ? 86  LEU B C   1 
ATOM   2425  O  O   . LEU B 1 86  ? 29.240  -12.159 18.896  1.00 77.70  ? 86  LEU B O   1 
ATOM   2426  C  CB  . LEU B 1 86  ? 26.592  -13.904 19.588  1.00 81.65  ? 86  LEU B CB  1 
ATOM   2427  C  CG  . LEU B 1 86  ? 25.834  -15.205 19.397  1.00 91.07  ? 86  LEU B CG  1 
ATOM   2428  C  CD1 . LEU B 1 86  ? 24.325  -15.013 19.463  1.00 95.91  ? 86  LEU B CD1 1 
ATOM   2429  C  CD2 . LEU B 1 86  ? 26.245  -15.818 18.068  1.00 98.56  ? 86  LEU B CD2 1 
ATOM   2430  N  N   . LEU B 1 87  ? 28.824  -12.228 21.097  1.00 76.11  ? 87  LEU B N   1 
ATOM   2431  C  CA  . LEU B 1 87  ? 29.387  -10.918 21.334  1.00 76.73  ? 87  LEU B CA  1 
ATOM   2432  C  C   . LEU B 1 87  ? 30.820  -10.937 20.895  1.00 77.92  ? 87  LEU B C   1 
ATOM   2433  O  O   . LEU B 1 87  ? 31.281  -10.028 20.197  1.00 77.06  ? 87  LEU B O   1 
ATOM   2434  C  CB  . LEU B 1 87  ? 29.323  -10.550 22.812  1.00 79.47  ? 87  LEU B CB  1 
ATOM   2435  C  CG  . LEU B 1 87  ? 30.133  -9.303  23.178  1.00 79.68  ? 87  LEU B CG  1 
ATOM   2436  C  CD1 . LEU B 1 87  ? 29.465  -8.072  22.593  1.00 81.45  ? 87  LEU B CD1 1 
ATOM   2437  C  CD2 . LEU B 1 87  ? 30.279  -9.159  24.680  1.00 78.47  ? 87  LEU B CD2 1 
ATOM   2438  N  N   . ILE B 1 88  ? 31.522  -11.990 21.307  1.00 79.38  ? 88  ILE B N   1 
ATOM   2439  C  CA  . ILE B 1 88  ? 32.952  -12.092 21.063  1.00 73.19  ? 88  ILE B CA  1 
ATOM   2440  C  C   . ILE B 1 88  ? 33.230  -12.282 19.597  1.00 70.70  ? 88  ILE B C   1 
ATOM   2441  O  O   . ILE B 1 88  ? 34.142  -11.670 19.067  1.00 72.22  ? 88  ILE B O   1 
ATOM   2442  C  CB  . ILE B 1 88  ? 33.578  -13.256 21.805  1.00 69.92  ? 88  ILE B CB  1 
ATOM   2443  C  CG1 . ILE B 1 88  ? 33.749  -12.888 23.259  1.00 71.04  ? 88  ILE B CG1 1 
ATOM   2444  C  CG2 . ILE B 1 88  ? 34.939  -13.562 21.234  1.00 71.98  ? 88  ILE B CG2 1 
ATOM   2445  C  CD1 . ILE B 1 88  ? 33.953  -14.097 24.125  1.00 71.87  ? 88  ILE B CD1 1 
ATOM   2446  N  N   . LYS B 1 89  ? 32.423  -13.086 18.924  1.00 70.51  ? 89  LYS B N   1 
ATOM   2447  C  CA  . LYS B 1 89  ? 32.586  -13.183 17.508  1.00 78.55  ? 89  LYS B CA  1 
ATOM   2448  C  C   . LYS B 1 89  ? 32.394  -11.795 16.894  1.00 81.05  ? 89  LYS B C   1 
ATOM   2449  O  O   . LYS B 1 89  ? 33.214  -11.365 16.094  1.00 84.08  ? 89  LYS B O   1 
ATOM   2450  C  CB  . LYS B 1 89  ? 31.636  -14.195 16.884  1.00 89.93  ? 89  LYS B CB  1 
ATOM   2451  C  CG  . LYS B 1 89  ? 31.535  -14.021 15.380  1.00 111.49 ? 89  LYS B CG  1 
ATOM   2452  C  CD  . LYS B 1 89  ? 30.973  -15.250 14.695  1.00 138.53 ? 89  LYS B CD  1 
ATOM   2453  C  CE  . LYS B 1 89  ? 31.177  -15.183 13.189  1.00 161.66 ? 89  LYS B CE  1 
ATOM   2454  N  NZ  . LYS B 1 89  ? 30.855  -16.473 12.520  1.00 186.05 ? 89  LYS B NZ  1 
ATOM   2455  N  N   . GLU B 1 90  ? 31.330  -11.085 17.264  1.00 81.50  ? 90  GLU B N   1 
ATOM   2456  C  CA  . GLU B 1 90  ? 31.038  -9.802  16.633  1.00 85.41  ? 90  GLU B CA  1 
ATOM   2457  C  C   . GLU B 1 90  ? 32.131  -8.784  16.936  1.00 81.69  ? 90  GLU B C   1 
ATOM   2458  O  O   . GLU B 1 90  ? 32.510  -7.995  16.068  1.00 82.19  ? 90  GLU B O   1 
ATOM   2459  C  CB  . GLU B 1 90  ? 29.678  -9.259  17.070  1.00 95.38  ? 90  GLU B CB  1 
ATOM   2460  C  CG  . GLU B 1 90  ? 28.497  -9.897  16.352  1.00 107.78 ? 90  GLU B CG  1 
ATOM   2461  C  CD  . GLU B 1 90  ? 27.153  -9.397  16.866  1.00 123.94 ? 90  GLU B CD  1 
ATOM   2462  O  OE1 . GLU B 1 90  ? 26.527  -8.571  16.167  1.00 138.89 ? 90  GLU B OE1 1 
ATOM   2463  O  OE2 . GLU B 1 90  ? 26.718  -9.820  17.965  1.00 122.31 ? 90  GLU B OE2 1 
ATOM   2464  N  N   . VAL B 1 91  ? 32.640  -8.799  18.160  1.00 76.28  ? 91  VAL B N   1 
ATOM   2465  C  CA  . VAL B 1 91  ? 33.747  -7.916  18.518  1.00 76.58  ? 91  VAL B CA  1 
ATOM   2466  C  C   . VAL B 1 91  ? 34.979  -8.247  17.694  1.00 76.72  ? 91  VAL B C   1 
ATOM   2467  O  O   . VAL B 1 91  ? 35.626  -7.362  17.149  1.00 77.65  ? 91  VAL B O   1 
ATOM   2468  C  CB  . VAL B 1 91  ? 34.111  -8.029  20.006  1.00 77.07  ? 91  VAL B CB  1 
ATOM   2469  C  CG1 . VAL B 1 91  ? 35.531  -7.536  20.256  1.00 75.85  ? 91  VAL B CG1 1 
ATOM   2470  C  CG2 . VAL B 1 91  ? 33.114  -7.254  20.852  1.00 80.41  ? 91  VAL B CG2 1 
ATOM   2471  N  N   . ALA B 1 92  ? 35.290  -9.530  17.588  1.00 75.52  ? 92  ALA B N   1 
ATOM   2472  C  CA  . ALA B 1 92  ? 36.436  -9.958  16.813  1.00 73.07  ? 92  ALA B CA  1 
ATOM   2473  C  C   . ALA B 1 92  ? 36.350  -9.489  15.372  1.00 72.78  ? 92  ALA B C   1 
ATOM   2474  O  O   . ALA B 1 92  ? 37.313  -8.970  14.845  1.00 73.13  ? 92  ALA B O   1 
ATOM   2475  C  CB  . ALA B 1 92  ? 36.566  -11.463 16.852  1.00 75.28  ? 92  ALA B CB  1 
ATOM   2476  N  N   . ASP B 1 93  ? 35.202  -9.658  14.733  1.00 75.14  ? 93  ASP B N   1 
ATOM   2477  C  CA  . ASP B 1 93  ? 35.045  -9.207  13.355  1.00 83.53  ? 93  ASP B CA  1 
ATOM   2478  C  C   . ASP B 1 93  ? 35.351  -7.709  13.203  1.00 85.62  ? 93  ASP B C   1 
ATOM   2479  O  O   . ASP B 1 93  ? 36.040  -7.301  12.273  1.00 89.65  ? 93  ASP B O   1 
ATOM   2480  C  CB  . ASP B 1 93  ? 33.632  -9.501  12.850  1.00 95.78  ? 93  ASP B CB  1 
ATOM   2481  C  CG  . ASP B 1 93  ? 33.353  -10.995 12.720  1.00 105.83 ? 93  ASP B CG  1 
ATOM   2482  O  OD1 . ASP B 1 93  ? 34.317  -11.790 12.724  1.00 126.77 ? 93  ASP B OD1 1 
ATOM   2483  O  OD2 . ASP B 1 93  ? 32.166  -11.374 12.616  1.00 114.54 ? 93  ASP B OD2 1 
ATOM   2484  N  N   . ALA B 1 94  ? 34.838  -6.888  14.109  1.00 84.59  ? 94  ALA B N   1 
ATOM   2485  C  CA  . ALA B 1 94  ? 35.100  -5.458  14.046  1.00 84.11  ? 94  ALA B CA  1 
ATOM   2486  C  C   . ALA B 1 94  ? 36.568  -5.149  14.274  1.00 82.80  ? 94  ALA B C   1 
ATOM   2487  O  O   . ALA B 1 94  ? 37.118  -4.301  13.593  1.00 90.34  ? 94  ALA B O   1 
ATOM   2488  C  CB  . ALA B 1 94  ? 34.250  -4.706  15.052  1.00 86.79  ? 94  ALA B CB  1 
ATOM   2489  N  N   . LEU B 1 95  ? 37.205  -5.817  15.232  1.00 82.40  ? 95  LEU B N   1 
ATOM   2490  C  CA  . LEU B 1 95  ? 38.635  -5.590  15.494  1.00 82.26  ? 95  LEU B CA  1 
ATOM   2491  C  C   . LEU B 1 95  ? 39.425  -6.007  14.269  1.00 81.21  ? 95  LEU B C   1 
ATOM   2492  O  O   . LEU B 1 95  ? 40.361  -5.332  13.848  1.00 82.09  ? 95  LEU B O   1 
ATOM   2493  C  CB  . LEU B 1 95  ? 39.113  -6.394  16.699  1.00 82.34  ? 95  LEU B CB  1 
ATOM   2494  C  CG  . LEU B 1 95  ? 38.438  -6.051  18.025  1.00 85.31  ? 95  LEU B CG  1 
ATOM   2495  C  CD1 . LEU B 1 95  ? 38.725  -7.112  19.075  1.00 85.75  ? 95  LEU B CD1 1 
ATOM   2496  C  CD2 . LEU B 1 95  ? 38.860  -4.678  18.510  1.00 85.05  ? 95  LEU B CD2 1 
ATOM   2497  N  N   . GLY B 1 96  ? 38.996  -7.108  13.669  1.00 79.76  ? 96  GLY B N   1 
ATOM   2498  C  CA  . GLY B 1 96  ? 39.616  -7.609  12.457  1.00 80.04  ? 96  GLY B CA  1 
ATOM   2499  C  C   . GLY B 1 96  ? 39.479  -6.639  11.313  1.00 80.29  ? 96  GLY B C   1 
ATOM   2500  O  O   . GLY B 1 96  ? 40.285  -6.647  10.401  1.00 81.67  ? 96  GLY B O   1 
ATOM   2501  N  N   . GLY B 1 97  ? 38.439  -5.817  11.353  1.00 83.97  ? 97  GLY B N   1 
ATOM   2502  C  CA  . GLY B 1 97  ? 38.278  -4.718  10.406  1.00 88.18  ? 97  GLY B CA  1 
ATOM   2503  C  C   . GLY B 1 97  ? 38.993  -3.441  10.829  1.00 91.74  ? 97  GLY B C   1 
ATOM   2504  O  O   . GLY B 1 97  ? 38.895  -2.418  10.152  1.00 100.15 ? 97  GLY B O   1 
ATOM   2505  N  N   . GLY B 1 98  ? 39.707  -3.490  11.949  1.00 91.08  ? 98  GLY B N   1 
ATOM   2506  C  CA  . GLY B 1 98  ? 40.577  -2.392  12.347  1.00 95.13  ? 98  GLY B CA  1 
ATOM   2507  C  C   . GLY B 1 98  ? 39.944  -1.441  13.341  1.00 97.41  ? 98  GLY B C   1 
ATOM   2508  O  O   . GLY B 1 98  ? 40.352  -0.281  13.458  1.00 109.52 ? 98  GLY B O   1 
ATOM   2509  N  N   . ALA B 1 99  ? 38.934  -1.916  14.053  1.00 93.90  ? 99  ALA B N   1 
ATOM   2510  C  CA  . ALA B 1 99  ? 38.405  -1.160  15.180  1.00 95.73  ? 99  ALA B CA  1 
ATOM   2511  C  C   . ALA B 1 99  ? 39.390  -1.225  16.344  1.00 92.32  ? 99  ALA B C   1 
ATOM   2512  O  O   . ALA B 1 99  ? 40.117  -2.200  16.498  1.00 94.32  ? 99  ALA B O   1 
ATOM   2513  C  CB  . ALA B 1 99  ? 37.044  -1.696  15.589  1.00 97.22  ? 99  ALA B CB  1 
ATOM   2514  N  N   . ASP B 1 100 ? 39.425  -0.171  17.144  1.00 93.09  ? 100 ASP B N   1 
ATOM   2515  C  CA  . ASP B 1 100 ? 40.343  -0.086  18.272  1.00 97.85  ? 100 ASP B CA  1 
ATOM   2516  C  C   . ASP B 1 100 ? 39.571  -0.215  19.590  1.00 101.97 ? 100 ASP B C   1 
ATOM   2517  O  O   . ASP B 1 100 ? 38.664  0.567   19.870  1.00 111.15 ? 100 ASP B O   1 
ATOM   2518  C  CB  . ASP B 1 100 ? 41.129  1.231   18.216  1.00 105.54 ? 100 ASP B CB  1 
ATOM   2519  C  CG  . ASP B 1 100 ? 41.860  1.550   19.517  1.00 114.31 ? 100 ASP B CG  1 
ATOM   2520  O  OD1 . ASP B 1 100 ? 42.183  0.613   20.278  1.00 123.02 ? 100 ASP B OD1 1 
ATOM   2521  O  OD2 . ASP B 1 100 ? 42.123  2.748   19.778  1.00 126.19 ? 100 ASP B OD2 1 
ATOM   2522  N  N   . PRO B 1 101 ? 39.937  -1.208  20.410  1.00 98.40  ? 101 PRO B N   1 
ATOM   2523  C  CA  . PRO B 1 101 ? 39.280  -1.495  21.683  1.00 100.73 ? 101 PRO B CA  1 
ATOM   2524  C  C   . PRO B 1 101 ? 39.255  -0.346  22.685  1.00 112.86 ? 101 PRO B C   1 
ATOM   2525  O  O   . PRO B 1 101 ? 38.397  -0.325  23.567  1.00 116.34 ? 101 PRO B O   1 
ATOM   2526  C  CB  . PRO B 1 101 ? 40.126  -2.625  22.259  1.00 96.73  ? 101 PRO B CB  1 
ATOM   2527  C  CG  . PRO B 1 101 ? 40.726  -3.288  21.081  1.00 94.57  ? 101 PRO B CG  1 
ATOM   2528  C  CD  . PRO B 1 101 ? 40.984  -2.191  20.099  1.00 95.12  ? 101 PRO B CD  1 
ATOM   2529  N  N   . GLU B 1 102 ? 40.186  0.592   22.560  1.00 126.60 ? 102 GLU B N   1 
ATOM   2530  C  CA  . GLU B 1 102 ? 40.461  1.541   23.639  1.00 145.71 ? 102 GLU B CA  1 
ATOM   2531  C  C   . GLU B 1 102 ? 39.438  2.676   23.692  1.00 153.94 ? 102 GLU B C   1 
ATOM   2532  O  O   . GLU B 1 102 ? 39.031  3.103   24.776  1.00 156.58 ? 102 GLU B O   1 
ATOM   2533  C  CB  . GLU B 1 102 ? 41.869  2.133   23.488  1.00 161.61 ? 102 GLU B CB  1 
ATOM   2534  C  CG  . GLU B 1 102 ? 42.986  1.102   23.332  1.00 167.55 ? 102 GLU B CG  1 
ATOM   2535  C  CD  . GLU B 1 102 ? 43.289  0.324   24.603  1.00 174.31 ? 102 GLU B CD  1 
ATOM   2536  O  OE1 . GLU B 1 102 ? 42.857  0.743   25.701  1.00 175.70 ? 102 GLU B OE1 1 
ATOM   2537  O  OE2 . GLU B 1 102 ? 43.980  -0.713  24.501  1.00 164.45 ? 102 GLU B OE2 1 
ATOM   2538  N  N   . THR B 1 103 ? 39.035  3.161   22.519  1.00 158.99 ? 103 THR B N   1 
ATOM   2539  C  CA  . THR B 1 103 ? 38.182  4.348   22.415  1.00 166.36 ? 103 THR B CA  1 
ATOM   2540  C  C   . THR B 1 103 ? 36.754  3.995   22.003  1.00 177.47 ? 103 THR B C   1 
ATOM   2541  O  O   . THR B 1 103 ? 36.464  2.850   21.648  1.00 190.97 ? 103 THR B O   1 
ATOM   2542  C  CB  . THR B 1 103 ? 38.739  5.343   21.381  1.00 160.30 ? 103 THR B CB  1 
ATOM   2543  O  OG1 . THR B 1 103 ? 38.629  4.778   20.069  1.00 151.58 ? 103 THR B OG1 1 
ATOM   2544  C  CG2 . THR B 1 103 ? 40.193  5.655   21.680  1.00 161.28 ? 103 THR B CG2 1 
ATOM   2545  N  N   . GLN B 1 104 ? 35.870  4.990   22.050  1.00 171.51 ? 104 GLN B N   1 
ATOM   2546  C  CA  . GLN B 1 104 ? 34.485  4.829   21.602  1.00 164.43 ? 104 GLN B CA  1 
ATOM   2547  C  C   . GLN B 1 104 ? 34.146  5.925   20.591  1.00 160.23 ? 104 GLN B C   1 
ATOM   2548  O  O   . GLN B 1 104 ? 33.789  7.035   20.973  1.00 167.67 ? 104 GLN B O   1 
ATOM   2549  C  CB  . GLN B 1 104 ? 33.514  4.905   22.794  1.00 162.77 ? 104 GLN B CB  1 
ATOM   2550  C  CG  . GLN B 1 104 ? 33.695  3.827   23.861  1.00 156.61 ? 104 GLN B CG  1 
ATOM   2551  C  CD  . GLN B 1 104 ? 33.082  4.213   25.204  1.00 156.27 ? 104 GLN B CD  1 
ATOM   2552  O  OE1 . GLN B 1 104 ? 33.451  5.226   25.801  1.00 171.37 ? 104 GLN B OE1 1 
ATOM   2553  N  NE2 . GLN B 1 104 ? 32.150  3.401   25.689  1.00 147.14 ? 104 GLN B NE2 1 
ATOM   2554  N  N   . SER B 1 105 ? 34.283  5.623   19.304  1.00 157.80 ? 105 SER B N   1 
ATOM   2555  C  CA  . SER B 1 105 ? 33.949  6.585   18.245  1.00 161.07 ? 105 SER B CA  1 
ATOM   2556  C  C   . SER B 1 105 ? 33.965  5.932   16.863  1.00 158.77 ? 105 SER B C   1 
ATOM   2557  O  O   . SER B 1 105 ? 33.648  6.572   15.858  1.00 155.63 ? 105 SER B O   1 
ATOM   2558  C  CB  . SER B 1 105 ? 34.912  7.781   18.266  1.00 159.02 ? 105 SER B CB  1 
ATOM   2559  O  OG  . SER B 1 105 ? 34.412  8.832   19.077  1.00 151.61 ? 105 SER B OG  1 
ATOM   2560  N  N   . SER B 1 110 ? 41.707  14.079  14.786  1.00 187.96 ? 110 SER B N   1 
ATOM   2561  C  CA  . SER B 1 110 ? 41.320  12.692  15.009  1.00 182.74 ? 110 SER B CA  1 
ATOM   2562  C  C   . SER B 1 110 ? 42.170  11.723  14.177  1.00 189.18 ? 110 SER B C   1 
ATOM   2563  O  O   . SER B 1 110 ? 42.159  10.524  14.446  1.00 185.34 ? 110 SER B O   1 
ATOM   2564  C  CB  . SER B 1 110 ? 39.831  12.498  14.703  1.00 177.53 ? 110 SER B CB  1 
ATOM   2565  O  OG  . SER B 1 110 ? 39.421  11.167  14.967  1.00 166.97 ? 110 SER B OG  1 
ATOM   2566  N  N   . HIS B 1 111 ? 42.893  12.239  13.176  1.00 202.23 ? 111 HIS B N   1 
ATOM   2567  C  CA  . HIS B 1 111 ? 43.843  11.439  12.373  1.00 207.55 ? 111 HIS B CA  1 
ATOM   2568  C  C   . HIS B 1 111 ? 43.153  10.515  11.357  1.00 201.37 ? 111 HIS B C   1 
ATOM   2569  O  O   . HIS B 1 111 ? 42.111  9.929   11.654  1.00 215.15 ? 111 HIS B O   1 
ATOM   2570  C  CB  . HIS B 1 111 ? 44.770  10.623  13.286  1.00 217.08 ? 111 HIS B CB  1 
ATOM   2571  C  CG  . HIS B 1 111 ? 45.431  9.463   12.604  1.00 227.14 ? 111 HIS B CG  1 
ATOM   2572  N  ND1 . HIS B 1 111 ? 44.779  8.272   12.355  1.00 226.14 ? 111 HIS B ND1 1 
ATOM   2573  C  CD2 . HIS B 1 111 ? 46.693  9.303   12.139  1.00 230.60 ? 111 HIS B CD2 1 
ATOM   2574  C  CE1 . HIS B 1 111 ? 45.606  7.437   11.750  1.00 223.51 ? 111 HIS B CE1 1 
ATOM   2575  N  NE2 . HIS B 1 111 ? 46.774  8.037   11.610  1.00 236.10 ? 111 HIS B NE2 1 
ATOM   2576  N  N   . SER B 1 112 ? 43.755  10.371  10.173  1.00 187.79 ? 112 SER B N   1 
ATOM   2577  C  CA  . SER B 1 112 ? 43.182  9.558   9.090   1.00 170.39 ? 112 SER B CA  1 
ATOM   2578  C  C   . SER B 1 112 ? 44.179  8.597   8.430   1.00 167.63 ? 112 SER B C   1 
ATOM   2579  O  O   . SER B 1 112 ? 45.265  8.999   7.995   1.00 147.14 ? 112 SER B O   1 
ATOM   2580  C  CB  . SER B 1 112 ? 42.600  10.466  8.014   1.00 166.90 ? 112 SER B CB  1 
ATOM   2581  O  OG  . SER B 1 112 ? 42.025  9.709   6.964   1.00 150.84 ? 112 SER B OG  1 
ATOM   2582  N  N   . ALA B 1 113 ? 43.769  7.336   8.314   1.00 167.38 ? 113 ALA B N   1 
ATOM   2583  C  CA  . ALA B 1 113 ? 44.585  6.307   7.683   1.00 161.71 ? 113 ALA B CA  1 
ATOM   2584  C  C   . ALA B 1 113 ? 44.547  6.413   6.153   1.00 150.73 ? 113 ALA B C   1 
ATOM   2585  O  O   . ALA B 1 113 ? 45.340  5.771   5.466   1.00 151.52 ? 113 ALA B O   1 
ATOM   2586  C  CB  . ALA B 1 113 ? 44.130  4.924   8.137   1.00 156.26 ? 113 ALA B CB  1 
ATOM   2587  N  N   . TRP B 1 114 ? 43.610  7.194   5.626   1.00 141.85 ? 114 TRP B N   1 
ATOM   2588  C  CA  . TRP B 1 114 ? 43.531  7.436   4.185   1.00 142.65 ? 114 TRP B CA  1 
ATOM   2589  C  C   . TRP B 1 114 ? 43.767  8.909   3.853   1.00 152.60 ? 114 TRP B C   1 
ATOM   2590  O  O   . TRP B 1 114 ? 43.278  9.396   2.831   1.00 154.50 ? 114 TRP B O   1 
ATOM   2591  C  CB  . TRP B 1 114 ? 42.170  7.002   3.624   1.00 141.97 ? 114 TRP B CB  1 
ATOM   2592  C  CG  . TRP B 1 114 ? 41.964  5.536   3.595   1.00 138.56 ? 114 TRP B CG  1 
ATOM   2593  C  CD1 . TRP B 1 114 ? 41.193  4.810   4.445   1.00 145.17 ? 114 TRP B CD1 1 
ATOM   2594  C  CD2 . TRP B 1 114 ? 42.530  4.603   2.668   1.00 138.11 ? 114 TRP B CD2 1 
ATOM   2595  N  NE1 . TRP B 1 114 ? 41.246  3.477   4.117   1.00 149.07 ? 114 TRP B NE1 1 
ATOM   2596  C  CE2 . TRP B 1 114 ? 42.062  3.323   3.029   1.00 143.59 ? 114 TRP B CE2 1 
ATOM   2597  C  CE3 . TRP B 1 114 ? 43.392  4.721   1.578   1.00 134.67 ? 114 TRP B CE3 1 
ATOM   2598  C  CZ2 . TRP B 1 114 ? 42.424  2.174   2.336   1.00 141.89 ? 114 TRP B CZ2 1 
ATOM   2599  C  CZ3 . TRP B 1 114 ? 43.751  3.578   0.889   1.00 133.74 ? 114 TRP B CZ3 1 
ATOM   2600  C  CH2 . TRP B 1 114 ? 43.265  2.322   1.268   1.00 139.33 ? 114 TRP B CH2 1 
ATOM   2601  N  N   . ASP B 1 115 ? 44.515  9.625   4.695   1.00 156.42 ? 115 ASP B N   1 
ATOM   2602  C  CA  . ASP B 1 115 ? 45.001  10.958  4.309   1.00 155.53 ? 115 ASP B CA  1 
ATOM   2603  C  C   . ASP B 1 115 ? 45.974  10.829  3.136   1.00 150.20 ? 115 ASP B C   1 
ATOM   2604  O  O   . ASP B 1 115 ? 46.402  9.727   2.796   1.00 150.90 ? 115 ASP B O   1 
ATOM   2605  C  CB  . ASP B 1 115 ? 45.643  11.710  5.488   1.00 156.76 ? 115 ASP B CB  1 
ATOM   2606  C  CG  . ASP B 1 115 ? 46.771  10.934  6.152   1.00 154.98 ? 115 ASP B CG  1 
ATOM   2607  O  OD1 . ASP B 1 115 ? 47.350  10.030  5.519   1.00 160.17 ? 115 ASP B OD1 1 
ATOM   2608  O  OD2 . ASP B 1 115 ? 47.079  11.238  7.322   1.00 153.36 ? 115 ASP B OD2 1 
ATOM   2609  N  N   . LEU B 1 116 ? 46.294  11.941  2.489   1.00 151.87 ? 116 LEU B N   1 
ATOM   2610  C  CA  . LEU B 1 116 ? 47.032  11.875  1.234   1.00 154.55 ? 116 LEU B CA  1 
ATOM   2611  C  C   . LEU B 1 116 ? 48.340  11.095  1.370   1.00 151.66 ? 116 LEU B C   1 
ATOM   2612  O  O   . LEU B 1 116 ? 48.707  10.327  0.480   1.00 145.31 ? 116 LEU B O   1 
ATOM   2613  C  CB  . LEU B 1 116 ? 47.324  13.270  0.703   1.00 163.60 ? 116 LEU B CB  1 
ATOM   2614  C  CG  . LEU B 1 116 ? 47.461  13.394  -0.826  1.00 167.90 ? 116 LEU B CG  1 
ATOM   2615  C  CD1 . LEU B 1 116 ? 48.829  12.941  -1.331  1.00 164.71 ? 116 LEU B CD1 1 
ATOM   2616  C  CD2 . LEU B 1 116 ? 46.351  12.646  -1.556  1.00 165.33 ? 116 LEU B CD2 1 
ATOM   2617  N  N   . GLY B 1 117 ? 49.041  11.298  2.482   1.00 152.73 ? 117 GLY B N   1 
ATOM   2618  C  CA  . GLY B 1 117 ? 50.345  10.677  2.690   1.00 151.85 ? 117 GLY B CA  1 
ATOM   2619  C  C   . GLY B 1 117 ? 50.256  9.175   2.889   1.00 149.90 ? 117 GLY B C   1 
ATOM   2620  O  O   . GLY B 1 117 ? 51.076  8.424   2.367   1.00 152.17 ? 117 GLY B O   1 
ATOM   2621  N  N   . SER B 1 118 ? 49.260  8.737   3.652   1.00 146.69 ? 118 SER B N   1 
ATOM   2622  C  CA  . SER B 1 118 ? 49.068  7.313   3.913   1.00 140.82 ? 118 SER B CA  1 
ATOM   2623  C  C   . SER B 1 118 ? 48.512  6.592   2.679   1.00 134.83 ? 118 SER B C   1 
ATOM   2624  O  O   . SER B 1 118 ? 48.816  5.427   2.451   1.00 137.77 ? 118 SER B O   1 
ATOM   2625  C  CB  . SER B 1 118 ? 48.147  7.102   5.121   1.00 145.81 ? 118 SER B CB  1 
ATOM   2626  O  OG  . SER B 1 118 ? 48.734  7.599   6.316   1.00 150.26 ? 118 SER B OG  1 
ATOM   2627  N  N   . ALA B 1 119 ? 47.695  7.282   1.886   1.00 133.43 ? 119 ALA B N   1 
ATOM   2628  C  CA  . ALA B 1 119 ? 47.175  6.711   0.638   1.00 132.03 ? 119 ALA B CA  1 
ATOM   2629  C  C   . ALA B 1 119 ? 48.286  6.561   -0.395  1.00 134.40 ? 119 ALA B C   1 
ATOM   2630  O  O   . ALA B 1 119 ? 48.334  5.578   -1.138  1.00 136.64 ? 119 ALA B O   1 
ATOM   2631  C  CB  . ALA B 1 119 ? 46.054  7.573   0.084   1.00 134.09 ? 119 ALA B CB  1 
ATOM   2632  N  N   . PHE B 1 120 ? 49.173  7.548   -0.442  1.00 139.16 ? 120 PHE B N   1 
ATOM   2633  C  CA  . PHE B 1 120 ? 50.376  7.457   -1.259  1.00 139.17 ? 120 PHE B CA  1 
ATOM   2634  C  C   . PHE B 1 120 ? 51.148  6.201   -0.879  1.00 135.40 ? 120 PHE B C   1 
ATOM   2635  O  O   . PHE B 1 120 ? 51.443  5.353   -1.726  1.00 129.23 ? 120 PHE B O   1 
ATOM   2636  C  CB  . PHE B 1 120 ? 51.243  8.692   -1.026  1.00 143.53 ? 120 PHE B CB  1 
ATOM   2637  C  CG  . PHE B 1 120 ? 52.509  8.710   -1.830  1.00 145.31 ? 120 PHE B CG  1 
ATOM   2638  C  CD1 . PHE B 1 120 ? 52.499  9.126   -3.157  1.00 147.30 ? 120 PHE B CD1 1 
ATOM   2639  C  CD2 . PHE B 1 120 ? 53.719  8.354   -1.251  1.00 142.44 ? 120 PHE B CD2 1 
ATOM   2640  C  CE1 . PHE B 1 120 ? 53.666  9.165   -3.897  1.00 145.35 ? 120 PHE B CE1 1 
ATOM   2641  C  CE2 . PHE B 1 120 ? 54.889  8.393   -1.986  1.00 143.29 ? 120 PHE B CE2 1 
ATOM   2642  C  CZ  . PHE B 1 120 ? 54.862  8.797   -3.311  1.00 144.54 ? 120 PHE B CZ  1 
ATOM   2643  N  N   . PHE B 1 121 ? 51.447  6.088   0.412   1.00 135.67 ? 121 PHE B N   1 
ATOM   2644  C  CA  . PHE B 1 121 ? 52.113  4.919   0.967   1.00 131.48 ? 121 PHE B CA  1 
ATOM   2645  C  C   . PHE B 1 121 ? 51.411  3.636   0.560   1.00 122.63 ? 121 PHE B C   1 
ATOM   2646  O  O   . PHE B 1 121 ? 52.048  2.703   0.089   1.00 125.37 ? 121 PHE B O   1 
ATOM   2647  C  CB  . PHE B 1 121 ? 52.156  5.012   2.494   1.00 131.55 ? 121 PHE B CB  1 
ATOM   2648  C  CG  . PHE B 1 121 ? 52.899  3.889   3.150   1.00 130.69 ? 121 PHE B CG  1 
ATOM   2649  C  CD1 . PHE B 1 121 ? 54.286  3.898   3.203   1.00 139.34 ? 121 PHE B CD1 1 
ATOM   2650  C  CD2 . PHE B 1 121 ? 52.217  2.833   3.722   1.00 126.23 ? 121 PHE B CD2 1 
ATOM   2651  C  CE1 . PHE B 1 121 ? 54.980  2.873   3.810   1.00 136.01 ? 121 PHE B CE1 1 
ATOM   2652  C  CE2 . PHE B 1 121 ? 52.902  1.807   4.336   1.00 127.13 ? 121 PHE B CE2 1 
ATOM   2653  C  CZ  . PHE B 1 121 ? 54.286  1.828   4.383   1.00 134.60 ? 121 PHE B CZ  1 
ATOM   2654  N  N   . PHE B 1 122 ? 50.100  3.590   0.745   1.00 117.43 ? 122 PHE B N   1 
ATOM   2655  C  CA  . PHE B 1 122 ? 49.337  2.394   0.422   1.00 115.71 ? 122 PHE B CA  1 
ATOM   2656  C  C   . PHE B 1 122 ? 49.539  1.991   -1.036  1.00 115.08 ? 122 PHE B C   1 
ATOM   2657  O  O   . PHE B 1 122 ? 49.719  0.810   -1.343  1.00 115.26 ? 122 PHE B O   1 
ATOM   2658  C  CB  . PHE B 1 122 ? 47.848  2.614   0.715   1.00 117.02 ? 122 PHE B CB  1 
ATOM   2659  C  CG  . PHE B 1 122 ? 46.965  1.481   0.265   1.00 116.01 ? 122 PHE B CG  1 
ATOM   2660  C  CD1 . PHE B 1 122 ? 46.845  0.332   1.032   1.00 117.25 ? 122 PHE B CD1 1 
ATOM   2661  C  CD2 . PHE B 1 122 ? 46.253  1.566   -0.921  1.00 116.38 ? 122 PHE B CD2 1 
ATOM   2662  C  CE1 . PHE B 1 122 ? 46.036  -0.712  0.623   1.00 116.95 ? 122 PHE B CE1 1 
ATOM   2663  C  CE2 . PHE B 1 122 ? 45.443  0.525   -1.335  1.00 116.76 ? 122 PHE B CE2 1 
ATOM   2664  C  CZ  . PHE B 1 122 ? 45.334  -0.614  -0.562  1.00 117.20 ? 122 PHE B CZ  1 
ATOM   2665  N  N   . SER B 1 123 ? 49.514  2.971   -1.932  1.00 117.42 ? 123 SER B N   1 
ATOM   2666  C  CA  . SER B 1 123 ? 49.713  2.705   -3.353  1.00 119.29 ? 123 SER B CA  1 
ATOM   2667  C  C   . SER B 1 123 ? 51.097  2.112   -3.597  1.00 121.91 ? 123 SER B C   1 
ATOM   2668  O  O   . SER B 1 123 ? 51.263  1.178   -4.389  1.00 117.00 ? 123 SER B O   1 
ATOM   2669  C  CB  . SER B 1 123 ? 49.548  3.991   -4.152  1.00 122.52 ? 123 SER B CB  1 
ATOM   2670  O  OG  . SER B 1 123 ? 48.269  4.553   -3.933  1.00 124.62 ? 123 SER B OG  1 
ATOM   2671  N  N   . GLY B 1 124 ? 52.091  2.661   -2.905  1.00 128.57 ? 124 GLY B N   1 
ATOM   2672  C  CA  . GLY B 1 124 ? 53.446  2.125   -2.952  1.00 126.60 ? 124 GLY B CA  1 
ATOM   2673  C  C   . GLY B 1 124 ? 53.491  0.657   -2.592  1.00 115.06 ? 124 GLY B C   1 
ATOM   2674  O  O   . GLY B 1 124 ? 54.197  -0.118  -3.237  1.00 108.43 ? 124 GLY B O   1 
ATOM   2675  N  N   . THR B 1 125 ? 52.722  0.280   -1.571  1.00 112.11 ? 125 THR B N   1 
ATOM   2676  C  CA  . THR B 1 125 ? 52.708  -1.096  -1.090  1.00 113.33 ? 125 THR B CA  1 
ATOM   2677  C  C   . THR B 1 125 ? 52.163  -2.052  -2.136  1.00 113.19 ? 125 THR B C   1 
ATOM   2678  O  O   . THR B 1 125 ? 52.421  -3.253  -2.071  1.00 120.98 ? 125 THR B O   1 
ATOM   2679  C  CB  . THR B 1 125 ? 51.857  -1.281  0.185   1.00 115.48 ? 125 THR B CB  1 
ATOM   2680  O  OG1 . THR B 1 125 ? 50.471  -1.040  -0.100  1.00 113.53 ? 125 THR B OG1 1 
ATOM   2681  C  CG2 . THR B 1 125 ? 52.337  -0.371  1.310   1.00 119.12 ? 125 THR B CG2 1 
ATOM   2682  N  N   . ILE B 1 126 ? 51.411  -1.522  -3.092  1.00 110.80 ? 126 ILE B N   1 
ATOM   2683  C  CA  . ILE B 1 126 ? 50.856  -2.342  -4.159  1.00 107.78 ? 126 ILE B CA  1 
ATOM   2684  C  C   . ILE B 1 126 ? 51.882  -2.613  -5.261  1.00 111.11 ? 126 ILE B C   1 
ATOM   2685  O  O   . ILE B 1 126 ? 52.189  -3.766  -5.567  1.00 105.26 ? 126 ILE B O   1 
ATOM   2686  C  CB  . ILE B 1 126 ? 49.639  -1.663  -4.792  1.00 109.25 ? 126 ILE B CB  1 
ATOM   2687  C  CG1 . ILE B 1 126 ? 48.570  -1.412  -3.734  1.00 110.55 ? 126 ILE B CG1 1 
ATOM   2688  C  CG2 . ILE B 1 126 ? 49.078  -2.523  -5.907  1.00 108.64 ? 126 ILE B CG2 1 
ATOM   2689  C  CD1 . ILE B 1 126 ? 47.290  -0.827  -4.294  1.00 116.06 ? 126 ILE B CD1 1 
ATOM   2690  N  N   . ILE B 1 127 ? 52.415  -1.550  -5.855  1.00 115.01 ? 127 ILE B N   1 
ATOM   2691  C  CA  . ILE B 1 127 ? 53.269  -1.696  -7.026  1.00 115.54 ? 127 ILE B CA  1 
ATOM   2692  C  C   . ILE B 1 127 ? 54.598  -2.363  -6.672  1.00 111.99 ? 127 ILE B C   1 
ATOM   2693  O  O   . ILE B 1 127 ? 55.236  -2.998  -7.517  1.00 109.57 ? 127 ILE B O   1 
ATOM   2694  C  CB  . ILE B 1 127 ? 53.507  -0.343  -7.721  1.00 124.90 ? 127 ILE B CB  1 
ATOM   2695  C  CG1 . ILE B 1 127 ? 54.270  0.625   -6.805  1.00 132.42 ? 127 ILE B CG1 1 
ATOM   2696  C  CG2 . ILE B 1 127 ? 52.177  0.264   -8.132  1.00 124.82 ? 127 ILE B CG2 1 
ATOM   2697  C  CD1 . ILE B 1 127 ? 54.562  1.974   -7.441  1.00 134.81 ? 127 ILE B CD1 1 
ATOM   2698  N  N   . THR B 1 128 ? 55.008  -2.216  -5.418  1.00 107.44 ? 128 THR B N   1 
ATOM   2699  C  CA  . THR B 1 128 ? 56.187  -2.906  -4.920  1.00 107.08 ? 128 THR B CA  1 
ATOM   2700  C  C   . THR B 1 128 ? 55.868  -4.359  -4.618  1.00 107.54 ? 128 THR B C   1 
ATOM   2701  O  O   . THR B 1 128 ? 56.762  -5.146  -4.314  1.00 114.93 ? 128 THR B O   1 
ATOM   2702  C  CB  . THR B 1 128 ? 56.661  -2.289  -3.608  1.00 105.30 ? 128 THR B CB  1 
ATOM   2703  O  OG1 . THR B 1 128 ? 55.565  -2.271  -2.689  1.00 105.28 ? 128 THR B OG1 1 
ATOM   2704  C  CG2 . THR B 1 128 ? 57.161  -0.884  -3.828  1.00 108.15 ? 128 THR B CG2 1 
ATOM   2705  N  N   . THR B 1 129 ? 54.587  -4.701  -4.677  1.00 109.46 ? 129 THR B N   1 
ATOM   2706  C  CA  . THR B 1 129 ? 54.097  -6.026  -4.291  1.00 112.99 ? 129 THR B CA  1 
ATOM   2707  C  C   . THR B 1 129 ? 54.354  -6.367  -2.821  1.00 113.14 ? 129 THR B C   1 
ATOM   2708  O  O   . THR B 1 129 ? 54.176  -7.517  -2.417  1.00 127.86 ? 129 THR B O   1 
ATOM   2709  C  CB  . THR B 1 129 ? 54.694  -7.154  -5.156  1.00 114.78 ? 129 THR B CB  1 
ATOM   2710  O  OG1 . THR B 1 129 ? 56.007  -7.487  -4.682  1.00 122.12 ? 129 THR B OG1 1 
ATOM   2711  C  CG2 . THR B 1 129 ? 54.750  -6.745  -6.620  1.00 119.88 ? 129 THR B CG2 1 
ATOM   2712  N  N   . ILE B 1 130 ? 54.738  -5.377  -2.021  1.00 108.11 ? 130 ILE B N   1 
ATOM   2713  C  CA  . ILE B 1 130 ? 55.004  -5.613  -0.610  1.00 105.86 ? 130 ILE B CA  1 
ATOM   2714  C  C   . ILE B 1 130 ? 53.725  -5.969  0.133   1.00 105.99 ? 130 ILE B C   1 
ATOM   2715  O  O   . ILE B 1 130 ? 53.678  -6.975  0.841   1.00 104.83 ? 130 ILE B O   1 
ATOM   2716  C  CB  . ILE B 1 130 ? 55.641  -4.390  0.046   1.00 105.32 ? 130 ILE B CB  1 
ATOM   2717  C  CG1 . ILE B 1 130 ? 57.082  -4.265  -0.422  1.00 109.31 ? 130 ILE B CG1 1 
ATOM   2718  C  CG2 . ILE B 1 130 ? 55.603  -4.524  1.560   1.00 106.99 ? 130 ILE B CG2 1 
ATOM   2719  C  CD1 . ILE B 1 130 ? 57.725  -2.959  -0.038  1.00 115.91 ? 130 ILE B CD1 1 
ATOM   2720  N  N   . GLY B 1 131 ? 52.713  -5.116  -0.013  1.00 106.00 ? 131 GLY B N   1 
ATOM   2721  C  CA  . GLY B 1 131 ? 51.337  -5.410  0.402   1.00 108.37 ? 131 GLY B CA  1 
ATOM   2722  C  C   . GLY B 1 131 ? 51.115  -5.598  1.890   1.00 109.41 ? 131 GLY B C   1 
ATOM   2723  O  O   . GLY B 1 131 ? 50.471  -6.562  2.301   1.00 114.98 ? 131 GLY B O   1 
ATOM   2724  N  N   . TYR B 1 132 ? 51.627  -4.672  2.696   1.00 111.20 ? 132 TYR B N   1 
ATOM   2725  C  CA  . TYR B 1 132 ? 51.540  -4.786  4.147   1.00 110.18 ? 132 TYR B CA  1 
ATOM   2726  C  C   . TYR B 1 132 ? 50.127  -5.113  4.582   1.00 107.40 ? 132 TYR B C   1 
ATOM   2727  O  O   . TYR B 1 132 ? 49.924  -6.013  5.385   1.00 119.58 ? 132 TYR B O   1 
ATOM   2728  C  CB  . TYR B 1 132 ? 51.965  -3.488  4.818   1.00 112.89 ? 132 TYR B CB  1 
ATOM   2729  C  CG  . TYR B 1 132 ? 53.454  -3.237  4.802   1.00 113.89 ? 132 TYR B CG  1 
ATOM   2730  C  CD1 . TYR B 1 132 ? 54.345  -4.159  5.335   1.00 114.87 ? 132 TYR B CD1 1 
ATOM   2731  C  CD2 . TYR B 1 132 ? 53.971  -2.065  4.273   1.00 112.74 ? 132 TYR B CD2 1 
ATOM   2732  C  CE1 . TYR B 1 132 ? 55.709  -3.917  5.336   1.00 114.74 ? 132 TYR B CE1 1 
ATOM   2733  C  CE2 . TYR B 1 132 ? 55.330  -1.813  4.277   1.00 111.94 ? 132 TYR B CE2 1 
ATOM   2734  C  CZ  . TYR B 1 132 ? 56.194  -2.740  4.808   1.00 110.88 ? 132 TYR B CZ  1 
ATOM   2735  O  OH  . TYR B 1 132 ? 57.543  -2.488  4.805   1.00 102.89 ? 132 TYR B OH  1 
ATOM   2736  N  N   . GLY B 1 133 ? 49.161  -4.345  4.082   1.00 110.80 ? 133 GLY B N   1 
ATOM   2737  C  CA  . GLY B 1 133 ? 47.741  -4.650  4.257   1.00 112.80 ? 133 GLY B CA  1 
ATOM   2738  C  C   . GLY B 1 133 ? 47.182  -4.333  5.628   1.00 112.38 ? 133 GLY B C   1 
ATOM   2739  O  O   . GLY B 1 133 ? 46.091  -4.777  5.970   1.00 121.88 ? 133 GLY B O   1 
ATOM   2740  N  N   . ASN B 1 134 ? 47.925  -3.566  6.415   1.00 113.40 ? 134 ASN B N   1 
ATOM   2741  C  CA  . ASN B 1 134 ? 47.468  -3.161  7.740   1.00 117.00 ? 134 ASN B CA  1 
ATOM   2742  C  C   . ASN B 1 134 ? 46.255  -2.206  7.688   1.00 118.05 ? 134 ASN B C   1 
ATOM   2743  O  O   . ASN B 1 134 ? 45.626  -1.931  8.709   1.00 121.42 ? 134 ASN B O   1 
ATOM   2744  C  CB  . ASN B 1 134 ? 48.624  -2.517  8.498   1.00 118.10 ? 134 ASN B CB  1 
ATOM   2745  C  CG  . ASN B 1 134 ? 49.248  -1.379  7.726   1.00 127.44 ? 134 ASN B CG  1 
ATOM   2746  O  OD1 . ASN B 1 134 ? 49.387  -1.446  6.500   1.00 130.65 ? 134 ASN B OD1 1 
ATOM   2747  N  ND2 . ASN B 1 134 ? 49.609  -0.314  8.432   1.00 138.51 ? 134 ASN B ND2 1 
ATOM   2748  N  N   . VAL B 1 135 ? 45.927  -1.713  6.495   1.00 118.17 ? 135 VAL B N   1 
ATOM   2749  C  CA  . VAL B 1 135 ? 44.665  -0.992  6.265   1.00 112.22 ? 135 VAL B CA  1 
ATOM   2750  C  C   . VAL B 1 135 ? 43.953  -1.556  5.047   1.00 114.83 ? 135 VAL B C   1 
ATOM   2751  O  O   . VAL B 1 135 ? 44.522  -1.591  3.954   1.00 123.84 ? 135 VAL B O   1 
ATOM   2752  C  CB  . VAL B 1 135 ? 44.918  0.496   6.012   1.00 114.91 ? 135 VAL B CB  1 
ATOM   2753  C  CG1 . VAL B 1 135 ? 43.627  1.206   5.636   1.00 118.30 ? 135 VAL B CG1 1 
ATOM   2754  C  CG2 . VAL B 1 135 ? 45.550  1.126   7.240   1.00 116.77 ? 135 VAL B CG2 1 
ATOM   2755  N  N   . ALA B 1 136 ? 42.723  -2.022  5.238   1.00 116.48 ? 136 ALA B N   1 
ATOM   2756  C  CA  . ALA B 1 136 ? 42.036  -2.783  4.199   1.00 120.44 ? 136 ALA B CA  1 
ATOM   2757  C  C   . ALA B 1 136 ? 41.146  -1.875  3.387   1.00 115.27 ? 136 ALA B C   1 
ATOM   2758  O  O   . ALA B 1 136 ? 40.643  -0.886  3.900   1.00 108.48 ? 136 ALA B O   1 
ATOM   2759  C  CB  . ALA B 1 136 ? 41.210  -3.913  4.808   1.00 122.78 ? 136 ALA B CB  1 
ATOM   2760  N  N   . LEU B 1 137 ? 40.967  -2.219  2.115   1.00 117.76 ? 137 LEU B N   1 
ATOM   2761  C  CA  . LEU B 1 137 ? 39.947  -1.599  1.281   1.00 114.46 ? 137 LEU B CA  1 
ATOM   2762  C  C   . LEU B 1 137 ? 38.589  -2.152  1.661   1.00 111.84 ? 137 LEU B C   1 
ATOM   2763  O  O   . LEU B 1 137 ? 38.417  -3.362  1.804   1.00 109.59 ? 137 LEU B O   1 
ATOM   2764  C  CB  . LEU B 1 137 ? 40.197  -1.890  -0.193  1.00 112.61 ? 137 LEU B CB  1 
ATOM   2765  C  CG  . LEU B 1 137 ? 41.539  -1.407  -0.737  1.00 112.85 ? 137 LEU B CG  1 
ATOM   2766  C  CD1 . LEU B 1 137 ? 41.883  -2.169  -2.005  1.00 110.81 ? 137 LEU B CD1 1 
ATOM   2767  C  CD2 . LEU B 1 137 ? 41.490  0.090   -0.992  1.00 120.82 ? 137 LEU B CD2 1 
ATOM   2768  N  N   . ARG B 1 138 ? 37.623  -1.259  1.816   1.00 115.26 ? 138 ARG B N   1 
ATOM   2769  C  CA  . ARG B 1 138 ? 36.319  -1.637  2.329   1.00 113.12 ? 138 ARG B CA  1 
ATOM   2770  C  C   . ARG B 1 138 ? 35.279  -1.614  1.227   1.00 112.66 ? 138 ARG B C   1 
ATOM   2771  O  O   . ARG B 1 138 ? 34.244  -2.247  1.345   1.00 116.36 ? 138 ARG B O   1 
ATOM   2772  C  CB  . ARG B 1 138 ? 35.917  -0.715  3.484   1.00 117.62 ? 138 ARG B CB  1 
ATOM   2773  C  CG  . ARG B 1 138 ? 36.841  -0.841  4.697   1.00 119.21 ? 138 ARG B CG  1 
ATOM   2774  C  CD  . ARG B 1 138 ? 36.330  -0.134  5.942   1.00 121.23 ? 138 ARG B CD  1 
ATOM   2775  N  NE  . ARG B 1 138 ? 34.892  -0.331  6.109   1.00 145.79 ? 138 ARG B NE  1 
ATOM   2776  C  CZ  . ARG B 1 138 ? 34.331  -1.312  6.813   1.00 157.41 ? 138 ARG B CZ  1 
ATOM   2777  N  NH1 . ARG B 1 138 ? 35.088  -2.204  7.445   1.00 166.35 ? 138 ARG B NH1 1 
ATOM   2778  N  NH2 . ARG B 1 138 ? 33.004  -1.394  6.891   1.00 145.73 ? 138 ARG B NH2 1 
ATOM   2779  N  N   . THR B 1 139 ? 35.575  -0.921  0.137   1.00 115.46 ? 139 THR B N   1 
ATOM   2780  C  CA  . THR B 1 139 ? 34.603  -0.733  -0.928  1.00 122.49 ? 139 THR B CA  1 
ATOM   2781  C  C   . THR B 1 139 ? 34.926  -1.591  -2.137  1.00 126.63 ? 139 THR B C   1 
ATOM   2782  O  O   . THR B 1 139 ? 36.096  -1.854  -2.427  1.00 130.53 ? 139 THR B O   1 
ATOM   2783  C  CB  . THR B 1 139 ? 34.554  0.736   -1.378  1.00 129.96 ? 139 THR B CB  1 
ATOM   2784  O  OG1 . THR B 1 139 ? 35.797  1.099   -1.998  1.00 127.86 ? 139 THR B OG1 1 
ATOM   2785  C  CG2 . THR B 1 139 ? 34.290  1.639   -0.181  1.00 132.85 ? 139 THR B CG2 1 
ATOM   2786  N  N   . ASP B 1 140 ? 33.879  -2.001  -2.849  1.00 132.48 ? 140 ASP B N   1 
ATOM   2787  C  CA  . ASP B 1 140 ? 34.021  -2.766  -4.086  1.00 134.37 ? 140 ASP B CA  1 
ATOM   2788  C  C   . ASP B 1 140 ? 34.767  -1.969  -5.138  1.00 135.43 ? 140 ASP B C   1 
ATOM   2789  O  O   . ASP B 1 140 ? 35.572  -2.524  -5.885  1.00 142.17 ? 140 ASP B O   1 
ATOM   2790  C  CB  . ASP B 1 140 ? 32.650  -3.163  -4.637  1.00 138.27 ? 140 ASP B CB  1 
ATOM   2791  C  CG  . ASP B 1 140 ? 31.999  -4.263  -3.832  1.00 140.41 ? 140 ASP B CG  1 
ATOM   2792  O  OD1 . ASP B 1 140 ? 32.711  -4.919  -3.030  1.00 145.70 ? 140 ASP B OD1 1 
ATOM   2793  O  OD2 . ASP B 1 140 ? 30.778  -4.469  -4.002  1.00 139.53 ? 140 ASP B OD2 1 
ATOM   2794  N  N   . ALA B 1 141 ? 34.496  -0.670  -5.201  1.00 135.57 ? 141 ALA B N   1 
ATOM   2795  C  CA  . ALA B 1 141 ? 35.220  0.205   -6.111  1.00 137.39 ? 141 ALA B CA  1 
ATOM   2796  C  C   . ALA B 1 141 ? 36.710  0.209   -5.758  1.00 136.16 ? 141 ALA B C   1 
ATOM   2797  O  O   . ALA B 1 141 ? 37.567  0.096   -6.638  1.00 136.76 ? 141 ALA B O   1 
ATOM   2798  C  CB  . ALA B 1 141 ? 34.655  1.612   -6.055  1.00 139.01 ? 141 ALA B CB  1 
ATOM   2799  N  N   . GLY B 1 142 ? 37.014  0.323   -4.468  1.00 130.79 ? 142 GLY B N   1 
ATOM   2800  C  CA  . GLY B 1 142 ? 38.397  0.288   -4.014  1.00 125.49 ? 142 GLY B CA  1 
ATOM   2801  C  C   . GLY B 1 142 ? 39.110  -0.949  -4.524  1.00 122.76 ? 142 GLY B C   1 
ATOM   2802  O  O   . GLY B 1 142 ? 40.216  -0.868  -5.064  1.00 116.97 ? 142 GLY B O   1 
ATOM   2803  N  N   . ARG B 1 143 ? 38.460  -2.097  -4.356  1.00 123.00 ? 143 ARG B N   1 
ATOM   2804  C  CA  . ARG B 1 143 ? 39.023  -3.376  -4.769  1.00 120.74 ? 143 ARG B CA  1 
ATOM   2805  C  C   . ARG B 1 143 ? 39.178  -3.428  -6.267  1.00 122.42 ? 143 ARG B C   1 
ATOM   2806  O  O   . ARG B 1 143 ? 40.223  -3.820  -6.779  1.00 128.92 ? 143 ARG B O   1 
ATOM   2807  C  CB  . ARG B 1 143 ? 38.105  -4.517  -4.351  1.00 120.80 ? 143 ARG B CB  1 
ATOM   2808  C  CG  . ARG B 1 143 ? 38.193  -4.861  -2.885  1.00 117.47 ? 143 ARG B CG  1 
ATOM   2809  C  CD  . ARG B 1 143 ? 36.849  -5.321  -2.361  1.00 117.02 ? 143 ARG B CD  1 
ATOM   2810  N  NE  . ARG B 1 143 ? 36.955  -5.620  -0.945  1.00 116.40 ? 143 ARG B NE  1 
ATOM   2811  C  CZ  . ARG B 1 143 ? 35.931  -5.632  -0.106  1.00 122.14 ? 143 ARG B CZ  1 
ATOM   2812  N  NH1 . ARG B 1 143 ? 34.704  -5.356  -0.542  1.00 123.02 ? 143 ARG B NH1 1 
ATOM   2813  N  NH2 . ARG B 1 143 ? 36.142  -5.915  1.175   1.00 124.50 ? 143 ARG B NH2 1 
ATOM   2814  N  N   . LEU B 1 144 ? 38.112  -3.074  -6.967  1.00 122.61 ? 144 LEU B N   1 
ATOM   2815  C  CA  . LEU B 1 144 ? 38.112  -3.140  -8.410  1.00 126.94 ? 144 LEU B CA  1 
ATOM   2816  C  C   . LEU B 1 144 ? 39.251  -2.291  -8.967  1.00 127.90 ? 144 LEU B C   1 
ATOM   2817  O  O   . LEU B 1 144 ? 40.060  -2.767  -9.762  1.00 124.67 ? 144 LEU B O   1 
ATOM   2818  C  CB  . LEU B 1 144 ? 36.770  -2.658  -8.942  1.00 131.24 ? 144 LEU B CB  1 
ATOM   2819  C  CG  . LEU B 1 144 ? 36.630  -2.662  -10.456 1.00 137.92 ? 144 LEU B CG  1 
ATOM   2820  C  CD1 . LEU B 1 144 ? 36.955  -4.038  -11.019 1.00 137.18 ? 144 LEU B CD1 1 
ATOM   2821  C  CD2 . LEU B 1 144 ? 35.223  -2.226  -10.831 1.00 145.01 ? 144 LEU B CD2 1 
ATOM   2822  N  N   . PHE B 1 145 ? 39.332  -1.045  -8.512  1.00 130.15 ? 145 PHE B N   1 
ATOM   2823  C  CA  . PHE B 1 145 ? 40.365  -0.125  -8.976  1.00 131.53 ? 145 PHE B CA  1 
ATOM   2824  C  C   . PHE B 1 145 ? 41.749  -0.685  -8.671  1.00 131.72 ? 145 PHE B C   1 
ATOM   2825  O  O   . PHE B 1 145 ? 42.675  -0.581  -9.477  1.00 128.11 ? 145 PHE B O   1 
ATOM   2826  C  CB  . PHE B 1 145 ? 40.206  1.245   -8.306  1.00 131.07 ? 145 PHE B CB  1 
ATOM   2827  C  CG  . PHE B 1 145 ? 41.324  2.197   -8.612  1.00 131.26 ? 145 PHE B CG  1 
ATOM   2828  C  CD1 . PHE B 1 145 ? 41.399  2.816   -9.843  1.00 133.85 ? 145 PHE B CD1 1 
ATOM   2829  C  CD2 . PHE B 1 145 ? 42.315  2.449   -7.679  1.00 128.67 ? 145 PHE B CD2 1 
ATOM   2830  C  CE1 . PHE B 1 145 ? 42.434  3.677   -10.137 1.00 135.08 ? 145 PHE B CE1 1 
ATOM   2831  C  CE2 . PHE B 1 145 ? 43.356  3.310   -7.967  1.00 130.16 ? 145 PHE B CE2 1 
ATOM   2832  C  CZ  . PHE B 1 145 ? 43.413  3.927   -9.198  1.00 132.98 ? 145 PHE B CZ  1 
ATOM   2833  N  N   . CYS B 1 146 ? 41.872  -1.278  -7.488  1.00 135.89 ? 146 CYS B N   1 
ATOM   2834  C  CA  . CYS B 1 146 ? 43.146  -1.789  -7.001  1.00 132.78 ? 146 CYS B CA  1 
ATOM   2835  C  C   . CYS B 1 146 ? 43.701  -2.842  -7.946  1.00 127.74 ? 146 CYS B C   1 
ATOM   2836  O  O   . CYS B 1 146 ? 44.905  -2.920  -8.152  1.00 127.15 ? 146 CYS B O   1 
ATOM   2837  C  CB  . CYS B 1 146 ? 42.974  -2.379  -5.600  1.00 131.42 ? 146 CYS B CB  1 
ATOM   2838  S  SG  . CYS B 1 146 ? 44.461  -3.162  -4.945  1.00 133.33 ? 146 CYS B SG  1 
ATOM   2839  N  N   . ILE B 1 147 ? 42.813  -3.655  -8.505  1.00 130.08 ? 147 ILE B N   1 
ATOM   2840  C  CA  . ILE B 1 147 ? 43.200  -4.687  -9.457  1.00 133.18 ? 147 ILE B CA  1 
ATOM   2841  C  C   . ILE B 1 147 ? 43.948  -4.087  -10.644 1.00 138.43 ? 147 ILE B C   1 
ATOM   2842  O  O   . ILE B 1 147 ? 45.075  -4.488  -10.948 1.00 142.58 ? 147 ILE B O   1 
ATOM   2843  C  CB  . ILE B 1 147 ? 41.963  -5.450  -9.972  1.00 135.85 ? 147 ILE B CB  1 
ATOM   2844  C  CG1 . ILE B 1 147 ? 41.463  -6.428  -8.905  1.00 132.14 ? 147 ILE B CG1 1 
ATOM   2845  C  CG2 . ILE B 1 147 ? 42.288  -6.190  -11.261 1.00 139.08 ? 147 ILE B CG2 1 
ATOM   2846  C  CD1 . ILE B 1 147 ? 40.021  -6.847  -9.087  1.00 134.88 ? 147 ILE B CD1 1 
ATOM   2847  N  N   . PHE B 1 148 ? 43.320  -3.126  -11.314 1.00 139.10 ? 148 PHE B N   1 
ATOM   2848  C  CA  . PHE B 1 148 ? 43.908  -2.524  -12.507 1.00 138.59 ? 148 PHE B CA  1 
ATOM   2849  C  C   . PHE B 1 148 ? 45.105  -1.658  -12.145 1.00 134.47 ? 148 PHE B C   1 
ATOM   2850  O  O   . PHE B 1 148 ? 46.067  -1.575  -12.903 1.00 132.47 ? 148 PHE B O   1 
ATOM   2851  C  CB  . PHE B 1 148 ? 42.878  -1.684  -13.255 1.00 143.92 ? 148 PHE B CB  1 
ATOM   2852  C  CG  . PHE B 1 148 ? 41.658  -2.453  -13.670 1.00 148.54 ? 148 PHE B CG  1 
ATOM   2853  C  CD1 . PHE B 1 148 ? 41.765  -3.527  -14.538 1.00 149.09 ? 148 PHE B CD1 1 
ATOM   2854  C  CD2 . PHE B 1 148 ? 40.400  -2.102  -13.193 1.00 147.48 ? 148 PHE B CD2 1 
ATOM   2855  C  CE1 . PHE B 1 148 ? 40.641  -4.238  -14.922 1.00 152.56 ? 148 PHE B CE1 1 
ATOM   2856  C  CE2 . PHE B 1 148 ? 39.275  -2.812  -13.572 1.00 145.12 ? 148 PHE B CE2 1 
ATOM   2857  C  CZ  . PHE B 1 148 ? 39.395  -3.880  -14.437 1.00 148.05 ? 148 PHE B CZ  1 
ATOM   2858  N  N   . TYR B 1 149 ? 45.045  -1.023  -10.980 1.00 130.67 ? 149 TYR B N   1 
ATOM   2859  C  CA  . TYR B 1 149 ? 46.145  -0.194  -10.523 1.00 126.92 ? 149 TYR B CA  1 
ATOM   2860  C  C   . TYR B 1 149 ? 47.412  -1.039  -10.407 1.00 122.36 ? 149 TYR B C   1 
ATOM   2861  O  O   . TYR B 1 149 ? 48.500  -0.584  -10.745 1.00 123.68 ? 149 TYR B O   1 
ATOM   2862  C  CB  . TYR B 1 149 ? 45.810  0.470   -9.185  1.00 124.50 ? 149 TYR B CB  1 
ATOM   2863  C  CG  . TYR B 1 149 ? 46.831  1.497   -8.758  1.00 124.80 ? 149 TYR B CG  1 
ATOM   2864  C  CD1 . TYR B 1 149 ? 46.789  2.786   -9.255  1.00 128.68 ? 149 TYR B CD1 1 
ATOM   2865  C  CD2 . TYR B 1 149 ? 47.852  1.171   -7.873  1.00 124.16 ? 149 TYR B CD2 1 
ATOM   2866  C  CE1 . TYR B 1 149 ? 47.729  3.729   -8.883  1.00 131.96 ? 149 TYR B CE1 1 
ATOM   2867  C  CE2 . TYR B 1 149 ? 48.795  2.108   -7.490  1.00 125.57 ? 149 TYR B CE2 1 
ATOM   2868  C  CZ  . TYR B 1 149 ? 48.728  3.387   -8.001  1.00 130.36 ? 149 TYR B CZ  1 
ATOM   2869  O  OH  . TYR B 1 149 ? 49.660  4.331   -7.630  1.00 134.81 ? 149 TYR B OH  1 
ATOM   2870  N  N   . ALA B 1 150 ? 47.259  -2.279  -9.952  1.00 119.44 ? 150 ALA B N   1 
ATOM   2871  C  CA  . ALA B 1 150 ? 48.397  -3.164  -9.730  1.00 119.21 ? 150 ALA B CA  1 
ATOM   2872  C  C   . ALA B 1 150 ? 48.905  -3.756  -11.044 1.00 124.07 ? 150 ALA B C   1 
ATOM   2873  O  O   . ALA B 1 150 ? 50.103  -3.708  -11.336 1.00 131.30 ? 150 ALA B O   1 
ATOM   2874  C  CB  . ALA B 1 150 ? 48.025  -4.273  -8.760  1.00 115.54 ? 150 ALA B CB  1 
ATOM   2875  N  N   . LEU B 1 151 ? 47.990  -4.300  -11.841 1.00 124.52 ? 151 LEU B N   1 
ATOM   2876  C  CA  . LEU B 1 151 ? 48.354  -4.891  -13.130 1.00 125.80 ? 151 LEU B CA  1 
ATOM   2877  C  C   . LEU B 1 151 ? 49.212  -3.934  -13.958 1.00 127.75 ? 151 LEU B C   1 
ATOM   2878  O  O   . LEU B 1 151 ? 50.207  -4.336  -14.562 1.00 129.94 ? 151 LEU B O   1 
ATOM   2879  C  CB  . LEU B 1 151 ? 47.098  -5.286  -13.911 1.00 126.64 ? 151 LEU B CB  1 
ATOM   2880  C  CG  . LEU B 1 151 ? 46.332  -6.484  -13.332 1.00 123.78 ? 151 LEU B CG  1 
ATOM   2881  C  CD1 . LEU B 1 151 ? 45.039  -6.745  -14.090 1.00 124.51 ? 151 LEU B CD1 1 
ATOM   2882  C  CD2 . LEU B 1 151 ? 47.218  -7.720  -13.331 1.00 122.04 ? 151 LEU B CD2 1 
ATOM   2883  N  N   . VAL B 1 152 ? 48.835  -2.663  -13.955 1.00 129.44 ? 152 VAL B N   1 
ATOM   2884  C  CA  . VAL B 1 152 ? 49.588  -1.632  -14.660 1.00 132.34 ? 152 VAL B CA  1 
ATOM   2885  C  C   . VAL B 1 152 ? 50.781  -1.121  -13.843 1.00 133.77 ? 152 VAL B C   1 
ATOM   2886  O  O   . VAL B 1 152 ? 51.829  -0.780  -14.400 1.00 129.81 ? 152 VAL B O   1 
ATOM   2887  C  CB  . VAL B 1 152 ? 48.668  -0.444  -15.002 1.00 134.38 ? 152 VAL B CB  1 
ATOM   2888  C  CG1 . VAL B 1 152 ? 49.464  0.698   -15.611 1.00 138.02 ? 152 VAL B CG1 1 
ATOM   2889  C  CG2 . VAL B 1 152 ? 47.553  -0.894  -15.934 1.00 133.49 ? 152 VAL B CG2 1 
ATOM   2890  N  N   . GLY B 1 153 ? 50.615  -1.070  -12.524 1.00 134.91 ? 153 GLY B N   1 
ATOM   2891  C  CA  . GLY B 1 153 ? 51.594  -0.431  -11.649 1.00 134.88 ? 153 GLY B CA  1 
ATOM   2892  C  C   . GLY B 1 153 ? 52.838  -1.257  -11.388 1.00 132.19 ? 153 GLY B C   1 
ATOM   2893  O  O   . GLY B 1 153 ? 53.946  -0.723  -11.352 1.00 137.38 ? 153 GLY B O   1 
ATOM   2894  N  N   . ILE B 1 154 ? 52.660  -2.562  -11.208 1.00 126.20 ? 154 ILE B N   1 
ATOM   2895  C  CA  . ILE B 1 154 ? 53.764  -3.437  -10.825 1.00 124.02 ? 154 ILE B CA  1 
ATOM   2896  C  C   . ILE B 1 154 ? 54.832  -3.558  -11.919 1.00 128.60 ? 154 ILE B C   1 
ATOM   2897  O  O   . ILE B 1 154 ? 56.024  -3.405  -11.640 1.00 129.76 ? 154 ILE B O   1 
ATOM   2898  C  CB  . ILE B 1 154 ? 53.265  -4.843  -10.443 1.00 116.45 ? 154 ILE B CB  1 
ATOM   2899  C  CG1 . ILE B 1 154 ? 52.378  -4.764  -9.201  1.00 113.19 ? 154 ILE B CG1 1 
ATOM   2900  C  CG2 . ILE B 1 154 ? 54.448  -5.762  -10.184 1.00 116.22 ? 154 ILE B CG2 1 
ATOM   2901  C  CD1 . ILE B 1 154 ? 51.587  -6.022  -8.927  1.00 111.14 ? 154 ILE B CD1 1 
ATOM   2902  N  N   . PRO B 1 155 ? 54.414  -3.840  -13.166 1.00 130.88 ? 155 PRO B N   1 
ATOM   2903  C  CA  . PRO B 1 155 ? 55.400  -3.906  -14.240 1.00 134.13 ? 155 PRO B CA  1 
ATOM   2904  C  C   . PRO B 1 155 ? 56.069  -2.556  -14.487 1.00 137.80 ? 155 PRO B C   1 
ATOM   2905  O  O   . PRO B 1 155 ? 57.284  -2.491  -14.704 1.00 139.30 ? 155 PRO B O   1 
ATOM   2906  C  CB  . PRO B 1 155 ? 54.575  -4.334  -15.457 1.00 132.90 ? 155 PRO B CB  1 
ATOM   2907  C  CG  . PRO B 1 155 ? 53.188  -3.905  -15.150 1.00 132.89 ? 155 PRO B CG  1 
ATOM   2908  C  CD  . PRO B 1 155 ? 53.040  -4.025  -13.663 1.00 131.13 ? 155 PRO B CD  1 
ATOM   2909  N  N   . LEU B 1 156 ? 55.284  -1.486  -14.423 1.00 137.18 ? 156 LEU B N   1 
ATOM   2910  C  CA  . LEU B 1 156 ? 55.836  -0.146  -14.533 1.00 142.88 ? 156 LEU B CA  1 
ATOM   2911  C  C   . LEU B 1 156 ? 56.931  0.049   -13.492 1.00 145.06 ? 156 LEU B C   1 
ATOM   2912  O  O   . LEU B 1 156 ? 57.982  0.618   -13.782 1.00 149.01 ? 156 LEU B O   1 
ATOM   2913  C  CB  . LEU B 1 156 ? 54.746  0.906   -14.330 1.00 145.96 ? 156 LEU B CB  1 
ATOM   2914  C  CG  . LEU B 1 156 ? 55.259  2.329   -14.068 1.00 152.25 ? 156 LEU B CG  1 
ATOM   2915  C  CD1 . LEU B 1 156 ? 56.063  2.846   -15.250 1.00 153.92 ? 156 LEU B CD1 1 
ATOM   2916  C  CD2 . LEU B 1 156 ? 54.111  3.275   -13.751 1.00 158.35 ? 156 LEU B CD2 1 
ATOM   2917  N  N   . PHE B 1 157 ? 56.670  -0.413  -12.274 1.00 144.15 ? 157 PHE B N   1 
ATOM   2918  C  CA  . PHE B 1 157 ? 57.621  -0.253  -11.183 1.00 140.57 ? 157 PHE B CA  1 
ATOM   2919  C  C   . PHE B 1 157 ? 58.852  -1.129  -11.400 1.00 138.02 ? 157 PHE B C   1 
ATOM   2920  O  O   . PHE B 1 157 ? 59.981  -0.702  -11.156 1.00 135.78 ? 157 PHE B O   1 
ATOM   2921  C  CB  . PHE B 1 157 ? 56.964  -0.583  -9.837  1.00 137.22 ? 157 PHE B CB  1 
ATOM   2922  C  CG  . PHE B 1 157 ? 57.868  -0.357  -8.668  1.00 132.33 ? 157 PHE B CG  1 
ATOM   2923  C  CD1 . PHE B 1 157 ? 58.084  0.928   -8.188  1.00 133.07 ? 157 PHE B CD1 1 
ATOM   2924  C  CD2 . PHE B 1 157 ? 58.537  -1.416  -8.080  1.00 126.17 ? 157 PHE B CD2 1 
ATOM   2925  C  CE1 . PHE B 1 157 ? 58.936  1.150   -7.129  1.00 131.86 ? 157 PHE B CE1 1 
ATOM   2926  C  CE2 . PHE B 1 157 ? 59.390  -1.200  -7.019  1.00 128.20 ? 157 PHE B CE2 1 
ATOM   2927  C  CZ  . PHE B 1 157 ? 59.593  0.085   -6.544  1.00 131.53 ? 157 PHE B CZ  1 
ATOM   2928  N  N   . GLY B 1 158 ? 58.621  -2.361  -11.844 1.00 139.37 ? 158 GLY B N   1 
ATOM   2929  C  CA  . GLY B 1 158 ? 59.705  -3.289  -12.143 1.00 136.32 ? 158 GLY B CA  1 
ATOM   2930  C  C   . GLY B 1 158 ? 60.719  -2.668  -13.079 1.00 137.91 ? 158 GLY B C   1 
ATOM   2931  O  O   . GLY B 1 158 ? 61.927  -2.800  -12.875 1.00 135.86 ? 158 GLY B O   1 
ATOM   2932  N  N   . ILE B 1 159 ? 60.217  -1.974  -14.097 1.00 142.28 ? 159 ILE B N   1 
ATOM   2933  C  CA  . ILE B 1 159 ? 61.069  -1.241  -15.039 1.00 145.76 ? 159 ILE B CA  1 
ATOM   2934  C  C   . ILE B 1 159 ? 61.940  -0.215  -14.321 1.00 142.16 ? 159 ILE B C   1 
ATOM   2935  O  O   . ILE B 1 159 ? 63.154  -0.180  -14.514 1.00 144.74 ? 159 ILE B O   1 
ATOM   2936  C  CB  . ILE B 1 159 ? 60.233  -0.500  -16.110 1.00 147.66 ? 159 ILE B CB  1 
ATOM   2937  C  CG1 . ILE B 1 159 ? 59.426  -1.494  -16.953 1.00 152.47 ? 159 ILE B CG1 1 
ATOM   2938  C  CG2 . ILE B 1 159 ? 61.128  0.344   -17.005 1.00 144.18 ? 159 ILE B CG2 1 
ATOM   2939  C  CD1 . ILE B 1 159 ? 60.252  -2.615  -17.552 1.00 155.85 ? 159 ILE B CD1 1 
ATOM   2940  N  N   . LEU B 1 160 ? 61.314  0.630   -13.509 1.00 140.24 ? 160 LEU B N   1 
ATOM   2941  C  CA  . LEU B 1 160 ? 62.039  1.652   -12.769 1.00 140.26 ? 160 LEU B CA  1 
ATOM   2942  C  C   . LEU B 1 160 ? 63.069  1.007   -11.868 1.00 139.61 ? 160 LEU B C   1 
ATOM   2943  O  O   . LEU B 1 160 ? 64.144  1.561   -11.653 1.00 143.52 ? 160 LEU B O   1 
ATOM   2944  C  CB  . LEU B 1 160 ? 61.086  2.485   -11.911 1.00 140.54 ? 160 LEU B CB  1 
ATOM   2945  C  CG  . LEU B 1 160 ? 61.753  3.522   -11.007 1.00 143.36 ? 160 LEU B CG  1 
ATOM   2946  C  CD1 . LEU B 1 160 ? 62.440  4.575   -11.854 1.00 149.64 ? 160 LEU B CD1 1 
ATOM   2947  C  CD2 . LEU B 1 160 ? 60.772  4.176   -10.048 1.00 146.65 ? 160 LEU B CD2 1 
ATOM   2948  N  N   . LEU B 1 161 ? 62.727  -0.162  -11.337 1.00 139.21 ? 161 LEU B N   1 
ATOM   2949  C  CA  . LEU B 1 161 ? 63.575  -0.849  -10.370 1.00 143.72 ? 161 LEU B CA  1 
ATOM   2950  C  C   . LEU B 1 161 ? 64.843  -1.389  -11.030 1.00 145.24 ? 161 LEU B C   1 
ATOM   2951  O  O   . LEU B 1 161 ? 65.959  -1.169  -10.542 1.00 145.90 ? 161 LEU B O   1 
ATOM   2952  C  CB  . LEU B 1 161 ? 62.790  -1.983  -9.707  1.00 143.25 ? 161 LEU B CB  1 
ATOM   2953  C  CG  . LEU B 1 161 ? 63.352  -2.484  -8.377  1.00 146.63 ? 161 LEU B CG  1 
ATOM   2954  C  CD1 . LEU B 1 161 ? 63.330  -1.376  -7.331  1.00 151.41 ? 161 LEU B CD1 1 
ATOM   2955  C  CD2 . LEU B 1 161 ? 62.561  -3.693  -7.897  1.00 139.41 ? 161 LEU B CD2 1 
ATOM   2956  N  N   . ALA B 1 162 ? 64.661  -2.086  -12.147 1.00 142.24 ? 162 ALA B N   1 
ATOM   2957  C  CA  . ALA B 1 162 ? 65.778  -2.473  -13.007 1.00 138.61 ? 162 ALA B CA  1 
ATOM   2958  C  C   . ALA B 1 162 ? 66.679  -1.278  -13.300 1.00 139.27 ? 162 ALA B C   1 
ATOM   2959  O  O   . ALA B 1 162 ? 67.905  -1.352  -13.158 1.00 137.97 ? 162 ALA B O   1 
ATOM   2960  C  CB  . ALA B 1 162 ? 65.251  -3.060  -14.307 1.00 135.58 ? 162 ALA B CB  1 
ATOM   2961  N  N   . GLY B 1 163 ? 66.058  -0.175  -13.702 1.00 142.33 ? 163 GLY B N   1 
ATOM   2962  C  CA  . GLY B 1 163 ? 66.782  1.049   -14.006 1.00 146.92 ? 163 GLY B CA  1 
ATOM   2963  C  C   . GLY B 1 163 ? 67.612  1.524   -12.830 1.00 151.15 ? 163 GLY B C   1 
ATOM   2964  O  O   . GLY B 1 163 ? 68.808  1.769   -12.969 1.00 154.45 ? 163 GLY B O   1 
ATOM   2965  N  N   . VAL B 1 164 ? 66.981  1.634   -11.665 1.00 151.79 ? 164 VAL B N   1 
ATOM   2966  C  CA  . VAL B 1 164 ? 67.665  2.117   -10.470 1.00 155.85 ? 164 VAL B CA  1 
ATOM   2967  C  C   . VAL B 1 164 ? 68.698  1.106   -9.988  1.00 157.32 ? 164 VAL B C   1 
ATOM   2968  O  O   . VAL B 1 164 ? 69.746  1.483   -9.458  1.00 157.11 ? 164 VAL B O   1 
ATOM   2969  C  CB  . VAL B 1 164 ? 66.671  2.405   -9.330  1.00 157.11 ? 164 VAL B CB  1 
ATOM   2970  C  CG1 . VAL B 1 164 ? 67.403  2.877   -8.081  1.00 161.23 ? 164 VAL B CG1 1 
ATOM   2971  C  CG2 . VAL B 1 164 ? 65.657  3.449   -9.774  1.00 159.72 ? 164 VAL B CG2 1 
ATOM   2972  N  N   . GLY B 1 165 ? 68.402  -0.176  -10.174 1.00 159.39 ? 165 GLY B N   1 
ATOM   2973  C  CA  . GLY B 1 165 ? 69.351  -1.233  -9.835  1.00 163.94 ? 165 GLY B CA  1 
ATOM   2974  C  C   . GLY B 1 165 ? 70.660  -1.103  -10.598 1.00 168.37 ? 165 GLY B C   1 
ATOM   2975  O  O   . GLY B 1 165 ? 71.750  -1.199  -10.018 1.00 159.91 ? 165 GLY B O   1 
ATOM   2976  N  N   . ASP B 1 166 ? 70.551  -0.886  -11.906 1.00 176.05 ? 166 ASP B N   1 
ATOM   2977  C  CA  . ASP B 1 166 ? 71.731  -0.714  -12.753 1.00 183.83 ? 166 ASP B CA  1 
ATOM   2978  C  C   . ASP B 1 166 ? 72.471  0.574   -12.404 1.00 178.89 ? 166 ASP B C   1 
ATOM   2979  O  O   . ASP B 1 166 ? 73.703  0.594   -12.329 1.00 176.34 ? 166 ASP B O   1 
ATOM   2980  C  CB  . ASP B 1 166 ? 71.336  -0.707  -14.235 1.00 188.64 ? 166 ASP B CB  1 
ATOM   2981  C  CG  . ASP B 1 166 ? 70.878  -2.073  -14.732 1.00 190.77 ? 166 ASP B CG  1 
ATOM   2982  O  OD1 . ASP B 1 166 ? 71.089  -3.083  -14.025 1.00 189.15 ? 166 ASP B OD1 1 
ATOM   2983  O  OD2 . ASP B 1 166 ? 70.302  -2.137  -15.837 1.00 190.99 ? 166 ASP B OD2 1 
ATOM   2984  N  N   . ARG B 1 167 ? 71.711  1.641   -12.180 1.00 174.70 ? 167 ARG B N   1 
ATOM   2985  C  CA  . ARG B 1 167 ? 72.285  2.943   -11.890 1.00 174.64 ? 167 ARG B CA  1 
ATOM   2986  C  C   . ARG B 1 167 ? 72.938  2.979   -10.510 1.00 171.11 ? 167 ARG B C   1 
ATOM   2987  O  O   . ARG B 1 167 ? 73.975  3.616   -10.333 1.00 174.87 ? 167 ARG B O   1 
ATOM   2988  C  CB  . ARG B 1 167 ? 71.214  4.032   -11.987 1.00 176.00 ? 167 ARG B CB  1 
ATOM   2989  C  CG  . ARG B 1 167 ? 71.780  5.439   -11.909 1.00 185.16 ? 167 ARG B CG  1 
ATOM   2990  C  CD  . ARG B 1 167 ? 72.737  5.712   -13.055 1.00 192.03 ? 167 ARG B CD  1 
ATOM   2991  N  NE  . ARG B 1 167 ? 73.384  7.010   -12.913 1.00 204.58 ? 167 ARG B NE  1 
ATOM   2992  C  CZ  . ARG B 1 167 ? 74.669  7.244   -13.168 1.00 222.63 ? 167 ARG B CZ  1 
ATOM   2993  N  NH1 . ARG B 1 167 ? 75.466  6.265   -13.580 1.00 224.70 ? 167 ARG B NH1 1 
ATOM   2994  N  NH2 . ARG B 1 167 ? 75.162  8.464   -13.004 1.00 240.60 ? 167 ARG B NH2 1 
ATOM   2995  N  N   . LEU B 1 168 ? 72.319  2.312   -9.537  1.00 167.87 ? 168 LEU B N   1 
ATOM   2996  C  CA  . LEU B 1 168 ? 72.848  2.270   -8.174  1.00 167.01 ? 168 LEU B CA  1 
ATOM   2997  C  C   . LEU B 1 168 ? 74.127  1.451   -8.134  1.00 168.90 ? 168 LEU B C   1 
ATOM   2998  O  O   . LEU B 1 168 ? 75.114  1.865   -7.525  1.00 175.80 ? 168 LEU B O   1 
ATOM   2999  C  CB  . LEU B 1 168 ? 71.821  1.680   -7.200  1.00 159.20 ? 168 LEU B CB  1 
ATOM   3000  C  CG  . LEU B 1 168 ? 72.337  1.441   -5.777  1.00 160.08 ? 168 LEU B CG  1 
ATOM   3001  C  CD1 . LEU B 1 168 ? 72.691  2.760   -5.107  1.00 164.28 ? 168 LEU B CD1 1 
ATOM   3002  C  CD2 . LEU B 1 168 ? 71.322  0.671   -4.939  1.00 154.83 ? 168 LEU B CD2 1 
ATOM   3003  N  N   . GLY B 1 169 ? 74.098  0.287   -8.780  1.00 164.46 ? 169 GLY B N   1 
ATOM   3004  C  CA  . GLY B 1 169 ? 75.286  -0.563  -8.888  1.00 164.84 ? 169 GLY B CA  1 
ATOM   3005  C  C   . GLY B 1 169 ? 76.425  0.102   -9.640  1.00 167.75 ? 169 GLY B C   1 
ATOM   3006  O  O   . GLY B 1 169 ? 77.591  -0.001  -9.247  1.00 168.86 ? 169 GLY B O   1 
ATOM   3007  N  N   . SER B 1 170 ? 76.084  0.791   -10.723 1.00 167.43 ? 170 SER B N   1 
ATOM   3008  C  CA  . SER B 1 170 ? 77.053  1.591   -11.464 1.00 168.98 ? 170 SER B CA  1 
ATOM   3009  C  C   . SER B 1 170 ? 77.771  2.593   -10.555 1.00 177.48 ? 170 SER B C   1 
ATOM   3010  O  O   . SER B 1 170 ? 79.000  2.620   -10.500 1.00 184.39 ? 170 SER B O   1 
ATOM   3011  C  CB  . SER B 1 170 ? 76.351  2.338   -12.596 1.00 167.56 ? 170 SER B CB  1 
ATOM   3012  O  OG  . SER B 1 170 ? 77.085  3.482   -12.980 1.00 170.06 ? 170 SER B OG  1 
ATOM   3013  N  N   . SER B 1 171 ? 77.001  3.415   -9.849  1.00 184.96 ? 171 SER B N   1 
ATOM   3014  C  CA  . SER B 1 171 ? 77.569  4.444   -8.978  1.00 192.33 ? 171 SER B CA  1 
ATOM   3015  C  C   . SER B 1 171 ? 78.418  3.839   -7.859  1.00 196.36 ? 171 SER B C   1 
ATOM   3016  O  O   . SER B 1 171 ? 79.483  4.366   -7.536  1.00 197.01 ? 171 SER B O   1 
ATOM   3017  C  CB  . SER B 1 171 ? 76.467  5.318   -8.377  1.00 194.52 ? 171 SER B CB  1 
ATOM   3018  O  OG  . SER B 1 171 ? 77.024  6.397   -7.647  1.00 198.29 ? 171 SER B OG  1 
ATOM   3019  N  N   . LEU B 1 172 ? 77.944  2.742   -7.266  1.00 198.72 ? 172 LEU B N   1 
ATOM   3020  C  CA  . LEU B 1 172 ? 78.709  2.034   -6.235  1.00 199.21 ? 172 LEU B CA  1 
ATOM   3021  C  C   . LEU B 1 172 ? 80.007  1.497   -6.829  1.00 202.92 ? 172 LEU B C   1 
ATOM   3022  O  O   . LEU B 1 172 ? 81.088  1.732   -6.297  1.00 208.34 ? 172 LEU B O   1 
ATOM   3023  C  CB  . LEU B 1 172 ? 77.899  0.873   -5.638  1.00 196.88 ? 172 LEU B CB  1 
ATOM   3024  C  CG  . LEU B 1 172 ? 76.818  1.202   -4.599  1.00 192.00 ? 172 LEU B CG  1 
ATOM   3025  C  CD1 . LEU B 1 172 ? 76.206  -0.088  -4.063  1.00 190.26 ? 172 LEU B CD1 1 
ATOM   3026  C  CD2 . LEU B 1 172 ? 77.382  2.041   -3.463  1.00 191.16 ? 172 LEU B CD2 1 
ATOM   3027  N  N   . ARG B 1 173 ? 79.888  0.777   -7.940  1.00 201.28 ? 173 ARG B N   1 
ATOM   3028  C  CA  . ARG B 1 173 ? 81.047  0.209   -8.624  1.00 199.38 ? 173 ARG B CA  1 
ATOM   3029  C  C   . ARG B 1 173 ? 82.093  1.269   -9.006  1.00 207.74 ? 173 ARG B C   1 
ATOM   3030  O  O   . ARG B 1 173 ? 83.294  1.016   -8.929  1.00 211.85 ? 173 ARG B O   1 
ATOM   3031  C  CB  . ARG B 1 173 ? 80.572  -0.542  -9.869  1.00 192.26 ? 173 ARG B CB  1 
ATOM   3032  C  CG  . ARG B 1 173 ? 81.587  -1.499  -10.461 1.00 190.61 ? 173 ARG B CG  1 
ATOM   3033  C  CD  . ARG B 1 173 ? 80.955  -2.346  -11.559 1.00 185.21 ? 173 ARG B CD  1 
ATOM   3034  N  NE  . ARG B 1 173 ? 80.559  -1.552  -12.725 1.00 187.46 ? 173 ARG B NE  1 
ATOM   3035  C  CZ  . ARG B 1 173 ? 81.399  -1.129  -13.669 1.00 192.77 ? 173 ARG B CZ  1 
ATOM   3036  N  NH1 . ARG B 1 173 ? 82.696  -1.403  -13.588 1.00 199.47 ? 173 ARG B NH1 1 
ATOM   3037  N  NH2 . ARG B 1 173 ? 80.946  -0.418  -14.692 1.00 191.34 ? 173 ARG B NH2 1 
ATOM   3038  N  N   . HIS B 1 174 ? 81.633  2.447   -9.421  1.00 211.54 ? 174 HIS B N   1 
ATOM   3039  C  CA  . HIS B 1 174 ? 82.535  3.564   -9.735  1.00 214.74 ? 174 HIS B CA  1 
ATOM   3040  C  C   . HIS B 1 174 ? 83.272  4.051   -8.487  1.00 219.43 ? 174 HIS B C   1 
ATOM   3041  O  O   . HIS B 1 174 ? 84.480  4.290   -8.524  1.00 234.84 ? 174 HIS B O   1 
ATOM   3042  C  CB  . HIS B 1 174 ? 81.761  4.726   -10.371 1.00 216.62 ? 174 HIS B CB  1 
ATOM   3043  C  CG  . HIS B 1 174 ? 82.570  5.978   -10.534 1.00 230.46 ? 174 HIS B CG  1 
ATOM   3044  N  ND1 . HIS B 1 174 ? 83.547  6.115   -11.498 1.00 238.52 ? 174 HIS B ND1 1 
ATOM   3045  C  CD2 . HIS B 1 174 ? 82.551  7.149   -9.852  1.00 238.33 ? 174 HIS B CD2 1 
ATOM   3046  C  CE1 . HIS B 1 174 ? 84.097  7.312   -11.400 1.00 240.41 ? 174 HIS B CE1 1 
ATOM   3047  N  NE2 . HIS B 1 174 ? 83.512  7.960   -10.410 1.00 243.21 ? 174 HIS B NE2 1 
ATOM   3048  N  N   . GLY B 1 175 ? 82.538  4.208   -7.390  1.00 215.53 ? 175 GLY B N   1 
ATOM   3049  C  CA  . GLY B 1 175 ? 83.128  4.618   -6.118  1.00 221.92 ? 175 GLY B CA  1 
ATOM   3050  C  C   . GLY B 1 175 ? 84.102  3.589   -5.571  1.00 231.78 ? 175 GLY B C   1 
ATOM   3051  O  O   . GLY B 1 175 ? 85.148  3.941   -5.033  1.00 244.98 ? 175 GLY B O   1 
ATOM   3052  N  N   . ILE B 1 176 ? 83.758  2.312   -5.707  1.00 241.45 ? 176 ILE B N   1 
ATOM   3053  C  CA  . ILE B 1 176 ? 84.668  1.217   -5.339  1.00 245.03 ? 176 ILE B CA  1 
ATOM   3054  C  C   . ILE B 1 176 ? 86.001  1.278   -6.102  1.00 251.23 ? 176 ILE B C   1 
ATOM   3055  O  O   . ILE B 1 176 ? 87.072  0.994   -5.545  1.00 257.40 ? 176 ILE B O   1 
ATOM   3056  C  CB  . ILE B 1 176 ? 84.006  -0.160  -5.579  1.00 242.42 ? 176 ILE B CB  1 
ATOM   3057  C  CG1 . ILE B 1 176 ? 83.185  -0.583  -4.350  1.00 241.58 ? 176 ILE B CG1 1 
ATOM   3058  C  CG2 . ILE B 1 176 ? 85.055  -1.210  -5.911  1.00 237.38 ? 176 ILE B CG2 1 
ATOM   3059  C  CD1 . ILE B 1 176 ? 81.690  -0.425  -4.527  1.00 246.35 ? 176 ILE B CD1 1 
ATOM   3060  N  N   . GLY B 1 177 ? 85.929  1.650   -7.377  1.00 251.05 ? 177 GLY B N   1 
ATOM   3061  C  CA  . GLY B 1 177 ? 87.106  1.668   -8.247  1.00 237.32 ? 177 GLY B CA  1 
ATOM   3062  C  C   . GLY B 1 177 ? 88.290  2.432   -7.679  1.00 231.00 ? 177 GLY B C   1 
ATOM   3063  O  O   . GLY B 1 177 ? 89.439  2.005   -7.817  1.00 224.09 ? 177 GLY B O   1 
ATOM   3064  N  N   . HIS B 1 178 ? 88.012  3.558   -7.029  1.00 232.40 ? 178 HIS B N   1 
ATOM   3065  C  CA  . HIS B 1 178 ? 89.064  4.418   -6.494  1.00 231.03 ? 178 HIS B CA  1 
ATOM   3066  C  C   . HIS B 1 178 ? 89.802  3.756   -5.324  1.00 236.65 ? 178 HIS B C   1 
ATOM   3067  O  O   . HIS B 1 178 ? 91.030  3.847   -5.222  1.00 241.48 ? 178 HIS B O   1 
ATOM   3068  C  CB  . HIS B 1 178 ? 88.474  5.763   -6.061  1.00 226.15 ? 178 HIS B CB  1 
ATOM   3069  C  CG  . HIS B 1 178 ? 87.810  6.520   -7.172  1.00 225.98 ? 178 HIS B CG  1 
ATOM   3070  N  ND1 . HIS B 1 178 ? 86.849  7.480   -6.940  1.00 229.00 ? 178 HIS B ND1 1 
ATOM   3071  C  CD2 . HIS B 1 178 ? 87.932  6.431   -8.519  1.00 221.10 ? 178 HIS B CD2 1 
ATOM   3072  C  CE1 . HIS B 1 178 ? 86.426  7.968   -8.092  1.00 227.20 ? 178 HIS B CE1 1 
ATOM   3073  N  NE2 . HIS B 1 178 ? 87.065  7.346   -9.067  1.00 223.47 ? 178 HIS B NE2 1 
ATOM   3074  N  N   . ILE B 1 179 ? 89.053  3.086   -4.450  1.00 244.49 ? 179 ILE B N   1 
ATOM   3075  C  CA  . ILE B 1 179 ? 89.646  2.327   -3.344  1.00 249.09 ? 179 ILE B CA  1 
ATOM   3076  C  C   . ILE B 1 179 ? 90.322  1.050   -3.859  1.00 261.76 ? 179 ILE B C   1 
ATOM   3077  O  O   . ILE B 1 179 ? 91.320  0.597   -3.291  1.00 273.35 ? 179 ILE B O   1 
ATOM   3078  C  CB  . ILE B 1 179 ? 88.596  1.949   -2.271  1.00 238.63 ? 179 ILE B CB  1 
ATOM   3079  C  CG1 . ILE B 1 179 ? 87.954  3.208   -1.675  1.00 229.93 ? 179 ILE B CG1 1 
ATOM   3080  C  CG2 . ILE B 1 179 ? 89.237  1.118   -1.164  1.00 231.75 ? 179 ILE B CG2 1 
ATOM   3081  C  CD1 . ILE B 1 179 ? 86.697  2.939   -0.878  1.00 225.11 ? 179 ILE B CD1 1 
ATOM   3082  N  N   . GLU B 1 180 ? 89.770  0.472   -4.926  1.00 269.34 ? 180 GLU B N   1 
ATOM   3083  C  CA  . GLU B 1 180 ? 90.374  -0.692  -5.585  1.00 271.81 ? 180 GLU B CA  1 
ATOM   3084  C  C   . GLU B 1 180 ? 91.797  -0.389  -6.078  1.00 283.46 ? 180 GLU B C   1 
ATOM   3085  O  O   . GLU B 1 180 ? 92.681  -1.254  -6.029  1.00 295.33 ? 180 GLU B O   1 
ATOM   3086  C  CB  . GLU B 1 180 ? 89.490  -1.151  -6.752  1.00 266.24 ? 180 GLU B CB  1 
ATOM   3087  C  CG  . GLU B 1 180 ? 90.125  -2.198  -7.655  1.00 264.60 ? 180 GLU B CG  1 
ATOM   3088  C  CD  . GLU B 1 180 ? 89.132  -2.841  -8.606  1.00 263.50 ? 180 GLU B CD  1 
ATOM   3089  O  OE1 . GLU B 1 180 ? 88.292  -3.643  -8.148  1.00 263.44 ? 180 GLU B OE1 1 
ATOM   3090  O  OE2 . GLU B 1 180 ? 89.209  -2.565  -9.820  1.00 264.10 ? 180 GLU B OE2 1 
ATOM   3091  N  N   . ALA B 1 181 ? 92.014  0.842   -6.539  1.00 281.15 ? 181 ALA B N   1 
ATOM   3092  C  CA  . ALA B 1 181 ? 93.346  1.299   -6.951  1.00 263.31 ? 181 ALA B CA  1 
ATOM   3093  C  C   . ALA B 1 181 ? 94.387  1.105   -5.840  1.00 259.76 ? 181 ALA B C   1 
ATOM   3094  O  O   . ALA B 1 181 ? 95.531  0.719   -6.102  1.00 260.02 ? 181 ALA B O   1 
ATOM   3095  C  CB  . ALA B 1 181 ? 93.287  2.760   -7.372  1.00 252.15 ? 181 ALA B CB  1 
ATOM   3096  N  N   . ILE B 1 182 ? 93.977  1.366   -4.601  1.00 253.77 ? 182 ILE B N   1 
ATOM   3097  C  CA  . ILE B 1 182 ? 94.858  1.218   -3.439  1.00 242.58 ? 182 ILE B CA  1 
ATOM   3098  C  C   . ILE B 1 182 ? 95.248  -0.246  -3.189  1.00 256.89 ? 182 ILE B C   1 
ATOM   3099  O  O   . ILE B 1 182 ? 96.415  -0.542  -2.925  1.00 260.85 ? 182 ILE B O   1 
ATOM   3100  C  CB  . ILE B 1 182 ? 94.208  1.801   -2.165  1.00 227.07 ? 182 ILE B CB  1 
ATOM   3101  C  CG1 . ILE B 1 182 ? 94.004  3.314   -2.314  1.00 215.30 ? 182 ILE B CG1 1 
ATOM   3102  C  CG2 . ILE B 1 182 ? 95.069  1.501   -0.945  1.00 222.36 ? 182 ILE B CG2 1 
ATOM   3103  C  CD1 . ILE B 1 182 ? 93.092  3.918   -1.269  1.00 208.59 ? 182 ILE B CD1 1 
ATOM   3104  N  N   . PHE B 1 183 ? 94.276  -1.154  -3.281  1.00 271.73 ? 183 PHE B N   1 
ATOM   3105  C  CA  . PHE B 1 183 ? 94.529  -2.589  -3.072  1.00 268.34 ? 183 PHE B CA  1 
ATOM   3106  C  C   . PHE B 1 183 ? 95.513  -3.157  -4.098  1.00 262.42 ? 183 PHE B C   1 
ATOM   3107  O  O   . PHE B 1 183 ? 96.389  -3.951  -3.754  1.00 249.58 ? 183 PHE B O   1 
ATOM   3108  C  CB  . PHE B 1 183 ? 93.222  -3.394  -3.144  1.00 273.98 ? 183 PHE B CB  1 
ATOM   3109  C  CG  . PHE B 1 183 ? 92.249  -3.094  -2.032  1.00 278.59 ? 183 PHE B CG  1 
ATOM   3110  C  CD1 . PHE B 1 183 ? 92.691  -2.877  -0.734  1.00 270.48 ? 183 PHE B CD1 1 
ATOM   3111  C  CD2 . PHE B 1 183 ? 90.884  -3.064  -2.283  1.00 281.89 ? 183 PHE B CD2 1 
ATOM   3112  C  CE1 . PHE B 1 183 ? 91.792  -2.610  0.284   1.00 262.48 ? 183 PHE B CE1 1 
ATOM   3113  C  CE2 . PHE B 1 183 ? 89.982  -2.798  -1.268  1.00 273.84 ? 183 PHE B CE2 1 
ATOM   3114  C  CZ  . PHE B 1 183 ? 90.436  -2.569  0.017   1.00 264.53 ? 183 PHE B CZ  1 
ATOM   3115  N  N   . LEU B 1 184 ? 95.351  -2.760  -5.358  1.00 259.72 ? 184 LEU B N   1 
ATOM   3116  C  CA  . LEU B 1 184 ? 96.185  -3.273  -6.446  1.00 250.69 ? 184 LEU B CA  1 
ATOM   3117  C  C   . LEU B 1 184 ? 97.640  -2.839  -6.305  1.00 249.94 ? 184 LEU B C   1 
ATOM   3118  O  O   . LEU B 1 184 ? 98.553  -3.583  -6.664  1.00 245.22 ? 184 LEU B O   1 
ATOM   3119  C  CB  . LEU B 1 184 ? 95.638  -2.804  -7.795  1.00 247.66 ? 184 LEU B CB  1 
ATOM   3120  C  CG  . LEU B 1 184 ? 94.354  -3.503  -8.240  1.00 244.54 ? 184 LEU B CG  1 
ATOM   3121  C  CD1 . LEU B 1 184 ? 93.700  -2.751  -9.391  1.00 241.62 ? 184 LEU B CD1 1 
ATOM   3122  C  CD2 . LEU B 1 184 ? 94.659  -4.940  -8.631  1.00 240.24 ? 184 LEU B CD2 1 
ATOM   3123  N  N   . LYS B 1 185 ? 97.847  -1.629  -5.795  1.00 250.13 ? 185 LYS B N   1 
ATOM   3124  C  CA  . LYS B 1 185 ? 99.192  -1.136  -5.512  1.00 241.09 ? 185 LYS B CA  1 
ATOM   3125  C  C   . LYS B 1 185 ? 99.817  -1.914  -4.357  1.00 246.07 ? 185 LYS B C   1 
ATOM   3126  O  O   . LYS B 1 185 ? 101.018 -2.185  -4.362  1.00 244.92 ? 185 LYS B O   1 
ATOM   3127  C  CB  . LYS B 1 185 ? 99.157  0.361   -5.197  1.00 231.69 ? 185 LYS B CB  1 
ATOM   3128  C  CG  . LYS B 1 185 ? 98.852  1.218   -6.414  1.00 226.16 ? 185 LYS B CG  1 
ATOM   3129  C  CD  . LYS B 1 185 ? 98.917  2.704   -6.106  1.00 216.77 ? 185 LYS B CD  1 
ATOM   3130  C  CE  . LYS B 1 185 ? 99.008  3.518   -7.387  1.00 211.72 ? 185 LYS B CE  1 
ATOM   3131  N  NZ  . LYS B 1 185 ? 99.068  4.981   -7.127  1.00 208.59 ? 185 LYS B NZ  1 
ATOM   3132  N  N   . TRP B 1 186 ? 98.988  -2.297  -3.387  1.00 256.44 ? 186 TRP B N   1 
ATOM   3133  C  CA  . TRP B 1 186 ? 99.434  -3.130  -2.269  1.00 255.65 ? 186 TRP B CA  1 
ATOM   3134  C  C   . TRP B 1 186 ? 99.693  -4.577  -2.702  1.00 258.10 ? 186 TRP B C   1 
ATOM   3135  O  O   . TRP B 1 186 ? 99.874  -5.460  -1.864  1.00 260.83 ? 186 TRP B O   1 
ATOM   3136  C  CB  . TRP B 1 186 ? 98.407  -3.087  -1.130  1.00 251.34 ? 186 TRP B CB  1 
ATOM   3137  C  CG  . TRP B 1 186 ? 98.406  -1.776  -0.378  1.00 245.22 ? 186 TRP B CG  1 
ATOM   3138  C  CD1 . TRP B 1 186 ? 97.324  -0.978  -0.120  1.00 236.55 ? 186 TRP B CD1 1 
ATOM   3139  C  CD2 . TRP B 1 186 ? 99.544  -1.101  0.185   1.00 235.62 ? 186 TRP B CD2 1 
ATOM   3140  N  NE1 . TRP B 1 186 ? 97.715  0.140   0.579   1.00 230.24 ? 186 TRP B NE1 1 
ATOM   3141  C  CE2 . TRP B 1 186 ? 99.071  0.091   0.777   1.00 231.57 ? 186 TRP B CE2 1 
ATOM   3142  C  CE3 . TRP B 1 186 ? 100.914 -1.390  0.248   1.00 225.01 ? 186 TRP B CE3 1 
ATOM   3143  C  CZ2 . TRP B 1 186 ? 99.921  0.991   1.424   1.00 223.09 ? 186 TRP B CZ2 1 
ATOM   3144  C  CZ3 . TRP B 1 186 ? 101.756 -0.492  0.891   1.00 220.20 ? 186 TRP B CZ3 1 
ATOM   3145  C  CH2 . TRP B 1 186 ? 101.255 0.682   1.470   1.00 220.21 ? 186 TRP B CH2 1 
ATOM   3146  N  N   . HIS B 1 187 ? 99.688  -4.809  -4.013  1.00 256.51 ? 187 HIS B N   1 
ATOM   3147  C  CA  . HIS B 1 187 ? 100.135 -6.072  -4.602  1.00 251.91 ? 187 HIS B CA  1 
ATOM   3148  C  C   . HIS B 1 187 ? 99.288  -7.280  -4.202  1.00 250.54 ? 187 HIS B C   1 
ATOM   3149  O  O   . HIS B 1 187 ? 99.737  -8.422  -4.306  1.00 239.75 ? 187 HIS B O   1 
ATOM   3150  C  CB  . HIS B 1 187 ? 101.612 -6.323  -4.274  1.00 247.23 ? 187 HIS B CB  1 
ATOM   3151  C  CG  . HIS B 1 187 ? 102.545 -5.349  -4.922  1.00 235.92 ? 187 HIS B CG  1 
ATOM   3152  N  ND1 . HIS B 1 187 ? 102.685 -5.249  -6.289  1.00 230.59 ? 187 HIS B ND1 1 
ATOM   3153  C  CD2 . HIS B 1 187 ? 103.390 -4.435  -4.389  1.00 230.07 ? 187 HIS B CD2 1 
ATOM   3154  C  CE1 . HIS B 1 187 ? 103.573 -4.313  -6.572  1.00 229.41 ? 187 HIS B CE1 1 
ATOM   3155  N  NE2 . HIS B 1 187 ? 104.017 -3.804  -5.436  1.00 230.94 ? 187 HIS B NE2 1 
ATOM   3156  N  N   . VAL B 1 188 ? 98.058  -7.031  -3.766  1.00 254.11 ? 188 VAL B N   1 
ATOM   3157  C  CA  . VAL B 1 188 ? 97.094  -8.111  -3.580  1.00 260.95 ? 188 VAL B CA  1 
ATOM   3158  C  C   . VAL B 1 188 ? 96.579  -8.521  -4.965  1.00 276.27 ? 188 VAL B C   1 
ATOM   3159  O  O   . VAL B 1 188 ? 96.271  -7.654  -5.786  1.00 280.22 ? 188 VAL B O   1 
ATOM   3160  C  CB  . VAL B 1 188 ? 95.924  -7.666  -2.675  1.00 250.73 ? 188 VAL B CB  1 
ATOM   3161  C  CG1 . VAL B 1 188 ? 94.970  -8.821  -2.415  1.00 245.20 ? 188 VAL B CG1 1 
ATOM   3162  C  CG2 . VAL B 1 188 ? 96.446  -7.104  -1.360  1.00 245.83 ? 188 VAL B CG2 1 
ATOM   3163  N  N   . PRO B 1 189 ? 96.524  -9.841  -5.247  1.00 281.06 ? 189 PRO B N   1 
ATOM   3164  C  CA  . PRO B 1 189 ? 96.096  -10.325 -6.568  1.00 285.75 ? 189 PRO B CA  1 
ATOM   3165  C  C   . PRO B 1 189 ? 94.775  -9.706  -7.037  1.00 302.89 ? 189 PRO B C   1 
ATOM   3166  O  O   . PRO B 1 189 ? 93.859  -9.536  -6.230  1.00 330.62 ? 189 PRO B O   1 
ATOM   3167  C  CB  . PRO B 1 189 ? 95.923  -11.832 -6.353  1.00 268.86 ? 189 PRO B CB  1 
ATOM   3168  C  CG  . PRO B 1 189 ? 96.840  -12.165 -5.228  1.00 257.86 ? 189 PRO B CG  1 
ATOM   3169  C  CD  . PRO B 1 189 ? 96.884  -10.950 -4.343  1.00 265.64 ? 189 PRO B CD  1 
ATOM   3170  N  N   . PRO B 1 190 ? 94.671  -9.384  -8.341  1.00 295.54 ? 190 PRO B N   1 
ATOM   3171  C  CA  . PRO B 1 190 ? 93.459  -8.756  -8.876  1.00 291.41 ? 190 PRO B CA  1 
ATOM   3172  C  C   . PRO B 1 190 ? 92.194  -9.589  -8.670  1.00 292.55 ? 190 PRO B C   1 
ATOM   3173  O  O   . PRO B 1 190 ? 91.094  -9.035  -8.627  1.00 298.78 ? 190 PRO B O   1 
ATOM   3174  C  CB  . PRO B 1 190 ? 93.765  -8.597  -10.375 1.00 280.13 ? 190 PRO B CB  1 
ATOM   3175  C  CG  . PRO B 1 190 ? 94.930  -9.483  -10.650 1.00 276.72 ? 190 PRO B CG  1 
ATOM   3176  C  CD  . PRO B 1 190 ? 95.707  -9.555  -9.373  1.00 284.91 ? 190 PRO B CD  1 
ATOM   3177  N  N   . GLU B 1 191 ? 92.352  -10.901 -8.527  1.00 278.82 ? 191 GLU B N   1 
ATOM   3178  C  CA  . GLU B 1 191 ? 91.216  -11.788 -8.295  1.00 261.88 ? 191 GLU B CA  1 
ATOM   3179  C  C   . GLU B 1 191 ? 90.646  -11.619 -6.886  1.00 271.54 ? 191 GLU B C   1 
ATOM   3180  O  O   . GLU B 1 191 ? 89.429  -11.604 -6.705  1.00 273.84 ? 191 GLU B O   1 
ATOM   3181  C  CB  . GLU B 1 191 ? 91.625  -13.245 -8.522  1.00 243.33 ? 191 GLU B CB  1 
ATOM   3182  C  CG  . GLU B 1 191 ? 91.800  -13.611 -9.986  1.00 230.09 ? 191 GLU B CG  1 
ATOM   3183  C  CD  . GLU B 1 191 ? 93.140  -13.174 -10.546 1.00 221.02 ? 191 GLU B CD  1 
ATOM   3184  O  OE1 . GLU B 1 191 ? 94.011  -12.746 -9.759  1.00 210.71 ? 191 GLU B OE1 1 
ATOM   3185  O  OE2 . GLU B 1 191 ? 93.323  -13.263 -11.775 1.00 216.40 ? 191 GLU B OE2 1 
ATOM   3186  N  N   . LEU B 1 192 ? 91.526  -11.486 -5.896  1.00 279.73 ? 192 LEU B N   1 
ATOM   3187  C  CA  . LEU B 1 192 ? 91.101  -11.284 -4.510  1.00 283.91 ? 192 LEU B CA  1 
ATOM   3188  C  C   . LEU B 1 192 ? 90.578  -9.865  -4.284  1.00 297.93 ? 192 LEU B C   1 
ATOM   3189  O  O   . LEU B 1 192 ? 89.607  -9.661  -3.553  1.00 310.55 ? 192 LEU B O   1 
ATOM   3190  C  CB  . LEU B 1 192 ? 92.258  -11.565 -3.549  1.00 272.17 ? 192 LEU B CB  1 
ATOM   3191  C  CG  . LEU B 1 192 ? 92.797  -12.998 -3.544  1.00 259.19 ? 192 LEU B CG  1 
ATOM   3192  C  CD1 . LEU B 1 192 ? 93.920  -13.131 -2.527  1.00 253.72 ? 192 LEU B CD1 1 
ATOM   3193  C  CD2 . LEU B 1 192 ? 91.685  -13.998 -3.259  1.00 251.39 ? 192 LEU B CD2 1 
ATOM   3194  N  N   . VAL B 1 193 ? 91.223  -8.888  -4.915  1.00 301.92 ? 193 VAL B N   1 
ATOM   3195  C  CA  . VAL B 1 193 ? 90.781  -7.497  -4.831  1.00 299.71 ? 193 VAL B CA  1 
ATOM   3196  C  C   . VAL B 1 193 ? 89.332  -7.374  -5.295  1.00 296.17 ? 193 VAL B C   1 
ATOM   3197  O  O   . VAL B 1 193 ? 88.564  -6.596  -4.734  1.00 290.94 ? 193 VAL B O   1 
ATOM   3198  C  CB  . VAL B 1 193 ? 91.666  -6.564  -5.683  1.00 301.37 ? 193 VAL B CB  1 
ATOM   3199  C  CG1 . VAL B 1 193 ? 91.142  -5.135  -5.636  1.00 293.69 ? 193 VAL B CG1 1 
ATOM   3200  C  CG2 . VAL B 1 193 ? 93.106  -6.615  -5.201  1.00 308.59 ? 193 VAL B CG2 1 
ATOM   3201  N  N   . ARG B 1 194 ? 88.964  -8.146  -6.317  1.00 284.84 ? 194 ARG B N   1 
ATOM   3202  C  CA  . ARG B 1 194 ? 87.578  -8.193  -6.780  1.00 264.51 ? 194 ARG B CA  1 
ATOM   3203  C  C   . ARG B 1 194 ? 86.684  -8.764  -5.690  1.00 262.84 ? 194 ARG B C   1 
ATOM   3204  O  O   . ARG B 1 194 ? 85.584  -8.270  -5.465  1.00 259.48 ? 194 ARG B O   1 
ATOM   3205  C  CB  . ARG B 1 194 ? 87.444  -9.037  -8.053  1.00 252.16 ? 194 ARG B CB  1 
ATOM   3206  C  CG  . ARG B 1 194 ? 88.264  -8.526  -9.226  1.00 243.39 ? 194 ARG B CG  1 
ATOM   3207  C  CD  . ARG B 1 194 ? 87.744  -7.189  -9.734  1.00 236.46 ? 194 ARG B CD  1 
ATOM   3208  N  NE  . ARG B 1 194 ? 88.614  -6.621  -10.758 1.00 232.61 ? 194 ARG B NE  1 
ATOM   3209  C  CZ  . ARG B 1 194 ? 89.661  -5.838  -10.506 1.00 230.95 ? 194 ARG B CZ  1 
ATOM   3210  N  NH1 . ARG B 1 194 ? 89.982  -5.515  -9.259  1.00 228.97 ? 194 ARG B NH1 1 
ATOM   3211  N  NH2 . ARG B 1 194 ? 90.393  -5.376  -11.509 1.00 233.88 ? 194 ARG B NH2 1 
ATOM   3212  N  N   . VAL B 1 195 ? 87.172  -9.798  -5.007  1.00 261.99 ? 195 VAL B N   1 
ATOM   3213  C  CA  . VAL B 1 195 ? 86.426  -10.416 -3.913  1.00 261.79 ? 195 VAL B CA  1 
ATOM   3214  C  C   . VAL B 1 195 ? 86.293  -9.455  -2.728  1.00 280.81 ? 195 VAL B C   1 
ATOM   3215  O  O   . VAL B 1 195 ? 85.187  -9.216  -2.246  1.00 300.31 ? 195 VAL B O   1 
ATOM   3216  C  CB  . VAL B 1 195 ? 87.077  -11.740 -3.453  1.00 240.93 ? 195 VAL B CB  1 
ATOM   3217  C  CG1 . VAL B 1 195 ? 86.387  -12.269 -2.204  1.00 236.46 ? 195 VAL B CG1 1 
ATOM   3218  C  CG2 . VAL B 1 195 ? 87.017  -12.774 -4.568  1.00 229.76 ? 195 VAL B CG2 1 
ATOM   3219  N  N   . LEU B 1 196 ? 87.410  -8.888  -2.277  1.00 279.75 ? 196 LEU B N   1 
ATOM   3220  C  CA  . LEU B 1 196 ? 87.389  -7.922  -1.173  1.00 272.74 ? 196 LEU B CA  1 
ATOM   3221  C  C   . LEU B 1 196 ? 86.412  -6.779  -1.450  1.00 284.41 ? 196 LEU B C   1 
ATOM   3222  O  O   . LEU B 1 196 ? 85.691  -6.332  -0.557  1.00 291.35 ? 196 LEU B O   1 
ATOM   3223  C  CB  . LEU B 1 196 ? 88.786  -7.345  -0.930  1.00 254.77 ? 196 LEU B CB  1 
ATOM   3224  C  CG  . LEU B 1 196 ? 89.858  -8.308  -0.418  1.00 241.07 ? 196 LEU B CG  1 
ATOM   3225  C  CD1 . LEU B 1 196 ? 91.095  -7.525  -0.012  1.00 234.42 ? 196 LEU B CD1 1 
ATOM   3226  C  CD2 . LEU B 1 196 ? 89.341  -9.145  0.743   1.00 235.54 ? 196 LEU B CD2 1 
ATOM   3227  N  N   . SER B 1 197 ? 86.394  -6.311  -2.693  1.00 283.72 ? 197 SER B N   1 
ATOM   3228  C  CA  . SER B 1 197 ? 85.551  -5.187  -3.081  1.00 280.53 ? 197 SER B CA  1 
ATOM   3229  C  C   . SER B 1 197 ? 84.071  -5.555  -3.024  1.00 275.63 ? 197 SER B C   1 
ATOM   3230  O  O   . SER B 1 197 ? 83.233  -4.726  -2.655  1.00 272.37 ? 197 SER B O   1 
ATOM   3231  C  CB  . SER B 1 197 ? 85.910  -4.722  -4.491  1.00 276.83 ? 197 SER B CB  1 
ATOM   3232  O  OG  . SER B 1 197 ? 85.650  -5.737  -5.446  1.00 280.77 ? 197 SER B OG  1 
ATOM   3233  N  N   . ALA B 1 198 ? 83.752  -6.791  -3.405  1.00 284.94 ? 198 ALA B N   1 
ATOM   3234  C  CA  . ALA B 1 198 ? 82.386  -7.285  -3.307  1.00 254.92 ? 198 ALA B CA  1 
ATOM   3235  C  C   . ALA B 1 198 ? 81.971  -7.283  -1.850  1.00 243.97 ? 198 ALA B C   1 
ATOM   3236  O  O   . ALA B 1 198 ? 80.880  -6.828  -1.521  1.00 233.09 ? 198 ALA B O   1 
ATOM   3237  C  CB  . ALA B 1 198 ? 82.269  -8.686  -3.889  1.00 248.47 ? 198 ALA B CB  1 
ATOM   3238  N  N   . MET B 1 199 ? 82.849  -7.788  -0.984  1.00 250.50 ? 199 MET B N   1 
ATOM   3239  C  CA  . MET B 1 199 ? 82.614  -7.761  0.456   1.00 255.23 ? 199 MET B CA  1 
ATOM   3240  C  C   . MET B 1 199 ? 82.270  -6.346  0.899   1.00 258.85 ? 199 MET B C   1 
ATOM   3241  O  O   . MET B 1 199 ? 81.255  -6.119  1.556   1.00 260.48 ? 199 MET B O   1 
ATOM   3242  C  CB  . MET B 1 199 ? 83.850  -8.243  1.225   1.00 256.57 ? 199 MET B CB  1 
ATOM   3243  C  CG  . MET B 1 199 ? 84.193  -9.712  1.040   1.00 258.60 ? 199 MET B CG  1 
ATOM   3244  S  SD  . MET B 1 199 ? 83.006  -10.823 1.817   1.00 254.48 ? 199 MET B SD  1 
ATOM   3245  C  CE  . MET B 1 199 ? 81.866  -11.163 0.473   1.00 250.62 ? 199 MET B CE  1 
ATOM   3246  N  N   . LEU B 1 200 ? 83.130  -5.400  0.538   1.00 256.24 ? 200 LEU B N   1 
ATOM   3247  C  CA  . LEU B 1 200 ? 82.895  -3.995  0.832   1.00 250.07 ? 200 LEU B CA  1 
ATOM   3248  C  C   . LEU B 1 200 ? 81.629  -3.509  0.133   1.00 248.63 ? 200 LEU B C   1 
ATOM   3249  O  O   . LEU B 1 200 ? 80.792  -2.835  0.741   1.00 244.73 ? 200 LEU B O   1 
ATOM   3250  C  CB  . LEU B 1 200 ? 84.104  -3.167  0.399   1.00 246.85 ? 200 LEU B CB  1 
ATOM   3251  C  CG  . LEU B 1 200 ? 85.333  -3.338  1.296   1.00 244.88 ? 200 LEU B CG  1 
ATOM   3252  C  CD1 . LEU B 1 200 ? 86.583  -2.828  0.598   1.00 252.47 ? 200 LEU B CD1 1 
ATOM   3253  C  CD2 . LEU B 1 200 ? 85.134  -2.632  2.628   1.00 239.19 ? 200 LEU B CD2 1 
ATOM   3254  N  N   . PHE B 1 201 ? 81.476  -3.893  -1.131  1.00 247.43 ? 201 PHE B N   1 
ATOM   3255  C  CA  . PHE B 1 201 ? 80.301  -3.527  -1.912  1.00 244.85 ? 201 PHE B CA  1 
ATOM   3256  C  C   . PHE B 1 201 ? 78.993  -3.853  -1.180  1.00 237.89 ? 201 PHE B C   1 
ATOM   3257  O  O   . PHE B 1 201 ? 78.110  -3.000  -1.052  1.00 230.56 ? 201 PHE B O   1 
ATOM   3258  C  CB  . PHE B 1 201 ? 80.314  -4.224  -3.276  1.00 242.24 ? 201 PHE B CB  1 
ATOM   3259  C  CG  . PHE B 1 201 ? 79.017  -4.083  -4.026  1.00 240.22 ? 201 PHE B CG  1 
ATOM   3260  C  CD1 . PHE B 1 201 ? 77.924  -4.875  -3.701  1.00 234.18 ? 201 PHE B CD1 1 
ATOM   3261  C  CD2 . PHE B 1 201 ? 78.865  -3.112  -5.007  1.00 240.50 ? 201 PHE B CD2 1 
ATOM   3262  C  CE1 . PHE B 1 201 ? 76.718  -4.727  -4.364  1.00 225.71 ? 201 PHE B CE1 1 
ATOM   3263  C  CE2 . PHE B 1 201 ? 77.662  -2.963  -5.677  1.00 233.32 ? 201 PHE B CE2 1 
ATOM   3264  C  CZ  . PHE B 1 201 ? 76.587  -3.769  -5.353  1.00 226.62 ? 201 PHE B CZ  1 
ATOM   3265  N  N   . LEU B 1 202 ? 78.854  -5.097  -0.731  1.00 227.37 ? 202 LEU B N   1 
ATOM   3266  C  CA  . LEU B 1 202 ? 77.639  -5.517  -0.049  1.00 213.82 ? 202 LEU B CA  1 
ATOM   3267  C  C   . LEU B 1 202 ? 77.621  -4.988  1.378   1.00 211.20 ? 202 LEU B C   1 
ATOM   3268  O  O   . LEU B 1 202 ? 76.574  -4.568  1.871   1.00 214.41 ? 202 LEU B O   1 
ATOM   3269  C  CB  . LEU B 1 202 ? 77.484  -7.043  -0.070  1.00 207.86 ? 202 LEU B CB  1 
ATOM   3270  C  CG  . LEU B 1 202 ? 78.464  -7.894  0.742   1.00 210.07 ? 202 LEU B CG  1 
ATOM   3271  C  CD1 . LEU B 1 202 ? 78.029  -8.010  2.195   1.00 209.19 ? 202 LEU B CD1 1 
ATOM   3272  C  CD2 . LEU B 1 202 ? 78.579  -9.276  0.117   1.00 205.77 ? 202 LEU B CD2 1 
ATOM   3273  N  N   . LEU B 1 203 ? 78.782  -4.986  2.030   1.00 208.26 ? 203 LEU B N   1 
ATOM   3274  C  CA  . LEU B 1 203 ? 78.861  -4.569  3.425   1.00 206.19 ? 203 LEU B CA  1 
ATOM   3275  C  C   . LEU B 1 203 ? 78.392  -3.129  3.576   1.00 208.14 ? 203 LEU B C   1 
ATOM   3276  O  O   . LEU B 1 203 ? 77.656  -2.812  4.507   1.00 213.15 ? 203 LEU B O   1 
ATOM   3277  C  CB  . LEU B 1 203 ? 80.282  -4.732  3.987   1.00 203.31 ? 203 LEU B CB  1 
ATOM   3278  C  CG  . LEU B 1 203 ? 80.643  -6.112  4.554   1.00 197.74 ? 203 LEU B CG  1 
ATOM   3279  C  CD1 . LEU B 1 203 ? 82.027  -6.084  5.182   1.00 197.84 ? 203 LEU B CD1 1 
ATOM   3280  C  CD2 . LEU B 1 203 ? 79.611  -6.591  5.568   1.00 194.16 ? 203 LEU B CD2 1 
ATOM   3281  N  N   . ILE B 1 204 ? 78.799  -2.265  2.651   1.00 208.04 ? 204 ILE B N   1 
ATOM   3282  C  CA  . ILE B 1 204 ? 78.380  -0.865  2.691   1.00 208.12 ? 204 ILE B CA  1 
ATOM   3283  C  C   . ILE B 1 204 ? 76.901  -0.714  2.323   1.00 197.26 ? 204 ILE B C   1 
ATOM   3284  O  O   . ILE B 1 204 ? 76.171  0.039   2.964   1.00 195.39 ? 204 ILE B O   1 
ATOM   3285  C  CB  . ILE B 1 204 ? 79.255  0.028   1.780   1.00 218.42 ? 204 ILE B CB  1 
ATOM   3286  C  CG1 . ILE B 1 204 ? 78.899  1.505   1.980   1.00 219.59 ? 204 ILE B CG1 1 
ATOM   3287  C  CG2 . ILE B 1 204 ? 79.096  -0.359  0.318   1.00 219.99 ? 204 ILE B CG2 1 
ATOM   3288  C  CD1 . ILE B 1 204 ? 79.923  2.465   1.411   1.00 222.18 ? 204 ILE B CD1 1 
ATOM   3289  N  N   . GLY B 1 205 ? 76.460  -1.435  1.297   1.00 188.47 ? 205 GLY B N   1 
ATOM   3290  C  CA  . GLY B 1 205 ? 75.039  -1.474  0.954   1.00 180.93 ? 205 GLY B CA  1 
ATOM   3291  C  C   . GLY B 1 205 ? 74.223  -1.978  2.130   1.00 169.79 ? 205 GLY B C   1 
ATOM   3292  O  O   . GLY B 1 205 ? 73.318  -1.297  2.613   1.00 165.60 ? 205 GLY B O   1 
ATOM   3293  N  N   . CYS B 1 206 ? 74.577  -3.163  2.615   1.00 161.57 ? 206 CYS B N   1 
ATOM   3294  C  CA  . CYS B 1 206 ? 74.021  -3.684  3.849   1.00 156.81 ? 206 CYS B CA  1 
ATOM   3295  C  C   . CYS B 1 206 ? 73.990  -2.582  4.907   1.00 158.95 ? 206 CYS B C   1 
ATOM   3296  O  O   . CYS B 1 206 ? 72.949  -2.314  5.501   1.00 165.77 ? 206 CYS B O   1 
ATOM   3297  C  CB  . CYS B 1 206 ? 74.862  -4.858  4.343   1.00 158.50 ? 206 CYS B CB  1 
ATOM   3298  S  SG  . CYS B 1 206 ? 74.216  -5.653  5.824   1.00 167.23 ? 206 CYS B SG  1 
ATOM   3299  N  N   . LEU B 1 207 ? 75.130  -1.933  5.124   1.00 164.58 ? 207 LEU B N   1 
ATOM   3300  C  CA  . LEU B 1 207 ? 75.232  -0.862  6.108   1.00 169.67 ? 207 LEU B CA  1 
ATOM   3301  C  C   . LEU B 1 207 ? 74.189  0.218   5.849   1.00 166.84 ? 207 LEU B C   1 
ATOM   3302  O  O   . LEU B 1 207 ? 73.526  0.673   6.777   1.00 167.23 ? 207 LEU B O   1 
ATOM   3303  C  CB  . LEU B 1 207 ? 76.638  -0.242  6.103   1.00 181.98 ? 207 LEU B CB  1 
ATOM   3304  C  CG  . LEU B 1 207 ? 76.854  0.975   7.016   1.00 188.20 ? 207 LEU B CG  1 
ATOM   3305  C  CD1 . LEU B 1 207 ? 76.743  0.589   8.486   1.00 185.67 ? 207 LEU B CD1 1 
ATOM   3306  C  CD2 . LEU B 1 207 ? 78.196  1.635   6.730   1.00 192.86 ? 207 LEU B CD2 1 
ATOM   3307  N  N   . LEU B 1 208 ? 74.043  0.617   4.588   1.00 165.17 ? 208 LEU B N   1 
ATOM   3308  C  CA  . LEU B 1 208 ? 73.177  1.736   4.228   1.00 165.57 ? 208 LEU B CA  1 
ATOM   3309  C  C   . LEU B 1 208 ? 71.703  1.356   4.164   1.00 163.35 ? 208 LEU B C   1 
ATOM   3310  O  O   . LEU B 1 208 ? 70.840  2.186   4.445   1.00 168.03 ? 208 LEU B O   1 
ATOM   3311  C  CB  . LEU B 1 208 ? 73.594  2.333   2.883   1.00 167.05 ? 208 LEU B CB  1 
ATOM   3312  C  CG  . LEU B 1 208 ? 74.868  3.176   2.904   1.00 173.09 ? 208 LEU B CG  1 
ATOM   3313  C  CD1 . LEU B 1 208 ? 75.287  3.509   1.483   1.00 176.48 ? 208 LEU B CD1 1 
ATOM   3314  C  CD2 . LEU B 1 208 ? 74.678  4.444   3.725   1.00 174.29 ? 208 LEU B CD2 1 
ATOM   3315  N  N   . PHE B 1 209 ? 71.412  0.117   3.775   1.00 161.18 ? 209 PHE B N   1 
ATOM   3316  C  CA  . PHE B 1 209 ? 70.035  -0.281  3.474   1.00 156.29 ? 209 PHE B CA  1 
ATOM   3317  C  C   . PHE B 1 209 ? 69.462  -1.312  4.439   1.00 144.47 ? 209 PHE B C   1 
ATOM   3318  O  O   . PHE B 1 209 ? 68.248  -1.488  4.510   1.00 138.16 ? 209 PHE B O   1 
ATOM   3319  C  CB  . PHE B 1 209 ? 69.935  -0.801  2.034   1.00 158.27 ? 209 PHE B CB  1 
ATOM   3320  C  CG  . PHE B 1 209 ? 70.419  0.180   1.000   1.00 162.27 ? 209 PHE B CG  1 
ATOM   3321  C  CD1 . PHE B 1 209 ? 70.189  1.540   1.149   1.00 167.59 ? 209 PHE B CD1 1 
ATOM   3322  C  CD2 . PHE B 1 209 ? 71.108  -0.255  -0.115  1.00 165.96 ? 209 PHE B CD2 1 
ATOM   3323  C  CE1 . PHE B 1 209 ? 70.638  2.444   0.204   1.00 172.91 ? 209 PHE B CE1 1 
ATOM   3324  C  CE2 . PHE B 1 209 ? 71.559  0.643   -1.067  1.00 173.59 ? 209 PHE B CE2 1 
ATOM   3325  C  CZ  . PHE B 1 209 ? 71.326  1.995   -0.907  1.00 175.78 ? 209 PHE B CZ  1 
ATOM   3326  N  N   . VAL B 1 210 ? 70.327  -2.001  5.169   1.00 142.76 ? 210 VAL B N   1 
ATOM   3327  C  CA  . VAL B 1 210 ? 69.869  -2.913  6.199   1.00 142.33 ? 210 VAL B CA  1 
ATOM   3328  C  C   . VAL B 1 210 ? 70.155  -2.319  7.572   1.00 143.94 ? 210 VAL B C   1 
ATOM   3329  O  O   . VAL B 1 210 ? 69.227  -2.000  8.314   1.00 150.45 ? 210 VAL B O   1 
ATOM   3330  C  CB  . VAL B 1 210 ? 70.523  -4.303  6.066   1.00 145.52 ? 210 VAL B CB  1 
ATOM   3331  C  CG1 . VAL B 1 210 ? 70.104  -5.203  7.222   1.00 148.16 ? 210 VAL B CG1 1 
ATOM   3332  C  CG2 . VAL B 1 210 ? 70.142  -4.939  4.736   1.00 142.03 ? 210 VAL B CG2 1 
ATOM   3333  N  N   . LEU B 1 211 ? 71.433  -2.151  7.899   1.00 142.45 ? 211 LEU B N   1 
ATOM   3334  C  CA  . LEU B 1 211 ? 71.832  -1.747  9.247   1.00 143.32 ? 211 LEU B CA  1 
ATOM   3335  C  C   . LEU B 1 211 ? 71.348  -0.354  9.619   1.00 144.00 ? 211 LEU B C   1 
ATOM   3336  O  O   . LEU B 1 211 ? 70.801  -0.151  10.700  1.00 141.97 ? 211 LEU B O   1 
ATOM   3337  C  CB  . LEU B 1 211 ? 73.347  -1.804  9.408   1.00 147.81 ? 211 LEU B CB  1 
ATOM   3338  C  CG  . LEU B 1 211 ? 73.886  -3.008  10.176  1.00 146.73 ? 211 LEU B CG  1 
ATOM   3339  C  CD1 . LEU B 1 211 ? 73.752  -4.278  9.351   1.00 142.47 ? 211 LEU B CD1 1 
ATOM   3340  C  CD2 . LEU B 1 211 ? 75.333  -2.756  10.575  1.00 152.32 ? 211 LEU B CD2 1 
ATOM   3341  N  N   . THR B 1 212 ? 71.572  0.607   8.731   1.00 146.45 ? 212 THR B N   1 
ATOM   3342  C  CA  . THR B 1 212 ? 71.225  1.994   9.013   1.00 151.01 ? 212 THR B CA  1 
ATOM   3343  C  C   . THR B 1 212 ? 69.741  2.136   9.326   1.00 149.46 ? 212 THR B C   1 
ATOM   3344  O  O   . THR B 1 212 ? 69.388  2.697   10.360  1.00 148.84 ? 212 THR B O   1 
ATOM   3345  C  CB  . THR B 1 212 ? 71.603  2.933   7.852   1.00 154.36 ? 212 THR B CB  1 
ATOM   3346  O  OG1 . THR B 1 212 ? 72.998  2.793   7.564   1.00 157.80 ? 212 THR B OG1 1 
ATOM   3347  C  CG2 . THR B 1 212 ? 71.308  4.383   8.212   1.00 156.72 ? 212 THR B CG2 1 
ATOM   3348  N  N   . PRO B 1 213 ? 68.868  1.607   8.447   1.00 148.40 ? 213 PRO B N   1 
ATOM   3349  C  CA  . PRO B 1 213 ? 67.423  1.667   8.682   1.00 144.84 ? 213 PRO B CA  1 
ATOM   3350  C  C   . PRO B 1 213 ? 66.985  1.011   9.984   1.00 139.99 ? 213 PRO B C   1 
ATOM   3351  O  O   . PRO B 1 213 ? 66.159  1.573   10.704  1.00 143.17 ? 213 PRO B O   1 
ATOM   3352  C  CB  . PRO B 1 213 ? 66.841  0.900   7.494   1.00 139.50 ? 213 PRO B CB  1 
ATOM   3353  C  CG  . PRO B 1 213 ? 67.856  1.046   6.419   1.00 143.06 ? 213 PRO B CG  1 
ATOM   3354  C  CD  . PRO B 1 213 ? 69.183  1.053   7.117   1.00 145.86 ? 213 PRO B CD  1 
ATOM   3355  N  N   . THR B 1 214 ? 67.531  -0.165  10.281  1.00 133.63 ? 214 THR B N   1 
ATOM   3356  C  CA  . THR B 1 214 ? 67.160  -0.884  11.496  1.00 135.44 ? 214 THR B CA  1 
ATOM   3357  C  C   . THR B 1 214 ? 67.441  -0.041  12.733  1.00 140.87 ? 214 THR B C   1 
ATOM   3358  O  O   . THR B 1 214 ? 66.628  0.015   13.655  1.00 138.55 ? 214 THR B O   1 
ATOM   3359  C  CB  . THR B 1 214 ? 67.926  -2.206  11.635  1.00 133.88 ? 214 THR B CB  1 
ATOM   3360  O  OG1 . THR B 1 214 ? 69.328  -1.943  11.565  1.00 137.99 ? 214 THR B OG1 1 
ATOM   3361  C  CG2 . THR B 1 214 ? 67.527  -3.181  10.536  1.00 131.97 ? 214 THR B CG2 1 
ATOM   3362  N  N   . PHE B 1 215 ? 68.600  0.609   12.746  1.00 147.05 ? 215 PHE B N   1 
ATOM   3363  C  CA  . PHE B 1 215 ? 68.956  1.525   13.829  1.00 153.14 ? 215 PHE B CA  1 
ATOM   3364  C  C   . PHE B 1 215 ? 68.044  2.752   13.848  1.00 152.03 ? 215 PHE B C   1 
ATOM   3365  O  O   . PHE B 1 215 ? 67.625  3.214   14.914  1.00 150.94 ? 215 PHE B O   1 
ATOM   3366  C  CB  . PHE B 1 215 ? 70.425  1.941   13.720  1.00 157.61 ? 215 PHE B CB  1 
ATOM   3367  C  CG  . PHE B 1 215 ? 71.362  1.050   14.496  1.00 158.91 ? 215 PHE B CG  1 
ATOM   3368  C  CD1 . PHE B 1 215 ? 71.760  -0.180  13.987  1.00 151.16 ? 215 PHE B CD1 1 
ATOM   3369  C  CD2 . PHE B 1 215 ? 71.827  1.435   15.748  1.00 164.94 ? 215 PHE B CD2 1 
ATOM   3370  C  CE1 . PHE B 1 215 ? 72.605  -1.006  14.704  1.00 151.84 ? 215 PHE B CE1 1 
ATOM   3371  C  CE2 . PHE B 1 215 ? 72.676  0.615   16.470  1.00 165.19 ? 215 PHE B CE2 1 
ATOM   3372  C  CZ  . PHE B 1 215 ? 73.065  -0.607  15.948  1.00 160.41 ? 215 PHE B CZ  1 
ATOM   3373  N  N   . VAL B 1 216 ? 67.707  3.252   12.665  1.00 149.10 ? 216 VAL B N   1 
ATOM   3374  C  CA  . VAL B 1 216 ? 66.752  4.344   12.551  1.00 151.91 ? 216 VAL B CA  1 
ATOM   3375  C  C   . VAL B 1 216 ? 65.413  3.958   13.183  1.00 154.63 ? 216 VAL B C   1 
ATOM   3376  O  O   . VAL B 1 216 ? 64.905  4.671   14.052  1.00 158.01 ? 216 VAL B O   1 
ATOM   3377  C  CB  . VAL B 1 216 ? 66.517  4.741   11.079  1.00 147.92 ? 216 VAL B CB  1 
ATOM   3378  C  CG1 . VAL B 1 216 ? 65.460  5.829   10.985  1.00 149.15 ? 216 VAL B CG1 1 
ATOM   3379  C  CG2 . VAL B 1 216 ? 67.810  5.211   10.440  1.00 149.82 ? 216 VAL B CG2 1 
ATOM   3380  N  N   . PHE B 1 217 ? 64.854  2.827   12.751  1.00 149.38 ? 217 PHE B N   1 
ATOM   3381  C  CA  . PHE B 1 217 ? 63.494  2.435   13.135  1.00 142.21 ? 217 PHE B CA  1 
ATOM   3382  C  C   . PHE B 1 217 ? 63.410  2.074   14.606  1.00 143.08 ? 217 PHE B C   1 
ATOM   3383  O  O   . PHE B 1 217 ? 62.406  2.348   15.269  1.00 142.20 ? 217 PHE B O   1 
ATOM   3384  C  CB  . PHE B 1 217 ? 63.030  1.249   12.297  1.00 132.83 ? 217 PHE B CB  1 
ATOM   3385  C  CG  . PHE B 1 217 ? 62.824  1.577   10.848  1.00 129.00 ? 217 PHE B CG  1 
ATOM   3386  C  CD1 . PHE B 1 217 ? 61.985  2.612   10.474  1.00 129.04 ? 217 PHE B CD1 1 
ATOM   3387  C  CD2 . PHE B 1 217 ? 63.453  0.839   9.857   1.00 126.39 ? 217 PHE B CD2 1 
ATOM   3388  C  CE1 . PHE B 1 217 ? 61.786  2.913   9.139   1.00 127.37 ? 217 PHE B CE1 1 
ATOM   3389  C  CE2 . PHE B 1 217 ? 63.255  1.131   8.520   1.00 124.33 ? 217 PHE B CE2 1 
ATOM   3390  C  CZ  . PHE B 1 217 ? 62.419  2.170   8.161   1.00 124.64 ? 217 PHE B CZ  1 
ATOM   3391  N  N   . CYS B 1 218 ? 64.465  1.426   15.087  1.00 144.34 ? 218 CYS B N   1 
ATOM   3392  C  CA  . CYS B 1 218 ? 64.666  1.173   16.507  1.00 151.10 ? 218 CYS B CA  1 
ATOM   3393  C  C   . CYS B 1 218 ? 64.237  2.397   17.312  1.00 155.73 ? 218 CYS B C   1 
ATOM   3394  O  O   . CYS B 1 218 ? 63.325  2.323   18.145  1.00 156.04 ? 218 CYS B O   1 
ATOM   3395  C  CB  . CYS B 1 218 ? 66.152  0.876   16.751  1.00 153.46 ? 218 CYS B CB  1 
ATOM   3396  S  SG  . CYS B 1 218 ? 66.553  -0.142  18.180  1.00 158.67 ? 218 CYS B SG  1 
ATOM   3397  N  N   . TYR B 1 219 ? 64.868  3.530   17.020  1.00 156.08 ? 219 TYR B N   1 
ATOM   3398  C  CA  . TYR B 1 219 ? 64.645  4.754   17.779  1.00 160.97 ? 219 TYR B CA  1 
ATOM   3399  C  C   . TYR B 1 219 ? 63.314  5.432   17.436  1.00 158.17 ? 219 TYR B C   1 
ATOM   3400  O  O   . TYR B 1 219 ? 62.660  6.012   18.306  1.00 157.20 ? 219 TYR B O   1 
ATOM   3401  C  CB  . TYR B 1 219 ? 65.800  5.723   17.534  1.00 167.95 ? 219 TYR B CB  1 
ATOM   3402  C  CG  . TYR B 1 219 ? 65.800  6.922   18.466  1.00 178.68 ? 219 TYR B CG  1 
ATOM   3403  C  CD1 . TYR B 1 219 ? 65.966  6.763   19.843  1.00 180.48 ? 219 TYR B CD1 1 
ATOM   3404  C  CD2 . TYR B 1 219 ? 65.635  8.213   17.970  1.00 181.52 ? 219 TYR B CD2 1 
ATOM   3405  C  CE1 . TYR B 1 219 ? 65.961  7.855   20.694  1.00 183.27 ? 219 TYR B CE1 1 
ATOM   3406  C  CE2 . TYR B 1 219 ? 65.630  9.309   18.816  1.00 184.69 ? 219 TYR B CE2 1 
ATOM   3407  C  CZ  . TYR B 1 219 ? 65.793  9.123   20.173  1.00 185.53 ? 219 TYR B CZ  1 
ATOM   3408  O  OH  . TYR B 1 219 ? 65.787  10.208  21.009  1.00 191.18 ? 219 TYR B OH  1 
ATOM   3409  N  N   . MET B 1 220 ? 62.917  5.347   16.170  1.00 154.25 ? 220 MET B N   1 
ATOM   3410  C  CA  . MET B 1 220 ? 61.760  6.084   15.671  1.00 156.42 ? 220 MET B CA  1 
ATOM   3411  C  C   . MET B 1 220 ? 60.421  5.413   15.971  1.00 157.46 ? 220 MET B C   1 
ATOM   3412  O  O   . MET B 1 220 ? 59.429  6.096   16.224  1.00 168.52 ? 220 MET B O   1 
ATOM   3413  C  CB  . MET B 1 220 ? 61.885  6.288   14.166  1.00 153.87 ? 220 MET B CB  1 
ATOM   3414  C  CG  . MET B 1 220 ? 62.886  7.359   13.779  1.00 160.68 ? 220 MET B CG  1 
ATOM   3415  S  SD  . MET B 1 220 ? 62.289  9.027   14.095  1.00 171.34 ? 220 MET B SD  1 
ATOM   3416  C  CE  . MET B 1 220 ? 63.818  9.963   14.111  1.00 173.98 ? 220 MET B CE  1 
ATOM   3417  N  N   . GLU B 1 221 ? 60.388  4.085   15.935  1.00 150.11 ? 221 GLU B N   1 
ATOM   3418  C  CA  . GLU B 1 221 ? 59.135  3.351   16.088  1.00 142.72 ? 221 GLU B CA  1 
ATOM   3419  C  C   . GLU B 1 221 ? 58.976  2.737   17.483  1.00 142.99 ? 221 GLU B C   1 
ATOM   3420  O  O   . GLU B 1 221 ? 57.936  2.161   17.808  1.00 135.86 ? 221 GLU B O   1 
ATOM   3421  C  CB  . GLU B 1 221 ? 59.066  2.263   15.022  1.00 136.29 ? 221 GLU B CB  1 
ATOM   3422  C  CG  . GLU B 1 221 ? 58.919  2.804   13.609  1.00 134.34 ? 221 GLU B CG  1 
ATOM   3423  C  CD  . GLU B 1 221 ? 57.537  3.392   13.356  1.00 137.04 ? 221 GLU B CD  1 
ATOM   3424  O  OE1 . GLU B 1 221 ? 57.435  4.368   12.588  1.00 142.21 ? 221 GLU B OE1 1 
ATOM   3425  O  OE2 . GLU B 1 221 ? 56.545  2.880   13.923  1.00 135.73 ? 221 GLU B OE2 1 
ATOM   3426  N  N   . ASP B 1 222 ? 60.009  2.886   18.307  1.00 148.15 ? 222 ASP B N   1 
ATOM   3427  C  CA  . ASP B 1 222 ? 60.117  2.154   19.569  1.00 151.08 ? 222 ASP B CA  1 
ATOM   3428  C  C   . ASP B 1 222 ? 59.945  0.652   19.368  1.00 141.06 ? 222 ASP B C   1 
ATOM   3429  O  O   . ASP B 1 222 ? 59.141  0.008   20.043  1.00 133.59 ? 222 ASP B O   1 
ATOM   3430  C  CB  . ASP B 1 222 ? 59.096  2.653   20.588  1.00 158.55 ? 222 ASP B CB  1 
ATOM   3431  C  CG  . ASP B 1 222 ? 59.519  2.362   22.008  1.00 162.66 ? 222 ASP B CG  1 
ATOM   3432  O  OD1 . ASP B 1 222 ? 60.739  2.314   22.259  1.00 160.35 ? 222 ASP B OD1 1 
ATOM   3433  O  OD2 . ASP B 1 222 ? 58.641  2.171   22.870  1.00 169.14 ? 222 ASP B OD2 1 
ATOM   3434  N  N   . TRP B 1 223 ? 60.690  0.118   18.407  1.00 132.49 ? 223 TRP B N   1 
ATOM   3435  C  CA  . TRP B 1 223 ? 60.815  -1.311  18.218  1.00 124.51 ? 223 TRP B CA  1 
ATOM   3436  C  C   . TRP B 1 223 ? 62.131  -1.746  18.831  1.00 127.43 ? 223 TRP B C   1 
ATOM   3437  O  O   . TRP B 1 223 ? 63.012  -0.918  19.039  1.00 130.04 ? 223 TRP B O   1 
ATOM   3438  C  CB  . TRP B 1 223 ? 60.824  -1.637  16.726  1.00 117.94 ? 223 TRP B CB  1 
ATOM   3439  C  CG  . TRP B 1 223 ? 59.548  -1.315  16.032  1.00 115.43 ? 223 TRP B CG  1 
ATOM   3440  C  CD1 . TRP B 1 223 ? 58.311  -1.186  16.602  1.00 117.63 ? 223 TRP B CD1 1 
ATOM   3441  C  CD2 . TRP B 1 223 ? 59.359  -1.146  14.626  1.00 112.33 ? 223 TRP B CD2 1 
ATOM   3442  N  NE1 . TRP B 1 223 ? 57.369  -0.932  15.638  1.00 116.70 ? 223 TRP B NE1 1 
ATOM   3443  C  CE2 . TRP B 1 223 ? 57.985  -0.904  14.415  1.00 113.52 ? 223 TRP B CE2 1 
ATOM   3444  C  CE3 . TRP B 1 223 ? 60.215  -1.173  13.524  1.00 112.49 ? 223 TRP B CE3 1 
ATOM   3445  C  CZ2 . TRP B 1 223 ? 57.451  -0.680  13.149  1.00 114.09 ? 223 TRP B CZ2 1 
ATOM   3446  C  CZ3 . TRP B 1 223 ? 59.684  -0.951  12.265  1.00 113.26 ? 223 TRP B CZ3 1 
ATOM   3447  C  CH2 . TRP B 1 223 ? 58.315  -0.703  12.089  1.00 114.02 ? 223 TRP B CH2 1 
ATOM   3448  N  N   . SER B 1 224 ? 62.277  -3.041  19.102  1.00 129.63 ? 224 SER B N   1 
ATOM   3449  C  CA  . SER B 1 224 ? 63.578  -3.602  19.472  1.00 133.92 ? 224 SER B CA  1 
ATOM   3450  C  C   . SER B 1 224 ? 64.436  -3.760  18.224  1.00 138.28 ? 224 SER B C   1 
ATOM   3451  O  O   . SER B 1 224 ? 63.934  -3.733  17.099  1.00 137.53 ? 224 SER B O   1 
ATOM   3452  C  CB  . SER B 1 224 ? 63.423  -4.961  20.163  1.00 130.58 ? 224 SER B CB  1 
ATOM   3453  O  OG  . SER B 1 224 ? 62.954  -5.947  19.259  1.00 123.83 ? 224 SER B OG  1 
ATOM   3454  N  N   . LYS B 1 225 ? 65.737  -3.917  18.421  1.00 145.11 ? 225 LYS B N   1 
ATOM   3455  C  CA  . LYS B 1 225 ? 66.630  -4.165  17.304  1.00 145.38 ? 225 LYS B CA  1 
ATOM   3456  C  C   . LYS B 1 225 ? 66.097  -5.325  16.476  1.00 136.39 ? 225 LYS B C   1 
ATOM   3457  O  O   . LYS B 1 225 ? 65.970  -5.210  15.255  1.00 136.48 ? 225 LYS B O   1 
ATOM   3458  C  CB  . LYS B 1 225 ? 68.054  -4.447  17.794  1.00 156.67 ? 225 LYS B CB  1 
ATOM   3459  C  CG  . LYS B 1 225 ? 68.204  -5.674  18.686  1.00 162.40 ? 225 LYS B CG  1 
ATOM   3460  C  CD  . LYS B 1 225 ? 69.586  -5.707  19.333  1.00 172.41 ? 225 LYS B CD  1 
ATOM   3461  C  CE  . LYS B 1 225 ? 69.865  -7.025  20.042  1.00 168.31 ? 225 LYS B CE  1 
ATOM   3462  N  NZ  . LYS B 1 225 ? 69.497  -6.985  21.483  1.00 166.06 ? 225 LYS B NZ  1 
ATOM   3463  N  N   . LEU B 1 226 ? 65.723  -6.414  17.141  1.00 128.30 ? 226 LEU B N   1 
ATOM   3464  C  CA  . LEU B 1 226 ? 65.283  -7.615  16.434  1.00 122.90 ? 226 LEU B CA  1 
ATOM   3465  C  C   . LEU B 1 226 ? 63.988  -7.373  15.659  1.00 117.67 ? 226 LEU B C   1 
ATOM   3466  O  O   . LEU B 1 226 ? 63.812  -7.871  14.543  1.00 111.45 ? 226 LEU B O   1 
ATOM   3467  C  CB  . LEU B 1 226 ? 65.103  -8.774  17.409  1.00 122.55 ? 226 LEU B CB  1 
ATOM   3468  C  CG  . LEU B 1 226 ? 64.833  -10.137 16.762  1.00 120.61 ? 226 LEU B CG  1 
ATOM   3469  C  CD1 . LEU B 1 226 ? 65.497  -11.251 17.552  1.00 121.90 ? 226 LEU B CD1 1 
ATOM   3470  C  CD2 . LEU B 1 226 ? 63.340  -10.400 16.642  1.00 124.55 ? 226 LEU B CD2 1 
ATOM   3471  N  N   . GLU B 1 227 ? 63.087  -6.602  16.252  1.00 117.07 ? 227 GLU B N   1 
ATOM   3472  C  CA  . GLU B 1 227 ? 61.854  -6.238  15.578  1.00 117.65 ? 227 GLU B CA  1 
ATOM   3473  C  C   . GLU B 1 227 ? 62.169  -5.428  14.319  1.00 116.93 ? 227 GLU B C   1 
ATOM   3474  O  O   . GLU B 1 227 ? 61.572  -5.640  13.262  1.00 114.59 ? 227 GLU B O   1 
ATOM   3475  C  CB  . GLU B 1 227 ? 60.943  -5.445  16.527  1.00 124.53 ? 227 GLU B CB  1 
ATOM   3476  C  CG  . GLU B 1 227 ? 60.232  -6.308  17.571  1.00 126.58 ? 227 GLU B CG  1 
ATOM   3477  C  CD  . GLU B 1 227 ? 59.462  -5.496  18.606  1.00 127.76 ? 227 GLU B CD  1 
ATOM   3478  O  OE1 . GLU B 1 227 ? 60.043  -4.566  19.203  1.00 128.07 ? 227 GLU B OE1 1 
ATOM   3479  O  OE2 . GLU B 1 227 ? 58.272  -5.791  18.833  1.00 127.69 ? 227 GLU B OE2 1 
ATOM   3480  N  N   . ALA B 1 228 ? 63.129  -4.516  14.440  1.00 119.93 ? 228 ALA B N   1 
ATOM   3481  C  CA  . ALA B 1 228 ? 63.477  -3.607  13.351  1.00 120.64 ? 228 ALA B CA  1 
ATOM   3482  C  C   . ALA B 1 228 ? 64.084  -4.340  12.162  1.00 114.18 ? 228 ALA B C   1 
ATOM   3483  O  O   . ALA B 1 228 ? 63.710  -4.090  11.016  1.00 116.07 ? 228 ALA B O   1 
ATOM   3484  C  CB  . ALA B 1 228 ? 64.433  -2.536  13.849  1.00 127.25 ? 228 ALA B CB  1 
ATOM   3485  N  N   . ILE B 1 229 ? 65.026  -5.235  12.431  1.00 110.18 ? 229 ILE B N   1 
ATOM   3486  C  CA  . ILE B 1 229 ? 65.623  -6.025  11.365  1.00 111.40 ? 229 ILE B CA  1 
ATOM   3487  C  C   . ILE B 1 229 ? 64.561  -6.912  10.738  1.00 109.03 ? 229 ILE B C   1 
ATOM   3488  O  O   . ILE B 1 229 ? 64.484  -7.029  9.512   1.00 109.05 ? 229 ILE B O   1 
ATOM   3489  C  CB  . ILE B 1 229 ? 66.779  -6.901  11.871  1.00 114.37 ? 229 ILE B CB  1 
ATOM   3490  C  CG1 . ILE B 1 229 ? 67.902  -6.018  12.422  1.00 124.51 ? 229 ILE B CG1 1 
ATOM   3491  C  CG2 . ILE B 1 229 ? 67.317  -7.762  10.739  1.00 112.38 ? 229 ILE B CG2 1 
ATOM   3492  C  CD1 . ILE B 1 229 ? 68.951  -6.756  13.229  1.00 128.40 ? 229 ILE B CD1 1 
ATOM   3493  N  N   . TYR B 1 230 ? 63.751  -7.542  11.586  1.00 107.71 ? 230 TYR B N   1 
ATOM   3494  C  CA  . TYR B 1 230 ? 62.627  -8.344  11.119  1.00 105.64 ? 230 TYR B CA  1 
ATOM   3495  C  C   . TYR B 1 230 ? 61.827  -7.533  10.105  1.00 104.52 ? 230 TYR B C   1 
ATOM   3496  O  O   . TYR B 1 230 ? 61.577  -7.986  8.982   1.00 101.61 ? 230 TYR B O   1 
ATOM   3497  C  CB  . TYR B 1 230 ? 61.742  -8.765  12.299  1.00 106.69 ? 230 TYR B CB  1 
ATOM   3498  C  CG  . TYR B 1 230 ? 60.452  -9.467  11.905  1.00 106.91 ? 230 TYR B CG  1 
ATOM   3499  C  CD1 . TYR B 1 230 ? 60.458  -10.785 11.464  1.00 107.00 ? 230 TYR B CD1 1 
ATOM   3500  C  CD2 . TYR B 1 230 ? 59.226  -8.812  11.989  1.00 108.99 ? 230 TYR B CD2 1 
ATOM   3501  C  CE1 . TYR B 1 230 ? 59.282  -11.425 11.106  1.00 108.92 ? 230 TYR B CE1 1 
ATOM   3502  C  CE2 . TYR B 1 230 ? 58.047  -9.443  11.632  1.00 109.35 ? 230 TYR B CE2 1 
ATOM   3503  C  CZ  . TYR B 1 230 ? 58.079  -10.749 11.193  1.00 109.04 ? 230 TYR B CZ  1 
ATOM   3504  O  OH  . TYR B 1 230 ? 56.901  -11.377 10.850  1.00 113.60 ? 230 TYR B OH  1 
ATOM   3505  N  N   . PHE B 1 231 ? 61.452  -6.320  10.499  1.00 105.42 ? 231 PHE B N   1 
ATOM   3506  C  CA  . PHE B 1 231 ? 60.669  -5.442  9.637   1.00 105.59 ? 231 PHE B CA  1 
ATOM   3507  C  C   . PHE B 1 231 ? 61.402  -5.163  8.333   1.00 103.45 ? 231 PHE B C   1 
ATOM   3508  O  O   . PHE B 1 231 ? 60.881  -5.405  7.247   1.00 98.25  ? 231 PHE B O   1 
ATOM   3509  C  CB  . PHE B 1 231 ? 60.377  -4.120  10.343  1.00 108.64 ? 231 PHE B CB  1 
ATOM   3510  C  CG  . PHE B 1 231 ? 59.855  -3.062  9.426   1.00 109.48 ? 231 PHE B CG  1 
ATOM   3511  C  CD1 . PHE B 1 231 ? 58.618  -3.206  8.824   1.00 109.43 ? 231 PHE B CD1 1 
ATOM   3512  C  CD2 . PHE B 1 231 ? 60.611  -1.943  9.139   1.00 113.46 ? 231 PHE B CD2 1 
ATOM   3513  C  CE1 . PHE B 1 231 ? 58.134  -2.243  7.962   1.00 114.09 ? 231 PHE B CE1 1 
ATOM   3514  C  CE2 . PHE B 1 231 ? 60.135  -0.975  8.277   1.00 119.30 ? 231 PHE B CE2 1 
ATOM   3515  C  CZ  . PHE B 1 231 ? 58.893  -1.125  7.688   1.00 118.71 ? 231 PHE B CZ  1 
ATOM   3516  N  N   . VAL B 1 232 ? 62.612  -4.639  8.459   1.00 107.96 ? 232 VAL B N   1 
ATOM   3517  C  CA  . VAL B 1 232 ? 63.447  -4.335  7.305   1.00 112.38 ? 232 VAL B CA  1 
ATOM   3518  C  C   . VAL B 1 232 ? 63.434  -5.470  6.299   1.00 110.38 ? 232 VAL B C   1 
ATOM   3519  O  O   . VAL B 1 232 ? 63.139  -5.271  5.123   1.00 116.24 ? 232 VAL B O   1 
ATOM   3520  C  CB  . VAL B 1 232 ? 64.903  -4.065  7.731   1.00 117.49 ? 232 VAL B CB  1 
ATOM   3521  C  CG1 . VAL B 1 232 ? 65.869  -4.375  6.596   1.00 119.68 ? 232 VAL B CG1 1 
ATOM   3522  C  CG2 . VAL B 1 232 ? 65.052  -2.624  8.195   1.00 121.74 ? 232 VAL B CG2 1 
ATOM   3523  N  N   . ILE B 1 233 ? 63.761  -6.665  6.761   1.00 105.88 ? 233 ILE B N   1 
ATOM   3524  C  CA  . ILE B 1 233 ? 63.923  -7.776  5.852   1.00 104.47 ? 233 ILE B CA  1 
ATOM   3525  C  C   . ILE B 1 233 ? 62.582  -8.267  5.304   1.00 103.47 ? 233 ILE B C   1 
ATOM   3526  O  O   . ILE B 1 233 ? 62.458  -8.520  4.105   1.00 104.03 ? 233 ILE B O   1 
ATOM   3527  C  CB  . ILE B 1 233 ? 64.720  -8.906  6.508   1.00 104.35 ? 233 ILE B CB  1 
ATOM   3528  C  CG1 . ILE B 1 233 ? 66.209  -8.567  6.445   1.00 107.74 ? 233 ILE B CG1 1 
ATOM   3529  C  CG2 . ILE B 1 233 ? 64.444  -10.229 5.815   1.00 103.18 ? 233 ILE B CG2 1 
ATOM   3530  C  CD1 . ILE B 1 233 ? 67.104  -9.676  6.941   1.00 110.70 ? 233 ILE B CD1 1 
ATOM   3531  N  N   . VAL B 1 234 ? 61.576  -8.395  6.164   1.00 101.25 ? 234 VAL B N   1 
ATOM   3532  C  CA  . VAL B 1 234 ? 60.237  -8.753  5.690   1.00 101.50 ? 234 VAL B CA  1 
ATOM   3533  C  C   . VAL B 1 234 ? 59.828  -7.794  4.578   1.00 100.81 ? 234 VAL B C   1 
ATOM   3534  O  O   . VAL B 1 234 ? 59.060  -8.147  3.673   1.00 99.92  ? 234 VAL B O   1 
ATOM   3535  C  CB  . VAL B 1 234 ? 59.190  -8.699  6.824   1.00 102.62 ? 234 VAL B CB  1 
ATOM   3536  C  CG1 . VAL B 1 234 ? 57.768  -8.797  6.263   1.00 102.22 ? 234 VAL B CG1 1 
ATOM   3537  C  CG2 . VAL B 1 234 ? 59.442  -9.806  7.831   1.00 100.02 ? 234 VAL B CG2 1 
ATOM   3538  N  N   . THR B 1 235 ? 60.336  -6.573  4.665   1.00 101.97 ? 235 THR B N   1 
ATOM   3539  C  CA  . THR B 1 235 ? 59.970  -5.534  3.726   1.00 107.60 ? 235 THR B CA  1 
ATOM   3540  C  C   . THR B 1 235 ? 60.737  -5.676  2.403   1.00 113.01 ? 235 THR B C   1 
ATOM   3541  O  O   . THR B 1 235 ? 60.143  -5.654  1.321   1.00 113.05 ? 235 THR B O   1 
ATOM   3542  C  CB  . THR B 1 235 ? 60.249  -4.142  4.321   1.00 111.00 ? 235 THR B CB  1 
ATOM   3543  O  OG1 . THR B 1 235 ? 59.616  -4.019  5.605   1.00 106.77 ? 235 THR B OG1 1 
ATOM   3544  C  CG2 . THR B 1 235 ? 59.740  -3.058  3.390   1.00 114.80 ? 235 THR B CG2 1 
ATOM   3545  N  N   . LEU B 1 236 ? 62.057  -5.812  2.490   1.00 114.85 ? 236 LEU B N   1 
ATOM   3546  C  CA  . LEU B 1 236 ? 62.901  -5.782  1.298   1.00 116.25 ? 236 LEU B CA  1 
ATOM   3547  C  C   . LEU B 1 236 ? 62.764  -7.070  0.491   1.00 112.66 ? 236 LEU B C   1 
ATOM   3548  O  O   . LEU B 1 236 ? 63.042  -7.097  -0.704  1.00 121.30 ? 236 LEU B O   1 
ATOM   3549  C  CB  . LEU B 1 236 ? 64.363  -5.520  1.677   1.00 121.10 ? 236 LEU B CB  1 
ATOM   3550  C  CG  . LEU B 1 236 ? 64.634  -4.151  2.319   1.00 126.21 ? 236 LEU B CG  1 
ATOM   3551  C  CD1 . LEU B 1 236 ? 66.128  -3.881  2.461   1.00 130.46 ? 236 LEU B CD1 1 
ATOM   3552  C  CD2 . LEU B 1 236 ? 63.967  -3.035  1.529   1.00 127.65 ? 236 LEU B CD2 1 
ATOM   3553  N  N   . THR B 1 237 ? 62.308  -8.129  1.144   1.00 104.21 ? 237 THR B N   1 
ATOM   3554  C  CA  . THR B 1 237 ? 61.965  -9.365  0.459   1.00 100.65 ? 237 THR B CA  1 
ATOM   3555  C  C   . THR B 1 237 ? 60.601  -9.273  -0.228  1.00 97.42  ? 237 THR B C   1 
ATOM   3556  O  O   . THR B 1 237 ? 60.216  -10.165 -0.981  1.00 94.29  ? 237 THR B O   1 
ATOM   3557  C  CB  . THR B 1 237 ? 61.921  -10.517 1.467   1.00 101.04 ? 237 THR B CB  1 
ATOM   3558  O  OG1 . THR B 1 237 ? 61.207  -10.091 2.633   1.00 101.63 ? 237 THR B OG1 1 
ATOM   3559  C  CG2 . THR B 1 237 ? 63.323  -10.926 1.876   1.00 102.34 ? 237 THR B CG2 1 
ATOM   3560  N  N   . THR B 1 238 ? 59.877  -8.190  0.052   1.00 99.21  ? 238 THR B N   1 
ATOM   3561  C  CA  . THR B 1 238 ? 58.498  -7.968  -0.436  1.00 99.21  ? 238 THR B CA  1 
ATOM   3562  C  C   . THR B 1 238 ? 57.484  -8.971  0.105   1.00 96.50  ? 238 THR B C   1 
ATOM   3563  O  O   . THR B 1 238 ? 56.409  -9.151  -0.466  1.00 91.17  ? 238 THR B O   1 
ATOM   3564  C  CB  . THR B 1 238 ? 58.387  -7.980  -1.970  1.00 99.57  ? 238 THR B CB  1 
ATOM   3565  O  OG1 . THR B 1 238 ? 58.163  -9.318  -2.421  1.00 94.44  ? 238 THR B OG1 1 
ATOM   3566  C  CG2 . THR B 1 238 ? 59.640  -7.393  -2.609  1.00 107.52 ? 238 THR B CG2 1 
ATOM   3567  N  N   . VAL B 1 239 ? 57.810  -9.599  1.225   1.00 97.69  ? 239 VAL B N   1 
ATOM   3568  C  CA  . VAL B 1 239 ? 56.851  -10.461 1.882   1.00 96.25  ? 239 VAL B CA  1 
ATOM   3569  C  C   . VAL B 1 239 ? 55.723  -9.592  2.422   1.00 97.14  ? 239 VAL B C   1 
ATOM   3570  O  O   . VAL B 1 239 ? 54.552  -9.850  2.169   1.00 99.21  ? 239 VAL B O   1 
ATOM   3571  C  CB  . VAL B 1 239 ? 57.486  -11.253 3.031   1.00 97.36  ? 239 VAL B CB  1 
ATOM   3572  C  CG1 . VAL B 1 239 ? 56.460  -12.197 3.633   1.00 98.28  ? 239 VAL B CG1 1 
ATOM   3573  C  CG2 . VAL B 1 239 ? 58.693  -12.033 2.538   1.00 101.35 ? 239 VAL B CG2 1 
ATOM   3574  N  N   . GLY B 1 240 ? 56.080  -8.557  3.171   1.00 96.22  ? 240 GLY B N   1 
ATOM   3575  C  CA  . GLY B 1 240 ? 55.099  -7.582  3.632   1.00 93.11  ? 240 GLY B CA  1 
ATOM   3576  C  C   . GLY B 1 240 ? 53.981  -8.198  4.444   1.00 88.11  ? 240 GLY B C   1 
ATOM   3577  O  O   . GLY B 1 240 ? 52.809  -8.087  4.097   1.00 82.83  ? 240 GLY B O   1 
ATOM   3578  N  N   . PHE B 1 241 ? 54.351  -8.843  5.540   1.00 89.70  ? 241 PHE B N   1 
ATOM   3579  C  CA  . PHE B 1 241 ? 53.371  -9.390  6.454   1.00 91.79  ? 241 PHE B CA  1 
ATOM   3580  C  C   . PHE B 1 241 ? 52.396  -8.303  6.868   1.00 92.89  ? 241 PHE B C   1 
ATOM   3581  O  O   . PHE B 1 241 ? 51.190  -8.436  6.681   1.00 89.83  ? 241 PHE B O   1 
ATOM   3582  C  CB  . PHE B 1 241 ? 54.056  -9.973  7.691   1.00 94.50  ? 241 PHE B CB  1 
ATOM   3583  C  CG  . PHE B 1 241 ? 54.610  -11.359 7.486   1.00 99.25  ? 241 PHE B CG  1 
ATOM   3584  C  CD1 . PHE B 1 241 ? 53.877  -12.326 6.804   1.00 100.40 ? 241 PHE B CD1 1 
ATOM   3585  C  CD2 . PHE B 1 241 ? 55.853  -11.709 8.009   1.00 101.59 ? 241 PHE B CD2 1 
ATOM   3586  C  CE1 . PHE B 1 241 ? 54.382  -13.601 6.628   1.00 99.86  ? 241 PHE B CE1 1 
ATOM   3587  C  CE2 . PHE B 1 241 ? 56.359  -12.985 7.842   1.00 98.02  ? 241 PHE B CE2 1 
ATOM   3588  C  CZ  . PHE B 1 241 ? 55.626  -13.927 7.146   1.00 99.69  ? 241 PHE B CZ  1 
ATOM   3589  N  N   . GLY B 1 242 ? 52.925  -7.230  7.440   1.00 96.34  ? 242 GLY B N   1 
ATOM   3590  C  CA  . GLY B 1 242 ? 52.093  -6.132  7.901   1.00 102.82 ? 242 GLY B CA  1 
ATOM   3591  C  C   . GLY B 1 242 ? 51.920  -6.088  9.407   1.00 108.66 ? 242 GLY B C   1 
ATOM   3592  O  O   . GLY B 1 242 ? 51.184  -5.239  9.928   1.00 110.86 ? 242 GLY B O   1 
ATOM   3593  N  N   . ASP B 1 243 ? 52.570  -7.007  10.117  1.00 108.47 ? 243 ASP B N   1 
ATOM   3594  C  CA  . ASP B 1 243 ? 52.593  -6.927  11.572  1.00 111.10 ? 243 ASP B CA  1 
ATOM   3595  C  C   . ASP B 1 243 ? 53.402  -5.706  12.017  1.00 109.01 ? 243 ASP B C   1 
ATOM   3596  O  O   . ASP B 1 243 ? 53.094  -5.090  13.042  1.00 106.92 ? 243 ASP B O   1 
ATOM   3597  C  CB  . ASP B 1 243 ? 53.107  -8.227  12.222  1.00 114.13 ? 243 ASP B CB  1 
ATOM   3598  C  CG  . ASP B 1 243 ? 54.314  -8.825  11.512  1.00 114.51 ? 243 ASP B CG  1 
ATOM   3599  O  OD1 . ASP B 1 243 ? 54.853  -8.188  10.583  1.00 116.87 ? 243 ASP B OD1 1 
ATOM   3600  O  OD2 . ASP B 1 243 ? 54.722  -9.948  11.892  1.00 114.49 ? 243 ASP B OD2 1 
ATOM   3601  N  N   . TYR B 1 244 ? 54.399  -5.333  11.213  1.00 107.37 ? 244 TYR B N   1 
ATOM   3602  C  CA  . TYR B 1 244 ? 55.211  -4.142  11.474  1.00 106.91 ? 244 TYR B CA  1 
ATOM   3603  C  C   . TYR B 1 244 ? 55.209  -3.247  10.247  1.00 108.54 ? 244 TYR B C   1 
ATOM   3604  O  O   . TYR B 1 244 ? 55.448  -3.708  9.131   1.00 106.90 ? 244 TYR B O   1 
ATOM   3605  C  CB  . TYR B 1 244 ? 56.653  -4.510  11.833  1.00 104.12 ? 244 TYR B CB  1 
ATOM   3606  C  CG  . TYR B 1 244 ? 56.791  -5.156  13.184  1.00 104.48 ? 244 TYR B CG  1 
ATOM   3607  C  CD1 . TYR B 1 244 ? 56.378  -6.466  13.392  1.00 105.11 ? 244 TYR B CD1 1 
ATOM   3608  C  CD2 . TYR B 1 244 ? 57.315  -4.458  14.258  1.00 105.30 ? 244 TYR B CD2 1 
ATOM   3609  C  CE1 . TYR B 1 244 ? 56.487  -7.060  14.635  1.00 103.30 ? 244 TYR B CE1 1 
ATOM   3610  C  CE2 . TYR B 1 244 ? 57.431  -5.045  15.503  1.00 104.55 ? 244 TYR B CE2 1 
ATOM   3611  C  CZ  . TYR B 1 244 ? 57.015  -6.338  15.683  1.00 101.98 ? 244 TYR B CZ  1 
ATOM   3612  O  OH  . TYR B 1 244 ? 57.129  -6.900  16.919  1.00 102.63 ? 244 TYR B OH  1 
ATOM   3613  N  N   . VAL B 1 245 ? 54.922  -1.970  10.463  1.00 113.37 ? 245 VAL B N   1 
ATOM   3614  C  CA  . VAL B 1 245 ? 54.845  -1.003  9.384   1.00 116.92 ? 245 VAL B CA  1 
ATOM   3615  C  C   . VAL B 1 245 ? 55.350  0.334   9.903   1.00 129.31 ? 245 VAL B C   1 
ATOM   3616  O  O   . VAL B 1 245 ? 54.865  0.841   10.917  1.00 130.68 ? 245 VAL B O   1 
ATOM   3617  C  CB  . VAL B 1 245 ? 53.401  -0.818  8.896   1.00 117.22 ? 245 VAL B CB  1 
ATOM   3618  C  CG1 . VAL B 1 245 ? 53.366  0.087   7.674   1.00 119.91 ? 245 VAL B CG1 1 
ATOM   3619  C  CG2 . VAL B 1 245 ? 52.767  -2.161  8.585   1.00 114.95 ? 245 VAL B CG2 1 
ATOM   3620  N  N   . ALA B 1 246 ? 56.320  0.909   9.203   1.00 139.12 ? 246 ALA B N   1 
ATOM   3621  C  CA  . ALA B 1 246 ? 56.932  2.157   9.649   1.00 145.34 ? 246 ALA B CA  1 
ATOM   3622  C  C   . ALA B 1 246 ? 56.025  3.350   9.337   1.00 155.08 ? 246 ALA B C   1 
ATOM   3623  O  O   . ALA B 1 246 ? 55.562  3.520   8.206   1.00 145.53 ? 246 ALA B O   1 
ATOM   3624  C  CB  . ALA B 1 246 ? 58.305  2.327   9.016   1.00 143.95 ? 246 ALA B CB  1 
ATOM   3625  N  N   . GLY B 1 247 ? 55.731  4.139   10.370  1.00 169.35 ? 247 GLY B N   1 
ATOM   3626  C  CA  . GLY B 1 247 ? 54.906  5.340   10.234  1.00 180.61 ? 247 GLY B CA  1 
ATOM   3627  C  C   . GLY B 1 247 ? 53.422  5.126   10.481  1.00 187.88 ? 247 GLY B C   1 
ATOM   3628  O  O   . GLY B 1 247 ? 52.687  6.084   10.743  1.00 185.06 ? 247 GLY B O   1 
ATOM   3629  N  N   . ALA B 1 248 ? 52.973  3.874   10.392  1.00 192.97 ? 248 ALA B N   1 
ATOM   3630  C  CA  . ALA B 1 248 ? 51.558  3.545   10.584  1.00 190.09 ? 248 ALA B CA  1 
ATOM   3631  C  C   . ALA B 1 248 ? 51.041  4.038   11.935  1.00 190.29 ? 248 ALA B C   1 
ATOM   3632  O  O   . ALA B 1 248 ? 49.867  4.396   12.067  1.00 181.04 ? 248 ALA B O   1 
ATOM   3633  C  CB  . ALA B 1 248 ? 51.341  2.043   10.454  1.00 180.65 ? 248 ALA B CB  1 
ATOM   3634  N  N   . ASP B 1 249 ? 51.923  4.050   12.933  1.00 193.70 ? 249 ASP B N   1 
ATOM   3635  C  CA  . ASP B 1 249 ? 51.547  4.441   14.288  1.00 199.13 ? 249 ASP B CA  1 
ATOM   3636  C  C   . ASP B 1 249 ? 50.675  5.692   14.246  1.00 209.15 ? 249 ASP B C   1 
ATOM   3637  O  O   . ASP B 1 249 ? 51.048  6.678   13.608  1.00 213.51 ? 249 ASP B O   1 
ATOM   3638  C  CB  . ASP B 1 249 ? 52.788  4.704   15.139  1.00 197.27 ? 249 ASP B CB  1 
ATOM   3639  C  CG  . ASP B 1 249 ? 52.455  4.865   16.608  1.00 196.52 ? 249 ASP B CG  1 
ATOM   3640  O  OD1 . ASP B 1 249 ? 51.815  3.955   17.174  1.00 188.40 ? 249 ASP B OD1 1 
ATOM   3641  O  OD2 . ASP B 1 249 ? 52.825  5.901   17.195  1.00 198.37 ? 249 ASP B OD2 1 
ATOM   3642  N  N   . PRO B 1 250 ? 49.501  5.650   14.906  1.00 211.75 ? 250 PRO B N   1 
ATOM   3643  C  CA  . PRO B 1 250 ? 48.590  6.804   14.844  1.00 220.02 ? 250 PRO B CA  1 
ATOM   3644  C  C   . PRO B 1 250 ? 49.108  8.078   15.523  1.00 227.04 ? 250 PRO B C   1 
ATOM   3645  O  O   . PRO B 1 250 ? 48.824  9.176   15.044  1.00 245.24 ? 250 PRO B O   1 
ATOM   3646  C  CB  . PRO B 1 250 ? 47.319  6.311   15.553  1.00 213.44 ? 250 PRO B CB  1 
ATOM   3647  C  CG  . PRO B 1 250 ? 47.426  4.827   15.612  1.00 202.91 ? 250 PRO B CG  1 
ATOM   3648  C  CD  . PRO B 1 250 ? 48.882  4.475   15.551  1.00 202.42 ? 250 PRO B CD  1 
ATOM   3649  N  N   . ARG B 1 251 ? 49.852  7.944   16.620  1.00 218.83 ? 251 ARG B N   1 
ATOM   3650  C  CA  . ARG B 1 251 ? 50.181  9.111   17.450  1.00 220.49 ? 251 ARG B CA  1 
ATOM   3651  C  C   . ARG B 1 251 ? 51.221  10.032  16.803  1.00 224.25 ? 251 ARG B C   1 
ATOM   3652  O  O   . ARG B 1 251 ? 51.235  11.238  17.062  1.00 227.52 ? 251 ARG B O   1 
ATOM   3653  C  CB  . ARG B 1 251 ? 50.663  8.687   18.848  1.00 212.56 ? 251 ARG B CB  1 
ATOM   3654  C  CG  . ARG B 1 251 ? 51.301  9.823   19.633  1.00 213.04 ? 251 ARG B CG  1 
ATOM   3655  C  CD  . ARG B 1 251 ? 51.117  9.690   21.132  1.00 211.16 ? 251 ARG B CD  1 
ATOM   3656  N  NE  . ARG B 1 251 ? 51.624  10.870  21.827  1.00 216.49 ? 251 ARG B NE  1 
ATOM   3657  C  CZ  . ARG B 1 251 ? 51.415  11.136  23.114  1.00 220.33 ? 251 ARG B CZ  1 
ATOM   3658  N  NH1 . ARG B 1 251 ? 50.710  10.298  23.862  1.00 219.79 ? 251 ARG B NH1 1 
ATOM   3659  N  NH2 . ARG B 1 251 ? 51.913  12.242  23.655  1.00 225.12 ? 251 ARG B NH2 1 
ATOM   3660  N  N   . GLN B 1 252 ? 52.084  9.470   15.962  1.00 214.02 ? 252 GLN B N   1 
ATOM   3661  C  CA  . GLN B 1 252 ? 53.230  10.208  15.434  1.00 210.93 ? 252 GLN B CA  1 
ATOM   3662  C  C   . GLN B 1 252 ? 52.798  11.420  14.605  1.00 211.37 ? 252 GLN B C   1 
ATOM   3663  O  O   . GLN B 1 252 ? 51.987  11.285  13.688  1.00 212.52 ? 252 GLN B O   1 
ATOM   3664  C  CB  . GLN B 1 252 ? 54.106  9.277   14.584  1.00 199.53 ? 252 GLN B CB  1 
ATOM   3665  C  CG  . GLN B 1 252 ? 55.040  8.384   15.386  1.00 193.21 ? 252 GLN B CG  1 
ATOM   3666  C  CD  . GLN B 1 252 ? 55.708  7.320   14.533  1.00 187.76 ? 252 GLN B CD  1 
ATOM   3667  O  OE1 . GLN B 1 252 ? 55.273  7.037   13.417  1.00 185.33 ? 252 GLN B OE1 1 
ATOM   3668  N  NE2 . GLN B 1 252 ? 56.770  6.720   15.061  1.00 189.45 ? 252 GLN B NE2 1 
ATOM   3669  N  N   . ASP B 1 253 ? 53.321  12.600  14.948  1.00 209.96 ? 253 ASP B N   1 
ATOM   3670  C  CA  . ASP B 1 253 ? 53.278  13.761  14.052  1.00 209.62 ? 253 ASP B CA  1 
ATOM   3671  C  C   . ASP B 1 253 ? 54.460  13.741  13.081  1.00 210.30 ? 253 ASP B C   1 
ATOM   3672  O  O   . ASP B 1 253 ? 55.455  14.442  13.277  1.00 211.43 ? 253 ASP B O   1 
ATOM   3673  C  CB  . ASP B 1 253 ? 53.268  15.071  14.847  1.00 213.08 ? 253 ASP B CB  1 
ATOM   3674  C  CG  . ASP B 1 253 ? 51.874  15.592  15.076  1.00 214.67 ? 253 ASP B CG  1 
ATOM   3675  O  OD1 . ASP B 1 253 ? 50.925  14.795  14.952  1.00 207.60 ? 253 ASP B OD1 1 
ATOM   3676  O  OD2 . ASP B 1 253 ? 51.726  16.796  15.368  1.00 220.37 ? 253 ASP B OD2 1 
ATOM   3677  N  N   . SER B 1 254 ? 54.314  12.959  12.011  1.00 209.07 ? 254 SER B N   1 
ATOM   3678  C  CA  . SER B 1 254 ? 55.416  12.638  11.104  1.00 203.03 ? 254 SER B CA  1 
ATOM   3679  C  C   . SER B 1 254 ? 54.908  12.557  9.662   1.00 205.63 ? 254 SER B C   1 
ATOM   3680  O  O   . SER B 1 254 ? 54.712  11.458  9.126   1.00 187.67 ? 254 SER B O   1 
ATOM   3681  C  CB  . SER B 1 254 ? 56.070  11.310  11.509  1.00 189.15 ? 254 SER B CB  1 
ATOM   3682  O  OG  . SER B 1 254 ? 56.769  11.430  12.733  1.00 186.51 ? 254 SER B OG  1 
ATOM   3683  N  N   . PRO B 1 255 ? 54.688  13.729  9.032   1.00 221.42 ? 255 PRO B N   1 
ATOM   3684  C  CA  . PRO B 1 255 ? 54.170  13.764  7.666   1.00 223.50 ? 255 PRO B CA  1 
ATOM   3685  C  C   . PRO B 1 255 ? 55.200  13.317  6.624   1.00 224.34 ? 255 PRO B C   1 
ATOM   3686  O  O   . PRO B 1 255 ? 54.926  12.401  5.851   1.00 214.80 ? 255 PRO B O   1 
ATOM   3687  C  CB  . PRO B 1 255 ? 53.774  15.234  7.469   1.00 226.46 ? 255 PRO B CB  1 
ATOM   3688  C  CG  . PRO B 1 255 ? 54.602  16.001  8.440   1.00 228.92 ? 255 PRO B CG  1 
ATOM   3689  C  CD  . PRO B 1 255 ? 54.898  15.080  9.588   1.00 225.41 ? 255 PRO B CD  1 
ATOM   3690  N  N   . ALA B 1 256 ? 56.385  13.927  6.641   1.00 232.28 ? 256 ALA B N   1 
ATOM   3691  C  CA  . ALA B 1 256 ? 57.426  13.641  5.654   1.00 230.58 ? 256 ALA B CA  1 
ATOM   3692  C  C   . ALA B 1 256 ? 58.001  12.244  5.870   1.00 230.20 ? 256 ALA B C   1 
ATOM   3693  O  O   . ALA B 1 256 ? 58.584  11.648  4.961   1.00 229.93 ? 256 ALA B O   1 
ATOM   3694  C  CB  . ALA B 1 256 ? 58.533  14.679  5.744   1.00 232.53 ? 256 ALA B CB  1 
ATOM   3695  N  N   . TYR B 1 257 ? 57.808  11.725  7.078   1.00 228.62 ? 257 TYR B N   1 
ATOM   3696  C  CA  . TYR B 1 257 ? 58.417  10.471  7.504   1.00 212.54 ? 257 TYR B CA  1 
ATOM   3697  C  C   . TYR B 1 257 ? 58.075  9.334   6.549   1.00 206.94 ? 257 TYR B C   1 
ATOM   3698  O  O   . TYR B 1 257 ? 58.966  8.775   5.908   1.00 195.52 ? 257 TYR B O   1 
ATOM   3699  C  CB  . TYR B 1 257 ? 57.959  10.138  8.926   1.00 206.94 ? 257 TYR B CB  1 
ATOM   3700  C  CG  . TYR B 1 257 ? 58.491  8.838   9.492   1.00 194.55 ? 257 TYR B CG  1 
ATOM   3701  C  CD1 . TYR B 1 257 ? 59.815  8.719   9.912   1.00 188.15 ? 257 TYR B CD1 1 
ATOM   3702  C  CD2 . TYR B 1 257 ? 57.652  7.745   9.658   1.00 185.53 ? 257 TYR B CD2 1 
ATOM   3703  C  CE1 . TYR B 1 257 ? 60.290  7.535   10.456  1.00 176.50 ? 257 TYR B CE1 1 
ATOM   3704  C  CE2 . TYR B 1 257 ? 58.117  6.561   10.198  1.00 175.18 ? 257 TYR B CE2 1 
ATOM   3705  C  CZ  . TYR B 1 257 ? 59.435  6.460   10.594  1.00 172.47 ? 257 TYR B CZ  1 
ATOM   3706  O  OH  . TYR B 1 257 ? 59.884  5.272   11.123  1.00 170.38 ? 257 TYR B OH  1 
ATOM   3707  N  N   . GLN B 1 258 ? 56.779  9.038   6.425   1.00 214.26 ? 258 GLN B N   1 
ATOM   3708  C  CA  . GLN B 1 258 ? 56.310  7.807   5.768   1.00 213.18 ? 258 GLN B CA  1 
ATOM   3709  C  C   . GLN B 1 258 ? 56.649  7.723   4.264   1.00 200.85 ? 258 GLN B C   1 
ATOM   3710  O  O   . GLN B 1 258 ? 57.113  6.683   3.792   1.00 192.52 ? 258 GLN B O   1 
ATOM   3711  C  CB  . GLN B 1 258 ? 54.803  7.586   6.017   1.00 212.54 ? 258 GLN B CB  1 
ATOM   3712  C  CG  . GLN B 1 258 ? 54.369  6.124   5.954   1.00 196.41 ? 258 GLN B CG  1 
ATOM   3713  C  CD  . GLN B 1 258 ? 52.990  5.872   6.537   1.00 181.88 ? 258 GLN B CD  1 
ATOM   3714  O  OE1 . GLN B 1 258 ? 52.169  6.785   6.667   1.00 171.65 ? 258 GLN B OE1 1 
ATOM   3715  N  NE2 . GLN B 1 258 ? 52.725  4.617   6.874   1.00 173.70 ? 258 GLN B NE2 1 
ATOM   3716  N  N   . PRO B 1 259 ? 56.420  8.809   3.505   1.00 194.96 ? 259 PRO B N   1 
ATOM   3717  C  CA  . PRO B 1 259 ? 56.908  8.759   2.126   1.00 188.50 ? 259 PRO B CA  1 
ATOM   3718  C  C   . PRO B 1 259 ? 58.439  8.682   2.053   1.00 187.41 ? 259 PRO B C   1 
ATOM   3719  O  O   . PRO B 1 259 ? 58.974  7.925   1.244   1.00 183.98 ? 259 PRO B O   1 
ATOM   3720  C  CB  . PRO B 1 259 ? 56.399  10.061  1.499   1.00 197.22 ? 259 PRO B CB  1 
ATOM   3721  C  CG  . PRO B 1 259 ? 55.446  10.669  2.465   1.00 199.91 ? 259 PRO B CG  1 
ATOM   3722  C  CD  . PRO B 1 259 ? 55.582  9.986   3.788   1.00 199.27 ? 259 PRO B CD  1 
ATOM   3723  N  N   . LEU B 1 260 ? 59.137  9.453   2.889   1.00 188.50 ? 260 LEU B N   1 
ATOM   3724  C  CA  . LEU B 1 260 ? 60.604  9.441   2.901   1.00 186.44 ? 260 LEU B CA  1 
ATOM   3725  C  C   . LEU B 1 260 ? 61.162  8.029   3.122   1.00 184.14 ? 260 LEU B C   1 
ATOM   3726  O  O   . LEU B 1 260 ? 62.150  7.630   2.506   1.00 179.74 ? 260 LEU B O   1 
ATOM   3727  C  CB  . LEU B 1 260 ? 61.144  10.386  3.979   1.00 186.16 ? 260 LEU B CB  1 
ATOM   3728  C  CG  . LEU B 1 260 ? 62.668  10.367  4.140   1.00 184.97 ? 260 LEU B CG  1 
ATOM   3729  C  CD1 . LEU B 1 260 ? 63.221  11.765  4.368   1.00 189.89 ? 260 LEU B CD1 1 
ATOM   3730  C  CD2 . LEU B 1 260 ? 63.066  9.431   5.274   1.00 181.66 ? 260 LEU B CD2 1 
ATOM   3731  N  N   . VAL B 1 261 ? 60.530  7.280   4.015   1.00 183.21 ? 261 VAL B N   1 
ATOM   3732  C  CA  . VAL B 1 261 ? 60.874  5.878   4.212   1.00 174.08 ? 261 VAL B CA  1 
ATOM   3733  C  C   . VAL B 1 261 ? 60.759  5.119   2.889   1.00 169.32 ? 261 VAL B C   1 
ATOM   3734  O  O   . VAL B 1 261 ? 61.577  4.254   2.581   1.00 168.33 ? 261 VAL B O   1 
ATOM   3735  C  CB  . VAL B 1 261 ? 59.955  5.231   5.264   1.00 172.95 ? 261 VAL B CB  1 
ATOM   3736  C  CG1 . VAL B 1 261 ? 60.125  3.723   5.273   1.00 163.44 ? 261 VAL B CG1 1 
ATOM   3737  C  CG2 . VAL B 1 261 ? 60.245  5.811   6.641   1.00 180.34 ? 261 VAL B CG2 1 
ATOM   3738  N  N   . TRP B 1 262 ? 59.741  5.446   2.102   1.00 168.66 ? 262 TRP B N   1 
ATOM   3739  C  CA  . TRP B 1 262 ? 59.598  4.852   0.775   1.00 166.27 ? 262 TRP B CA  1 
ATOM   3740  C  C   . TRP B 1 262 ? 60.831  5.116   -0.105  1.00 158.92 ? 262 TRP B C   1 
ATOM   3741  O  O   . TRP B 1 262 ? 61.223  4.264   -0.895  1.00 151.35 ? 262 TRP B O   1 
ATOM   3742  C  CB  . TRP B 1 262 ? 58.323  5.351   0.090   1.00 171.73 ? 262 TRP B CB  1 
ATOM   3743  C  CG  . TRP B 1 262 ? 58.041  4.665   -1.207  1.00 173.05 ? 262 TRP B CG  1 
ATOM   3744  C  CD1 . TRP B 1 262 ? 57.330  3.514   -1.392  1.00 169.78 ? 262 TRP B CD1 1 
ATOM   3745  C  CD2 . TRP B 1 262 ? 58.471  5.087   -2.506  1.00 175.03 ? 262 TRP B CD2 1 
ATOM   3746  N  NE1 . TRP B 1 262 ? 57.285  3.196   -2.730  1.00 166.77 ? 262 TRP B NE1 1 
ATOM   3747  C  CE2 . TRP B 1 262 ? 57.978  4.146   -3.435  1.00 167.90 ? 262 TRP B CE2 1 
ATOM   3748  C  CE3 . TRP B 1 262 ? 59.219  6.173   -2.976  1.00 183.63 ? 262 TRP B CE3 1 
ATOM   3749  C  CZ2 . TRP B 1 262 ? 58.210  4.258   -4.805  1.00 168.81 ? 262 TRP B CZ2 1 
ATOM   3750  C  CZ3 . TRP B 1 262 ? 59.447  6.284   -4.338  1.00 182.04 ? 262 TRP B CZ3 1 
ATOM   3751  C  CH2 . TRP B 1 262 ? 58.948  5.330   -5.236  1.00 176.59 ? 262 TRP B CH2 1 
ATOM   3752  N  N   . PHE B 1 263 ? 61.450  6.282   0.050   1.00 156.84 ? 263 PHE B N   1 
ATOM   3753  C  CA  . PHE B 1 263 ? 62.719  6.590   -0.622  1.00 156.36 ? 263 PHE B CA  1 
ATOM   3754  C  C   . PHE B 1 263 ? 63.720  5.466   -0.335  1.00 146.74 ? 263 PHE B C   1 
ATOM   3755  O  O   . PHE B 1 263 ? 64.383  4.950   -1.236  1.00 141.85 ? 263 PHE B O   1 
ATOM   3756  C  CB  . PHE B 1 263 ? 63.257  7.933   -0.101  1.00 164.64 ? 263 PHE B CB  1 
ATOM   3757  C  CG  . PHE B 1 263 ? 64.113  8.699   -1.080  1.00 171.01 ? 263 PHE B CG  1 
ATOM   3758  C  CD1 . PHE B 1 263 ? 65.318  8.184   -1.544  1.00 171.25 ? 263 PHE B CD1 1 
ATOM   3759  C  CD2 . PHE B 1 263 ? 63.761  9.992   -1.456  1.00 178.22 ? 263 PHE B CD2 1 
ATOM   3760  C  CE1 . PHE B 1 263 ? 66.122  8.918   -2.407  1.00 175.70 ? 263 PHE B CE1 1 
ATOM   3761  C  CE2 . PHE B 1 263 ? 64.562  10.731  -2.314  1.00 183.37 ? 263 PHE B CE2 1 
ATOM   3762  C  CZ  . PHE B 1 263 ? 65.743  10.193  -2.791  1.00 181.20 ? 263 PHE B CZ  1 
ATOM   3763  N  N   . TRP B 1 264 ? 63.823  5.091   0.934   1.00 144.71 ? 264 TRP B N   1 
ATOM   3764  C  CA  . TRP B 1 264 ? 64.665  3.972   1.340   1.00 143.86 ? 264 TRP B CA  1 
ATOM   3765  C  C   . TRP B 1 264 ? 64.206  2.667   0.697   1.00 139.87 ? 264 TRP B C   1 
ATOM   3766  O  O   . TRP B 1 264 ? 65.008  1.891   0.178   1.00 137.64 ? 264 TRP B O   1 
ATOM   3767  C  CB  . TRP B 1 264 ? 64.645  3.818   2.859   1.00 143.16 ? 264 TRP B CB  1 
ATOM   3768  C  CG  . TRP B 1 264 ? 65.020  2.450   3.294   1.00 138.84 ? 264 TRP B CG  1 
ATOM   3769  C  CD1 . TRP B 1 264 ? 66.245  1.880   3.194   1.00 139.91 ? 264 TRP B CD1 1 
ATOM   3770  C  CD2 . TRP B 1 264 ? 64.159  1.462   3.877   1.00 137.59 ? 264 TRP B CD2 1 
ATOM   3771  N  NE1 . TRP B 1 264 ? 66.213  0.601   3.689   1.00 139.10 ? 264 TRP B NE1 1 
ATOM   3772  C  CE2 . TRP B 1 264 ? 64.941  0.320   4.118   1.00 137.51 ? 264 TRP B CE2 1 
ATOM   3773  C  CE3 . TRP B 1 264 ? 62.807  1.437   4.229   1.00 137.12 ? 264 TRP B CE3 1 
ATOM   3774  C  CZ2 . TRP B 1 264 ? 64.415  -0.841  4.693   1.00 130.90 ? 264 TRP B CZ2 1 
ATOM   3775  C  CZ3 . TRP B 1 264 ? 62.288  0.286   4.808   1.00 129.24 ? 264 TRP B CZ3 1 
ATOM   3776  C  CH2 . TRP B 1 264 ? 63.090  -0.834  5.029   1.00 125.91 ? 264 TRP B CH2 1 
ATOM   3777  N  N   . ILE B 1 265 ? 62.906  2.416   0.765   1.00 141.58 ? 265 ILE B N   1 
ATOM   3778  C  CA  . ILE B 1 265 ? 62.337  1.195   0.212   1.00 138.58 ? 265 ILE B CA  1 
ATOM   3779  C  C   . ILE B 1 265 ? 62.730  1.045   -1.255  1.00 139.24 ? 265 ILE B C   1 
ATOM   3780  O  O   . ILE B 1 265 ? 63.146  -0.025  -1.691  1.00 133.88 ? 265 ILE B O   1 
ATOM   3781  C  CB  . ILE B 1 265 ? 60.801  1.193   0.322   1.00 136.84 ? 265 ILE B CB  1 
ATOM   3782  C  CG1 . ILE B 1 265 ? 60.368  1.156   1.789   1.00 137.59 ? 265 ILE B CG1 1 
ATOM   3783  C  CG2 . ILE B 1 265 ? 60.218  0.004   -0.417  1.00 130.95 ? 265 ILE B CG2 1 
ATOM   3784  C  CD1 . ILE B 1 265 ? 58.890  0.880   1.975   1.00 137.20 ? 265 ILE B CD1 1 
ATOM   3785  N  N   . LEU B 1 266 ? 62.608  2.130   -2.009  1.00 143.66 ? 266 LEU B N   1 
ATOM   3786  C  CA  . LEU B 1 266 ? 62.993  2.129   -3.414  1.00 144.98 ? 266 LEU B CA  1 
ATOM   3787  C  C   . LEU B 1 266 ? 64.445  1.693   -3.581  1.00 144.79 ? 266 LEU B C   1 
ATOM   3788  O  O   . LEU B 1 266 ? 64.738  0.732   -4.289  1.00 141.93 ? 266 LEU B O   1 
ATOM   3789  C  CB  . LEU B 1 266 ? 62.803  3.525   -4.012  1.00 150.44 ? 266 LEU B CB  1 
ATOM   3790  C  CG  . LEU B 1 266 ? 63.302  3.706   -5.446  1.00 153.21 ? 266 LEU B CG  1 
ATOM   3791  C  CD1 . LEU B 1 266 ? 62.700  2.648   -6.356  1.00 150.46 ? 266 LEU B CD1 1 
ATOM   3792  C  CD2 . LEU B 1 266 ? 62.979  5.107   -5.943  1.00 157.55 ? 266 LEU B CD2 1 
ATOM   3793  N  N   . LEU B 1 267 ? 65.348  2.414   -2.927  1.00 148.41 ? 267 LEU B N   1 
ATOM   3794  C  CA  . LEU B 1 267 ? 66.778  2.154   -3.053  1.00 152.25 ? 267 LEU B CA  1 
ATOM   3795  C  C   . LEU B 1 267 ? 67.131  0.769   -2.529  1.00 147.68 ? 267 LEU B C   1 
ATOM   3796  O  O   . LEU B 1 267 ? 67.912  0.053   -3.141  1.00 147.69 ? 267 LEU B O   1 
ATOM   3797  C  CB  . LEU B 1 267 ? 67.586  3.227   -2.309  1.00 157.41 ? 267 LEU B CB  1 
ATOM   3798  C  CG  . LEU B 1 267 ? 67.424  4.647   -2.861  1.00 161.23 ? 267 LEU B CG  1 
ATOM   3799  C  CD1 . LEU B 1 267 ? 68.155  5.666   -2.003  1.00 163.31 ? 267 LEU B CD1 1 
ATOM   3800  C  CD2 . LEU B 1 267 ? 67.901  4.710   -4.306  1.00 163.06 ? 267 LEU B CD2 1 
ATOM   3801  N  N   . GLY B 1 268 ? 66.540  0.392   -1.403  1.00 147.15 ? 268 GLY B N   1 
ATOM   3802  C  CA  . GLY B 1 268 ? 66.795  -0.914  -0.803  1.00 148.03 ? 268 GLY B CA  1 
ATOM   3803  C  C   . GLY B 1 268 ? 66.346  -2.085  -1.663  1.00 147.64 ? 268 GLY B C   1 
ATOM   3804  O  O   . GLY B 1 268 ? 67.019  -3.113  -1.721  1.00 152.12 ? 268 GLY B O   1 
ATOM   3805  N  N   . LEU B 1 269 ? 65.196  -1.946  -2.317  1.00 146.10 ? 269 LEU B N   1 
ATOM   3806  C  CA  . LEU B 1 269 ? 64.651  -3.020  -3.153  1.00 142.14 ? 269 LEU B CA  1 
ATOM   3807  C  C   . LEU B 1 269 ? 65.536  -3.298  -4.369  1.00 141.57 ? 269 LEU B C   1 
ATOM   3808  O  O   . LEU B 1 269 ? 65.813  -4.454  -4.689  1.00 143.44 ? 269 LEU B O   1 
ATOM   3809  C  CB  . LEU B 1 269 ? 63.234  -2.672  -3.615  1.00 142.26 ? 269 LEU B CB  1 
ATOM   3810  C  CG  . LEU B 1 269 ? 62.098  -2.995  -2.635  1.00 143.74 ? 269 LEU B CG  1 
ATOM   3811  C  CD1 . LEU B 1 269 ? 60.830  -2.222  -2.979  1.00 149.68 ? 269 LEU B CD1 1 
ATOM   3812  C  CD2 . LEU B 1 269 ? 61.815  -4.491  -2.589  1.00 137.00 ? 269 LEU B CD2 1 
ATOM   3813  N  N   . ALA B 1 270 ? 65.982  -2.228  -5.025  1.00 146.18 ? 270 ALA B N   1 
ATOM   3814  C  CA  . ALA B 1 270 ? 66.798  -2.324  -6.240  1.00 154.33 ? 270 ALA B CA  1 
ATOM   3815  C  C   . ALA B 1 270 ? 68.150  -2.956  -5.937  1.00 159.38 ? 270 ALA B C   1 
ATOM   3816  O  O   . ALA B 1 270 ? 68.665  -3.756  -6.717  1.00 153.99 ? 270 ALA B O   1 
ATOM   3817  C  CB  . ALA B 1 270 ? 67.008  -0.942  -6.840  1.00 158.82 ? 270 ALA B CB  1 
ATOM   3818  N  N   . TYR B 1 271 ? 68.729  -2.572  -4.805  1.00 169.22 ? 271 TYR B N   1 
ATOM   3819  C  CA  . TYR B 1 271 ? 70.005  -3.102  -4.375  1.00 183.12 ? 271 TYR B CA  1 
ATOM   3820  C  C   . TYR B 1 271 ? 69.890  -4.586  -4.067  1.00 172.93 ? 271 TYR B C   1 
ATOM   3821  O  O   . TYR B 1 271 ? 70.685  -5.393  -4.541  1.00 186.30 ? 271 TYR B O   1 
ATOM   3822  C  CB  . TYR B 1 271 ? 70.482  -2.352  -3.133  1.00 199.09 ? 271 TYR B CB  1 
ATOM   3823  C  CG  . TYR B 1 271 ? 71.840  -2.795  -2.661  1.00 222.00 ? 271 TYR B CG  1 
ATOM   3824  C  CD1 . TYR B 1 271 ? 72.982  -2.469  -3.385  1.00 240.10 ? 271 TYR B CD1 1 
ATOM   3825  C  CD2 . TYR B 1 271 ? 71.983  -3.560  -1.505  1.00 218.94 ? 271 TYR B CD2 1 
ATOM   3826  C  CE1 . TYR B 1 271 ? 74.231  -2.881  -2.971  1.00 251.81 ? 271 TYR B CE1 1 
ATOM   3827  C  CE2 . TYR B 1 271 ? 73.231  -3.976  -1.081  1.00 233.82 ? 271 TYR B CE2 1 
ATOM   3828  C  CZ  . TYR B 1 271 ? 74.350  -3.634  -1.821  1.00 255.18 ? 271 TYR B CZ  1 
ATOM   3829  O  OH  . TYR B 1 271 ? 75.599  -4.035  -1.420  1.00 264.75 ? 271 TYR B OH  1 
ATOM   3830  N  N   . PHE B 1 272 ? 68.475  -5.216  -3.168  1.00 176.27 ? 272 PHE B N   1 
ATOM   3831  C  CA  . PHE B 1 272 ? 68.171  -6.592  -2.809  1.00 176.51 ? 272 PHE B CA  1 
ATOM   3832  C  C   . PHE B 1 272 ? 67.936  -7.449  -4.045  1.00 183.35 ? 272 PHE B C   1 
ATOM   3833  O  O   . PHE B 1 272 ? 68.179  -8.658  -4.022  1.00 193.43 ? 272 PHE B O   1 
ATOM   3834  C  CB  . PHE B 1 272 ? 66.946  -6.643  -1.902  1.00 165.68 ? 272 PHE B CB  1 
ATOM   3835  C  CG  . PHE B 1 272 ? 67.155  -7.479  -0.673  1.00 158.31 ? 272 PHE B CG  1 
ATOM   3836  C  CD1 . PHE B 1 272 ? 66.912  -8.840  -0.705  1.00 149.51 ? 272 PHE B CD1 1 
ATOM   3837  C  CD2 . PHE B 1 272 ? 67.648  -6.914  0.500   1.00 155.57 ? 272 PHE B CD2 1 
ATOM   3838  C  CE1 . PHE B 1 272 ? 67.122  -9.621  0.419   1.00 147.30 ? 272 PHE B CE1 1 
ATOM   3839  C  CE2 . PHE B 1 272 ? 67.861  -7.689  1.627   1.00 147.90 ? 272 PHE B CE2 1 
ATOM   3840  C  CZ  . PHE B 1 272 ? 67.599  -9.046  1.587   1.00 145.49 ? 272 PHE B CZ  1 
ATOM   3841  N  N   . ALA B 1 273 ? 67.471  -6.823  -5.123  1.00 182.69 ? 273 ALA B N   1 
ATOM   3842  C  CA  . ALA B 1 273 ? 67.295  -7.527  -6.385  1.00 172.13 ? 273 ALA B CA  1 
ATOM   3843  C  C   . ALA B 1 273 ? 68.578  -8.256  -6.801  1.00 171.41 ? 273 ALA B C   1 
ATOM   3844  O  O   . ALA B 1 273 ? 68.515  -9.404  -7.233  1.00 181.72 ? 273 ALA B O   1 
ATOM   3845  C  CB  . ALA B 1 273 ? 66.832  -6.572  -7.476  1.00 172.12 ? 273 ALA B CB  1 
ATOM   3846  N  N   . SER B 1 274 ? 69.737  -7.610  -6.649  1.00 171.74 ? 274 SER B N   1 
ATOM   3847  C  CA  . SER B 1 274 ? 71.028  -8.273  -6.925  1.00 174.52 ? 274 SER B CA  1 
ATOM   3848  C  C   . SER B 1 274 ? 71.139  -9.610  -6.186  1.00 168.89 ? 274 SER B C   1 
ATOM   3849  O  O   . SER B 1 274 ? 71.582  -10.611 -6.752  1.00 163.14 ? 274 SER B O   1 
ATOM   3850  C  CB  . SER B 1 274 ? 72.213  -7.378  -6.531  1.00 172.36 ? 274 SER B CB  1 
ATOM   3851  O  OG  . SER B 1 274 ? 72.469  -6.387  -7.507  1.00 171.05 ? 274 SER B OG  1 
ATOM   3852  N  N   . GLN C 2 1   ? 32.954  13.833  29.120  1.00 126.77 ? 1   GLN D N   1 
ATOM   3853  C  CA  . GLN C 2 1   ? 33.844  14.411  28.068  1.00 120.85 ? 1   GLN D CA  1 
ATOM   3854  C  C   . GLN C 2 1   ? 33.043  15.033  26.940  1.00 118.50 ? 1   GLN D C   1 
ATOM   3855  O  O   . GLN C 2 1   ? 33.345  16.143  26.514  1.00 123.65 ? 1   GLN D O   1 
ATOM   3856  C  CB  . GLN C 2 1   ? 34.765  13.338  27.481  1.00 130.18 ? 1   GLN D CB  1 
ATOM   3857  C  CG  . GLN C 2 1   ? 36.156  13.840  27.172  1.00 143.33 ? 1   GLN D CG  1 
ATOM   3858  C  CD  . GLN C 2 1   ? 36.811  14.458  28.390  1.00 153.64 ? 1   GLN D CD  1 
ATOM   3859  O  OE1 . GLN C 2 1   ? 36.170  14.633  29.432  1.00 136.15 ? 1   GLN D OE1 1 
ATOM   3860  N  NE2 . GLN C 2 1   ? 38.091  14.797  28.267  1.00 165.62 ? 1   GLN D NE2 1 
ATOM   3861  N  N   . ILE C 2 2   ? 32.058  14.298  26.423  1.00 113.85 ? 2   ILE D N   1 
ATOM   3862  C  CA  . ILE C 2 2   ? 31.137  14.847  25.431  1.00 110.98 ? 2   ILE D CA  1 
ATOM   3863  C  C   . ILE C 2 2   ? 30.268  15.912  26.078  1.00 109.83 ? 2   ILE D C   1 
ATOM   3864  O  O   . ILE C 2 2   ? 29.703  15.695  27.150  1.00 104.74 ? 2   ILE D O   1 
ATOM   3865  C  CB  . ILE C 2 2   ? 30.223  13.772  24.821  1.00 106.17 ? 2   ILE D CB  1 
ATOM   3866  C  CG1 . ILE C 2 2   ? 31.002  12.933  23.816  1.00 116.04 ? 2   ILE D CG1 1 
ATOM   3867  C  CG2 . ILE C 2 2   ? 29.030  14.421  24.129  1.00 103.97 ? 2   ILE D CG2 1 
ATOM   3868  C  CD1 . ILE C 2 2   ? 30.188  11.812  23.211  1.00 128.56 ? 2   ILE D CD1 1 
ATOM   3869  N  N   . VAL C 2 3   ? 30.155  17.055  25.409  1.00 104.83 ? 3   VAL D N   1 
ATOM   3870  C  CA  . VAL C 2 3   ? 29.448  18.195  25.955  1.00 100.60 ? 3   VAL D CA  1 
ATOM   3871  C  C   . VAL C 2 3   ? 28.089  18.353  25.305  1.00 97.35  ? 3   VAL D C   1 
ATOM   3872  O  O   . VAL C 2 3   ? 27.984  18.373  24.080  1.00 102.57 ? 3   VAL D O   1 
ATOM   3873  C  CB  . VAL C 2 3   ? 30.240  19.476  25.704  1.00 107.72 ? 3   VAL D CB  1 
ATOM   3874  C  CG1 . VAL C 2 3   ? 29.524  20.670  26.318  1.00 111.73 ? 3   VAL D CG1 1 
ATOM   3875  C  CG2 . VAL C 2 3   ? 31.647  19.329  26.257  1.00 114.11 ? 3   VAL D CG2 1 
ATOM   3876  N  N   . LEU C 2 4   ? 27.052  18.491  26.125  1.00 91.96  ? 4   LEU D N   1 
ATOM   3877  C  CA  . LEU C 2 4   ? 25.709  18.721  25.605  1.00 96.24  ? 4   LEU D CA  1 
ATOM   3878  C  C   . LEU C 2 4   ? 25.243  20.148  25.889  1.00 99.01  ? 4   LEU D C   1 
ATOM   3879  O  O   . LEU C 2 4   ? 25.257  20.610  27.031  1.00 98.31  ? 4   LEU D O   1 
ATOM   3880  C  CB  . LEU C 2 4   ? 24.720  17.727  26.206  1.00 90.37  ? 4   LEU D CB  1 
ATOM   3881  C  CG  . LEU C 2 4   ? 25.106  16.262  26.039  1.00 88.34  ? 4   LEU D CG  1 
ATOM   3882  C  CD1 . LEU C 2 4   ? 24.163  15.396  26.858  1.00 85.68  ? 4   LEU D CD1 1 
ATOM   3883  C  CD2 . LEU C 2 4   ? 25.099  15.866  24.569  1.00 84.07  ? 4   LEU D CD2 1 
ATOM   3884  N  N   . THR C 2 5   ? 24.809  20.831  24.838  1.00 99.61  ? 5   THR D N   1 
ATOM   3885  C  CA  . THR C 2 5   ? 24.318  22.186  24.965  1.00 100.84 ? 5   THR D CA  1 
ATOM   3886  C  C   . THR C 2 5   ? 22.829  22.244  24.676  1.00 96.83  ? 5   THR D C   1 
ATOM   3887  O  O   . THR C 2 5   ? 22.377  21.909  23.580  1.00 103.30 ? 5   THR D O   1 
ATOM   3888  C  CB  . THR C 2 5   ? 25.072  23.118  24.009  1.00 110.21 ? 5   THR D CB  1 
ATOM   3889  O  OG1 . THR C 2 5   ? 26.449  23.173  24.407  1.00 117.40 ? 5   THR D OG1 1 
ATOM   3890  C  CG2 . THR C 2 5   ? 24.495  24.519  24.042  1.00 115.32 ? 5   THR D CG2 1 
ATOM   3891  N  N   . GLN C 2 6   ? 22.062  22.662  25.671  1.00 93.87  ? 6   GLN D N   1 
ATOM   3892  C  CA  . GLN C 2 6   ? 20.669  23.019  25.448  1.00 96.42  ? 6   GLN D CA  1 
ATOM   3893  C  C   . GLN C 2 6   ? 20.515  24.543  25.447  1.00 101.28 ? 6   GLN D C   1 
ATOM   3894  O  O   . GLN C 2 6   ? 20.787  25.212  26.451  1.00 98.77  ? 6   GLN D O   1 
ATOM   3895  C  CB  . GLN C 2 6   ? 19.783  22.408  26.529  1.00 90.34  ? 6   GLN D CB  1 
ATOM   3896  C  CG  . GLN C 2 6   ? 19.935  20.909  26.687  1.00 80.60  ? 6   GLN D CG  1 
ATOM   3897  C  CD  . GLN C 2 6   ? 19.167  20.385  27.878  1.00 78.13  ? 6   GLN D CD  1 
ATOM   3898  O  OE1 . GLN C 2 6   ? 19.750  20.050  28.917  1.00 83.73  ? 6   GLN D OE1 1 
ATOM   3899  N  NE2 . GLN C 2 6   ? 17.849  20.345  27.753  1.00 76.98  ? 6   GLN D NE2 1 
ATOM   3900  N  N   . SER C 2 7   ? 20.075  25.086  24.317  1.00 101.86 ? 7   SER D N   1 
ATOM   3901  C  CA  . SER C 2 7   ? 19.893  26.522  24.179  1.00 107.09 ? 7   SER D CA  1 
ATOM   3902  C  C   . SER C 2 7   ? 18.622  26.789  23.377  1.00 109.21 ? 7   SER D C   1 
ATOM   3903  O  O   . SER C 2 7   ? 18.352  26.103  22.395  1.00 107.44 ? 7   SER D O   1 
ATOM   3904  C  CB  . SER C 2 7   ? 21.111  27.130  23.484  1.00 113.55 ? 7   SER D CB  1 
ATOM   3905  O  OG  . SER C 2 7   ? 21.036  28.539  23.437  1.00 123.71 ? 7   SER D OG  1 
ATOM   3906  N  N   . PRO C 2 8   ? 17.809  27.760  23.816  1.00 113.25 ? 8   PRO D N   1 
ATOM   3907  C  CA  . PRO C 2 8   ? 18.011  28.588  24.997  1.00 112.21 ? 8   PRO D CA  1 
ATOM   3908  C  C   . PRO C 2 8   ? 17.804  27.825  26.291  1.00 104.01 ? 8   PRO D C   1 
ATOM   3909  O  O   . PRO C 2 8   ? 17.194  26.756  26.287  1.00 102.58 ? 8   PRO D O   1 
ATOM   3910  C  CB  . PRO C 2 8   ? 16.912  29.630  24.863  1.00 118.07 ? 8   PRO D CB  1 
ATOM   3911  C  CG  . PRO C 2 8   ? 15.807  28.891  24.193  1.00 112.49 ? 8   PRO D CG  1 
ATOM   3912  C  CD  . PRO C 2 8   ? 16.504  28.026  23.187  1.00 113.37 ? 8   PRO D CD  1 
ATOM   3913  N  N   . ALA C 2 9   ? 18.297  28.384  27.389  1.00 104.12 ? 9   ALA D N   1 
ATOM   3914  C  CA  . ALA C 2 9   ? 18.194  27.724  28.681  1.00 107.90 ? 9   ALA D CA  1 
ATOM   3915  C  C   . ALA C 2 9   ? 16.839  27.995  29.307  1.00 110.75 ? 9   ALA D C   1 
ATOM   3916  O  O   . ALA C 2 9   ? 16.391  27.253  30.178  1.00 105.64 ? 9   ALA D O   1 
ATOM   3917  C  CB  . ALA C 2 9   ? 19.307  28.184  29.607  1.00 111.00 ? 9   ALA D CB  1 
ATOM   3918  N  N   . ILE C 2 10  ? 16.195  29.071  28.871  1.00 121.70 ? 10  ILE D N   1 
ATOM   3919  C  CA  . ILE C 2 10  ? 14.848  29.387  29.330  1.00 123.49 ? 10  ILE D CA  1 
ATOM   3920  C  C   . ILE C 2 10  ? 13.928  29.543  28.135  1.00 119.11 ? 10  ILE D C   1 
ATOM   3921  O  O   . ILE C 2 10  ? 14.322  30.093  27.114  1.00 120.85 ? 10  ILE D O   1 
ATOM   3922  C  CB  . ILE C 2 10  ? 14.798  30.708  30.120  1.00 127.76 ? 10  ILE D CB  1 
ATOM   3923  C  CG1 . ILE C 2 10  ? 15.975  30.811  31.107  1.00 139.52 ? 10  ILE D CG1 1 
ATOM   3924  C  CG2 . ILE C 2 10  ? 13.457  30.829  30.827  1.00 121.20 ? 10  ILE D CG2 1 
ATOM   3925  C  CD1 . ILE C 2 10  ? 15.793  30.051  32.409  1.00 136.59 ? 10  ILE D CD1 1 
ATOM   3926  N  N   . MET C 2 11  ? 12.698  29.067  28.261  1.00 117.05 ? 11  MET D N   1 
ATOM   3927  C  CA  . MET C 2 11  ? 11.690  29.349  27.252  1.00 123.95 ? 11  MET D CA  1 
ATOM   3928  C  C   . MET C 2 11  ? 10.289  29.251  27.831  1.00 122.49 ? 11  MET D C   1 
ATOM   3929  O  O   . MET C 2 11  ? 10.097  28.755  28.941  1.00 110.39 ? 11  MET D O   1 
ATOM   3930  C  CB  . MET C 2 11  ? 11.840  28.417  26.054  1.00 125.78 ? 11  MET D CB  1 
ATOM   3931  C  CG  . MET C 2 11  ? 11.759  26.937  26.382  1.00 119.08 ? 11  MET D CG  1 
ATOM   3932  S  SD  . MET C 2 11  ? 12.494  25.951  25.070  1.00 132.92 ? 11  MET D SD  1 
ATOM   3933  C  CE  . MET C 2 11  ? 12.046  26.869  23.592  1.00 124.82 ? 11  MET D CE  1 
ATOM   3934  N  N   . SER C 2 12  ? 9.318   29.756  27.079  1.00 123.96 ? 12  SER D N   1 
ATOM   3935  C  CA  . SER C 2 12  ? 7.978   29.909  27.600  1.00 124.00 ? 12  SER D CA  1 
ATOM   3936  C  C   . SER C 2 12  ? 6.944   29.663  26.518  1.00 123.54 ? 12  SER D C   1 
ATOM   3937  O  O   . SER C 2 12  ? 7.144   30.016  25.352  1.00 117.69 ? 12  SER D O   1 
ATOM   3938  C  CB  . SER C 2 12  ? 7.802   31.311  28.179  1.00 130.09 ? 12  SER D CB  1 
ATOM   3939  O  OG  . SER C 2 12  ? 7.662   32.271  27.150  1.00 132.76 ? 12  SER D OG  1 
ATOM   3940  N  N   . ALA C 2 13  ? 5.826   29.075  26.927  1.00 122.02 ? 13  ALA D N   1 
ATOM   3941  C  CA  . ALA C 2 13  ? 4.810   28.642  25.998  1.00 120.66 ? 13  ALA D CA  1 
ATOM   3942  C  C   . ALA C 2 13  ? 3.438   28.838  26.609  1.00 124.66 ? 13  ALA D C   1 
ATOM   3943  O  O   . ALA C 2 13  ? 3.236   28.600  27.800  1.00 118.92 ? 13  ALA D O   1 
ATOM   3944  C  CB  . ALA C 2 13  ? 5.025   27.185  25.659  1.00 116.52 ? 13  ALA D CB  1 
ATOM   3945  N  N   . SER C 2 14  ? 2.505   29.300  25.786  1.00 131.87 ? 14  SER D N   1 
ATOM   3946  C  CA  . SER C 2 14  ? 1.105   29.328  26.157  1.00 137.93 ? 14  SER D CA  1 
ATOM   3947  C  C   . SER C 2 14  ? 0.579   27.918  26.000  1.00 139.09 ? 14  SER D C   1 
ATOM   3948  O  O   . SER C 2 14  ? 1.169   27.125  25.282  1.00 150.33 ? 14  SER D O   1 
ATOM   3949  C  CB  . SER C 2 14  ? 0.331   30.271  25.242  1.00 145.44 ? 14  SER D CB  1 
ATOM   3950  O  OG  . SER C 2 14  ? 0.870   31.579  25.299  1.00 151.29 ? 14  SER D OG  1 
ATOM   3951  N  N   . PRO C 2 15  ? -0.522  27.587  26.682  1.00 144.89 ? 15  PRO D N   1 
ATOM   3952  C  CA  . PRO C 2 15  ? -1.095  26.254  26.518  1.00 140.11 ? 15  PRO D CA  1 
ATOM   3953  C  C   . PRO C 2 15  ? -1.761  26.097  25.150  1.00 143.90 ? 15  PRO D C   1 
ATOM   3954  O  O   . PRO C 2 15  ? -2.525  26.969  24.729  1.00 142.83 ? 15  PRO D O   1 
ATOM   3955  C  CB  . PRO C 2 15  ? -2.128  26.162  27.649  1.00 145.68 ? 15  PRO D CB  1 
ATOM   3956  C  CG  . PRO C 2 15  ? -1.998  27.424  28.451  1.00 153.73 ? 15  PRO D CG  1 
ATOM   3957  C  CD  . PRO C 2 15  ? -1.332  28.431  27.570  1.00 155.12 ? 15  PRO D CD  1 
ATOM   3958  N  N   . GLY C 2 16  ? -1.445  25.007  24.455  1.00 139.40 ? 16  GLY D N   1 
ATOM   3959  C  CA  . GLY C 2 16  ? -1.895  24.809  23.074  1.00 143.86 ? 16  GLY D CA  1 
ATOM   3960  C  C   . GLY C 2 16  ? -0.766  25.017  22.077  1.00 140.15 ? 16  GLY D C   1 
ATOM   3961  O  O   . GLY C 2 16  ? -0.781  24.473  20.973  1.00 136.47 ? 16  GLY D O   1 
ATOM   3962  N  N   . GLU C 2 17  ? 0.208   25.827  22.474  1.00 139.31 ? 17  GLU D N   1 
ATOM   3963  C  CA  . GLU C 2 17  ? 1.386   26.104  21.666  1.00 141.11 ? 17  GLU D CA  1 
ATOM   3964  C  C   . GLU C 2 17  ? 2.250   24.846  21.512  1.00 137.63 ? 17  GLU D C   1 
ATOM   3965  O  O   . GLU C 2 17  ? 2.294   23.977  22.391  1.00 135.82 ? 17  GLU D O   1 
ATOM   3966  C  CB  . GLU C 2 17  ? 2.186   27.230  22.337  1.00 149.56 ? 17  GLU D CB  1 
ATOM   3967  C  CG  . GLU C 2 17  ? 3.083   28.066  21.435  1.00 157.60 ? 17  GLU D CG  1 
ATOM   3968  C  CD  . GLU C 2 17  ? 3.545   29.354  22.116  1.00 162.46 ? 17  GLU D CD  1 
ATOM   3969  O  OE1 . GLU C 2 17  ? 4.752   29.470  22.431  1.00 163.75 ? 17  GLU D OE1 1 
ATOM   3970  O  OE2 . GLU C 2 17  ? 2.697   30.245  22.354  1.00 153.79 ? 17  GLU D OE2 1 
ATOM   3971  N  N   . LYS C 2 18  ? 2.909   24.737  20.368  1.00 132.19 ? 18  LYS D N   1 
ATOM   3972  C  CA  . LYS C 2 18  ? 3.877   23.678  20.137  1.00 119.30 ? 18  LYS D CA  1 
ATOM   3973  C  C   . LYS C 2 18  ? 5.227   24.122  20.677  1.00 116.40 ? 18  LYS D C   1 
ATOM   3974  O  O   . LYS C 2 18  ? 5.615   25.272  20.511  1.00 130.41 ? 18  LYS D O   1 
ATOM   3975  C  CB  . LYS C 2 18  ? 3.983   23.404  18.642  1.00 121.60 ? 18  LYS D CB  1 
ATOM   3976  C  CG  . LYS C 2 18  ? 5.254   22.687  18.217  1.00 120.67 ? 18  LYS D CG  1 
ATOM   3977  C  CD  . LYS C 2 18  ? 5.742   23.221  16.880  1.00 128.52 ? 18  LYS D CD  1 
ATOM   3978  C  CE  . LYS C 2 18  ? 6.655   22.229  16.188  1.00 127.83 ? 18  LYS D CE  1 
ATOM   3979  N  NZ  . LYS C 2 18  ? 5.881   21.371  15.254  1.00 132.67 ? 18  LYS D NZ  1 
ATOM   3980  N  N   . VAL C 2 19  ? 5.947   23.205  21.311  1.00 112.38 ? 19  VAL D N   1 
ATOM   3981  C  CA  . VAL C 2 19  ? 7.223   23.520  21.937  1.00 108.86 ? 19  VAL D CA  1 
ATOM   3982  C  C   . VAL C 2 19  ? 8.310   22.567  21.446  1.00 107.58 ? 19  VAL D C   1 
ATOM   3983  O  O   . VAL C 2 19  ? 8.090   21.360  21.353  1.00 105.46 ? 19  VAL D O   1 
ATOM   3984  C  CB  . VAL C 2 19  ? 7.119   23.398  23.469  1.00 108.68 ? 19  VAL D CB  1 
ATOM   3985  C  CG1 . VAL C 2 19  ? 8.469   23.647  24.130  1.00 107.63 ? 19  VAL D CG1 1 
ATOM   3986  C  CG2 . VAL C 2 19  ? 6.061   24.352  24.005  1.00 110.84 ? 19  VAL D CG2 1 
ATOM   3987  N  N   . THR C 2 20  ? 9.485   23.112  21.146  1.00 104.89 ? 20  THR D N   1 
ATOM   3988  C  CA  . THR C 2 20  ? 10.623  22.308  20.711  1.00 99.40  ? 20  THR D CA  1 
ATOM   3989  C  C   . THR C 2 20  ? 11.894  22.744  21.423  1.00 97.90  ? 20  THR D C   1 
ATOM   3990  O  O   . THR C 2 20  ? 12.310  23.892  21.293  1.00 105.46 ? 20  THR D O   1 
ATOM   3991  C  CB  . THR C 2 20  ? 10.866  22.475  19.203  1.00 102.67 ? 20  THR D CB  1 
ATOM   3992  O  OG1 . THR C 2 20  ? 9.720   22.018  18.479  1.00 110.62 ? 20  THR D OG1 1 
ATOM   3993  C  CG2 . THR C 2 20  ? 12.087  21.683  18.769  1.00 106.37 ? 20  THR D CG2 1 
ATOM   3994  N  N   . MET C 2 21  ? 12.529  21.835  22.159  1.00 95.37  ? 21  MET D N   1 
ATOM   3995  C  CA  . MET C 2 21  ? 13.853  22.125  22.721  1.00 100.02 ? 21  MET D CA  1 
ATOM   3996  C  C   . MET C 2 21  ? 14.905  21.201  22.146  1.00 96.22  ? 21  MET D C   1 
ATOM   3997  O  O   . MET C 2 21  ? 14.637  20.043  21.859  1.00 103.85 ? 21  MET D O   1 
ATOM   3998  C  CB  . MET C 2 21  ? 13.873  22.051  24.251  1.00 98.54  ? 21  MET D CB  1 
ATOM   3999  C  CG  . MET C 2 21  ? 12.811  21.165  24.857  1.00 102.21 ? 21  MET D CG  1 
ATOM   4000  S  SD  . MET C 2 21  ? 12.203  21.867  26.395  1.00 109.75 ? 21  MET D SD  1 
ATOM   4001  C  CE  . MET C 2 21  ? 10.642  20.999  26.538  1.00 126.15 ? 21  MET D CE  1 
ATOM   4002  N  N   . THR C 2 22  ? 16.109  21.730  21.988  1.00 94.52  ? 22  THR D N   1 
ATOM   4003  C  CA  . THR C 2 22  ? 17.156  21.038  21.268  1.00 95.60  ? 22  THR D CA  1 
ATOM   4004  C  C   . THR C 2 22  ? 18.326  20.721  22.187  1.00 98.70  ? 22  THR D C   1 
ATOM   4005  O  O   . THR C 2 22  ? 18.515  21.367  23.221  1.00 98.28  ? 22  THR D O   1 
ATOM   4006  C  CB  . THR C 2 22  ? 17.667  21.880  20.091  1.00 96.57  ? 22  THR D CB  1 
ATOM   4007  O  OG1 . THR C 2 22  ? 18.217  23.108  20.589  1.00 102.67 ? 22  THR D OG1 1 
ATOM   4008  C  CG2 . THR C 2 22  ? 16.540  22.173  19.117  1.00 95.07  ? 22  THR D CG2 1 
ATOM   4009  N  N   . CYS C 2 23  ? 19.103  19.717  21.787  1.00 101.30 ? 23  CYS D N   1 
ATOM   4010  C  CA  . CYS C 2 23  ? 20.283  19.277  22.516  1.00 98.02  ? 23  CYS D CA  1 
ATOM   4011  C  C   . CYS C 2 23  ? 21.333  18.942  21.475  1.00 98.64  ? 23  CYS D C   1 
ATOM   4012  O  O   . CYS C 2 23  ? 21.152  18.044  20.653  1.00 98.20  ? 23  CYS D O   1 
ATOM   4013  C  CB  . CYS C 2 23  ? 19.966  18.047  23.375  1.00 94.14  ? 23  CYS D CB  1 
ATOM   4014  S  SG  . CYS C 2 23  ? 21.359  17.392  24.336  1.00 101.08 ? 23  CYS D SG  1 
ATOM   4015  N  N   . SER C 2 24  ? 22.404  19.718  21.471  1.00 102.56 ? 24  SER D N   1 
ATOM   4016  C  CA  . SER C 2 24  ? 23.457  19.550  20.502  1.00 104.28 ? 24  SER D CA  1 
ATOM   4017  C  C   . SER C 2 24  ? 24.686  18.968  21.200  1.00 104.90 ? 24  SER D C   1 
ATOM   4018  O  O   . SER C 2 24  ? 25.033  19.379  22.310  1.00 122.46 ? 24  SER D O   1 
ATOM   4019  C  CB  . SER C 2 24  ? 23.769  20.906  19.886  1.00 106.50 ? 24  SER D CB  1 
ATOM   4020  O  OG  . SER C 2 24  ? 24.935  20.846  19.106  1.00 119.79 ? 24  SER D OG  1 
ATOM   4021  N  N   . ALA C 2 25  ? 25.334  18.000  20.557  1.00 96.14  ? 25  ALA D N   1 
ATOM   4022  C  CA  . ALA C 2 25  ? 26.433  17.267  21.182  1.00 92.00  ? 25  ALA D CA  1 
ATOM   4023  C  C   . ALA C 2 25  ? 27.778  17.634  20.587  1.00 95.01  ? 25  ALA D C   1 
ATOM   4024  O  O   . ALA C 2 25  ? 27.907  17.739  19.377  1.00 99.54  ? 25  ALA D O   1 
ATOM   4025  C  CB  . ALA C 2 25  ? 26.203  15.782  21.029  1.00 94.34  ? 25  ALA D CB  1 
ATOM   4026  N  N   . SER C 2 26  ? 28.794  17.770  21.435  1.00 98.29  ? 26  SER D N   1 
ATOM   4027  C  CA  . SER C 2 26  ? 30.123  18.192  20.984  1.00 104.87 ? 26  SER D CA  1 
ATOM   4028  C  C   . SER C 2 26  ? 30.678  17.241  19.934  1.00 106.40 ? 26  SER D C   1 
ATOM   4029  O  O   . SER C 2 26  ? 31.496  17.623  19.108  1.00 107.91 ? 26  SER D O   1 
ATOM   4030  C  CB  . SER C 2 26  ? 31.096  18.281  22.164  1.00 105.04 ? 26  SER D CB  1 
ATOM   4031  O  OG  . SER C 2 26  ? 31.565  17.002  22.547  1.00 102.87 ? 26  SER D OG  1 
ATOM   4032  N  N   . SER C 2 27  ? 30.253  15.987  20.000  1.00 111.63 ? 27  SER D N   1 
ATOM   4033  C  CA  . SER C 2 27  ? 30.533  15.025  18.944  1.00 116.75 ? 27  SER D CA  1 
ATOM   4034  C  C   . SER C 2 27  ? 29.454  13.940  18.946  1.00 113.65 ? 27  SER D C   1 
ATOM   4035  O  O   . SER C 2 27  ? 28.712  13.797  19.913  1.00 106.79 ? 27  SER D O   1 
ATOM   4036  C  CB  . SER C 2 27  ? 31.922  14.420  19.130  1.00 118.39 ? 27  SER D CB  1 
ATOM   4037  O  OG  . SER C 2 27  ? 31.990  13.683  20.335  1.00 114.27 ? 27  SER D OG  1 
ATOM   4038  N  N   . SER C 2 28  ? 29.373  13.178  17.862  1.00 112.97 ? 28  SER D N   1 
ATOM   4039  C  CA  . SER C 2 28  ? 28.178  12.386  17.589  1.00 103.40 ? 28  SER D CA  1 
ATOM   4040  C  C   . SER C 2 28  ? 27.932  11.337  18.670  1.00 97.96  ? 28  SER D C   1 
ATOM   4041  O  O   . SER C 2 28  ? 28.868  10.822  19.280  1.00 96.31  ? 28  SER D O   1 
ATOM   4042  C  CB  . SER C 2 28  ? 28.255  11.720  16.218  1.00 106.35 ? 28  SER D CB  1 
ATOM   4043  O  OG  . SER C 2 28  ? 28.946  10.500  16.311  1.00 116.18 ? 28  SER D OG  1 
ATOM   4044  N  N   . VAL C 2 29  ? 26.653  11.073  18.920  1.00 98.38  ? 29  VAL D N   1 
ATOM   4045  C  CA  . VAL C 2 29  ? 26.198  10.018  19.818  1.00 94.18  ? 29  VAL D CA  1 
ATOM   4046  C  C   . VAL C 2 29  ? 25.064  9.279   19.112  1.00 99.05  ? 29  VAL D C   1 
ATOM   4047  O  O   . VAL C 2 29  ? 24.447  9.808   18.185  1.00 98.85  ? 29  VAL D O   1 
ATOM   4048  C  CB  . VAL C 2 29  ? 25.657  10.581  21.151  1.00 84.52  ? 29  VAL D CB  1 
ATOM   4049  C  CG1 . VAL C 2 29  ? 26.729  11.360  21.897  1.00 82.41  ? 29  VAL D CG1 1 
ATOM   4050  C  CG2 . VAL C 2 29  ? 24.437  11.455  20.908  1.00 84.15  ? 29  VAL D CG2 1 
ATOM   4051  N  N   . SER C 2 30  ? 24.783  8.063   19.559  1.00 103.22 ? 30  SER D N   1 
ATOM   4052  C  CA  . SER C 2 30  ? 23.837  7.201   18.865  1.00 95.12  ? 30  SER D CA  1 
ATOM   4053  C  C   . SER C 2 30  ? 22.442  7.363   19.423  1.00 86.52  ? 30  SER D C   1 
ATOM   4054  O  O   . SER C 2 30  ? 21.460  7.068   18.751  1.00 89.44  ? 30  SER D O   1 
ATOM   4055  C  CB  . SER C 2 30  ? 24.271  5.748   18.992  1.00 98.36  ? 30  SER D CB  1 
ATOM   4056  O  OG  . SER C 2 30  ? 25.683  5.641   19.000  1.00 109.18 ? 30  SER D OG  1 
ATOM   4057  N  N   . TYR C 2 31  ? 22.356  7.825   20.660  1.00 82.11  ? 31  TYR D N   1 
ATOM   4058  C  CA  . TYR C 2 31  ? 21.074  7.956   21.329  1.00 84.91  ? 31  TYR D CA  1 
ATOM   4059  C  C   . TYR C 2 31  ? 21.098  9.156   22.250  1.00 86.66  ? 31  TYR D C   1 
ATOM   4060  O  O   . TYR C 2 31  ? 22.141  9.486   22.815  1.00 92.48  ? 31  TYR D O   1 
ATOM   4061  C  CB  . TYR C 2 31  ? 20.786  6.714   22.174  1.00 86.97  ? 31  TYR D CB  1 
ATOM   4062  C  CG  . TYR C 2 31  ? 20.612  5.434   21.394  1.00 82.53  ? 31  TYR D CG  1 
ATOM   4063  C  CD1 . TYR C 2 31  ? 19.439  5.183   20.700  1.00 84.55  ? 31  TYR D CD1 1 
ATOM   4064  C  CD2 . TYR C 2 31  ? 21.603  4.462   21.384  1.00 78.64  ? 31  TYR D CD2 1 
ATOM   4065  C  CE1 . TYR C 2 31  ? 19.274  4.019   19.985  1.00 89.80  ? 31  TYR D CE1 1 
ATOM   4066  C  CE2 . TYR C 2 31  ? 21.440  3.287   20.684  1.00 79.12  ? 31  TYR D CE2 1 
ATOM   4067  C  CZ  . TYR C 2 31  ? 20.275  3.079   19.981  1.00 85.49  ? 31  TYR D CZ  1 
ATOM   4068  O  OH  . TYR C 2 31  ? 20.081  1.922   19.279  1.00 95.53  ? 31  TYR D OH  1 
ATOM   4069  N  N   . MET C 2 32  ? 19.946  9.792   22.426  1.00 86.23  ? 32  MET D N   1 
ATOM   4070  C  CA  . MET C 2 32  ? 19.832  10.853  23.409  1.00 87.34  ? 32  MET D CA  1 
ATOM   4071  C  C   . MET C 2 32  ? 18.693  10.526  24.358  1.00 81.11  ? 32  MET D C   1 
ATOM   4072  O  O   . MET C 2 32  ? 17.687  9.968   23.934  1.00 83.75  ? 32  MET D O   1 
ATOM   4073  C  CB  . MET C 2 32  ? 19.576  12.188  22.715  1.00 91.87  ? 32  MET D CB  1 
ATOM   4074  C  CG  . MET C 2 32  ? 19.712  13.379  23.646  1.00 98.58  ? 32  MET D CG  1 
ATOM   4075  S  SD  . MET C 2 32  ? 21.382  13.522  24.316  1.00 93.57  ? 32  MET D SD  1 
ATOM   4076  C  CE  . MET C 2 32  ? 22.235  14.153  22.874  1.00 93.70  ? 32  MET D CE  1 
ATOM   4077  N  N   . HIS C 2 33  ? 18.861  10.846  25.638  1.00 74.52  ? 33  HIS D N   1 
ATOM   4078  C  CA  . HIS C 2 33  ? 17.787  10.657  26.612  1.00 76.28  ? 33  HIS D CA  1 
ATOM   4079  C  C   . HIS C 2 33  ? 17.391  11.989  27.214  1.00 76.88  ? 33  HIS D C   1 
ATOM   4080  O  O   . HIS C 2 33  ? 18.187  12.927  27.228  1.00 88.08  ? 33  HIS D O   1 
ATOM   4081  C  CB  . HIS C 2 33  ? 18.220  9.695   27.723  1.00 74.53  ? 33  HIS D CB  1 
ATOM   4082  C  CG  . HIS C 2 33  ? 18.969  8.501   27.221  1.00 74.40  ? 33  HIS D CG  1 
ATOM   4083  N  ND1 . HIS C 2 33  ? 18.433  7.616   26.309  1.00 74.64  ? 33  HIS D ND1 1 
ATOM   4084  C  CD2 . HIS C 2 33  ? 20.216  8.054   27.490  1.00 70.25  ? 33  HIS D CD2 1 
ATOM   4085  C  CE1 . HIS C 2 33  ? 19.319  6.675   26.038  1.00 74.62  ? 33  HIS D CE1 1 
ATOM   4086  N  NE2 . HIS C 2 33  ? 20.408  6.914   26.746  1.00 73.64  ? 33  HIS D NE2 1 
ATOM   4087  N  N   . TRP C 2 34  ? 16.171  12.059  27.734  1.00 67.65  ? 34  TRP D N   1 
ATOM   4088  C  CA  . TRP C 2 34  ? 15.675  13.283  28.332  1.00 65.71  ? 34  TRP D CA  1 
ATOM   4089  C  C   . TRP C 2 34  ? 14.994  13.062  29.669  1.00 67.63  ? 34  TRP D C   1 
ATOM   4090  O  O   . TRP C 2 34  ? 14.219  12.127  29.820  1.00 72.91  ? 34  TRP D O   1 
ATOM   4091  C  CB  . TRP C 2 34  ? 14.667  13.907  27.405  1.00 67.93  ? 34  TRP D CB  1 
ATOM   4092  C  CG  . TRP C 2 34  ? 15.190  14.267  26.074  1.00 67.51  ? 34  TRP D CG  1 
ATOM   4093  C  CD1 . TRP C 2 34  ? 15.250  13.469  24.980  1.00 68.17  ? 34  TRP D CD1 1 
ATOM   4094  C  CD2 . TRP C 2 34  ? 15.612  15.561  25.653  1.00 70.63  ? 34  TRP D CD2 1 
ATOM   4095  N  NE1 . TRP C 2 34  ? 15.701  14.181  23.898  1.00 71.30  ? 34  TRP D NE1 1 
ATOM   4096  C  CE2 . TRP C 2 34  ? 15.933  15.472  24.288  1.00 74.37  ? 34  TRP D CE2 1 
ATOM   4097  C  CE3 . TRP C 2 34  ? 15.749  16.789  26.297  1.00 73.81  ? 34  TRP D CE3 1 
ATOM   4098  C  CZ2 . TRP C 2 34  ? 16.403  16.553  23.564  1.00 78.04  ? 34  TRP D CZ2 1 
ATOM   4099  C  CZ3 . TRP C 2 34  ? 16.213  17.852  25.581  1.00 80.83  ? 34  TRP D CZ3 1 
ATOM   4100  C  CH2 . TRP C 2 34  ? 16.537  17.732  24.225  1.00 78.42  ? 34  TRP D CH2 1 
ATOM   4101  N  N   . TYR C 2 35  ? 15.224  13.970  30.612  1.00 70.90  ? 35  TYR D N   1 
ATOM   4102  C  CA  . TYR C 2 35  ? 14.541  13.927  31.905  1.00 77.04  ? 35  TYR D CA  1 
ATOM   4103  C  C   . TYR C 2 35  ? 13.685  15.171  32.149  1.00 74.85  ? 35  TYR D C   1 
ATOM   4104  O  O   . TYR C 2 35  ? 13.992  16.249  31.654  1.00 78.89  ? 35  TYR D O   1 
ATOM   4105  C  CB  . TYR C 2 35  ? 15.559  13.768  33.034  1.00 79.20  ? 35  TYR D CB  1 
ATOM   4106  C  CG  . TYR C 2 35  ? 16.476  12.599  32.820  1.00 67.08  ? 35  TYR D CG  1 
ATOM   4107  C  CD1 . TYR C 2 35  ? 16.226  11.379  33.404  1.00 69.32  ? 35  TYR D CD1 1 
ATOM   4108  C  CD2 . TYR C 2 35  ? 17.555  12.713  32.001  1.00 63.55  ? 35  TYR D CD2 1 
ATOM   4109  C  CE1 . TYR C 2 35  ? 17.060  10.301  33.193  1.00 70.49  ? 35  TYR D CE1 1 
ATOM   4110  C  CE2 . TYR C 2 35  ? 18.390  11.651  31.780  1.00 74.14  ? 35  TYR D CE2 1 
ATOM   4111  C  CZ  . TYR C 2 35  ? 18.147  10.445  32.377  1.00 68.59  ? 35  TYR D CZ  1 
ATOM   4112  O  OH  . TYR C 2 35  ? 19.004  9.399   32.125  1.00 57.85  ? 35  TYR D OH  1 
ATOM   4113  N  N   . GLN C 2 36  ? 12.598  14.997  32.894  1.00 70.18  ? 36  GLN D N   1 
ATOM   4114  C  CA  . GLN C 2 36  ? 11.763  16.108  33.320  1.00 66.38  ? 36  GLN D CA  1 
ATOM   4115  C  C   . GLN C 2 36  ? 11.875  16.318  34.817  1.00 66.06  ? 36  GLN D C   1 
ATOM   4116  O  O   . GLN C 2 36  ? 11.687  15.393  35.589  1.00 64.27  ? 36  GLN D O   1 
ATOM   4117  C  CB  . GLN C 2 36  ? 10.305  15.829  32.987  1.00 72.96  ? 36  GLN D CB  1 
ATOM   4118  C  CG  . GLN C 2 36  ? 9.386   16.951  33.429  1.00 77.66  ? 36  GLN D CG  1 
ATOM   4119  C  CD  . GLN C 2 36  ? 7.944   16.530  33.523  1.00 80.64  ? 36  GLN D CD  1 
ATOM   4120  O  OE1 . GLN C 2 36  ? 7.554   15.823  34.455  1.00 84.64  ? 36  GLN D OE1 1 
ATOM   4121  N  NE2 . GLN C 2 36  ? 7.133   16.983  32.572  1.00 86.56  ? 36  GLN D NE2 1 
ATOM   4122  N  N   . GLN C 2 37  ? 12.141  17.549  35.233  1.00 72.42  ? 37  GLN D N   1 
ATOM   4123  C  CA  . GLN C 2 37  ? 12.244  17.862  36.657  1.00 72.91  ? 37  GLN D CA  1 
ATOM   4124  C  C   . GLN C 2 37  ? 11.404  19.058  37.051  1.00 73.67  ? 37  GLN D C   1 
ATOM   4125  O  O   . GLN C 2 37  ? 11.460  20.105  36.411  1.00 78.72  ? 37  GLN D O   1 
ATOM   4126  C  CB  . GLN C 2 37  ? 13.686  18.161  37.032  1.00 77.09  ? 37  GLN D CB  1 
ATOM   4127  C  CG  . GLN C 2 37  ? 13.899  18.349  38.523  1.00 73.11  ? 37  GLN D CG  1 
ATOM   4128  C  CD  . GLN C 2 37  ? 15.369  18.365  38.878  1.00 73.20  ? 37  GLN D CD  1 
ATOM   4129  O  OE1 . GLN C 2 37  ? 16.206  18.827  38.096  1.00 76.07  ? 37  GLN D OE1 1 
ATOM   4130  N  NE2 . GLN C 2 37  ? 15.696  17.846  40.051  1.00 73.25  ? 37  GLN D NE2 1 
ATOM   4131  N  N   . LYS C 2 38  ? 10.643  18.898  38.124  1.00 75.96  ? 38  LYS D N   1 
ATOM   4132  C  CA  . LYS C 2 38  ? 9.857   19.987  38.686  1.00 79.78  ? 38  LYS D CA  1 
ATOM   4133  C  C   . LYS C 2 38  ? 10.445  20.359  40.041  1.00 80.32  ? 38  LYS D C   1 
ATOM   4134  O  O   . LYS C 2 38  ? 10.888  19.496  40.786  1.00 80.25  ? 38  LYS D O   1 
ATOM   4135  C  CB  . LYS C 2 38  ? 8.389   19.565  38.822  1.00 79.56  ? 38  LYS D CB  1 
ATOM   4136  C  CG  . LYS C 2 38  ? 7.710   19.319  37.480  1.00 80.96  ? 38  LYS D CG  1 
ATOM   4137  C  CD  . LYS C 2 38  ? 6.242   18.965  37.645  1.00 88.12  ? 38  LYS D CD  1 
ATOM   4138  C  CE  . LYS C 2 38  ? 5.526   18.842  36.306  1.00 92.90  ? 38  LYS D CE  1 
ATOM   4139  N  NZ  . LYS C 2 38  ? 4.045   18.905  36.481  1.00 107.69 ? 38  LYS D NZ  1 
ATOM   4140  N  N   . SER C 2 39  ? 10.487  21.644  40.353  1.00 88.42  ? 39  SER D N   1 
ATOM   4141  C  CA  . SER C 2 39  ? 11.075  22.065  41.608  1.00 96.97  ? 39  SER D CA  1 
ATOM   4142  C  C   . SER C 2 39  ? 10.532  21.231  42.756  1.00 92.27  ? 39  SER D C   1 
ATOM   4143  O  O   . SER C 2 39  ? 9.331   21.031  42.882  1.00 93.15  ? 39  SER D O   1 
ATOM   4144  C  CB  . SER C 2 39  ? 10.820  23.551  41.868  1.00 112.43 ? 39  SER D CB  1 
ATOM   4145  O  OG  . SER C 2 39  ? 11.858  24.334  41.304  1.00 129.17 ? 39  SER D OG  1 
ATOM   4146  N  N   . GLY C 2 40  ? 11.443  20.731  43.579  1.00 93.06  ? 40  GLY D N   1 
ATOM   4147  C  CA  . GLY C 2 40  ? 11.080  20.066  44.814  1.00 94.51  ? 40  GLY D CA  1 
ATOM   4148  C  C   . GLY C 2 40  ? 11.366  18.586  44.732  1.00 90.80  ? 40  GLY D C   1 
ATOM   4149  O  O   . GLY C 2 40  ? 11.423  17.903  45.753  1.00 95.56  ? 40  GLY D O   1 
ATOM   4150  N  N   . THR C 2 41  ? 11.567  18.091  43.516  1.00 83.88  ? 41  THR D N   1 
ATOM   4151  C  CA  . THR C 2 41  ? 11.576  16.658  43.290  1.00 81.91  ? 41  THR D CA  1 
ATOM   4152  C  C   . THR C 2 41  ? 12.656  16.211  42.308  1.00 77.90  ? 41  THR D C   1 
ATOM   4153  O  O   . THR C 2 41  ? 13.161  17.011  41.529  1.00 81.11  ? 41  THR D O   1 
ATOM   4154  C  CB  . THR C 2 41  ? 10.198  16.194  42.783  1.00 82.32  ? 41  THR D CB  1 
ATOM   4155  O  OG1 . THR C 2 41  ? 9.846   16.926  41.608  1.00 80.49  ? 41  THR D OG1 1 
ATOM   4156  C  CG2 . THR C 2 41  ? 9.124   16.418  43.851  1.00 80.12  ? 41  THR D CG2 1 
ATOM   4157  N  N   . SER C 2 42  ? 12.986  14.921  42.346  1.00 79.48  ? 42  SER D N   1 
ATOM   4158  C  CA  . SER C 2 42  ? 14.035  14.343  41.496  1.00 75.71  ? 42  SER D CA  1 
ATOM   4159  C  C   . SER C 2 42  ? 13.628  14.315  40.027  1.00 70.14  ? 42  SER D C   1 
ATOM   4160  O  O   . SER C 2 42  ? 12.447  14.398  39.709  1.00 81.53  ? 42  SER D O   1 
ATOM   4161  C  CB  . SER C 2 42  ? 14.341  12.909  41.928  1.00 78.49  ? 42  SER D CB  1 
ATOM   4162  O  OG  . SER C 2 42  ? 14.141  12.730  43.320  1.00 92.88  ? 42  SER D OG  1 
ATOM   4163  N  N   . PRO C 2 43  ? 14.609  14.191  39.127  1.00 65.46  ? 43  PRO D N   1 
ATOM   4164  C  CA  . PRO C 2 43  ? 14.321  14.073  37.697  1.00 66.37  ? 43  PRO D CA  1 
ATOM   4165  C  C   . PRO C 2 43  ? 13.609  12.772  37.372  1.00 66.91  ? 43  PRO D C   1 
ATOM   4166  O  O   . PRO C 2 43  ? 13.700  11.808  38.120  1.00 67.19  ? 43  PRO D O   1 
ATOM   4167  C  CB  . PRO C 2 43  ? 15.704  14.071  37.050  1.00 65.64  ? 43  PRO D CB  1 
ATOM   4168  C  CG  . PRO C 2 43  ? 16.602  14.704  38.051  1.00 68.17  ? 43  PRO D CG  1 
ATOM   4169  C  CD  . PRO C 2 43  ? 16.046  14.341  39.394  1.00 68.99  ? 43  PRO D CD  1 
ATOM   4170  N  N   . LYS C 2 44  ? 12.864  12.770  36.280  1.00 68.51  ? 44  LYS D N   1 
ATOM   4171  C  CA  . LYS C 2 44  ? 12.149  11.582  35.850  1.00 74.57  ? 44  LYS D CA  1 
ATOM   4172  C  C   . LYS C 2 44  ? 12.597  11.253  34.457  1.00 71.45  ? 44  LYS D C   1 
ATOM   4173  O  O   . LYS C 2 44  ? 12.618  12.124  33.594  1.00 68.31  ? 44  LYS D O   1 
ATOM   4174  C  CB  . LYS C 2 44  ? 10.632  11.832  35.809  1.00 82.94  ? 44  LYS D CB  1 
ATOM   4175  C  CG  . LYS C 2 44  ? 9.974   12.028  37.163  1.00 84.92  ? 44  LYS D CG  1 
ATOM   4176  C  CD  . LYS C 2 44  ? 8.462   12.000  37.043  1.00 90.56  ? 44  LYS D CD  1 
ATOM   4177  C  CE  . LYS C 2 44  ? 7.806   11.820  38.403  1.00 99.54  ? 44  LYS D CE  1 
ATOM   4178  N  NZ  . LYS C 2 44  ? 7.759   13.102  39.159  1.00 111.77 ? 44  LYS D NZ  1 
ATOM   4179  N  N   . ARG C 2 45  ? 12.886  9.988   34.203  1.00 72.13  ? 45  ARG D N   1 
ATOM   4180  C  CA  . ARG C 2 45  ? 13.137  9.592   32.838  1.00 73.30  ? 45  ARG D CA  1 
ATOM   4181  C  C   . ARG C 2 45  ? 11.909  9.929   32.051  1.00 65.85  ? 45  ARG D C   1 
ATOM   4182  O  O   . ARG C 2 45  ? 10.823  9.531   32.425  1.00 67.05  ? 45  ARG D O   1 
ATOM   4183  C  CB  . ARG C 2 45  ? 13.396  8.103   32.719  1.00 79.15  ? 45  ARG D CB  1 
ATOM   4184  C  CG  . ARG C 2 45  ? 13.756  7.723   31.297  1.00 80.96  ? 45  ARG D CG  1 
ATOM   4185  C  CD  . ARG C 2 45  ? 14.045  6.250   31.185  1.00 83.97  ? 45  ARG D CD  1 
ATOM   4186  N  NE  . ARG C 2 45  ? 12.891  5.459   31.577  1.00 79.18  ? 45  ARG D NE  1 
ATOM   4187  C  CZ  . ARG C 2 45  ? 12.760  4.173   31.294  1.00 84.04  ? 45  ARG D CZ  1 
ATOM   4188  N  NH1 . ARG C 2 45  ? 13.703  3.539   30.603  1.00 82.06  ? 45  ARG D NH1 1 
ATOM   4189  N  NH2 . ARG C 2 45  ? 11.681  3.529   31.697  1.00 97.20  ? 45  ARG D NH2 1 
ATOM   4190  N  N   . TRP C 2 46  ? 12.074  10.697  30.986  1.00 65.45  ? 46  TRP D N   1 
ATOM   4191  C  CA  . TRP C 2 46  ? 10.933  11.169  30.227  1.00 69.84  ? 46  TRP D CA  1 
ATOM   4192  C  C   . TRP C 2 46  ? 10.953  10.536  28.856  1.00 65.29  ? 46  TRP D C   1 
ATOM   4193  O  O   . TRP C 2 46  ? 10.033  9.816   28.484  1.00 67.88  ? 46  TRP D O   1 
ATOM   4194  C  CB  . TRP C 2 46  ? 10.929  12.704  30.118  1.00 72.49  ? 46  TRP D CB  1 
ATOM   4195  C  CG  . TRP C 2 46  ? 9.543   13.268  30.050  1.00 69.33  ? 46  TRP D CG  1 
ATOM   4196  C  CD1 . TRP C 2 46  ? 8.965   13.927  29.004  1.00 69.93  ? 46  TRP D CD1 1 
ATOM   4197  C  CD2 . TRP C 2 46  ? 8.548   13.166  31.056  1.00 70.40  ? 46  TRP D CD2 1 
ATOM   4198  N  NE1 . TRP C 2 46  ? 7.672   14.258  29.309  1.00 70.31  ? 46  TRP D NE1 1 
ATOM   4199  C  CE2 . TRP C 2 46  ? 7.393   13.802  30.568  1.00 71.14  ? 46  TRP D CE2 1 
ATOM   4200  C  CE3 . TRP C 2 46  ? 8.523   12.602  32.334  1.00 72.77  ? 46  TRP D CE3 1 
ATOM   4201  C  CZ2 . TRP C 2 46  ? 6.227   13.890  31.309  1.00 78.18  ? 46  TRP D CZ2 1 
ATOM   4202  C  CZ3 . TRP C 2 46  ? 7.363   12.691  33.072  1.00 76.00  ? 46  TRP D CZ3 1 
ATOM   4203  C  CH2 . TRP C 2 46  ? 6.230   13.331  32.559  1.00 80.65  ? 46  TRP D CH2 1 
ATOM   4204  N  N   . ILE C 2 47  ? 11.996  10.820  28.096  1.00 63.59  ? 47  ILE D N   1 
ATOM   4205  C  CA  . ILE C 2 47  ? 12.204  10.114  26.854  1.00 72.99  ? 47  ILE D CA  1 
ATOM   4206  C  C   . ILE C 2 47  ? 13.584  9.479   26.845  1.00 77.38  ? 47  ILE D C   1 
ATOM   4207  O  O   . ILE C 2 47  ? 14.562  10.100  27.267  1.00 82.33  ? 47  ILE D O   1 
ATOM   4208  C  CB  . ILE C 2 47  ? 12.083  11.045  25.652  1.00 74.77  ? 47  ILE D CB  1 
ATOM   4209  C  CG1 . ILE C 2 47  ? 10.632  11.434  25.446  1.00 84.80  ? 47  ILE D CG1 1 
ATOM   4210  C  CG2 . ILE C 2 47  ? 12.611  10.358  24.403  1.00 74.39  ? 47  ILE D CG2 1 
ATOM   4211  C  CD1 . ILE C 2 47  ? 10.453  12.505  24.391  1.00 101.03 ? 47  ILE D CD1 1 
ATOM   4212  N  N   . TYR C 2 48  ? 13.663  8.242   26.361  1.00 75.50  ? 48  TYR D N   1 
ATOM   4213  C  CA  . TYR C 2 48  ? 14.939  7.551   26.284  1.00 75.84  ? 48  TYR D CA  1 
ATOM   4214  C  C   . TYR C 2 48  ? 15.116  6.899   24.923  1.00 74.57  ? 48  TYR D C   1 
ATOM   4215  O  O   . TYR C 2 48  ? 14.154  6.723   24.179  1.00 75.05  ? 48  TYR D O   1 
ATOM   4216  C  CB  . TYR C 2 48  ? 15.056  6.512   27.398  1.00 73.45  ? 48  TYR D CB  1 
ATOM   4217  C  CG  . TYR C 2 48  ? 14.079  5.362   27.273  1.00 73.50  ? 48  TYR D CG  1 
ATOM   4218  C  CD1 . TYR C 2 48  ? 12.773  5.497   27.684  1.00 73.32  ? 48  TYR D CD1 1 
ATOM   4219  C  CD2 . TYR C 2 48  ? 14.479  4.138   26.765  1.00 73.37  ? 48  TYR D CD2 1 
ATOM   4220  C  CE1 . TYR C 2 48  ? 11.892  4.444   27.598  1.00 79.86  ? 48  TYR D CE1 1 
ATOM   4221  C  CE2 . TYR C 2 48  ? 13.607  3.080   26.673  1.00 73.91  ? 48  TYR D CE2 1 
ATOM   4222  C  CZ  . TYR C 2 48  ? 12.314  3.239   27.091  1.00 79.42  ? 48  TYR D CZ  1 
ATOM   4223  O  OH  . TYR C 2 48  ? 11.433  2.188   26.996  1.00 90.05  ? 48  TYR D OH  1 
ATOM   4224  N  N   . ASP C 2 49  ? 16.343  6.476   24.646  1.00 72.64  ? 49  ASP D N   1 
ATOM   4225  C  CA  . ASP C 2 49  ? 16.749  6.078   23.310  1.00 78.87  ? 49  ASP D CA  1 
ATOM   4226  C  C   . ASP C 2 49  ? 16.118  6.994   22.269  1.00 73.67  ? 49  ASP D C   1 
ATOM   4227  O  O   . ASP C 2 49  ? 15.435  6.538   21.357  1.00 74.51  ? 49  ASP D O   1 
ATOM   4228  C  CB  . ASP C 2 49  ? 16.416  4.592   23.041  1.00 86.33  ? 49  ASP D CB  1 
ATOM   4229  C  CG  . ASP C 2 49  ? 17.525  3.633   23.522  1.00 89.09  ? 49  ASP D CG  1 
ATOM   4230  O  OD1 . ASP C 2 49  ? 18.440  4.090   24.251  1.00 87.70  ? 49  ASP D OD1 1 
ATOM   4231  O  OD2 . ASP C 2 49  ? 17.486  2.428   23.158  1.00 82.29  ? 49  ASP D OD2 1 
ATOM   4232  N  N   . THR C 2 50  ? 16.356  8.292   22.427  1.00 73.64  ? 50  THR D N   1 
ATOM   4233  C  CA  . THR C 2 50  ? 16.023  9.289   21.408  1.00 77.58  ? 50  THR D CA  1 
ATOM   4234  C  C   . THR C 2 50  ? 14.524  9.575   21.261  1.00 81.19  ? 50  THR D C   1 
ATOM   4235  O  O   . THR C 2 50  ? 14.109  10.749  21.254  1.00 75.23  ? 50  THR D O   1 
ATOM   4236  C  CB  . THR C 2 50  ? 16.587  8.889   20.042  1.00 80.37  ? 50  THR D CB  1 
ATOM   4237  O  OG1 . THR C 2 50  ? 18.011  8.823   20.132  1.00 82.42  ? 50  THR D OG1 1 
ATOM   4238  C  CG2 . THR C 2 50  ? 16.188  9.902   18.986  1.00 85.01  ? 50  THR D CG2 1 
ATOM   4239  N  N   . SER C 2 51  ? 13.715  8.521   21.133  1.00 75.46  ? 51  SER D N   1 
ATOM   4240  C  CA  . SER C 2 51  ? 12.308  8.710   20.816  1.00 77.18  ? 51  SER D CA  1 
ATOM   4241  C  C   . SER C 2 51  ? 11.338  7.755   21.505  1.00 79.56  ? 51  SER D C   1 
ATOM   4242  O  O   . SER C 2 51  ? 10.159  7.741   21.168  1.00 91.99  ? 51  SER D O   1 
ATOM   4243  C  CB  . SER C 2 51  ? 12.119  8.616   19.310  1.00 76.20  ? 51  SER D CB  1 
ATOM   4244  O  OG  . SER C 2 51  ? 12.502  7.347   18.857  1.00 73.61  ? 51  SER D OG  1 
ATOM   4245  N  N   . LYS C 2 52  ? 11.815  6.983   22.473  1.00 78.56  ? 52  LYS D N   1 
ATOM   4246  C  CA  . LYS C 2 52  ? 10.932  6.126   23.274  1.00 82.66  ? 52  LYS D CA  1 
ATOM   4247  C  C   . LYS C 2 52  ? 10.387  6.868   24.481  1.00 77.96  ? 52  LYS D C   1 
ATOM   4248  O  O   . LYS C 2 52  ? 11.142  7.510   25.218  1.00 86.09  ? 52  LYS D O   1 
ATOM   4249  C  CB  . LYS C 2 52  ? 11.683  4.895   23.774  1.00 90.40  ? 52  LYS D CB  1 
ATOM   4250  C  CG  . LYS C 2 52  ? 11.992  3.883   22.696  1.00 97.37  ? 52  LYS D CG  1 
ATOM   4251  C  CD  . LYS C 2 52  ? 12.638  2.648   23.289  1.00 104.50 ? 52  LYS D CD  1 
ATOM   4252  C  CE  . LYS C 2 52  ? 13.018  1.667   22.191  1.00 125.22 ? 52  LYS D CE  1 
ATOM   4253  N  NZ  . LYS C 2 52  ? 13.870  0.555   22.695  1.00 130.68 ? 52  LYS D NZ  1 
ATOM   4254  N  N   . LEU C 2 53  ? 9.087   6.740   24.706  1.00 75.25  ? 53  LEU D N   1 
ATOM   4255  C  CA  . LEU C 2 53  ? 8.438   7.407   25.829  1.00 78.31  ? 53  LEU D CA  1 
ATOM   4256  C  C   . LEU C 2 53  ? 8.447   6.554   27.088  1.00 71.90  ? 53  LEU D C   1 
ATOM   4257  O  O   . LEU C 2 53  ? 8.064   5.390   27.054  1.00 76.84  ? 53  LEU D O   1 
ATOM   4258  C  CB  . LEU C 2 53  ? 6.991   7.746   25.462  1.00 89.51  ? 53  LEU D CB  1 
ATOM   4259  C  CG  . LEU C 2 53  ? 6.762   9.176   24.967  1.00 94.67  ? 53  LEU D CG  1 
ATOM   4260  C  CD1 . LEU C 2 53  ? 7.614   9.472   23.744  1.00 99.94  ? 53  LEU D CD1 1 
ATOM   4261  C  CD2 . LEU C 2 53  ? 5.293   9.405   24.661  1.00 99.94  ? 53  LEU D CD2 1 
ATOM   4262  N  N   . ALA C 2 54  ? 8.837   7.143   28.211  1.00 68.01  ? 54  ALA D N   1 
ATOM   4263  C  CA  . ALA C 2 54  ? 8.734   6.449   29.487  1.00 74.12  ? 54  ALA D CA  1 
ATOM   4264  C  C   . ALA C 2 54  ? 7.278   6.254   29.861  1.00 82.32  ? 54  ALA D C   1 
ATOM   4265  O  O   . ALA C 2 54  ? 6.395   6.879   29.283  1.00 80.52  ? 54  ALA D O   1 
ATOM   4266  C  CB  . ALA C 2 54  ? 9.462   7.211   30.579  1.00 73.10  ? 54  ALA D CB  1 
ATOM   4267  N  N   . SER C 2 55  ? 7.044   5.397   30.848  1.00 96.62  ? 55  SER D N   1 
ATOM   4268  C  CA  . SER C 2 55  ? 5.711   4.898   31.151  1.00 106.80 ? 55  SER D CA  1 
ATOM   4269  C  C   . SER C 2 55  ? 4.675   6.013   31.311  1.00 112.46 ? 55  SER D C   1 
ATOM   4270  O  O   . SER C 2 55  ? 3.651   6.031   30.621  1.00 116.84 ? 55  SER D O   1 
ATOM   4271  C  CB  . SER C 2 55  ? 5.758   4.035   32.416  1.00 106.68 ? 55  SER D CB  1 
ATOM   4272  O  OG  . SER C 2 55  ? 4.498   3.440   32.679  1.00 126.84 ? 55  SER D OG  1 
ATOM   4273  N  N   . GLY C 2 56  ? 4.938   6.944   32.220  1.00 113.10 ? 56  GLY D N   1 
ATOM   4274  C  CA  . GLY C 2 56  ? 3.929   7.938   32.591  1.00 114.60 ? 56  GLY D CA  1 
ATOM   4275  C  C   . GLY C 2 56  ? 3.618   8.963   31.512  1.00 100.78 ? 56  GLY D C   1 
ATOM   4276  O  O   . GLY C 2 56  ? 2.592   9.625   31.558  1.00 102.91 ? 56  GLY D O   1 
ATOM   4277  N  N   . VAL C 2 57  ? 4.495   9.072   30.525  1.00 90.97  ? 57  VAL D N   1 
ATOM   4278  C  CA  . VAL C 2 57  ? 4.548   10.240  29.665  1.00 85.63  ? 57  VAL D CA  1 
ATOM   4279  C  C   . VAL C 2 57  ? 3.426   10.249  28.655  1.00 83.45  ? 57  VAL D C   1 
ATOM   4280  O  O   . VAL C 2 57  ? 3.239   9.278   27.947  1.00 88.73  ? 57  VAL D O   1 
ATOM   4281  C  CB  . VAL C 2 57  ? 5.863   10.263  28.871  1.00 89.75  ? 57  VAL D CB  1 
ATOM   4282  C  CG1 . VAL C 2 57  ? 5.926   11.494  27.981  1.00 98.33  ? 57  VAL D CG1 1 
ATOM   4283  C  CG2 . VAL C 2 57  ? 7.053   10.212  29.816  1.00 85.31  ? 57  VAL D CG2 1 
ATOM   4284  N  N   . PRO C 2 58  ? 2.699   11.368  28.551  1.00 88.46  ? 58  PRO D N   1 
ATOM   4285  C  CA  . PRO C 2 58  ? 1.631   11.477  27.564  1.00 90.50  ? 58  PRO D CA  1 
ATOM   4286  C  C   . PRO C 2 58  ? 2.156   11.651  26.141  1.00 88.21  ? 58  PRO D C   1 
ATOM   4287  O  O   . PRO C 2 58  ? 3.309   12.032  25.936  1.00 80.09  ? 58  PRO D O   1 
ATOM   4288  C  CB  . PRO C 2 58  ? 0.871   12.723  28.005  1.00 95.15  ? 58  PRO D CB  1 
ATOM   4289  C  CG  . PRO C 2 58  ? 1.906   13.559  28.657  1.00 96.07  ? 58  PRO D CG  1 
ATOM   4290  C  CD  . PRO C 2 58  ? 2.846   12.602  29.341  1.00 92.60  ? 58  PRO D CD  1 
ATOM   4291  N  N   . ALA C 2 59  ? 1.288   11.379  25.175  1.00 91.96  ? 59  ALA D N   1 
ATOM   4292  C  CA  . ALA C 2 59  ? 1.681   11.237  23.783  1.00 90.16  ? 59  ALA D CA  1 
ATOM   4293  C  C   . ALA C 2 59  ? 2.112   12.549  23.152  1.00 93.45  ? 59  ALA D C   1 
ATOM   4294  O  O   . ALA C 2 59  ? 2.808   12.546  22.147  1.00 95.04  ? 59  ALA D O   1 
ATOM   4295  C  CB  . ALA C 2 59  ? 0.539   10.639  22.989  1.00 95.22  ? 59  ALA D CB  1 
ATOM   4296  N  N   . ARG C 2 60  ? 1.682   13.673  23.718  1.00 100.66 ? 60  ARG D N   1 
ATOM   4297  C  CA  . ARG C 2 60  ? 2.000   14.976  23.135  1.00 101.93 ? 60  ARG D CA  1 
ATOM   4298  C  C   . ARG C 2 60  ? 3.511   15.196  23.101  1.00 99.26  ? 60  ARG D C   1 
ATOM   4299  O  O   . ARG C 2 60  ? 4.003   16.014  22.323  1.00 103.54 ? 60  ARG D O   1 
ATOM   4300  C  CB  . ARG C 2 60  ? 1.300   16.111  23.901  1.00 103.45 ? 60  ARG D CB  1 
ATOM   4301  C  CG  . ARG C 2 60  ? 1.834   16.355  25.310  1.00 101.18 ? 60  ARG D CG  1 
ATOM   4302  C  CD  . ARG C 2 60  ? 1.070   17.435  26.068  1.00 100.19 ? 60  ARG D CD  1 
ATOM   4303  N  NE  . ARG C 2 60  ? 0.137   16.838  27.027  1.00 99.43  ? 60  ARG D NE  1 
ATOM   4304  C  CZ  . ARG C 2 60  ? 0.337   16.757  28.341  1.00 95.42  ? 60  ARG D CZ  1 
ATOM   4305  N  NH1 . ARG C 2 60  ? 1.433   17.258  28.890  1.00 90.83  ? 60  ARG D NH1 1 
ATOM   4306  N  NH2 . ARG C 2 60  ? -0.570  16.179  29.116  1.00 99.79  ? 60  ARG D NH2 1 
ATOM   4307  N  N   . PHE C 2 61  ? 4.242   14.456  23.933  1.00 95.47  ? 61  PHE D N   1 
ATOM   4308  C  CA  . PHE C 2 61  ? 5.697   14.497  23.905  1.00 92.67  ? 61  PHE D CA  1 
ATOM   4309  C  C   . PHE C 2 61  ? 6.235   13.567  22.831  1.00 91.14  ? 61  PHE D C   1 
ATOM   4310  O  O   . PHE C 2 61  ? 5.706   12.482  22.615  1.00 101.09 ? 61  PHE D O   1 
ATOM   4311  C  CB  . PHE C 2 61  ? 6.281   14.094  25.262  1.00 89.33  ? 61  PHE D CB  1 
ATOM   4312  C  CG  . PHE C 2 61  ? 6.086   15.123  26.332  1.00 88.80  ? 61  PHE D CG  1 
ATOM   4313  C  CD1 . PHE C 2 61  ? 4.947   15.120  27.110  1.00 89.78  ? 61  PHE D CD1 1 
ATOM   4314  C  CD2 . PHE C 2 61  ? 7.039   16.096  26.551  1.00 86.31  ? 61  PHE D CD2 1 
ATOM   4315  C  CE1 . PHE C 2 61  ? 4.762   16.069  28.096  1.00 92.28  ? 61  PHE D CE1 1 
ATOM   4316  C  CE2 . PHE C 2 61  ? 6.863   17.046  27.535  1.00 89.21  ? 61  PHE D CE2 1 
ATOM   4317  C  CZ  . PHE C 2 61  ? 5.720   17.037  28.308  1.00 89.80  ? 61  PHE D CZ  1 
ATOM   4318  N  N   . SER C 2 62  ? 7.294   13.995  22.163  1.00 89.15  ? 62  SER D N   1 
ATOM   4319  C  CA  . SER C 2 62  ? 8.019   13.133  21.246  1.00 91.10  ? 62  SER D CA  1 
ATOM   4320  C  C   . SER C 2 62  ? 9.482   13.535  21.256  1.00 92.33  ? 62  SER D C   1 
ATOM   4321  O  O   . SER C 2 62  ? 9.823   14.652  21.641  1.00 95.05  ? 62  SER D O   1 
ATOM   4322  C  CB  . SER C 2 62  ? 7.474   13.275  19.829  1.00 93.28  ? 62  SER D CB  1 
ATOM   4323  O  OG  . SER C 2 62  ? 8.245   14.212  19.097  1.00 91.99  ? 62  SER D OG  1 
ATOM   4324  N  N   . GLY C 2 63  ? 10.338  12.633  20.791  1.00 96.83  ? 63  GLY D N   1 
ATOM   4325  C  CA  . GLY C 2 63  ? 11.764  12.920  20.672  1.00 93.31  ? 63  GLY D CA  1 
ATOM   4326  C  C   . GLY C 2 63  ? 12.248  12.564  19.285  1.00 88.45  ? 63  GLY D C   1 
ATOM   4327  O  O   . GLY C 2 63  ? 11.639  11.744  18.615  1.00 97.66  ? 63  GLY D O   1 
ATOM   4328  N  N   . SER C 2 64  ? 13.322  13.196  18.838  1.00 86.87  ? 64  SER D N   1 
ATOM   4329  C  CA  . SER C 2 64  ? 13.962  12.791  17.600  1.00 92.08  ? 64  SER D CA  1 
ATOM   4330  C  C   . SER C 2 64  ? 15.376  13.343  17.529  1.00 96.06  ? 64  SER D C   1 
ATOM   4331  O  O   . SER C 2 64  ? 15.814  14.066  18.422  1.00 96.88  ? 64  SER D O   1 
ATOM   4332  C  CB  . SER C 2 64  ? 13.165  13.285  16.404  1.00 92.72  ? 64  SER D CB  1 
ATOM   4333  O  OG  . SER C 2 64  ? 13.439  14.647  16.192  1.00 105.55 ? 64  SER D OG  1 
ATOM   4334  N  N   . GLY C 2 65  ? 16.084  12.994  16.459  1.00 100.82 ? 65  GLY D N   1 
ATOM   4335  C  CA  . GLY C 2 65  ? 17.427  13.506  16.231  1.00 103.22 ? 65  GLY D CA  1 
ATOM   4336  C  C   . GLY C 2 65  ? 18.361  12.421  15.754  1.00 99.48  ? 65  GLY D C   1 
ATOM   4337  O  O   . GLY C 2 65  ? 17.939  11.300  15.523  1.00 101.71 ? 65  GLY D O   1 
ATOM   4338  N  N   . SER C 2 66  ? 19.637  12.756  15.615  1.00 101.51 ? 66  SER D N   1 
ATOM   4339  C  CA  . SER C 2 66  ? 20.653  11.790  15.232  1.00 102.98 ? 66  SER D CA  1 
ATOM   4340  C  C   . SER C 2 66  ? 22.012  12.454  15.191  1.00 105.74 ? 66  SER D C   1 
ATOM   4341  O  O   . SER C 2 66  ? 22.110  13.667  15.048  1.00 118.67 ? 66  SER D O   1 
ATOM   4342  C  CB  . SER C 2 66  ? 20.365  11.228  13.848  1.00 111.07 ? 66  SER D CB  1 
ATOM   4343  O  OG  . SER C 2 66  ? 20.568  12.226  12.867  1.00 114.47 ? 66  SER D OG  1 
ATOM   4344  N  N   . GLY C 2 67  ? 23.063  11.648  15.270  1.00 107.26 ? 67  GLY D N   1 
ATOM   4345  C  CA  . GLY C 2 67  ? 24.419  12.168  15.233  1.00 108.04 ? 67  GLY D CA  1 
ATOM   4346  C  C   . GLY C 2 67  ? 24.635  13.181  16.339  1.00 101.31 ? 67  GLY D C   1 
ATOM   4347  O  O   . GLY C 2 67  ? 24.786  12.818  17.502  1.00 95.44  ? 67  GLY D O   1 
ATOM   4348  N  N   . THR C 2 68  ? 24.617  14.459  15.983  1.00 102.06 ? 68  THR D N   1 
ATOM   4349  C  CA  . THR C 2 68  ? 25.048  15.496  16.903  1.00 98.25  ? 68  THR D CA  1 
ATOM   4350  C  C   . THR C 2 68  ? 23.926  16.461  17.309  1.00 99.50  ? 68  THR D C   1 
ATOM   4351  O  O   . THR C 2 68  ? 24.136  17.362  18.117  1.00 90.09  ? 68  THR D O   1 
ATOM   4352  C  CB  . THR C 2 68  ? 26.232  16.257  16.305  1.00 100.47 ? 68  THR D CB  1 
ATOM   4353  O  OG1 . THR C 2 68  ? 26.974  16.858  17.365  1.00 99.02  ? 68  THR D OG1 1 
ATOM   4354  C  CG2 . THR C 2 68  ? 25.764  17.313  15.295  1.00 104.90 ? 68  THR D CG2 1 
ATOM   4355  N  N   . SER C 2 69  ? 22.719  16.212  16.811  1.00 109.30 ? 69  SER D N   1 
ATOM   4356  C  CA  . SER C 2 69  ? 21.600  17.121  17.012  1.00 111.65 ? 69  SER D CA  1 
ATOM   4357  C  C   . SER C 2 69  ? 20.303  16.388  17.337  1.00 106.30 ? 69  SER D C   1 
ATOM   4358  O  O   . SER C 2 69  ? 19.769  15.643  16.516  1.00 105.08 ? 69  SER D O   1 
ATOM   4359  C  CB  . SER C 2 69  ? 21.394  17.962  15.758  1.00 123.31 ? 69  SER D CB  1 
ATOM   4360  O  OG  . SER C 2 69  ? 20.089  18.509  15.738  1.00 137.31 ? 69  SER D OG  1 
ATOM   4361  N  N   . TYR C 2 70  ? 19.772  16.655  18.523  1.00 104.33 ? 70  TYR D N   1 
ATOM   4362  C  CA  . TYR C 2 70  ? 18.579  15.975  18.993  1.00 100.37 ? 70  TYR D CA  1 
ATOM   4363  C  C   . TYR C 2 70  ? 17.577  16.966  19.539  1.00 101.19 ? 70  TYR D C   1 
ATOM   4364  O  O   . TYR C 2 70  ? 17.936  18.077  19.914  1.00 111.03 ? 70  TYR D O   1 
ATOM   4365  C  CB  . TYR C 2 70  ? 18.959  14.978  20.078  1.00 101.11 ? 70  TYR D CB  1 
ATOM   4366  C  CG  . TYR C 2 70  ? 19.743  13.808  19.547  1.00 98.08  ? 70  TYR D CG  1 
ATOM   4367  C  CD1 . TYR C 2 70  ? 21.122  13.877  19.399  1.00 91.99  ? 70  TYR D CD1 1 
ATOM   4368  C  CD2 . TYR C 2 70  ? 19.101  12.646  19.169  1.00 92.26  ? 70  TYR D CD2 1 
ATOM   4369  C  CE1 . TYR C 2 70  ? 21.835  12.812  18.908  1.00 87.29  ? 70  TYR D CE1 1 
ATOM   4370  C  CE2 . TYR C 2 70  ? 19.806  11.582  18.672  1.00 93.61  ? 70  TYR D CE2 1 
ATOM   4371  C  CZ  . TYR C 2 70  ? 21.171  11.673  18.547  1.00 91.76  ? 70  TYR D CZ  1 
ATOM   4372  O  OH  . TYR C 2 70  ? 21.872  10.598  18.066  1.00 116.94 ? 70  TYR D OH  1 
ATOM   4373  N  N   . SER C 2 71  ? 16.320  16.560  19.601  1.00 100.88 ? 71  SER D N   1 
ATOM   4374  C  CA  . SER C 2 71  ? 15.272  17.481  19.989  1.00 99.29  ? 71  SER D CA  1 
ATOM   4375  C  C   . SER C 2 71  ? 14.168  16.801  20.773  1.00 99.07  ? 71  SER D C   1 
ATOM   4376  O  O   . SER C 2 71  ? 13.896  15.620  20.588  1.00 103.23 ? 71  SER D O   1 
ATOM   4377  C  CB  . SER C 2 71  ? 14.673  18.121  18.752  1.00 101.25 ? 71  SER D CB  1 
ATOM   4378  O  OG  . SER C 2 71  ? 13.656  17.290  18.240  1.00 105.72 ? 71  SER D OG  1 
ATOM   4379  N  N   . LEU C 2 72  ? 13.537  17.569  21.649  1.00 99.68  ? 72  LEU D N   1 
ATOM   4380  C  CA  . LEU C 2 72  ? 12.350  17.134  22.361  1.00 97.45  ? 72  LEU D CA  1 
ATOM   4381  C  C   . LEU C 2 72  ? 11.222  18.087  21.994  1.00 93.56  ? 72  LEU D C   1 
ATOM   4382  O  O   . LEU C 2 72  ? 11.401  19.302  22.006  1.00 92.72  ? 72  LEU D O   1 
ATOM   4383  C  CB  . LEU C 2 72  ? 12.604  17.159  23.871  1.00 96.75  ? 72  LEU D CB  1 
ATOM   4384  C  CG  . LEU C 2 72  ? 11.593  16.427  24.756  1.00 93.63  ? 72  LEU D CG  1 
ATOM   4385  C  CD1 . LEU C 2 72  ? 12.025  16.546  26.204  1.00 93.15  ? 72  LEU D CD1 1 
ATOM   4386  C  CD2 . LEU C 2 72  ? 10.183  16.963  24.582  1.00 96.15  ? 72  LEU D CD2 1 
ATOM   4387  N  N   . THR C 2 73  ? 10.057  17.532  21.688  1.00 93.73  ? 73  THR D N   1 
ATOM   4388  C  CA  . THR C 2 73  ? 8.940   18.325  21.190  1.00 94.96  ? 73  THR D CA  1 
ATOM   4389  C  C   . THR C 2 73  ? 7.656   18.068  21.964  1.00 91.41  ? 73  THR D C   1 
ATOM   4390  O  O   . THR C 2 73  ? 7.358   16.932  22.326  1.00 84.22  ? 73  THR D O   1 
ATOM   4391  C  CB  . THR C 2 73  ? 8.674   18.007  19.714  1.00 95.15  ? 73  THR D CB  1 
ATOM   4392  O  OG1 . THR C 2 73  ? 9.857   18.295  18.963  1.00 97.29  ? 73  THR D OG1 1 
ATOM   4393  C  CG2 . THR C 2 73  ? 7.508   18.837  19.181  1.00 100.00 ? 73  THR D CG2 1 
ATOM   4394  N  N   . ILE C 2 74  ? 6.901   19.133  22.212  1.00 90.56  ? 74  ILE D N   1 
ATOM   4395  C  CA  . ILE C 2 74  ? 5.555   19.001  22.730  1.00 90.60  ? 74  ILE D CA  1 
ATOM   4396  C  C   . ILE C 2 74  ? 4.605   19.477  21.650  1.00 93.91  ? 74  ILE D C   1 
ATOM   4397  O  O   . ILE C 2 74  ? 4.691   20.612  21.212  1.00 104.43 ? 74  ILE D O   1 
ATOM   4398  C  CB  . ILE C 2 74  ? 5.350   19.827  24.009  1.00 90.25  ? 74  ILE D CB  1 
ATOM   4399  C  CG1 . ILE C 2 74  ? 6.506   19.586  24.987  1.00 87.75  ? 74  ILE D CG1 1 
ATOM   4400  C  CG2 . ILE C 2 74  ? 4.015   19.471  24.657  1.00 93.56  ? 74  ILE D CG2 1 
ATOM   4401  C  CD1 . ILE C 2 74  ? 6.277   20.166  26.367  1.00 88.77  ? 74  ILE D CD1 1 
ATOM   4402  N  N   . SER C 2 75  ? 3.706   18.605  21.211  1.00 99.00  ? 75  SER D N   1 
ATOM   4403  C  CA  . SER C 2 75  ? 2.799   18.947  20.119  1.00 106.29 ? 75  SER D CA  1 
ATOM   4404  C  C   . SER C 2 75  ? 1.896   20.097  20.541  1.00 111.54 ? 75  SER D C   1 
ATOM   4405  O  O   . SER C 2 75  ? 1.692   21.044  19.784  1.00 113.28 ? 75  SER D O   1 
ATOM   4406  C  CB  . SER C 2 75  ? 1.958   17.735  19.716  1.00 111.60 ? 75  SER D CB  1 
ATOM   4407  O  OG  . SER C 2 75  ? 1.174   17.263  20.798  1.00 118.53 ? 75  SER D OG  1 
ATOM   4408  N  N   . SER C 2 76  ? 1.400   20.020  21.774  1.00 113.29 ? 76  SER D N   1 
ATOM   4409  C  CA  . SER C 2 76  ? 0.516   21.036  22.328  1.00 115.62 ? 76  SER D CA  1 
ATOM   4410  C  C   . SER C 2 76  ? 0.743   21.222  23.835  1.00 116.01 ? 76  SER D C   1 
ATOM   4411  O  O   . SER C 2 76  ? 0.342   20.390  24.655  1.00 114.00 ? 76  SER D O   1 
ATOM   4412  C  CB  . SER C 2 76  ? -0.932  20.650  22.062  1.00 118.69 ? 76  SER D CB  1 
ATOM   4413  O  OG  . SER C 2 76  ? -1.804  21.561  22.688  1.00 125.87 ? 76  SER D OG  1 
ATOM   4414  N  N   . MET C 2 77  ? 1.378   22.331  24.191  1.00 118.79 ? 77  MET D N   1 
ATOM   4415  C  CA  . MET C 2 77  ? 1.697   22.629  25.583  1.00 118.90 ? 77  MET D CA  1 
ATOM   4416  C  C   . MET C 2 77  ? 0.501   22.417  26.506  1.00 120.61 ? 77  MET D C   1 
ATOM   4417  O  O   . MET C 2 77  ? -0.633  22.749  26.158  1.00 131.18 ? 77  MET D O   1 
ATOM   4418  C  CB  . MET C 2 77  ? 2.151   24.082  25.701  1.00 123.70 ? 77  MET D CB  1 
ATOM   4419  C  CG  . MET C 2 77  ? 2.525   24.507  27.107  1.00 121.73 ? 77  MET D CG  1 
ATOM   4420  S  SD  . MET C 2 77  ? 4.125   23.828  27.536  1.00 128.08 ? 77  MET D SD  1 
ATOM   4421  C  CE  . MET C 2 77  ? 4.399   24.606  29.127  1.00 135.29 ? 77  MET D CE  1 
ATOM   4422  N  N   . GLU C 2 78  ? 0.774   21.911  27.701  1.00 113.01 ? 78  GLU D N   1 
ATOM   4423  C  CA  . GLU C 2 78  ? -0.199  21.925  28.783  1.00 117.69 ? 78  GLU D CA  1 
ATOM   4424  C  C   . GLU C 2 78  ? 0.421   22.536  30.034  1.00 113.35 ? 78  GLU D C   1 
ATOM   4425  O  O   . GLU C 2 78  ? 1.617   22.800  30.069  1.00 108.01 ? 78  GLU D O   1 
ATOM   4426  C  CB  . GLU C 2 78  ? -0.697  20.517  29.073  1.00 120.44 ? 78  GLU D CB  1 
ATOM   4427  C  CG  . GLU C 2 78  ? -1.532  19.927  27.953  1.00 128.60 ? 78  GLU D CG  1 
ATOM   4428  C  CD  . GLU C 2 78  ? -2.785  19.243  28.471  1.00 140.01 ? 78  GLU D CD  1 
ATOM   4429  O  OE1 . GLU C 2 78  ? -2.680  18.462  29.449  1.00 135.47 ? 78  GLU D OE1 1 
ATOM   4430  O  OE2 . GLU C 2 78  ? -3.877  19.510  27.914  1.00 143.78 ? 78  GLU D OE2 1 
ATOM   4431  N  N   . ALA C 2 79  ? -0.400  22.762  31.055  1.00 115.66 ? 79  ALA D N   1 
ATOM   4432  C  CA  . ALA C 2 79  ? 0.050   23.437  32.273  1.00 116.00 ? 79  ALA D CA  1 
ATOM   4433  C  C   . ALA C 2 79  ? 1.046   22.590  33.045  1.00 111.69 ? 79  ALA D C   1 
ATOM   4434  O  O   . ALA C 2 79  ? 2.066   23.090  33.528  1.00 116.25 ? 79  ALA D O   1 
ATOM   4435  C  CB  . ALA C 2 79  ? -1.138  23.761  33.156  1.00 120.87 ? 79  ALA D CB  1 
ATOM   4436  N  N   . GLU C 2 80  ? 0.738   21.306  33.162  1.00 107.31 ? 80  GLU D N   1 
ATOM   4437  C  CA  . GLU C 2 80  ? 1.562   20.386  33.924  1.00 103.75 ? 80  GLU D CA  1 
ATOM   4438  C  C   . GLU C 2 80  ? 2.881   20.095  33.205  1.00 97.60  ? 80  GLU D C   1 
ATOM   4439  O  O   . GLU C 2 80  ? 3.697   19.320  33.692  1.00 99.59  ? 80  GLU D O   1 
ATOM   4440  C  CB  . GLU C 2 80  ? 0.794   19.087  34.142  1.00 107.92 ? 80  GLU D CB  1 
ATOM   4441  C  CG  . GLU C 2 80  ? 0.525   18.340  32.843  1.00 116.25 ? 80  GLU D CG  1 
ATOM   4442  C  CD  . GLU C 2 80  ? -0.803  17.594  32.830  1.00 126.83 ? 80  GLU D CD  1 
ATOM   4443  O  OE1 . GLU C 2 80  ? -1.865  18.234  33.011  1.00 124.18 ? 80  GLU D OE1 1 
ATOM   4444  O  OE2 . GLU C 2 80  ? -0.786  16.365  32.594  1.00 135.32 ? 80  GLU D OE2 1 
ATOM   4445  N  N   . ASP C 2 81  ? 3.085   20.703  32.040  1.00 95.78  ? 81  ASP D N   1 
ATOM   4446  C  CA  . ASP C 2 81  ? 4.310   20.491  31.276  1.00 91.81  ? 81  ASP D CA  1 
ATOM   4447  C  C   . ASP C 2 81  ? 5.405   21.454  31.682  1.00 89.47  ? 81  ASP D C   1 
ATOM   4448  O  O   . ASP C 2 81  ? 6.562   21.263  31.337  1.00 91.96  ? 81  ASP D O   1 
ATOM   4449  C  CB  . ASP C 2 81  ? 4.039   20.610  29.780  1.00 94.96  ? 81  ASP D CB  1 
ATOM   4450  C  CG  . ASP C 2 81  ? 3.188   19.477  29.262  1.00 106.64 ? 81  ASP D CG  1 
ATOM   4451  O  OD1 . ASP C 2 81  ? 3.000   18.493  30.019  1.00 112.50 ? 81  ASP D OD1 1 
ATOM   4452  O  OD2 . ASP C 2 81  ? 2.696   19.567  28.111  1.00 122.32 ? 81  ASP D OD2 1 
ATOM   4453  N  N   . ALA C 2 82  ? 5.037   22.494  32.412  1.00 96.51  ? 82  ALA D N   1 
ATOM   4454  C  CA  . ALA C 2 82  ? 6.014   23.439  32.912  1.00 102.25 ? 82  ALA D CA  1 
ATOM   4455  C  C   . ALA C 2 82  ? 7.005   22.705  33.789  1.00 98.07  ? 82  ALA D C   1 
ATOM   4456  O  O   . ALA C 2 82  ? 6.633   22.092  34.786  1.00 97.99  ? 82  ALA D O   1 
ATOM   4457  C  CB  . ALA C 2 82  ? 5.332   24.540  33.700  1.00 116.39 ? 82  ALA D CB  1 
ATOM   4458  N  N   . ALA C 2 83  ? 8.267   22.741  33.393  1.00 98.25  ? 83  ALA D N   1 
ATOM   4459  C  CA  . ALA C 2 83  ? 9.298   22.012  34.107  1.00 93.79  ? 83  ALA D CA  1 
ATOM   4460  C  C   . ALA C 2 83  ? 10.641  22.322  33.481  1.00 91.75  ? 83  ALA D C   1 
ATOM   4461  O  O   . ALA C 2 83  ? 10.711  23.056  32.495  1.00 92.53  ? 83  ALA D O   1 
ATOM   4462  C  CB  . ALA C 2 83  ? 9.024   20.520  34.027  1.00 91.41  ? 83  ALA D CB  1 
ATOM   4463  N  N   . THR C 2 84  ? 11.699  21.747  34.047  1.00 85.99  ? 84  THR D N   1 
ATOM   4464  C  CA  . THR C 2 84  ? 13.005  21.749  33.409  1.00 85.96  ? 84  THR D CA  1 
ATOM   4465  C  C   . THR C 2 84  ? 13.300  20.405  32.751  1.00 82.07  ? 84  THR D C   1 
ATOM   4466  O  O   . THR C 2 84  ? 13.191  19.365  33.395  1.00 81.54  ? 84  THR D O   1 
ATOM   4467  C  CB  . THR C 2 84  ? 14.113  22.038  34.425  1.00 85.55  ? 84  THR D CB  1 
ATOM   4468  O  OG1 . THR C 2 84  ? 13.878  23.313  35.027  1.00 93.95  ? 84  THR D OG1 1 
ATOM   4469  C  CG2 . THR C 2 84  ? 15.467  22.037  33.735  1.00 89.40  ? 84  THR D CG2 1 
ATOM   4470  N  N   . TYR C 2 85  ? 13.688  20.440  31.478  1.00 77.18  ? 85  TYR D N   1 
ATOM   4471  C  CA  . TYR C 2 85  ? 14.032  19.236  30.736  1.00 74.80  ? 85  TYR D CA  1 
ATOM   4472  C  C   . TYR C 2 85  ? 15.539  19.155  30.497  1.00 74.89  ? 85  TYR D C   1 
ATOM   4473  O  O   . TYR C 2 85  ? 16.155  20.121  30.072  1.00 85.56  ? 85  TYR D O   1 
ATOM   4474  C  CB  . TYR C 2 85  ? 13.262  19.196  29.409  1.00 77.93  ? 85  TYR D CB  1 
ATOM   4475  C  CG  . TYR C 2 85  ? 11.762  19.171  29.616  1.00 82.41  ? 85  TYR D CG  1 
ATOM   4476  C  CD1 . TYR C 2 85  ? 11.079  20.310  30.001  1.00 85.12  ? 85  TYR D CD1 1 
ATOM   4477  C  CD2 . TYR C 2 85  ? 11.038  17.997  29.467  1.00 83.56  ? 85  TYR D CD2 1 
ATOM   4478  C  CE1 . TYR C 2 85  ? 9.715   20.287  30.220  1.00 84.55  ? 85  TYR D CE1 1 
ATOM   4479  C  CE2 . TYR C 2 85  ? 9.675   17.963  29.688  1.00 80.21  ? 85  TYR D CE2 1 
ATOM   4480  C  CZ  . TYR C 2 85  ? 9.023   19.112  30.065  1.00 81.13  ? 85  TYR D CZ  1 
ATOM   4481  O  OH  . TYR C 2 85  ? 7.672   19.094  30.279  1.00 83.95  ? 85  TYR D OH  1 
ATOM   4482  N  N   . TYR C 2 86  ? 16.125  17.998  30.789  1.00 74.43  ? 86  TYR D N   1 
ATOM   4483  C  CA  . TYR C 2 86  ? 17.548  17.765  30.573  1.00 67.40  ? 86  TYR D CA  1 
ATOM   4484  C  C   . TYR C 2 86  ? 17.768  16.673  29.540  1.00 68.15  ? 86  TYR D C   1 
ATOM   4485  O  O   . TYR C 2 86  ? 17.109  15.634  29.574  1.00 69.90  ? 86  TYR D O   1 
ATOM   4486  C  CB  . TYR C 2 86  ? 18.198  17.296  31.856  1.00 63.58  ? 86  TYR D CB  1 
ATOM   4487  C  CG  . TYR C 2 86  ? 18.172  18.271  32.982  1.00 64.95  ? 86  TYR D CG  1 
ATOM   4488  C  CD1 . TYR C 2 86  ? 19.246  19.109  33.209  1.00 70.53  ? 86  TYR D CD1 1 
ATOM   4489  C  CD2 . TYR C 2 86  ? 17.114  18.294  33.882  1.00 64.14  ? 86  TYR D CD2 1 
ATOM   4490  C  CE1 . TYR C 2 86  ? 19.255  19.973  34.286  1.00 77.22  ? 86  TYR D CE1 1 
ATOM   4491  C  CE2 . TYR C 2 86  ? 17.110  19.147  34.964  1.00 66.96  ? 86  TYR D CE2 1 
ATOM   4492  C  CZ  . TYR C 2 86  ? 18.183  19.984  35.165  1.00 74.75  ? 86  TYR D CZ  1 
ATOM   4493  O  OH  . TYR C 2 86  ? 18.182  20.850  36.233  1.00 83.95  ? 86  TYR D OH  1 
ATOM   4494  N  N   . CYS C 2 87  ? 18.728  16.871  28.652  1.00 69.85  ? 87  CYS D N   1 
ATOM   4495  C  CA  . CYS C 2 87  ? 19.178  15.776  27.806  1.00 74.02  ? 87  CYS D CA  1 
ATOM   4496  C  C   . CYS C 2 87  ? 20.422  15.129  28.420  1.00 73.62  ? 87  CYS D C   1 
ATOM   4497  O  O   . CYS C 2 87  ? 21.113  15.746  29.243  1.00 72.79  ? 87  CYS D O   1 
ATOM   4498  C  CB  . CYS C 2 87  ? 19.458  16.260  26.386  1.00 78.91  ? 87  CYS D CB  1 
ATOM   4499  S  SG  . CYS C 2 87  ? 20.758  17.506  26.279  1.00 88.56  ? 87  CYS D SG  1 
ATOM   4500  N  N   . GLN C 2 88  ? 20.664  13.868  28.060  1.00 69.78  ? 88  GLN D N   1 
ATOM   4501  C  CA  . GLN C 2 88  ? 21.863  13.150  28.485  1.00 67.95  ? 88  GLN D CA  1 
ATOM   4502  C  C   . GLN C 2 88  ? 22.203  12.030  27.510  1.00 71.83  ? 88  GLN D C   1 
ATOM   4503  O  O   . GLN C 2 88  ? 21.335  11.496  26.814  1.00 74.80  ? 88  GLN D O   1 
ATOM   4504  C  CB  . GLN C 2 88  ? 21.709  12.581  29.905  1.00 65.35  ? 88  GLN D CB  1 
ATOM   4505  C  CG  . GLN C 2 88  ? 20.968  11.251  29.984  1.00 69.25  ? 88  GLN D CG  1 
ATOM   4506  C  CD  . GLN C 2 88  ? 21.853  10.032  30.191  1.00 71.79  ? 88  GLN D CD  1 
ATOM   4507  O  OE1 . GLN C 2 88  ? 21.353  8.947   30.443  1.00 70.67  ? 88  GLN D OE1 1 
ATOM   4508  N  NE2 . GLN C 2 88  ? 23.156  10.200  30.082  1.00 78.00  ? 88  GLN D NE2 1 
ATOM   4509  N  N   . GLN C 2 89  ? 23.476  11.650  27.523  1.00 72.91  ? 89  GLN D N   1 
ATOM   4510  C  CA  . GLN C 2 89  ? 24.047  10.708  26.575  1.00 67.92  ? 89  GLN D CA  1 
ATOM   4511  C  C   . GLN C 2 89  ? 24.896  9.694   27.335  1.00 73.37  ? 89  GLN D C   1 
ATOM   4512  O  O   . GLN C 2 89  ? 25.491  10.030  28.363  1.00 73.56  ? 89  GLN D O   1 
ATOM   4513  C  CB  . GLN C 2 89  ? 24.918  11.470  25.577  1.00 69.97  ? 89  GLN D CB  1 
ATOM   4514  C  CG  . GLN C 2 89  ? 26.220  10.782  25.189  1.00 73.84  ? 89  GLN D CG  1 
ATOM   4515  C  CD  . GLN C 2 89  ? 27.324  10.930  26.221  1.00 71.58  ? 89  GLN D CD  1 
ATOM   4516  O  OE1 . GLN C 2 89  ? 27.345  11.867  27.017  1.00 75.09  ? 89  GLN D OE1 1 
ATOM   4517  N  NE2 . GLN C 2 89  ? 28.252  10.001  26.204  1.00 72.67  ? 89  GLN D NE2 1 
ATOM   4518  N  N   . TRP C 2 90  ? 24.952  8.459   26.830  1.00 75.24  ? 90  TRP D N   1 
ATOM   4519  C  CA  . TRP C 2 90  ? 25.891  7.453   27.337  1.00 68.75  ? 90  TRP D CA  1 
ATOM   4520  C  C   . TRP C 2 90  ? 26.413  6.581   26.218  1.00 71.19  ? 90  TRP D C   1 
ATOM   4521  O  O   . TRP C 2 90  ? 26.593  5.375   26.393  1.00 76.40  ? 90  TRP D O   1 
ATOM   4522  C  CB  . TRP C 2 90  ? 25.246  6.554   28.397  1.00 65.63  ? 90  TRP D CB  1 
ATOM   4523  C  CG  . TRP C 2 90  ? 26.245  6.006   29.379  1.00 65.50  ? 90  TRP D CG  1 
ATOM   4524  C  CD1 . TRP C 2 90  ? 27.585  5.860   29.180  1.00 70.33  ? 90  TRP D CD1 1 
ATOM   4525  C  CD2 . TRP C 2 90  ? 25.987  5.548   30.714  1.00 61.92  ? 90  TRP D CD2 1 
ATOM   4526  N  NE1 . TRP C 2 90  ? 28.174  5.355   30.307  1.00 72.86  ? 90  TRP D NE1 1 
ATOM   4527  C  CE2 . TRP C 2 90  ? 27.215  5.169   31.269  1.00 67.87  ? 90  TRP D CE2 1 
ATOM   4528  C  CE3 . TRP C 2 90  ? 24.835  5.431   31.497  1.00 60.72  ? 90  TRP D CE3 1 
ATOM   4529  C  CZ2 . TRP C 2 90  ? 27.329  4.682   32.577  1.00 70.99  ? 90  TRP D CZ2 1 
ATOM   4530  C  CZ3 . TRP C 2 90  ? 24.950  4.941   32.799  1.00 56.93  ? 90  TRP D CZ3 1 
ATOM   4531  C  CH2 . TRP C 2 90  ? 26.183  4.586   33.325  1.00 61.01  ? 90  TRP D CH2 1 
ATOM   4532  N  N   . SER C 2 91  ? 26.664  7.187   25.067  1.00 75.37  ? 91  SER D N   1 
ATOM   4533  C  CA  . SER C 2 91  ? 27.350  6.486   23.996  1.00 83.06  ? 91  SER D CA  1 
ATOM   4534  C  C   . SER C 2 91  ? 28.866  6.515   24.243  1.00 82.81  ? 91  SER D C   1 
ATOM   4535  O  O   . SER C 2 91  ? 29.607  5.760   23.632  1.00 98.35  ? 91  SER D O   1 
ATOM   4536  C  CB  . SER C 2 91  ? 26.988  7.084   22.631  1.00 87.43  ? 91  SER D CB  1 
ATOM   4537  O  OG  . SER C 2 91  ? 25.621  6.851   22.309  1.00 82.98  ? 91  SER D OG  1 
ATOM   4538  N  N   . ASN C 2 92  ? 29.313  7.377   25.151  1.00 80.84  ? 92  ASN D N   1 
ATOM   4539  C  CA  . ASN C 2 92  ? 30.701  7.396   25.613  1.00 84.42  ? 92  ASN D CA  1 
ATOM   4540  C  C   . ASN C 2 92  ? 30.717  7.568   27.112  1.00 87.34  ? 92  ASN D C   1 
ATOM   4541  O  O   . ASN C 2 92  ? 30.048  8.449   27.643  1.00 100.86 ? 92  ASN D O   1 
ATOM   4542  C  CB  . ASN C 2 92  ? 31.471  8.569   25.021  1.00 87.69  ? 92  ASN D CB  1 
ATOM   4543  C  CG  . ASN C 2 92  ? 31.859  8.351   23.585  1.00 97.65  ? 92  ASN D CG  1 
ATOM   4544  O  OD1 . ASN C 2 92  ? 31.185  7.645   22.843  1.00 99.14  ? 92  ASN D OD1 1 
ATOM   4545  N  ND2 . ASN C 2 92  ? 32.934  8.998   23.170  1.00 113.98 ? 92  ASN D ND2 1 
ATOM   4546  N  N   . SER C 2 93  ? 31.464  6.734   27.815  1.00 96.38  ? 93  SER D N   1 
ATOM   4547  C  CA  . SER C 2 93  ? 31.662  6.983   29.232  1.00 95.19  ? 93  SER D CA  1 
ATOM   4548  C  C   . SER C 2 93  ? 32.652  8.122   29.321  1.00 89.47  ? 93  SER D C   1 
ATOM   4549  O  O   . SER C 2 93  ? 33.537  8.229   28.479  1.00 104.91 ? 93  SER D O   1 
ATOM   4550  C  CB  . SER C 2 93  ? 32.169  5.736   29.966  1.00 99.02  ? 93  SER D CB  1 
ATOM   4551  O  OG  . SER C 2 93  ? 31.132  4.765   30.112  1.00 97.85  ? 93  SER D OG  1 
ATOM   4552  N  N   . PRO C 2 94  ? 32.456  9.025   30.286  1.00 83.82  ? 94  PRO D N   1 
ATOM   4553  C  CA  . PRO C 2 94  ? 31.335  9.023   31.212  1.00 83.47  ? 94  PRO D CA  1 
ATOM   4554  C  C   . PRO C 2 94  ? 30.048  9.615   30.636  1.00 78.76  ? 94  PRO D C   1 
ATOM   4555  O  O   . PRO C 2 94  ? 30.090  10.472  29.756  1.00 79.42  ? 94  PRO D O   1 
ATOM   4556  C  CB  . PRO C 2 94  ? 31.833  9.914   32.343  1.00 87.74  ? 94  PRO D CB  1 
ATOM   4557  C  CG  . PRO C 2 94  ? 32.695  10.906  31.652  1.00 89.94  ? 94  PRO D CG  1 
ATOM   4558  C  CD  . PRO C 2 94  ? 33.370  10.151  30.542  1.00 87.99  ? 94  PRO D CD  1 
ATOM   4559  N  N   . PRO C 2 95  ? 28.900  9.189   31.169  1.00 75.96  ? 95  PRO D N   1 
ATOM   4560  C  CA  . PRO C 2 95  ? 27.670  9.804   30.739  1.00 74.35  ? 95  PRO D CA  1 
ATOM   4561  C  C   . PRO C 2 95  ? 27.680  11.280  31.105  1.00 76.33  ? 95  PRO D C   1 
ATOM   4562  O  O   . PRO C 2 95  ? 28.359  11.676  32.063  1.00 73.78  ? 95  PRO D O   1 
ATOM   4563  C  CB  . PRO C 2 95  ? 26.616  9.051   31.554  1.00 71.22  ? 95  PRO D CB  1 
ATOM   4564  C  CG  . PRO C 2 95  ? 27.313  8.696   32.820  1.00 67.57  ? 95  PRO D CG  1 
ATOM   4565  C  CD  . PRO C 2 95  ? 28.727  8.407   32.409  1.00 74.27  ? 95  PRO D CD  1 
ATOM   4566  N  N   . THR C 2 96  ? 26.934  12.084  30.350  1.00 80.30  ? 96  THR D N   1 
ATOM   4567  C  CA  . THR C 2 96  ? 26.841  13.517  30.621  1.00 79.01  ? 96  THR D CA  1 
ATOM   4568  C  C   . THR C 2 96  ? 25.455  14.089  30.349  1.00 76.01  ? 96  THR D C   1 
ATOM   4569  O  O   . THR C 2 96  ? 24.654  13.502  29.628  1.00 76.43  ? 96  THR D O   1 
ATOM   4570  C  CB  . THR C 2 96  ? 27.845  14.293  29.770  1.00 82.21  ? 96  THR D CB  1 
ATOM   4571  O  OG1 . THR C 2 96  ? 27.654  13.961  28.389  1.00 84.20  ? 96  THR D OG1 1 
ATOM   4572  C  CG2 . THR C 2 96  ? 29.263  13.953  30.184  1.00 86.50  ? 96  THR D CG2 1 
ATOM   4573  N  N   . PHE C 2 97  ? 25.198  15.259  30.927  1.00 79.86  ? 97  PHE D N   1 
ATOM   4574  C  CA  . PHE C 2 97  ? 23.913  15.929  30.805  1.00 76.30  ? 97  PHE D CA  1 
ATOM   4575  C  C   . PHE C 2 97  ? 24.018  17.284  30.102  1.00 83.49  ? 97  PHE D C   1 
ATOM   4576  O  O   . PHE C 2 97  ? 25.026  17.989  30.222  1.00 79.49  ? 97  PHE D O   1 
ATOM   4577  C  CB  . PHE C 2 97  ? 23.354  16.203  32.191  1.00 72.66  ? 97  PHE D CB  1 
ATOM   4578  C  CG  . PHE C 2 97  ? 22.978  14.985  32.957  1.00 69.16  ? 97  PHE D CG  1 
ATOM   4579  C  CD1 . PHE C 2 97  ? 21.702  14.457  32.849  1.00 68.11  ? 97  PHE D CD1 1 
ATOM   4580  C  CD2 . PHE C 2 97  ? 23.856  14.430  33.861  1.00 68.19  ? 97  PHE D CD2 1 
ATOM   4581  C  CE1 . PHE C 2 97  ? 21.334  13.354  33.589  1.00 69.04  ? 97  PHE D CE1 1 
ATOM   4582  C  CE2 . PHE C 2 97  ? 23.492  13.327  34.608  1.00 71.85  ? 97  PHE D CE2 1 
ATOM   4583  C  CZ  . PHE C 2 97  ? 22.231  12.789  34.474  1.00 67.82  ? 97  PHE D CZ  1 
ATOM   4584  N  N   . GLY C 2 98  ? 22.939  17.685  29.438  1.00 79.85  ? 98  GLY D N   1 
ATOM   4585  C  CA  . GLY C 2 98  ? 22.749  19.090  29.128  1.00 84.15  ? 98  GLY D CA  1 
ATOM   4586  C  C   . GLY C 2 98  ? 22.585  19.884  30.408  1.00 83.95  ? 98  GLY D C   1 
ATOM   4587  O  O   . GLY C 2 98  ? 22.324  19.310  31.460  1.00 77.59  ? 98  GLY D O   1 
ATOM   4588  N  N   . ALA C 2 99  ? 22.713  21.207  30.327  1.00 90.10  ? 99  ALA D N   1 
ATOM   4589  C  CA  . ALA C 2 99  ? 22.550  22.051  31.509  1.00 90.82  ? 99  ALA D CA  1 
ATOM   4590  C  C   . ALA C 2 99  ? 21.079  22.311  31.837  1.00 86.46  ? 99  ALA D C   1 
ATOM   4591  O  O   . ALA C 2 99  ? 20.764  22.957  32.838  1.00 77.14  ? 99  ALA D O   1 
ATOM   4592  C  CB  . ALA C 2 99  ? 23.294  23.359  31.335  1.00 98.08  ? 99  ALA D CB  1 
ATOM   4593  N  N   . GLY C 2 100 ? 20.188  21.782  31.003  1.00 90.42  ? 100 GLY D N   1 
ATOM   4594  C  CA  . GLY C 2 100 ? 18.755  21.834  31.270  1.00 90.02  ? 100 GLY D CA  1 
ATOM   4595  C  C   . GLY C 2 100 ? 18.061  23.019  30.616  1.00 87.87  ? 100 GLY D C   1 
ATOM   4596  O  O   . GLY C 2 100 ? 18.669  24.066  30.391  1.00 90.61  ? 100 GLY D O   1 
ATOM   4597  N  N   . ALA C 2 101 ? 16.787  22.838  30.292  1.00 82.45  ? 101 ALA D N   1 
ATOM   4598  C  CA  . ALA C 2 101 ? 15.998  23.871  29.644  1.00 86.71  ? 101 ALA D CA  1 
ATOM   4599  C  C   . ALA C 2 101 ? 14.720  24.039  30.432  1.00 88.10  ? 101 ALA D C   1 
ATOM   4600  O  O   . ALA C 2 101 ? 13.914  23.116  30.533  1.00 88.56  ? 101 ALA D O   1 
ATOM   4601  C  CB  . ALA C 2 101 ? 15.685  23.493  28.202  1.00 90.09  ? 101 ALA D CB  1 
ATOM   4602  N  N   . LYS C 2 102 ? 14.544  25.228  30.992  1.00 92.86  ? 102 LYS D N   1 
ATOM   4603  C  CA  . LYS C 2 102 ? 13.405  25.523  31.845  1.00 91.25  ? 102 LYS D CA  1 
ATOM   4604  C  C   . LYS C 2 102 ? 12.256  25.987  30.963  1.00 88.19  ? 102 LYS D C   1 
ATOM   4605  O  O   . LYS C 2 102 ? 12.434  26.830  30.084  1.00 95.72  ? 102 LYS D O   1 
ATOM   4606  C  CB  . LYS C 2 102 ? 13.794  26.608  32.840  1.00 101.53 ? 102 LYS D CB  1 
ATOM   4607  C  CG  . LYS C 2 102 ? 13.031  26.612  34.154  1.00 109.33 ? 102 LYS D CG  1 
ATOM   4608  C  CD  . LYS C 2 102 ? 13.413  27.859  34.949  1.00 130.14 ? 102 LYS D CD  1 
ATOM   4609  C  CE  . LYS C 2 102 ? 12.708  27.955  36.294  1.00 137.13 ? 102 LYS D CE  1 
ATOM   4610  N  NZ  . LYS C 2 102 ? 13.398  27.145  37.334  1.00 139.00 ? 102 LYS D NZ  1 
ATOM   4611  N  N   . LEU C 2 103 ? 11.083  25.412  31.171  1.00 84.97  ? 103 LEU D N   1 
ATOM   4612  C  CA  . LEU C 2 103 ? 9.925   25.749  30.360  1.00 88.34  ? 103 LEU D CA  1 
ATOM   4613  C  C   . LEU C 2 103 ? 8.832   26.297  31.252  1.00 96.80  ? 103 LEU D C   1 
ATOM   4614  O  O   . LEU C 2 103 ? 8.241   25.553  32.037  1.00 91.83  ? 103 LEU D O   1 
ATOM   4615  C  CB  . LEU C 2 103 ? 9.417   24.517  29.629  1.00 86.46  ? 103 LEU D CB  1 
ATOM   4616  C  CG  . LEU C 2 103 ? 8.133   24.666  28.819  1.00 87.46  ? 103 LEU D CG  1 
ATOM   4617  C  CD1 . LEU C 2 103 ? 8.365   25.554  27.610  1.00 94.07  ? 103 LEU D CD1 1 
ATOM   4618  C  CD2 . LEU C 2 103 ? 7.647   23.302  28.376  1.00 85.33  ? 103 LEU D CD2 1 
ATOM   4619  N  N   . GLU C 2 104 ? 8.574   27.601  31.118  1.00 105.63 ? 104 GLU D N   1 
ATOM   4620  C  CA  . GLU C 2 104 ? 7.583   28.302  31.931  1.00 110.93 ? 104 GLU D CA  1 
ATOM   4621  C  C   . GLU C 2 104 ? 6.292   28.536  31.143  1.00 113.96 ? 104 GLU D C   1 
ATOM   4622  O  O   . GLU C 2 104 ? 6.289   28.475  29.911  1.00 114.76 ? 104 GLU D O   1 
ATOM   4623  C  CB  . GLU C 2 104 ? 8.151   29.645  32.407  1.00 118.61 ? 104 GLU D CB  1 
ATOM   4624  C  CG  . GLU C 2 104 ? 8.633   30.554  31.278  1.00 127.63 ? 104 GLU D CG  1 
ATOM   4625  C  CD  . GLU C 2 104 ? 8.344   32.038  31.514  1.00 137.21 ? 104 GLU D CD  1 
ATOM   4626  O  OE1 . GLU C 2 104 ? 7.285   32.364  32.092  1.00 136.44 ? 104 GLU D OE1 1 
ATOM   4627  O  OE2 . GLU C 2 104 ? 9.164   32.889  31.096  1.00 141.39 ? 104 GLU D OE2 1 
ATOM   4628  N  N   . LEU C 2 105 ? 5.199   28.788  31.860  1.00 115.35 ? 105 LEU D N   1 
ATOM   4629  C  CA  . LEU C 2 105 ? 3.917   29.099  31.234  1.00 122.21 ? 105 LEU D CA  1 
ATOM   4630  C  C   . LEU C 2 105 ? 3.837   30.576  30.842  1.00 123.45 ? 105 LEU D C   1 
ATOM   4631  O  O   . LEU C 2 105 ? 4.213   31.450  31.618  1.00 127.14 ? 105 LEU D O   1 
ATOM   4632  C  CB  . LEU C 2 105 ? 2.779   28.760  32.198  1.00 132.66 ? 105 LEU D CB  1 
ATOM   4633  C  CG  . LEU C 2 105 ? 2.048   27.442  31.964  1.00 145.85 ? 105 LEU D CG  1 
ATOM   4634  C  CD1 . LEU C 2 105 ? 1.340   26.988  33.235  1.00 146.78 ? 105 LEU D CD1 1 
ATOM   4635  C  CD2 . LEU C 2 105 ? 1.059   27.608  30.815  1.00 160.61 ? 105 LEU D CD2 1 
ATOM   4636  N  N   . LYS C 2 106 ? 3.348   30.856  29.637  1.00 121.87 ? 106 LYS D N   1 
ATOM   4637  C  CA  . LYS C 2 106 ? 3.165   32.246  29.200  1.00 121.01 ? 106 LYS D CA  1 
ATOM   4638  C  C   . LYS C 2 106 ? 1.831   32.814  29.698  1.00 118.45 ? 106 LYS D C   1 
ATOM   4639  O  O   . LYS C 2 106 ? 0.877   32.072  29.922  1.00 114.84 ? 106 LYS D O   1 
ATOM   4640  C  CB  . LYS C 2 106 ? 3.257   32.352  27.672  1.00 122.27 ? 106 LYS D CB  1 
ATOM   4641  C  CG  . LYS C 2 106 ? 3.756   33.705  27.186  1.00 123.93 ? 106 LYS D CG  1 
ATOM   4642  C  CD  . LYS C 2 106 ? 3.614   33.855  25.681  1.00 131.33 ? 106 LYS D CD  1 
ATOM   4643  C  CE  . LYS C 2 106 ? 4.437   32.821  24.930  1.00 139.72 ? 106 LYS D CE  1 
ATOM   4644  N  NZ  . LYS C 2 106 ? 4.248   32.901  23.451  1.00 147.16 ? 106 LYS D NZ  1 
ATOM   4645  N  N   . ARG C 2 107 ? 1.790   34.128  29.913  1.00 118.45 ? 107 ARG D N   1 
ATOM   4646  C  CA  . ARG C 2 107 ? 0.572   34.812  30.342  1.00 114.88 ? 107 ARG D CA  1 
ATOM   4647  C  C   . ARG C 2 107 ? 0.652   36.285  29.993  1.00 118.45 ? 107 ARG D C   1 
ATOM   4648  O  O   . ARG C 2 107 ? 1.710   36.780  29.599  1.00 118.90 ? 107 ARG D O   1 
ATOM   4649  C  CB  . ARG C 2 107 ? 0.361   34.663  31.851  1.00 111.32 ? 107 ARG D CB  1 
ATOM   4650  C  CG  . ARG C 2 107 ? 1.497   35.201  32.703  1.00 110.63 ? 107 ARG D CG  1 
ATOM   4651  C  CD  . ARG C 2 107 ? 0.970   35.767  34.011  1.00 110.07 ? 107 ARG D CD  1 
ATOM   4652  N  NE  . ARG C 2 107 ? 0.283   37.037  33.804  1.00 112.57 ? 107 ARG D NE  1 
ATOM   4653  C  CZ  . ARG C 2 107 ? -0.684  37.498  34.589  1.00 112.19 ? 107 ARG D CZ  1 
ATOM   4654  N  NH1 . ARG C 2 107 ? -1.106  36.788  35.627  1.00 111.57 ? 107 ARG D NH1 1 
ATOM   4655  N  NH2 . ARG C 2 107 ? -1.243  38.668  34.331  1.00 115.26 ? 107 ARG D NH2 1 
ATOM   4656  N  N   . ALA C 2 108 ? -0.470  36.984  30.159  1.00 122.37 ? 108 ALA D N   1 
ATOM   4657  C  CA  . ALA C 2 108 ? -0.523  38.426  29.942  1.00 123.31 ? 108 ALA D CA  1 
ATOM   4658  C  C   . ALA C 2 108 ? 0.526   39.124  30.805  1.00 124.08 ? 108 ALA D C   1 
ATOM   4659  O  O   . ALA C 2 108 ? 0.796   38.709  31.942  1.00 111.52 ? 108 ALA D O   1 
ATOM   4660  C  CB  . ALA C 2 108 ? -1.909  38.959  30.268  1.00 123.24 ? 108 ALA D CB  1 
ATOM   4661  N  N   . ASP C 2 109 ? 1.134   40.172  30.257  1.00 128.73 ? 109 ASP D N   1 
ATOM   4662  C  CA  . ASP C 2 109 ? 2.155   40.910  30.990  1.00 127.91 ? 109 ASP D CA  1 
ATOM   4663  C  C   . ASP C 2 109 ? 1.532   41.572  32.222  1.00 127.49 ? 109 ASP D C   1 
ATOM   4664  O  O   . ASP C 2 109 ? 0.339   41.882  32.231  1.00 130.56 ? 109 ASP D O   1 
ATOM   4665  C  CB  . ASP C 2 109 ? 2.836   41.941  30.082  1.00 128.09 ? 109 ASP D CB  1 
ATOM   4666  C  CG  . ASP C 2 109 ? 3.667   41.293  28.983  1.00 131.69 ? 109 ASP D CG  1 
ATOM   4667  O  OD1 . ASP C 2 109 ? 4.018   40.101  29.123  1.00 137.11 ? 109 ASP D OD1 1 
ATOM   4668  O  OD2 . ASP C 2 109 ? 3.973   41.969  27.982  1.00 132.54 ? 109 ASP D OD2 1 
ATOM   4669  N  N   . ALA C 2 110 ? 2.326   41.727  33.279  1.00 127.53 ? 110 ALA D N   1 
ATOM   4670  C  CA  . ALA C 2 110 ? 1.865   42.356  34.523  1.00 124.80 ? 110 ALA D CA  1 
ATOM   4671  C  C   . ALA C 2 110 ? 2.970   43.227  35.100  1.00 125.30 ? 110 ALA D C   1 
ATOM   4672  O  O   . ALA C 2 110 ? 4.131   42.818  35.128  1.00 143.82 ? 110 ALA D O   1 
ATOM   4673  C  CB  . ALA C 2 110 ? 1.458   41.297  35.534  1.00 119.26 ? 110 ALA D CB  1 
ATOM   4674  N  N   . ALA C 2 111 ? 2.624   44.439  35.524  1.00 116.64 ? 111 ALA D N   1 
ATOM   4675  C  CA  . ALA C 2 111 ? 3.611   45.335  36.102  1.00 106.41 ? 111 ALA D CA  1 
ATOM   4676  C  C   . ALA C 2 111 ? 3.862   44.952  37.541  1.00 98.68  ? 111 ALA D C   1 
ATOM   4677  O  O   . ALA C 2 111 ? 2.974   44.448  38.224  1.00 94.51  ? 111 ALA D O   1 
ATOM   4678  C  CB  . ALA C 2 111 ? 3.142   46.766  36.027  1.00 112.85 ? 111 ALA D CB  1 
ATOM   4679  N  N   . PRO C 2 112 ? 5.085   45.185  38.012  1.00 97.05  ? 112 PRO D N   1 
ATOM   4680  C  CA  . PRO C 2 112 ? 5.362   44.878  39.398  1.00 92.84  ? 112 PRO D CA  1 
ATOM   4681  C  C   . PRO C 2 112 ? 4.589   45.808  40.304  1.00 90.91  ? 112 PRO D C   1 
ATOM   4682  O  O   . PRO C 2 112 ? 4.512   46.993  40.031  1.00 94.07  ? 112 PRO D O   1 
ATOM   4683  C  CB  . PRO C 2 112 ? 6.874   45.122  39.527  1.00 93.81  ? 112 PRO D CB  1 
ATOM   4684  C  CG  . PRO C 2 112 ? 7.233   46.022  38.395  1.00 98.51  ? 112 PRO D CG  1 
ATOM   4685  C  CD  . PRO C 2 112 ? 6.265   45.701  37.295  1.00 101.23 ? 112 PRO D CD  1 
ATOM   4686  N  N   . THR C 2 113 ? 3.977   45.255  41.340  1.00 92.04  ? 113 THR D N   1 
ATOM   4687  C  CA  . THR C 2 113 ? 3.576   46.039  42.494  1.00 96.86  ? 113 THR D CA  1 
ATOM   4688  C  C   . THR C 2 113 ? 4.791   46.239  43.398  1.00 97.55  ? 113 THR D C   1 
ATOM   4689  O  O   . THR C 2 113 ? 5.321   45.273  43.951  1.00 93.41  ? 113 THR D O   1 
ATOM   4690  C  CB  . THR C 2 113 ? 2.489   45.319  43.303  1.00 102.00 ? 113 THR D CB  1 
ATOM   4691  O  OG1 . THR C 2 113 ? 1.534   44.736  42.411  1.00 115.40 ? 113 THR D OG1 1 
ATOM   4692  C  CG2 . THR C 2 113 ? 1.793   46.288  44.232  1.00 103.94 ? 113 THR D CG2 1 
ATOM   4693  N  N   . VAL C 2 114 ? 5.227   47.491  43.551  1.00 102.49 ? 114 VAL D N   1 
ATOM   4694  C  CA  . VAL C 2 114 ? 6.477   47.794  44.253  1.00 97.34  ? 114 VAL D CA  1 
ATOM   4695  C  C   . VAL C 2 114 ? 6.232   48.415  45.619  1.00 95.71  ? 114 VAL D C   1 
ATOM   4696  O  O   . VAL C 2 114 ? 5.337   49.245  45.784  1.00 103.00 ? 114 VAL D O   1 
ATOM   4697  C  CB  . VAL C 2 114 ? 7.365   48.749  43.436  1.00 97.43  ? 114 VAL D CB  1 
ATOM   4698  C  CG1 . VAL C 2 114 ? 8.687   48.992  44.156  1.00 92.67  ? 114 VAL D CG1 1 
ATOM   4699  C  CG2 . VAL C 2 114 ? 7.590   48.172  42.048  1.00 102.22 ? 114 VAL D CG2 1 
ATOM   4700  N  N   . SER C 2 115 ? 7.046   48.011  46.586  1.00 92.00  ? 115 SER D N   1 
ATOM   4701  C  CA  . SER C 2 115 ? 6.968   48.534  47.938  1.00 96.84  ? 115 SER D CA  1 
ATOM   4702  C  C   . SER C 2 115 ? 8.358   48.659  48.525  1.00 97.57  ? 115 SER D C   1 
ATOM   4703  O  O   . SER C 2 115 ? 9.157   47.723  48.439  1.00 99.99  ? 115 SER D O   1 
ATOM   4704  C  CB  . SER C 2 115 ? 6.138   47.596  48.807  1.00 103.28 ? 115 SER D CB  1 
ATOM   4705  O  OG  . SER C 2 115 ? 4.767   47.681  48.460  1.00 114.63 ? 115 SER D OG  1 
ATOM   4706  N  N   . ILE C 2 116 ? 8.648   49.810  49.127  1.00 99.10  ? 116 ILE D N   1 
ATOM   4707  C  CA  . ILE C 2 116 ? 9.915   49.990  49.825  1.00 96.51  ? 116 ILE D CA  1 
ATOM   4708  C  C   . ILE C 2 116 ? 9.679   50.093  51.329  1.00 91.68  ? 116 ILE D C   1 
ATOM   4709  O  O   . ILE C 2 116 ? 8.639   50.562  51.783  1.00 88.32  ? 116 ILE D O   1 
ATOM   4710  C  CB  . ILE C 2 116 ? 10.680  51.225  49.320  1.00 98.22  ? 116 ILE D CB  1 
ATOM   4711  C  CG1 . ILE C 2 116 ? 12.084  51.270  49.930  1.00 98.18  ? 116 ILE D CG1 1 
ATOM   4712  C  CG2 . ILE C 2 116 ? 9.914   52.494  49.645  1.00 101.58 ? 116 ILE D CG2 1 
ATOM   4713  C  CD1 . ILE C 2 116 ? 12.975  52.327  49.311  1.00 105.93 ? 116 ILE D CD1 1 
ATOM   4714  N  N   . PHE C 2 117 ? 10.647  49.615  52.094  1.00 92.68  ? 117 PHE D N   1 
ATOM   4715  C  CA  . PHE C 2 117 ? 10.516  49.550  53.536  1.00 92.30  ? 117 PHE D CA  1 
ATOM   4716  C  C   . PHE C 2 117 ? 11.800  50.031  54.196  1.00 88.81  ? 117 PHE D C   1 
ATOM   4717  O  O   . PHE C 2 117 ? 12.901  49.521  53.927  1.00 95.03  ? 117 PHE D O   1 
ATOM   4718  C  CB  . PHE C 2 117 ? 10.241  48.116  53.985  1.00 97.65  ? 117 PHE D CB  1 
ATOM   4719  C  CG  . PHE C 2 117 ? 8.949   47.558  53.488  1.00 92.82  ? 117 PHE D CG  1 
ATOM   4720  C  CD1 . PHE C 2 117 ? 8.880   46.928  52.251  1.00 92.10  ? 117 PHE D CD1 1 
ATOM   4721  C  CD2 . PHE C 2 117 ? 7.817   47.627  54.268  1.00 92.87  ? 117 PHE D CD2 1 
ATOM   4722  C  CE1 . PHE C 2 117 ? 7.692   46.394  51.791  1.00 90.12  ? 117 PHE D CE1 1 
ATOM   4723  C  CE2 . PHE C 2 117 ? 6.629   47.088  53.819  1.00 96.70  ? 117 PHE D CE2 1 
ATOM   4724  C  CZ  . PHE C 2 117 ? 6.564   46.470  52.580  1.00 91.51  ? 117 PHE D CZ  1 
ATOM   4725  N  N   . PRO C 2 118 ? 11.659  50.996  55.090  1.00 81.53  ? 118 PRO D N   1 
ATOM   4726  C  CA  . PRO C 2 118 ? 12.770  51.500  55.869  1.00 80.43  ? 118 PRO D CA  1 
ATOM   4727  C  C   . PRO C 2 118 ? 13.186  50.526  56.955  1.00 74.79  ? 118 PRO D C   1 
ATOM   4728  O  O   . PRO C 2 118 ? 12.384  49.731  57.392  1.00 74.99  ? 118 PRO D O   1 
ATOM   4729  C  CB  . PRO C 2 118 ? 12.204  52.767  56.506  1.00 84.61  ? 118 PRO D CB  1 
ATOM   4730  C  CG  . PRO C 2 118 ? 10.782  52.888  56.038  1.00 85.56  ? 118 PRO D CG  1 
ATOM   4731  C  CD  . PRO C 2 118 ? 10.377  51.568  55.506  1.00 82.97  ? 118 PRO D CD  1 
ATOM   4732  N  N   . PRO C 2 119 ? 14.427  50.625  57.420  1.00 75.02  ? 119 PRO D N   1 
ATOM   4733  C  CA  . PRO C 2 119 ? 14.873  49.817  58.537  1.00 76.12  ? 119 PRO D CA  1 
ATOM   4734  C  C   . PRO C 2 119 ? 13.970  49.963  59.730  1.00 72.71  ? 119 PRO D C   1 
ATOM   4735  O  O   . PRO C 2 119 ? 13.570  51.062  60.063  1.00 76.37  ? 119 PRO D O   1 
ATOM   4736  C  CB  . PRO C 2 119 ? 16.263  50.381  58.865  1.00 78.21  ? 119 PRO D CB  1 
ATOM   4737  C  CG  . PRO C 2 119 ? 16.738  50.963  57.586  1.00 82.57  ? 119 PRO D CG  1 
ATOM   4738  C  CD  . PRO C 2 119 ? 15.515  51.432  56.846  1.00 82.10  ? 119 PRO D CD  1 
ATOM   4739  N  N   . SER C 2 120 ? 13.671  48.846  60.373  1.00 75.20  ? 120 SER D N   1 
ATOM   4740  C  CA  . SER C 2 120 ? 12.960  48.858  61.639  1.00 76.85  ? 120 SER D CA  1 
ATOM   4741  C  C   . SER C 2 120 ? 13.801  49.500  62.722  1.00 74.80  ? 120 SER D C   1 
ATOM   4742  O  O   . SER C 2 120 ? 15.024  49.449  62.702  1.00 68.67  ? 120 SER D O   1 
ATOM   4743  C  CB  . SER C 2 120 ? 12.631  47.429  62.067  1.00 80.55  ? 120 SER D CB  1 
ATOM   4744  O  OG  . SER C 2 120 ? 13.822  46.669  62.224  1.00 77.62  ? 120 SER D OG  1 
ATOM   4745  N  N   . SER C 2 121 ? 13.125  50.062  63.705  1.00 81.43  ? 121 SER D N   1 
ATOM   4746  C  CA  . SER C 2 121 ? 13.801  50.563  64.885  1.00 86.09  ? 121 SER D CA  1 
ATOM   4747  C  C   . SER C 2 121 ? 14.551  49.436  65.582  1.00 86.75  ? 121 SER D C   1 
ATOM   4748  O  O   . SER C 2 121 ? 15.650  49.642  66.088  1.00 86.16  ? 121 SER D O   1 
ATOM   4749  C  CB  . SER C 2 121 ? 12.796  51.219  65.841  1.00 92.24  ? 121 SER D CB  1 
ATOM   4750  O  OG  . SER C 2 121 ? 11.662  50.394  66.045  1.00 96.43  ? 121 SER D OG  1 
ATOM   4751  N  N   . GLU C 2 122 ? 13.960  48.244  65.600  1.00 91.16  ? 122 GLU D N   1 
ATOM   4752  C  CA  . GLU C 2 122 ? 14.559  47.102  66.290  1.00 93.01  ? 122 GLU D CA  1 
ATOM   4753  C  C   . GLU C 2 122 ? 15.928  46.782  65.723  1.00 92.12  ? 122 GLU D C   1 
ATOM   4754  O  O   . GLU C 2 122 ? 16.872  46.498  66.462  1.00 97.08  ? 122 GLU D O   1 
ATOM   4755  C  CB  . GLU C 2 122 ? 13.679  45.868  66.162  1.00 98.15  ? 122 GLU D CB  1 
ATOM   4756  C  CG  . GLU C 2 122 ? 12.429  45.887  67.029  1.00 108.94 ? 122 GLU D CG  1 
ATOM   4757  C  CD  . GLU C 2 122 ? 11.152  46.121  66.234  1.00 115.55 ? 122 GLU D CD  1 
ATOM   4758  O  OE1 . GLU C 2 122 ? 11.111  47.076  65.412  1.00 116.58 ? 122 GLU D OE1 1 
ATOM   4759  O  OE2 . GLU C 2 122 ? 10.189  45.344  66.441  1.00 115.89 ? 122 GLU D OE2 1 
ATOM   4760  N  N   . GLN C 2 123 ? 16.037  46.834  64.405  1.00 88.97  ? 123 GLN D N   1 
ATOM   4761  C  CA  . GLN C 2 123 ? 17.284  46.500  63.741  1.00 89.72  ? 123 GLN D CA  1 
ATOM   4762  C  C   . GLN C 2 123 ? 18.320  47.581  64.015  1.00 89.03  ? 123 GLN D C   1 
ATOM   4763  O  O   . GLN C 2 123 ? 19.490  47.298  64.296  1.00 98.92  ? 123 GLN D O   1 
ATOM   4764  C  CB  . GLN C 2 123 ? 17.053  46.371  62.240  1.00 86.93  ? 123 GLN D CB  1 
ATOM   4765  C  CG  . GLN C 2 123 ? 18.226  45.781  61.487  1.00 82.99  ? 123 GLN D CG  1 
ATOM   4766  C  CD  . GLN C 2 123 ? 18.037  45.870  59.995  1.00 82.51  ? 123 GLN D CD  1 
ATOM   4767  O  OE1 . GLN C 2 123 ? 17.031  46.406  59.499  1.00 85.43  ? 123 GLN D OE1 1 
ATOM   4768  N  NE2 . GLN C 2 123 ? 18.997  45.341  59.263  1.00 79.17  ? 123 GLN D NE2 1 
ATOM   4769  N  N   . LEU C 2 124 ? 17.877  48.827  63.940  1.00 83.61  ? 124 LEU D N   1 
ATOM   4770  C  CA  . LEU C 2 124 ? 18.786  49.939  64.060  1.00 81.29  ? 124 LEU D CA  1 
ATOM   4771  C  C   . LEU C 2 124 ? 19.516  49.876  65.382  1.00 81.63  ? 124 LEU D C   1 
ATOM   4772  O  O   . LEU C 2 124 ? 20.708  50.155  65.440  1.00 91.79  ? 124 LEU D O   1 
ATOM   4773  C  CB  . LEU C 2 124 ? 18.033  51.249  63.913  1.00 82.18  ? 124 LEU D CB  1 
ATOM   4774  C  CG  . LEU C 2 124 ? 17.581  51.537  62.481  1.00 84.19  ? 124 LEU D CG  1 
ATOM   4775  C  CD1 . LEU C 2 124 ? 16.706  52.783  62.429  1.00 91.35  ? 124 LEU D CD1 1 
ATOM   4776  C  CD2 . LEU C 2 124 ? 18.789  51.696  61.574  1.00 86.24  ? 124 LEU D CD2 1 
ATOM   4777  N  N   . THR C 2 125 ? 18.824  49.462  66.436  1.00 82.88  ? 125 THR D N   1 
ATOM   4778  C  CA  . THR C 2 125 ? 19.432  49.447  67.772  1.00 89.08  ? 125 THR D CA  1 
ATOM   4779  C  C   . THR C 2 125 ? 20.581  48.442  67.868  1.00 92.34  ? 125 THR D C   1 
ATOM   4780  O  O   . THR C 2 125 ? 21.432  48.553  68.737  1.00 99.51  ? 125 THR D O   1 
ATOM   4781  C  CB  . THR C 2 125 ? 18.405  49.129  68.872  1.00 89.84  ? 125 THR D CB  1 
ATOM   4782  O  OG1 . THR C 2 125 ? 18.111  47.732  68.858  1.00 98.93  ? 125 THR D OG1 1 
ATOM   4783  C  CG2 . THR C 2 125 ? 17.114  49.915  68.665  1.00 89.50  ? 125 THR D CG2 1 
ATOM   4784  N  N   . SER C 2 126 ? 20.600  47.461  66.973  1.00 94.03  ? 126 SER D N   1 
ATOM   4785  C  CA  . SER C 2 126 ? 21.692  46.493  66.917  1.00 94.44  ? 126 SER D CA  1 
ATOM   4786  C  C   . SER C 2 126 ? 22.760  46.892  65.895  1.00 95.45  ? 126 SER D C   1 
ATOM   4787  O  O   . SER C 2 126 ? 23.731  46.167  65.679  1.00 106.69 ? 126 SER D O   1 
ATOM   4788  C  CB  . SER C 2 126 ? 21.141  45.115  66.580  1.00 95.65  ? 126 SER D CB  1 
ATOM   4789  O  OG  . SER C 2 126 ? 20.397  45.177  65.381  1.00 102.23 ? 126 SER D OG  1 
ATOM   4790  N  N   . GLY C 2 127 ? 22.596  48.050  65.271  1.00 93.04  ? 127 GLY D N   1 
ATOM   4791  C  CA  . GLY C 2 127 ? 23.693  48.652  64.515  1.00 95.25  ? 127 GLY D CA  1 
ATOM   4792  C  C   . GLY C 2 127 ? 23.637  48.326  63.038  1.00 93.61  ? 127 GLY D C   1 
ATOM   4793  O  O   . GLY C 2 127 ? 24.518  48.720  62.269  1.00 96.49  ? 127 GLY D O   1 
ATOM   4794  N  N   . GLY C 2 128 ? 22.600  47.606  62.632  1.00 84.42  ? 128 GLY D N   1 
ATOM   4795  C  CA  . GLY C 2 128 ? 22.443  47.270  61.230  1.00 82.79  ? 128 GLY D CA  1 
ATOM   4796  C  C   . GLY C 2 128 ? 21.302  48.042  60.625  1.00 74.76  ? 128 GLY D C   1 
ATOM   4797  O  O   . GLY C 2 128 ? 20.463  48.559  61.341  1.00 70.37  ? 128 GLY D O   1 
ATOM   4798  N  N   . ALA C 2 129 ? 21.251  48.090  59.302  1.00 74.87  ? 129 ALA D N   1 
ATOM   4799  C  CA  . ALA C 2 129 ? 20.170  48.785  58.633  1.00 80.41  ? 129 ALA D CA  1 
ATOM   4800  C  C   . ALA C 2 129 ? 19.891  48.210  57.259  1.00 83.09  ? 129 ALA D C   1 
ATOM   4801  O  O   . ALA C 2 129 ? 20.639  48.458  56.311  1.00 92.97  ? 129 ALA D O   1 
ATOM   4802  C  CB  . ALA C 2 129 ? 20.512  50.253  58.517  1.00 88.07  ? 129 ALA D CB  1 
ATOM   4803  N  N   . SER C 2 130 ? 18.807  47.450  57.148  1.00 77.10  ? 130 SER D N   1 
ATOM   4804  C  CA  . SER C 2 130 ? 18.473  46.815  55.894  1.00 75.91  ? 130 SER D CA  1 
ATOM   4805  C  C   . SER C 2 130 ? 17.286  47.514  55.294  1.00 77.40  ? 130 SER D C   1 
ATOM   4806  O  O   . SER C 2 130 ? 16.255  47.685  55.943  1.00 86.22  ? 130 SER D O   1 
ATOM   4807  C  CB  . SER C 2 130 ? 18.151  45.341  56.095  1.00 76.32  ? 130 SER D CB  1 
ATOM   4808  O  OG  . SER C 2 130 ? 19.320  44.597  56.375  1.00 80.43  ? 130 SER D OG  1 
ATOM   4809  N  N   . VAL C 2 131 ? 17.435  47.934  54.050  1.00 80.98  ? 131 VAL D N   1 
ATOM   4810  C  CA  . VAL C 2 131 ? 16.341  48.559  53.345  1.00 83.17  ? 131 VAL D CA  1 
ATOM   4811  C  C   . VAL C 2 131 ? 15.825  47.595  52.311  1.00 82.94  ? 131 VAL D C   1 
ATOM   4812  O  O   . VAL C 2 131 ? 16.589  47.096  51.484  1.00 83.35  ? 131 VAL D O   1 
ATOM   4813  C  CB  . VAL C 2 131 ? 16.781  49.841  52.636  1.00 88.98  ? 131 VAL D CB  1 
ATOM   4814  C  CG1 . VAL C 2 131 ? 15.554  50.637  52.214  1.00 89.74  ? 131 VAL D CG1 1 
ATOM   4815  C  CG2 . VAL C 2 131 ? 17.679  50.663  53.548  1.00 93.16  ? 131 VAL D CG2 1 
ATOM   4816  N  N   . VAL C 2 132 ? 14.519  47.356  52.348  1.00 84.67  ? 132 VAL D N   1 
ATOM   4817  C  CA  . VAL C 2 132 ? 13.931  46.269  51.587  1.00 86.12  ? 132 VAL D CA  1 
ATOM   4818  C  C   . VAL C 2 132 ? 12.937  46.764  50.558  1.00 85.43  ? 132 VAL D C   1 
ATOM   4819  O  O   . VAL C 2 132 ? 12.173  47.689  50.810  1.00 87.83  ? 132 VAL D O   1 
ATOM   4820  C  CB  . VAL C 2 132 ? 13.212  45.283  52.516  1.00 88.14  ? 132 VAL D CB  1 
ATOM   4821  C  CG1 . VAL C 2 132 ? 12.497  44.222  51.700  1.00 90.76  ? 132 VAL D CG1 1 
ATOM   4822  C  CG2 . VAL C 2 132 ? 14.207  44.641  53.471  1.00 88.20  ? 132 VAL D CG2 1 
ATOM   4823  N  N   . CYS C 2 133 ? 12.945  46.122  49.401  1.00 88.96  ? 133 CYS D N   1 
ATOM   4824  C  CA  . CYS C 2 133 ? 12.015  46.447  48.341  1.00 96.17  ? 133 CYS D CA  1 
ATOM   4825  C  C   . CYS C 2 133 ? 11.393  45.169  47.768  1.00 99.82  ? 133 CYS D C   1 
ATOM   4826  O  O   . CYS C 2 133 ? 12.110  44.247  47.369  1.00 111.67 ? 133 CYS D O   1 
ATOM   4827  C  CB  . CYS C 2 133 ? 12.769  47.182  47.249  1.00 99.83  ? 133 CYS D CB  1 
ATOM   4828  S  SG  . CYS C 2 133 ? 11.758  48.213  46.191  1.00 107.46 ? 133 CYS D SG  1 
ATOM   4829  N  N   . PHE C 2 134 ? 10.064  45.106  47.742  1.00 93.79  ? 134 PHE D N   1 
ATOM   4830  C  CA  . PHE C 2 134 ? 9.356   43.971  47.141  1.00 88.65  ? 134 PHE D CA  1 
ATOM   4831  C  C   . PHE C 2 134 ? 8.822   44.363  45.777  1.00 92.40  ? 134 PHE D C   1 
ATOM   4832  O  O   . PHE C 2 134 ? 8.172   45.397  45.639  1.00 101.14 ? 134 PHE D O   1 
ATOM   4833  C  CB  . PHE C 2 134 ? 8.172   43.546  48.005  1.00 85.41  ? 134 PHE D CB  1 
ATOM   4834  C  CG  . PHE C 2 134 ? 8.550   43.000  49.355  1.00 81.73  ? 134 PHE D CG  1 
ATOM   4835  C  CD1 . PHE C 2 134 ? 9.787   42.454  49.585  1.00 83.34  ? 134 PHE D CD1 1 
ATOM   4836  C  CD2 . PHE C 2 134 ? 7.635   43.001  50.386  1.00 83.06  ? 134 PHE D CD2 1 
ATOM   4837  C  CE1 . PHE C 2 134 ? 10.116  41.946  50.831  1.00 84.90  ? 134 PHE D CE1 1 
ATOM   4838  C  CE2 . PHE C 2 134 ? 7.954   42.496  51.632  1.00 79.38  ? 134 PHE D CE2 1 
ATOM   4839  C  CZ  . PHE C 2 134 ? 9.193   41.965  51.855  1.00 80.64  ? 134 PHE D CZ  1 
ATOM   4840  N  N   . LEU C 2 135 ? 9.091   43.535  44.774  1.00 93.18  ? 135 LEU D N   1 
ATOM   4841  C  CA  . LEU C 2 135 ? 8.523   43.716  43.440  1.00 96.34  ? 135 LEU D CA  1 
ATOM   4842  C  C   . LEU C 2 135 ? 7.648   42.506  43.129  1.00 90.59  ? 135 LEU D C   1 
ATOM   4843  O  O   . LEU C 2 135 ? 8.150   41.426  42.852  1.00 95.74  ? 135 LEU D O   1 
ATOM   4844  C  CB  . LEU C 2 135 ? 9.638   43.848  42.398  1.00 100.09 ? 135 LEU D CB  1 
ATOM   4845  C  CG  . LEU C 2 135 ? 10.535  45.085  42.511  1.00 99.54  ? 135 LEU D CG  1 
ATOM   4846  C  CD1 . LEU C 2 135 ? 11.556  44.911  43.622  1.00 97.46  ? 135 LEU D CD1 1 
ATOM   4847  C  CD2 . LEU C 2 135 ? 11.230  45.357  41.187  1.00 103.22 ? 135 LEU D CD2 1 
ATOM   4848  N  N   . ASN C 2 136 ? 6.339   42.674  43.221  1.00 89.55  ? 136 ASN D N   1 
ATOM   4849  C  CA  . ASN C 2 136 ? 5.450   41.527  43.363  1.00 89.07  ? 136 ASN D CA  1 
ATOM   4850  C  C   . ASN C 2 136 ? 4.503   41.306  42.199  1.00 91.17  ? 136 ASN D C   1 
ATOM   4851  O  O   . ASN C 2 136 ? 3.923   42.241  41.652  1.00 99.64  ? 136 ASN D O   1 
ATOM   4852  C  CB  . ASN C 2 136 ? 4.637   41.647  44.654  1.00 92.59  ? 136 ASN D CB  1 
ATOM   4853  C  CG  . ASN C 2 136 ? 5.452   41.316  45.890  1.00 96.89  ? 136 ASN D CG  1 
ATOM   4854  O  OD1 . ASN C 2 136 ? 6.653   41.057  45.801  1.00 110.13 ? 136 ASN D OD1 1 
ATOM   4855  N  ND2 . ASN C 2 136 ? 4.801   41.328  47.054  1.00 96.08  ? 136 ASN D ND2 1 
ATOM   4856  N  N   . ASN C 2 137 ? 4.341   40.038  41.849  1.00 94.55  ? 137 ASN D N   1 
ATOM   4857  C  CA  . ASN C 2 137 ? 3.289   39.586  40.935  1.00 98.57  ? 137 ASN D CA  1 
ATOM   4858  C  C   . ASN C 2 137 ? 3.339   40.238  39.562  1.00 96.40  ? 137 ASN D C   1 
ATOM   4859  O  O   . ASN C 2 137 ? 2.347   40.783  39.083  1.00 94.39  ? 137 ASN D O   1 
ATOM   4860  C  CB  . ASN C 2 137 ? 1.909   39.761  41.568  1.00 99.84  ? 137 ASN D CB  1 
ATOM   4861  C  CG  . ASN C 2 137 ? 1.747   38.941  42.838  1.00 106.37 ? 137 ASN D CG  1 
ATOM   4862  O  OD1 . ASN C 2 137 ? 1.756   37.697  42.817  1.00 119.00 ? 137 ASN D OD1 1 
ATOM   4863  N  ND2 . ASN C 2 137 ? 1.605   39.632  43.959  1.00 108.70 ? 137 ASN D ND2 1 
ATOM   4864  N  N   . PHE C 2 138 ? 4.496   40.121  38.919  1.00 94.55  ? 138 PHE D N   1 
ATOM   4865  C  CA  . PHE C 2 138 ? 4.699   40.663  37.588  1.00 97.31  ? 138 PHE D CA  1 
ATOM   4866  C  C   . PHE C 2 138 ? 5.042   39.553  36.599  1.00 98.45  ? 138 PHE D C   1 
ATOM   4867  O  O   . PHE C 2 138 ? 5.380   38.438  36.994  1.00 97.39  ? 138 PHE D O   1 
ATOM   4868  C  CB  . PHE C 2 138 ? 5.823   41.689  37.614  1.00 98.05  ? 138 PHE D CB  1 
ATOM   4869  C  CG  . PHE C 2 138 ? 7.140   41.130  38.053  1.00 96.02  ? 138 PHE D CG  1 
ATOM   4870  C  CD1 . PHE C 2 138 ? 7.490   41.130  39.392  1.00 94.50  ? 138 PHE D CD1 1 
ATOM   4871  C  CD2 . PHE C 2 138 ? 8.035   40.623  37.129  1.00 96.83  ? 138 PHE D CD2 1 
ATOM   4872  C  CE1 . PHE C 2 138 ? 8.706   40.621  39.802  1.00 93.99  ? 138 PHE D CE1 1 
ATOM   4873  C  CE2 . PHE C 2 138 ? 9.251   40.114  37.534  1.00 98.68  ? 138 PHE D CE2 1 
ATOM   4874  C  CZ  . PHE C 2 138 ? 9.588   40.116  38.873  1.00 96.47  ? 138 PHE D CZ  1 
ATOM   4875  N  N   . TYR C 2 139 ? 4.925   39.875  35.313  1.00 102.64 ? 139 TYR D N   1 
ATOM   4876  C  CA  . TYR C 2 139 ? 5.312   38.979  34.223  1.00 104.87 ? 139 TYR D CA  1 
ATOM   4877  C  C   . TYR C 2 139 ? 5.599   39.811  32.972  1.00 107.88 ? 139 TYR D C   1 
ATOM   4878  O  O   . TYR C 2 139 ? 4.839   40.727  32.657  1.00 115.51 ? 139 TYR D O   1 
ATOM   4879  C  CB  . TYR C 2 139 ? 4.197   37.965  33.915  1.00 106.13 ? 139 TYR D CB  1 
ATOM   4880  C  CG  . TYR C 2 139 ? 4.597   36.940  32.867  1.00 105.77 ? 139 TYR D CG  1 
ATOM   4881  C  CD1 . TYR C 2 139 ? 4.511   37.238  31.508  1.00 107.90 ? 139 TYR D CD1 1 
ATOM   4882  C  CD2 . TYR C 2 139 ? 5.088   35.694  33.234  1.00 99.53  ? 139 TYR D CD2 1 
ATOM   4883  C  CE1 . TYR C 2 139 ? 4.893   36.323  30.550  1.00 108.81 ? 139 TYR D CE1 1 
ATOM   4884  C  CE2 . TYR C 2 139 ? 5.485   34.780  32.279  1.00 102.86 ? 139 TYR D CE2 1 
ATOM   4885  C  CZ  . TYR C 2 139 ? 5.387   35.104  30.941  1.00 107.23 ? 139 TYR D CZ  1 
ATOM   4886  O  OH  . TYR C 2 139 ? 5.769   34.199  29.979  1.00 114.43 ? 139 TYR D OH  1 
ATOM   4887  N  N   . PRO C 2 140 ? 6.665   39.476  32.226  1.00 105.71 ? 140 PRO D N   1 
ATOM   4888  C  CA  . PRO C 2 140 ? 7.507   38.315  32.419  1.00 107.71 ? 140 PRO D CA  1 
ATOM   4889  C  C   . PRO C 2 140 ? 8.557   38.511  33.508  1.00 109.24 ? 140 PRO D C   1 
ATOM   4890  O  O   . PRO C 2 140 ? 8.532   39.512  34.222  1.00 104.64 ? 140 PRO D O   1 
ATOM   4891  C  CB  . PRO C 2 140 ? 8.177   38.159  31.055  1.00 113.72 ? 140 PRO D CB  1 
ATOM   4892  C  CG  . PRO C 2 140 ? 8.327   39.556  30.568  1.00 113.70 ? 140 PRO D CG  1 
ATOM   4893  C  CD  . PRO C 2 140 ? 7.095   40.266  31.057  1.00 111.58 ? 140 PRO D CD  1 
ATOM   4894  N  N   . LYS C 2 141 ? 9.475   37.550  33.611  1.00 116.64 ? 141 LYS D N   1 
ATOM   4895  C  CA  . LYS C 2 141 ? 10.412  37.484  34.722  1.00 118.30 ? 141 LYS D CA  1 
ATOM   4896  C  C   . LYS C 2 141 ? 11.575  38.472  34.580  1.00 118.73 ? 141 LYS D C   1 
ATOM   4897  O  O   . LYS C 2 141 ? 12.141  38.901  35.580  1.00 110.21 ? 141 LYS D O   1 
ATOM   4898  C  CB  . LYS C 2 141 ? 10.952  36.057  34.877  1.00 125.92 ? 141 LYS D CB  1 
ATOM   4899  C  CG  . LYS C 2 141 ? 11.909  35.920  36.053  1.00 138.09 ? 141 LYS D CG  1 
ATOM   4900  C  CD  . LYS C 2 141 ? 12.407  34.497  36.269  1.00 150.20 ? 141 LYS D CD  1 
ATOM   4901  C  CE  . LYS C 2 141 ? 13.489  34.475  37.346  1.00 157.94 ? 141 LYS D CE  1 
ATOM   4902  N  NZ  . LYS C 2 141 ? 13.826  33.105  37.827  1.00 158.24 ? 141 LYS D NZ  1 
ATOM   4903  N  N   . ASP C 2 142 ? 11.947  38.816  33.349  1.00 124.48 ? 142 ASP D N   1 
ATOM   4904  C  CA  . ASP C 2 142 ? 13.016  39.788  33.128  1.00 129.80 ? 142 ASP D CA  1 
ATOM   4905  C  C   . ASP C 2 142 ? 12.664  41.099  33.808  1.00 129.75 ? 142 ASP D C   1 
ATOM   4906  O  O   . ASP C 2 142 ? 11.621  41.688  33.525  1.00 133.20 ? 142 ASP D O   1 
ATOM   4907  C  CB  . ASP C 2 142 ? 13.225  40.031  31.639  1.00 139.73 ? 142 ASP D CB  1 
ATOM   4908  C  CG  . ASP C 2 142 ? 13.707  38.800  30.917  1.00 150.86 ? 142 ASP D CG  1 
ATOM   4909  O  OD1 . ASP C 2 142 ? 14.269  37.905  31.580  1.00 153.50 ? 142 ASP D OD1 1 
ATOM   4910  O  OD2 . ASP C 2 142 ? 13.526  38.724  29.685  1.00 167.73 ? 142 ASP D OD2 1 
ATOM   4911  N  N   . ILE C 2 143 ? 13.513  41.532  34.733  1.00 125.42 ? 143 ILE D N   1 
ATOM   4912  C  CA  . ILE C 2 143 ? 13.294  42.781  35.452  1.00 117.03 ? 143 ILE D CA  1 
ATOM   4913  C  C   . ILE C 2 143 ? 14.609  43.299  36.014  1.00 119.97 ? 143 ILE D C   1 
ATOM   4914  O  O   . ILE C 2 143 ? 15.532  42.528  36.273  1.00 119.35 ? 143 ILE D O   1 
ATOM   4915  C  CB  . ILE C 2 143 ? 12.254  42.620  36.584  1.00 110.39 ? 143 ILE D CB  1 
ATOM   4916  C  CG1 . ILE C 2 143 ? 11.812  43.988  37.096  1.00 114.93 ? 143 ILE D CG1 1 
ATOM   4917  C  CG2 . ILE C 2 143 ? 12.810  41.810  37.742  1.00 107.37 ? 143 ILE D CG2 1 
ATOM   4918  C  CD1 . ILE C 2 143 ? 10.528  43.949  37.899  1.00 113.42 ? 143 ILE D CD1 1 
ATOM   4919  N  N   . ASN C 2 144 ? 14.706  44.615  36.166  1.00 127.58 ? 144 ASN D N   1 
ATOM   4920  C  CA  . ASN C 2 144 ? 15.896  45.226  36.741  1.00 132.28 ? 144 ASN D CA  1 
ATOM   4921  C  C   . ASN C 2 144 ? 15.536  46.133  37.901  1.00 124.10 ? 144 ASN D C   1 
ATOM   4922  O  O   . ASN C 2 144 ? 14.584  46.912  37.814  1.00 116.70 ? 144 ASN D O   1 
ATOM   4923  C  CB  . ASN C 2 144 ? 16.678  46.016  35.686  1.00 142.69 ? 144 ASN D CB  1 
ATOM   4924  C  CG  . ASN C 2 144 ? 17.605  47.053  36.302  1.00 152.83 ? 144 ASN D CG  1 
ATOM   4925  O  OD1 . ASN C 2 144 ? 17.205  48.187  36.588  1.00 153.88 ? 144 ASN D OD1 1 
ATOM   4926  N  ND2 . ASN C 2 144 ? 18.854  46.663  36.514  1.00 157.99 ? 144 ASN D ND2 1 
ATOM   4927  N  N   . VAL C 2 145 ? 16.308  46.019  38.981  1.00 120.57 ? 145 VAL D N   1 
ATOM   4928  C  CA  . VAL C 2 145 ? 16.172  46.902  40.124  1.00 117.87 ? 145 VAL D CA  1 
ATOM   4929  C  C   . VAL C 2 145 ? 17.433  47.741  40.315  1.00 122.21 ? 145 VAL D C   1 
ATOM   4930  O  O   . VAL C 2 145 ? 18.559  47.263  40.118  1.00 118.47 ? 145 VAL D O   1 
ATOM   4931  C  CB  . VAL C 2 145 ? 15.885  46.121  41.412  1.00 114.02 ? 145 VAL D CB  1 
ATOM   4932  C  CG1 . VAL C 2 145 ? 16.007  47.025  42.623  1.00 116.15 ? 145 VAL D CG1 1 
ATOM   4933  C  CG2 . VAL C 2 145 ? 14.492  45.523  41.358  1.00 117.02 ? 145 VAL D CG2 1 
ATOM   4934  N  N   . LYS C 2 146 ? 17.216  49.010  40.659  1.00 122.78 ? 146 LYS D N   1 
ATOM   4935  C  CA  . LYS C 2 146 ? 18.289  49.949  40.938  1.00 117.28 ? 146 LYS D CA  1 
ATOM   4936  C  C   . LYS C 2 146 ? 18.024  50.652  42.268  1.00 112.07 ? 146 LYS D C   1 
ATOM   4937  O  O   . LYS C 2 146 ? 16.905  51.114  42.539  1.00 107.13 ? 146 LYS D O   1 
ATOM   4938  C  CB  . LYS C 2 146 ? 18.380  50.983  39.815  1.00 123.35 ? 146 LYS D CB  1 
ATOM   4939  C  CG  . LYS C 2 146 ? 19.147  50.518  38.585  1.00 127.62 ? 146 LYS D CG  1 
ATOM   4940  C  CD  . LYS C 2 146 ? 19.047  51.538  37.460  1.00 133.13 ? 146 LYS D CD  1 
ATOM   4941  C  CE  . LYS C 2 146 ? 19.820  52.802  37.792  1.00 134.74 ? 146 LYS D CE  1 
ATOM   4942  N  NZ  . LYS C 2 146 ? 19.555  53.882  36.811  1.00 141.20 ? 146 LYS D NZ  1 
ATOM   4943  N  N   . TRP C 2 147 ? 19.054  50.721  43.102  1.00 111.20 ? 147 TRP D N   1 
ATOM   4944  C  CA  . TRP C 2 147 ? 18.955  51.435  44.370  1.00 112.10 ? 147 TRP D CA  1 
ATOM   4945  C  C   . TRP C 2 147 ? 19.575  52.821  44.254  1.00 121.95 ? 147 TRP D C   1 
ATOM   4946  O  O   . TRP C 2 147 ? 20.608  52.989  43.611  1.00 129.68 ? 147 TRP D O   1 
ATOM   4947  C  CB  . TRP C 2 147 ? 19.648  50.653  45.485  1.00 108.14 ? 147 TRP D CB  1 
ATOM   4948  C  CG  . TRP C 2 147 ? 18.822  49.533  46.028  1.00 105.47 ? 147 TRP D CG  1 
ATOM   4949  C  CD1 . TRP C 2 147 ? 18.912  48.217  45.689  1.00 105.63 ? 147 TRP D CD1 1 
ATOM   4950  C  CD2 . TRP C 2 147 ? 17.773  49.626  47.000  1.00 101.01 ? 147 TRP D CD2 1 
ATOM   4951  N  NE1 . TRP C 2 147 ? 17.989  47.486  46.387  1.00 101.60 ? 147 TRP D NE1 1 
ATOM   4952  C  CE2 . TRP C 2 147 ? 17.276  48.329  47.198  1.00 99.71  ? 147 TRP D CE2 1 
ATOM   4953  C  CE3 . TRP C 2 147 ? 17.207  50.682  47.723  1.00 101.23 ? 147 TRP D CE3 1 
ATOM   4954  C  CZ2 . TRP C 2 147 ? 16.243  48.053  48.093  1.00 99.40  ? 147 TRP D CZ2 1 
ATOM   4955  C  CZ3 . TRP C 2 147 ? 16.186  50.404  48.614  1.00 98.10  ? 147 TRP D CZ3 1 
ATOM   4956  C  CH2 . TRP C 2 147 ? 15.713  49.101  48.788  1.00 97.89  ? 147 TRP D CH2 1 
ATOM   4957  N  N   . LYS C 2 148 ? 18.940  53.811  44.877  1.00 122.75 ? 148 LYS D N   1 
ATOM   4958  C  CA  . LYS C 2 148 ? 19.506  55.149  44.944  1.00 119.18 ? 148 LYS D CA  1 
ATOM   4959  C  C   . LYS C 2 148 ? 19.461  55.711  46.355  1.00 114.94 ? 148 LYS D C   1 
ATOM   4960  O  O   . LYS C 2 148 ? 18.451  55.635  47.055  1.00 108.26 ? 148 LYS D O   1 
ATOM   4961  C  CB  . LYS C 2 148 ? 18.791  56.083  43.980  1.00 125.13 ? 148 LYS D CB  1 
ATOM   4962  C  CG  . LYS C 2 148 ? 19.215  55.883  42.537  1.00 134.89 ? 148 LYS D CG  1 
ATOM   4963  C  CD  . LYS C 2 148 ? 18.376  56.710  41.580  1.00 142.56 ? 148 LYS D CD  1 
ATOM   4964  C  CE  . LYS C 2 148 ? 18.834  56.497  40.149  1.00 152.37 ? 148 LYS D CE  1 
ATOM   4965  N  NZ  . LYS C 2 148 ? 18.170  57.444  39.215  1.00 163.02 ? 148 LYS D NZ  1 
ATOM   4966  N  N   . ILE C 2 149 ? 20.600  56.239  46.772  1.00 122.09 ? 149 ILE D N   1 
ATOM   4967  C  CA  . ILE C 2 149 ? 20.736  56.918  48.044  1.00 126.31 ? 149 ILE D CA  1 
ATOM   4968  C  C   . ILE C 2 149 ? 21.010  58.401  47.789  1.00 133.44 ? 149 ILE D C   1 
ATOM   4969  O  O   . ILE C 2 149 ? 22.023  58.758  47.176  1.00 137.91 ? 149 ILE D O   1 
ATOM   4970  C  CB  . ILE C 2 149 ? 21.925  56.339  48.822  1.00 126.30 ? 149 ILE D CB  1 
ATOM   4971  C  CG1 . ILE C 2 149 ? 21.656  54.884  49.191  1.00 117.45 ? 149 ILE D CG1 1 
ATOM   4972  C  CG2 . ILE C 2 149 ? 22.214  57.173  50.059  1.00 129.73 ? 149 ILE D CG2 1 
ATOM   4973  C  CD1 . ILE C 2 149 ? 22.874  54.172  49.732  1.00 117.61 ? 149 ILE D CD1 1 
ATOM   4974  N  N   . ASP C 2 150 ? 20.111  59.259  48.263  1.00 129.60 ? 150 ASP D N   1 
ATOM   4975  C  CA  . ASP C 2 150 ? 20.206  60.685  47.982  1.00 132.93 ? 150 ASP D CA  1 
ATOM   4976  C  C   . ASP C 2 150 ? 20.419  60.905  46.490  1.00 139.78 ? 150 ASP D C   1 
ATOM   4977  O  O   . ASP C 2 150 ? 21.259  61.707  46.087  1.00 142.95 ? 150 ASP D O   1 
ATOM   4978  C  CB  . ASP C 2 150 ? 21.360  61.308  48.761  1.00 132.96 ? 150 ASP D CB  1 
ATOM   4979  C  CG  . ASP C 2 150 ? 21.049  61.468  50.229  1.00 131.31 ? 150 ASP D CG  1 
ATOM   4980  O  OD1 . ASP C 2 150 ? 19.859  61.372  50.601  1.00 125.03 ? 150 ASP D OD1 1 
ATOM   4981  O  OD2 . ASP C 2 150 ? 21.996  61.705  51.010  1.00 136.23 ? 150 ASP D OD2 1 
ATOM   4982  N  N   . GLY C 2 151 ? 19.668  60.165  45.676  1.00 142.38 ? 151 GLY D N   1 
ATOM   4983  C  CA  . GLY C 2 151 ? 19.712  60.314  44.220  1.00 146.38 ? 151 GLY D CA  1 
ATOM   4984  C  C   . GLY C 2 151 ? 20.883  59.605  43.565  1.00 146.44 ? 151 GLY D C   1 
ATOM   4985  O  O   . GLY C 2 151 ? 20.872  59.362  42.354  1.00 146.70 ? 151 GLY D O   1 
ATOM   4986  N  N   . SER C 2 152 ? 21.894  59.273  44.365  1.00 144.08 ? 152 SER D N   1 
ATOM   4987  C  CA  . SER C 2 152 ? 23.080  58.594  43.870  1.00 150.86 ? 152 SER D CA  1 
ATOM   4988  C  C   . SER C 2 152 ? 22.887  57.079  43.922  1.00 145.51 ? 152 SER D C   1 
ATOM   4989  O  O   . SER C 2 152 ? 22.425  56.540  44.925  1.00 138.54 ? 152 SER D O   1 
ATOM   4990  C  CB  . SER C 2 152 ? 24.299  58.994  44.699  1.00 154.48 ? 152 SER D CB  1 
ATOM   4991  O  OG  . SER C 2 152 ? 25.499  58.728  43.995  1.00 164.01 ? 152 SER D OG  1 
ATOM   4992  N  N   . GLU C 2 153 ? 23.242  56.405  42.833  1.00 146.96 ? 153 GLU D N   1 
ATOM   4993  C  CA  . GLU C 2 153 ? 22.996  54.977  42.683  1.00 139.76 ? 153 GLU D CA  1 
ATOM   4994  C  C   . GLU C 2 153 ? 23.963  54.161  43.539  1.00 137.29 ? 153 GLU D C   1 
ATOM   4995  O  O   . GLU C 2 153 ? 25.123  54.528  43.721  1.00 132.54 ? 153 GLU D O   1 
ATOM   4996  C  CB  . GLU C 2 153 ? 23.112  54.579  41.205  1.00 146.71 ? 153 GLU D CB  1 
ATOM   4997  C  CG  . GLU C 2 153 ? 22.730  53.139  40.891  1.00 143.72 ? 153 GLU D CG  1 
ATOM   4998  C  CD  . GLU C 2 153 ? 22.816  52.811  39.408  1.00 151.05 ? 153 GLU D CD  1 
ATOM   4999  O  OE1 . GLU C 2 153 ? 23.054  53.726  38.587  1.00 158.41 ? 153 GLU D OE1 1 
ATOM   5000  O  OE2 . GLU C 2 153 ? 22.649  51.624  39.059  1.00 150.11 ? 153 GLU D OE2 1 
ATOM   5001  N  N   . ARG C 2 154 ? 23.461  53.051  44.067  1.00 139.11 ? 154 ARG D N   1 
ATOM   5002  C  CA  . ARG C 2 154 ? 24.250  52.150  44.903  1.00 137.69 ? 154 ARG D CA  1 
ATOM   5003  C  C   . ARG C 2 154 ? 23.973  50.695  44.513  1.00 133.44 ? 154 ARG D C   1 
ATOM   5004  O  O   . ARG C 2 154 ? 22.818  50.294  44.393  1.00 120.25 ? 154 ARG D O   1 
ATOM   5005  C  CB  . ARG C 2 154 ? 23.890  52.381  46.372  1.00 132.37 ? 154 ARG D CB  1 
ATOM   5006  C  CG  . ARG C 2 154 ? 24.567  51.443  47.355  1.00 128.75 ? 154 ARG D CG  1 
ATOM   5007  C  CD  . ARG C 2 154 ? 25.975  51.893  47.706  1.00 132.52 ? 154 ARG D CD  1 
ATOM   5008  N  NE  . ARG C 2 154 ? 26.437  51.236  48.923  1.00 130.58 ? 154 ARG D NE  1 
ATOM   5009  C  CZ  . ARG C 2 154 ? 26.622  51.861  50.080  1.00 134.43 ? 154 ARG D CZ  1 
ATOM   5010  N  NH1 . ARG C 2 154 ? 26.378  53.159  50.187  1.00 138.34 ? 154 ARG D NH1 1 
ATOM   5011  N  NH2 . ARG C 2 154 ? 27.047  51.184  51.138  1.00 136.97 ? 154 ARG D NH2 1 
ATOM   5012  N  N   . GLN C 2 155 ? 25.037  49.917  44.320  1.00 138.24 ? 155 GLN D N   1 
ATOM   5013  C  CA  . GLN C 2 155 ? 24.919  48.529  43.846  1.00 137.12 ? 155 GLN D CA  1 
ATOM   5014  C  C   . GLN C 2 155 ? 25.523  47.516  44.827  1.00 135.62 ? 155 GLN D C   1 
ATOM   5015  O  O   . GLN C 2 155 ? 25.146  46.345  44.850  1.00 127.36 ? 155 GLN D O   1 
ATOM   5016  C  CB  . GLN C 2 155 ? 25.586  48.383  42.478  1.00 143.90 ? 155 GLN D CB  1 
ATOM   5017  C  CG  . GLN C 2 155 ? 24.962  47.305  41.612  1.00 143.73 ? 155 GLN D CG  1 
ATOM   5018  C  CD  . GLN C 2 155 ? 25.216  47.525  40.136  1.00 153.50 ? 155 GLN D CD  1 
ATOM   5019  O  OE1 . GLN C 2 155 ? 25.987  48.400  39.748  1.00 159.91 ? 155 GLN D OE1 1 
ATOM   5020  N  NE2 . GLN C 2 155 ? 24.557  46.733  39.302  1.00 159.98 ? 155 GLN D NE2 1 
ATOM   5021  N  N   . ASN C 2 156 ? 26.453  47.989  45.646  1.00 143.01 ? 156 ASN D N   1 
ATOM   5022  C  CA  . ASN C 2 156 ? 27.131  47.160  46.634  1.00 143.01 ? 156 ASN D CA  1 
ATOM   5023  C  C   . ASN C 2 156 ? 26.290  46.980  47.920  1.00 129.33 ? 156 ASN D C   1 
ATOM   5024  O  O   . ASN C 2 156 ? 25.578  47.894  48.354  1.00 116.94 ? 156 ASN D O   1 
ATOM   5025  C  CB  . ASN C 2 156 ? 28.490  47.802  46.940  1.00 156.20 ? 156 ASN D CB  1 
ATOM   5026  C  CG  . ASN C 2 156 ? 29.255  47.076  48.021  1.00 168.98 ? 156 ASN D CG  1 
ATOM   5027  O  OD1 . ASN C 2 156 ? 29.637  45.919  47.856  1.00 197.23 ? 156 ASN D OD1 1 
ATOM   5028  N  ND2 . ASN C 2 156 ? 29.511  47.764  49.127  1.00 171.19 ? 156 ASN D ND2 1 
ATOM   5029  N  N   . GLY C 2 157 ? 26.361  45.791  48.514  1.00 122.91 ? 157 GLY D N   1 
ATOM   5030  C  CA  . GLY C 2 157 ? 25.563  45.466  49.704  1.00 115.75 ? 157 GLY D CA  1 
ATOM   5031  C  C   . GLY C 2 157 ? 24.094  45.214  49.391  1.00 112.14 ? 157 GLY D C   1 
ATOM   5032  O  O   . GLY C 2 157 ? 23.224  45.336  50.263  1.00 110.01 ? 157 GLY D O   1 
ATOM   5033  N  N   . VAL C 2 158 ? 23.819  44.860  48.140  1.00 106.18 ? 158 VAL D N   1 
ATOM   5034  C  CA  . VAL C 2 158 ? 22.465  44.558  47.693  1.00 100.48 ? 158 VAL D CA  1 
ATOM   5035  C  C   . VAL C 2 158 ? 22.336  43.063  47.439  1.00 101.72 ? 158 VAL D C   1 
ATOM   5036  O  O   . VAL C 2 158 ? 23.224  42.449  46.855  1.00 103.47 ? 158 VAL D O   1 
ATOM   5037  C  CB  . VAL C 2 158 ? 22.125  45.314  46.394  1.00 102.23 ? 158 VAL D CB  1 
ATOM   5038  C  CG1 . VAL C 2 158 ? 20.801  44.837  45.824  1.00 102.94 ? 158 VAL D CG1 1 
ATOM   5039  C  CG2 . VAL C 2 158 ? 22.072  46.811  46.649  1.00 101.84 ? 158 VAL D CG2 1 
ATOM   5040  N  N   . LEU C 2 159 ? 21.231  42.477  47.894  1.00 104.29 ? 159 LEU D N   1 
ATOM   5041  C  CA  . LEU C 2 159 ? 20.950  41.058  47.660  1.00 100.49 ? 159 LEU D CA  1 
ATOM   5042  C  C   . LEU C 2 159 ? 19.538  40.841  47.149  1.00 100.08 ? 159 LEU D C   1 
ATOM   5043  O  O   . LEU C 2 159 ? 18.567  41.389  47.680  1.00 94.69  ? 159 LEU D O   1 
ATOM   5044  C  CB  . LEU C 2 159 ? 21.147  40.244  48.935  1.00 97.60  ? 159 LEU D CB  1 
ATOM   5045  C  CG  . LEU C 2 159 ? 22.604  39.972  49.267  1.00 101.92 ? 159 LEU D CG  1 
ATOM   5046  C  CD1 . LEU C 2 159 ? 22.705  39.227  50.589  1.00 99.53  ? 159 LEU D CD1 1 
ATOM   5047  C  CD2 . LEU C 2 159 ? 23.251  39.194  48.126  1.00 110.95 ? 159 LEU D CD2 1 
ATOM   5048  N  N   . ASN C 2 160 ? 19.433  39.997  46.134  1.00 104.76 ? 160 ASN D N   1 
ATOM   5049  C  CA  . ASN C 2 160 ? 18.173  39.776  45.454  1.00 102.67 ? 160 ASN D CA  1 
ATOM   5050  C  C   . ASN C 2 160 ? 17.699  38.330  45.554  1.00 100.88 ? 160 ASN D C   1 
ATOM   5051  O  O   . ASN C 2 160 ? 18.491  37.408  45.746  1.00 113.39 ? 160 ASN D O   1 
ATOM   5052  C  CB  . ASN C 2 160 ? 18.320  40.175  43.990  1.00 105.73 ? 160 ASN D CB  1 
ATOM   5053  C  CG  . ASN C 2 160 ? 18.498  41.668  43.812  1.00 105.33 ? 160 ASN D CG  1 
ATOM   5054  O  OD1 . ASN C 2 160 ? 18.365  42.445  44.759  1.00 92.08  ? 160 ASN D OD1 1 
ATOM   5055  N  ND2 . ASN C 2 160 ? 18.781  42.078  42.585  1.00 115.83 ? 160 ASN D ND2 1 
ATOM   5056  N  N   . SER C 2 161 ? 16.397  38.140  45.416  1.00 94.56  ? 161 SER D N   1 
ATOM   5057  C  CA  . SER C 2 161 ? 15.822  36.814  45.498  1.00 100.24 ? 161 SER D CA  1 
ATOM   5058  C  C   . SER C 2 161 ? 14.555  36.757  44.644  1.00 101.94 ? 161 SER D C   1 
ATOM   5059  O  O   . SER C 2 161 ? 13.672  37.594  44.793  1.00 106.77 ? 161 SER D O   1 
ATOM   5060  C  CB  . SER C 2 161 ? 15.513  36.479  46.963  1.00 99.27  ? 161 SER D CB  1 
ATOM   5061  O  OG  . SER C 2 161 ? 15.714  35.101  47.233  1.00 102.45 ? 161 SER D OG  1 
ATOM   5062  N  N   . TRP C 2 162 ? 14.482  35.783  43.740  1.00 103.87 ? 162 TRP D N   1 
ATOM   5063  C  CA  . TRP C 2 162 ? 13.289  35.573  42.918  1.00 103.44 ? 162 TRP D CA  1 
ATOM   5064  C  C   . TRP C 2 162 ? 12.536  34.328  43.392  1.00 100.25 ? 162 TRP D C   1 
ATOM   5065  O  O   . TRP C 2 162 ? 13.138  33.345  43.809  1.00 97.49  ? 162 TRP D O   1 
ATOM   5066  C  CB  . TRP C 2 162 ? 13.668  35.399  41.444  1.00 113.27 ? 162 TRP D CB  1 
ATOM   5067  C  CG  . TRP C 2 162 ? 14.295  36.614  40.795  1.00 130.42 ? 162 TRP D CG  1 
ATOM   5068  C  CD1 . TRP C 2 162 ? 13.691  37.480  39.923  1.00 137.89 ? 162 TRP D CD1 1 
ATOM   5069  C  CD2 . TRP C 2 162 ? 15.653  37.074  40.936  1.00 139.45 ? 162 TRP D CD2 1 
ATOM   5070  N  NE1 . TRP C 2 162 ? 14.578  38.461  39.533  1.00 139.82 ? 162 TRP D NE1 1 
ATOM   5071  C  CE2 . TRP C 2 162 ? 15.786  38.236  40.139  1.00 141.20 ? 162 TRP D CE2 1 
ATOM   5072  C  CE3 . TRP C 2 162 ? 16.764  36.625  41.667  1.00 140.30 ? 162 TRP D CE3 1 
ATOM   5073  C  CZ2 . TRP C 2 162 ? 16.983  38.952  40.051  1.00 145.14 ? 162 TRP D CZ2 1 
ATOM   5074  C  CZ3 . TRP C 2 162 ? 17.956  37.336  41.574  1.00 144.95 ? 162 TRP D CZ3 1 
ATOM   5075  C  CH2 . TRP C 2 162 ? 18.055  38.487  40.771  1.00 150.79 ? 162 TRP D CH2 1 
ATOM   5076  N  N   . THR C 2 163 ? 11.210  34.381  43.353  1.00 104.59 ? 163 THR D N   1 
ATOM   5077  C  CA  . THR C 2 163 ? 10.396  33.182  43.550  1.00 100.99 ? 163 THR D CA  1 
ATOM   5078  C  C   . THR C 2 163 ? 10.326  32.409  42.243  1.00 106.39 ? 163 THR D C   1 
ATOM   5079  O  O   . THR C 2 163 ? 10.656  32.942  41.176  1.00 105.83 ? 163 THR D O   1 
ATOM   5080  C  CB  . THR C 2 163 ? 8.956   33.525  43.970  1.00 96.40  ? 163 THR D CB  1 
ATOM   5081  O  OG1 . THR C 2 163 ? 8.336   34.328  42.955  1.00 93.36  ? 163 THR D OG1 1 
ATOM   5082  C  CG2 . THR C 2 163 ? 8.943   34.278  45.287  1.00 93.36  ? 163 THR D CG2 1 
ATOM   5083  N  N   . ASP C 2 164 ? 9.894   31.154  42.327  1.00 108.43 ? 164 ASP D N   1 
ATOM   5084  C  CA  . ASP C 2 164 ? 9.505   30.410  41.137  1.00 112.40 ? 164 ASP D CA  1 
ATOM   5085  C  C   . ASP C 2 164 ? 8.219   30.994  40.622  1.00 105.76 ? 164 ASP D C   1 
ATOM   5086  O  O   . ASP C 2 164 ? 7.531   31.705  41.348  1.00 118.43 ? 164 ASP D O   1 
ATOM   5087  C  CB  . ASP C 2 164 ? 9.271   28.936  41.457  1.00 122.45 ? 164 ASP D CB  1 
ATOM   5088  C  CG  . ASP C 2 164 ? 10.540  28.215  41.834  1.00 131.43 ? 164 ASP D CG  1 
ATOM   5089  O  OD1 . ASP C 2 164 ? 11.638  28.771  41.607  1.00 136.57 ? 164 ASP D OD1 1 
ATOM   5090  O  OD2 . ASP C 2 164 ? 10.434  27.090  42.364  1.00 132.77 ? 164 ASP D OD2 1 
ATOM   5091  N  N   . GLN C 2 165 ? 7.886   30.690  39.373  1.00 101.00 ? 165 GLN D N   1 
ATOM   5092  C  CA  . GLN C 2 165 ? 6.595   31.077  38.826  1.00 96.65  ? 165 GLN D CA  1 
ATOM   5093  C  C   . GLN C 2 165 ? 5.497   30.631  39.777  1.00 97.25  ? 165 GLN D C   1 
ATOM   5094  O  O   . GLN C 2 165 ? 5.530   29.527  40.303  1.00 96.04  ? 165 GLN D O   1 
ATOM   5095  C  CB  . GLN C 2 165 ? 6.381   30.452  37.453  1.00 98.63  ? 165 GLN D CB  1 
ATOM   5096  C  CG  . GLN C 2 165 ? 5.151   30.950  36.717  1.00 99.24  ? 165 GLN D CG  1 
ATOM   5097  C  CD  . GLN C 2 165 ? 5.207   30.629  35.229  1.00 107.47 ? 165 GLN D CD  1 
ATOM   5098  O  OE1 . GLN C 2 165 ? 5.518   29.506  34.830  1.00 109.22 ? 165 GLN D OE1 1 
ATOM   5099  N  NE2 . GLN C 2 165 ? 4.916   31.626  34.399  1.00 119.42 ? 165 GLN D NE2 1 
ATOM   5100  N  N   . ASP C 2 166 ? 4.556   31.519  40.056  1.00 105.69 ? 166 ASP D N   1 
ATOM   5101  C  CA  . ASP C 2 166 ? 3.460   31.181  40.948  1.00 111.42 ? 166 ASP D CA  1 
ATOM   5102  C  C   . ASP C 2 166 ? 2.577   30.158  40.255  1.00 114.09 ? 166 ASP D C   1 
ATOM   5103  O  O   . ASP C 2 166 ? 2.322   30.260  39.058  1.00 113.37 ? 166 ASP D O   1 
ATOM   5104  C  CB  . ASP C 2 166 ? 2.659   32.427  41.310  1.00 116.06 ? 166 ASP D CB  1 
ATOM   5105  C  CG  . ASP C 2 166 ? 1.747   32.206  42.501  1.00 119.21 ? 166 ASP D CG  1 
ATOM   5106  O  OD1 . ASP C 2 166 ? 1.018   31.194  42.505  1.00 114.47 ? 166 ASP D OD1 1 
ATOM   5107  O  OD2 . ASP C 2 166 ? 1.763   33.046  43.431  1.00 133.34 ? 166 ASP D OD2 1 
ATOM   5108  N  N   . SER C 2 167 ? 2.129   29.157  41.003  1.00 119.16 ? 167 SER D N   1 
ATOM   5109  C  CA  . SER C 2 167 ? 1.448   28.011  40.404  1.00 122.89 ? 167 SER D CA  1 
ATOM   5110  C  C   . SER C 2 167 ? -0.004  28.318  40.049  1.00 119.29 ? 167 SER D C   1 
ATOM   5111  O  O   . SER C 2 167 ? -0.612  27.609  39.256  1.00 121.96 ? 167 SER D O   1 
ATOM   5112  C  CB  . SER C 2 167 ? 1.526   26.796  41.335  1.00 128.05 ? 167 SER D CB  1 
ATOM   5113  O  OG  . SER C 2 167 ? 1.138   27.137  42.653  1.00 131.04 ? 167 SER D OG  1 
ATOM   5114  N  N   . LYS C 2 168 ? -0.555  29.381  40.620  1.00 119.70 ? 168 LYS D N   1 
ATOM   5115  C  CA  . LYS C 2 168 ? -1.939  29.744  40.346  1.00 122.45 ? 168 LYS D CA  1 
ATOM   5116  C  C   . LYS C 2 168 ? -2.084  30.938  39.370  1.00 120.88 ? 168 LYS D C   1 
ATOM   5117  O  O   . LYS C 2 168 ? -2.887  30.874  38.438  1.00 123.57 ? 168 LYS D O   1 
ATOM   5118  C  CB  . LYS C 2 168 ? -2.699  29.980  41.664  1.00 131.92 ? 168 LYS D CB  1 
ATOM   5119  C  CG  . LYS C 2 168 ? -2.225  31.174  42.495  1.00 142.70 ? 168 LYS D CG  1 
ATOM   5120  C  CD  . LYS C 2 168 ? -2.839  31.182  43.894  1.00 146.65 ? 168 LYS D CD  1 
ATOM   5121  C  CE  . LYS C 2 168 ? -1.884  31.750  44.936  1.00 142.66 ? 168 LYS D CE  1 
ATOM   5122  N  NZ  . LYS C 2 168 ? -1.534  33.177  44.689  1.00 142.40 ? 168 LYS D NZ  1 
ATOM   5123  N  N   . ASP C 2 169 ? -1.300  32.004  39.552  1.00 116.04 ? 169 ASP D N   1 
ATOM   5124  C  CA  . ASP C 2 169 ? -1.420  33.200  38.696  1.00 113.42 ? 169 ASP D CA  1 
ATOM   5125  C  C   . ASP C 2 169 ? -0.271  33.343  37.691  1.00 109.04 ? 169 ASP D C   1 
ATOM   5126  O  O   . ASP C 2 169 ? -0.268  34.250  36.854  1.00 103.52 ? 169 ASP D O   1 
ATOM   5127  C  CB  . ASP C 2 169 ? -1.558  34.478  39.543  1.00 113.75 ? 169 ASP D CB  1 
ATOM   5128  C  CG  . ASP C 2 169 ? -0.292  34.820  40.316  1.00 116.41 ? 169 ASP D CG  1 
ATOM   5129  O  OD1 . ASP C 2 169 ? 0.798   34.343  39.927  1.00 128.51 ? 169 ASP D OD1 1 
ATOM   5130  O  OD2 . ASP C 2 169 ? -0.379  35.579  41.306  1.00 116.46 ? 169 ASP D OD2 1 
ATOM   5131  N  N   . SER C 2 170 ? 0.716   32.461  37.791  1.00 110.65 ? 170 SER D N   1 
ATOM   5132  C  CA  . SER C 2 170 ? 1.795   32.399  36.806  1.00 110.22 ? 170 SER D CA  1 
ATOM   5133  C  C   . SER C 2 170 ? 2.701   33.633  36.827  1.00 104.27 ? 170 SER D C   1 
ATOM   5134  O  O   . SER C 2 170 ? 3.425   33.902  35.866  1.00 101.62 ? 170 SER D O   1 
ATOM   5135  C  CB  . SER C 2 170 ? 1.218   32.217  35.401  1.00 112.09 ? 170 SER D CB  1 
ATOM   5136  O  OG  . SER C 2 170 ? 0.334   31.118  35.353  1.00 115.40 ? 170 SER D OG  1 
ATOM   5137  N  N   . THR C 2 171 ? 2.662   34.384  37.918  1.00 97.90  ? 171 THR D N   1 
ATOM   5138  C  CA  . THR C 2 171 ? 3.472   35.580  38.017  1.00 94.45  ? 171 THR D CA  1 
ATOM   5139  C  C   . THR C 2 171 ? 4.803   35.252  38.670  1.00 92.24  ? 171 THR D C   1 
ATOM   5140  O  O   . THR C 2 171 ? 5.017   34.139  39.140  1.00 92.48  ? 171 THR D O   1 
ATOM   5141  C  CB  . THR C 2 171 ? 2.772   36.660  38.854  1.00 90.74  ? 171 THR D CB  1 
ATOM   5142  O  OG1 . THR C 2 171 ? 2.538   36.165  40.181  1.00 88.62  ? 171 THR D OG1 1 
ATOM   5143  C  CG2 . THR C 2 171 ? 1.465   37.049  38.213  1.00 91.07  ? 171 THR D CG2 1 
ATOM   5144  N  N   . TYR C 2 172 ? 5.693   36.232  38.690  1.00 88.75  ? 172 TYR D N   1 
ATOM   5145  C  CA  . TYR C 2 172 ? 6.911   36.139  39.453  1.00 85.24  ? 172 TYR D CA  1 
ATOM   5146  C  C   . TYR C 2 172 ? 6.929   37.259  40.475  1.00 85.08  ? 172 TYR D C   1 
ATOM   5147  O  O   . TYR C 2 172 ? 6.172   38.218  40.355  1.00 89.78  ? 172 TYR D O   1 
ATOM   5148  C  CB  . TYR C 2 172 ? 8.100   36.264  38.514  1.00 86.63  ? 172 TYR D CB  1 
ATOM   5149  C  CG  . TYR C 2 172 ? 8.196   35.119  37.544  1.00 93.96  ? 172 TYR D CG  1 
ATOM   5150  C  CD1 . TYR C 2 172 ? 7.554   35.165  36.315  1.00 99.03  ? 172 TYR D CD1 1 
ATOM   5151  C  CD2 . TYR C 2 172 ? 8.921   33.967  37.866  1.00 100.26 ? 172 TYR D CD2 1 
ATOM   5152  C  CE1 . TYR C 2 172 ? 7.649   34.109  35.419  1.00 105.10 ? 172 TYR D CE1 1 
ATOM   5153  C  CE2 . TYR C 2 172 ? 9.017   32.906  36.982  1.00 100.64 ? 172 TYR D CE2 1 
ATOM   5154  C  CZ  . TYR C 2 172 ? 8.382   32.982  35.760  1.00 104.21 ? 172 TYR D CZ  1 
ATOM   5155  O  OH  . TYR C 2 172 ? 8.478   31.932  34.880  1.00 104.76 ? 172 TYR D OH  1 
ATOM   5156  N  N   . SER C 2 173 ? 7.787   37.133  41.481  1.00 83.84  ? 173 SER D N   1 
ATOM   5157  C  CA  . SER C 2 173 ? 8.016   38.204  42.446  1.00 82.48  ? 173 SER D CA  1 
ATOM   5158  C  C   . SER C 2 173 ? 9.471   38.167  42.859  1.00 82.35  ? 173 SER D C   1 
ATOM   5159  O  O   . SER C 2 173 ? 10.107  37.119  42.780  1.00 82.04  ? 173 SER D O   1 
ATOM   5160  C  CB  . SER C 2 173 ? 7.121   38.035  43.682  1.00 81.90  ? 173 SER D CB  1 
ATOM   5161  O  OG  . SER C 2 173 ? 5.776   37.795  43.313  1.00 83.36  ? 173 SER D OG  1 
ATOM   5162  N  N   . MET C 2 174 ? 10.006  39.306  43.286  1.00 85.21  ? 174 MET D N   1 
ATOM   5163  C  CA  . MET C 2 174 ? 11.363  39.337  43.809  1.00 88.43  ? 174 MET D CA  1 
ATOM   5164  C  C   . MET C 2 174 ? 11.515  40.342  44.938  1.00 84.42  ? 174 MET D C   1 
ATOM   5165  O  O   . MET C 2 174 ? 10.777  41.322  45.019  1.00 87.54  ? 174 MET D O   1 
ATOM   5166  C  CB  . MET C 2 174 ? 12.371  39.639  42.694  1.00 91.77  ? 174 MET D CB  1 
ATOM   5167  C  CG  . MET C 2 174 ? 12.713  41.107  42.502  1.00 95.33  ? 174 MET D CG  1 
ATOM   5168  S  SD  . MET C 2 174 ? 14.272  41.308  41.621  1.00 106.33 ? 174 MET D SD  1 
ATOM   5169  C  CE  . MET C 2 174 ? 15.349  41.802  42.962  1.00 108.38 ? 174 MET D CE  1 
ATOM   5170  N  N   . SER C 2 175 ? 12.484  40.085  45.805  1.00 80.77  ? 175 SER D N   1 
ATOM   5171  C  CA  . SER C 2 175 ? 12.841  41.022  46.847  1.00 81.80  ? 175 SER D CA  1 
ATOM   5172  C  C   . SER C 2 175 ? 14.209  41.571  46.500  1.00 85.23  ? 175 SER D C   1 
ATOM   5173  O  O   . SER C 2 175 ? 15.029  40.846  45.936  1.00 86.16  ? 175 SER D O   1 
ATOM   5174  C  CB  . SER C 2 175 ? 12.894  40.308  48.191  1.00 82.59  ? 175 SER D CB  1 
ATOM   5175  O  OG  . SER C 2 175 ? 14.145  39.679  48.359  1.00 91.59  ? 175 SER D OG  1 
ATOM   5176  N  N   . SER C 2 176 ? 14.454  42.844  46.816  1.00 85.84  ? 176 SER D N   1 
ATOM   5177  C  CA  . SER C 2 176 ? 15.815  43.382  46.801  1.00 83.64  ? 176 SER D CA  1 
ATOM   5178  C  C   . SER C 2 176 ? 16.137  44.022  48.135  1.00 78.54  ? 176 SER D C   1 
ATOM   5179  O  O   . SER C 2 176 ? 15.315  44.753  48.682  1.00 77.13  ? 176 SER D O   1 
ATOM   5180  C  CB  . SER C 2 176 ? 16.002  44.402  45.692  1.00 83.17  ? 176 SER D CB  1 
ATOM   5181  O  OG  . SER C 2 176 ? 17.389  44.614  45.475  1.00 86.34  ? 176 SER D OG  1 
ATOM   5182  N  N   . THR C 2 177 ? 17.329  43.747  48.654  1.00 76.09  ? 177 THR D N   1 
ATOM   5183  C  CA  . THR C 2 177 ? 17.666  44.160  50.001  1.00 79.69  ? 177 THR D CA  1 
ATOM   5184  C  C   . THR C 2 177 ? 19.021  44.833  50.060  1.00 85.88  ? 177 THR D C   1 
ATOM   5185  O  O   . THR C 2 177 ? 20.070  44.205  49.874  1.00 85.06  ? 177 THR D O   1 
ATOM   5186  C  CB  . THR C 2 177 ? 17.656  42.976  50.970  1.00 85.24  ? 177 THR D CB  1 
ATOM   5187  O  OG1 . THR C 2 177 ? 16.364  42.362  50.955  1.00 94.96  ? 177 THR D OG1 1 
ATOM   5188  C  CG2 . THR C 2 177 ? 17.984  43.430  52.390  1.00 85.38  ? 177 THR D CG2 1 
ATOM   5189  N  N   . LEU C 2 178 ? 18.976  46.129  50.339  1.00 90.43  ? 178 LEU D N   1 
ATOM   5190  C  CA  . LEU C 2 178 ? 20.166  46.921  50.568  1.00 92.88  ? 178 LEU D CA  1 
ATOM   5191  C  C   . LEU C 2 178 ? 20.506  46.834  52.042  1.00 93.91  ? 178 LEU D C   1 
ATOM   5192  O  O   . LEU C 2 178 ? 19.730  47.273  52.894  1.00 96.56  ? 178 LEU D O   1 
ATOM   5193  C  CB  . LEU C 2 178 ? 19.897  48.372  50.168  1.00 92.80  ? 178 LEU D CB  1 
ATOM   5194  C  CG  . LEU C 2 178 ? 21.035  49.381  50.318  1.00 92.00  ? 178 LEU D CG  1 
ATOM   5195  C  CD1 . LEU C 2 178 ? 22.341  48.878  49.717  1.00 94.36  ? 178 LEU D CD1 1 
ATOM   5196  C  CD2 . LEU C 2 178 ? 20.606  50.681  49.663  1.00 90.70  ? 178 LEU D CD2 1 
ATOM   5197  N  N   . THR C 2 179 ? 21.637  46.215  52.350  1.00 96.30  ? 179 THR D N   1 
ATOM   5198  C  CA  . THR C 2 179 ? 22.065  46.098  53.729  1.00 100.28 ? 179 THR D CA  1 
ATOM   5199  C  C   . THR C 2 179 ? 23.207  47.054  53.968  1.00 103.15 ? 179 THR D C   1 
ATOM   5200  O  O   . THR C 2 179 ? 24.238  46.959  53.313  1.00 114.54 ? 179 THR D O   1 
ATOM   5201  C  CB  . THR C 2 179 ? 22.547  44.679  54.048  1.00 112.43 ? 179 THR D CB  1 
ATOM   5202  O  OG1 . THR C 2 179 ? 21.542  43.729  53.661  1.00 114.92 ? 179 THR D OG1 1 
ATOM   5203  C  CG2 . THR C 2 179 ? 22.846  44.551  55.535  1.00 116.06 ? 179 THR D CG2 1 
ATOM   5204  N  N   . LEU C 2 180 ? 23.014  47.981  54.899  1.00 109.59 ? 180 LEU D N   1 
ATOM   5205  C  CA  . LEU C 2 180 ? 24.060  48.931  55.280  1.00 111.25 ? 180 LEU D CA  1 
ATOM   5206  C  C   . LEU C 2 180 ? 24.328  48.833  56.761  1.00 110.63 ? 180 LEU D C   1 
ATOM   5207  O  O   . LEU C 2 180 ? 23.555  48.219  57.505  1.00 112.13 ? 180 LEU D O   1 
ATOM   5208  C  CB  . LEU C 2 180 ? 23.635  50.365  54.997  1.00 106.63 ? 180 LEU D CB  1 
ATOM   5209  C  CG  . LEU C 2 180 ? 23.037  50.649  53.629  1.00 108.99 ? 180 LEU D CG  1 
ATOM   5210  C  CD1 . LEU C 2 180 ? 22.326  51.995  53.672  1.00 107.90 ? 180 LEU D CD1 1 
ATOM   5211  C  CD2 . LEU C 2 180 ? 24.117  50.615  52.553  1.00 117.50 ? 180 LEU D CD2 1 
ATOM   5212  N  N   . THR C 2 181 ? 25.419  49.456  57.188  1.00 104.12 ? 181 THR D N   1 
ATOM   5213  C  CA  . THR C 2 181 ? 25.626  49.704  58.599  1.00 103.57 ? 181 THR D CA  1 
ATOM   5214  C  C   . THR C 2 181 ? 24.780  50.917  58.988  1.00 103.40 ? 181 THR D C   1 
ATOM   5215  O  O   . THR C 2 181 ? 24.474  51.771  58.150  1.00 102.56 ? 181 THR D O   1 
ATOM   5216  C  CB  . THR C 2 181 ? 27.120  49.919  58.937  1.00 106.57 ? 181 THR D CB  1 
ATOM   5217  O  OG1 . THR C 2 181 ? 27.261  50.279  60.317  1.00 106.02 ? 181 THR D OG1 1 
ATOM   5218  C  CG2 . THR C 2 181 ? 27.739  51.009  58.070  1.00 109.79 ? 181 THR D CG2 1 
ATOM   5219  N  N   . LYS C 2 182 ? 24.382  50.978  60.255  1.00 102.62 ? 182 LYS D N   1 
ATOM   5220  C  CA  . LYS C 2 182 ? 23.596  52.103  60.765  1.00 98.62  ? 182 LYS D CA  1 
ATOM   5221  C  C   . LYS C 2 182 ? 24.249  53.434  60.437  1.00 99.81  ? 182 LYS D C   1 
ATOM   5222  O  O   . LYS C 2 182 ? 23.566  54.385  60.088  1.00 98.29  ? 182 LYS D O   1 
ATOM   5223  C  CB  . LYS C 2 182 ? 23.432  51.979  62.275  1.00 100.03 ? 182 LYS D CB  1 
ATOM   5224  C  CG  . LYS C 2 182 ? 22.510  53.005  62.904  1.00 99.20  ? 182 LYS D CG  1 
ATOM   5225  C  CD  . LYS C 2 182 ? 22.835  53.145  64.380  1.00 107.53 ? 182 LYS D CD  1 
ATOM   5226  C  CE  . LYS C 2 182 ? 21.688  53.738  65.177  1.00 113.02 ? 182 LYS D CE  1 
ATOM   5227  N  NZ  . LYS C 2 182 ? 21.867  53.463  66.633  1.00 121.93 ? 182 LYS D NZ  1 
ATOM   5228  N  N   . ASP C 2 183 ? 25.574  53.492  60.558  1.00 114.26 ? 183 ASP D N   1 
ATOM   5229  C  CA  . ASP C 2 183 ? 26.337  54.672  60.151  1.00 121.00 ? 183 ASP D CA  1 
ATOM   5230  C  C   . ASP C 2 183 ? 25.982  55.156  58.753  1.00 113.19 ? 183 ASP D C   1 
ATOM   5231  O  O   . ASP C 2 183 ? 25.469  56.259  58.601  1.00 106.11 ? 183 ASP D O   1 
ATOM   5232  C  CB  . ASP C 2 183 ? 27.844  54.432  60.245  1.00 132.85 ? 183 ASP D CB  1 
ATOM   5233  C  CG  . ASP C 2 183 ? 28.483  55.259  61.336  1.00 143.42 ? 183 ASP D CG  1 
ATOM   5234  O  OD1 . ASP C 2 183 ? 27.755  55.671  62.271  1.00 142.60 ? 183 ASP D OD1 1 
ATOM   5235  O  OD2 . ASP C 2 183 ? 29.700  55.528  61.240  1.00 153.38 ? 183 ASP D OD2 1 
ATOM   5236  N  N   . GLU C 2 184 ? 26.275  54.343  57.741  1.00 109.35 ? 184 GLU D N   1 
ATOM   5237  C  CA  . GLU C 2 184 ? 26.010  54.721  56.358  1.00 111.80 ? 184 GLU D CA  1 
ATOM   5238  C  C   . GLU C 2 184 ? 24.562  55.160  56.216  1.00 107.14 ? 184 GLU D C   1 
ATOM   5239  O  O   . GLU C 2 184 ? 24.274  56.129  55.523  1.00 105.98 ? 184 GLU D O   1 
ATOM   5240  C  CB  . GLU C 2 184 ? 26.292  53.558  55.402  1.00 120.93 ? 184 GLU D CB  1 
ATOM   5241  C  CG  . GLU C 2 184 ? 27.757  53.150  55.316  1.00 138.73 ? 184 GLU D CG  1 
ATOM   5242  C  CD  . GLU C 2 184 ? 27.957  51.747  54.757  1.00 150.01 ? 184 GLU D CD  1 
ATOM   5243  O  OE1 . GLU C 2 184 ? 27.020  50.912  54.856  1.00 142.94 ? 184 GLU D OE1 1 
ATOM   5244  O  OE2 . GLU C 2 184 ? 29.066  51.474  54.240  1.00 154.56 ? 184 GLU D OE2 1 
ATOM   5245  N  N   . TYR C 2 185 ? 23.652  54.444  56.876  1.00 105.77 ? 185 TYR D N   1 
ATOM   5246  C  CA  . TYR C 2 185 ? 22.223  54.731  56.760  1.00 100.63 ? 185 TYR D CA  1 
ATOM   5247  C  C   . TYR C 2 185 ? 21.900  56.144  57.208  1.00 98.01  ? 185 TYR D C   1 
ATOM   5248  O  O   . TYR C 2 185 ? 21.189  56.866  56.519  1.00 94.61  ? 185 TYR D O   1 
ATOM   5249  C  CB  . TYR C 2 185 ? 21.390  53.752  57.592  1.00 97.00  ? 185 TYR D CB  1 
ATOM   5250  C  CG  . TYR C 2 185 ? 19.906  54.050  57.569  1.00 96.91  ? 185 TYR D CG  1 
ATOM   5251  C  CD1 . TYR C 2 185 ? 19.206  54.107  56.358  1.00 97.15  ? 185 TYR D CD1 1 
ATOM   5252  C  CD2 . TYR C 2 185 ? 19.201  54.272  58.747  1.00 94.43  ? 185 TYR D CD2 1 
ATOM   5253  C  CE1 . TYR C 2 185 ? 17.847  54.381  56.325  1.00 92.69  ? 185 TYR D CE1 1 
ATOM   5254  C  CE2 . TYR C 2 185 ? 17.839  54.547  58.725  1.00 94.65  ? 185 TYR D CE2 1 
ATOM   5255  C  CZ  . TYR C 2 185 ? 17.161  54.595  57.516  1.00 91.58  ? 185 TYR D CZ  1 
ATOM   5256  O  OH  . TYR C 2 185 ? 15.805  54.869  57.508  1.00 84.12  ? 185 TYR D OH  1 
ATOM   5257  N  N   . GLU C 2 186 ? 22.408  56.517  58.379  1.00 99.26  ? 186 GLU D N   1 
ATOM   5258  C  CA  . GLU C 2 186 ? 22.047  57.781  59.006  1.00 101.37 ? 186 GLU D CA  1 
ATOM   5259  C  C   . GLU C 2 186 ? 22.721  58.975  58.336  1.00 108.20 ? 186 GLU D C   1 
ATOM   5260  O  O   . GLU C 2 186 ? 22.341  60.114  58.584  1.00 111.71 ? 186 GLU D O   1 
ATOM   5261  C  CB  . GLU C 2 186 ? 22.388  57.763  60.495  1.00 100.74 ? 186 GLU D CB  1 
ATOM   5262  C  CG  . GLU C 2 186 ? 21.467  56.885  61.324  1.00 105.62 ? 186 GLU D CG  1 
ATOM   5263  C  CD  . GLU C 2 186 ? 21.807  56.910  62.806  1.00 112.55 ? 186 GLU D CD  1 
ATOM   5264  O  OE1 . GLU C 2 186 ? 22.919  57.358  63.153  1.00 121.43 ? 186 GLU D OE1 1 
ATOM   5265  O  OE2 . GLU C 2 186 ? 20.971  56.469  63.628  1.00 113.82 ? 186 GLU D OE2 1 
ATOM   5266  N  N   . ARG C 2 187 ? 23.710  58.720  57.484  1.00 111.45 ? 187 ARG D N   1 
ATOM   5267  C  CA  . ARG C 2 187 ? 24.408  59.797  56.795  1.00 112.27 ? 187 ARG D CA  1 
ATOM   5268  C  C   . ARG C 2 187 ? 23.552  60.391  55.692  1.00 116.60 ? 187 ARG D C   1 
ATOM   5269  O  O   . ARG C 2 187 ? 23.683  61.570  55.376  1.00 143.47 ? 187 ARG D O   1 
ATOM   5270  C  CB  . ARG C 2 187 ? 25.731  59.307  56.218  1.00 117.39 ? 187 ARG D CB  1 
ATOM   5271  C  CG  . ARG C 2 187 ? 26.699  58.832  57.287  1.00 126.56 ? 187 ARG D CG  1 
ATOM   5272  C  CD  . ARG C 2 187 ? 28.148  59.117  56.929  1.00 138.54 ? 187 ARG D CD  1 
ATOM   5273  N  NE  . ARG C 2 187 ? 29.010  57.975  57.238  1.00 144.88 ? 187 ARG D NE  1 
ATOM   5274  C  CZ  . ARG C 2 187 ? 29.269  56.979  56.393  1.00 141.54 ? 187 ARG D CZ  1 
ATOM   5275  N  NH1 . ARG C 2 187 ? 28.744  56.981  55.174  1.00 142.79 ? 187 ARG D NH1 1 
ATOM   5276  N  NH2 . ARG C 2 187 ? 30.055  55.978  56.764  1.00 136.25 ? 187 ARG D NH2 1 
ATOM   5277  N  N   . HIS C 2 188 ? 22.661  59.588  55.117  1.00 112.91 ? 188 HIS D N   1 
ATOM   5278  C  CA  . HIS C 2 188 ? 21.806  60.060  54.032  1.00 112.28 ? 188 HIS D CA  1 
ATOM   5279  C  C   . HIS C 2 188 ? 20.330  60.068  54.409  1.00 108.06 ? 188 HIS D C   1 
ATOM   5280  O  O   . HIS C 2 188 ? 19.942  59.560  55.463  1.00 102.52 ? 188 HIS D O   1 
ATOM   5281  C  CB  . HIS C 2 188 ? 22.059  59.219  52.787  1.00 114.46 ? 188 HIS D CB  1 
ATOM   5282  C  CG  . HIS C 2 188 ? 23.498  59.190  52.385  1.00 123.91 ? 188 HIS D CG  1 
ATOM   5283  N  ND1 . HIS C 2 188 ? 24.092  60.220  51.688  1.00 136.04 ? 188 HIS D ND1 1 
ATOM   5284  C  CD2 . HIS C 2 188 ? 24.476  58.289  52.631  1.00 127.14 ? 188 HIS D CD2 1 
ATOM   5285  C  CE1 . HIS C 2 188 ? 25.368  59.941  51.498  1.00 140.69 ? 188 HIS D CE1 1 
ATOM   5286  N  NE2 . HIS C 2 188 ? 25.628  58.777  52.066  1.00 137.41 ? 188 HIS D NE2 1 
ATOM   5287  N  N   . ASN C 2 189 ? 19.510  60.665  53.552  1.00 110.90 ? 189 ASN D N   1 
ATOM   5288  C  CA  . ASN C 2 189 ? 18.122  60.932  53.902  1.00 114.73 ? 189 ASN D CA  1 
ATOM   5289  C  C   . ASN C 2 189 ? 17.099  60.312  52.950  1.00 115.05 ? 189 ASN D C   1 
ATOM   5290  O  O   . ASN C 2 189 ? 16.096  59.759  53.400  1.00 112.54 ? 189 ASN D O   1 
ATOM   5291  C  CB  . ASN C 2 189 ? 17.884  62.432  53.982  1.00 117.89 ? 189 ASN D CB  1 
ATOM   5292  C  CG  . ASN C 2 189 ? 16.583  62.764  54.665  1.00 118.57 ? 189 ASN D CG  1 
ATOM   5293  O  OD1 . ASN C 2 189 ? 15.676  63.325  54.056  1.00 132.29 ? 189 ASN D OD1 1 
ATOM   5294  N  ND2 . ASN C 2 189 ? 16.462  62.369  55.924  1.00 116.84 ? 189 ASN D ND2 1 
ATOM   5295  N  N   . SER C 2 190 ? 17.340  60.426  51.646  1.00 116.26 ? 190 SER D N   1 
ATOM   5296  C  CA  . SER C 2 190 ? 16.429  59.873  50.641  1.00 117.61 ? 190 SER D CA  1 
ATOM   5297  C  C   . SER C 2 190 ? 16.886  58.496  50.140  1.00 121.74 ? 190 SER D C   1 
ATOM   5298  O  O   . SER C 2 190 ? 18.039  58.323  49.731  1.00 120.14 ? 190 SER D O   1 
ATOM   5299  C  CB  . SER C 2 190 ? 16.306  60.835  49.460  1.00 122.55 ? 190 SER D CB  1 
ATOM   5300  O  OG  . SER C 2 190 ? 15.395  60.343  48.490  1.00 119.07 ? 190 SER D OG  1 
ATOM   5301  N  N   . TYR C 2 191 ? 15.968  57.528  50.164  1.00 123.62 ? 191 TYR D N   1 
ATOM   5302  C  CA  . TYR C 2 191 ? 16.247  56.159  49.716  1.00 111.81 ? 191 TYR D CA  1 
ATOM   5303  C  C   . TYR C 2 191 ? 15.203  55.717  48.704  1.00 111.54 ? 191 TYR D C   1 
ATOM   5304  O  O   . TYR C 2 191 ? 14.003  55.753  48.980  1.00 106.25 ? 191 TYR D O   1 
ATOM   5305  C  CB  . TYR C 2 191 ? 16.242  55.198  50.900  1.00 101.82 ? 191 TYR D CB  1 
ATOM   5306  C  CG  . TYR C 2 191 ? 17.466  55.324  51.766  1.00 102.14 ? 191 TYR D CG  1 
ATOM   5307  C  CD1 . TYR C 2 191 ? 18.629  54.630  51.460  1.00 102.65 ? 191 TYR D CD1 1 
ATOM   5308  C  CD2 . TYR C 2 191 ? 17.475  56.164  52.873  1.00 103.83 ? 191 TYR D CD2 1 
ATOM   5309  C  CE1 . TYR C 2 191 ? 19.753  54.739  52.254  1.00 104.25 ? 191 TYR D CE1 1 
ATOM   5310  C  CE2 . TYR C 2 191 ? 18.597  56.284  53.671  1.00 105.06 ? 191 TYR D CE2 1 
ATOM   5311  C  CZ  . TYR C 2 191 ? 19.734  55.572  53.354  1.00 106.72 ? 191 TYR D CZ  1 
ATOM   5312  O  OH  . TYR C 2 191 ? 20.855  55.700  54.137  1.00 103.66 ? 191 TYR D OH  1 
ATOM   5313  N  N   . THR C 2 192 ? 15.659  55.331  47.518  1.00 114.44 ? 192 THR D N   1 
ATOM   5314  C  CA  . THR C 2 192 ? 14.743  55.036  46.433  1.00 115.44 ? 192 THR D CA  1 
ATOM   5315  C  C   . THR C 2 192 ? 15.062  53.710  45.778  1.00 114.65 ? 192 THR D C   1 
ATOM   5316  O  O   . THR C 2 192 ? 16.220  53.370  45.531  1.00 106.60 ? 192 THR D O   1 
ATOM   5317  C  CB  . THR C 2 192 ? 14.751  56.127  45.345  1.00 121.97 ? 192 THR D CB  1 
ATOM   5318  O  OG1 . THR C 2 192 ? 15.922  55.990  44.536  1.00 126.32 ? 192 THR D OG1 1 
ATOM   5319  C  CG2 . THR C 2 192 ? 14.730  57.504  45.964  1.00 131.83 ? 192 THR D CG2 1 
ATOM   5320  N  N   . CYS C 2 193 ? 13.995  52.994  45.459  1.00 121.93 ? 193 CYS D N   1 
ATOM   5321  C  CA  . CYS C 2 193 ? 14.075  51.703  44.818  1.00 117.91 ? 193 CYS D CA  1 
ATOM   5322  C  C   . CYS C 2 193 ? 13.415  51.844  43.455  1.00 122.06 ? 193 CYS D C   1 
ATOM   5323  O  O   . CYS C 2 193 ? 12.267  52.287  43.358  1.00 127.70 ? 193 CYS D O   1 
ATOM   5324  C  CB  . CYS C 2 193 ? 13.329  50.695  45.679  1.00 114.71 ? 193 CYS D CB  1 
ATOM   5325  S  SG  . CYS C 2 193 ? 13.161  49.044  44.986  1.00 122.25 ? 193 CYS D SG  1 
ATOM   5326  N  N   . GLU C 2 194 ? 14.142  51.483  42.402  1.00 119.58 ? 194 GLU D N   1 
ATOM   5327  C  CA  . GLU C 2 194 ? 13.734  51.833  41.046  1.00 125.45 ? 194 GLU D CA  1 
ATOM   5328  C  C   . GLU C 2 194 ? 13.695  50.607  40.137  1.00 127.03 ? 194 GLU D C   1 
ATOM   5329  O  O   . GLU C 2 194 ? 14.711  49.938  39.938  1.00 131.22 ? 194 GLU D O   1 
ATOM   5330  C  CB  . GLU C 2 194 ? 14.699  52.878  40.498  1.00 132.20 ? 194 GLU D CB  1 
ATOM   5331  C  CG  . GLU C 2 194 ? 14.346  53.444  39.136  1.00 142.16 ? 194 GLU D CG  1 
ATOM   5332  C  CD  . GLU C 2 194 ? 15.307  54.539  38.728  1.00 152.73 ? 194 GLU D CD  1 
ATOM   5333  O  OE1 . GLU C 2 194 ? 15.261  55.618  39.355  1.00 155.15 ? 194 GLU D OE1 1 
ATOM   5334  O  OE2 . GLU C 2 194 ? 16.115  54.319  37.802  1.00 157.04 ? 194 GLU D OE2 1 
ATOM   5335  N  N   . ALA C 2 195 ? 12.513  50.321  39.591  1.00 126.80 ? 195 ALA D N   1 
ATOM   5336  C  CA  . ALA C 2 195 ? 12.271  49.075  38.862  1.00 128.11 ? 195 ALA D CA  1 
ATOM   5337  C  C   . ALA C 2 195 ? 12.071  49.323  37.369  1.00 128.64 ? 195 ALA D C   1 
ATOM   5338  O  O   . ALA C 2 195 ? 11.197  50.088  36.974  1.00 132.32 ? 195 ALA D O   1 
ATOM   5339  C  CB  . ALA C 2 195 ? 11.052  48.361  39.437  1.00 123.84 ? 195 ALA D CB  1 
ATOM   5340  N  N   . THR C 2 196 ? 12.863  48.648  36.542  1.00 127.77 ? 196 THR D N   1 
ATOM   5341  C  CA  . THR C 2 196 ? 12.669  48.694  35.091  1.00 128.36 ? 196 THR D CA  1 
ATOM   5342  C  C   . THR C 2 196 ? 12.113  47.371  34.567  1.00 126.71 ? 196 THR D C   1 
ATOM   5343  O  O   . THR C 2 196 ? 12.773  46.338  34.655  1.00 124.68 ? 196 THR D O   1 
ATOM   5344  C  CB  . THR C 2 196 ? 13.982  49.022  34.367  1.00 127.03 ? 196 THR D CB  1 
ATOM   5345  O  OG1 . THR C 2 196 ? 14.368  50.358  34.694  1.00 129.85 ? 196 THR D OG1 1 
ATOM   5346  C  CG2 . THR C 2 196 ? 13.824  48.905  32.859  1.00 127.61 ? 196 THR D CG2 1 
ATOM   5347  N  N   . HIS C 2 197 ? 10.885  47.415  34.050  1.00 127.75 ? 197 HIS D N   1 
ATOM   5348  C  CA  . HIS C 2 197 ? 10.205  46.234  33.514  1.00 126.82 ? 197 HIS D CA  1 
ATOM   5349  C  C   . HIS C 2 197 ? 9.686   46.534  32.112  1.00 129.48 ? 197 HIS D C   1 
ATOM   5350  O  O   . HIS C 2 197 ? 9.437   47.682  31.770  1.00 133.19 ? 197 HIS D O   1 
ATOM   5351  C  CB  . HIS C 2 197 ? 9.046   45.809  34.440  1.00 127.09 ? 197 HIS D CB  1 
ATOM   5352  C  CG  . HIS C 2 197 ? 8.539   44.415  34.191  1.00 127.83 ? 197 HIS D CG  1 
ATOM   5353  N  ND1 . HIS C 2 197 ? 7.230   44.145  33.853  1.00 123.43 ? 197 HIS D ND1 1 
ATOM   5354  C  CD2 . HIS C 2 197 ? 9.166   43.213  34.241  1.00 124.11 ? 197 HIS D CD2 1 
ATOM   5355  C  CE1 . HIS C 2 197 ? 7.075   42.841  33.700  1.00 120.53 ? 197 HIS D CE1 1 
ATOM   5356  N  NE2 . HIS C 2 197 ? 8.233   42.252  33.935  1.00 118.96 ? 197 HIS D NE2 1 
ATOM   5357  N  N   . LYS C 2 198 ? 9.541   45.489  31.308  1.00 133.67 ? 198 LYS D N   1 
ATOM   5358  C  CA  . LYS C 2 198 ? 9.038   45.594  29.939  1.00 141.63 ? 198 LYS D CA  1 
ATOM   5359  C  C   . LYS C 2 198 ? 7.728   46.373  29.839  1.00 137.24 ? 198 LYS D C   1 
ATOM   5360  O  O   . LYS C 2 198 ? 7.469   47.034  28.835  1.00 136.95 ? 198 LYS D O   1 
ATOM   5361  C  CB  . LYS C 2 198 ? 8.835   44.178  29.382  1.00 147.06 ? 198 LYS D CB  1 
ATOM   5362  C  CG  . LYS C 2 198 ? 8.368   44.103  27.940  1.00 156.31 ? 198 LYS D CG  1 
ATOM   5363  C  CD  . LYS C 2 198 ? 8.374   42.663  27.444  1.00 154.41 ? 198 LYS D CD  1 
ATOM   5364  C  CE  . LYS C 2 198 ? 6.998   42.029  27.522  1.00 158.19 ? 198 LYS D CE  1 
ATOM   5365  N  NZ  . LYS C 2 198 ? 7.033   40.663  26.933  1.00 164.67 ? 198 LYS D NZ  1 
ATOM   5366  N  N   . THR C 2 199 ? 6.912   46.289  30.886  1.00 133.91 ? 199 THR D N   1 
ATOM   5367  C  CA  . THR C 2 199 ? 5.546   46.816  30.869  1.00 136.06 ? 199 THR D CA  1 
ATOM   5368  C  C   . THR C 2 199 ? 5.486   48.348  30.812  1.00 144.66 ? 199 THR D C   1 
ATOM   5369  O  O   . THR C 2 199 ? 4.421   48.919  30.572  1.00 148.23 ? 199 THR D O   1 
ATOM   5370  C  CB  . THR C 2 199 ? 4.744   46.343  32.101  1.00 129.67 ? 199 THR D CB  1 
ATOM   5371  O  OG1 . THR C 2 199 ? 5.520   46.537  33.289  1.00 123.90 ? 199 THR D OG1 1 
ATOM   5372  C  CG2 . THR C 2 199 ? 4.386   44.879  31.985  1.00 128.46 ? 199 THR D CG2 1 
ATOM   5373  N  N   . SER C 2 200 ? 6.616   49.012  31.041  1.00 145.79 ? 200 SER D N   1 
ATOM   5374  C  CA  . SER C 2 200 ? 6.686   50.463  30.892  1.00 150.16 ? 200 SER D CA  1 
ATOM   5375  C  C   . SER C 2 200 ? 8.070   50.923  30.446  1.00 150.55 ? 200 SER D C   1 
ATOM   5376  O  O   . SER C 2 200 ? 9.085   50.323  30.805  1.00 145.83 ? 200 SER D O   1 
ATOM   5377  C  CB  . SER C 2 200 ? 6.309   51.153  32.205  1.00 151.19 ? 200 SER D CB  1 
ATOM   5378  O  OG  . SER C 2 200 ? 6.113   52.545  32.009  1.00 159.26 ? 200 SER D OG  1 
ATOM   5379  N  N   . THR C 2 201 ? 8.099   51.993  29.659  1.00 154.72 ? 201 THR D N   1 
ATOM   5380  C  CA  . THR C 2 201 ? 9.350   52.605  29.240  1.00 157.00 ? 201 THR D CA  1 
ATOM   5381  C  C   . THR C 2 201 ? 9.944   53.388  30.405  1.00 153.20 ? 201 THR D C   1 
ATOM   5382  O  O   . THR C 2 201 ? 11.157  53.540  30.510  1.00 152.87 ? 201 THR D O   1 
ATOM   5383  C  CB  . THR C 2 201 ? 9.129   53.564  28.059  1.00 167.02 ? 201 THR D CB  1 
ATOM   5384  O  OG1 . THR C 2 201 ? 8.370   54.693  28.501  1.00 174.38 ? 201 THR D OG1 1 
ATOM   5385  C  CG2 . THR C 2 201 ? 8.384   52.867  26.927  1.00 168.90 ? 201 THR D CG2 1 
ATOM   5386  N  N   . SER C 2 202 ? 9.076   53.878  31.282  1.00 151.85 ? 202 SER D N   1 
ATOM   5387  C  CA  . SER C 2 202 ? 9.495   54.693  32.416  1.00 149.43 ? 202 SER D CA  1 
ATOM   5388  C  C   . SER C 2 202 ? 9.523   53.875  33.711  1.00 138.53 ? 202 SER D C   1 
ATOM   5389  O  O   . SER C 2 202 ? 8.509   53.296  34.105  1.00 132.21 ? 202 SER D O   1 
ATOM   5390  C  CB  . SER C 2 202 ? 8.554   55.889  32.569  1.00 153.84 ? 202 SER D CB  1 
ATOM   5391  O  OG  . SER C 2 202 ? 7.208   55.517  32.318  1.00 154.37 ? 202 SER D OG  1 
ATOM   5392  N  N   . PRO C 2 203 ? 10.688  53.835  34.381  1.00 135.29 ? 203 PRO D N   1 
ATOM   5393  C  CA  . PRO C 2 203 ? 10.867  53.063  35.603  1.00 128.40 ? 203 PRO D CA  1 
ATOM   5394  C  C   . PRO C 2 203 ? 9.727   53.258  36.593  1.00 129.65 ? 203 PRO D C   1 
ATOM   5395  O  O   . PRO C 2 203 ? 9.052   54.290  36.574  1.00 126.32 ? 203 PRO D O   1 
ATOM   5396  C  CB  . PRO C 2 203 ? 12.180  53.612  36.171  1.00 126.74 ? 203 PRO D CB  1 
ATOM   5397  C  CG  . PRO C 2 203 ? 12.957  54.018  34.967  1.00 133.11 ? 203 PRO D CG  1 
ATOM   5398  C  CD  . PRO C 2 203 ? 11.951  54.456  33.936  1.00 139.72 ? 203 PRO D CD  1 
ATOM   5399  N  N   . ILE C 2 204 ? 9.485   52.240  37.414  1.00 137.18 ? 204 ILE D N   1 
ATOM   5400  C  CA  . ILE C 2 204 ? 8.624   52.381  38.586  1.00 142.00 ? 204 ILE D CA  1 
ATOM   5401  C  C   . ILE C 2 204 ? 9.517   52.598  39.799  1.00 136.62 ? 204 ILE D C   1 
ATOM   5402  O  O   . ILE C 2 204 ? 10.453  51.827  40.055  1.00 133.28 ? 204 ILE D O   1 
ATOM   5403  C  CB  . ILE C 2 204 ? 7.718   51.145  38.821  1.00 138.86 ? 204 ILE D CB  1 
ATOM   5404  C  CG1 . ILE C 2 204 ? 6.845   50.878  37.590  1.00 143.01 ? 204 ILE D CG1 1 
ATOM   5405  C  CG2 . ILE C 2 204 ? 6.833   51.360  40.045  1.00 134.11 ? 204 ILE D CG2 1 
ATOM   5406  C  CD1 . ILE C 2 204 ? 5.862   49.738  37.762  1.00 138.34 ? 204 ILE D CD1 1 
ATOM   5407  N  N   . VAL C 2 205 ? 9.222   53.646  40.553  1.00 123.93 ? 205 VAL D N   1 
ATOM   5408  C  CA  . VAL C 2 205 ? 10.119  54.065  41.605  1.00 118.13 ? 205 VAL D CA  1 
ATOM   5409  C  C   . VAL C 2 205 ? 9.341   54.298  42.889  1.00 110.90 ? 205 VAL D C   1 
ATOM   5410  O  O   . VAL C 2 205 ? 8.365   55.040  42.901  1.00 121.51 ? 205 VAL D O   1 
ATOM   5411  C  CB  . VAL C 2 205 ? 10.883  55.333  41.179  1.00 119.88 ? 205 VAL D CB  1 
ATOM   5412  C  CG1 . VAL C 2 205 ? 9.917   56.369  40.632  1.00 124.92 ? 205 VAL D CG1 1 
ATOM   5413  C  CG2 . VAL C 2 205 ? 11.702  55.885  42.334  1.00 120.04 ? 205 VAL D CG2 1 
ATOM   5414  N  N   . LYS C 2 206 ? 9.745   53.623  43.957  1.00 100.54 ? 206 LYS D N   1 
ATOM   5415  C  CA  . LYS C 2 206 ? 9.251   53.953  45.282  1.00 101.60 ? 206 LYS D CA  1 
ATOM   5416  C  C   . LYS C 2 206 ? 10.393  54.504  46.107  1.00 101.92 ? 206 LYS D C   1 
ATOM   5417  O  O   . LYS C 2 206 ? 11.506  53.975  46.071  1.00 101.16 ? 206 LYS D O   1 
ATOM   5418  C  CB  . LYS C 2 206 ? 8.650   52.729  45.974  1.00 101.38 ? 206 LYS D CB  1 
ATOM   5419  C  CG  . LYS C 2 206 ? 7.351   52.229  45.362  1.00 100.94 ? 206 LYS D CG  1 
ATOM   5420  C  CD  . LYS C 2 206 ? 6.482   53.370  44.884  1.00 107.86 ? 206 LYS D CD  1 
ATOM   5421  C  CE  . LYS C 2 206 ? 5.196   52.864  44.262  1.00 115.02 ? 206 LYS D CE  1 
ATOM   5422  N  NZ  . LYS C 2 206 ? 4.324   52.219  45.278  1.00 118.90 ? 206 LYS D NZ  1 
ATOM   5423  N  N   . SER C 2 207 ? 10.110  55.568  46.852  1.00 104.85 ? 207 SER D N   1 
ATOM   5424  C  CA  . SER C 2 207 ? 11.125  56.223  47.662  1.00 106.40 ? 207 SER D CA  1 
ATOM   5425  C  C   . SER C 2 207 ? 10.633  56.488  49.086  1.00 104.28 ? 207 SER D C   1 
ATOM   5426  O  O   . SER C 2 207 ? 9.435   56.388  49.364  1.00 101.27 ? 207 SER D O   1 
ATOM   5427  C  CB  . SER C 2 207 ? 11.536  57.534  47.005  1.00 110.68 ? 207 SER D CB  1 
ATOM   5428  O  OG  . SER C 2 207 ? 12.518  58.190  47.782  1.00 118.20 ? 207 SER D OG  1 
ATOM   5429  N  N   . PHE C 2 208 ? 11.567  56.808  49.984  1.00 103.09 ? 208 PHE D N   1 
ATOM   5430  C  CA  . PHE C 2 208 ? 11.221  57.365  51.295  1.00 104.03 ? 208 PHE D CA  1 
ATOM   5431  C  C   . PHE C 2 208 ? 12.353  58.222  51.864  1.00 107.67 ? 208 PHE D C   1 
ATOM   5432  O  O   . PHE C 2 208 ? 13.521  58.000  51.545  1.00 104.90 ? 208 PHE D O   1 
ATOM   5433  C  CB  . PHE C 2 208 ? 10.856  56.255  52.275  1.00 95.23  ? 208 PHE D CB  1 
ATOM   5434  C  CG  . PHE C 2 208 ? 12.038  55.573  52.884  1.00 95.65  ? 208 PHE D CG  1 
ATOM   5435  C  CD1 . PHE C 2 208 ? 12.702  56.137  53.961  1.00 94.82  ? 208 PHE D CD1 1 
ATOM   5436  C  CD2 . PHE C 2 208 ? 12.469  54.342  52.396  1.00 103.77 ? 208 PHE D CD2 1 
ATOM   5437  C  CE1 . PHE C 2 208 ? 13.792  55.500  54.530  1.00 98.41  ? 208 PHE D CE1 1 
ATOM   5438  C  CE2 . PHE C 2 208 ? 13.553  53.694  52.964  1.00 101.40 ? 208 PHE D CE2 1 
ATOM   5439  C  CZ  . PHE C 2 208 ? 14.215  54.274  54.032  1.00 100.61 ? 208 PHE D CZ  1 
ATOM   5440  N  N   . ASN C 2 209 ? 11.997  59.215  52.679  1.00 112.21 ? 209 ASN D N   1 
ATOM   5441  C  CA  . ASN C 2 209 ? 12.990  60.032  53.380  1.00 114.25 ? 209 ASN D CA  1 
ATOM   5442  C  C   . ASN C 2 209 ? 13.136  59.621  54.833  1.00 115.11 ? 209 ASN D C   1 
ATOM   5443  O  O   . ASN C 2 209 ? 12.141  59.412  55.528  1.00 131.68 ? 209 ASN D O   1 
ATOM   5444  C  CB  . ASN C 2 209 ? 12.618  61.506  53.314  1.00 114.67 ? 209 ASN D CB  1 
ATOM   5445  C  CG  . ASN C 2 209 ? 12.743  62.067  51.920  1.00 119.12 ? 209 ASN D CG  1 
ATOM   5446  O  OD1 . ASN C 2 209 ? 13.169  61.377  50.991  1.00 116.49 ? 209 ASN D OD1 1 
ATOM   5447  N  ND2 . ASN C 2 209 ? 12.374  63.328  51.763  1.00 131.85 ? 209 ASN D ND2 1 
ATOM   5448  N  N   . ARG C 2 210 ? 14.380  59.527  55.293  1.00 114.06 ? 210 ARG D N   1 
ATOM   5449  C  CA  . ARG C 2 210 ? 14.673  59.008  56.627  1.00 118.75 ? 210 ARG D CA  1 
ATOM   5450  C  C   . ARG C 2 210 ? 13.921  59.760  57.739  1.00 125.53 ? 210 ARG D C   1 
ATOM   5451  O  O   . ARG C 2 210 ? 13.640  59.202  58.802  1.00 133.44 ? 210 ARG D O   1 
ATOM   5452  C  CB  . ARG C 2 210 ? 16.180  59.039  56.886  1.00 116.87 ? 210 ARG D CB  1 
ATOM   5453  C  CG  . ARG C 2 210 ? 16.626  58.164  58.052  1.00 117.26 ? 210 ARG D CG  1 
ATOM   5454  C  CD  . ARG C 2 210 ? 18.115  57.877  57.987  1.00 112.40 ? 210 ARG D CD  1 
ATOM   5455  N  NE  . ARG C 2 210 ? 18.858  59.096  57.699  1.00 115.26 ? 210 ARG D NE  1 
ATOM   5456  C  CZ  . ARG C 2 210 ? 19.036  60.074  58.577  1.00 122.08 ? 210 ARG D CZ  1 
ATOM   5457  N  NH1 . ARG C 2 210 ? 18.550  59.958  59.808  1.00 125.48 ? 210 ARG D NH1 1 
ATOM   5458  N  NH2 . ARG C 2 210 ? 19.707  61.164  58.231  1.00 126.72 ? 210 ARG D NH2 1 
ATOM   5459  N  N   . ASN C 2 211 ? 13.570  61.012  57.474  1.00 133.89 ? 211 ASN D N   1 
ATOM   5460  C  CA  . ASN C 2 211 ? 12.780  61.808  58.425  1.00 133.58 ? 211 ASN D CA  1 
ATOM   5461  C  C   . ASN C 2 211 ? 11.331  62.011  57.960  1.00 134.22 ? 211 ASN D C   1 
ATOM   5462  O  O   . ASN C 2 211 ? 10.959  63.052  57.416  1.00 131.44 ? 211 ASN D O   1 
ATOM   5463  C  CB  . ASN C 2 211 ? 13.450  63.166  58.676  1.00 136.02 ? 211 ASN D CB  1 
ATOM   5464  C  CG  . ASN C 2 211 ? 14.035  63.770  57.415  1.00 138.91 ? 211 ASN D CG  1 
ATOM   5465  O  OD1 . ASN C 2 211 ? 14.308  63.064  56.447  1.00 158.43 ? 211 ASN D OD1 1 
ATOM   5466  N  ND2 . ASN C 2 211 ? 14.231  65.080  57.420  1.00 141.18 ? 211 ASN D ND2 1 
ATOM   5467  O  OXT . ASN C 2 211 ? 10.481  61.134  58.120  1.00 124.40 ? 211 ASN D OXT 1 
ATOM   5468  N  N   . GLU D 3 1   ? 6.330   -1.805  42.146  1.00 137.32 ? 1   GLU E N   1 
ATOM   5469  C  CA  . GLU D 3 1   ? 6.715   -0.381  42.345  1.00 126.79 ? 1   GLU E CA  1 
ATOM   5470  C  C   . GLU D 3 1   ? 8.149   -0.306  42.822  1.00 107.58 ? 1   GLU E C   1 
ATOM   5471  O  O   . GLU D 3 1   ? 8.426   -0.478  44.011  1.00 102.23 ? 1   GLU E O   1 
ATOM   5472  C  CB  . GLU D 3 1   ? 5.789   0.288   43.363  1.00 140.87 ? 1   GLU E CB  1 
ATOM   5473  C  CG  . GLU D 3 1   ? 6.142   1.738   43.661  1.00 146.33 ? 1   GLU E CG  1 
ATOM   5474  C  CD  . GLU D 3 1   ? 5.184   2.376   44.642  1.00 154.00 ? 1   GLU E CD  1 
ATOM   5475  O  OE1 . GLU D 3 1   ? 5.664   2.903   45.666  1.00 155.85 ? 1   GLU E OE1 1 
ATOM   5476  O  OE2 . GLU D 3 1   ? 3.958   2.339   44.401  1.00 164.36 ? 1   GLU E OE2 1 
ATOM   5477  N  N   . VAL D 3 2   ? 9.060   -0.076  41.882  1.00 98.42  ? 2   VAL E N   1 
ATOM   5478  C  CA  . VAL D 3 2   ? 10.462  0.173   42.208  1.00 87.21  ? 2   VAL E CA  1 
ATOM   5479  C  C   . VAL D 3 2   ? 10.597  1.424   43.065  1.00 90.79  ? 2   VAL E C   1 
ATOM   5480  O  O   . VAL D 3 2   ? 9.867   2.399   42.877  1.00 95.33  ? 2   VAL E O   1 
ATOM   5481  C  CB  . VAL D 3 2   ? 11.291  0.367   40.939  1.00 81.09  ? 2   VAL E CB  1 
ATOM   5482  C  CG1 . VAL D 3 2   ? 12.676  0.884   41.284  1.00 82.59  ? 2   VAL E CG1 1 
ATOM   5483  C  CG2 . VAL D 3 2   ? 11.373  -0.941  40.188  1.00 81.96  ? 2   VAL E CG2 1 
ATOM   5484  N  N   . GLN D 3 3   ? 11.524  1.391   44.014  1.00 90.95  ? 3   GLN E N   1 
ATOM   5485  C  CA  . GLN D 3 3   ? 11.715  2.525   44.909  1.00 96.07  ? 3   GLN E CA  1 
ATOM   5486  C  C   . GLN D 3 3   ? 13.131  2.593   45.450  1.00 87.98  ? 3   GLN E C   1 
ATOM   5487  O  O   . GLN D 3 3   ? 13.657  1.597   45.947  1.00 81.32  ? 3   GLN E O   1 
ATOM   5488  C  CB  . GLN D 3 3   ? 10.712  2.471   46.064  1.00 104.79 ? 3   GLN E CB  1 
ATOM   5489  C  CG  . GLN D 3 3   ? 11.027  3.427   47.203  1.00 115.23 ? 3   GLN E CG  1 
ATOM   5490  C  CD  . GLN D 3 3   ? 9.939   3.466   48.257  1.00 126.78 ? 3   GLN E CD  1 
ATOM   5491  O  OE1 . GLN D 3 3   ? 8.832   2.961   48.048  1.00 144.94 ? 3   GLN E OE1 1 
ATOM   5492  N  NE2 . GLN D 3 3   ? 10.244  4.083   49.396  1.00 124.79 ? 3   GLN E NE2 1 
ATOM   5493  N  N   . LEU D 3 4   ? 13.744  3.773   45.325  1.00 80.21  ? 4   LEU E N   1 
ATOM   5494  C  CA  . LEU D 3 4   ? 15.060  4.032   45.905  1.00 76.98  ? 4   LEU E CA  1 
ATOM   5495  C  C   . LEU D 3 4   ? 14.869  5.038   47.014  1.00 72.52  ? 4   LEU E C   1 
ATOM   5496  O  O   . LEU D 3 4   ? 14.409  6.141   46.769  1.00 84.00  ? 4   LEU E O   1 
ATOM   5497  C  CB  . LEU D 3 4   ? 16.021  4.592   44.861  1.00 72.60  ? 4   LEU E CB  1 
ATOM   5498  C  CG  . LEU D 3 4   ? 16.591  3.598   43.854  1.00 74.01  ? 4   LEU E CG  1 
ATOM   5499  C  CD1 . LEU D 3 4   ? 15.505  2.864   43.093  1.00 82.21  ? 4   LEU E CD1 1 
ATOM   5500  C  CD2 . LEU D 3 4   ? 17.476  4.331   42.870  1.00 77.24  ? 4   LEU E CD2 1 
ATOM   5501  N  N   . GLN D 3 5   ? 15.154  4.625   48.239  1.00 70.53  ? 5   GLN E N   1 
ATOM   5502  C  CA  . GLN D 3 5   ? 14.849  5.426   49.410  1.00 73.22  ? 5   GLN E CA  1 
ATOM   5503  C  C   . GLN D 3 5   ? 16.131  5.943   49.987  1.00 69.38  ? 5   GLN E C   1 
ATOM   5504  O  O   . GLN D 3 5   ? 16.905  5.176   50.555  1.00 69.76  ? 5   GLN E O   1 
ATOM   5505  C  CB  . GLN D 3 5   ? 14.130  4.592   50.470  1.00 83.52  ? 5   GLN E CB  1 
ATOM   5506  C  CG  . GLN D 3 5   ? 13.651  5.394   51.668  1.00 97.09  ? 5   GLN E CG  1 
ATOM   5507  C  CD  . GLN D 3 5   ? 12.647  6.468   51.279  1.00 115.02 ? 5   GLN E CD  1 
ATOM   5508  O  OE1 . GLN D 3 5   ? 11.983  6.370   50.244  1.00 130.18 ? 5   GLN E OE1 1 
ATOM   5509  N  NE2 . GLN D 3 5   ? 12.540  7.508   52.101  1.00 122.95 ? 5   GLN E NE2 1 
ATOM   5510  N  N   . GLN D 3 6   ? 16.381  7.237   49.822  1.00 64.19  ? 6   GLN E N   1 
ATOM   5511  C  CA  . GLN D 3 6   ? 17.619  7.804   50.327  1.00 62.00  ? 6   GLN E CA  1 
ATOM   5512  C  C   . GLN D 3 6   ? 17.466  8.257   51.760  1.00 62.86  ? 6   GLN E C   1 
ATOM   5513  O  O   . GLN D 3 6   ? 16.351  8.498   52.231  1.00 68.00  ? 6   GLN E O   1 
ATOM   5514  C  CB  . GLN D 3 6   ? 18.110  8.938   49.447  1.00 58.68  ? 6   GLN E CB  1 
ATOM   5515  C  CG  . GLN D 3 6   ? 18.667  8.421   48.141  1.00 62.72  ? 6   GLN E CG  1 
ATOM   5516  C  CD  . GLN D 3 6   ? 19.024  9.518   47.182  1.00 68.60  ? 6   GLN E CD  1 
ATOM   5517  O  OE1 . GLN D 3 6   ? 18.296  9.776   46.223  1.00 75.64  ? 6   GLN E OE1 1 
ATOM   5518  N  NE2 . GLN D 3 6   ? 20.155  10.176  47.432  1.00 71.28  ? 6   GLN E NE2 1 
ATOM   5519  N  N   . SER D 3 7   ? 18.590  8.306   52.467  1.00 59.88  ? 7   SER E N   1 
ATOM   5520  C  CA  . SER D 3 7   ? 18.601  8.708   53.866  1.00 64.55  ? 7   SER E CA  1 
ATOM   5521  C  C   . SER D 3 7   ? 18.447  10.204  53.947  1.00 69.95  ? 7   SER E C   1 
ATOM   5522  O  O   . SER D 3 7   ? 18.501  10.897  52.928  1.00 79.98  ? 7   SER E O   1 
ATOM   5523  C  CB  . SER D 3 7   ? 19.905  8.305   54.523  1.00 65.18  ? 7   SER E CB  1 
ATOM   5524  O  OG  . SER D 3 7   ? 20.974  8.536   53.626  1.00 71.22  ? 7   SER E OG  1 
ATOM   5525  N  N   . GLY D 3 8   ? 18.269  10.706  55.164  1.00 74.04  ? 8   GLY E N   1 
ATOM   5526  C  CA  . GLY D 3 8   ? 17.866  12.091  55.360  1.00 71.29  ? 8   GLY E CA  1 
ATOM   5527  C  C   . GLY D 3 8   ? 18.971  13.085  55.109  1.00 68.70  ? 8   GLY E C   1 
ATOM   5528  O  O   . GLY D 3 8   ? 20.109  12.709  54.840  1.00 70.66  ? 8   GLY E O   1 
ATOM   5529  N  N   . PRO D 3 9   ? 18.643  14.371  55.205  1.00 69.63  ? 9   PRO E N   1 
ATOM   5530  C  CA  . PRO D 3 9   ? 19.607  15.433  55.022  1.00 72.74  ? 9   PRO E CA  1 
ATOM   5531  C  C   . PRO D 3 9   ? 20.709  15.347  56.062  1.00 78.28  ? 9   PRO E C   1 
ATOM   5532  O  O   . PRO D 3 9   ? 20.467  14.840  57.163  1.00 77.52  ? 9   PRO E O   1 
ATOM   5533  C  CB  . PRO D 3 9   ? 18.780  16.678  55.264  1.00 76.54  ? 9   PRO E CB  1 
ATOM   5534  C  CG  . PRO D 3 9   ? 17.714  16.225  56.196  1.00 76.31  ? 9   PRO E CG  1 
ATOM   5535  C  CD  . PRO D 3 9   ? 17.357  14.880  55.688  1.00 72.71  ? 9   PRO E CD  1 
ATOM   5536  N  N   . GLU D 3 10  ? 21.900  15.836  55.710  1.00 81.38  ? 10  GLU E N   1 
ATOM   5537  C  CA  . GLU D 3 10  ? 23.054  15.808  56.606  1.00 83.16  ? 10  GLU E CA  1 
ATOM   5538  C  C   . GLU D 3 10  ? 23.801  17.142  56.593  1.00 79.29  ? 10  GLU E C   1 
ATOM   5539  O  O   . GLU D 3 10  ? 23.953  17.776  55.544  1.00 74.64  ? 10  GLU E O   1 
ATOM   5540  C  CB  . GLU D 3 10  ? 24.002  14.679  56.202  1.00 86.30  ? 10  GLU E CB  1 
ATOM   5541  C  CG  . GLU D 3 10  ? 23.434  13.283  56.422  1.00 98.72  ? 10  GLU E CG  1 
ATOM   5542  C  CD  . GLU D 3 10  ? 24.492  12.245  56.785  1.00 117.26 ? 10  GLU E CD  1 
ATOM   5543  O  OE1 . GLU D 3 10  ? 25.593  12.652  57.211  1.00 132.89 ? 10  GLU E OE1 1 
ATOM   5544  O  OE2 . GLU D 3 10  ? 24.217  11.022  56.663  1.00 116.26 ? 10  GLU E OE2 1 
ATOM   5545  N  N   . LEU D 3 11  ? 24.289  17.542  57.763  1.00 79.01  ? 11  LEU E N   1 
ATOM   5546  C  CA  . LEU D 3 11  ? 24.971  18.826  57.935  1.00 83.49  ? 11  LEU E CA  1 
ATOM   5547  C  C   . LEU D 3 11  ? 26.305  18.620  58.638  1.00 83.64  ? 11  LEU E C   1 
ATOM   5548  O  O   . LEU D 3 11  ? 26.347  18.171  59.781  1.00 82.01  ? 11  LEU E O   1 
ATOM   5549  C  CB  . LEU D 3 11  ? 24.106  19.765  58.768  1.00 92.26  ? 11  LEU E CB  1 
ATOM   5550  C  CG  . LEU D 3 11  ? 24.832  20.941  59.403  1.00 98.48  ? 11  LEU E CG  1 
ATOM   5551  C  CD1 . LEU D 3 11  ? 25.475  21.780  58.318  1.00 105.92 ? 11  LEU E CD1 1 
ATOM   5552  C  CD2 . LEU D 3 11  ? 23.866  21.774  60.227  1.00 102.59 ? 11  LEU E CD2 1 
ATOM   5553  N  N   . VAL D 3 12  ? 27.396  18.945  57.953  1.00 86.11  ? 12  VAL E N   1 
ATOM   5554  C  CA  . VAL D 3 12  ? 28.737  18.580  58.428  1.00 87.78  ? 12  VAL E CA  1 
ATOM   5555  C  C   . VAL D 3 12  ? 29.729  19.735  58.288  1.00 89.68  ? 12  VAL E C   1 
ATOM   5556  O  O   . VAL D 3 12  ? 29.539  20.630  57.463  1.00 87.61  ? 12  VAL E O   1 
ATOM   5557  C  CB  . VAL D 3 12  ? 29.283  17.350  57.668  1.00 83.62  ? 12  VAL E CB  1 
ATOM   5558  C  CG1 . VAL D 3 12  ? 28.210  16.287  57.541  1.00 83.41  ? 12  VAL E CG1 1 
ATOM   5559  C  CG2 . VAL D 3 12  ? 29.762  17.736  56.285  1.00 84.06  ? 12  VAL E CG2 1 
ATOM   5560  N  N   . LYS D 3 13  ? 30.796  19.690  59.083  1.00 89.12  ? 13  LYS E N   1 
ATOM   5561  C  CA  . LYS D 3 13  ? 31.835  20.717  59.049  1.00 88.25  ? 13  LYS E CA  1 
ATOM   5562  C  C   . LYS D 3 13  ? 32.711  20.566  57.810  1.00 85.99  ? 13  LYS E C   1 
ATOM   5563  O  O   . LYS D 3 13  ? 32.867  19.466  57.283  1.00 86.47  ? 13  LYS E O   1 
ATOM   5564  C  CB  . LYS D 3 13  ? 32.716  20.608  60.286  1.00 92.83  ? 13  LYS E CB  1 
ATOM   5565  C  CG  . LYS D 3 13  ? 31.970  20.760  61.589  1.00 98.00  ? 13  LYS E CG  1 
ATOM   5566  C  CD  . LYS D 3 13  ? 31.632  22.217  61.820  1.00 108.93 ? 13  LYS E CD  1 
ATOM   5567  C  CE  . LYS D 3 13  ? 31.025  22.443  63.194  1.00 117.97 ? 13  LYS E CE  1 
ATOM   5568  N  NZ  . LYS D 3 13  ? 31.014  23.890  63.546  1.00 124.11 ? 13  LYS E NZ  1 
ATOM   5569  N  N   . PRO D 3 14  ? 33.303  21.670  57.343  1.00 87.51  ? 14  PRO E N   1 
ATOM   5570  C  CA  . PRO D 3 14  ? 34.306  21.596  56.281  1.00 87.03  ? 14  PRO E CA  1 
ATOM   5571  C  C   . PRO D 3 14  ? 35.464  20.719  56.715  1.00 89.28  ? 14  PRO E C   1 
ATOM   5572  O  O   . PRO D 3 14  ? 35.952  20.858  57.836  1.00 92.05  ? 14  PRO E O   1 
ATOM   5573  C  CB  . PRO D 3 14  ? 34.789  23.038  56.135  1.00 92.85  ? 14  PRO E CB  1 
ATOM   5574  C  CG  . PRO D 3 14  ? 33.744  23.888  56.759  1.00 94.04  ? 14  PRO E CG  1 
ATOM   5575  C  CD  . PRO D 3 14  ? 32.997  23.050  57.749  1.00 91.22  ? 14  PRO E CD  1 
ATOM   5576  N  N   . GLY D 3 15  ? 35.898  19.814  55.850  1.00 90.18  ? 15  GLY E N   1 
ATOM   5577  C  CA  . GLY D 3 15  ? 36.995  18.909  56.194  1.00 94.40  ? 15  GLY E CA  1 
ATOM   5578  C  C   . GLY D 3 15  ? 36.501  17.527  56.575  1.00 91.71  ? 15  GLY E C   1 
ATOM   5579  O  O   . GLY D 3 15  ? 37.093  16.522  56.198  1.00 94.30  ? 15  GLY E O   1 
ATOM   5580  N  N   . ALA D 3 16  ? 35.399  17.476  57.309  1.00 90.14  ? 16  ALA E N   1 
ATOM   5581  C  CA  . ALA D 3 16  ? 34.768  16.214  57.647  1.00 87.62  ? 16  ALA E CA  1 
ATOM   5582  C  C   . ALA D 3 16  ? 34.328  15.470  56.397  1.00 82.79  ? 16  ALA E C   1 
ATOM   5583  O  O   . ALA D 3 16  ? 34.314  16.029  55.300  1.00 77.96  ? 16  ALA E O   1 
ATOM   5584  C  CB  . ALA D 3 16  ? 33.573  16.456  58.548  1.00 90.58  ? 16  ALA E CB  1 
ATOM   5585  N  N   . SER D 3 17  ? 33.987  14.197  56.574  1.00 82.75  ? 17  SER E N   1 
ATOM   5586  C  CA  . SER D 3 17  ? 33.422  13.404  55.499  1.00 81.46  ? 17  SER E CA  1 
ATOM   5587  C  C   . SER D 3 17  ? 32.032  12.986  55.916  1.00 78.76  ? 17  SER E C   1 
ATOM   5588  O  O   . SER D 3 17  ? 31.592  13.292  57.022  1.00 80.32  ? 17  SER E O   1 
ATOM   5589  C  CB  . SER D 3 17  ? 34.264  12.169  55.266  1.00 86.40  ? 17  SER E CB  1 
ATOM   5590  O  OG  . SER D 3 17  ? 34.016  11.248  56.305  1.00 100.25 ? 17  SER E OG  1 
ATOM   5591  N  N   . MET D 3 18  ? 31.344  12.266  55.045  1.00 77.56  ? 18  MET E N   1 
ATOM   5592  C  CA  . MET D 3 18  ? 29.957  11.938  55.299  1.00 79.13  ? 18  MET E CA  1 
ATOM   5593  C  C   . MET D 3 18  ? 29.536  10.764  54.435  1.00 79.02  ? 18  MET E C   1 
ATOM   5594  O  O   . MET D 3 18  ? 30.019  10.605  53.318  1.00 88.89  ? 18  MET E O   1 
ATOM   5595  C  CB  . MET D 3 18  ? 29.094  13.168  55.032  1.00 82.97  ? 18  MET E CB  1 
ATOM   5596  C  CG  . MET D 3 18  ? 27.710  12.888  54.467  1.00 87.59  ? 18  MET E CG  1 
ATOM   5597  S  SD  . MET D 3 18  ? 27.760  12.598  52.683  1.00 98.51  ? 18  MET E SD  1 
ATOM   5598  C  CE  . MET D 3 18  ? 26.179  13.259  52.162  1.00 95.29  ? 18  MET E CE  1 
ATOM   5599  N  N   . LYS D 3 19  ? 28.653  9.927   54.969  1.00 79.19  ? 19  LYS E N   1 
ATOM   5600  C  CA  . LYS D 3 19  ? 28.187  8.740   54.265  1.00 74.24  ? 19  LYS E CA  1 
ATOM   5601  C  C   . LYS D 3 19  ? 26.680  8.774   54.193  1.00 70.23  ? 19  LYS E C   1 
ATOM   5602  O  O   . LYS D 3 19  ? 26.016  9.107   55.177  1.00 71.73  ? 19  LYS E O   1 
ATOM   5603  C  CB  . LYS D 3 19  ? 28.626  7.501   55.024  1.00 84.70  ? 19  LYS E CB  1 
ATOM   5604  C  CG  . LYS D 3 19  ? 28.640  6.220   54.214  1.00 88.22  ? 19  LYS E CG  1 
ATOM   5605  C  CD  . LYS D 3 19  ? 29.352  5.115   54.982  1.00 93.99  ? 19  LYS E CD  1 
ATOM   5606  C  CE  . LYS D 3 19  ? 29.576  3.889   54.116  1.00 106.60 ? 19  LYS E CE  1 
ATOM   5607  N  NZ  . LYS D 3 19  ? 30.669  3.029   54.644  1.00 116.96 ? 19  LYS E NZ  1 
ATOM   5608  N  N   . THR D 3 20  ? 26.142  8.455   53.021  1.00 68.13  ? 20  THR E N   1 
ATOM   5609  C  CA  . THR D 3 20  ? 24.704  8.526   52.796  1.00 73.08  ? 20  THR E CA  1 
ATOM   5610  C  C   . THR D 3 20  ? 24.247  7.269   52.067  1.00 68.36  ? 20  THR E C   1 
ATOM   5611  O  O   . THR D 3 20  ? 25.051  6.604   51.417  1.00 69.74  ? 20  THR E O   1 
ATOM   5612  C  CB  . THR D 3 20  ? 24.323  9.792   51.995  1.00 75.78  ? 20  THR E CB  1 
ATOM   5613  O  OG1 . THR D 3 20  ? 22.898  9.983   52.024  1.00 82.41  ? 20  THR E OG1 1 
ATOM   5614  C  CG2 . THR D 3 20  ? 24.790  9.686   50.555  1.00 73.52  ? 20  THR E CG2 1 
ATOM   5615  N  N   . SER D 3 21  ? 22.967  6.923   52.187  1.00 67.09  ? 21  SER E N   1 
ATOM   5616  C  CA  . SER D 3 21  ? 22.511  5.615   51.729  1.00 68.62  ? 21  SER E CA  1 
ATOM   5617  C  C   . SER D 3 21  ? 21.285  5.652   50.845  1.00 64.68  ? 21  SER E C   1 
ATOM   5618  O  O   . SER D 3 21  ? 20.518  6.604   50.854  1.00 79.26  ? 21  SER E O   1 
ATOM   5619  C  CB  . SER D 3 21  ? 22.253  4.690   52.918  1.00 71.14  ? 21  SER E CB  1 
ATOM   5620  O  OG  . SER D 3 21  ? 21.275  5.232   53.793  1.00 69.09  ? 21  SER E OG  1 
ATOM   5621  N  N   . CYS D 3 22  ? 21.113  4.573   50.101  1.00 62.94  ? 22  CYS E N   1 
ATOM   5622  C  CA  . CYS D 3 22  ? 20.061  4.453   49.121  1.00 65.65  ? 22  CYS E CA  1 
ATOM   5623  C  C   . CYS D 3 22  ? 19.595  2.995   49.145  1.00 69.66  ? 22  CYS E C   1 
ATOM   5624  O  O   . CYS D 3 22  ? 20.291  2.112   48.646  1.00 75.24  ? 22  CYS E O   1 
ATOM   5625  C  CB  . CYS D 3 22  ? 20.620  4.836   47.745  1.00 60.93  ? 22  CYS E CB  1 
ATOM   5626  S  SG  . CYS D 3 22  ? 19.572  4.466   46.332  1.00 76.46  ? 22  CYS E SG  1 
ATOM   5627  N  N   . LYS D 3 23  ? 18.462  2.735   49.794  1.00 71.52  ? 23  LYS E N   1 
ATOM   5628  C  CA  . LYS D 3 23  ? 17.933  1.367   49.942  1.00 74.03  ? 23  LYS E CA  1 
ATOM   5629  C  C   . LYS D 3 23  ? 16.909  1.078   48.852  1.00 69.48  ? 23  LYS E C   1 
ATOM   5630  O  O   . LYS D 3 23  ? 15.940  1.820   48.704  1.00 71.84  ? 23  LYS E O   1 
ATOM   5631  C  CB  . LYS D 3 23  ? 17.302  1.215   51.332  1.00 77.06  ? 23  LYS E CB  1 
ATOM   5632  C  CG  . LYS D 3 23  ? 16.749  -0.154  51.664  1.00 92.22  ? 23  LYS E CG  1 
ATOM   5633  C  CD  . LYS D 3 23  ? 16.498  -0.283  53.171  1.00 109.31 ? 23  LYS E CD  1 
ATOM   5634  C  CE  . LYS D 3 23  ? 16.360  -1.726  53.663  1.00 117.81 ? 23  LYS E CE  1 
ATOM   5635  N  NZ  . LYS D 3 23  ? 16.268  -2.742  52.576  1.00 121.31 ? 23  LYS E NZ  1 
ATOM   5636  N  N   . VAL D 3 24  ? 17.143  0.034   48.058  1.00 65.27  ? 24  VAL E N   1 
ATOM   5637  C  CA  . VAL D 3 24  ? 16.251  -0.263  46.953  1.00 67.58  ? 24  VAL E CA  1 
ATOM   5638  C  C   . VAL D 3 24  ? 15.240  -1.322  47.359  1.00 76.73  ? 24  VAL E C   1 
ATOM   5639  O  O   . VAL D 3 24  ? 15.525  -2.189  48.182  1.00 75.11  ? 24  VAL E O   1 
ATOM   5640  C  CB  . VAL D 3 24  ? 16.984  -0.794  45.721  1.00 63.35  ? 24  VAL E CB  1 
ATOM   5641  C  CG1 . VAL D 3 24  ? 18.226  0.007   45.449  1.00 67.30  ? 24  VAL E CG1 1 
ATOM   5642  C  CG2 . VAL D 3 24  ? 17.345  -2.240  45.923  1.00 69.43  ? 24  VAL E CG2 1 
ATOM   5643  N  N   . SER D 3 25  ? 14.055  -1.232  46.767  1.00 81.57  ? 25  SER E N   1 
ATOM   5644  C  CA  . SER D 3 25  ? 13.052  -2.265  46.875  1.00 84.60  ? 25  SER E CA  1 
ATOM   5645  C  C   . SER D 3 25  ? 12.213  -2.226  45.610  1.00 88.32  ? 25  SER E C   1 
ATOM   5646  O  O   . SER D 3 25  ? 12.203  -1.215  44.903  1.00 89.62  ? 25  SER E O   1 
ATOM   5647  C  CB  . SER D 3 25  ? 12.168  -1.983  48.068  1.00 93.52  ? 25  SER E CB  1 
ATOM   5648  O  OG  . SER D 3 25  ? 11.384  -0.839  47.810  1.00 104.94 ? 25  SER E OG  1 
ATOM   5649  N  N   . GLY D 3 26  ? 11.494  -3.314  45.337  1.00 92.85  ? 26  GLY E N   1 
ATOM   5650  C  CA  . GLY D 3 26  ? 10.663  -3.419  44.126  1.00 97.65  ? 26  GLY E CA  1 
ATOM   5651  C  C   . GLY D 3 26  ? 11.340  -4.097  42.933  1.00 98.47  ? 26  GLY E C   1 
ATOM   5652  O  O   . GLY D 3 26  ? 10.689  -4.398  41.924  1.00 94.26  ? 26  GLY E O   1 
ATOM   5653  N  N   . TYR D 3 27  ? 12.651  -4.314  43.041  1.00 96.83  ? 27  TYR E N   1 
ATOM   5654  C  CA  . TYR D 3 27  ? 13.405  -5.081  42.053  1.00 98.86  ? 27  TYR E CA  1 
ATOM   5655  C  C   . TYR D 3 27  ? 14.599  -5.725  42.750  1.00 100.21 ? 27  TYR E C   1 
ATOM   5656  O  O   . TYR D 3 27  ? 14.781  -5.553  43.954  1.00 111.23 ? 27  TYR E O   1 
ATOM   5657  C  CB  . TYR D 3 27  ? 13.859  -4.181  40.898  1.00 96.08  ? 27  TYR E CB  1 
ATOM   5658  C  CG  . TYR D 3 27  ? 15.020  -3.248  41.213  1.00 88.54  ? 27  TYR E CG  1 
ATOM   5659  C  CD1 . TYR D 3 27  ? 16.319  -3.594  40.871  1.00 90.07  ? 27  TYR E CD1 1 
ATOM   5660  C  CD2 . TYR D 3 27  ? 14.809  -2.002  41.794  1.00 84.51  ? 27  TYR E CD2 1 
ATOM   5661  C  CE1 . TYR D 3 27  ? 17.380  -2.739  41.117  1.00 85.11  ? 27  TYR E CE1 1 
ATOM   5662  C  CE2 . TYR D 3 27  ? 15.864  -1.143  42.047  1.00 84.35  ? 27  TYR E CE2 1 
ATOM   5663  C  CZ  . TYR D 3 27  ? 17.150  -1.518  41.707  1.00 83.65  ? 27  TYR E CZ  1 
ATOM   5664  O  OH  . TYR D 3 27  ? 18.210  -0.674  41.965  1.00 77.84  ? 27  TYR E OH  1 
ATOM   5665  N  N   . SER D 3 28  ? 15.408  -6.477  42.020  1.00 85.57  ? 28  SER E N   1 
ATOM   5666  C  CA  . SER D 3 28  ? 16.548  -7.093  42.657  1.00 81.34  ? 28  SER E CA  1 
ATOM   5667  C  C   . SER D 3 28  ? 17.774  -6.196  42.537  1.00 74.31  ? 28  SER E C   1 
ATOM   5668  O  O   . SER D 3 28  ? 18.274  -5.894  41.449  1.00 61.23  ? 28  SER E O   1 
ATOM   5669  C  CB  . SER D 3 28  ? 16.809  -8.486  42.103  1.00 92.83  ? 28  SER E CB  1 
ATOM   5670  O  OG  . SER D 3 28  ? 17.688  -8.446  40.995  1.00 104.37 ? 28  SER E OG  1 
ATOM   5671  N  N   . PHE D 3 29  ? 18.228  -5.761  43.701  1.00 79.06  ? 29  PHE E N   1 
ATOM   5672  C  CA  . PHE D 3 29  ? 19.340  -4.826  43.849  1.00 72.34  ? 29  PHE E CA  1 
ATOM   5673  C  C   . PHE D 3 29  ? 20.537  -5.158  42.989  1.00 67.17  ? 29  PHE E C   1 
ATOM   5674  O  O   . PHE D 3 29  ? 21.151  -4.271  42.412  1.00 74.07  ? 29  PHE E O   1 
ATOM   5675  C  CB  . PHE D 3 29  ? 19.765  -4.854  45.310  1.00 73.71  ? 29  PHE E CB  1 
ATOM   5676  C  CG  . PHE D 3 29  ? 20.876  -3.920  45.655  1.00 63.52  ? 29  PHE E CG  1 
ATOM   5677  C  CD1 . PHE D 3 29  ? 20.807  -2.586  45.325  1.00 63.91  ? 29  PHE E CD1 1 
ATOM   5678  C  CD2 . PHE D 3 29  ? 21.926  -4.361  46.426  1.00 63.55  ? 29  PHE E CD2 1 
ATOM   5679  C  CE1 . PHE D 3 29  ? 21.808  -1.716  45.702  1.00 64.58  ? 29  PHE E CE1 1 
ATOM   5680  C  CE2 . PHE D 3 29  ? 22.924  -3.499  46.819  1.00 66.28  ? 29  PHE E CE2 1 
ATOM   5681  C  CZ  . PHE D 3 29  ? 22.869  -2.173  46.451  1.00 64.19  ? 29  PHE E CZ  1 
ATOM   5682  N  N   . THR D 3 30  ? 20.888  -6.435  42.929  1.00 70.08  ? 30  THR E N   1 
ATOM   5683  C  CA  . THR D 3 30  ? 22.142  -6.839  42.298  1.00 70.28  ? 30  THR E CA  1 
ATOM   5684  C  C   . THR D 3 30  ? 22.044  -6.944  40.780  1.00 68.27  ? 30  THR E C   1 
ATOM   5685  O  O   . THR D 3 30  ? 23.036  -7.233  40.111  1.00 65.37  ? 30  THR E O   1 
ATOM   5686  C  CB  . THR D 3 30  ? 22.622  -8.190  42.829  1.00 71.27  ? 30  THR E CB  1 
ATOM   5687  O  OG1 . THR D 3 30  ? 21.589  -9.160  42.645  1.00 76.94  ? 30  THR E OG1 1 
ATOM   5688  C  CG2 . THR D 3 30  ? 22.978  -8.083  44.306  1.00 75.93  ? 30  THR E CG2 1 
ATOM   5689  N  N   . GLY D 3 31  ? 20.852  -6.718  40.240  1.00 68.86  ? 31  GLY E N   1 
ATOM   5690  C  CA  . GLY D 3 31  ? 20.607  -6.976  38.831  1.00 69.87  ? 31  GLY E CA  1 
ATOM   5691  C  C   . GLY D 3 31  ? 20.904  -5.771  37.987  1.00 68.52  ? 31  GLY E C   1 
ATOM   5692  O  O   . GLY D 3 31  ? 21.042  -5.877  36.758  1.00 69.89  ? 31  GLY E O   1 
ATOM   5693  N  N   . TYR D 3 32  ? 21.027  -4.625  38.655  1.00 65.68  ? 32  TYR E N   1 
ATOM   5694  C  CA  . TYR D 3 32  ? 21.174  -3.359  37.963  1.00 60.69  ? 32  TYR E CA  1 
ATOM   5695  C  C   . TYR D 3 32  ? 22.293  -2.525  38.507  1.00 59.75  ? 32  TYR E C   1 
ATOM   5696  O  O   . TYR D 3 32  ? 22.625  -2.612  39.690  1.00 63.05  ? 32  TYR E O   1 
ATOM   5697  C  CB  . TYR D 3 32  ? 19.878  -2.589  38.063  1.00 62.89  ? 32  TYR E CB  1 
ATOM   5698  C  CG  . TYR D 3 32  ? 18.771  -3.300  37.346  1.00 66.56  ? 32  TYR E CG  1 
ATOM   5699  C  CD1 . TYR D 3 32  ? 18.171  -4.416  37.896  1.00 63.91  ? 32  TYR E CD1 1 
ATOM   5700  C  CD2 . TYR D 3 32  ? 18.384  -2.903  36.077  1.00 70.32  ? 32  TYR E CD2 1 
ATOM   5701  C  CE1 . TYR D 3 32  ? 17.182  -5.093  37.214  1.00 71.92  ? 32  TYR E CE1 1 
ATOM   5702  C  CE2 . TYR D 3 32  ? 17.401  -3.578  35.385  1.00 70.42  ? 32  TYR E CE2 1 
ATOM   5703  C  CZ  . TYR D 3 32  ? 16.802  -4.671  35.957  1.00 71.67  ? 32  TYR E CZ  1 
ATOM   5704  O  OH  . TYR D 3 32  ? 15.821  -5.339  35.259  1.00 74.09  ? 32  TYR E OH  1 
ATOM   5705  N  N   . ILE D 3 33  ? 22.857  -1.701  37.627  1.00 61.49  ? 33  ILE E N   1 
ATOM   5706  C  CA  . ILE D 3 33  ? 23.915  -0.762  37.987  1.00 65.28  ? 33  ILE E CA  1 
ATOM   5707  C  C   . ILE D 3 33  ? 23.364  0.425   38.796  1.00 68.76  ? 33  ILE E C   1 
ATOM   5708  O  O   . ILE D 3 33  ? 22.316  0.987   38.447  1.00 65.50  ? 33  ILE E O   1 
ATOM   5709  C  CB  . ILE D 3 33  ? 24.573  -0.220  36.713  1.00 64.96  ? 33  ILE E CB  1 
ATOM   5710  C  CG1 . ILE D 3 33  ? 25.135  -1.376  35.891  1.00 65.92  ? 33  ILE E CG1 1 
ATOM   5711  C  CG2 . ILE D 3 33  ? 25.654  0.797   37.055  1.00 67.16  ? 33  ILE E CG2 1 
ATOM   5712  C  CD1 . ILE D 3 33  ? 26.169  -2.192  36.633  1.00 72.19  ? 33  ILE E CD1 1 
ATOM   5713  N  N   . MET D 3 34  ? 24.059  0.805   39.870  1.00 63.04  ? 34  MET E N   1 
ATOM   5714  C  CA  . MET D 3 34  ? 23.705  2.016   40.609  1.00 69.11  ? 34  MET E CA  1 
ATOM   5715  C  C   . MET D 3 34  ? 24.681  3.145   40.301  1.00 64.64  ? 34  MET E C   1 
ATOM   5716  O  O   . MET D 3 34  ? 25.891  2.943   40.262  1.00 73.40  ? 34  MET E O   1 
ATOM   5717  C  CB  . MET D 3 34  ? 23.663  1.766   42.119  1.00 74.15  ? 34  MET E CB  1 
ATOM   5718  C  CG  . MET D 3 34  ? 22.391  1.064   42.599  1.00 96.98  ? 34  MET E CG  1 
ATOM   5719  S  SD  . MET D 3 34  ? 20.837  2.013   42.577  1.00 87.46  ? 34  MET E SD  1 
ATOM   5720  C  CE  . MET D 3 34  ? 21.469  3.607   43.026  1.00 76.50  ? 34  MET E CE  1 
ATOM   5721  N  N   . ASN D 3 35  ? 24.131  4.332   40.076  1.00 57.32  ? 35  ASN E N   1 
ATOM   5722  C  CA  . ASN D 3 35  ? 24.912  5.536   39.870  1.00 50.93  ? 35  ASN E CA  1 
ATOM   5723  C  C   . ASN D 3 35  ? 24.615  6.521   40.991  1.00 51.45  ? 35  ASN E C   1 
ATOM   5724  O  O   . ASN D 3 35  ? 23.620  6.417   41.694  1.00 56.66  ? 35  ASN E O   1 
ATOM   5725  C  CB  . ASN D 3 35  ? 24.553  6.184   38.528  1.00 50.22  ? 35  ASN E CB  1 
ATOM   5726  C  CG  . ASN D 3 35  ? 24.595  5.209   37.365  1.00 51.94  ? 35  ASN E CG  1 
ATOM   5727  O  OD1 . ASN D 3 35  ? 25.552  5.179   36.597  1.00 56.48  ? 35  ASN E OD1 1 
ATOM   5728  N  ND2 . ASN D 3 35  ? 23.538  4.432   37.208  1.00 54.41  ? 35  ASN E ND2 1 
ATOM   5729  N  N   . TRP D 3 36  ? 25.454  7.526   41.117  1.00 55.26  ? 36  TRP E N   1 
ATOM   5730  C  CA  . TRP D 3 36  ? 25.102  8.687   41.910  1.00 58.30  ? 36  TRP E CA  1 
ATOM   5731  C  C   . TRP D 3 36  ? 25.279  9.978   41.129  1.00 55.56  ? 36  TRP E C   1 
ATOM   5732  O  O   . TRP D 3 36  ? 26.203  10.116  40.339  1.00 63.83  ? 36  TRP E O   1 
ATOM   5733  C  CB  . TRP D 3 36  ? 25.957  8.727   43.157  1.00 60.33  ? 36  TRP E CB  1 
ATOM   5734  C  CG  . TRP D 3 36  ? 25.662  7.615   44.083  1.00 57.60  ? 36  TRP E CG  1 
ATOM   5735  C  CD1 . TRP D 3 36  ? 26.094  6.346   43.981  1.00 57.46  ? 36  TRP E CD1 1 
ATOM   5736  C  CD2 . TRP D 3 36  ? 24.888  7.687   45.282  1.00 59.53  ? 36  TRP E CD2 1 
ATOM   5737  N  NE1 . TRP D 3 36  ? 25.648  5.611   45.051  1.00 64.08  ? 36  TRP E NE1 1 
ATOM   5738  C  CE2 . TRP D 3 36  ? 24.910  6.421   45.867  1.00 58.27  ? 36  TRP E CE2 1 
ATOM   5739  C  CE3 . TRP D 3 36  ? 24.178  8.708   45.916  1.00 67.59  ? 36  TRP E CE3 1 
ATOM   5740  C  CZ2 . TRP D 3 36  ? 24.270  6.144   47.062  1.00 61.72  ? 36  TRP E CZ2 1 
ATOM   5741  C  CZ3 . TRP D 3 36  ? 23.521  8.431   47.092  1.00 65.89  ? 36  TRP E CZ3 1 
ATOM   5742  C  CH2 . TRP D 3 36  ? 23.575  7.163   47.655  1.00 69.61  ? 36  TRP E CH2 1 
ATOM   5743  N  N   . VAL D 3 37  ? 24.414  10.941  41.404  1.00 56.75  ? 37  VAL E N   1 
ATOM   5744  C  CA  . VAL D 3 37  ? 24.380  12.194  40.665  1.00 58.08  ? 37  VAL E CA  1 
ATOM   5745  C  C   . VAL D 3 37  ? 24.320  13.366  41.625  1.00 57.07  ? 37  VAL E C   1 
ATOM   5746  O  O   . VAL D 3 37  ? 23.649  13.312  42.645  1.00 57.66  ? 37  VAL E O   1 
ATOM   5747  C  CB  . VAL D 3 37  ? 23.162  12.229  39.738  1.00 55.94  ? 37  VAL E CB  1 
ATOM   5748  C  CG1 . VAL D 3 37  ? 23.057  13.552  39.024  1.00 55.94  ? 37  VAL E CG1 1 
ATOM   5749  C  CG2 . VAL D 3 37  ? 23.261  11.091  38.737  1.00 59.63  ? 37  VAL E CG2 1 
ATOM   5750  N  N   . LYS D 3 38  ? 25.053  14.419  41.297  1.00 61.86  ? 38  LYS E N   1 
ATOM   5751  C  CA  . LYS D 3 38  ? 25.086  15.627  42.113  1.00 61.93  ? 38  LYS E CA  1 
ATOM   5752  C  C   . LYS D 3 38  ? 24.318  16.724  41.397  1.00 63.60  ? 38  LYS E C   1 
ATOM   5753  O  O   . LYS D 3 38  ? 24.453  16.893  40.186  1.00 64.01  ? 38  LYS E O   1 
ATOM   5754  C  CB  . LYS D 3 38  ? 26.532  16.066  42.322  1.00 62.50  ? 38  LYS E CB  1 
ATOM   5755  C  CG  . LYS D 3 38  ? 26.697  17.413  42.983  1.00 64.81  ? 38  LYS E CG  1 
ATOM   5756  C  CD  . LYS D 3 38  ? 28.160  17.682  43.295  1.00 69.10  ? 38  LYS E CD  1 
ATOM   5757  C  CE  . LYS D 3 38  ? 28.398  19.111  43.752  1.00 72.80  ? 38  LYS E CE  1 
ATOM   5758  N  NZ  . LYS D 3 38  ? 29.822  19.323  44.101  1.00 75.15  ? 38  LYS E NZ  1 
ATOM   5759  N  N   . GLN D 3 39  ? 23.499  17.457  42.141  1.00 65.10  ? 39  GLN E N   1 
ATOM   5760  C  CA  . GLN D 3 39  ? 22.889  18.655  41.603  1.00 71.99  ? 39  GLN E CA  1 
ATOM   5761  C  C   . GLN D 3 39  ? 23.038  19.769  42.592  1.00 78.45  ? 39  GLN E C   1 
ATOM   5762  O  O   . GLN D 3 39  ? 22.420  19.738  43.653  1.00 75.04  ? 39  GLN E O   1 
ATOM   5763  C  CB  . GLN D 3 39  ? 21.427  18.422  41.325  1.00 74.42  ? 39  GLN E CB  1 
ATOM   5764  C  CG  . GLN D 3 39  ? 20.760  19.565  40.594  1.00 78.79  ? 39  GLN E CG  1 
ATOM   5765  C  CD  . GLN D 3 39  ? 19.324  19.234  40.231  1.00 77.78  ? 39  GLN E CD  1 
ATOM   5766  O  OE1 . GLN D 3 39  ? 18.602  18.620  41.018  1.00 67.87  ? 39  GLN E OE1 1 
ATOM   5767  N  NE2 . GLN D 3 39  ? 18.906  19.630  39.028  1.00 83.13  ? 39  GLN E NE2 1 
ATOM   5768  N  N   . ARG D 3 40  ? 23.922  20.713  42.268  1.00 92.71  ? 40  ARG E N   1 
ATOM   5769  C  CA  . ARG D 3 40  ? 24.185  21.865  43.126  1.00 96.35  ? 40  ARG E CA  1 
ATOM   5770  C  C   . ARG D 3 40  ? 23.126  22.892  42.823  1.00 108.38 ? 40  ARG E C   1 
ATOM   5771  O  O   . ARG D 3 40  ? 22.801  23.116  41.662  1.00 119.79 ? 40  ARG E O   1 
ATOM   5772  C  CB  . ARG D 3 40  ? 25.571  22.446  42.867  1.00 98.37  ? 40  ARG E CB  1 
ATOM   5773  C  CG  . ARG D 3 40  ? 26.176  23.116  44.083  1.00 103.10 ? 40  ARG E CG  1 
ATOM   5774  C  CD  . ARG D 3 40  ? 27.565  23.667  43.803  1.00 110.02 ? 40  ARG E CD  1 
ATOM   5775  N  NE  . ARG D 3 40  ? 27.767  24.939  44.497  1.00 123.48 ? 40  ARG E NE  1 
ATOM   5776  C  CZ  . ARG D 3 40  ? 27.932  25.070  45.812  1.00 123.68 ? 40  ARG E CZ  1 
ATOM   5777  N  NH1 . ARG D 3 40  ? 27.935  24.004  46.604  1.00 121.26 ? 40  ARG E NH1 1 
ATOM   5778  N  NH2 . ARG D 3 40  ? 28.105  26.275  46.341  1.00 128.18 ? 40  ARG E NH2 1 
ATOM   5779  N  N   . HIS D 3 41  ? 22.608  23.517  43.878  1.00 124.21 ? 41  HIS E N   1 
ATOM   5780  C  CA  . HIS D 3 41  ? 21.278  24.146  43.875  1.00 127.50 ? 41  HIS E CA  1 
ATOM   5781  C  C   . HIS D 3 41  ? 20.717  24.513  42.498  1.00 128.58 ? 41  HIS E C   1 
ATOM   5782  O  O   . HIS D 3 41  ? 20.998  25.590  41.967  1.00 115.04 ? 41  HIS E O   1 
ATOM   5783  C  CB  . HIS D 3 41  ? 21.234  25.356  44.821  1.00 130.69 ? 41  HIS E CB  1 
ATOM   5784  C  CG  . HIS D 3 41  ? 22.309  26.371  44.583  1.00 147.84 ? 41  HIS E CG  1 
ATOM   5785  N  ND1 . HIS D 3 41  ? 23.639  26.136  44.866  1.00 144.95 ? 41  HIS E ND1 1 
ATOM   5786  C  CD2 . HIS D 3 41  ? 22.239  27.654  44.155  1.00 175.82 ? 41  HIS E CD2 1 
ATOM   5787  C  CE1 . HIS D 3 41  ? 24.345  27.217  44.588  1.00 158.67 ? 41  HIS E CE1 1 
ATOM   5788  N  NE2 . HIS D 3 41  ? 23.519  28.154  44.159  1.00 179.61 ? 41  HIS E NE2 1 
ATOM   5789  N  N   . GLY D 3 42  ? 19.930  23.584  41.942  1.00 127.44 ? 42  GLY E N   1 
ATOM   5790  C  CA  . GLY D 3 42  ? 19.074  23.828  40.781  1.00 126.83 ? 42  GLY E CA  1 
ATOM   5791  C  C   . GLY D 3 42  ? 19.846  24.156  39.527  1.00 137.36 ? 42  GLY E C   1 
ATOM   5792  O  O   . GLY D 3 42  ? 19.575  25.152  38.866  1.00 173.47 ? 42  GLY E O   1 
ATOM   5793  N  N   . LYS D 3 43  ? 20.832  23.338  39.206  1.00 137.49 ? 43  LYS E N   1 
ATOM   5794  C  CA  . LYS D 3 43  ? 21.712  23.636  38.081  1.00 151.11 ? 43  LYS E CA  1 
ATOM   5795  C  C   . LYS D 3 43  ? 21.908  22.368  37.276  1.00 130.71 ? 43  LYS E C   1 
ATOM   5796  O  O   . LYS D 3 43  ? 21.066  21.471  37.339  1.00 127.36 ? 43  LYS E O   1 
ATOM   5797  C  CB  . LYS D 3 43  ? 23.057  24.178  38.581  1.00 169.45 ? 43  LYS E CB  1 
ATOM   5798  C  CG  . LYS D 3 43  ? 23.044  25.632  39.014  1.00 171.35 ? 43  LYS E CG  1 
ATOM   5799  C  CD  . LYS D 3 43  ? 24.470  26.088  39.294  1.00 179.88 ? 43  LYS E CD  1 
ATOM   5800  C  CE  . LYS D 3 43  ? 24.527  27.061  40.460  1.00 191.05 ? 43  LYS E CE  1 
ATOM   5801  N  NZ  . LYS D 3 43  ? 25.906  27.552  40.745  1.00 203.85 ? 43  LYS E NZ  1 
ATOM   5802  N  N   . ASN D 3 44  ? 23.013  22.282  36.536  1.00 123.58 ? 44  ASN E N   1 
ATOM   5803  C  CA  . ASN D 3 44  ? 23.347  21.042  35.841  1.00 124.01 ? 44  ASN E CA  1 
ATOM   5804  C  C   . ASN D 3 44  ? 23.602  19.820  36.745  1.00 103.92 ? 44  ASN E C   1 
ATOM   5805  O  O   . ASN D 3 44  ? 24.103  19.911  37.873  1.00 89.01  ? 44  ASN E O   1 
ATOM   5806  C  CB  . ASN D 3 44  ? 24.499  21.234  34.850  1.00 124.22 ? 44  ASN E CB  1 
ATOM   5807  C  CG  . ASN D 3 44  ? 25.561  22.152  35.371  1.00 127.71 ? 44  ASN E CG  1 
ATOM   5808  O  OD1 . ASN D 3 44  ? 25.922  22.098  36.542  1.00 139.98 ? 44  ASN E OD1 1 
ATOM   5809  N  ND2 . ASN D 3 44  ? 26.084  22.996  34.500  1.00 144.11 ? 44  ASN E ND2 1 
ATOM   5810  N  N   . LEU D 3 45  ? 23.173  18.681  36.218  1.00 89.52  ? 45  LEU E N   1 
ATOM   5811  C  CA  . LEU D 3 45  ? 23.304  17.394  36.855  1.00 80.71  ? 45  LEU E CA  1 
ATOM   5812  C  C   . LEU D 3 45  ? 24.672  16.811  36.521  1.00 80.75  ? 45  LEU E C   1 
ATOM   5813  O  O   . LEU D 3 45  ? 25.085  16.804  35.363  1.00 83.44  ? 45  LEU E O   1 
ATOM   5814  C  CB  . LEU D 3 45  ? 22.216  16.469  36.316  1.00 81.99  ? 45  LEU E CB  1 
ATOM   5815  C  CG  . LEU D 3 45  ? 20.785  16.905  36.628  1.00 80.65  ? 45  LEU E CG  1 
ATOM   5816  C  CD1 . LEU D 3 45  ? 19.798  16.374  35.596  1.00 79.05  ? 45  LEU E CD1 1 
ATOM   5817  C  CD2 . LEU D 3 45  ? 20.407  16.448  38.028  1.00 76.56  ? 45  LEU E CD2 1 
ATOM   5818  N  N   . GLU D 3 46  ? 25.353  16.293  37.537  1.00 77.36  ? 46  GLU E N   1 
ATOM   5819  C  CA  . GLU D 3 46  ? 26.698  15.762  37.381  1.00 76.99  ? 46  GLU E CA  1 
ATOM   5820  C  C   . GLU D 3 46  ? 26.746  14.295  37.784  1.00 72.22  ? 46  GLU E C   1 
ATOM   5821  O  O   . GLU D 3 46  ? 26.414  13.941  38.911  1.00 69.52  ? 46  GLU E O   1 
ATOM   5822  C  CB  . GLU D 3 46  ? 27.654  16.542  38.270  1.00 84.73  ? 46  GLU E CB  1 
ATOM   5823  C  CG  . GLU D 3 46  ? 28.126  17.861  37.683  1.00 103.81 ? 46  GLU E CG  1 
ATOM   5824  C  CD  . GLU D 3 46  ? 29.146  18.554  38.567  1.00 113.53 ? 46  GLU E CD  1 
ATOM   5825  O  OE1 . GLU D 3 46  ? 28.767  18.986  39.681  1.00 103.97 ? 46  GLU E OE1 1 
ATOM   5826  O  OE2 . GLU D 3 46  ? 30.325  18.659  38.147  1.00 117.47 ? 46  GLU E OE2 1 
ATOM   5827  N  N   . TRP D 3 47  ? 27.168  13.436  36.869  1.00 70.85  ? 47  TRP E N   1 
ATOM   5828  C  CA  . TRP D 3 47  ? 27.356  12.029  37.194  1.00 66.79  ? 47  TRP E CA  1 
ATOM   5829  C  C   . TRP D 3 47  ? 28.621  11.870  38.027  1.00 64.27  ? 47  TRP E C   1 
ATOM   5830  O  O   . TRP D 3 47  ? 29.690  12.303  37.621  1.00 66.42  ? 47  TRP E O   1 
ATOM   5831  C  CB  . TRP D 3 47  ? 27.465  11.224  35.901  1.00 70.41  ? 47  TRP E CB  1 
ATOM   5832  C  CG  . TRP D 3 47  ? 27.664  9.746   36.081  1.00 70.78  ? 47  TRP E CG  1 
ATOM   5833  C  CD1 . TRP D 3 47  ? 26.709  8.823   36.350  1.00 70.57  ? 47  TRP E CD1 1 
ATOM   5834  C  CD2 . TRP D 3 47  ? 28.885  9.021   35.922  1.00 70.04  ? 47  TRP E CD2 1 
ATOM   5835  N  NE1 . TRP D 3 47  ? 27.260  7.574   36.389  1.00 67.65  ? 47  TRP E NE1 1 
ATOM   5836  C  CE2 . TRP D 3 47  ? 28.598  7.675   36.134  1.00 66.15  ? 47  TRP E CE2 1 
ATOM   5837  C  CE3 . TRP D 3 47  ? 30.195  9.390   35.627  1.00 80.43  ? 47  TRP E CE3 1 
ATOM   5838  C  CZ2 . TRP D 3 47  ? 29.562  6.696   36.058  1.00 78.83  ? 47  TRP E CZ2 1 
ATOM   5839  C  CZ3 . TRP D 3 47  ? 31.153  8.422   35.556  1.00 76.51  ? 47  TRP E CZ3 1 
ATOM   5840  C  CH2 . TRP D 3 47  ? 30.837  7.091   35.767  1.00 85.58  ? 47  TRP E CH2 1 
ATOM   5841  N  N   . ILE D 3 48  ? 28.496  11.248  39.192  1.00 60.26  ? 48  ILE E N   1 
ATOM   5842  C  CA  . ILE D 3 48  ? 29.626  11.069  40.091  1.00 62.83  ? 48  ILE E CA  1 
ATOM   5843  C  C   . ILE D 3 48  ? 30.363  9.770   39.776  1.00 64.93  ? 48  ILE E C   1 
ATOM   5844  O  O   . ILE D 3 48  ? 31.588  9.720   39.723  1.00 62.63  ? 48  ILE E O   1 
ATOM   5845  C  CB  . ILE D 3 48  ? 29.155  11.011  41.549  1.00 66.26  ? 48  ILE E CB  1 
ATOM   5846  C  CG1 . ILE D 3 48  ? 28.567  12.356  41.966  1.00 74.30  ? 48  ILE E CG1 1 
ATOM   5847  C  CG2 . ILE D 3 48  ? 30.309  10.662  42.468  1.00 67.53  ? 48  ILE E CG2 1 
ATOM   5848  C  CD1 . ILE D 3 48  ? 27.648  12.266  43.167  1.00 76.71  ? 48  ILE E CD1 1 
ATOM   5849  N  N   . GLY D 3 49  ? 29.601  8.707   39.589  1.00 65.18  ? 49  GLY E N   1 
ATOM   5850  C  CA  . GLY D 3 49  ? 30.181  7.406   39.318  1.00 67.51  ? 49  GLY E CA  1 
ATOM   5851  C  C   . GLY D 3 49  ? 29.153  6.296   39.411  1.00 64.61  ? 49  GLY E C   1 
ATOM   5852  O  O   . GLY D 3 49  ? 27.967  6.547   39.599  1.00 60.25  ? 49  GLY E O   1 
ATOM   5853  N  N   . LEU D 3 50  ? 29.608  5.059   39.264  1.00 64.99  ? 50  LEU E N   1 
ATOM   5854  C  CA  . LEU D 3 50  ? 28.712  3.928   39.367  1.00 59.80  ? 50  LEU E CA  1 
ATOM   5855  C  C   . LEU D 3 50  ? 29.358  2.784   40.103  1.00 56.76  ? 50  LEU E C   1 
ATOM   5856  O  O   . LEU D 3 50  ? 30.570  2.709   40.233  1.00 57.60  ? 50  LEU E O   1 
ATOM   5857  C  CB  . LEU D 3 50  ? 28.253  3.469   37.981  1.00 60.13  ? 50  LEU E CB  1 
ATOM   5858  C  CG  . LEU D 3 50  ? 29.289  2.864   37.039  1.00 61.90  ? 50  LEU E CG  1 
ATOM   5859  C  CD1 . LEU D 3 50  ? 29.632  1.441   37.440  1.00 59.44  ? 50  LEU E CD1 1 
ATOM   5860  C  CD2 . LEU D 3 50  ? 28.739  2.895   35.622  1.00 63.77  ? 50  LEU E CD2 1 
ATOM   5861  N  N   . ILE D 3 51  ? 28.517  1.901   40.598  1.00 55.85  ? 51  ILE E N   1 
ATOM   5862  C  CA  . ILE D 3 51  ? 28.969  0.674   41.189  1.00 58.15  ? 51  ILE E CA  1 
ATOM   5863  C  C   . ILE D 3 51  ? 28.053  -0.417  40.674  1.00 62.97  ? 51  ILE E C   1 
ATOM   5864  O  O   . ILE D 3 51  ? 26.858  -0.194  40.421  1.00 59.31  ? 51  ILE E O   1 
ATOM   5865  C  CB  . ILE D 3 51  ? 28.890  0.731   42.717  1.00 60.81  ? 51  ILE E CB  1 
ATOM   5866  C  CG1 . ILE D 3 51  ? 29.566  -0.482  43.334  1.00 61.36  ? 51  ILE E CG1 1 
ATOM   5867  C  CG2 . ILE D 3 51  ? 27.438  0.802   43.177  1.00 61.52  ? 51  ILE E CG2 1 
ATOM   5868  C  CD1 . ILE D 3 51  ? 29.758  -0.323  44.825  1.00 63.23  ? 51  ILE E CD1 1 
ATOM   5869  N  N   . ASN D 3 52  ? 28.642  -1.582  40.452  1.00 72.89  ? 52  ASN E N   1 
ATOM   5870  C  CA  . ASN D 3 52  ? 27.885  -2.764  40.096  1.00 71.47  ? 52  ASN E CA  1 
ATOM   5871  C  C   . ASN D 3 52  ? 27.681  -3.563  41.361  1.00 69.79  ? 52  ASN E C   1 
ATOM   5872  O  O   . ASN D 3 52  ? 28.615  -4.194  41.832  1.00 70.05  ? 52  ASN E O   1 
ATOM   5873  C  CB  . ASN D 3 52  ? 28.663  -3.589  39.075  1.00 69.52  ? 52  ASN E CB  1 
ATOM   5874  C  CG  . ASN D 3 52  ? 27.899  -4.793  38.610  1.00 68.01  ? 52  ASN E CG  1 
ATOM   5875  O  OD1 . ASN D 3 52  ? 27.209  -5.437  39.402  1.00 70.73  ? 52  ASN E OD1 1 
ATOM   5876  N  ND2 . ASN D 3 52  ? 28.003  -5.104  37.317  1.00 65.45  ? 52  ASN E ND2 1 
ATOM   5877  N  N   . PRO D 3 53  ? 26.478  -3.487  41.952  1.00 68.13  ? 53  PRO E N   1 
ATOM   5878  C  CA  . PRO D 3 53  ? 26.273  -4.079  43.270  1.00 66.60  ? 53  PRO E CA  1 
ATOM   5879  C  C   . PRO D 3 53  ? 26.622  -5.575  43.287  1.00 69.66  ? 53  PRO E C   1 
ATOM   5880  O  O   . PRO D 3 53  ? 26.996  -6.121  44.330  1.00 74.53  ? 53  PRO E O   1 
ATOM   5881  C  CB  . PRO D 3 53  ? 24.770  -3.866  43.527  1.00 65.89  ? 53  PRO E CB  1 
ATOM   5882  C  CG  . PRO D 3 53  ? 24.307  -2.879  42.513  1.00 62.07  ? 53  PRO E CG  1 
ATOM   5883  C  CD  . PRO D 3 53  ? 25.210  -3.067  41.332  1.00 64.19  ? 53  PRO E CD  1 
ATOM   5884  N  N   . ASN D 3 54  ? 26.515  -6.231  42.136  1.00 65.93  ? 54  ASN E N   1 
ATOM   5885  C  CA  . ASN D 3 54  ? 26.786  -7.655  42.058  1.00 72.66  ? 54  ASN E CA  1 
ATOM   5886  C  C   . ASN D 3 54  ? 28.268  -7.981  42.066  1.00 74.28  ? 54  ASN E C   1 
ATOM   5887  O  O   . ASN D 3 54  ? 28.668  -8.991  42.617  1.00 72.93  ? 54  ASN E O   1 
ATOM   5888  C  CB  . ASN D 3 54  ? 26.151  -8.257  40.807  1.00 73.94  ? 54  ASN E CB  1 
ATOM   5889  C  CG  . ASN D 3 54  ? 26.029  -9.759  40.897  1.00 80.33  ? 54  ASN E CG  1 
ATOM   5890  O  OD1 . ASN D 3 54  ? 25.485  -10.290 41.868  1.00 88.11  ? 54  ASN E OD1 1 
ATOM   5891  N  ND2 . ASN D 3 54  ? 26.552  -10.457 39.902  1.00 87.92  ? 54  ASN E ND2 1 
ATOM   5892  N  N   . THR D 3 55  ? 29.073  -7.135  41.427  1.00 73.83  ? 55  THR E N   1 
ATOM   5893  C  CA  . THR D 3 55  ? 30.494  -7.413  41.248  1.00 67.81  ? 55  THR E CA  1 
ATOM   5894  C  C   . THR D 3 55  ? 31.389  -6.566  42.150  1.00 67.16  ? 55  THR E C   1 
ATOM   5895  O  O   . THR D 3 55  ? 32.556  -6.883  42.334  1.00 73.09  ? 55  THR E O   1 
ATOM   5896  C  CB  . THR D 3 55  ? 30.917  -7.170  39.793  1.00 65.96  ? 55  THR E CB  1 
ATOM   5897  O  OG1 . THR D 3 55  ? 30.785  -5.781  39.488  1.00 63.48  ? 55  THR E OG1 1 
ATOM   5898  C  CG2 . THR D 3 55  ? 30.046  -7.959  38.834  1.00 67.69  ? 55  THR E CG2 1 
ATOM   5899  N  N   . GLY D 3 56  ? 30.849  -5.479  42.692  1.00 69.73  ? 56  GLY E N   1 
ATOM   5900  C  CA  . GLY D 3 56  ? 31.633  -4.507  43.478  1.00 67.43  ? 56  GLY E CA  1 
ATOM   5901  C  C   . GLY D 3 56  ? 32.409  -3.504  42.626  1.00 65.76  ? 56  GLY E C   1 
ATOM   5902  O  O   . GLY D 3 56  ? 33.122  -2.650  43.147  1.00 61.51  ? 56  GLY E O   1 
ATOM   5903  N  N   . TYR D 3 57  ? 32.285  -3.618  41.308  1.00 66.62  ? 57  TYR E N   1 
ATOM   5904  C  CA  . TYR D 3 57  ? 33.087  -2.823  40.388  1.00 67.96  ? 57  TYR E CA  1 
ATOM   5905  C  C   . TYR D 3 57  ? 32.639  -1.381  40.447  1.00 72.40  ? 57  TYR E C   1 
ATOM   5906  O  O   . TYR D 3 57  ? 31.434  -1.105  40.482  1.00 79.25  ? 57  TYR E O   1 
ATOM   5907  C  CB  . TYR D 3 57  ? 32.921  -3.338  38.959  1.00 67.31  ? 57  TYR E CB  1 
ATOM   5908  C  CG  . TYR D 3 57  ? 33.587  -2.470  37.928  1.00 68.94  ? 57  TYR E CG  1 
ATOM   5909  C  CD1 . TYR D 3 57  ? 32.886  -1.474  37.288  1.00 72.29  ? 57  TYR E CD1 1 
ATOM   5910  C  CD2 . TYR D 3 57  ? 34.934  -2.616  37.629  1.00 75.70  ? 57  TYR E CD2 1 
ATOM   5911  C  CE1 . TYR D 3 57  ? 33.496  -0.667  36.348  1.00 78.41  ? 57  TYR E CE1 1 
ATOM   5912  C  CE2 . TYR D 3 57  ? 35.556  -1.814  36.694  1.00 76.48  ? 57  TYR E CE2 1 
ATOM   5913  C  CZ  . TYR D 3 57  ? 34.828  -0.848  36.050  1.00 78.09  ? 57  TYR E CZ  1 
ATOM   5914  O  OH  . TYR D 3 57  ? 35.436  -0.045  35.120  1.00 90.38  ? 57  TYR E OH  1 
ATOM   5915  N  N   . THR D 3 58  ? 33.602  -0.461  40.471  1.00 70.53  ? 58  THR E N   1 
ATOM   5916  C  CA  . THR D 3 58  ? 33.293  0.967   40.487  1.00 64.20  ? 58  THR E CA  1 
ATOM   5917  C  C   . THR D 3 58  ? 34.083  1.711   39.434  1.00 66.76  ? 58  THR E C   1 
ATOM   5918  O  O   . THR D 3 58  ? 35.234  1.379   39.150  1.00 87.97  ? 58  THR E O   1 
ATOM   5919  C  CB  . THR D 3 58  ? 33.609  1.615   41.847  1.00 63.79  ? 58  THR E CB  1 
ATOM   5920  O  OG1 . THR D 3 58  ? 34.988  1.430   42.156  1.00 65.44  ? 58  THR E OG1 1 
ATOM   5921  C  CG2 . THR D 3 58  ? 32.751  1.019   42.955  1.00 66.99  ? 58  THR E CG2 1 
ATOM   5922  N  N   . THR D 3 59  ? 33.439  2.700   38.831  1.00 68.58  ? 59  THR E N   1 
ATOM   5923  C  CA  . THR D 3 59  ? 34.126  3.700   38.042  1.00 71.82  ? 59  THR E CA  1 
ATOM   5924  C  C   . THR D 3 59  ? 33.678  5.045   38.516  1.00 70.48  ? 59  THR E C   1 
ATOM   5925  O  O   . THR D 3 59  ? 32.544  5.198   38.948  1.00 69.96  ? 59  THR E O   1 
ATOM   5926  C  CB  . THR D 3 59  ? 33.743  3.641   36.556  1.00 75.25  ? 59  THR E CB  1 
ATOM   5927  O  OG1 . THR D 3 59  ? 33.440  2.293   36.176  1.00 81.67  ? 59  THR E OG1 1 
ATOM   5928  C  CG2 . THR D 3 59  ? 34.877  4.191   35.706  1.00 81.32  ? 59  THR E CG2 1 
ATOM   5929  N  N   . TYR D 3 60  ? 34.539  6.038   38.354  1.00 74.34  ? 60  TYR E N   1 
ATOM   5930  C  CA  . TYR D 3 60  ? 34.220  7.384   38.775  1.00 74.25  ? 60  TYR E CA  1 
ATOM   5931  C  C   . TYR D 3 60  ? 34.486  8.382   37.669  1.00 75.48  ? 60  TYR E C   1 
ATOM   5932  O  O   . TYR D 3 60  ? 35.387  8.216   36.849  1.00 78.96  ? 60  TYR E O   1 
ATOM   5933  C  CB  . TYR D 3 60  ? 35.051  7.770   39.993  1.00 78.92  ? 60  TYR E CB  1 
ATOM   5934  C  CG  . TYR D 3 60  ? 34.804  6.914   41.206  1.00 78.40  ? 60  TYR E CG  1 
ATOM   5935  C  CD1 . TYR D 3 60  ? 35.477  5.739   41.383  1.00 88.36  ? 60  TYR E CD1 1 
ATOM   5936  C  CD2 . TYR D 3 60  ? 33.905  7.290   42.175  1.00 87.61  ? 60  TYR E CD2 1 
ATOM   5937  C  CE1 . TYR D 3 60  ? 35.266  4.951   42.493  1.00 90.01  ? 60  TYR E CE1 1 
ATOM   5938  C  CE2 . TYR D 3 60  ? 33.687  6.504   43.288  1.00 89.37  ? 60  TYR E CE2 1 
ATOM   5939  C  CZ  . TYR D 3 60  ? 34.378  5.335   43.438  1.00 82.34  ? 60  TYR E CZ  1 
ATOM   5940  O  OH  . TYR D 3 60  ? 34.180  4.537   44.539  1.00 85.86  ? 60  TYR E OH  1 
ATOM   5941  N  N   . ASN D 3 61  ? 33.669  9.420   37.658  1.00 76.03  ? 61  ASN E N   1 
ATOM   5942  C  CA  . ASN D 3 61  ? 34.031  10.678  37.037  1.00 77.72  ? 61  ASN E CA  1 
ATOM   5943  C  C   . ASN D 3 61  ? 35.390  11.171  37.529  1.00 74.04  ? 61  ASN E C   1 
ATOM   5944  O  O   . ASN D 3 61  ? 35.640  11.240  38.735  1.00 66.36  ? 61  ASN E O   1 
ATOM   5945  C  CB  . ASN D 3 61  ? 32.954  11.714  37.361  1.00 80.62  ? 61  ASN E CB  1 
ATOM   5946  C  CG  . ASN D 3 61  ? 32.997  12.896  36.437  1.00 84.25  ? 61  ASN E CG  1 
ATOM   5947  O  OD1 . ASN D 3 61  ? 34.053  13.453  36.187  1.00 92.00  ? 61  ASN E OD1 1 
ATOM   5948  N  ND2 . ASN D 3 61  ? 31.849  13.264  35.895  1.00 93.19  ? 61  ASN E ND2 1 
ATOM   5949  N  N   . GLN D 3 62  ? 36.247  11.534  36.583  1.00 77.84  ? 62  GLN E N   1 
ATOM   5950  C  CA  . GLN D 3 62  ? 37.538  12.113  36.893  1.00 88.53  ? 62  GLN E CA  1 
ATOM   5951  C  C   . GLN D 3 62  ? 37.422  13.237  37.919  1.00 94.65  ? 62  GLN E C   1 
ATOM   5952  O  O   . GLN D 3 62  ? 38.241  13.334  38.827  1.00 102.19 ? 62  GLN E O   1 
ATOM   5953  C  CB  . GLN D 3 62  ? 38.190  12.644  35.620  1.00 102.15 ? 62  GLN E CB  1 
ATOM   5954  C  CG  . GLN D 3 62  ? 39.704  12.719  35.692  1.00 120.40 ? 62  GLN E CG  1 
ATOM   5955  C  CD  . GLN D 3 62  ? 40.350  11.352  35.852  1.00 133.81 ? 62  GLN E CD  1 
ATOM   5956  O  OE1 . GLN D 3 62  ? 39.702  10.315  35.675  1.00 137.26 ? 62  GLN E OE1 1 
ATOM   5957  N  NE2 . GLN D 3 62  ? 41.644  11.342  36.169  1.00 147.83 ? 62  GLN E NE2 1 
ATOM   5958  N  N   . LYS D 3 63  ? 36.406  14.086  37.767  1.00 99.40  ? 63  LYS E N   1 
ATOM   5959  C  CA  . LYS D 3 63  ? 36.130  15.175  38.712  1.00 94.90  ? 63  LYS E CA  1 
ATOM   5960  C  C   . LYS D 3 63  ? 36.073  14.687  40.153  1.00 89.15  ? 63  LYS E C   1 
ATOM   5961  O  O   . LYS D 3 63  ? 36.438  15.403  41.069  1.00 87.99  ? 63  LYS E O   1 
ATOM   5962  C  CB  . LYS D 3 63  ? 34.780  15.818  38.401  1.00 99.41  ? 63  LYS E CB  1 
ATOM   5963  C  CG  . LYS D 3 63  ? 34.806  17.038  37.501  1.00 114.04 ? 63  LYS E CG  1 
ATOM   5964  C  CD  . LYS D 3 63  ? 33.558  17.881  37.767  1.00 121.46 ? 63  LYS E CD  1 
ATOM   5965  C  CE  . LYS D 3 63  ? 33.279  18.924  36.698  1.00 132.59 ? 63  LYS E CE  1 
ATOM   5966  N  NZ  . LYS D 3 63  ? 34.406  19.885  36.524  1.00 145.90 ? 63  LYS E NZ  1 
ATOM   5967  N  N   . PHE D 3 64  ? 35.568  13.479  40.360  1.00 89.13  ? 64  PHE E N   1 
ATOM   5968  C  CA  . PHE D 3 64  ? 35.250  13.030  41.700  1.00 85.07  ? 64  PHE E CA  1 
ATOM   5969  C  C   . PHE D 3 64  ? 36.174  11.938  42.183  1.00 82.77  ? 64  PHE E C   1 
ATOM   5970  O  O   . PHE D 3 64  ? 35.954  11.383  43.252  1.00 73.23  ? 64  PHE E O   1 
ATOM   5971  C  CB  . PHE D 3 64  ? 33.810  12.542  41.735  1.00 87.38  ? 64  PHE E CB  1 
ATOM   5972  C  CG  . PHE D 3 64  ? 32.810  13.642  41.558  1.00 94.34  ? 64  PHE E CG  1 
ATOM   5973  C  CD1 . PHE D 3 64  ? 32.410  14.409  42.642  1.00 96.21  ? 64  PHE E CD1 1 
ATOM   5974  C  CD2 . PHE D 3 64  ? 32.308  13.945  40.304  1.00 95.34  ? 64  PHE E CD2 1 
ATOM   5975  C  CE1 . PHE D 3 64  ? 31.509  15.445  42.484  1.00 92.54  ? 64  PHE E CE1 1 
ATOM   5976  C  CE2 . PHE D 3 64  ? 31.397  14.974  40.140  1.00 96.86  ? 64  PHE E CE2 1 
ATOM   5977  C  CZ  . PHE D 3 64  ? 31.000  15.726  41.231  1.00 92.96  ? 64  PHE E CZ  1 
ATOM   5978  N  N   . LYS D 3 65  ? 37.231  11.665  41.421  1.00 89.36  ? 65  LYS E N   1 
ATOM   5979  C  CA  . LYS D 3 65  ? 38.088  10.521  41.689  1.00 92.23  ? 65  LYS E CA  1 
ATOM   5980  C  C   . LYS D 3 65  ? 38.439  10.408  43.163  1.00 87.15  ? 65  LYS E C   1 
ATOM   5981  O  O   . LYS D 3 65  ? 38.044  9.453   43.820  1.00 107.96 ? 65  LYS E O   1 
ATOM   5982  C  CB  . LYS D 3 65  ? 39.352  10.556  40.833  1.00 106.24 ? 65  LYS E CB  1 
ATOM   5983  C  CG  . LYS D 3 65  ? 39.992  9.185   40.648  1.00 118.95 ? 65  LYS E CG  1 
ATOM   5984  C  CD  . LYS D 3 65  ? 39.203  8.281   39.692  1.00 119.43 ? 65  LYS E CD  1 
ATOM   5985  C  CE  . LYS D 3 65  ? 39.235  8.808   38.262  1.00 130.98 ? 65  LYS E CE  1 
ATOM   5986  N  NZ  . LYS D 3 65  ? 38.610  7.862   37.294  1.00 128.50 ? 65  LYS E NZ  1 
ATOM   5987  N  N   . GLY D 3 66  ? 39.144  11.382  43.704  1.00 85.73  ? 66  GLY E N   1 
ATOM   5988  C  CA  . GLY D 3 66  ? 39.525  11.314  45.108  1.00 90.47  ? 66  GLY E CA  1 
ATOM   5989  C  C   . GLY D 3 66  ? 38.394  11.533  46.108  1.00 91.65  ? 66  GLY E C   1 
ATOM   5990  O  O   . GLY D 3 66  ? 38.583  11.322  47.308  1.00 96.08  ? 66  GLY E O   1 
ATOM   5991  N  N   . LYS D 3 67  ? 37.228  11.978  45.637  1.00 89.95  ? 67  LYS E N   1 
ATOM   5992  C  CA  . LYS D 3 67  ? 36.228  12.585  46.527  1.00 93.73  ? 67  LYS E CA  1 
ATOM   5993  C  C   . LYS D 3 67  ? 35.265  11.578  47.070  1.00 90.81  ? 67  LYS E C   1 
ATOM   5994  O  O   . LYS D 3 67  ? 34.837  11.656  48.218  1.00 97.87  ? 67  LYS E O   1 
ATOM   5995  C  CB  . LYS D 3 67  ? 35.398  13.643  45.790  1.00 99.96  ? 67  LYS E CB  1 
ATOM   5996  C  CG  . LYS D 3 67  ? 35.793  15.081  46.101  1.00 111.68 ? 67  LYS E CG  1 
ATOM   5997  C  CD  . LYS D 3 67  ? 34.591  15.909  46.544  1.00 109.46 ? 67  LYS E CD  1 
ATOM   5998  C  CE  . LYS D 3 67  ? 34.586  16.156  48.050  1.00 98.94  ? 67  LYS E CE  1 
ATOM   5999  N  NZ  . LYS D 3 67  ? 35.441  17.309  48.442  1.00 96.05  ? 67  LYS E NZ  1 
ATOM   6000  N  N   . ALA D 3 68  ? 34.864  10.672  46.200  1.00 89.97  ? 68  ALA E N   1 
ATOM   6001  C  CA  . ALA D 3 68  ? 33.705  9.855   46.453  1.00 81.17  ? 68  ALA E CA  1 
ATOM   6002  C  C   . ALA D 3 68  ? 34.087  8.387   46.460  1.00 84.87  ? 68  ALA E C   1 
ATOM   6003  O  O   . ALA D 3 68  ? 34.909  7.933   45.646  1.00 94.66  ? 68  ALA E O   1 
ATOM   6004  C  CB  . ALA D 3 68  ? 32.656  10.137  45.399  1.00 80.43  ? 68  ALA E CB  1 
ATOM   6005  N  N   . THR D 3 69  ? 33.502  7.655   47.404  1.00 85.58  ? 69  THR E N   1 
ATOM   6006  C  CA  . THR D 3 69  ? 33.644  6.209   47.459  1.00 82.47  ? 69  THR E CA  1 
ATOM   6007  C  C   . THR D 3 69  ? 32.274  5.545   47.452  1.00 73.48  ? 69  THR E C   1 
ATOM   6008  O  O   . THR D 3 69  ? 31.454  5.779   48.335  1.00 66.10  ? 69  THR E O   1 
ATOM   6009  C  CB  . THR D 3 69  ? 34.378  5.755   48.725  1.00 83.54  ? 69  THR E CB  1 
ATOM   6010  O  OG1 . THR D 3 69  ? 35.552  6.555   48.925  1.00 83.64  ? 69  THR E OG1 1 
ATOM   6011  C  CG2 . THR D 3 69  ? 34.755  4.298   48.587  1.00 89.51  ? 69  THR E CG2 1 
ATOM   6012  N  N   . LEU D 3 70  ? 32.038  4.718   46.446  1.00 69.83  ? 70  LEU E N   1 
ATOM   6013  C  CA  . LEU D 3 70  ? 30.809  3.963   46.360  1.00 68.65  ? 70  LEU E CA  1 
ATOM   6014  C  C   . LEU D 3 70  ? 30.988  2.552   46.938  1.00 70.35  ? 70  LEU E C   1 
ATOM   6015  O  O   . LEU D 3 70  ? 31.979  1.877   46.654  1.00 75.78  ? 70  LEU E O   1 
ATOM   6016  C  CB  . LEU D 3 70  ? 30.370  3.897   44.899  1.00 66.30  ? 70  LEU E CB  1 
ATOM   6017  C  CG  . LEU D 3 70  ? 30.193  5.269   44.257  1.00 64.32  ? 70  LEU E CG  1 
ATOM   6018  C  CD1 . LEU D 3 70  ? 29.658  5.138   42.835  1.00 63.16  ? 70  LEU E CD1 1 
ATOM   6019  C  CD2 . LEU D 3 70  ? 29.264  6.119   45.113  1.00 63.15  ? 70  LEU E CD2 1 
ATOM   6020  N  N   . THR D 3 71  ? 30.035  2.124   47.762  1.00 64.94  ? 71  THR E N   1 
ATOM   6021  C  CA  . THR D 3 71  ? 30.004  0.761   48.265  1.00 65.58  ? 71  THR E CA  1 
ATOM   6022  C  C   . THR D 3 71  ? 28.559  0.274   48.262  1.00 70.68  ? 71  THR E C   1 
ATOM   6023  O  O   . THR D 3 71  ? 27.641  1.068   48.070  1.00 73.75  ? 71  THR E O   1 
ATOM   6024  C  CB  . THR D 3 71  ? 30.593  0.655   49.689  1.00 65.25  ? 71  THR E CB  1 
ATOM   6025  O  OG1 . THR D 3 71  ? 29.870  1.484   50.594  1.00 63.79  ? 71  THR E OG1 1 
ATOM   6026  C  CG2 . THR D 3 71  ? 32.037  1.077   49.697  1.00 68.35  ? 71  THR E CG2 1 
ATOM   6027  N  N   . VAL D 3 72  ? 28.359  -1.031  48.446  1.00 72.84  ? 72  VAL E N   1 
ATOM   6028  C  CA  . VAL D 3 72  ? 27.012  -1.581  48.584  1.00 68.26  ? 72  VAL E CA  1 
ATOM   6029  C  C   . VAL D 3 72  ? 26.986  -2.562  49.712  1.00 67.47  ? 72  VAL E C   1 
ATOM   6030  O  O   . VAL D 3 72  ? 28.021  -3.053  50.121  1.00 69.14  ? 72  VAL E O   1 
ATOM   6031  C  CB  . VAL D 3 72  ? 26.526  -2.305  47.316  1.00 68.62  ? 72  VAL E CB  1 
ATOM   6032  C  CG1 . VAL D 3 72  ? 26.590  -1.367  46.127  1.00 79.79  ? 72  VAL E CG1 1 
ATOM   6033  C  CG2 . VAL D 3 72  ? 27.341  -3.546  47.046  1.00 65.05  ? 72  VAL E CG2 1 
ATOM   6034  N  N   . ASP D 3 73  ? 25.797  -2.809  50.237  1.00 72.95  ? 73  ASP E N   1 
ATOM   6035  C  CA  . ASP D 3 73  ? 25.565  -3.941  51.118  1.00 81.94  ? 73  ASP E CA  1 
ATOM   6036  C  C   . ASP D 3 73  ? 24.521  -4.863  50.480  1.00 80.83  ? 73  ASP E C   1 
ATOM   6037  O  O   . ASP D 3 73  ? 23.333  -4.547  50.445  1.00 81.99  ? 73  ASP E O   1 
ATOM   6038  C  CB  . ASP D 3 73  ? 25.094  -3.463  52.485  1.00 88.56  ? 73  ASP E CB  1 
ATOM   6039  C  CG  . ASP D 3 73  ? 24.815  -4.608  53.428  1.00 98.28  ? 73  ASP E CG  1 
ATOM   6040  O  OD1 . ASP D 3 73  ? 24.490  -5.716  52.946  1.00 98.20  ? 73  ASP E OD1 1 
ATOM   6041  O  OD2 . ASP D 3 73  ? 24.912  -4.396  54.653  1.00 116.39 ? 73  ASP E OD2 1 
ATOM   6042  N  N   . LYS D 3 74  ? 24.974  -5.990  49.947  1.00 83.77  ? 74  LYS E N   1 
ATOM   6043  C  CA  . LYS D 3 74  ? 24.104  -6.847  49.158  1.00 80.73  ? 74  LYS E CA  1 
ATOM   6044  C  C   . LYS D 3 74  ? 22.943  -7.370  49.993  1.00 80.87  ? 74  LYS E C   1 
ATOM   6045  O  O   . LYS D 3 74  ? 21.802  -7.410  49.534  1.00 77.38  ? 74  LYS E O   1 
ATOM   6046  C  CB  . LYS D 3 74  ? 24.892  -8.009  48.588  1.00 84.14  ? 74  LYS E CB  1 
ATOM   6047  C  CG  . LYS D 3 74  ? 25.804  -7.627  47.443  1.00 85.32  ? 74  LYS E CG  1 
ATOM   6048  C  CD  . LYS D 3 74  ? 26.431  -8.871  46.843  1.00 103.16 ? 74  LYS E CD  1 
ATOM   6049  C  CE  . LYS D 3 74  ? 27.886  -8.651  46.477  1.00 108.59 ? 74  LYS E CE  1 
ATOM   6050  N  NZ  . LYS D 3 74  ? 28.412  -9.801  45.697  1.00 115.72 ? 74  LYS E NZ  1 
ATOM   6051  N  N   . SER D 3 75  ? 23.241  -7.753  51.226  1.00 83.79  ? 75  SER E N   1 
ATOM   6052  C  CA  . SER D 3 75  ? 22.257  -8.384  52.081  1.00 90.59  ? 75  SER E CA  1 
ATOM   6053  C  C   . SER D 3 75  ? 21.072  -7.463  52.368  1.00 90.16  ? 75  SER E C   1 
ATOM   6054  O  O   . SER D 3 75  ? 19.928  -7.908  52.386  1.00 103.13 ? 75  SER E O   1 
ATOM   6055  C  CB  . SER D 3 75  ? 22.912  -8.831  53.388  1.00 101.09 ? 75  SER E CB  1 
ATOM   6056  O  OG  . SER D 3 75  ? 23.206  -7.725  54.225  1.00 103.15 ? 75  SER E OG  1 
ATOM   6057  N  N   . SER D 3 76  ? 21.334  -6.177  52.569  1.00 85.18  ? 76  SER E N   1 
ATOM   6058  C  CA  . SER D 3 76  ? 20.260  -5.224  52.848  1.00 78.37  ? 76  SER E CA  1 
ATOM   6059  C  C   . SER D 3 76  ? 19.905  -4.428  51.605  1.00 70.08  ? 76  SER E C   1 
ATOM   6060  O  O   . SER D 3 76  ? 19.289  -3.379  51.687  1.00 65.09  ? 76  SER E O   1 
ATOM   6061  C  CB  . SER D 3 76  ? 20.674  -4.284  53.970  1.00 78.42  ? 76  SER E CB  1 
ATOM   6062  O  OG  . SER D 3 76  ? 21.827  -3.540  53.609  1.00 76.58  ? 76  SER E OG  1 
ATOM   6063  N  N   . SER D 3 77  ? 20.276  -4.957  50.448  1.00 72.05  ? 77  SER E N   1 
ATOM   6064  C  CA  . SER D 3 77  ? 20.143  -4.246  49.175  1.00 77.83  ? 77  SER E CA  1 
ATOM   6065  C  C   . SER D 3 77  ? 20.167  -2.710  49.330  1.00 79.30  ? 77  SER E C   1 
ATOM   6066  O  O   . SER D 3 77  ? 19.214  -1.991  49.004  1.00 78.60  ? 77  SER E O   1 
ATOM   6067  C  CB  . SER D 3 77  ? 18.911  -4.739  48.420  1.00 78.45  ? 77  SER E CB  1 
ATOM   6068  O  OG  . SER D 3 77  ? 17.926  -5.181  49.324  1.00 97.46  ? 77  SER E OG  1 
ATOM   6069  N  N   . THR D 3 78  ? 21.309  -2.229  49.798  1.00 77.46  ? 78  THR E N   1 
ATOM   6070  C  CA  . THR D 3 78  ? 21.516  -0.832  50.079  1.00 75.31  ? 78  THR E CA  1 
ATOM   6071  C  C   . THR D 3 78  ? 22.807  -0.380  49.397  1.00 74.74  ? 78  THR E C   1 
ATOM   6072  O  O   . THR D 3 78  ? 23.801  -1.097  49.399  1.00 72.05  ? 78  THR E O   1 
ATOM   6073  C  CB  . THR D 3 78  ? 21.638  -0.615  51.596  1.00 81.26  ? 78  THR E CB  1 
ATOM   6074  O  OG1 . THR D 3 78  ? 20.397  -0.942  52.224  1.00 75.79  ? 78  THR E OG1 1 
ATOM   6075  C  CG2 . THR D 3 78  ? 22.000  0.837   51.921  1.00 89.15  ? 78  THR E CG2 1 
ATOM   6076  N  N   . ALA D 3 79  ? 22.789  0.814   48.819  1.00 75.32  ? 79  ALA E N   1 
ATOM   6077  C  CA  . ALA D 3 79  ? 23.985  1.387   48.229  1.00 70.63  ? 79  ALA E CA  1 
ATOM   6078  C  C   . ALA D 3 79  ? 24.437  2.537   49.101  1.00 71.94  ? 79  ALA E C   1 
ATOM   6079  O  O   . ALA D 3 79  ? 23.608  3.252   49.671  1.00 80.58  ? 79  ALA E O   1 
ATOM   6080  C  CB  . ALA D 3 79  ? 23.699  1.870   46.816  1.00 72.21  ? 79  ALA E CB  1 
ATOM   6081  N  N   . TYR D 3 80  ? 25.750  2.719   49.200  1.00 69.49  ? 80  TYR E N   1 
ATOM   6082  C  CA  . TYR D 3 80  ? 26.311  3.815   49.980  1.00 66.95  ? 80  TYR E CA  1 
ATOM   6083  C  C   . TYR D 3 80  ? 27.201  4.714   49.146  1.00 70.78  ? 80  TYR E C   1 
ATOM   6084  O  O   . TYR D 3 80  ? 27.905  4.244   48.246  1.00 67.91  ? 80  TYR E O   1 
ATOM   6085  C  CB  . TYR D 3 80  ? 27.122  3.265   51.131  1.00 63.79  ? 80  TYR E CB  1 
ATOM   6086  C  CG  . TYR D 3 80  ? 26.283  2.574   52.161  1.00 65.63  ? 80  TYR E CG  1 
ATOM   6087  C  CD1 . TYR D 3 80  ? 25.758  3.268   53.232  1.00 66.59  ? 80  TYR E CD1 1 
ATOM   6088  C  CD2 . TYR D 3 80  ? 26.027  1.216   52.070  1.00 73.97  ? 80  TYR E CD2 1 
ATOM   6089  C  CE1 . TYR D 3 80  ? 25.007  2.631   54.190  1.00 72.27  ? 80  TYR E CE1 1 
ATOM   6090  C  CE2 . TYR D 3 80  ? 25.276  0.563   53.026  1.00 78.11  ? 80  TYR E CE2 1 
ATOM   6091  C  CZ  . TYR D 3 80  ? 24.767  1.281   54.081  1.00 77.79  ? 80  TYR E CZ  1 
ATOM   6092  O  OH  . TYR D 3 80  ? 24.011  0.646   55.032  1.00 91.12  ? 80  TYR E OH  1 
ATOM   6093  N  N   . MET D 3 81  ? 27.163  6.010   49.458  1.00 79.79  ? 81  MET E N   1 
ATOM   6094  C  CA  . MET D 3 81  ? 28.179  6.939   48.991  1.00 75.19  ? 81  MET E CA  1 
ATOM   6095  C  C   . MET D 3 81  ? 28.858  7.650   50.158  1.00 69.02  ? 81  MET E C   1 
ATOM   6096  O  O   . MET D 3 81  ? 28.202  8.229   51.006  1.00 63.01  ? 81  MET E O   1 
ATOM   6097  C  CB  . MET D 3 81  ? 27.576  7.966   48.038  1.00 73.65  ? 81  MET E CB  1 
ATOM   6098  C  CG  . MET D 3 81  ? 28.572  9.036   47.651  1.00 76.95  ? 81  MET E CG  1 
ATOM   6099  S  SD  . MET D 3 81  ? 27.972  10.050  46.300  1.00 88.67  ? 81  MET E SD  1 
ATOM   6100  C  CE  . MET D 3 81  ? 26.753  11.028  47.180  1.00 88.05  ? 81  MET E CE  1 
ATOM   6101  N  N   . GLU D 3 82  ? 30.184  7.608   50.184  1.00 72.36  ? 82  GLU E N   1 
ATOM   6102  C  CA  . GLU D 3 82  ? 30.954  8.414   51.115  1.00 74.59  ? 82  GLU E CA  1 
ATOM   6103  C  C   . GLU D 3 82  ? 31.637  9.567   50.384  1.00 81.56  ? 82  GLU E C   1 
ATOM   6104  O  O   . GLU D 3 82  ? 32.257  9.373   49.335  1.00 87.16  ? 82  GLU E O   1 
ATOM   6105  C  CB  . GLU D 3 82  ? 31.999  7.559   51.803  1.00 77.00  ? 82  GLU E CB  1 
ATOM   6106  C  CG  . GLU D 3 82  ? 32.523  8.159   53.090  1.00 82.81  ? 82  GLU E CG  1 
ATOM   6107  C  CD  . GLU D 3 82  ? 33.391  7.190   53.871  1.00 99.26  ? 82  GLU E CD  1 
ATOM   6108  O  OE1 . GLU D 3 82  ? 33.543  7.395   55.095  1.00 110.17 ? 82  GLU E OE1 1 
ATOM   6109  O  OE2 . GLU D 3 82  ? 33.923  6.224   53.266  1.00 104.71 ? 82  GLU E OE2 1 
ATOM   6110  N  N   . LEU D 3 83  ? 31.513  10.771  50.942  1.00 84.62  ? 83  LEU E N   1 
ATOM   6111  C  CA  . LEU D 3 83  ? 32.190  11.953  50.415  1.00 82.50  ? 83  LEU E CA  1 
ATOM   6112  C  C   . LEU D 3 83  ? 33.262  12.436  51.385  1.00 84.96  ? 83  LEU E C   1 
ATOM   6113  O  O   . LEU D 3 83  ? 33.026  12.530  52.587  1.00 82.62  ? 83  LEU E O   1 
ATOM   6114  C  CB  . LEU D 3 83  ? 31.179  13.063  50.185  1.00 82.31  ? 83  LEU E CB  1 
ATOM   6115  C  CG  . LEU D 3 83  ? 30.170  12.807  49.069  1.00 88.57  ? 83  LEU E CG  1 
ATOM   6116  C  CD1 . LEU D 3 83  ? 29.168  13.953  48.983  1.00 88.29  ? 83  LEU E CD1 1 
ATOM   6117  C  CD2 . LEU D 3 83  ? 30.883  12.598  47.732  1.00 91.92  ? 83  LEU E CD2 1 
ATOM   6118  N  N   . LEU D 3 84  ? 34.430  12.777  50.852  1.00 91.34  ? 84  LEU E N   1 
ATOM   6119  C  CA  . LEU D 3 84  ? 35.609  13.015  51.677  1.00 96.40  ? 84  LEU E CA  1 
ATOM   6120  C  C   . LEU D 3 84  ? 36.062  14.471  51.669  1.00 95.69  ? 84  LEU E C   1 
ATOM   6121  O  O   . LEU D 3 84  ? 35.746  15.229  50.754  1.00 92.99  ? 84  LEU E O   1 
ATOM   6122  C  CB  . LEU D 3 84  ? 36.748  12.126  51.197  1.00 97.30  ? 84  LEU E CB  1 
ATOM   6123  C  CG  . LEU D 3 84  ? 36.302  10.676  51.102  1.00 94.80  ? 84  LEU E CG  1 
ATOM   6124  C  CD1 . LEU D 3 84  ? 37.296  9.869   50.296  1.00 101.28 ? 84  LEU E CD1 1 
ATOM   6125  C  CD2 . LEU D 3 84  ? 36.119  10.100  52.499  1.00 98.18  ? 84  LEU E CD2 1 
ATOM   6126  N  N   . SER D 3 85  ? 36.799  14.852  52.707  1.00 97.35  ? 85  SER E N   1 
ATOM   6127  C  CA  . SER D 3 85  ? 37.343  16.199  52.808  1.00 99.18  ? 85  SER E CA  1 
ATOM   6128  C  C   . SER D 3 85  ? 36.379  17.221  52.237  1.00 92.19  ? 85  SER E C   1 
ATOM   6129  O  O   . SER D 3 85  ? 36.662  17.851  51.230  1.00 89.83  ? 85  SER E O   1 
ATOM   6130  C  CB  . SER D 3 85  ? 38.669  16.282  52.052  1.00 108.34 ? 85  SER E CB  1 
ATOM   6131  O  OG  . SER D 3 85  ? 39.553  15.251  52.455  1.00 120.15 ? 85  SER E OG  1 
ATOM   6132  N  N   . LEU D 3 86  ? 35.232  17.373  52.879  1.00 92.30  ? 86  LEU E N   1 
ATOM   6133  C  CA  . LEU D 3 86  ? 34.166  18.171  52.314  1.00 90.53  ? 86  LEU E CA  1 
ATOM   6134  C  C   . LEU D 3 86  ? 34.497  19.643  52.368  1.00 90.51  ? 86  LEU E C   1 
ATOM   6135  O  O   . LEU D 3 86  ? 34.967  20.152  53.388  1.00 82.97  ? 86  LEU E O   1 
ATOM   6136  C  CB  . LEU D 3 86  ? 32.857  17.909  53.053  1.00 89.59  ? 86  LEU E CB  1 
ATOM   6137  C  CG  . LEU D 3 86  ? 32.307  16.514  52.822  1.00 84.25  ? 86  LEU E CG  1 
ATOM   6138  C  CD1 . LEU D 3 86  ? 31.178  16.215  53.783  1.00 86.05  ? 86  LEU E CD1 1 
ATOM   6139  C  CD2 . LEU D 3 86  ? 31.827  16.404  51.388  1.00 84.03  ? 86  LEU E CD2 1 
ATOM   6140  N  N   . THR D 3 87  ? 34.238  20.314  51.251  1.00 93.14  ? 87  THR E N   1 
ATOM   6141  C  CA  . THR D 3 87  ? 34.335  21.755  51.170  1.00 96.50  ? 87  THR E CA  1 
ATOM   6142  C  C   . THR D 3 87  ? 32.965  22.312  50.835  1.00 90.30  ? 87  THR E C   1 
ATOM   6143  O  O   . THR D 3 87  ? 32.019  21.566  50.615  1.00 95.84  ? 87  THR E O   1 
ATOM   6144  C  CB  . THR D 3 87  ? 35.352  22.195  50.102  1.00 101.54 ? 87  THR E CB  1 
ATOM   6145  O  OG1 . THR D 3 87  ? 35.348  23.627  50.006  1.00 118.62 ? 87  THR E OG1 1 
ATOM   6146  C  CG2 . THR D 3 87  ? 35.025  21.581  48.735  1.00 96.06  ? 87  THR E CG2 1 
ATOM   6147  N  N   . SER D 3 88  ? 32.858  23.628  50.805  1.00 89.30  ? 88  SER E N   1 
ATOM   6148  C  CA  . SER D 3 88  ? 31.580  24.267  50.600  1.00 84.95  ? 88  SER E CA  1 
ATOM   6149  C  C   . SER D 3 88  ? 31.014  23.955  49.219  1.00 80.67  ? 88  SER E C   1 
ATOM   6150  O  O   . SER D 3 88  ? 29.796  23.901  49.044  1.00 83.21  ? 88  SER E O   1 
ATOM   6151  C  CB  . SER D 3 88  ? 31.736  25.770  50.788  1.00 92.68  ? 88  SER E CB  1 
ATOM   6152  O  OG  . SER D 3 88  ? 30.481  26.407  50.765  1.00 103.92 ? 88  SER E OG  1 
ATOM   6153  N  N   . GLU D 3 89  ? 31.886  23.720  48.245  1.00 82.83  ? 89  GLU E N   1 
ATOM   6154  C  CA  . GLU D 3 89  ? 31.429  23.369  46.900  1.00 91.88  ? 89  GLU E CA  1 
ATOM   6155  C  C   . GLU D 3 89  ? 30.725  22.008  46.836  1.00 94.90  ? 89  GLU E C   1 
ATOM   6156  O  O   . GLU D 3 89  ? 30.175  21.652  45.799  1.00 105.76 ? 89  GLU E O   1 
ATOM   6157  C  CB  . GLU D 3 89  ? 32.581  23.411  45.890  1.00 101.99 ? 89  GLU E CB  1 
ATOM   6158  C  CG  . GLU D 3 89  ? 33.058  24.809  45.551  1.00 115.18 ? 89  GLU E CG  1 
ATOM   6159  C  CD  . GLU D 3 89  ? 31.918  25.767  45.239  1.00 130.10 ? 89  GLU E CD  1 
ATOM   6160  O  OE1 . GLU D 3 89  ? 31.642  25.997  44.040  1.00 144.97 ? 89  GLU E OE1 1 
ATOM   6161  O  OE2 . GLU D 3 89  ? 31.300  26.295  46.194  1.00 128.01 ? 89  GLU E OE2 1 
ATOM   6162  N  N   . ASP D 3 90  ? 30.736  21.253  47.935  1.00 92.93  ? 90  ASP E N   1 
ATOM   6163  C  CA  . ASP D 3 90  ? 30.094  19.944  47.968  1.00 83.50  ? 90  ASP E CA  1 
ATOM   6164  C  C   . ASP D 3 90  ? 28.650  20.045  48.406  1.00 74.26  ? 90  ASP E C   1 
ATOM   6165  O  O   . ASP D 3 90  ? 27.859  19.140  48.167  1.00 79.76  ? 90  ASP E O   1 
ATOM   6166  C  CB  . ASP D 3 90  ? 30.853  18.992  48.893  1.00 87.67  ? 90  ASP E CB  1 
ATOM   6167  C  CG  . ASP D 3 90  ? 32.244  18.680  48.380  1.00 93.11  ? 90  ASP E CG  1 
ATOM   6168  O  OD1 . ASP D 3 90  ? 32.344  18.307  47.189  1.00 96.37  ? 90  ASP E OD1 1 
ATOM   6169  O  OD2 . ASP D 3 90  ? 33.226  18.796  49.156  1.00 87.00  ? 90  ASP E OD2 1 
ATOM   6170  N  N   . SER D 3 91  ? 28.294  21.147  49.045  1.00 69.57  ? 91  SER E N   1 
ATOM   6171  C  CA  . SER D 3 91  ? 26.907  21.355  49.415  1.00 66.53  ? 91  SER E CA  1 
ATOM   6172  C  C   . SER D 3 91  ? 26.038  21.257  48.180  1.00 67.24  ? 91  SER E C   1 
ATOM   6173  O  O   . SER D 3 91  ? 26.240  22.001  47.220  1.00 65.76  ? 91  SER E O   1 
ATOM   6174  C  CB  . SER D 3 91  ? 26.727  22.708  50.074  1.00 65.42  ? 91  SER E CB  1 
ATOM   6175  O  OG  . SER D 3 91  ? 27.316  22.678  51.356  1.00 65.41  ? 91  SER E OG  1 
ATOM   6176  N  N   . ALA D 3 92  ? 25.100  20.307  48.202  1.00 66.69  ? 92  ALA E N   1 
ATOM   6177  C  CA  . ALA D 3 92  ? 24.228  20.044  47.060  1.00 65.28  ? 92  ALA E CA  1 
ATOM   6178  C  C   . ALA D 3 92  ? 23.194  18.983  47.407  1.00 68.46  ? 92  ALA E C   1 
ATOM   6179  O  O   . ALA D 3 92  ? 23.148  18.475  48.534  1.00 67.05  ? 92  ALA E O   1 
ATOM   6180  C  CB  . ALA D 3 92  ? 25.052  19.574  45.876  1.00 66.49  ? 92  ALA E CB  1 
ATOM   6181  N  N   . ILE D 3 93  ? 22.370  18.646  46.419  1.00 68.60  ? 93  ILE E N   1 
ATOM   6182  C  CA  . ILE D 3 93  ? 21.518  17.477  46.506  1.00 68.72  ? 93  ILE E CA  1 
ATOM   6183  C  C   . ILE D 3 93  ? 22.161  16.338  45.729  1.00 69.90  ? 93  ILE E C   1 
ATOM   6184  O  O   . ILE D 3 93  ? 22.647  16.525  44.608  1.00 70.66  ? 93  ILE E O   1 
ATOM   6185  C  CB  . ILE D 3 93  ? 20.126  17.764  45.937  1.00 71.58  ? 93  ILE E CB  1 
ATOM   6186  C  CG1 . ILE D 3 93  ? 19.396  18.744  46.842  1.00 75.61  ? 93  ILE E CG1 1 
ATOM   6187  C  CG2 . ILE D 3 93  ? 19.305  16.488  45.816  1.00 71.26  ? 93  ILE E CG2 1 
ATOM   6188  C  CD1 . ILE D 3 93  ? 17.999  19.061  46.352  1.00 83.97  ? 93  ILE E CD1 1 
ATOM   6189  N  N   . TYR D 3 94  ? 22.164  15.160  46.341  1.00 67.68  ? 94  TYR E N   1 
ATOM   6190  C  CA  . TYR D 3 94  ? 22.745  13.966  45.745  1.00 65.93  ? 94  TYR E CA  1 
ATOM   6191  C  C   . TYR D 3 94  ? 21.670  12.897  45.556  1.00 67.31  ? 94  TYR E C   1 
ATOM   6192  O  O   . TYR D 3 94  ? 20.902  12.609  46.473  1.00 71.79  ? 94  TYR E O   1 
ATOM   6193  C  CB  . TYR D 3 94  ? 23.852  13.434  46.642  1.00 63.46  ? 94  TYR E CB  1 
ATOM   6194  C  CG  . TYR D 3 94  ? 25.037  14.349  46.717  1.00 66.77  ? 94  TYR E CG  1 
ATOM   6195  C  CD1 . TYR D 3 94  ? 25.141  15.310  47.711  1.00 67.01  ? 94  TYR E CD1 1 
ATOM   6196  C  CD2 . TYR D 3 94  ? 26.044  14.270  45.781  1.00 70.30  ? 94  TYR E CD2 1 
ATOM   6197  C  CE1 . TYR D 3 94  ? 26.226  16.158  47.774  1.00 67.14  ? 94  TYR E CE1 1 
ATOM   6198  C  CE2 . TYR D 3 94  ? 27.125  15.113  45.837  1.00 72.23  ? 94  TYR E CE2 1 
ATOM   6199  C  CZ  . TYR D 3 94  ? 27.209  16.054  46.833  1.00 71.33  ? 94  TYR E CZ  1 
ATOM   6200  O  OH  . TYR D 3 94  ? 28.304  16.881  46.879  1.00 83.74  ? 94  TYR E OH  1 
ATOM   6201  N  N   . TYR D 3 95  ? 21.609  12.333  44.355  1.00 63.07  ? 95  TYR E N   1 
ATOM   6202  C  CA  . TYR D 3 95  ? 20.662  11.283  44.044  1.00 61.90  ? 95  TYR E CA  1 
ATOM   6203  C  C   . TYR D 3 95  ? 21.384  9.967   43.858  1.00 65.50  ? 95  TYR E C   1 
ATOM   6204  O  O   . TYR D 3 95  ? 22.490  9.929   43.326  1.00 70.28  ? 95  TYR E O   1 
ATOM   6205  C  CB  . TYR D 3 95  ? 19.951  11.609  42.746  1.00 58.16  ? 95  TYR E CB  1 
ATOM   6206  C  CG  . TYR D 3 95  ? 19.217  12.905  42.783  1.00 58.27  ? 95  TYR E CG  1 
ATOM   6207  C  CD1 . TYR D 3 95  ? 17.993  13.002  43.403  1.00 60.53  ? 95  TYR E CD1 1 
ATOM   6208  C  CD2 . TYR D 3 95  ? 19.727  14.027  42.173  1.00 63.67  ? 95  TYR E CD2 1 
ATOM   6209  C  CE1 . TYR D 3 95  ? 17.287  14.184  43.411  1.00 65.71  ? 95  TYR E CE1 1 
ATOM   6210  C  CE2 . TYR D 3 95  ? 19.032  15.226  42.187  1.00 66.66  ? 95  TYR E CE2 1 
ATOM   6211  C  CZ  . TYR D 3 95  ? 17.810  15.293  42.812  1.00 66.50  ? 95  TYR E CZ  1 
ATOM   6212  O  OH  . TYR D 3 95  ? 17.099  16.465  42.859  1.00 70.96  ? 95  TYR E OH  1 
ATOM   6213  N  N   . CYS D 3 96  ? 20.749  8.874   44.250  1.00 65.44  ? 96  CYS E N   1 
ATOM   6214  C  CA  . CYS D 3 96  ? 21.127  7.597   43.679  1.00 65.42  ? 96  CYS E CA  1 
ATOM   6215  C  C   . CYS D 3 96  ? 20.148  7.325   42.552  1.00 58.97  ? 96  CYS E C   1 
ATOM   6216  O  O   . CYS D 3 96  ? 18.986  7.664   42.665  1.00 63.06  ? 96  CYS E O   1 
ATOM   6217  C  CB  . CYS D 3 96  ? 21.074  6.503   44.725  1.00 65.40  ? 96  CYS E CB  1 
ATOM   6218  S  SG  . CYS D 3 96  ? 19.425  6.231   45.325  1.00 71.19  ? 96  CYS E SG  1 
ATOM   6219  N  N   . THR D 3 97  ? 20.636  6.809   41.435  1.00 55.19  ? 97  THR E N   1 
ATOM   6220  C  CA  . THR D 3 97  ? 19.767  6.450   40.337  1.00 58.21  ? 97  THR E CA  1 
ATOM   6221  C  C   . THR D 3 97  ? 20.291  5.201   39.624  1.00 63.13  ? 97  THR E C   1 
ATOM   6222  O  O   . THR D 3 97  ? 21.484  4.933   39.600  1.00 67.33  ? 97  THR E O   1 
ATOM   6223  C  CB  . THR D 3 97  ? 19.641  7.593   39.318  1.00 61.03  ? 97  THR E CB  1 
ATOM   6224  O  OG1 . THR D 3 97  ? 18.802  7.186   38.228  1.00 61.74  ? 97  THR E OG1 1 
ATOM   6225  C  CG2 . THR D 3 97  ? 21.003  7.964   38.773  1.00 64.07  ? 97  THR E CG2 1 
ATOM   6226  N  N   . ARG D 3 98  ? 19.374  4.466   39.015  1.00 64.90  ? 98  ARG E N   1 
ATOM   6227  C  CA  . ARG D 3 98  ? 19.648  3.159   38.462  1.00 62.97  ? 98  ARG E CA  1 
ATOM   6228  C  C   . ARG D 3 98  ? 19.804  3.241   36.945  1.00 63.43  ? 98  ARG E C   1 
ATOM   6229  O  O   . ARG D 3 98  ? 19.131  4.026   36.285  1.00 68.48  ? 98  ARG E O   1 
ATOM   6230  C  CB  . ARG D 3 98  ? 18.466  2.260   38.792  1.00 69.25  ? 98  ARG E CB  1 
ATOM   6231  C  CG  . ARG D 3 98  ? 18.745  0.785   38.653  1.00 75.26  ? 98  ARG E CG  1 
ATOM   6232  C  CD  . ARG D 3 98  ? 17.462  -0.019  38.781  1.00 75.56  ? 98  ARG E CD  1 
ATOM   6233  N  NE  . ARG D 3 98  ? 16.645  0.054   37.569  1.00 75.68  ? 98  ARG E NE  1 
ATOM   6234  C  CZ  . ARG D 3 98  ? 15.725  -0.851  37.236  1.00 81.06  ? 98  ARG E CZ  1 
ATOM   6235  N  NH1 . ARG D 3 98  ? 15.033  -0.719  36.111  1.00 79.99  ? 98  ARG E NH1 1 
ATOM   6236  N  NH2 . ARG D 3 98  ? 15.497  -1.897  38.027  1.00 81.88  ? 98  ARG E NH2 1 
ATOM   6237  N  N   . GLY D 3 99  ? 20.660  2.403   36.379  1.00 60.91  ? 99  GLY E N   1 
ATOM   6238  C  CA  . GLY D 3 99  ? 20.808  2.358   34.922  1.00 60.83  ? 99  GLY E CA  1 
ATOM   6239  C  C   . GLY D 3 99  ? 22.231  2.096   34.445  1.00 61.55  ? 99  GLY E C   1 
ATOM   6240  O  O   . GLY D 3 99  ? 23.204  2.387   35.143  1.00 57.94  ? 99  GLY E O   1 
ATOM   6241  N  N   . ASN D 3 100 ? 22.346  1.523   33.251  1.00 62.56  ? 100 ASN E N   1 
ATOM   6242  C  CA  . ASN D 3 100 ? 23.632  1.337   32.619  1.00 61.86  ? 100 ASN E CA  1 
ATOM   6243  C  C   . ASN D 3 100 ? 23.666  1.998   31.252  1.00 68.55  ? 100 ASN E C   1 
ATOM   6244  O  O   . ASN D 3 100 ? 24.674  1.918   30.553  1.00 78.50  ? 100 ASN E O   1 
ATOM   6245  C  CB  . ASN D 3 100 ? 23.994  -0.147  32.511  1.00 62.33  ? 100 ASN E CB  1 
ATOM   6246  C  CG  . ASN D 3 100 ? 23.113  -0.911  31.538  1.00 65.31  ? 100 ASN E CG  1 
ATOM   6247  O  OD1 . ASN D 3 100 ? 22.078  -0.419  31.108  1.00 70.19  ? 100 ASN E OD1 1 
ATOM   6248  N  ND2 . ASN D 3 100 ? 23.523  -2.133  31.192  1.00 65.67  ? 100 ASN E ND2 1 
ATOM   6249  N  N   . TYR D 3 101 ? 22.576  2.653   30.864  1.00 66.95  ? 101 TYR E N   1 
ATOM   6250  C  CA  . TYR D 3 101 ? 22.626  3.512   29.694  1.00 70.78  ? 101 TYR E CA  1 
ATOM   6251  C  C   . TYR D 3 101 ? 21.707  4.729   29.801  1.00 72.84  ? 101 TYR E C   1 
ATOM   6252  O  O   . TYR D 3 101 ? 22.093  5.821   29.391  1.00 82.38  ? 101 TYR E O   1 
ATOM   6253  C  CB  . TYR D 3 101 ? 22.372  2.719   28.411  1.00 72.26  ? 101 TYR E CB  1 
ATOM   6254  C  CG  . TYR D 3 101 ? 20.946  2.289   28.217  1.00 76.47  ? 101 TYR E CG  1 
ATOM   6255  C  CD1 . TYR D 3 101 ? 20.463  1.146   28.815  1.00 76.73  ? 101 TYR E CD1 1 
ATOM   6256  C  CD2 . TYR D 3 101 ? 20.084  3.021   27.419  1.00 81.18  ? 101 TYR E CD2 1 
ATOM   6257  C  CE1 . TYR D 3 101 ? 19.156  0.749   28.636  1.00 79.40  ? 101 TYR E CE1 1 
ATOM   6258  C  CE2 . TYR D 3 101 ? 18.778  2.626   27.230  1.00 81.01  ? 101 TYR E CE2 1 
ATOM   6259  C  CZ  . TYR D 3 101 ? 18.321  1.495   27.848  1.00 78.46  ? 101 TYR E CZ  1 
ATOM   6260  O  OH  . TYR D 3 101 ? 17.022  1.105   27.669  1.00 81.23  ? 101 TYR E OH  1 
ATOM   6261  N  N   . VAL D 3 102 ? 20.506  4.545   30.346  1.00 73.00  ? 102 VAL E N   1 
ATOM   6262  C  CA  . VAL D 3 102 ? 19.667  5.673   30.791  1.00 68.68  ? 102 VAL E CA  1 
ATOM   6263  C  C   . VAL D 3 102 ? 19.346  5.519   32.279  1.00 64.32  ? 102 VAL E C   1 
ATOM   6264  O  O   . VAL D 3 102 ? 19.385  4.416   32.815  1.00 68.75  ? 102 VAL E O   1 
ATOM   6265  C  CB  . VAL D 3 102 ? 18.373  5.799   29.956  1.00 71.47  ? 102 VAL E CB  1 
ATOM   6266  C  CG1 . VAL D 3 102 ? 17.530  4.549   30.062  1.00 75.24  ? 102 VAL E CG1 1 
ATOM   6267  C  CG2 . VAL D 3 102 ? 17.556  6.988   30.415  1.00 75.72  ? 102 VAL E CG2 1 
ATOM   6268  N  N   . PHE D 3 103 ? 19.081  6.620   32.965  1.00 65.35  ? 103 PHE E N   1 
ATOM   6269  C  CA  . PHE D 3 103 ? 18.804  6.556   34.398  1.00 68.20  ? 103 PHE E CA  1 
ATOM   6270  C  C   . PHE D 3 103 ? 17.300  6.500   34.629  1.00 74.24  ? 103 PHE E C   1 
ATOM   6271  O  O   . PHE D 3 103 ? 16.605  7.528   34.593  1.00 69.53  ? 103 PHE E O   1 
ATOM   6272  C  CB  . PHE D 3 103 ? 19.422  7.742   35.121  1.00 69.11  ? 103 PHE E CB  1 
ATOM   6273  C  CG  . PHE D 3 103 ? 20.890  7.898   34.865  1.00 74.86  ? 103 PHE E CG  1 
ATOM   6274  C  CD1 . PHE D 3 103 ? 21.785  6.951   35.303  1.00 74.59  ? 103 PHE E CD1 1 
ATOM   6275  C  CD2 . PHE D 3 103 ? 21.373  8.991   34.165  1.00 82.40  ? 103 PHE E CD2 1 
ATOM   6276  C  CE1 . PHE D 3 103 ? 23.135  7.101   35.064  1.00 78.02  ? 103 PHE E CE1 1 
ATOM   6277  C  CE2 . PHE D 3 103 ? 22.723  9.143   33.925  1.00 76.47  ? 103 PHE E CE2 1 
ATOM   6278  C  CZ  . PHE D 3 103 ? 23.604  8.199   34.376  1.00 73.83  ? 103 PHE E CZ  1 
ATOM   6279  N  N   . ASP D 3 104 ? 16.802  5.285   34.861  1.00 75.41  ? 104 ASP E N   1 
ATOM   6280  C  CA  . ASP D 3 104 ? 15.374  5.020   34.741  1.00 72.54  ? 104 ASP E CA  1 
ATOM   6281  C  C   . ASP D 3 104 ? 14.625  5.153   36.059  1.00 67.08  ? 104 ASP E C   1 
ATOM   6282  O  O   . ASP D 3 104 ? 13.438  5.400   36.049  1.00 74.34  ? 104 ASP E O   1 
ATOM   6283  C  CB  . ASP D 3 104 ? 15.098  3.666   34.055  1.00 75.60  ? 104 ASP E CB  1 
ATOM   6284  C  CG  . ASP D 3 104 ? 15.862  2.500   34.679  1.00 82.03  ? 104 ASP E CG  1 
ATOM   6285  O  OD1 . ASP D 3 104 ? 16.562  2.688   35.703  1.00 90.59  ? 104 ASP E OD1 1 
ATOM   6286  O  OD2 . ASP D 3 104 ? 15.752  1.376   34.133  1.00 85.48  ? 104 ASP E OD2 1 
ATOM   6287  N  N   . TYR D 3 105 ? 15.318  5.037   37.184  1.00 62.48  ? 105 TYR E N   1 
ATOM   6288  C  CA  . TYR D 3 105 ? 14.703  5.261   38.492  1.00 63.72  ? 105 TYR E CA  1 
ATOM   6289  C  C   . TYR D 3 105 ? 15.636  6.025   39.403  1.00 63.78  ? 105 TYR E C   1 
ATOM   6290  O  O   . TYR D 3 105 ? 16.808  5.678   39.514  1.00 63.89  ? 105 TYR E O   1 
ATOM   6291  C  CB  . TYR D 3 105 ? 14.324  3.931   39.164  1.00 65.55  ? 105 TYR E CB  1 
ATOM   6292  C  CG  . TYR D 3 105 ? 13.236  3.192   38.434  1.00 67.60  ? 105 TYR E CG  1 
ATOM   6293  C  CD1 . TYR D 3 105 ? 11.981  3.756   38.268  1.00 72.09  ? 105 TYR E CD1 1 
ATOM   6294  C  CD2 . TYR D 3 105 ? 13.475  1.962   37.871  1.00 70.21  ? 105 TYR E CD2 1 
ATOM   6295  C  CE1 . TYR D 3 105 ? 10.990  3.109   37.555  1.00 78.16  ? 105 TYR E CE1 1 
ATOM   6296  C  CE2 . TYR D 3 105 ? 12.490  1.294   37.169  1.00 80.00  ? 105 TYR E CE2 1 
ATOM   6297  C  CZ  . TYR D 3 105 ? 11.246  1.870   37.010  1.00 81.98  ? 105 TYR E CZ  1 
ATOM   6298  O  OH  . TYR D 3 105 ? 10.268  1.195   36.306  1.00 81.78  ? 105 TYR E OH  1 
ATOM   6299  N  N   . TRP D 3 106 ? 15.106  7.043   40.083  1.00 65.55  ? 106 TRP E N   1 
ATOM   6300  C  CA  . TRP D 3 106 ? 15.922  7.883   40.963  1.00 62.19  ? 106 TRP E CA  1 
ATOM   6301  C  C   . TRP D 3 106 ? 15.392  7.919   42.378  1.00 59.95  ? 106 TRP E C   1 
ATOM   6302  O  O   . TRP D 3 106 ? 14.194  7.934   42.586  1.00 65.39  ? 106 TRP E O   1 
ATOM   6303  C  CB  . TRP D 3 106 ? 15.925  9.308   40.466  1.00 63.37  ? 106 TRP E CB  1 
ATOM   6304  C  CG  . TRP D 3 106 ? 16.464  9.521   39.082  1.00 66.53  ? 106 TRP E CG  1 
ATOM   6305  C  CD1 . TRP D 3 106 ? 15.981  8.992   37.917  1.00 72.24  ? 106 TRP E CD1 1 
ATOM   6306  C  CD2 . TRP D 3 106 ? 17.495  10.439  38.706  1.00 65.60  ? 106 TRP E CD2 1 
ATOM   6307  N  NE1 . TRP D 3 106 ? 16.672  9.503   36.844  1.00 71.31  ? 106 TRP E NE1 1 
ATOM   6308  C  CE2 . TRP D 3 106 ? 17.607  10.394  37.304  1.00 68.57  ? 106 TRP E CE2 1 
ATOM   6309  C  CE3 . TRP D 3 106 ? 18.345  11.281  39.425  1.00 63.54  ? 106 TRP E CE3 1 
ATOM   6310  C  CZ2 . TRP D 3 106 ? 18.537  11.151  36.611  1.00 67.08  ? 106 TRP E CZ2 1 
ATOM   6311  C  CZ3 . TRP D 3 106 ? 19.258  12.024  38.745  1.00 64.51  ? 106 TRP E CZ3 1 
ATOM   6312  C  CH2 . TRP D 3 106 ? 19.360  11.951  37.350  1.00 67.47  ? 106 TRP E CH2 1 
ATOM   6313  N  N   . GLY D 3 107 ? 16.292  7.988   43.348  1.00 60.66  ? 107 GLY E N   1 
ATOM   6314  C  CA  . GLY D 3 107 ? 15.907  8.258   44.726  1.00 65.11  ? 107 GLY E CA  1 
ATOM   6315  C  C   . GLY D 3 107 ? 15.325  9.648   44.826  1.00 68.70  ? 107 GLY E C   1 
ATOM   6316  O  O   . GLY D 3 107 ? 15.352  10.410  43.856  1.00 65.70  ? 107 GLY E O   1 
ATOM   6317  N  N   . GLN D 3 108 ? 14.793  9.980   45.996  1.00 73.37  ? 108 GLN E N   1 
ATOM   6318  C  CA  . GLN D 3 108 ? 14.148  11.275  46.190  1.00 77.42  ? 108 GLN E CA  1 
ATOM   6319  C  C   . GLN D 3 108 ? 15.181  12.358  46.447  1.00 72.02  ? 108 GLN E C   1 
ATOM   6320  O  O   . GLN D 3 108 ? 14.853  13.549  46.511  1.00 71.06  ? 108 GLN E O   1 
ATOM   6321  C  CB  . GLN D 3 108 ? 13.152  11.220  47.348  1.00 80.79  ? 108 GLN E CB  1 
ATOM   6322  C  CG  . GLN D 3 108 ? 13.772  11.378  48.726  1.00 77.32  ? 108 GLN E CG  1 
ATOM   6323  C  CD  . GLN D 3 108 ? 14.329  10.091  49.262  1.00 80.64  ? 108 GLN E CD  1 
ATOM   6324  O  OE1 . GLN D 3 108 ? 14.615  9.159   48.507  1.00 87.03  ? 108 GLN E OE1 1 
ATOM   6325  N  NE2 . GLN D 3 108 ? 14.492  10.026  50.574  1.00 83.68  ? 108 GLN E NE2 1 
ATOM   6326  N  N   . GLY D 3 109 ? 16.429  11.933  46.590  1.00 66.50  ? 109 GLY E N   1 
ATOM   6327  C  CA  . GLY D 3 109 ? 17.530  12.856  46.781  1.00 68.79  ? 109 GLY E CA  1 
ATOM   6328  C  C   . GLY D 3 109 ? 17.834  13.066  48.251  1.00 69.80  ? 109 GLY E C   1 
ATOM   6329  O  O   . GLY D 3 109 ? 16.993  12.823  49.110  1.00 69.55  ? 109 GLY E O   1 
ATOM   6330  N  N   . THR D 3 110 ? 19.045  13.513  48.541  1.00 68.74  ? 110 THR E N   1 
ATOM   6331  C  CA  . THR D 3 110 ? 19.393  13.917  49.891  1.00 74.45  ? 110 THR E CA  1 
ATOM   6332  C  C   . THR D 3 110 ? 20.220  15.194  49.837  1.00 77.89  ? 110 THR E C   1 
ATOM   6333  O  O   . THR D 3 110 ? 21.055  15.368  48.955  1.00 77.19  ? 110 THR E O   1 
ATOM   6334  C  CB  . THR D 3 110 ? 20.180  12.817  50.619  1.00 83.19  ? 110 THR E CB  1 
ATOM   6335  O  OG1 . THR D 3 110 ? 20.645  13.306  51.886  1.00 87.26  ? 110 THR E OG1 1 
ATOM   6336  C  CG2 . THR D 3 110 ? 21.371  12.375  49.788  1.00 89.60  ? 110 THR E CG2 1 
ATOM   6337  N  N   . THR D 3 111 ? 19.966  16.101  50.769  1.00 82.31  ? 111 THR E N   1 
ATOM   6338  C  CA  . THR D 3 111 ? 20.640  17.386  50.768  1.00 78.46  ? 111 THR E CA  1 
ATOM   6339  C  C   . THR D 3 111 ? 21.806  17.375  51.736  1.00 74.84  ? 111 THR E C   1 
ATOM   6340  O  O   . THR D 3 111 ? 21.648  17.058  52.919  1.00 73.54  ? 111 THR E O   1 
ATOM   6341  C  CB  . THR D 3 111 ? 19.675  18.514  51.169  1.00 78.78  ? 111 THR E CB  1 
ATOM   6342  O  OG1 . THR D 3 111 ? 18.649  18.629  50.177  1.00 77.75  ? 111 THR E OG1 1 
ATOM   6343  C  CG2 . THR D 3 111 ? 20.414  19.832  51.281  1.00 81.63  ? 111 THR E CG2 1 
ATOM   6344  N  N   . LEU D 3 112 ? 22.976  17.744  51.232  1.00 70.37  ? 112 LEU E N   1 
ATOM   6345  C  CA  . LEU D 3 112 ? 24.150  17.868  52.075  1.00 71.29  ? 112 LEU E CA  1 
ATOM   6346  C  C   . LEU D 3 112 ? 24.476  19.327  52.232  1.00 71.14  ? 112 LEU E C   1 
ATOM   6347  O  O   . LEU D 3 112 ? 24.489  20.087  51.259  1.00 69.44  ? 112 LEU E O   1 
ATOM   6348  C  CB  . LEU D 3 112 ? 25.336  17.146  51.450  1.00 78.44  ? 112 LEU E CB  1 
ATOM   6349  C  CG  . LEU D 3 112 ? 26.720  17.481  52.008  1.00 84.39  ? 112 LEU E CG  1 
ATOM   6350  C  CD1 . LEU D 3 112 ? 26.897  17.025  53.446  1.00 82.55  ? 112 LEU E CD1 1 
ATOM   6351  C  CD2 . LEU D 3 112 ? 27.775  16.852  51.119  1.00 90.50  ? 112 LEU E CD2 1 
ATOM   6352  N  N   . THR D 3 113 ? 24.735  19.720  53.468  1.00 73.81  ? 113 THR E N   1 
ATOM   6353  C  CA  . THR D 3 113 ? 25.122  21.082  53.750  1.00 74.41  ? 113 THR E CA  1 
ATOM   6354  C  C   . THR D 3 113 ? 26.447  21.093  54.484  1.00 72.15  ? 113 THR E C   1 
ATOM   6355  O  O   . THR D 3 113 ? 26.563  20.516  55.560  1.00 72.03  ? 113 THR E O   1 
ATOM   6356  C  CB  . THR D 3 113 ? 24.053  21.785  54.593  1.00 77.74  ? 113 THR E CB  1 
ATOM   6357  O  OG1 . THR D 3 113 ? 22.804  21.745  53.892  1.00 74.00  ? 113 THR E OG1 1 
ATOM   6358  C  CG2 . THR D 3 113 ? 24.453  23.235  54.859  1.00 82.86  ? 113 THR E CG2 1 
ATOM   6359  N  N   . VAL D 3 114 ? 27.441  21.752  53.895  1.00 70.24  ? 114 VAL E N   1 
ATOM   6360  C  CA  . VAL D 3 114 ? 28.778  21.833  54.476  1.00 73.80  ? 114 VAL E CA  1 
ATOM   6361  C  C   . VAL D 3 114 ? 29.022  23.231  54.952  1.00 73.92  ? 114 VAL E C   1 
ATOM   6362  O  O   . VAL D 3 114 ? 28.974  24.168  54.161  1.00 77.83  ? 114 VAL E O   1 
ATOM   6363  C  CB  . VAL D 3 114 ? 29.858  21.555  53.437  1.00 78.96  ? 114 VAL E CB  1 
ATOM   6364  C  CG1 . VAL D 3 114 ? 31.236  21.599  54.080  1.00 81.00  ? 114 VAL E CG1 1 
ATOM   6365  C  CG2 . VAL D 3 114 ? 29.593  20.224  52.761  1.00 82.61  ? 114 VAL E CG2 1 
ATOM   6366  N  N   . SER D 3 115 ? 29.290  23.385  56.240  1.00 75.02  ? 115 SER E N   1 
ATOM   6367  C  CA  . SER D 3 115 ? 29.336  24.711  56.795  1.00 78.35  ? 115 SER E CA  1 
ATOM   6368  C  C   . SER D 3 115 ? 29.938  24.729  58.177  1.00 82.52  ? 115 SER E C   1 
ATOM   6369  O  O   . SER D 3 115 ? 29.722  23.805  58.976  1.00 80.12  ? 115 SER E O   1 
ATOM   6370  C  CB  . SER D 3 115 ? 27.931  25.303  56.841  1.00 82.20  ? 115 SER E CB  1 
ATOM   6371  O  OG  . SER D 3 115 ? 27.914  26.449  57.673  1.00 89.98  ? 115 SER E OG  1 
ATOM   6372  N  N   . SER D 3 116 ? 30.672  25.808  58.451  1.00 86.43  ? 116 SER E N   1 
ATOM   6373  C  CA  . SER D 3 116 ? 31.327  26.005  59.736  1.00 92.87  ? 116 SER E CA  1 
ATOM   6374  C  C   . SER D 3 116 ? 30.357  26.600  60.734  1.00 92.21  ? 116 SER E C   1 
ATOM   6375  O  O   . SER D 3 116 ? 30.639  26.671  61.925  1.00 87.89  ? 116 SER E O   1 
ATOM   6376  C  CB  . SER D 3 116 ? 32.524  26.939  59.586  1.00 101.90 ? 116 SER E CB  1 
ATOM   6377  O  OG  . SER D 3 116 ? 33.566  26.337  58.840  1.00 114.45 ? 116 SER E OG  1 
ATOM   6378  N  N   . ALA D 3 117 ? 29.197  27.006  60.240  1.00 100.15 ? 117 ALA E N   1 
ATOM   6379  C  CA  . ALA D 3 117 ? 28.274  27.813  61.014  1.00 108.74 ? 117 ALA E CA  1 
ATOM   6380  C  C   . ALA D 3 117 ? 27.705  27.053  62.197  1.00 104.06 ? 117 ALA E C   1 
ATOM   6381  O  O   . ALA D 3 117 ? 27.582  25.830  62.166  1.00 100.11 ? 117 ALA E O   1 
ATOM   6382  C  CB  . ALA D 3 117 ? 27.147  28.301  60.120  1.00 117.12 ? 117 ALA E CB  1 
ATOM   6383  N  N   . LYS D 3 118 ? 27.343  27.797  63.234  1.00 104.69 ? 118 LYS E N   1 
ATOM   6384  C  CA  . LYS D 3 118 ? 26.712  27.220  64.406  1.00 109.96 ? 118 LYS E CA  1 
ATOM   6385  C  C   . LYS D 3 118 ? 25.223  27.492  64.378  1.00 104.84 ? 118 LYS E C   1 
ATOM   6386  O  O   . LYS D 3 118 ? 24.774  28.440  63.750  1.00 111.56 ? 118 LYS E O   1 
ATOM   6387  C  CB  . LYS D 3 118 ? 27.331  27.814  65.661  1.00 121.08 ? 118 LYS E CB  1 
ATOM   6388  C  CG  . LYS D 3 118 ? 28.839  27.649  65.692  1.00 136.96 ? 118 LYS E CG  1 
ATOM   6389  C  CD  . LYS D 3 118 ? 29.401  27.883  67.078  1.00 150.57 ? 118 LYS E CD  1 
ATOM   6390  C  CE  . LYS D 3 118 ? 30.769  27.242  67.216  1.00 160.17 ? 118 LYS E CE  1 
ATOM   6391  N  NZ  . LYS D 3 118 ? 31.383  27.572  68.532  1.00 178.68 ? 118 LYS E NZ  1 
ATOM   6392  N  N   . THR D 3 119 ? 24.449  26.654  65.051  1.00 104.51 ? 119 THR E N   1 
ATOM   6393  C  CA  . THR D 3 119 ? 23.015  26.860  65.091  1.00 99.67  ? 119 THR E CA  1 
ATOM   6394  C  C   . THR D 3 119 ? 22.771  28.232  65.676  1.00 98.63  ? 119 THR E C   1 
ATOM   6395  O  O   . THR D 3 119 ? 23.220  28.526  66.780  1.00 102.77 ? 119 THR E O   1 
ATOM   6396  C  CB  . THR D 3 119 ? 22.291  25.797  65.936  1.00 103.08 ? 119 THR E CB  1 
ATOM   6397  O  OG1 . THR D 3 119 ? 22.403  24.524  65.294  1.00 103.21 ? 119 THR E OG1 1 
ATOM   6398  C  CG2 . THR D 3 119 ? 20.819  26.131  66.075  1.00 103.71 ? 119 THR E CG2 1 
ATOM   6399  N  N   . THR D 3 120 ? 22.095  29.077  64.900  1.00 100.88 ? 120 THR E N   1 
ATOM   6400  C  CA  . THR D 3 120 ? 21.782  30.451  65.298  1.00 97.78  ? 120 THR E CA  1 
ATOM   6401  C  C   . THR D 3 120 ? 20.303  30.752  65.024  1.00 92.94  ? 120 THR E C   1 
ATOM   6402  O  O   . THR D 3 120 ? 19.818  30.524  63.914  1.00 83.55  ? 120 THR E O   1 
ATOM   6403  C  CB  . THR D 3 120 ? 22.643  31.475  64.521  1.00 98.18  ? 120 THR E CB  1 
ATOM   6404  O  OG1 . THR D 3 120 ? 24.035  31.166  64.680  1.00 92.93  ? 120 THR E OG1 1 
ATOM   6405  C  CG2 . THR D 3 120 ? 22.387  32.889  65.020  1.00 102.28 ? 120 THR E CG2 1 
ATOM   6406  N  N   . PRO D 3 121 ? 19.579  31.255  66.043  1.00 96.78  ? 121 PRO E N   1 
ATOM   6407  C  CA  . PRO D 3 121 ? 18.208  31.692  65.827  1.00 89.58  ? 121 PRO E CA  1 
ATOM   6408  C  C   . PRO D 3 121 ? 18.166  33.003  65.058  1.00 88.53  ? 121 PRO E C   1 
ATOM   6409  O  O   . PRO D 3 121 ? 19.090  33.813  65.164  1.00 94.36  ? 121 PRO E O   1 
ATOM   6410  C  CB  . PRO D 3 121 ? 17.682  31.893  67.241  1.00 91.21  ? 121 PRO E CB  1 
ATOM   6411  C  CG  . PRO D 3 121 ? 18.883  32.279  68.037  1.00 97.25  ? 121 PRO E CG  1 
ATOM   6412  C  CD  . PRO D 3 121 ? 20.046  31.557  67.412  1.00 103.18 ? 121 PRO E CD  1 
ATOM   6413  N  N   . PRO D 3 122 ? 17.098  33.218  64.287  1.00 87.91  ? 122 PRO E N   1 
ATOM   6414  C  CA  . PRO D 3 122 ? 16.974  34.384  63.412  1.00 89.98  ? 122 PRO E CA  1 
ATOM   6415  C  C   . PRO D 3 122 ? 16.557  35.629  64.179  1.00 91.59  ? 122 PRO E C   1 
ATOM   6416  O  O   . PRO D 3 122 ? 15.838  35.510  65.169  1.00 91.07  ? 122 PRO E O   1 
ATOM   6417  C  CB  . PRO D 3 122 ? 15.846  33.978  62.473  1.00 88.91  ? 122 PRO E CB  1 
ATOM   6418  C  CG  . PRO D 3 122 ? 14.979  33.102  63.314  1.00 86.18  ? 122 PRO E CG  1 
ATOM   6419  C  CD  . PRO D 3 122 ? 15.874  32.404  64.299  1.00 84.02  ? 122 PRO E CD  1 
ATOM   6420  N  N   . SER D 3 123 ? 17.013  36.802  63.738  1.00 91.15  ? 123 SER E N   1 
ATOM   6421  C  CA  . SER D 3 123 ? 16.387  38.061  64.142  1.00 84.50  ? 123 SER E CA  1 
ATOM   6422  C  C   . SER D 3 123 ? 15.231  38.334  63.208  1.00 79.35  ? 123 SER E C   1 
ATOM   6423  O  O   . SER D 3 123 ? 15.362  38.231  61.982  1.00 74.96  ? 123 SER E O   1 
ATOM   6424  C  CB  . SER D 3 123 ? 17.368  39.225  64.082  1.00 84.19  ? 123 SER E CB  1 
ATOM   6425  O  OG  . SER D 3 123 ? 18.508  38.945  64.864  1.00 90.90  ? 123 SER E OG  1 
ATOM   6426  N  N   . VAL D 3 124 ? 14.096  38.676  63.801  1.00 77.07  ? 124 VAL E N   1 
ATOM   6427  C  CA  . VAL D 3 124 ? 12.889  38.932  63.049  1.00 77.01  ? 124 VAL E CA  1 
ATOM   6428  C  C   . VAL D 3 124 ? 12.488  40.387  63.203  1.00 80.24  ? 124 VAL E C   1 
ATOM   6429  O  O   . VAL D 3 124 ? 12.282  40.875  64.309  1.00 81.68  ? 124 VAL E O   1 
ATOM   6430  C  CB  . VAL D 3 124 ? 11.744  38.053  63.537  1.00 80.37  ? 124 VAL E CB  1 
ATOM   6431  C  CG1 . VAL D 3 124 ? 10.490  38.332  62.727  1.00 82.70  ? 124 VAL E CG1 1 
ATOM   6432  C  CG2 . VAL D 3 124 ? 12.141  36.594  63.420  1.00 83.37  ? 124 VAL E CG2 1 
ATOM   6433  N  N   . TYR D 3 125 ? 12.405  41.078  62.077  1.00 81.82  ? 125 TYR E N   1 
ATOM   6434  C  CA  . TYR D 3 125 ? 12.183  42.507  62.062  1.00 77.18  ? 125 TYR E CA  1 
ATOM   6435  C  C   . TYR D 3 125 ? 11.000  42.799  61.173  1.00 78.32  ? 125 TYR E C   1 
ATOM   6436  O  O   . TYR D 3 125 ? 10.912  42.280  60.064  1.00 83.50  ? 125 TYR E O   1 
ATOM   6437  C  CB  . TYR D 3 125 ? 13.397  43.205  61.482  1.00 76.07  ? 125 TYR E CB  1 
ATOM   6438  C  CG  . TYR D 3 125 ? 14.681  42.988  62.241  1.00 74.29  ? 125 TYR E CG  1 
ATOM   6439  C  CD1 . TYR D 3 125 ? 14.757  43.231  63.604  1.00 76.64  ? 125 TYR E CD1 1 
ATOM   6440  C  CD2 . TYR D 3 125 ? 15.838  42.618  61.580  1.00 74.26  ? 125 TYR E CD2 1 
ATOM   6441  C  CE1 . TYR D 3 125 ? 15.945  43.090  64.296  1.00 78.88  ? 125 TYR E CE1 1 
ATOM   6442  C  CE2 . TYR D 3 125 ? 17.036  42.476  62.260  1.00 78.80  ? 125 TYR E CE2 1 
ATOM   6443  C  CZ  . TYR D 3 125 ? 17.082  42.718  63.620  1.00 81.01  ? 125 TYR E CZ  1 
ATOM   6444  O  OH  . TYR D 3 125 ? 18.256  42.563  64.319  1.00 83.59  ? 125 TYR E OH  1 
ATOM   6445  N  N   . PRO D 3 126 ? 10.087  43.641  61.648  1.00 81.81  ? 126 PRO E N   1 
ATOM   6446  C  CA  . PRO D 3 126 ? 8.875   43.912  60.910  1.00 81.44  ? 126 PRO E CA  1 
ATOM   6447  C  C   . PRO D 3 126 ? 9.143   44.922  59.808  1.00 76.33  ? 126 PRO E C   1 
ATOM   6448  O  O   . PRO D 3 126 ? 10.048  45.728  59.924  1.00 68.58  ? 126 PRO E O   1 
ATOM   6449  C  CB  . PRO D 3 126 ? 7.969   44.511  61.972  1.00 84.89  ? 126 PRO E CB  1 
ATOM   6450  C  CG  . PRO D 3 126 ? 8.924   45.284  62.825  1.00 87.82  ? 126 PRO E CG  1 
ATOM   6451  C  CD  . PRO D 3 126 ? 10.223  44.525  62.815  1.00 84.12  ? 126 PRO E CD  1 
ATOM   6452  N  N   . LEU D 3 127 ? 8.378   44.832  58.731  1.00 80.66  ? 127 LEU E N   1 
ATOM   6453  C  CA  . LEU D 3 127 ? 8.503   45.752  57.617  1.00 84.72  ? 127 LEU E CA  1 
ATOM   6454  C  C   . LEU D 3 127 ? 7.168   46.450  57.418  1.00 94.40  ? 127 LEU E C   1 
ATOM   6455  O  O   . LEU D 3 127 ? 6.216   45.858  56.900  1.00 97.61  ? 127 LEU E O   1 
ATOM   6456  C  CB  . LEU D 3 127 ? 8.903   45.013  56.345  1.00 80.69  ? 127 LEU E CB  1 
ATOM   6457  C  CG  . LEU D 3 127 ? 10.224  44.266  56.431  1.00 77.64  ? 127 LEU E CG  1 
ATOM   6458  C  CD1 . LEU D 3 127 ? 10.449  43.480  55.143  1.00 80.33  ? 127 LEU E CD1 1 
ATOM   6459  C  CD2 . LEU D 3 127 ? 11.374  45.220  56.704  1.00 79.48  ? 127 LEU E CD2 1 
ATOM   6460  N  N   . ALA D 3 128 ? 7.099   47.691  57.894  1.00 98.92  ? 128 ALA E N   1 
ATOM   6461  C  CA  . ALA D 3 128 ? 5.914   48.510  57.773  1.00 94.25  ? 128 ALA E CA  1 
ATOM   6462  C  C   . ALA D 3 128 ? 6.260   49.659  56.867  1.00 100.11 ? 128 ALA E C   1 
ATOM   6463  O  O   . ALA D 3 128 ? 7.414   50.065  56.821  1.00 106.33 ? 128 ALA E O   1 
ATOM   6464  C  CB  . ALA D 3 128 ? 5.490   49.023  59.136  1.00 91.32  ? 128 ALA E CB  1 
ATOM   6465  N  N   . PRO D 3 129 ? 5.264   50.181  56.131  1.00 114.55 ? 129 PRO E N   1 
ATOM   6466  C  CA  . PRO D 3 129 ? 5.437   51.388  55.319  1.00 118.96 ? 129 PRO E CA  1 
ATOM   6467  C  C   . PRO D 3 129 ? 5.645   52.640  56.164  1.00 111.58 ? 129 PRO E C   1 
ATOM   6468  O  O   . PRO D 3 129 ? 6.681   53.291  56.044  1.00 107.82 ? 129 PRO E O   1 
ATOM   6469  C  CB  . PRO D 3 129 ? 4.119   51.488  54.542  1.00 125.70 ? 129 PRO E CB  1 
ATOM   6470  C  CG  . PRO D 3 129 ? 3.524   50.120  54.595  1.00 124.77 ? 129 PRO E CG  1 
ATOM   6471  C  CD  . PRO D 3 129 ? 3.944   49.563  55.919  1.00 119.23 ? 129 PRO E CD  1 
ATOM   6472  N  N   . ASN D 3 136 ? -4.395  53.903  47.556  1.00 178.82 ? 136 ASN E N   1 
ATOM   6473  C  CA  . ASN D 3 136 ? -4.401  52.495  47.143  1.00 190.84 ? 136 ASN E CA  1 
ATOM   6474  C  C   . ASN D 3 136 ? -5.201  51.601  48.098  1.00 185.34 ? 136 ASN E C   1 
ATOM   6475  O  O   . ASN D 3 136 ? -5.035  51.694  49.311  1.00 195.76 ? 136 ASN E O   1 
ATOM   6476  C  CB  . ASN D 3 136 ? -2.967  51.945  46.986  1.00 187.18 ? 136 ASN E CB  1 
ATOM   6477  C  CG  . ASN D 3 136 ? -1.970  52.573  47.951  1.00 182.22 ? 136 ASN E CG  1 
ATOM   6478  O  OD1 . ASN D 3 136 ? -0.766  52.335  47.843  1.00 168.43 ? 136 ASN E OD1 1 
ATOM   6479  N  ND2 . ASN D 3 136 ? -2.463  53.354  48.909  1.00 184.82 ? 136 ASN E ND2 1 
ATOM   6480  N  N   . SER D 3 137 ? -6.060  50.738  47.548  1.00 173.70 ? 137 SER E N   1 
ATOM   6481  C  CA  . SER D 3 137 ? -6.892  49.841  48.360  1.00 162.67 ? 137 SER E CA  1 
ATOM   6482  C  C   . SER D 3 137 ? -6.069  48.779  49.086  1.00 154.81 ? 137 SER E C   1 
ATOM   6483  O  O   . SER D 3 137 ? -6.303  48.502  50.259  1.00 150.25 ? 137 SER E O   1 
ATOM   6484  C  CB  . SER D 3 137 ? -7.951  49.152  47.494  1.00 164.43 ? 137 SER E CB  1 
ATOM   6485  O  OG  . SER D 3 137 ? -7.368  48.192  46.628  1.00 156.05 ? 137 SER E OG  1 
ATOM   6486  N  N   . MET D 3 138 ? -5.108  48.184  48.387  1.00 128.65 ? 138 MET E N   1 
ATOM   6487  C  CA  . MET D 3 138 ? -4.284  47.133  48.974  1.00 123.15 ? 138 MET E CA  1 
ATOM   6488  C  C   . MET D 3 138 ? -3.038  47.726  49.622  1.00 122.78 ? 138 MET E C   1 
ATOM   6489  O  O   . MET D 3 138 ? -2.506  48.751  49.168  1.00 126.63 ? 138 MET E O   1 
ATOM   6490  C  CB  . MET D 3 138 ? -3.865  46.102  47.920  1.00 123.92 ? 138 MET E CB  1 
ATOM   6491  C  CG  . MET D 3 138 ? -5.027  45.378  47.269  1.00 125.30 ? 138 MET E CG  1 
ATOM   6492  S  SD  . MET D 3 138 ? -6.127  44.658  48.499  1.00 120.75 ? 138 MET E SD  1 
ATOM   6493  C  CE  . MET D 3 138 ? -5.429  43.016  48.642  1.00 115.45 ? 138 MET E CE  1 
ATOM   6494  N  N   . VAL D 3 139 ? -2.576  47.066  50.681  1.00 113.81 ? 139 VAL E N   1 
ATOM   6495  C  CA  . VAL D 3 139 ? -1.308  47.416  51.312  1.00 105.23 ? 139 VAL E CA  1 
ATOM   6496  C  C   . VAL D 3 139 ? -0.443  46.164  51.523  1.00 101.64 ? 139 VAL E C   1 
ATOM   6497  O  O   . VAL D 3 139 ? -0.947  45.070  51.778  1.00 92.83  ? 139 VAL E O   1 
ATOM   6498  C  CB  . VAL D 3 139 ? -1.527  48.175  52.645  1.00 97.57  ? 139 VAL E CB  1 
ATOM   6499  C  CG1 . VAL D 3 139 ? -2.209  47.289  53.674  1.00 95.22  ? 139 VAL E CG1 1 
ATOM   6500  C  CG2 . VAL D 3 139 ? -0.217  48.717  53.191  1.00 95.02  ? 139 VAL E CG2 1 
ATOM   6501  N  N   . THR D 3 140 ? 0.867   46.340  51.388  1.00 105.54 ? 140 THR E N   1 
ATOM   6502  C  CA  . THR D 3 140 ? 1.823   45.248  51.532  1.00 92.53  ? 140 THR E CA  1 
ATOM   6503  C  C   . THR D 3 140 ? 2.692   45.452  52.769  1.00 88.07  ? 140 THR E C   1 
ATOM   6504  O  O   . THR D 3 140 ? 3.279   46.511  52.966  1.00 89.06  ? 140 THR E O   1 
ATOM   6505  C  CB  . THR D 3 140 ? 2.709   45.127  50.277  1.00 90.40  ? 140 THR E CB  1 
ATOM   6506  O  OG1 . THR D 3 140 ? 1.891   44.788  49.150  1.00 92.17  ? 140 THR E OG1 1 
ATOM   6507  C  CG2 . THR D 3 140 ? 3.771   44.067  50.461  1.00 85.95  ? 140 THR E CG2 1 
ATOM   6508  N  N   . LEU D 3 141 ? 2.753   44.425  53.604  1.00 89.16  ? 141 LEU E N   1 
ATOM   6509  C  CA  . LEU D 3 141 ? 3.621   44.406  54.780  1.00 94.01  ? 141 LEU E CA  1 
ATOM   6510  C  C   . LEU D 3 141 ? 4.591   43.235  54.686  1.00 94.07  ? 141 LEU E C   1 
ATOM   6511  O  O   . LEU D 3 141 ? 4.404   42.336  53.863  1.00 102.97 ? 141 LEU E O   1 
ATOM   6512  C  CB  . LEU D 3 141 ? 2.778   44.249  56.036  1.00 94.37  ? 141 LEU E CB  1 
ATOM   6513  C  CG  . LEU D 3 141 ? 1.656   45.265  56.148  1.00 99.84  ? 141 LEU E CG  1 
ATOM   6514  C  CD1 . LEU D 3 141 ? 0.605   44.793  57.144  1.00 104.34 ? 141 LEU E CD1 1 
ATOM   6515  C  CD2 . LEU D 3 141 ? 2.247   46.608  56.551  1.00 107.00 ? 141 LEU E CD2 1 
ATOM   6516  N  N   . GLY D 3 142 ? 5.604   43.218  55.547  1.00 91.57  ? 142 GLY E N   1 
ATOM   6517  C  CA  . GLY D 3 142 ? 6.657   42.212  55.421  1.00 95.43  ? 142 GLY E CA  1 
ATOM   6518  C  C   . GLY D 3 142 ? 7.294   41.773  56.719  1.00 87.81  ? 142 GLY E C   1 
ATOM   6519  O  O   . GLY D 3 142 ? 7.105   42.414  57.752  1.00 88.66  ? 142 GLY E O   1 
ATOM   6520  N  N   . CYS D 3 143 ? 8.036   40.666  56.657  1.00 79.18  ? 143 CYS E N   1 
ATOM   6521  C  CA  . CYS D 3 143 ? 8.898   40.254  57.752  1.00 83.90  ? 143 CYS E CA  1 
ATOM   6522  C  C   . CYS D 3 143 ? 10.282  39.934  57.262  1.00 80.53  ? 143 CYS E C   1 
ATOM   6523  O  O   . CYS D 3 143 ? 10.457  39.116  56.368  1.00 91.16  ? 143 CYS E O   1 
ATOM   6524  C  CB  . CYS D 3 143 ? 8.323   39.051  58.494  1.00 90.00  ? 143 CYS E CB  1 
ATOM   6525  S  SG  . CYS D 3 143 ? 7.503   39.653  59.983  1.00 119.76 ? 143 CYS E SG  1 
ATOM   6526  N  N   . LEU D 3 144 ? 11.265  40.615  57.834  1.00 78.86  ? 144 LEU E N   1 
ATOM   6527  C  CA  . LEU D 3 144 ? 12.654  40.327  57.546  1.00 78.35  ? 144 LEU E CA  1 
ATOM   6528  C  C   . LEU D 3 144 ? 13.139  39.327  58.580  1.00 79.50  ? 144 LEU E C   1 
ATOM   6529  O  O   . LEU D 3 144 ? 13.001  39.553  59.782  1.00 81.65  ? 144 LEU E O   1 
ATOM   6530  C  CB  . LEU D 3 144 ? 13.495  41.606  57.597  1.00 75.48  ? 144 LEU E CB  1 
ATOM   6531  C  CG  . LEU D 3 144 ? 14.978  41.415  57.317  1.00 77.65  ? 144 LEU E CG  1 
ATOM   6532  C  CD1 . LEU D 3 144 ? 15.208  40.954  55.885  1.00 86.33  ? 144 LEU E CD1 1 
ATOM   6533  C  CD2 . LEU D 3 144 ? 15.717  42.705  57.575  1.00 78.39  ? 144 LEU E CD2 1 
ATOM   6534  N  N   . VAL D 3 145 ? 13.685  38.212  58.111  1.00 72.75  ? 145 VAL E N   1 
ATOM   6535  C  CA  . VAL D 3 145 ? 14.169  37.181  59.001  1.00 74.13  ? 145 VAL E CA  1 
ATOM   6536  C  C   . VAL D 3 145 ? 15.624  36.964  58.696  1.00 75.62  ? 145 VAL E C   1 
ATOM   6537  O  O   . VAL D 3 145 ? 15.940  36.302  57.710  1.00 80.73  ? 145 VAL E O   1 
ATOM   6538  C  CB  . VAL D 3 145 ? 13.438  35.856  58.747  1.00 74.49  ? 145 VAL E CB  1 
ATOM   6539  C  CG1 . VAL D 3 145 ? 13.982  34.765  59.655  1.00 79.73  ? 145 VAL E CG1 1 
ATOM   6540  C  CG2 . VAL D 3 145 ? 11.950  36.030  58.967  1.00 80.98  ? 145 VAL E CG2 1 
ATOM   6541  N  N   . LYS D 3 146 ? 16.528  37.498  59.511  1.00 76.46  ? 146 LYS E N   1 
ATOM   6542  C  CA  . LYS D 3 146 ? 17.930  37.413  59.116  1.00 81.26  ? 146 LYS E CA  1 
ATOM   6543  C  C   . LYS D 3 146 ? 18.878  36.860  60.158  1.00 81.16  ? 146 LYS E C   1 
ATOM   6544  O  O   . LYS D 3 146 ? 18.646  36.981  61.360  1.00 86.38  ? 146 LYS E O   1 
ATOM   6545  C  CB  . LYS D 3 146 ? 18.428  38.754  58.579  1.00 83.58  ? 146 LYS E CB  1 
ATOM   6546  C  CG  . LYS D 3 146 ? 18.558  39.852  59.604  1.00 87.39  ? 146 LYS E CG  1 
ATOM   6547  C  CD  . LYS D 3 146 ? 19.211  41.070  58.973  1.00 94.17  ? 146 LYS E CD  1 
ATOM   6548  C  CE  . LYS D 3 146 ? 20.556  40.727  58.362  1.00 100.52 ? 146 LYS E CE  1 
ATOM   6549  N  NZ  . LYS D 3 146 ? 21.386  41.942  58.146  1.00 108.60 ? 146 LYS E NZ  1 
ATOM   6550  N  N   . GLY D 3 147 ? 19.930  36.214  59.664  1.00 76.74  ? 147 GLY E N   1 
ATOM   6551  C  CA  . GLY D 3 147 ? 21.041  35.784  60.496  1.00 81.32  ? 147 GLY E CA  1 
ATOM   6552  C  C   . GLY D 3 147 ? 20.754  34.500  61.227  1.00 80.63  ? 147 GLY E C   1 
ATOM   6553  O  O   . GLY D 3 147 ? 21.104  34.356  62.397  1.00 96.25  ? 147 GLY E O   1 
ATOM   6554  N  N   . TYR D 3 148 ? 20.096  33.568  60.550  1.00 83.70  ? 148 TYR E N   1 
ATOM   6555  C  CA  . TYR D 3 148 ? 19.805  32.263  61.151  1.00 85.83  ? 148 TYR E CA  1 
ATOM   6556  C  C   . TYR D 3 148 ? 20.589  31.165  60.457  1.00 83.41  ? 148 TYR E C   1 
ATOM   6557  O  O   . TYR D 3 148 ? 20.994  31.306  59.296  1.00 81.34  ? 148 TYR E O   1 
ATOM   6558  C  CB  . TYR D 3 148 ? 18.301  31.935  61.114  1.00 80.53  ? 148 TYR E CB  1 
ATOM   6559  C  CG  . TYR D 3 148 ? 17.726  31.719  59.727  1.00 73.36  ? 148 TYR E CG  1 
ATOM   6560  C  CD1 . TYR D 3 148 ? 17.197  32.774  59.001  1.00 71.43  ? 148 TYR E CD1 1 
ATOM   6561  C  CD2 . TYR D 3 148 ? 17.709  30.470  59.151  1.00 70.15  ? 148 TYR E CD2 1 
ATOM   6562  C  CE1 . TYR D 3 148 ? 16.686  32.596  57.732  1.00 68.26  ? 148 TYR E CE1 1 
ATOM   6563  C  CE2 . TYR D 3 148 ? 17.194  30.281  57.884  1.00 72.54  ? 148 TYR E CE2 1 
ATOM   6564  C  CZ  . TYR D 3 148 ? 16.683  31.352  57.179  1.00 70.45  ? 148 TYR E CZ  1 
ATOM   6565  O  OH  . TYR D 3 148 ? 16.157  31.173  55.916  1.00 71.82  ? 148 TYR E OH  1 
ATOM   6566  N  N   . PHE D 3 149 ? 20.808  30.084  61.198  1.00 83.84  ? 149 PHE E N   1 
ATOM   6567  C  CA  . PHE D 3 149 ? 21.389  28.863  60.661  1.00 79.60  ? 149 PHE E CA  1 
ATOM   6568  C  C   . PHE D 3 149 ? 20.963  27.690  61.518  1.00 74.55  ? 149 PHE E C   1 
ATOM   6569  O  O   . PHE D 3 149 ? 21.007  27.767  62.735  1.00 79.96  ? 149 PHE E O   1 
ATOM   6570  C  CB  . PHE D 3 149 ? 22.914  28.930  60.672  1.00 84.12  ? 149 PHE E CB  1 
ATOM   6571  C  CG  . PHE D 3 149 ? 23.562  27.757  60.007  1.00 81.76  ? 149 PHE E CG  1 
ATOM   6572  C  CD1 . PHE D 3 149 ? 23.794  27.764  58.636  1.00 82.78  ? 149 PHE E CD1 1 
ATOM   6573  C  CD2 . PHE D 3 149 ? 23.882  26.630  60.733  1.00 80.98  ? 149 PHE E CD2 1 
ATOM   6574  C  CE1 . PHE D 3 149 ? 24.355  26.678  58.003  1.00 78.41  ? 149 PHE E CE1 1 
ATOM   6575  C  CE2 . PHE D 3 149 ? 24.435  25.532  60.108  1.00 82.05  ? 149 PHE E CE2 1 
ATOM   6576  C  CZ  . PHE D 3 149 ? 24.673  25.554  58.743  1.00 80.87  ? 149 PHE E CZ  1 
ATOM   6577  N  N   . PRO D 3 150 ? 20.574  26.589  60.891  1.00 74.05  ? 150 PRO E N   1 
ATOM   6578  C  CA  . PRO D 3 150 ? 20.513  26.425  59.452  1.00 76.08  ? 150 PRO E CA  1 
ATOM   6579  C  C   . PRO D 3 150 ? 19.094  26.562  58.926  1.00 73.19  ? 150 PRO E C   1 
ATOM   6580  O  O   . PRO D 3 150 ? 18.161  26.753  59.700  1.00 70.81  ? 150 PRO E O   1 
ATOM   6581  C  CB  . PRO D 3 150 ? 20.979  24.986  59.269  1.00 80.89  ? 150 PRO E CB  1 
ATOM   6582  C  CG  . PRO D 3 150 ? 20.447  24.292  60.482  1.00 81.29  ? 150 PRO E CG  1 
ATOM   6583  C  CD  . PRO D 3 150 ? 20.381  25.311  61.593  1.00 76.12  ? 150 PRO E CD  1 
ATOM   6584  N  N   . GLU D 3 151 ? 18.942  26.427  57.616  1.00 71.10  ? 151 GLU E N   1 
ATOM   6585  C  CA  . GLU D 3 151 ? 17.642  26.260  57.016  1.00 75.77  ? 151 GLU E CA  1 
ATOM   6586  C  C   . GLU D 3 151 ? 16.968  25.057  57.676  1.00 86.85  ? 151 GLU E C   1 
ATOM   6587  O  O   . GLU D 3 151 ? 17.644  24.147  58.142  1.00 100.70 ? 151 GLU E O   1 
ATOM   6588  C  CB  . GLU D 3 151 ? 17.802  25.987  55.526  1.00 81.51  ? 151 GLU E CB  1 
ATOM   6589  C  CG  . GLU D 3 151 ? 18.402  27.126  54.732  1.00 79.08  ? 151 GLU E CG  1 
ATOM   6590  C  CD  . GLU D 3 151 ? 17.364  27.822  53.878  1.00 98.26  ? 151 GLU E CD  1 
ATOM   6591  O  OE1 . GLU D 3 151 ? 16.462  28.495  54.449  1.00 101.78 ? 151 GLU E OE1 1 
ATOM   6592  O  OE2 . GLU D 3 151 ? 17.439  27.661  52.638  1.00 108.19 ? 151 GLU E OE2 1 
ATOM   6593  N  N   . PRO D 3 152 ? 15.632  25.035  57.708  1.00 88.74  ? 152 PRO E N   1 
ATOM   6594  C  CA  . PRO D 3 152 ? 14.758  26.081  57.214  1.00 87.42  ? 152 PRO E CA  1 
ATOM   6595  C  C   . PRO D 3 152 ? 14.211  26.957  58.328  1.00 87.85  ? 152 PRO E C   1 
ATOM   6596  O  O   . PRO D 3 152 ? 14.380  26.638  59.513  1.00 84.87  ? 152 PRO E O   1 
ATOM   6597  C  CB  . PRO D 3 152 ? 13.616  25.282  56.615  1.00 90.14  ? 152 PRO E CB  1 
ATOM   6598  C  CG  . PRO D 3 152 ? 13.503  24.102  57.525  1.00 89.19  ? 152 PRO E CG  1 
ATOM   6599  C  CD  . PRO D 3 152 ? 14.876  23.821  58.060  1.00 82.61  ? 152 PRO E CD  1 
ATOM   6600  N  N   . VAL D 3 153 ? 13.539  28.040  57.940  1.00 87.64  ? 153 VAL E N   1 
ATOM   6601  C  CA  . VAL D 3 153 ? 12.565  28.686  58.816  1.00 81.15  ? 153 VAL E CA  1 
ATOM   6602  C  C   . VAL D 3 153 ? 11.199  28.639  58.171  1.00 78.08  ? 153 VAL E C   1 
ATOM   6603  O  O   . VAL D 3 153 ? 11.076  28.543  56.948  1.00 79.68  ? 153 VAL E O   1 
ATOM   6604  C  CB  . VAL D 3 153 ? 12.892  30.158  59.071  1.00 77.94  ? 153 VAL E CB  1 
ATOM   6605  C  CG1 . VAL D 3 153 ? 14.258  30.293  59.713  1.00 81.70  ? 153 VAL E CG1 1 
ATOM   6606  C  CG2 . VAL D 3 153 ? 12.810  30.958  57.774  1.00 78.35  ? 153 VAL E CG2 1 
ATOM   6607  N  N   . THR D 3 154 ? 10.177  28.744  59.004  1.00 78.57  ? 154 THR E N   1 
ATOM   6608  C  CA  . THR D 3 154 ? 8.804   28.770  58.533  1.00 86.94  ? 154 THR E CA  1 
ATOM   6609  C  C   . THR D 3 154 ? 8.225   30.122  58.892  1.00 83.08  ? 154 THR E C   1 
ATOM   6610  O  O   . THR D 3 154 ? 8.362   30.569  60.029  1.00 83.37  ? 154 THR E O   1 
ATOM   6611  C  CB  . THR D 3 154 ? 7.953   27.672  59.203  1.00 97.11  ? 154 THR E CB  1 
ATOM   6612  O  OG1 . THR D 3 154 ? 8.129   27.730  60.620  1.00 95.58  ? 154 THR E OG1 1 
ATOM   6613  C  CG2 . THR D 3 154 ? 8.353   26.284  58.706  1.00 103.39 ? 154 THR E CG2 1 
ATOM   6614  N  N   . VAL D 3 155 ? 7.590   30.779  57.929  1.00 82.54  ? 155 VAL E N   1 
ATOM   6615  C  CA  . VAL D 3 155 ? 6.921   32.049  58.204  1.00 90.07  ? 155 VAL E CA  1 
ATOM   6616  C  C   . VAL D 3 155 ? 5.432   31.926  57.923  1.00 88.90  ? 155 VAL E C   1 
ATOM   6617  O  O   . VAL D 3 155 ? 5.028   31.557  56.817  1.00 92.11  ? 155 VAL E O   1 
ATOM   6618  C  CB  . VAL D 3 155 ? 7.496   33.220  57.368  1.00 88.73  ? 155 VAL E CB  1 
ATOM   6619  C  CG1 . VAL D 3 155 ? 6.881   34.541  57.813  1.00 95.55  ? 155 VAL E CG1 1 
ATOM   6620  C  CG2 . VAL D 3 155 ? 9.006   33.276  57.506  1.00 79.27  ? 155 VAL E CG2 1 
ATOM   6621  N  N   . THR D 3 156 ? 4.619   32.232  58.928  1.00 89.64  ? 156 THR E N   1 
ATOM   6622  C  CA  . THR D 3 156 ? 3.184   32.340  58.725  1.00 97.71  ? 156 THR E CA  1 
ATOM   6623  C  C   . THR D 3 156 ? 2.708   33.697  59.203  1.00 88.79  ? 156 THR E C   1 
ATOM   6624  O  O   . THR D 3 156 ? 3.455   34.451  59.820  1.00 77.72  ? 156 THR E O   1 
ATOM   6625  C  CB  . THR D 3 156 ? 2.394   31.224  59.447  1.00 104.36 ? 156 THR E CB  1 
ATOM   6626  O  OG1 . THR D 3 156 ? 2.423   31.425  60.864  1.00 99.95  ? 156 THR E OG1 1 
ATOM   6627  C  CG2 . THR D 3 156 ? 2.979   29.857  59.125  1.00 115.46 ? 156 THR E CG2 1 
ATOM   6628  N  N   . TRP D 3 157 ? 1.457   34.000  58.892  1.00 92.19  ? 157 TRP E N   1 
ATOM   6629  C  CA  . TRP D 3 157 ? 0.876   35.292  59.206  1.00 92.28  ? 157 TRP E CA  1 
ATOM   6630  C  C   . TRP D 3 157 ? -0.417  35.100  59.995  1.00 87.08  ? 157 TRP E C   1 
ATOM   6631  O  O   . TRP D 3 157 ? -1.342  34.431  59.531  1.00 87.15  ? 157 TRP E O   1 
ATOM   6632  C  CB  . TRP D 3 157 ? 0.626   36.095  57.914  1.00 98.99  ? 157 TRP E CB  1 
ATOM   6633  C  CG  . TRP D 3 157 ? 1.892   36.551  57.222  1.00 93.33  ? 157 TRP E CG  1 
ATOM   6634  C  CD1 . TRP D 3 157 ? 2.527   35.936  56.183  1.00 85.12  ? 157 TRP E CD1 1 
ATOM   6635  C  CD2 . TRP D 3 157 ? 2.656   37.731  57.520  1.00 87.99  ? 157 TRP E CD2 1 
ATOM   6636  N  NE1 . TRP D 3 157 ? 3.637   36.659  55.817  1.00 91.34  ? 157 TRP E NE1 1 
ATOM   6637  C  CE2 . TRP D 3 157 ? 3.739   37.763  56.620  1.00 86.08  ? 157 TRP E CE2 1 
ATOM   6638  C  CE3 . TRP D 3 157 ? 2.520   38.766  58.452  1.00 81.99  ? 157 TRP E CE3 1 
ATOM   6639  C  CZ2 . TRP D 3 157 ? 4.690   38.775  56.633  1.00 84.46  ? 157 TRP E CZ2 1 
ATOM   6640  C  CZ3 . TRP D 3 157 ? 3.462   39.769  58.463  1.00 84.67  ? 157 TRP E CZ3 1 
ATOM   6641  C  CH2 . TRP D 3 157 ? 4.539   39.766  57.562  1.00 85.17  ? 157 TRP E CH2 1 
ATOM   6642  N  N   . ASN D 3 158 ? -0.474  35.703  61.179  1.00 84.36  ? 158 ASN E N   1 
ATOM   6643  C  CA  . ASN D 3 158 ? -1.605  35.532  62.089  1.00 88.31  ? 158 ASN E CA  1 
ATOM   6644  C  C   . ASN D 3 158 ? -1.886  34.057  62.314  1.00 91.43  ? 158 ASN E C   1 
ATOM   6645  O  O   . ASN D 3 158 ? -3.003  33.574  62.126  1.00 88.20  ? 158 ASN E O   1 
ATOM   6646  C  CB  . ASN D 3 158 ? -2.841  36.233  61.541  1.00 89.18  ? 158 ASN E CB  1 
ATOM   6647  C  CG  . ASN D 3 158 ? -2.707  37.735  61.562  1.00 87.34  ? 158 ASN E CG  1 
ATOM   6648  O  OD1 . ASN D 3 158 ? -1.853  38.292  62.246  1.00 87.45  ? 158 ASN E OD1 1 
ATOM   6649  N  ND2 . ASN D 3 158 ? -3.555  38.400  60.808  1.00 99.06  ? 158 ASN E ND2 1 
ATOM   6650  N  N   . SER D 3 159 ? -0.828  33.346  62.676  1.00 96.34  ? 159 SER E N   1 
ATOM   6651  C  CA  . SER D 3 159 ? -0.881  31.908  62.934  1.00 97.27  ? 159 SER E CA  1 
ATOM   6652  C  C   . SER D 3 159 ? -1.428  31.115  61.743  1.00 94.52  ? 159 SER E C   1 
ATOM   6653  O  O   . SER D 3 159 ? -1.946  30.015  61.912  1.00 100.35 ? 159 SER E O   1 
ATOM   6654  C  CB  . SER D 3 159 ? -1.709  31.624  64.187  1.00 103.31 ? 159 SER E CB  1 
ATOM   6655  O  OG  . SER D 3 159 ? -1.346  32.501  65.235  1.00 106.54 ? 159 SER E OG  1 
ATOM   6656  N  N   . GLY D 3 160 ? -1.297  31.674  60.543  1.00 90.07  ? 160 GLY E N   1 
ATOM   6657  C  CA  . GLY D 3 160 ? -1.671  30.982  59.324  1.00 90.86  ? 160 GLY E CA  1 
ATOM   6658  C  C   . GLY D 3 160 ? -3.088  31.266  58.875  1.00 94.29  ? 160 GLY E C   1 
ATOM   6659  O  O   . GLY D 3 160 ? -3.547  30.698  57.883  1.00 94.12  ? 160 GLY E O   1 
ATOM   6660  N  N   . SER D 3 161 ? -3.807  32.114  59.610  1.00 95.65  ? 161 SER E N   1 
ATOM   6661  C  CA  . SER D 3 161 ? -5.171  32.467  59.207  1.00 96.49  ? 161 SER E CA  1 
ATOM   6662  C  C   . SER D 3 161 ? -5.104  33.467  58.059  1.00 90.62  ? 161 SER E C   1 
ATOM   6663  O  O   . SER D 3 161 ? -6.073  33.666  57.326  1.00 87.08  ? 161 SER E O   1 
ATOM   6664  C  CB  . SER D 3 161 ? -5.997  33.004  60.385  1.00 96.75  ? 161 SER E CB  1 
ATOM   6665  O  OG  . SER D 3 161 ? -5.310  34.022  61.077  1.00 93.38  ? 161 SER E OG  1 
ATOM   6666  N  N   . LEU D 3 162 ? -3.924  34.038  57.872  1.00 86.92  ? 162 LEU E N   1 
ATOM   6667  C  CA  . LEU D 3 162 ? -3.674  34.917  56.767  1.00 90.16  ? 162 LEU E CA  1 
ATOM   6668  C  C   . LEU D 3 162 ? -2.695  34.247  55.832  1.00 91.54  ? 162 LEU E C   1 
ATOM   6669  O  O   . LEU D 3 162 ? -1.501  34.280  56.068  1.00 103.35 ? 162 LEU E O   1 
ATOM   6670  C  CB  . LEU D 3 162 ? -3.090  36.198  57.322  1.00 90.51  ? 162 LEU E CB  1 
ATOM   6671  C  CG  . LEU D 3 162 ? -2.788  37.337  56.366  1.00 94.33  ? 162 LEU E CG  1 
ATOM   6672  C  CD1 . LEU D 3 162 ? -3.807  37.493  55.244  1.00 94.87  ? 162 LEU E CD1 1 
ATOM   6673  C  CD2 . LEU D 3 162 ? -2.674  38.603  57.205  1.00 93.21  ? 162 LEU E CD2 1 
ATOM   6674  N  N   . SER D 3 163 ? -3.205  33.586  54.798  1.00 98.36  ? 163 SER E N   1 
ATOM   6675  C  CA  . SER D 3 163 ? -2.364  32.733  53.953  1.00 99.65  ? 163 SER E CA  1 
ATOM   6676  C  C   . SER D 3 163 ? -2.416  33.064  52.446  1.00 102.58 ? 163 SER E C   1 
ATOM   6677  O  O   . SER D 3 163 ? -1.540  32.658  51.684  1.00 105.07 ? 163 SER E O   1 
ATOM   6678  C  CB  . SER D 3 163 ? -2.693  31.252  54.188  1.00 99.65  ? 163 SER E CB  1 
ATOM   6679  O  OG  . SER D 3 163 ? -4.034  30.933  53.854  1.00 106.97 ? 163 SER E OG  1 
ATOM   6680  N  N   . SER D 3 164 ? -3.441  33.777  52.001  1.00 104.11 ? 164 SER E N   1 
ATOM   6681  C  CA  . SER D 3 164 ? -3.450  34.248  50.622  1.00 103.20 ? 164 SER E CA  1 
ATOM   6682  C  C   . SER D 3 164 ? -2.833  35.635  50.601  1.00 107.77 ? 164 SER E C   1 
ATOM   6683  O  O   . SER D 3 164 ? -2.881  36.353  51.602  1.00 105.58 ? 164 SER E O   1 
ATOM   6684  C  CB  . SER D 3 164 ? -4.864  34.265  50.051  1.00 102.78 ? 164 SER E CB  1 
ATOM   6685  O  OG  . SER D 3 164 ? -5.689  35.096  50.819  1.00 96.91  ? 164 SER E OG  1 
ATOM   6686  N  N   . GLY D 3 165 ? -2.197  35.979  49.483  1.00 116.89 ? 165 GLY E N   1 
ATOM   6687  C  CA  . GLY D 3 165 ? -1.448  37.240  49.356  1.00 117.97 ? 165 GLY E CA  1 
ATOM   6688  C  C   . GLY D 3 165 ? -0.018  37.182  49.880  1.00 104.86 ? 165 GLY E C   1 
ATOM   6689  O  O   . GLY D 3 165 ? 0.621   38.210  50.107  1.00 103.14 ? 165 GLY E O   1 
ATOM   6690  N  N   . VAL D 3 166 ? 0.501   35.979  50.067  1.00 97.65  ? 166 VAL E N   1 
ATOM   6691  C  CA  . VAL D 3 166 ? 1.776   35.828  50.749  1.00 93.75  ? 166 VAL E CA  1 
ATOM   6692  C  C   . VAL D 3 166 ? 2.846   35.321  49.804  1.00 91.03  ? 166 VAL E C   1 
ATOM   6693  O  O   . VAL D 3 166 ? 2.603   34.404  49.036  1.00 106.50 ? 166 VAL E O   1 
ATOM   6694  C  CB  . VAL D 3 166 ? 1.644   34.864  51.935  1.00 91.17  ? 166 VAL E CB  1 
ATOM   6695  C  CG1 . VAL D 3 166 ? 2.985   34.681  52.623  1.00 84.18  ? 166 VAL E CG1 1 
ATOM   6696  C  CG2 . VAL D 3 166 ? 0.593   35.374  52.915  1.00 91.58  ? 166 VAL E CG2 1 
ATOM   6697  N  N   . HIS D 3 167 ? 4.017   35.947  49.846  1.00 87.10  ? 167 HIS E N   1 
ATOM   6698  C  CA  . HIS D 3 167 ? 5.206   35.407  49.211  1.00 89.11  ? 167 HIS E CA  1 
ATOM   6699  C  C   . HIS D 3 167 ? 6.298   35.330  50.263  1.00 90.17  ? 167 HIS E C   1 
ATOM   6700  O  O   . HIS D 3 167 ? 6.569   36.307  50.953  1.00 98.25  ? 167 HIS E O   1 
ATOM   6701  C  CB  . HIS D 3 167 ? 5.661   36.291  48.043  1.00 89.07  ? 167 HIS E CB  1 
ATOM   6702  C  CG  . HIS D 3 167 ? 4.566   36.630  47.091  1.00 95.34  ? 167 HIS E CG  1 
ATOM   6703  N  ND1 . HIS D 3 167 ? 3.857   35.668  46.405  1.00 110.18 ? 167 HIS E ND1 1 
ATOM   6704  C  CD2 . HIS D 3 167 ? 4.032   37.817  46.731  1.00 108.45 ? 167 HIS E CD2 1 
ATOM   6705  C  CE1 . HIS D 3 167 ? 2.936   36.248  45.657  1.00 115.41 ? 167 HIS E CE1 1 
ATOM   6706  N  NE2 . HIS D 3 167 ? 3.017   37.552  45.841  1.00 117.50 ? 167 HIS E NE2 1 
ATOM   6707  N  N   . THR D 3 168 ? 6.911   34.164  50.415  1.00 88.31  ? 168 THR E N   1 
ATOM   6708  C  CA  . THR D 3 168 ? 8.170   34.108  51.122  1.00 79.30  ? 168 THR E CA  1 
ATOM   6709  C  C   . THR D 3 168 ? 9.253   33.863  50.096  1.00 77.23  ? 168 THR E C   1 
ATOM   6710  O  O   . THR D 3 168 ? 9.151   32.962  49.276  1.00 77.98  ? 168 THR E O   1 
ATOM   6711  C  CB  . THR D 3 168 ? 8.200   33.028  52.208  1.00 75.80  ? 168 THR E CB  1 
ATOM   6712  O  OG1 . THR D 3 168 ? 7.095   33.211  53.104  1.00 76.15  ? 168 THR E OG1 1 
ATOM   6713  C  CG2 . THR D 3 168 ? 9.511   33.127  52.994  1.00 76.40  ? 168 THR E CG2 1 
ATOM   6714  N  N   . PHE D 3 169 ? 10.270  34.708  50.115  1.00 76.53  ? 169 PHE E N   1 
ATOM   6715  C  CA  . PHE D 3 169 ? 11.353  34.599  49.159  1.00 78.11  ? 169 PHE E CA  1 
ATOM   6716  C  C   . PHE D 3 169 ? 12.406  33.598  49.653  1.00 77.71  ? 169 PHE E C   1 
ATOM   6717  O  O   . PHE D 3 169 ? 12.562  33.386  50.862  1.00 74.77  ? 169 PHE E O   1 
ATOM   6718  C  CB  . PHE D 3 169 ? 11.965  35.981  48.923  1.00 84.86  ? 169 PHE E CB  1 
ATOM   6719  C  CG  . PHE D 3 169 ? 10.981  36.986  48.394  1.00 84.23  ? 169 PHE E CG  1 
ATOM   6720  C  CD1 . PHE D 3 169 ? 10.180  37.706  49.254  1.00 81.91  ? 169 PHE E CD1 1 
ATOM   6721  C  CD2 . PHE D 3 169 ? 10.838  37.179  47.031  1.00 87.44  ? 169 PHE E CD2 1 
ATOM   6722  C  CE1 . PHE D 3 169 ? 9.257   38.606  48.766  1.00 88.99  ? 169 PHE E CE1 1 
ATOM   6723  C  CE2 . PHE D 3 169 ? 9.928   38.084  46.533  1.00 85.32  ? 169 PHE E CE2 1 
ATOM   6724  C  CZ  . PHE D 3 169 ? 9.130   38.792  47.401  1.00 91.23  ? 169 PHE E CZ  1 
ATOM   6725  N  N   . PRO D 3 170 ? 13.099  32.944  48.709  1.00 76.03  ? 170 PRO E N   1 
ATOM   6726  C  CA  . PRO D 3 170 ? 14.230  32.078  48.970  1.00 68.14  ? 170 PRO E CA  1 
ATOM   6727  C  C   . PRO D 3 170 ? 15.233  32.713  49.900  1.00 69.59  ? 170 PRO E C   1 
ATOM   6728  O  O   . PRO D 3 170 ? 15.529  33.910  49.778  1.00 82.11  ? 170 PRO E O   1 
ATOM   6729  C  CB  . PRO D 3 170 ? 14.870  31.937  47.597  1.00 74.71  ? 170 PRO E CB  1 
ATOM   6730  C  CG  . PRO D 3 170 ? 13.746  32.061  46.643  1.00 79.75  ? 170 PRO E CG  1 
ATOM   6731  C  CD  . PRO D 3 170 ? 12.791  33.030  47.269  1.00 82.04  ? 170 PRO E CD  1 
ATOM   6732  N  N   . ALA D 3 171 ? 15.783  31.912  50.802  1.00 69.76  ? 171 ALA E N   1 
ATOM   6733  C  CA  . ALA D 3 171 ? 16.886  32.365  51.639  1.00 70.37  ? 171 ALA E CA  1 
ATOM   6734  C  C   . ALA D 3 171 ? 18.122  32.608  50.788  1.00 68.38  ? 171 ALA E C   1 
ATOM   6735  O  O   . ALA D 3 171 ? 18.235  32.093  49.674  1.00 64.45  ? 171 ALA E O   1 
ATOM   6736  C  CB  . ALA D 3 171 ? 17.183  31.344  52.725  1.00 70.79  ? 171 ALA E CB  1 
ATOM   6737  N  N   . VAL D 3 172 ? 19.025  33.427  51.307  1.00 70.59  ? 172 VAL E N   1 
ATOM   6738  C  CA  . VAL D 3 172 ? 20.329  33.605  50.702  1.00 78.86  ? 172 VAL E CA  1 
ATOM   6739  C  C   . VAL D 3 172 ? 21.392  33.639  51.779  1.00 79.97  ? 172 VAL E C   1 
ATOM   6740  O  O   . VAL D 3 172 ? 21.125  34.021  52.922  1.00 67.11  ? 172 VAL E O   1 
ATOM   6741  C  CB  . VAL D 3 172 ? 20.423  34.907  49.902  1.00 87.45  ? 172 VAL E CB  1 
ATOM   6742  C  CG1 . VAL D 3 172 ? 19.359  34.938  48.813  1.00 96.09  ? 172 VAL E CG1 1 
ATOM   6743  C  CG2 . VAL D 3 172 ? 20.296  36.101  50.833  1.00 90.44  ? 172 VAL E CG2 1 
ATOM   6744  N  N   . LEU D 3 173 ? 22.601  33.240  51.392  1.00 91.33  ? 173 LEU E N   1 
ATOM   6745  C  CA  . LEU D 3 173 ? 23.728  33.218  52.303  1.00 88.53  ? 173 LEU E CA  1 
ATOM   6746  C  C   . LEU D 3 173 ? 24.401  34.560  52.350  1.00 94.53  ? 173 LEU E C   1 
ATOM   6747  O  O   . LEU D 3 173 ? 24.735  35.142  51.319  1.00 98.36  ? 173 LEU E O   1 
ATOM   6748  C  CB  . LEU D 3 173 ? 24.748  32.178  51.892  1.00 86.22  ? 173 LEU E CB  1 
ATOM   6749  C  CG  . LEU D 3 173 ? 24.561  30.894  52.677  1.00 94.45  ? 173 LEU E CG  1 
ATOM   6750  C  CD1 . LEU D 3 173 ? 25.421  29.784  52.091  1.00 112.01 ? 173 LEU E CD1 1 
ATOM   6751  C  CD2 . LEU D 3 173 ? 24.885  31.128  54.145  1.00 100.88 ? 173 LEU E CD2 1 
ATOM   6752  N  N   . GLN D 3 174 ? 24.562  35.059  53.566  1.00 94.43  ? 174 GLN E N   1 
ATOM   6753  C  CA  . GLN D 3 174 ? 25.320  36.256  53.795  1.00 94.77  ? 174 GLN E CA  1 
ATOM   6754  C  C   . GLN D 3 174 ? 26.304  35.913  54.882  1.00 98.41  ? 174 GLN E C   1 
ATOM   6755  O  O   . GLN D 3 174 ? 25.917  35.704  56.030  1.00 89.73  ? 174 GLN E O   1 
ATOM   6756  C  CB  . GLN D 3 174 ? 24.397  37.382  54.238  1.00 107.26 ? 174 GLN E CB  1 
ATOM   6757  C  CG  . GLN D 3 174 ? 24.891  38.779  53.897  1.00 112.78 ? 174 GLN E CG  1 
ATOM   6758  C  CD  . GLN D 3 174 ? 23.854  39.837  54.217  1.00 125.28 ? 174 GLN E CD  1 
ATOM   6759  O  OE1 . GLN D 3 174 ? 22.709  39.516  54.564  1.00 126.40 ? 174 GLN E OE1 1 
ATOM   6760  N  NE2 . GLN D 3 174 ? 24.246  41.108  54.115  1.00 130.37 ? 174 GLN E NE2 1 
ATOM   6761  N  N   . SER D 3 175 ? 27.575  35.818  54.504  1.00 115.16 ? 175 SER E N   1 
ATOM   6762  C  CA  . SER D 3 175 ? 28.639  35.499  55.441  1.00 117.74 ? 175 SER E CA  1 
ATOM   6763  C  C   . SER D 3 175 ? 28.182  34.395  56.385  1.00 107.69 ? 175 SER E C   1 
ATOM   6764  O  O   . SER D 3 175 ? 28.109  34.587  57.607  1.00 95.44  ? 175 SER E O   1 
ATOM   6765  C  CB  . SER D 3 175 ? 29.089  36.747  56.212  1.00 123.54 ? 175 SER E CB  1 
ATOM   6766  O  OG  . SER D 3 175 ? 27.995  37.522  56.655  1.00 136.74 ? 175 SER E OG  1 
ATOM   6767  N  N   . ASP D 3 176 ? 27.845  33.253  55.789  1.00 96.78  ? 176 ASP E N   1 
ATOM   6768  C  CA  . ASP D 3 176 ? 27.649  32.008  56.523  1.00 102.80 ? 176 ASP E CA  1 
ATOM   6769  C  C   . ASP D 3 176 ? 26.321  31.915  57.261  1.00 97.44  ? 176 ASP E C   1 
ATOM   6770  O  O   . ASP D 3 176 ? 26.067  30.924  57.942  1.00 99.99  ? 176 ASP E O   1 
ATOM   6771  C  CB  . ASP D 3 176 ? 28.806  31.751  57.492  1.00 110.10 ? 176 ASP E CB  1 
ATOM   6772  C  CG  . ASP D 3 176 ? 30.106  31.457  56.766  1.00 139.28 ? 176 ASP E CG  1 
ATOM   6773  O  OD1 . ASP D 3 176 ? 30.178  30.373  56.151  1.00 142.88 ? 176 ASP E OD1 1 
ATOM   6774  O  OD2 . ASP D 3 176 ? 31.040  32.297  56.783  1.00 171.70 ? 176 ASP E OD2 1 
ATOM   6775  N  N   . LEU D 3 177 ? 25.464  32.920  57.116  1.00 87.15  ? 177 LEU E N   1 
ATOM   6776  C  CA  . LEU D 3 177 ? 24.144  32.837  57.705  1.00 78.39  ? 177 LEU E CA  1 
ATOM   6777  C  C   . LEU D 3 177 ? 23.090  33.170  56.688  1.00 79.43  ? 177 LEU E C   1 
ATOM   6778  O  O   . LEU D 3 177 ? 23.361  33.839  55.689  1.00 88.94  ? 177 LEU E O   1 
ATOM   6779  C  CB  . LEU D 3 177 ? 24.009  33.777  58.891  1.00 78.22  ? 177 LEU E CB  1 
ATOM   6780  C  CG  . LEU D 3 177 ? 24.988  33.539  60.038  1.00 81.86  ? 177 LEU E CG  1 
ATOM   6781  C  CD1 . LEU D 3 177 ? 24.890  34.661  61.054  1.00 84.01  ? 177 LEU E CD1 1 
ATOM   6782  C  CD2 . LEU D 3 177 ? 24.738  32.200  60.713  1.00 82.20  ? 177 LEU E CD2 1 
ATOM   6783  N  N   . TYR D 3 178 ? 21.873  32.723  56.972  1.00 79.14  ? 178 TYR E N   1 
ATOM   6784  C  CA  . TYR D 3 178 ? 20.775  32.845  56.031  1.00 75.49  ? 178 TYR E CA  1 
ATOM   6785  C  C   . TYR D 3 178 ? 19.908  34.056  56.316  1.00 77.63  ? 178 TYR E C   1 
ATOM   6786  O  O   . TYR D 3 178 ? 19.765  34.495  57.459  1.00 70.31  ? 178 TYR E O   1 
ATOM   6787  C  CB  . TYR D 3 178 ? 19.923  31.587  56.064  1.00 74.18  ? 178 TYR E CB  1 
ATOM   6788  C  CG  . TYR D 3 178 ? 20.618  30.398  55.443  1.00 75.63  ? 178 TYR E CG  1 
ATOM   6789  C  CD1 . TYR D 3 178 ? 20.618  30.211  54.064  1.00 73.42  ? 178 TYR E CD1 1 
ATOM   6790  C  CD2 . TYR D 3 178 ? 21.284  29.466  56.234  1.00 76.57  ? 178 TYR E CD2 1 
ATOM   6791  C  CE1 . TYR D 3 178 ? 21.243  29.116  53.495  1.00 79.80  ? 178 TYR E CE1 1 
ATOM   6792  C  CE2 . TYR D 3 178 ? 21.913  28.369  55.675  1.00 78.65  ? 178 TYR E CE2 1 
ATOM   6793  C  CZ  . TYR D 3 178 ? 21.895  28.202  54.307  1.00 83.82  ? 178 TYR E CZ  1 
ATOM   6794  O  OH  . TYR D 3 178 ? 22.518  27.107  53.758  1.00 96.27  ? 178 TYR E OH  1 
ATOM   6795  N  N   . THR D 3 179 ? 19.346  34.606  55.251  1.00 83.26  ? 179 THR E N   1 
ATOM   6796  C  CA  . THR D 3 179 ? 18.378  35.676  55.364  1.00 81.58  ? 179 THR E CA  1 
ATOM   6797  C  C   . THR D 3 179 ? 17.271  35.462  54.338  1.00 82.98  ? 179 THR E C   1 
ATOM   6798  O  O   . THR D 3 179 ? 17.519  35.076  53.198  1.00 87.13  ? 179 THR E O   1 
ATOM   6799  C  CB  . THR D 3 179 ? 19.026  37.045  55.099  1.00 85.20  ? 179 THR E CB  1 
ATOM   6800  O  OG1 . THR D 3 179 ? 20.141  37.237  55.978  1.00 89.12  ? 179 THR E OG1 1 
ATOM   6801  C  CG2 . THR D 3 179 ? 18.001  38.171  55.292  1.00 91.37  ? 179 THR E CG2 1 
ATOM   6802  N  N   . LEU D 3 180 ? 16.043  35.726  54.743  1.00 81.98  ? 180 LEU E N   1 
ATOM   6803  C  CA  . LEU D 3 180 ? 14.964  35.858  53.789  1.00 81.10  ? 180 LEU E CA  1 
ATOM   6804  C  C   . LEU D 3 180 ? 13.981  36.874  54.323  1.00 78.17  ? 180 LEU E C   1 
ATOM   6805  O  O   . LEU D 3 180 ? 14.104  37.328  55.466  1.00 73.11  ? 180 LEU E O   1 
ATOM   6806  C  CB  . LEU D 3 180 ? 14.271  34.512  53.578  1.00 82.10  ? 180 LEU E CB  1 
ATOM   6807  C  CG  . LEU D 3 180 ? 13.543  33.909  54.782  1.00 75.07  ? 180 LEU E CG  1 
ATOM   6808  C  CD1 . LEU D 3 180 ? 12.293  34.685  55.133  1.00 80.18  ? 180 LEU E CD1 1 
ATOM   6809  C  CD2 . LEU D 3 180 ? 13.160  32.485  54.460  1.00 82.87  ? 180 LEU E CD2 1 
ATOM   6810  N  N   . SER D 3 181 ? 12.998  37.215  53.503  1.00 76.09  ? 181 SER E N   1 
ATOM   6811  C  CA  . SER D 3 181 ? 11.846  37.963  53.982  1.00 83.22  ? 181 SER E CA  1 
ATOM   6812  C  C   . SER D 3 181 ? 10.562  37.384  53.414  1.00 77.17  ? 181 SER E C   1 
ATOM   6813  O  O   . SER D 3 181 ? 10.584  36.588  52.477  1.00 70.83  ? 181 SER E O   1 
ATOM   6814  C  CB  . SER D 3 181 ? 11.963  39.448  53.624  1.00 90.21  ? 181 SER E CB  1 
ATOM   6815  O  OG  . SER D 3 181 ? 12.749  39.619  52.461  1.00 104.05 ? 181 SER E OG  1 
ATOM   6816  N  N   . SER D 3 182 ? 9.446   37.776  54.014  1.00 80.66  ? 182 SER E N   1 
ATOM   6817  C  CA  . SER D 3 182 ? 8.137   37.323  53.582  1.00 85.49  ? 182 SER E CA  1 
ATOM   6818  C  C   . SER D 3 182 ? 7.248   38.546  53.409  1.00 86.73  ? 182 SER E C   1 
ATOM   6819  O  O   . SER D 3 182 ? 7.237   39.432  54.260  1.00 79.20  ? 182 SER E O   1 
ATOM   6820  C  CB  . SER D 3 182 ? 7.532   36.384  54.634  1.00 88.03  ? 182 SER E CB  1 
ATOM   6821  O  OG  . SER D 3 182 ? 6.320   35.812  54.187  1.00 81.86  ? 182 SER E OG  1 
ATOM   6822  N  N   . SER D 3 183 ? 6.516   38.598  52.301  1.00 88.98  ? 183 SER E N   1 
ATOM   6823  C  CA  . SER D 3 183 ? 5.530   39.649  52.089  1.00 89.60  ? 183 SER E CA  1 
ATOM   6824  C  C   . SER D 3 183 ? 4.116   39.106  52.266  1.00 86.70  ? 183 SER E C   1 
ATOM   6825  O  O   . SER D 3 183 ? 3.848   37.931  52.062  1.00 87.81  ? 183 SER E O   1 
ATOM   6826  C  CB  . SER D 3 183 ? 5.698   40.286  50.701  1.00 90.56  ? 183 SER E CB  1 
ATOM   6827  O  OG  . SER D 3 183 ? 4.912   39.632  49.728  1.00 93.42  ? 183 SER E OG  1 
ATOM   6828  N  N   . VAL D 3 184 ? 3.211   39.978  52.667  1.00 87.18  ? 184 VAL E N   1 
ATOM   6829  C  CA  . VAL D 3 184 ? 1.806   39.650  52.688  1.00 85.37  ? 184 VAL E CA  1 
ATOM   6830  C  C   . VAL D 3 184 ? 1.075   40.888  52.223  1.00 81.23  ? 184 VAL E C   1 
ATOM   6831  O  O   . VAL D 3 184 ? 1.431   41.987  52.609  1.00 77.40  ? 184 VAL E O   1 
ATOM   6832  C  CB  . VAL D 3 184 ? 1.327   39.251  54.098  1.00 87.81  ? 184 VAL E CB  1 
ATOM   6833  C  CG1 . VAL D 3 184 ? 1.581   40.364  55.103  1.00 86.39  ? 184 VAL E CG1 1 
ATOM   6834  C  CG2 . VAL D 3 184 ? -0.147  38.900  54.078  1.00 92.16  ? 184 VAL E CG2 1 
ATOM   6835  N  N   . THR D 3 185 ? 0.069   40.702  51.376  1.00 89.16  ? 185 THR E N   1 
ATOM   6836  C  CA  . THR D 3 185 ? -0.728  41.806  50.864  1.00 93.15  ? 185 THR E CA  1 
ATOM   6837  C  C   . THR D 3 185 ? -2.154  41.701  51.389  1.00 93.52  ? 185 THR E C   1 
ATOM   6838  O  O   . THR D 3 185 ? -2.776  40.642  51.305  1.00 95.22  ? 185 THR E O   1 
ATOM   6839  C  CB  . THR D 3 185 ? -0.718  41.823  49.325  1.00 98.39  ? 185 THR E CB  1 
ATOM   6840  O  OG1 . THR D 3 185 ? 0.603   42.148  48.874  1.00 108.16 ? 185 THR E OG1 1 
ATOM   6841  C  CG2 . THR D 3 185 ? -1.696  42.851  48.789  1.00 104.84 ? 185 THR E CG2 1 
ATOM   6842  N  N   . VAL D 3 186 ? -2.647  42.795  51.966  1.00 95.54  ? 186 VAL E N   1 
ATOM   6843  C  CA  . VAL D 3 186 ? -3.988  42.832  52.548  1.00 103.60 ? 186 VAL E CA  1 
ATOM   6844  C  C   . VAL D 3 186 ? -4.733  44.104  52.167  1.00 109.11 ? 186 VAL E C   1 
ATOM   6845  O  O   . VAL D 3 186 ? -4.108  45.115  51.829  1.00 124.11 ? 186 VAL E O   1 
ATOM   6846  C  CB  . VAL D 3 186 ? -3.949  42.756  54.092  1.00 103.51 ? 186 VAL E CB  1 
ATOM   6847  C  CG1 . VAL D 3 186 ? -3.335  41.439  54.539  1.00 100.13 ? 186 VAL E CG1 1 
ATOM   6848  C  CG2 . VAL D 3 186 ? -3.198  43.944  54.682  1.00 99.51  ? 186 VAL E CG2 1 
ATOM   6849  N  N   . PRO D 3 187 ? -6.072  44.068  52.259  1.00 102.91 ? 187 PRO E N   1 
ATOM   6850  C  CA  . PRO D 3 187 ? -6.868  45.266  52.047  1.00 106.32 ? 187 PRO E CA  1 
ATOM   6851  C  C   . PRO D 3 187 ? -6.582  46.313  53.119  1.00 108.51 ? 187 PRO E C   1 
ATOM   6852  O  O   . PRO D 3 187 ? -6.474  45.977  54.297  1.00 104.35 ? 187 PRO E O   1 
ATOM   6853  C  CB  . PRO D 3 187 ? -8.314  44.762  52.134  1.00 106.73 ? 187 PRO E CB  1 
ATOM   6854  C  CG  . PRO D 3 187 ? -8.242  43.441  52.802  1.00 103.32 ? 187 PRO E CG  1 
ATOM   6855  C  CD  . PRO D 3 187 ? -6.906  42.875  52.456  1.00 100.77 ? 187 PRO E CD  1 
ATOM   6856  N  N   . SER D 3 188 ? -6.436  47.567  52.700  1.00 117.01 ? 188 SER E N   1 
ATOM   6857  C  CA  . SER D 3 188 ? -5.951  48.623  53.583  1.00 118.84 ? 188 SER E CA  1 
ATOM   6858  C  C   . SER D 3 188 ? -6.991  48.974  54.637  1.00 121.33 ? 188 SER E C   1 
ATOM   6859  O  O   . SER D 3 188 ? -6.674  49.605  55.646  1.00 134.66 ? 188 SER E O   1 
ATOM   6860  C  CB  . SER D 3 188 ? -5.578  49.860  52.771  1.00 121.87 ? 188 SER E CB  1 
ATOM   6861  O  OG  . SER D 3 188 ? -6.616  50.175  51.865  1.00 136.05 ? 188 SER E OG  1 
ATOM   6862  N  N   . SER D 3 189 ? -8.236  48.570  54.400  1.00 117.02 ? 189 SER E N   1 
ATOM   6863  C  CA  . SER D 3 189 ? -9.257  48.654  55.433  1.00 115.53 ? 189 SER E CA  1 
ATOM   6864  C  C   . SER D 3 189 ? -8.906  47.736  56.613  1.00 118.60 ? 189 SER E C   1 
ATOM   6865  O  O   . SER D 3 189 ? -9.305  47.993  57.744  1.00 116.30 ? 189 SER E O   1 
ATOM   6866  C  CB  . SER D 3 189 ? -10.631 48.307  54.857  1.00 112.18 ? 189 SER E CB  1 
ATOM   6867  O  OG  . SER D 3 189 ? -10.593 47.102  54.119  1.00 105.89 ? 189 SER E OG  1 
ATOM   6868  N  N   . SER D 3 190 ? -8.134  46.685  56.349  1.00 128.42 ? 190 SER E N   1 
ATOM   6869  C  CA  . SER D 3 190 ? -7.780  45.706  57.382  1.00 127.43 ? 190 SER E CA  1 
ATOM   6870  C  C   . SER D 3 190 ? -6.623  46.151  58.257  1.00 124.35 ? 190 SER E C   1 
ATOM   6871  O  O   . SER D 3 190 ? -6.444  45.619  59.348  1.00 131.75 ? 190 SER E O   1 
ATOM   6872  C  CB  . SER D 3 190 ? -7.424  44.350  56.759  1.00 124.22 ? 190 SER E CB  1 
ATOM   6873  O  OG  . SER D 3 190 ? -8.587  43.581  56.543  1.00 143.50 ? 190 SER E OG  1 
ATOM   6874  N  N   . TRP D 3 191 ? -5.799  47.070  57.761  1.00 119.68 ? 191 TRP E N   1 
ATOM   6875  C  CA  . TRP D 3 191 ? -4.581  47.448  58.473  1.00 117.06 ? 191 TRP E CA  1 
ATOM   6876  C  C   . TRP D 3 191 ? -4.330  48.947  58.407  1.00 114.18 ? 191 TRP E C   1 
ATOM   6877  O  O   . TRP D 3 191 ? -4.262  49.528  57.320  1.00 109.16 ? 191 TRP E O   1 
ATOM   6878  C  CB  . TRP D 3 191 ? -3.368  46.688  57.926  1.00 116.26 ? 191 TRP E CB  1 
ATOM   6879  C  CG  . TRP D 3 191 ? -2.107  46.890  58.718  1.00 113.21 ? 191 TRP E CG  1 
ATOM   6880  C  CD1 . TRP D 3 191 ? -1.683  46.166  59.804  1.00 111.20 ? 191 TRP E CD1 1 
ATOM   6881  C  CD2 . TRP D 3 191 ? -1.098  47.868  58.470  1.00 109.40 ? 191 TRP E CD2 1 
ATOM   6882  N  NE1 . TRP D 3 191 ? -0.476  46.646  60.249  1.00 106.59 ? 191 TRP E NE1 1 
ATOM   6883  C  CE2 . TRP D 3 191 ? -0.094  47.688  59.445  1.00 108.55 ? 191 TRP E CE2 1 
ATOM   6884  C  CE3 . TRP D 3 191 ? -0.946  48.879  57.519  1.00 109.02 ? 191 TRP E CE3 1 
ATOM   6885  C  CZ2 . TRP D 3 191 ? 1.041   48.480  59.493  1.00 112.30 ? 191 TRP E CZ2 1 
ATOM   6886  C  CZ3 . TRP D 3 191 ? 0.178   49.666  57.572  1.00 115.84 ? 191 TRP E CZ3 1 
ATOM   6887  C  CH2 . TRP D 3 191 ? 1.160   49.463  58.551  1.00 120.55 ? 191 TRP E CH2 1 
ATOM   6888  N  N   . PRO D 3 192 ? -4.126  49.564  59.579  1.00 112.34 ? 192 PRO E N   1 
ATOM   6889  C  CA  . PRO D 3 192 ? -3.930  48.844  60.840  1.00 113.76 ? 192 PRO E CA  1 
ATOM   6890  C  C   . PRO D 3 192 ? -5.182  48.663  61.717  1.00 115.65 ? 192 PRO E C   1 
ATOM   6891  O  O   . PRO D 3 192 ? -5.048  48.441  62.918  1.00 120.69 ? 192 PRO E O   1 
ATOM   6892  C  CB  . PRO D 3 192 ? -2.890  49.705  61.555  1.00 111.73 ? 192 PRO E CB  1 
ATOM   6893  C  CG  . PRO D 3 192 ? -3.193  51.088  61.089  1.00 114.74 ? 192 PRO E CG  1 
ATOM   6894  C  CD  . PRO D 3 192 ? -3.791  50.989  59.708  1.00 112.54 ? 192 PRO E CD  1 
ATOM   6895  N  N   . SER D 3 193 ? -6.378  48.723  61.132  1.00 118.34 ? 193 SER E N   1 
ATOM   6896  C  CA  . SER D 3 193 ? -7.611  48.414  61.876  1.00 123.09 ? 193 SER E CA  1 
ATOM   6897  C  C   . SER D 3 193 ? -7.493  47.085  62.603  1.00 121.95 ? 193 SER E C   1 
ATOM   6898  O  O   . SER D 3 193 ? -7.943  46.946  63.735  1.00 121.83 ? 193 SER E O   1 
ATOM   6899  C  CB  . SER D 3 193 ? -8.825  48.343  60.943  1.00 125.22 ? 193 SER E CB  1 
ATOM   6900  O  OG  . SER D 3 193 ? -9.109  49.593  60.343  1.00 138.80 ? 193 SER E OG  1 
ATOM   6901  N  N   . GLU D 3 194 ? -6.922  46.100  61.915  1.00 129.12 ? 194 GLU E N   1 
ATOM   6902  C  CA  . GLU D 3 194 ? -6.700  44.767  62.475  1.00 127.63 ? 194 GLU E CA  1 
ATOM   6903  C  C   . GLU D 3 194 ? -5.208  44.465  62.553  1.00 118.24 ? 194 GLU E C   1 
ATOM   6904  O  O   . GLU D 3 194 ? -4.447  44.809  61.648  1.00 114.22 ? 194 GLU E O   1 
ATOM   6905  C  CB  . GLU D 3 194 ? -7.385  43.705  61.612  1.00 129.14 ? 194 GLU E CB  1 
ATOM   6906  C  CG  . GLU D 3 194 ? -7.555  42.368  62.310  1.00 131.57 ? 194 GLU E CG  1 
ATOM   6907  C  CD  . GLU D 3 194 ? -8.498  42.445  63.497  1.00 139.09 ? 194 GLU E CD  1 
ATOM   6908  O  OE1 . GLU D 3 194 ? -9.297  43.410  63.593  1.00 134.73 ? 194 GLU E OE1 1 
ATOM   6909  O  OE2 . GLU D 3 194 ? -8.430  41.530  64.343  1.00 142.69 ? 194 GLU E OE2 1 
ATOM   6910  N  N   . THR D 3 195 ? -4.794  43.810  63.630  1.00 111.19 ? 195 THR E N   1 
ATOM   6911  C  CA  . THR D 3 195 ? -3.391  43.510  63.821  1.00 110.12 ? 195 THR E CA  1 
ATOM   6912  C  C   . THR D 3 195 ? -2.942  42.465  62.812  1.00 102.66 ? 195 THR E C   1 
ATOM   6913  O  O   . THR D 3 195 ? -3.716  41.608  62.391  1.00 103.53 ? 195 THR E O   1 
ATOM   6914  C  CB  . THR D 3 195 ? -3.109  43.005  65.243  1.00 113.91 ? 195 THR E CB  1 
ATOM   6915  O  OG1 . THR D 3 195 ? -3.894  41.842  65.497  1.00 122.94 ? 195 THR E OG1 1 
ATOM   6916  C  CG2 . THR D 3 195 ? -3.466  44.062  66.263  1.00 123.79 ? 195 THR E CG2 1 
ATOM   6917  N  N   . VAL D 3 196 ? -1.695  42.590  62.387  1.00 100.77 ? 196 VAL E N   1 
ATOM   6918  C  CA  . VAL D 3 196 ? -1.066  41.599  61.543  1.00 94.93  ? 196 VAL E CA  1 
ATOM   6919  C  C   . VAL D 3 196 ? 0.250   41.241  62.212  1.00 91.72  ? 196 VAL E C   1 
ATOM   6920  O  O   . VAL D 3 196 ? 1.056   42.122  62.528  1.00 88.80  ? 196 VAL E O   1 
ATOM   6921  C  CB  . VAL D 3 196 ? -0.804  42.150  60.121  1.00 94.74  ? 196 VAL E CB  1 
ATOM   6922  C  CG1 . VAL D 3 196 ? 0.118   41.212  59.351  1.00 100.51 ? 196 VAL E CG1 1 
ATOM   6923  C  CG2 . VAL D 3 196 ? -2.114  42.364  59.373  1.00 90.80  ? 196 VAL E CG2 1 
ATOM   6924  N  N   . THR D 3 197 ? 0.459   39.955  62.461  1.00 88.52  ? 197 THR E N   1 
ATOM   6925  C  CA  . THR D 3 197 ? 1.708   39.502  63.043  1.00 87.68  ? 197 THR E CA  1 
ATOM   6926  C  C   . THR D 3 197 ? 2.258   38.379  62.200  1.00 84.99  ? 197 THR E C   1 
ATOM   6927  O  O   . THR D 3 197 ? 1.516   37.521  61.753  1.00 98.11  ? 197 THR E O   1 
ATOM   6928  C  CB  . THR D 3 197 ? 1.518   39.009  64.484  1.00 89.18  ? 197 THR E CB  1 
ATOM   6929  O  OG1 . THR D 3 197 ? 0.717   37.836  64.471  1.00 115.95 ? 197 THR E OG1 1 
ATOM   6930  C  CG2 . THR D 3 197 ? 0.818   40.059  65.329  1.00 95.79  ? 197 THR E CG2 1 
ATOM   6931  N  N   . CYS D 3 198 ? 3.556   38.399  61.944  1.00 90.09  ? 198 CYS E N   1 
ATOM   6932  C  CA  . CYS D 3 198 ? 4.174   37.292  61.251  1.00 90.30  ? 198 CYS E CA  1 
ATOM   6933  C  C   . CYS D 3 198 ? 4.767   36.355  62.291  1.00 89.56  ? 198 CYS E C   1 
ATOM   6934  O  O   . CYS D 3 198 ? 5.327   36.795  63.289  1.00 87.39  ? 198 CYS E O   1 
ATOM   6935  C  CB  . CYS D 3 198 ? 5.230   37.784  60.269  1.00 95.10  ? 198 CYS E CB  1 
ATOM   6936  S  SG  . CYS D 3 198 ? 6.874   38.015  60.962  1.00 101.47 ? 198 CYS E SG  1 
ATOM   6937  N  N   . ASN D 3 199 ? 4.592   35.059  62.074  1.00 90.50  ? 199 ASN E N   1 
ATOM   6938  C  CA  . ASN D 3 199 ? 5.068   34.055  63.007  1.00 92.14  ? 199 ASN E CA  1 
ATOM   6939  C  C   . ASN D 3 199 ? 6.208   33.307  62.382  1.00 84.64  ? 199 ASN E C   1 
ATOM   6940  O  O   . ASN D 3 199 ? 6.073   32.754  61.294  1.00 88.07  ? 199 ASN E O   1 
ATOM   6941  C  CB  . ASN D 3 199 ? 3.941   33.091  63.334  1.00 99.91  ? 199 ASN E CB  1 
ATOM   6942  C  CG  . ASN D 3 199 ? 2.610   33.794  63.452  1.00 97.36  ? 199 ASN E CG  1 
ATOM   6943  O  OD1 . ASN D 3 199 ? 1.877   33.926  62.471  1.00 88.41  ? 199 ASN E OD1 1 
ATOM   6944  N  ND2 . ASN D 3 199 ? 2.323   34.312  64.643  1.00 98.41  ? 199 ASN E ND2 1 
ATOM   6945  N  N   . VAL D 3 200 ? 7.343   33.324  63.055  1.00 85.97  ? 200 VAL E N   1 
ATOM   6946  C  CA  . VAL D 3 200 ? 8.536   32.715  62.516  1.00 88.13  ? 200 VAL E CA  1 
ATOM   6947  C  C   . VAL D 3 200 ? 9.001   31.581  63.416  1.00 88.84  ? 200 VAL E C   1 
ATOM   6948  O  O   . VAL D 3 200 ? 9.205   31.766  64.621  1.00 83.49  ? 200 VAL E O   1 
ATOM   6949  C  CB  . VAL D 3 200 ? 9.665   33.744  62.388  1.00 85.59  ? 200 VAL E CB  1 
ATOM   6950  C  CG1 . VAL D 3 200 ? 10.948  33.056  61.976  1.00 86.49  ? 200 VAL E CG1 1 
ATOM   6951  C  CG2 . VAL D 3 200 ? 9.288   34.823  61.388  1.00 85.47  ? 200 VAL E CG2 1 
ATOM   6952  N  N   . ALA D 3 201 ? 9.172   30.407  62.818  1.00 87.79  ? 201 ALA E N   1 
ATOM   6953  C  CA  . ALA D 3 201 ? 9.709   29.259  63.531  1.00 85.25  ? 201 ALA E CA  1 
ATOM   6954  C  C   . ALA D 3 201 ? 11.051  28.834  62.961  1.00 83.55  ? 201 ALA E C   1 
ATOM   6955  O  O   . ALA D 3 201 ? 11.230  28.745  61.736  1.00 79.43  ? 201 ALA E O   1 
ATOM   6956  C  CB  . ALA D 3 201 ? 8.734   28.107  63.456  1.00 96.93  ? 201 ALA E CB  1 
ATOM   6957  N  N   . HIS D 3 202 ? 11.997  28.583  63.856  1.00 81.29  ? 202 HIS E N   1 
ATOM   6958  C  CA  . HIS D 3 202 ? 13.267  27.995  63.469  1.00 81.53  ? 202 HIS E CA  1 
ATOM   6959  C  C   . HIS D 3 202 ? 13.507  26.753  64.307  1.00 87.31  ? 202 HIS E C   1 
ATOM   6960  O  O   . HIS D 3 202 ? 14.075  26.830  65.404  1.00 83.06  ? 202 HIS E O   1 
ATOM   6961  C  CB  . HIS D 3 202 ? 14.392  28.988  63.670  1.00 81.77  ? 202 HIS E CB  1 
ATOM   6962  C  CG  . HIS D 3 202 ? 15.721  28.506  63.180  1.00 79.37  ? 202 HIS E CG  1 
ATOM   6963  N  ND1 . HIS D 3 202 ? 16.828  28.431  63.997  1.00 76.10  ? 202 HIS E ND1 1 
ATOM   6964  C  CD2 . HIS D 3 202 ? 16.129  28.108  61.952  1.00 78.50  ? 202 HIS E CD2 1 
ATOM   6965  C  CE1 . HIS D 3 202 ? 17.862  28.011  63.292  1.00 75.43  ? 202 HIS E CE1 1 
ATOM   6966  N  NE2 . HIS D 3 202 ? 17.465  27.806  62.049  1.00 76.80  ? 202 HIS E NE2 1 
ATOM   6967  N  N   . PRO D 3 203 ? 13.044  25.601  63.796  1.00 88.26  ? 203 PRO E N   1 
ATOM   6968  C  CA  . PRO D 3 203 ? 13.090  24.322  64.481  1.00 85.77  ? 203 PRO E CA  1 
ATOM   6969  C  C   . PRO D 3 203 ? 14.477  23.974  65.014  1.00 85.46  ? 203 PRO E C   1 
ATOM   6970  O  O   . PRO D 3 203 ? 14.597  23.467  66.125  1.00 85.76  ? 203 PRO E O   1 
ATOM   6971  C  CB  . PRO D 3 203 ? 12.670  23.343  63.394  1.00 84.31  ? 203 PRO E CB  1 
ATOM   6972  C  CG  . PRO D 3 203 ? 11.781  24.138  62.505  1.00 82.10  ? 203 PRO E CG  1 
ATOM   6973  C  CD  . PRO D 3 203 ? 12.424  25.484  62.462  1.00 83.21  ? 203 PRO E CD  1 
ATOM   6974  N  N   . ALA D 3 204 ? 15.518  24.270  64.248  1.00 84.49  ? 204 ALA E N   1 
ATOM   6975  C  CA  . ALA D 3 204 ? 16.877  23.919  64.663  1.00 94.29  ? 204 ALA E CA  1 
ATOM   6976  C  C   . ALA D 3 204 ? 17.296  24.531  66.009  1.00 99.51  ? 204 ALA E C   1 
ATOM   6977  O  O   . ALA D 3 204 ? 18.088  23.950  66.744  1.00 97.44  ? 204 ALA E O   1 
ATOM   6978  C  CB  . ALA D 3 204 ? 17.869  24.313  63.586  1.00 93.50  ? 204 ALA E CB  1 
ATOM   6979  N  N   . SER D 3 205 ? 16.783  25.715  66.318  1.00 107.86 ? 205 SER E N   1 
ATOM   6980  C  CA  . SER D 3 205 ? 17.144  26.399  67.554  1.00 106.24 ? 205 SER E CA  1 
ATOM   6981  C  C   . SER D 3 205 ? 15.982  26.393  68.547  1.00 109.34 ? 205 SER E C   1 
ATOM   6982  O  O   . SER D 3 205 ? 16.065  27.009  69.604  1.00 109.75 ? 205 SER E O   1 
ATOM   6983  C  CB  . SER D 3 205 ? 17.575  27.836  67.241  1.00 102.24 ? 205 SER E CB  1 
ATOM   6984  O  OG  . SER D 3 205 ? 16.582  28.520  66.502  1.00 93.94  ? 205 SER E OG  1 
ATOM   6985  N  N   . SER D 3 206 ? 14.909  25.681  68.208  1.00 112.40 ? 206 SER E N   1 
ATOM   6986  C  CA  . SER D 3 206 ? 13.689  25.654  69.028  1.00 120.67 ? 206 SER E CA  1 
ATOM   6987  C  C   . SER D 3 206 ? 13.188  27.062  69.266  1.00 119.83 ? 206 SER E C   1 
ATOM   6988  O  O   . SER D 3 206 ? 12.830  27.432  70.382  1.00 128.22 ? 206 SER E O   1 
ATOM   6989  C  CB  . SER D 3 206 ? 13.921  24.947  70.365  1.00 128.38 ? 206 SER E CB  1 
ATOM   6990  O  OG  . SER D 3 206 ? 13.903  23.541  70.200  1.00 131.43 ? 206 SER E OG  1 
ATOM   6991  N  N   . THR D 3 207 ? 13.166  27.837  68.193  1.00 118.70 ? 207 THR E N   1 
ATOM   6992  C  CA  . THR D 3 207 ? 12.812  29.237  68.254  1.00 109.87 ? 207 THR E CA  1 
ATOM   6993  C  C   . THR D 3 207 ? 11.466  29.448  67.592  1.00 107.75 ? 207 THR E C   1 
ATOM   6994  O  O   . THR D 3 207 ? 11.258  29.089  66.430  1.00 95.44  ? 207 THR E O   1 
ATOM   6995  C  CB  . THR D 3 207 ? 13.867  30.088  67.535  1.00 107.38 ? 207 THR E CB  1 
ATOM   6996  O  OG1 . THR D 3 207 ? 15.076  30.070  68.298  1.00 110.56 ? 207 THR E OG1 1 
ATOM   6997  C  CG2 . THR D 3 207 ? 13.399  31.524  67.357  1.00 108.07 ? 207 THR E CG2 1 
ATOM   6998  N  N   . LYS D 3 208 ? 10.560  30.046  68.350  1.00 109.62 ? 208 LYS E N   1 
ATOM   6999  C  CA  . LYS D 3 208 ? 9.285   30.490  67.835  1.00 112.07 ? 208 LYS E CA  1 
ATOM   7000  C  C   . LYS D 3 208 ? 9.122   31.960  68.205  1.00 106.75 ? 208 LYS E C   1 
ATOM   7001  O  O   . LYS D 3 208 ? 9.185   32.304  69.385  1.00 101.96 ? 208 LYS E O   1 
ATOM   7002  C  CB  . LYS D 3 208 ? 8.183   29.652  68.480  1.00 128.57 ? 208 LYS E CB  1 
ATOM   7003  C  CG  . LYS D 3 208 ? 6.771   29.956  67.998  1.00 144.55 ? 208 LYS E CG  1 
ATOM   7004  C  CD  . LYS D 3 208 ? 6.667   29.887  66.484  1.00 154.01 ? 208 LYS E CD  1 
ATOM   7005  C  CE  . LYS D 3 208 ? 5.225   29.750  66.022  1.00 153.79 ? 208 LYS E CE  1 
ATOM   7006  N  NZ  . LYS D 3 208 ? 5.152   29.356  64.587  1.00 145.37 ? 208 LYS E NZ  1 
ATOM   7007  N  N   . VAL D 3 209 ? 8.935   32.824  67.205  1.00 103.91 ? 209 VAL E N   1 
ATOM   7008  C  CA  . VAL D 3 209 ? 8.866   34.275  67.427  1.00 99.76  ? 209 VAL E CA  1 
ATOM   7009  C  C   . VAL D 3 209 ? 7.691   34.892  66.675  1.00 96.52  ? 209 VAL E C   1 
ATOM   7010  O  O   . VAL D 3 209 ? 7.478   34.595  65.496  1.00 97.37  ? 209 VAL E O   1 
ATOM   7011  C  CB  . VAL D 3 209 ? 10.156  34.964  66.947  1.00 99.45  ? 209 VAL E CB  1 
ATOM   7012  C  CG1 . VAL D 3 209 ? 9.955   36.465  66.820  1.00 101.38 ? 209 VAL E CG1 1 
ATOM   7013  C  CG2 . VAL D 3 209 ? 11.309  34.652  67.889  1.00 103.14 ? 209 VAL E CG2 1 
ATOM   7014  N  N   . ASP D 3 210 ? 6.929   35.746  67.360  1.00 100.44 ? 210 ASP E N   1 
ATOM   7015  C  CA  . ASP D 3 210 ? 5.814   36.470  66.731  1.00 105.05 ? 210 ASP E CA  1 
ATOM   7016  C  C   . ASP D 3 210 ? 6.108   37.971  66.654  1.00 101.62 ? 210 ASP E C   1 
ATOM   7017  O  O   . ASP D 3 210 ? 6.570   38.567  67.624  1.00 106.58 ? 210 ASP E O   1 
ATOM   7018  C  CB  . ASP D 3 210 ? 4.520   36.247  67.515  1.00 111.53 ? 210 ASP E CB  1 
ATOM   7019  C  CG  . ASP D 3 210 ? 4.052   34.799  67.487  1.00 120.14 ? 210 ASP E CG  1 
ATOM   7020  O  OD1 . ASP D 3 210 ? 4.612   33.985  66.722  1.00 124.08 ? 210 ASP E OD1 1 
ATOM   7021  O  OD2 . ASP D 3 210 ? 3.115   34.471  68.242  1.00 136.93 ? 210 ASP E OD2 1 
ATOM   7022  N  N   . LYS D 3 211 ? 5.856   38.576  65.499  1.00 91.59  ? 211 LYS E N   1 
ATOM   7023  C  CA  . LYS D 3 211 ? 6.149   39.981  65.321  1.00 92.04  ? 211 LYS E CA  1 
ATOM   7024  C  C   . LYS D 3 211 ? 4.962   40.725  64.769  1.00 89.91  ? 211 LYS E C   1 
ATOM   7025  O  O   . LYS D 3 211 ? 4.534   40.473  63.649  1.00 99.61  ? 211 LYS E O   1 
ATOM   7026  C  CB  . LYS D 3 211 ? 7.346   40.170  64.397  1.00 97.81  ? 211 LYS E CB  1 
ATOM   7027  C  CG  . LYS D 3 211 ? 8.625   40.475  65.151  1.00 110.52 ? 211 LYS E CG  1 
ATOM   7028  C  CD  . LYS D 3 211 ? 8.614   41.897  65.705  1.00 122.78 ? 211 LYS E CD  1 
ATOM   7029  C  CE  . LYS D 3 211 ? 9.240   41.978  67.094  1.00 131.23 ? 211 LYS E CE  1 
ATOM   7030  N  NZ  . LYS D 3 211 ? 10.527  41.232  67.191  1.00 135.64 ? 211 LYS E NZ  1 
ATOM   7031  N  N   . LYS D 3 212 ? 4.448   41.660  65.557  1.00 89.77  ? 212 LYS E N   1 
ATOM   7032  C  CA  . LYS D 3 212 ? 3.346   42.510  65.139  1.00 89.07  ? 212 LYS E CA  1 
ATOM   7033  C  C   . LYS D 3 212 ? 3.854   43.636  64.242  1.00 84.35  ? 212 LYS E C   1 
ATOM   7034  O  O   . LYS D 3 212 ? 4.787   44.356  64.590  1.00 85.99  ? 212 LYS E O   1 
ATOM   7035  C  CB  . LYS D 3 212 ? 2.648   43.079  66.375  1.00 96.77  ? 212 LYS E CB  1 
ATOM   7036  C  CG  . LYS D 3 212 ? 1.404   43.899  66.092  1.00 106.71 ? 212 LYS E CG  1 
ATOM   7037  C  CD  . LYS D 3 212 ? 0.831   44.446  67.392  1.00 116.71 ? 212 LYS E CD  1 
ATOM   7038  C  CE  . LYS D 3 212 ? -0.160  45.567  67.134  1.00 122.70 ? 212 LYS E CE  1 
ATOM   7039  N  NZ  . LYS D 3 212 ? -0.602  46.211  68.399  1.00 132.26 ? 212 LYS E NZ  1 
ATOM   7040  N  N   . ILE D 3 213 ? 3.238   43.780  63.080  1.00 80.03  ? 213 ILE E N   1 
ATOM   7041  C  CA  . ILE D 3 213 ? 3.529   44.905  62.208  1.00 79.02  ? 213 ILE E CA  1 
ATOM   7042  C  C   . ILE D 3 213 ? 2.749   46.132  62.687  1.00 85.23  ? 213 ILE E C   1 
ATOM   7043  O  O   . ILE D 3 213 ? 1.514   46.126  62.756  1.00 85.41  ? 213 ILE E O   1 
ATOM   7044  C  CB  . ILE D 3 213 ? 3.154   44.596  60.751  1.00 78.08  ? 213 ILE E CB  1 
ATOM   7045  C  CG1 . ILE D 3 213 ? 3.669   43.218  60.356  1.00 80.86  ? 213 ILE E CG1 1 
ATOM   7046  C  CG2 . ILE D 3 213 ? 3.727   45.640  59.816  1.00 79.79  ? 213 ILE E CG2 1 
ATOM   7047  C  CD1 . ILE D 3 213 ? 5.146   43.024  60.606  1.00 85.53  ? 213 ILE E CD1 1 
ATOM   7048  N  N   . VAL D 3 214 ? 3.489   47.177  63.036  1.00 92.30  ? 214 VAL E N   1 
ATOM   7049  C  CA  . VAL D 3 214 ? 2.915   48.418  63.548  1.00 91.77  ? 214 VAL E CA  1 
ATOM   7050  C  C   . VAL D 3 214 ? 3.303   49.520  62.574  1.00 94.77  ? 214 VAL E C   1 
ATOM   7051  O  O   . VAL D 3 214 ? 4.450   49.569  62.133  1.00 100.43 ? 214 VAL E O   1 
ATOM   7052  C  CB  . VAL D 3 214 ? 3.484   48.747  64.943  1.00 93.76  ? 214 VAL E CB  1 
ATOM   7053  C  CG1 . VAL D 3 214 ? 2.920   50.050  65.468  1.00 101.50 ? 214 VAL E CG1 1 
ATOM   7054  C  CG2 . VAL D 3 214 ? 3.192   47.623  65.920  1.00 96.02  ? 214 VAL E CG2 1 
ATOM   7055  N  N   . PRO D 3 215 ? 2.353   50.401  62.221  1.00 107.26 ? 215 PRO E N   1 
ATOM   7056  C  CA  . PRO D 3 215 ? 2.637   51.515  61.297  1.00 108.24 ? 215 PRO E CA  1 
ATOM   7057  C  C   . PRO D 3 215 ? 3.698   52.472  61.824  1.00 109.18 ? 215 PRO E C   1 
ATOM   7058  O  O   . PRO D 3 215 ? 3.715   52.784  63.012  1.00 108.53 ? 215 PRO E O   1 
ATOM   7059  C  CB  . PRO D 3 215 ? 1.285   52.234  61.180  1.00 113.23 ? 215 PRO E CB  1 
ATOM   7060  C  CG  . PRO D 3 215 ? 0.500   51.802  62.379  1.00 115.29 ? 215 PRO E CG  1 
ATOM   7061  C  CD  . PRO D 3 215 ? 0.947   50.398  62.664  1.00 111.77 ? 215 PRO E CD  1 
ATOM   7062  N  N   . ARG D 3 216 ? 4.574   52.940  60.946  1.00 118.35 ? 216 ARG E N   1 
ATOM   7063  C  CA  . ARG D 3 216 ? 5.647   53.837  61.366  1.00 140.64 ? 216 ARG E CA  1 
ATOM   7064  C  C   . ARG D 3 216 ? 5.031   55.049  62.077  1.00 153.26 ? 216 ARG E C   1 
ATOM   7065  O  O   . ARG D 3 216 ? 4.043   55.609  61.602  1.00 147.58 ? 216 ARG E O   1 
ATOM   7066  C  CB  . ARG D 3 216 ? 6.487   54.287  60.162  1.00 150.10 ? 216 ARG E CB  1 
ATOM   7067  C  CG  . ARG D 3 216 ? 7.071   53.158  59.314  1.00 151.19 ? 216 ARG E CG  1 
ATOM   7068  C  CD  . ARG D 3 216 ? 8.181   52.382  60.016  1.00 156.04 ? 216 ARG E CD  1 
ATOM   7069  N  NE  . ARG D 3 216 ? 9.248   53.248  60.520  1.00 166.95 ? 216 ARG E NE  1 
ATOM   7070  C  CZ  . ARG D 3 216 ? 10.482  52.834  60.794  1.00 167.96 ? 216 ARG E CZ  1 
ATOM   7071  N  NH1 . ARG D 3 216 ? 11.383  53.696  61.255  1.00 168.47 ? 216 ARG E NH1 1 
ATOM   7072  N  NH2 . ARG D 3 216 ? 10.824  51.565  60.596  1.00 160.16 ? 216 ARG E NH2 1 
ATOM   7073  N  N   . ASP D 3 217 ? 5.601   55.441  63.216  1.00 169.75 ? 217 ASP E N   1 
ATOM   7074  C  CA  . ASP D 3 217 ? 4.945   56.409  64.109  1.00 180.66 ? 217 ASP E CA  1 
ATOM   7075  C  C   . ASP D 3 217 ? 4.580   57.718  63.401  1.00 185.96 ? 217 ASP E C   1 
ATOM   7076  O  O   . ASP D 3 217 ? 3.405   57.993  63.138  1.00 174.97 ? 217 ASP E O   1 
ATOM   7077  C  CB  . ASP D 3 217 ? 5.811   56.703  65.342  1.00 181.41 ? 217 ASP E CB  1 
ATOM   7078  C  CG  . ASP D 3 217 ? 7.122   57.361  64.989  1.00 182.07 ? 217 ASP E CG  1 
ATOM   7079  O  OD1 . ASP D 3 217 ? 7.940   56.699  64.319  1.00 184.19 ? 217 ASP E OD1 1 
ATOM   7080  O  OD2 . ASP D 3 217 ? 7.332   58.532  65.379  1.00 182.04 ? 217 ASP E OD2 1 
ATOM   7081  O  OXT . ASP D 3 217 ? 5.441   58.540  63.085  1.00 185.52 ? 217 ASP E OXT 1 
ATOM   7082  N  N   . GLN E 2 1   ? 29.456  -31.282 23.845  1.00 124.35 ? 1   GLN F N   1 
ATOM   7083  C  CA  . GLN E 2 1   ? 29.808  -32.672 23.489  1.00 107.59 ? 1   GLN F CA  1 
ATOM   7084  C  C   . GLN E 2 1   ? 31.174  -33.070 24.054  1.00 105.65 ? 1   GLN F C   1 
ATOM   7085  O  O   . GLN E 2 1   ? 31.767  -34.051 23.620  1.00 125.76 ? 1   GLN F O   1 
ATOM   7086  C  CB  . GLN E 2 1   ? 29.780  -32.818 21.982  1.00 108.49 ? 1   GLN F CB  1 
ATOM   7087  C  CG  . GLN E 2 1   ? 28.376  -32.790 21.412  1.00 112.00 ? 1   GLN F CG  1 
ATOM   7088  C  CD  . GLN E 2 1   ? 28.371  -32.775 19.896  1.00 135.34 ? 1   GLN F CD  1 
ATOM   7089  O  OE1 . GLN E 2 1   ? 29.428  -32.796 19.256  1.00 147.87 ? 1   GLN F OE1 1 
ATOM   7090  N  NE2 . GLN E 2 1   ? 27.178  -32.750 19.309  1.00 147.67 ? 1   GLN F NE2 1 
ATOM   7091  N  N   . ILE E 2 2   ? 31.662  -32.323 25.038  1.00 93.75  ? 2   ILE F N   1 
ATOM   7092  C  CA  . ILE E 2 2   ? 32.660  -32.858 25.954  1.00 88.88  ? 2   ILE F CA  1 
ATOM   7093  C  C   . ILE E 2 2   ? 32.019  -33.960 26.764  1.00 81.83  ? 2   ILE F C   1 
ATOM   7094  O  O   . ILE E 2 2   ? 30.922  -33.793 27.287  1.00 80.21  ? 2   ILE F O   1 
ATOM   7095  C  CB  . ILE E 2 2   ? 33.170  -31.802 26.939  1.00 88.90  ? 2   ILE F CB  1 
ATOM   7096  C  CG1 . ILE E 2 2   ? 34.174  -30.894 26.242  1.00 92.24  ? 2   ILE F CG1 1 
ATOM   7097  C  CG2 . ILE E 2 2   ? 33.821  -32.463 28.144  1.00 83.87  ? 2   ILE F CG2 1 
ATOM   7098  C  CD1 . ILE E 2 2   ? 34.681  -29.775 27.122  1.00 90.34  ? 2   ILE F CD1 1 
ATOM   7099  N  N   . VAL E 2 3   ? 32.715  -35.082 26.865  1.00 79.12  ? 3   VAL F N   1 
ATOM   7100  C  CA  . VAL E 2 3   ? 32.179  -36.272 27.501  1.00 79.95  ? 3   VAL F CA  1 
ATOM   7101  C  C   . VAL E 2 3   ? 32.767  -36.467 28.894  1.00 77.28  ? 3   VAL F C   1 
ATOM   7102  O  O   . VAL E 2 3   ? 33.976  -36.444 29.056  1.00 79.58  ? 3   VAL F O   1 
ATOM   7103  C  CB  . VAL E 2 3   ? 32.506  -37.511 26.660  1.00 85.09  ? 3   VAL F CB  1 
ATOM   7104  C  CG1 . VAL E 2 3   ? 31.921  -38.755 27.304  1.00 92.14  ? 3   VAL F CG1 1 
ATOM   7105  C  CG2 . VAL E 2 3   ? 31.999  -37.327 25.234  1.00 88.25  ? 3   VAL F CG2 1 
ATOM   7106  N  N   . LEU E 2 4   ? 31.909  -36.660 29.892  1.00 78.23  ? 4   LEU F N   1 
ATOM   7107  C  CA  . LEU E 2 4   ? 32.360  -36.892 31.259  1.00 74.62  ? 4   LEU F CA  1 
ATOM   7108  C  C   . LEU E 2 4   ? 32.104  -38.322 31.672  1.00 81.97  ? 4   LEU F C   1 
ATOM   7109  O  O   . LEU E 2 4   ? 30.974  -38.819 31.587  1.00 91.16  ? 4   LEU F O   1 
ATOM   7110  C  CB  . LEU E 2 4   ? 31.638  -35.973 32.229  1.00 69.48  ? 4   LEU F CB  1 
ATOM   7111  C  CG  . LEU E 2 4   ? 31.764  -34.493 31.886  1.00 72.25  ? 4   LEU F CG  1 
ATOM   7112  C  CD1 . LEU E 2 4   ? 30.858  -33.687 32.809  1.00 74.62  ? 4   LEU F CD1 1 
ATOM   7113  C  CD2 . LEU E 2 4   ? 33.209  -34.035 31.978  1.00 70.20  ? 4   LEU F CD2 1 
ATOM   7114  N  N   . THR E 2 5   ? 33.157  -38.980 32.138  1.00 83.40  ? 5   THR F N   1 
ATOM   7115  C  CA  . THR E 2 5   ? 33.062  -40.366 32.552  1.00 75.93  ? 5   THR F CA  1 
ATOM   7116  C  C   . THR E 2 5   ? 33.255  -40.512 34.053  1.00 72.56  ? 5   THR F C   1 
ATOM   7117  O  O   . THR E 2 5   ? 34.294  -40.175 34.589  1.00 75.35  ? 5   THR F O   1 
ATOM   7118  C  CB  . THR E 2 5   ? 34.104  -41.207 31.824  1.00 76.87  ? 5   THR F CB  1 
ATOM   7119  O  OG1 . THR E 2 5   ? 33.819  -41.188 30.424  1.00 79.77  ? 5   THR F OG1 1 
ATOM   7120  C  CG2 . THR E 2 5   ? 34.070  -42.629 32.312  1.00 87.89  ? 5   THR F CG2 1 
ATOM   7121  N  N   . GLN E 2 6   ? 32.216  -40.966 34.735  1.00 77.17  ? 6   GLN F N   1 
ATOM   7122  C  CA  . GLN E 2 6   ? 32.340  -41.367 36.125  1.00 78.44  ? 6   GLN F CA  1 
ATOM   7123  C  C   . GLN E 2 6   ? 32.377  -42.896 36.205  1.00 83.59  ? 6   GLN F C   1 
ATOM   7124  O  O   . GLN E 2 6   ? 31.428  -43.587 35.826  1.00 86.50  ? 6   GLN F O   1 
ATOM   7125  C  CB  . GLN E 2 6   ? 31.170  -40.830 36.955  1.00 77.16  ? 6   GLN F CB  1 
ATOM   7126  C  CG  . GLN E 2 6   ? 30.949  -39.333 36.849  1.00 76.28  ? 6   GLN F CG  1 
ATOM   7127  C  CD  . GLN E 2 6   ? 29.691  -38.880 37.579  1.00 80.66  ? 6   GLN F CD  1 
ATOM   7128  O  OE1 . GLN E 2 6   ? 28.673  -38.534 36.962  1.00 73.84  ? 6   GLN F OE1 1 
ATOM   7129  N  NE2 . GLN E 2 6   ? 29.758  -38.876 38.905  1.00 83.91  ? 6   GLN F NE2 1 
ATOM   7130  N  N   . SER E 2 7   ? 33.490  -43.424 36.683  1.00 84.85  ? 7   SER F N   1 
ATOM   7131  C  CA  . SER E 2 7   ? 33.655  -44.862 36.794  1.00 86.22  ? 7   SER F CA  1 
ATOM   7132  C  C   . SER E 2 7   ? 34.388  -45.164 38.092  1.00 79.72  ? 7   SER F C   1 
ATOM   7133  O  O   . SER E 2 7   ? 35.322  -44.458 38.463  1.00 90.60  ? 7   SER F O   1 
ATOM   7134  C  CB  . SER E 2 7   ? 34.440  -45.398 35.595  1.00 90.41  ? 7   SER F CB  1 
ATOM   7135  O  OG  . SER E 2 7   ? 34.509  -46.805 35.615  1.00 104.29 ? 7   SER F OG  1 
ATOM   7136  N  N   . PRO E 2 8   ? 33.925  -46.168 38.826  1.00 73.74  ? 8   PRO F N   1 
ATOM   7137  C  CA  . PRO E 2 8   ? 32.759  -46.983 38.535  1.00 79.21  ? 8   PRO F CA  1 
ATOM   7138  C  C   . PRO E 2 8   ? 31.448  -46.230 38.696  1.00 81.66  ? 8   PRO F C   1 
ATOM   7139  O  O   . PRO E 2 8   ? 31.407  -45.185 39.342  1.00 81.06  ? 8   PRO F O   1 
ATOM   7140  C  CB  . PRO E 2 8   ? 32.830  -48.048 39.609  1.00 83.38  ? 8   PRO F CB  1 
ATOM   7141  C  CG  . PRO E 2 8   ? 33.425  -47.325 40.775  1.00 80.33  ? 8   PRO F CG  1 
ATOM   7142  C  CD  . PRO E 2 8   ? 34.463  -46.439 40.166  1.00 74.70  ? 8   PRO F CD  1 
ATOM   7143  N  N   . ALA E 2 9   ? 30.378  -46.783 38.136  1.00 87.18  ? 9   ALA F N   1 
ATOM   7144  C  CA  . ALA E 2 9   ? 29.064  -46.155 38.220  1.00 83.50  ? 9   ALA F CA  1 
ATOM   7145  C  C   . ALA E 2 9   ? 28.376  -46.509 39.534  1.00 81.42  ? 9   ALA F C   1 
ATOM   7146  O  O   . ALA E 2 9   ? 27.470  -45.816 39.974  1.00 81.87  ? 9   ALA F O   1 
ATOM   7147  C  CB  . ALA E 2 9   ? 28.197  -46.573 37.042  1.00 86.82  ? 9   ALA F CB  1 
ATOM   7148  N  N   . ILE E 2 10  ? 28.801  -47.601 40.152  1.00 91.54  ? 10  ILE F N   1 
ATOM   7149  C  CA  . ILE E 2 10  ? 28.281  -47.991 41.459  1.00 96.82  ? 10  ILE F CA  1 
ATOM   7150  C  C   . ILE E 2 10  ? 29.426  -48.145 42.449  1.00 94.88  ? 10  ILE F C   1 
ATOM   7151  O  O   . ILE E 2 10  ? 30.483  -48.639 42.088  1.00 107.52 ? 10  ILE F O   1 
ATOM   7152  C  CB  . ILE E 2 10  ? 27.541  -49.341 41.407  1.00 100.97 ? 10  ILE F CB  1 
ATOM   7153  C  CG1 . ILE E 2 10  ? 26.629  -49.433 40.170  1.00 106.43 ? 10  ILE F CG1 1 
ATOM   7154  C  CG2 . ILE E 2 10  ? 26.762  -49.537 42.699  1.00 103.27 ? 10  ILE F CG2 1 
ATOM   7155  C  CD1 . ILE E 2 10  ? 25.294  -48.723 40.305  1.00 110.34 ? 10  ILE F CD1 1 
ATOM   7156  N  N   . MET E 2 11  ? 29.217  -47.734 43.694  1.00 85.95  ? 11  MET F N   1 
ATOM   7157  C  CA  . MET E 2 11  ? 30.173  -48.028 44.749  1.00 85.35  ? 11  MET F CA  1 
ATOM   7158  C  C   . MET E 2 11  ? 29.498  -48.009 46.110  1.00 81.15  ? 11  MET F C   1 
ATOM   7159  O  O   . MET E 2 11  ? 28.374  -47.555 46.247  1.00 83.87  ? 11  MET F O   1 
ATOM   7160  C  CB  . MET E 2 11  ? 31.359  -47.061 44.703  1.00 91.89  ? 11  MET F CB  1 
ATOM   7161  C  CG  . MET E 2 11  ? 31.005  -45.586 44.805  1.00 99.53  ? 11  MET F CG  1 
ATOM   7162  S  SD  . MET E 2 11  ? 32.323  -44.507 44.173  1.00 108.97 ? 11  MET F SD  1 
ATOM   7163  C  CE  . MET E 2 11  ? 33.797  -45.405 44.658  1.00 107.25 ? 11  MET F CE  1 
ATOM   7164  N  N   . SER E 2 12  ? 30.167  -48.557 47.112  1.00 84.77  ? 12  SER F N   1 
ATOM   7165  C  CA  . SER E 2 12  ? 29.549  -48.752 48.422  1.00 85.24  ? 12  SER F CA  1 
ATOM   7166  C  C   . SER E 2 12  ? 30.592  -48.544 49.502  1.00 83.26  ? 12  SER F C   1 
ATOM   7167  O  O   . SER E 2 12  ? 31.756  -48.883 49.320  1.00 87.76  ? 12  SER F O   1 
ATOM   7168  C  CB  . SER E 2 12  ? 28.935  -50.153 48.549  1.00 85.70  ? 12  SER F CB  1 
ATOM   7169  O  OG  . SER E 2 12  ? 29.933  -51.124 48.737  1.00 98.89  ? 12  SER F OG  1 
ATOM   7170  N  N   . ALA E 2 13  ? 30.170  -47.972 50.620  1.00 79.31  ? 13  ALA F N   1 
ATOM   7171  C  CA  . ALA E 2 13  ? 31.097  -47.559 51.654  1.00 78.58  ? 13  ALA F CA  1 
ATOM   7172  C  C   . ALA E 2 13  ? 30.485  -47.799 53.001  1.00 80.39  ? 13  ALA F C   1 
ATOM   7173  O  O   . ALA E 2 13  ? 29.292  -47.568 53.192  1.00 81.18  ? 13  ALA F O   1 
ATOM   7174  C  CB  . ALA E 2 13  ? 31.425  -46.088 51.504  1.00 79.35  ? 13  ALA F CB  1 
ATOM   7175  N  N   . SER E 2 14  ? 31.302  -48.277 53.933  1.00 85.24  ? 14  SER F N   1 
ATOM   7176  C  CA  . SER E 2 14  ? 30.894  -48.387 55.324  1.00 91.38  ? 14  SER F CA  1 
ATOM   7177  C  C   . SER E 2 14  ? 30.995  -47.015 55.925  1.00 89.44  ? 14  SER F C   1 
ATOM   7178  O  O   . SER E 2 14  ? 31.678  -46.163 55.383  1.00 94.80  ? 14  SER F O   1 
ATOM   7179  C  CB  . SER E 2 14  ? 31.812  -49.343 56.084  1.00 100.69 ? 14  SER F CB  1 
ATOM   7180  O  OG  . SER E 2 14  ? 31.763  -50.653 55.538  1.00 105.99 ? 14  SER F OG  1 
ATOM   7181  N  N   . PRO E 2 15  ? 30.317  -46.786 57.048  1.00 93.27  ? 15  PRO F N   1 
ATOM   7182  C  CA  . PRO E 2 15  ? 30.415  -45.468 57.665  1.00 97.81  ? 15  PRO F CA  1 
ATOM   7183  C  C   . PRO E 2 15  ? 31.760  -45.281 58.355  1.00 102.24 ? 15  PRO F C   1 
ATOM   7184  O  O   . PRO E 2 15  ? 32.201  -46.169 59.081  1.00 106.66 ? 15  PRO F O   1 
ATOM   7185  C  CB  . PRO E 2 15  ? 29.272  -45.460 58.695  1.00 101.05 ? 15  PRO F CB  1 
ATOM   7186  C  CG  . PRO E 2 15  ? 28.516  -46.732 58.498  1.00 100.62 ? 15  PRO F CG  1 
ATOM   7187  C  CD  . PRO E 2 15  ? 29.428  -47.683 57.792  1.00 98.23  ? 15  PRO F CD  1 
ATOM   7188  N  N   . GLY E 2 16  ? 32.404  -44.138 58.119  1.00 104.98 ? 16  GLY F N   1 
ATOM   7189  C  CA  . GLY E 2 16  ? 33.753  -43.886 58.639  1.00 107.34 ? 16  GLY F CA  1 
ATOM   7190  C  C   . GLY E 2 16  ? 34.797  -43.982 57.543  1.00 104.27 ? 16  GLY F C   1 
ATOM   7191  O  O   . GLY E 2 16  ? 35.865  -43.384 57.637  1.00 102.84 ? 16  GLY F O   1 
ATOM   7192  N  N   . GLU E 2 17  ? 34.475  -44.746 56.501  1.00 105.07 ? 17  GLU F N   1 
ATOM   7193  C  CA  . GLU E 2 17  ? 35.346  -44.889 55.340  1.00 102.04 ? 17  GLU F CA  1 
ATOM   7194  C  C   . GLU E 2 17  ? 35.452  -43.579 54.573  1.00 89.94  ? 17  GLU F C   1 
ATOM   7195  O  O   . GLU E 2 17  ? 34.518  -42.799 54.528  1.00 81.14  ? 17  GLU F O   1 
ATOM   7196  C  CB  . GLU E 2 17  ? 34.833  -45.990 54.397  1.00 105.07 ? 17  GLU F CB  1 
ATOM   7197  C  CG  . GLU E 2 17  ? 35.491  -47.349 54.591  1.00 116.25 ? 17  GLU F CG  1 
ATOM   7198  C  CD  . GLU E 2 17  ? 34.731  -48.469 53.901  1.00 123.48 ? 17  GLU F CD  1 
ATOM   7199  O  OE1 . GLU E 2 17  ? 33.801  -48.159 53.124  1.00 125.23 ? 17  GLU F OE1 1 
ATOM   7200  O  OE2 . GLU E 2 17  ? 35.062  -49.656 54.129  1.00 134.94 ? 17  GLU F OE2 1 
ATOM   7201  N  N   . LYS E 2 18  ? 36.610  -43.361 53.969  1.00 88.93  ? 18  LYS F N   1 
ATOM   7202  C  CA  . LYS E 2 18  ? 36.810  -42.276 53.044  1.00 86.34  ? 18  LYS F CA  1 
ATOM   7203  C  C   . LYS E 2 18  ? 36.344  -42.720 51.663  1.00 80.46  ? 18  LYS F C   1 
ATOM   7204  O  O   . LYS E 2 18  ? 36.563  -43.851 51.245  1.00 90.10  ? 18  LYS F O   1 
ATOM   7205  C  CB  . LYS E 2 18  ? 38.292  -41.890 53.035  1.00 96.04  ? 18  LYS F CB  1 
ATOM   7206  C  CG  . LYS E 2 18  ? 38.737  -40.932 51.939  1.00 99.58  ? 18  LYS F CG  1 
ATOM   7207  C  CD  . LYS E 2 18  ? 39.989  -40.193 52.396  1.00 110.35 ? 18  LYS F CD  1 
ATOM   7208  C  CE  . LYS E 2 18  ? 40.618  -39.329 51.313  1.00 120.65 ? 18  LYS F CE  1 
ATOM   7209  N  NZ  . LYS E 2 18  ? 41.746  -40.002 50.607  1.00 124.88 ? 18  LYS F NZ  1 
ATOM   7210  N  N   . VAL E 2 19  ? 35.687  -41.826 50.956  1.00 74.57  ? 19  VAL F N   1 
ATOM   7211  C  CA  . VAL E 2 19  ? 35.140  -42.156 49.661  1.00 73.22  ? 19  VAL F CA  1 
ATOM   7212  C  C   . VAL E 2 19  ? 35.662  -41.148 48.657  1.00 71.26  ? 19  VAL F C   1 
ATOM   7213  O  O   . VAL E 2 19  ? 35.722  -39.967 48.939  1.00 75.80  ? 19  VAL F O   1 
ATOM   7214  C  CB  . VAL E 2 19  ? 33.597  -42.101 49.696  1.00 71.99  ? 19  VAL F CB  1 
ATOM   7215  C  CG1 . VAL E 2 19  ? 33.004  -42.319 48.312  1.00 72.18  ? 19  VAL F CG1 1 
ATOM   7216  C  CG2 . VAL E 2 19  ? 33.054  -43.125 50.679  1.00 71.93  ? 19  VAL F CG2 1 
ATOM   7217  N  N   . THR E 2 20  ? 36.003  -41.621 47.471  1.00 75.58  ? 20  THR F N   1 
ATOM   7218  C  CA  . THR E 2 20  ? 36.446  -40.760 46.396  1.00 79.61  ? 20  THR F CA  1 
ATOM   7219  C  C   . THR E 2 20  ? 35.802  -41.195 45.082  1.00 76.75  ? 20  THR F C   1 
ATOM   7220  O  O   . THR E 2 20  ? 35.990  -42.330 44.641  1.00 95.10  ? 20  THR F O   1 
ATOM   7221  C  CB  . THR E 2 20  ? 37.974  -40.860 46.235  1.00 92.47  ? 20  THR F CB  1 
ATOM   7222  O  OG1 . THR E 2 20  ? 38.624  -40.416 47.436  1.00 88.22  ? 20  THR F OG1 1 
ATOM   7223  C  CG2 . THR E 2 20  ? 38.442  -40.033 45.048  1.00 96.91  ? 20  THR F CG2 1 
ATOM   7224  N  N   . MET E 2 21  ? 35.083  -40.294 44.429  1.00 70.80  ? 21  MET F N   1 
ATOM   7225  C  CA  . MET E 2 21  ? 34.605  -40.576 43.076  1.00 74.63  ? 21  MET F CA  1 
ATOM   7226  C  C   . MET E 2 21  ? 35.193  -39.616 42.067  1.00 67.96  ? 21  MET F C   1 
ATOM   7227  O  O   . MET E 2 21  ? 35.434  -38.465 42.374  1.00 73.22  ? 21  MET F O   1 
ATOM   7228  C  CB  . MET E 2 21  ? 33.085  -40.552 42.992  1.00 78.60  ? 21  MET F CB  1 
ATOM   7229  C  CG  . MET E 2 21  ? 32.401  -39.708 44.043  1.00 85.57  ? 21  MET F CG  1 
ATOM   7230  S  SD  . MET E 2 21  ? 30.865  -40.481 44.566  1.00 94.99  ? 21  MET F SD  1 
ATOM   7231  C  CE  . MET E 2 21  ? 30.627  -39.656 46.142  1.00 90.18  ? 21  MET F CE  1 
ATOM   7232  N  N   . THR E 2 22  ? 35.418  -40.108 40.858  1.00 69.26  ? 22  THR F N   1 
ATOM   7233  C  CA  . THR E 2 22  ? 36.189  -39.378 39.873  1.00 73.06  ? 22  THR F CA  1 
ATOM   7234  C  C   . THR E 2 22  ? 35.351  -39.054 38.658  1.00 71.92  ? 22  THR F C   1 
ATOM   7235  O  O   . THR E 2 22  ? 34.355  -39.718 38.384  1.00 75.14  ? 22  THR F O   1 
ATOM   7236  C  CB  . THR E 2 22  ? 37.402  -40.193 39.397  1.00 77.61  ? 22  THR F CB  1 
ATOM   7237  O  OG1 . THR E 2 22  ? 36.955  -41.406 38.760  1.00 73.17  ? 22  THR F OG1 1 
ATOM   7238  C  CG2 . THR E 2 22  ? 38.310  -40.506 40.573  1.00 76.82  ? 22  THR F CG2 1 
ATOM   7239  N  N   . CYS E 2 23  ? 35.781  -38.028 37.935  1.00 66.70  ? 23  CYS F N   1 
ATOM   7240  C  CA  . CYS E 2 23  ? 35.107  -37.587 36.743  1.00 70.41  ? 23  CYS F CA  1 
ATOM   7241  C  C   . CYS E 2 23  ? 36.217  -37.195 35.778  1.00 75.63  ? 23  CYS F C   1 
ATOM   7242  O  O   . CYS E 2 23  ? 36.990  -36.287 36.051  1.00 84.44  ? 23  CYS F O   1 
ATOM   7243  C  CB  . CYS E 2 23  ? 34.184  -36.398 37.074  1.00 69.81  ? 23  CYS F CB  1 
ATOM   7244  S  SG  . CYS E 2 23  ? 33.247  -35.743 35.681  1.00 89.98  ? 23  CYS F SG  1 
ATOM   7245  N  N   . SER E 2 24  ? 36.338  -37.922 34.678  1.00 79.35  ? 24  SER F N   1 
ATOM   7246  C  CA  . SER E 2 24  ? 37.334  -37.604 33.660  1.00 81.51  ? 24  SER F CA  1 
ATOM   7247  C  C   . SER E 2 24  ? 36.649  -37.002 32.447  1.00 78.60  ? 24  SER F C   1 
ATOM   7248  O  O   . SER E 2 24  ? 35.559  -37.431 32.067  1.00 80.86  ? 24  SER F O   1 
ATOM   7249  C  CB  . SER E 2 24  ? 38.110  -38.856 33.244  1.00 88.54  ? 24  SER F CB  1 
ATOM   7250  O  OG  . SER E 2 24  ? 37.357  -39.615 32.320  1.00 104.08 ? 24  SER F OG  1 
ATOM   7251  N  N   . ALA E 2 25  ? 37.312  -36.031 31.828  1.00 74.84  ? 25  ALA F N   1 
ATOM   7252  C  CA  . ALA E 2 25  ? 36.731  -35.280 30.729  1.00 73.20  ? 25  ALA F CA  1 
ATOM   7253  C  C   . ALA E 2 25  ? 37.401  -35.590 29.395  1.00 72.16  ? 25  ALA F C   1 
ATOM   7254  O  O   . ALA E 2 25  ? 38.609  -35.673 29.318  1.00 73.44  ? 25  ALA F O   1 
ATOM   7255  C  CB  . ALA E 2 25  ? 36.830  -33.800 31.028  1.00 74.72  ? 25  ALA F CB  1 
ATOM   7256  N  N   . SER E 2 26  ? 36.608  -35.714 28.340  1.00 72.72  ? 26  SER F N   1 
ATOM   7257  C  CA  . SER E 2 26  ? 37.130  -36.073 27.026  1.00 79.99  ? 26  SER F CA  1 
ATOM   7258  C  C   . SER E 2 26  ? 38.158  -35.075 26.539  1.00 80.26  ? 26  SER F C   1 
ATOM   7259  O  O   . SER E 2 26  ? 39.031  -35.407 25.751  1.00 88.62  ? 26  SER F O   1 
ATOM   7260  C  CB  . SER E 2 26  ? 36.008  -36.153 25.998  1.00 82.74  ? 26  SER F CB  1 
ATOM   7261  O  OG  . SER E 2 26  ? 35.614  -34.861 25.580  1.00 82.43  ? 26  SER F OG  1 
ATOM   7262  N  N   . SER E 2 27  ? 38.036  -33.842 26.987  1.00 78.89  ? 27  SER F N   1 
ATOM   7263  C  CA  . SER E 2 27  ? 39.077  -32.869 26.752  1.00 87.86  ? 27  SER F CA  1 
ATOM   7264  C  C   . SER E 2 27  ? 39.036  -31.837 27.855  1.00 84.61  ? 27  SER F C   1 
ATOM   7265  O  O   . SER E 2 27  ? 38.083  -31.773 28.613  1.00 85.18  ? 27  SER F O   1 
ATOM   7266  C  CB  . SER E 2 27  ? 38.911  -32.211 25.386  1.00 93.77  ? 27  SER F CB  1 
ATOM   7267  O  OG  . SER E 2 27  ? 37.729  -31.442 25.346  1.00 93.87  ? 27  SER F OG  1 
ATOM   7268  N  N   . SER E 2 28  ? 40.072  -31.020 27.934  1.00 88.19  ? 28  SER F N   1 
ATOM   7269  C  CA  . SER E 2 28  ? 40.331  -30.269 29.130  1.00 88.83  ? 28  SER F CA  1 
ATOM   7270  C  C   . SER E 2 28  ? 39.184  -29.335 29.479  1.00 87.42  ? 28  SER F C   1 
ATOM   7271  O  O   . SER E 2 28  ? 38.444  -28.881 28.605  1.00 89.99  ? 28  SER F O   1 
ATOM   7272  C  CB  . SER E 2 28  ? 41.608  -29.473 28.950  1.00 94.87  ? 28  SER F CB  1 
ATOM   7273  O  OG  . SER E 2 28  ? 41.771  -28.589 30.036  1.00 113.73 ? 28  SER F OG  1 
ATOM   7274  N  N   . VAL E 2 29  ? 39.079  -29.036 30.771  1.00 81.51  ? 29  VAL F N   1 
ATOM   7275  C  CA  . VAL E 2 29  ? 37.940  -28.334 31.335  1.00 76.01  ? 29  VAL F CA  1 
ATOM   7276  C  C   . VAL E 2 29  ? 38.407  -27.549 32.558  1.00 75.64  ? 29  VAL F C   1 
ATOM   7277  O  O   . VAL E 2 29  ? 39.217  -28.054 33.325  1.00 72.96  ? 29  VAL F O   1 
ATOM   7278  C  CB  . VAL E 2 29  ? 36.862  -29.358 31.715  1.00 75.12  ? 29  VAL F CB  1 
ATOM   7279  C  CG1 . VAL E 2 29  ? 36.349  -29.131 33.126  1.00 71.88  ? 29  VAL F CG1 1 
ATOM   7280  C  CG2 . VAL E 2 29  ? 35.734  -29.319 30.701  1.00 76.35  ? 29  VAL F CG2 1 
ATOM   7281  N  N   . SER E 2 30  ? 37.924  -26.317 32.734  1.00 77.34  ? 30  SER F N   1 
ATOM   7282  C  CA  . SER E 2 30  ? 38.525  -25.377 33.700  1.00 78.68  ? 30  SER F CA  1 
ATOM   7283  C  C   . SER E 2 30  ? 37.912  -25.487 35.094  1.00 73.22  ? 30  SER F C   1 
ATOM   7284  O  O   . SER E 2 30  ? 38.531  -25.105 36.087  1.00 64.07  ? 30  SER F O   1 
ATOM   7285  C  CB  . SER E 2 30  ? 38.382  -23.945 33.203  1.00 82.51  ? 30  SER F CB  1 
ATOM   7286  O  OG  . SER E 2 30  ? 38.513  -23.906 31.793  1.00 97.75  ? 30  SER F OG  1 
ATOM   7287  N  N   . TYR E 2 31  ? 36.692  -26.008 35.155  1.00 71.47  ? 31  TYR F N   1 
ATOM   7288  C  CA  . TYR E 2 31  ? 35.985  -26.195 36.412  1.00 68.83  ? 31  TYR F CA  1 
ATOM   7289  C  C   . TYR E 2 31  ? 35.079  -27.407 36.312  1.00 66.14  ? 31  TYR F C   1 
ATOM   7290  O  O   . TYR E 2 31  ? 34.526  -27.686 35.249  1.00 71.54  ? 31  TYR F O   1 
ATOM   7291  C  CB  . TYR E 2 31  ? 35.111  -24.982 36.702  1.00 74.94  ? 31  TYR F CB  1 
ATOM   7292  C  CG  . TYR E 2 31  ? 35.861  -23.696 36.974  1.00 73.57  ? 31  TYR F CG  1 
ATOM   7293  C  CD1 . TYR E 2 31  ? 36.466  -23.473 38.205  1.00 73.71  ? 31  TYR F CD1 1 
ATOM   7294  C  CD2 . TYR E 2 31  ? 35.900  -22.681 36.027  1.00 67.49  ? 31  TYR F CD2 1 
ATOM   7295  C  CE1 . TYR E 2 31  ? 37.116  -22.288 38.474  1.00 80.66  ? 31  TYR F CE1 1 
ATOM   7296  C  CE2 . TYR E 2 31  ? 36.534  -21.491 36.293  1.00 73.80  ? 31  TYR F CE2 1 
ATOM   7297  C  CZ  . TYR E 2 31  ? 37.143  -21.294 37.517  1.00 79.66  ? 31  TYR F CZ  1 
ATOM   7298  O  OH  . TYR E 2 31  ? 37.797  -20.107 37.787  1.00 83.72  ? 31  TYR F OH  1 
ATOM   7299  N  N   . MET E 2 32  ? 34.879  -28.098 37.425  1.00 61.56  ? 32  MET F N   1 
ATOM   7300  C  CA  . MET E 2 32  ? 33.919  -29.185 37.453  1.00 64.69  ? 32  MET F CA  1 
ATOM   7301  C  C   . MET E 2 32  ? 32.906  -28.898 38.544  1.00 61.90  ? 32  MET F C   1 
ATOM   7302  O  O   . MET E 2 32  ? 33.269  -28.383 39.594  1.00 65.55  ? 32  MET F O   1 
ATOM   7303  C  CB  . MET E 2 32  ? 34.628  -30.521 37.713  1.00 69.30  ? 32  MET F CB  1 
ATOM   7304  C  CG  . MET E 2 32  ? 33.749  -31.745 37.500  1.00 67.47  ? 32  MET F CG  1 
ATOM   7305  S  SD  . MET E 2 32  ? 33.164  -31.912 35.802  1.00 74.65  ? 32  MET F SD  1 
ATOM   7306  C  CE  . MET E 2 32  ? 34.663  -32.414 34.976  1.00 79.52  ? 32  MET F CE  1 
ATOM   7307  N  N   . HIS E 2 33  ? 31.639  -29.230 38.307  1.00 61.83  ? 33  HIS F N   1 
ATOM   7308  C  CA  . HIS E 2 33  ? 30.615  -29.103 39.353  1.00 65.04  ? 33  HIS F CA  1 
ATOM   7309  C  C   . HIS E 2 33  ? 30.042  -30.470 39.682  1.00 68.89  ? 33  HIS F C   1 
ATOM   7310  O  O   . HIS E 2 33  ? 30.076  -31.383 38.847  1.00 73.13  ? 33  HIS F O   1 
ATOM   7311  C  CB  . HIS E 2 33  ? 29.486  -28.163 38.915  1.00 62.39  ? 33  HIS F CB  1 
ATOM   7312  C  CG  . HIS E 2 33  ? 29.966  -26.932 38.222  1.00 62.19  ? 33  HIS F CG  1 
ATOM   7313  N  ND1 . HIS E 2 33  ? 30.825  -26.036 38.821  1.00 61.22  ? 33  HIS F ND1 1 
ATOM   7314  C  CD2 . HIS E 2 33  ? 29.748  -26.466 36.967  1.00 64.83  ? 33  HIS F CD2 1 
ATOM   7315  C  CE1 . HIS E 2 33  ? 31.117  -25.069 37.966  1.00 62.38  ? 33  HIS F CE1 1 
ATOM   7316  N  NE2 . HIS E 2 33  ? 30.471  -25.300 36.836  1.00 64.42  ? 33  HIS F NE2 1 
ATOM   7317  N  N   . TRP E 2 34  ? 29.486  -30.591 40.888  1.00 71.29  ? 34  TRP F N   1 
ATOM   7318  C  CA  . TRP E 2 34  ? 28.883  -31.843 41.339  1.00 67.53  ? 34  TRP F CA  1 
ATOM   7319  C  C   . TRP E 2 34  ? 27.498  -31.676 41.972  1.00 63.79  ? 34  TRP F C   1 
ATOM   7320  O  O   . TRP E 2 34  ? 27.286  -30.792 42.797  1.00 58.78  ? 34  TRP F O   1 
ATOM   7321  C  CB  . TRP E 2 34  ? 29.776  -32.473 42.377  1.00 65.62  ? 34  TRP F CB  1 
ATOM   7322  C  CG  . TRP E 2 34  ? 31.138  -32.802 41.912  1.00 62.89  ? 34  TRP F CG  1 
ATOM   7323  C  CD1 . TRP E 2 34  ? 32.209  -31.984 41.924  1.00 64.02  ? 34  TRP F CD1 1 
ATOM   7324  C  CD2 . TRP E 2 34  ? 31.599  -34.070 41.434  1.00 59.91  ? 34  TRP F CD2 1 
ATOM   7325  N  NE1 . TRP E 2 34  ? 33.318  -32.651 41.468  1.00 66.02  ? 34  TRP F NE1 1 
ATOM   7326  C  CE2 . TRP E 2 34  ? 32.970  -33.940 41.174  1.00 62.61  ? 34  TRP F CE2 1 
ATOM   7327  C  CE3 . TRP E 2 34  ? 30.984  -35.298 41.199  1.00 58.43  ? 34  TRP F CE3 1 
ATOM   7328  C  CZ2 . TRP E 2 34  ? 33.740  -34.987 40.684  1.00 62.99  ? 34  TRP F CZ2 1 
ATOM   7329  C  CZ3 . TRP E 2 34  ? 31.746  -36.333 40.719  1.00 63.12  ? 34  TRP F CZ3 1 
ATOM   7330  C  CH2 . TRP E 2 34  ? 33.114  -36.169 40.456  1.00 62.01  ? 34  TRP F CH2 1 
ATOM   7331  N  N   . TYR E 2 35  ? 26.583  -32.578 41.632  1.00 62.04  ? 35  TYR F N   1 
ATOM   7332  C  CA  . TYR E 2 35  ? 25.259  -32.592 42.248  1.00 65.22  ? 35  TYR F CA  1 
ATOM   7333  C  C   . TYR E 2 35  ? 25.042  -33.853 43.070  1.00 65.22  ? 35  TYR F C   1 
ATOM   7334  O  O   . TYR E 2 35  ? 25.581  -34.922 42.742  1.00 66.81  ? 35  TYR F O   1 
ATOM   7335  C  CB  . TYR E 2 35  ? 24.167  -32.471 41.174  1.00 66.18  ? 35  TYR F CB  1 
ATOM   7336  C  CG  . TYR E 2 35  ? 24.391  -31.289 40.283  1.00 65.68  ? 35  TYR F CG  1 
ATOM   7337  C  CD1 . TYR E 2 35  ? 25.078  -31.426 39.107  1.00 67.03  ? 35  TYR F CD1 1 
ATOM   7338  C  CD2 . TYR E 2 35  ? 23.991  -30.019 40.669  1.00 64.86  ? 35  TYR F CD2 1 
ATOM   7339  C  CE1 . TYR E 2 35  ? 25.346  -30.331 38.316  1.00 80.31  ? 35  TYR F CE1 1 
ATOM   7340  C  CE2 . TYR E 2 35  ? 24.256  -28.918 39.890  1.00 68.91  ? 35  TYR F CE2 1 
ATOM   7341  C  CZ  . TYR E 2 35  ? 24.938  -29.071 38.712  1.00 73.35  ? 35  TYR F CZ  1 
ATOM   7342  O  OH  . TYR E 2 35  ? 25.203  -27.965 37.923  1.00 62.18  ? 35  TYR F OH  1 
ATOM   7343  N  N   . GLN E 2 36  ? 24.257  -33.717 44.136  1.00 58.55  ? 36  GLN F N   1 
ATOM   7344  C  CA  . GLN E 2 36  ? 23.815  -34.858 44.917  1.00 62.14  ? 36  GLN F CA  1 
ATOM   7345  C  C   . GLN E 2 36  ? 22.330  -35.117 44.719  1.00 61.83  ? 36  GLN F C   1 
ATOM   7346  O  O   . GLN E 2 36  ? 21.506  -34.235 44.925  1.00 69.78  ? 36  GLN F O   1 
ATOM   7347  C  CB  . GLN E 2 36  ? 24.070  -34.619 46.399  1.00 65.15  ? 36  GLN F CB  1 
ATOM   7348  C  CG  . GLN E 2 36  ? 23.614  -35.779 47.255  1.00 70.41  ? 36  GLN F CG  1 
ATOM   7349  C  CD  . GLN E 2 36  ? 23.441  -35.408 48.710  1.00 76.78  ? 36  GLN F CD  1 
ATOM   7350  O  OE1 . GLN E 2 36  ? 22.473  -34.746 49.084  1.00 74.52  ? 36  GLN F OE1 1 
ATOM   7351  N  NE2 . GLN E 2 36  ? 24.369  -35.864 49.547  1.00 86.63  ? 36  GLN F NE2 1 
ATOM   7352  N  N   . GLN E 2 37  ? 21.979  -36.342 44.358  1.00 64.95  ? 37  GLN F N   1 
ATOM   7353  C  CA  . GLN E 2 37  ? 20.577  -36.683 44.167  1.00 64.91  ? 37  GLN F CA  1 
ATOM   7354  C  C   . GLN E 2 37  ? 20.184  -37.882 44.987  1.00 65.78  ? 37  GLN F C   1 
ATOM   7355  O  O   . GLN E 2 37  ? 20.831  -38.921 44.937  1.00 79.10  ? 37  GLN F O   1 
ATOM   7356  C  CB  . GLN E 2 37  ? 20.280  -36.972 42.705  1.00 60.89  ? 37  GLN F CB  1 
ATOM   7357  C  CG  . GLN E 2 37  ? 18.807  -37.190 42.431  1.00 61.70  ? 37  GLN F CG  1 
ATOM   7358  C  CD  . GLN E 2 37  ? 18.514  -37.240 40.954  1.00 63.30  ? 37  GLN F CD  1 
ATOM   7359  O  OE1 . GLN E 2 37  ? 19.318  -37.740 40.166  1.00 65.49  ? 37  GLN F OE1 1 
ATOM   7360  N  NE2 . GLN E 2 37  ? 17.355  -36.736 40.569  1.00 67.50  ? 37  GLN F NE2 1 
ATOM   7361  N  N   . LYS E 2 38  ? 19.098  -37.743 45.722  1.00 66.98  ? 38  LYS F N   1 
ATOM   7362  C  CA  . LYS E 2 38  ? 18.553  -38.856 46.441  1.00 74.62  ? 38  LYS F CA  1 
ATOM   7363  C  C   . LYS E 2 38  ? 17.266  -39.258 45.756  1.00 83.78  ? 38  LYS F C   1 
ATOM   7364  O  O   . LYS E 2 38  ? 16.498  -38.404 45.330  1.00 99.78  ? 38  LYS F O   1 
ATOM   7365  C  CB  . LYS E 2 38  ? 18.331  -38.467 47.894  1.00 76.22  ? 38  LYS F CB  1 
ATOM   7366  C  CG  . LYS E 2 38  ? 19.632  -38.216 48.641  1.00 74.99  ? 38  LYS F CG  1 
ATOM   7367  C  CD  . LYS E 2 38  ? 19.380  -37.946 50.115  1.00 84.73  ? 38  LYS F CD  1 
ATOM   7368  C  CE  . LYS E 2 38  ? 20.671  -37.853 50.912  1.00 90.00  ? 38  LYS F CE  1 
ATOM   7369  N  NZ  . LYS E 2 38  ? 20.418  -37.992 52.376  1.00 96.32  ? 38  LYS F NZ  1 
ATOM   7370  N  N   . SER E 2 39  ? 17.040  -40.556 45.600  1.00 93.79  ? 39  SER F N   1 
ATOM   7371  C  CA  . SER E 2 39  ? 15.898  -40.997 44.817  1.00 99.49  ? 39  SER F CA  1 
ATOM   7372  C  C   . SER E 2 39  ? 14.661  -40.309 45.369  1.00 94.83  ? 39  SER F C   1 
ATOM   7373  O  O   . SER E 2 39  ? 14.475  -40.214 46.584  1.00 87.10  ? 39  SER F O   1 
ATOM   7374  C  CB  . SER E 2 39  ? 15.740  -42.519 44.830  1.00 102.99 ? 39  SER F CB  1 
ATOM   7375  O  OG  . SER E 2 39  ? 15.043  -42.949 45.979  1.00 126.39 ? 39  SER F OG  1 
ATOM   7376  N  N   . GLY E 2 40  ? 13.868  -39.755 44.462  1.00 95.57  ? 40  GLY F N   1 
ATOM   7377  C  CA  . GLY E 2 40  ? 12.580  -39.196 44.814  1.00 108.04 ? 40  GLY F CA  1 
ATOM   7378  C  C   . GLY E 2 40  ? 12.580  -37.705 44.635  1.00 107.72 ? 40  GLY F C   1 
ATOM   7379  O  O   . GLY E 2 40  ? 11.524  -37.079 44.549  1.00 143.58 ? 40  GLY F O   1 
ATOM   7380  N  N   . THR E 2 41  ? 13.771  -37.130 44.566  1.00 100.01 ? 41  THR F N   1 
ATOM   7381  C  CA  . THR E 2 41  ? 13.909  -35.688 44.619  1.00 96.71  ? 41  THR F CA  1 
ATOM   7382  C  C   . THR E 2 41  ? 14.919  -35.189 43.595  1.00 83.22  ? 41  THR F C   1 
ATOM   7383  O  O   . THR E 2 41  ? 15.716  -35.946 43.051  1.00 96.21  ? 41  THR F O   1 
ATOM   7384  C  CB  . THR E 2 41  ? 14.306  -35.232 46.039  1.00 96.61  ? 41  THR F CB  1 
ATOM   7385  O  OG1 . THR E 2 41  ? 15.469  -35.946 46.470  1.00 90.12  ? 41  THR F OG1 1 
ATOM   7386  C  CG2 . THR E 2 41  ? 13.175  -35.506 47.024  1.00 98.93  ? 41  THR F CG2 1 
ATOM   7387  N  N   . SER E 2 42  ? 14.855  -33.903 43.318  1.00 78.32  ? 42  SER F N   1 
ATOM   7388  C  CA  . SER E 2 42  ? 15.705  -33.302 42.316  1.00 75.36  ? 42  SER F CA  1 
ATOM   7389  C  C   . SER E 2 42  ? 17.154  -33.280 42.798  1.00 68.15  ? 42  SER F C   1 
ATOM   7390  O  O   . SER E 2 42  ? 17.427  -33.395 43.989  1.00 67.85  ? 42  SER F O   1 
ATOM   7391  C  CB  . SER E 2 42  ? 15.231  -31.869 42.035  1.00 81.62  ? 42  SER F CB  1 
ATOM   7392  O  OG  . SER E 2 42  ? 13.816  -31.731 42.150  1.00 79.25  ? 42  SER F OG  1 
ATOM   7393  N  N   . PRO E 2 43  ? 18.087  -33.099 41.869  1.00 64.23  ? 43  PRO F N   1 
ATOM   7394  C  CA  . PRO E 2 43  ? 19.478  -32.906 42.243  1.00 64.20  ? 43  PRO F CA  1 
ATOM   7395  C  C   . PRO E 2 43  ? 19.686  -31.633 43.059  1.00 64.97  ? 43  PRO F C   1 
ATOM   7396  O  O   . PRO E 2 43  ? 18.928  -30.674 42.926  1.00 76.09  ? 43  PRO F O   1 
ATOM   7397  C  CB  . PRO E 2 43  ? 20.199  -32.800 40.891  1.00 64.72  ? 43  PRO F CB  1 
ATOM   7398  C  CG  . PRO E 2 43  ? 19.281  -33.423 39.897  1.00 67.09  ? 43  PRO F CG  1 
ATOM   7399  C  CD  . PRO E 2 43  ? 17.897  -33.149 40.410  1.00 69.12  ? 43  PRO F CD  1 
ATOM   7400  N  N   . LYS E 2 44  ? 20.733  -31.623 43.872  1.00 63.22  ? 44  LYS F N   1 
ATOM   7401  C  CA  . LYS E 2 44  ? 21.135  -30.438 44.623  1.00 64.67  ? 44  LYS F CA  1 
ATOM   7402  C  C   . LYS E 2 44  ? 22.553  -30.076 44.243  1.00 61.57  ? 44  LYS F C   1 
ATOM   7403  O  O   . LYS E 2 44  ? 23.440  -30.913 44.245  1.00 64.84  ? 44  LYS F O   1 
ATOM   7404  C  CB  . LYS E 2 44  ? 21.124  -30.713 46.120  1.00 68.21  ? 44  LYS F CB  1 
ATOM   7405  C  CG  . LYS E 2 44  ? 19.755  -30.984 46.697  1.00 81.02  ? 44  LYS F CG  1 
ATOM   7406  C  CD  . LYS E 2 44  ? 19.804  -31.019 48.215  1.00 92.86  ? 44  LYS F CD  1 
ATOM   7407  C  CE  . LYS E 2 44  ? 18.410  -30.921 48.813  1.00 110.45 ? 44  LYS F CE  1 
ATOM   7408  N  NZ  . LYS E 2 44  ? 17.702  -32.231 48.765  1.00 123.62 ? 44  LYS F NZ  1 
ATOM   7409  N  N   . ARG E 2 45  ? 22.792  -28.816 43.948  1.00 65.21  ? 45  ARG F N   1 
ATOM   7410  C  CA  . ARG E 2 45  ? 24.152  -28.387 43.772  1.00 61.00  ? 45  ARG F CA  1 
ATOM   7411  C  C   . ARG E 2 45  ? 24.868  -28.751 45.043  1.00 63.69  ? 45  ARG F C   1 
ATOM   7412  O  O   . ARG E 2 45  ? 24.439  -28.378 46.125  1.00 64.50  ? 45  ARG F O   1 
ATOM   7413  C  CB  . ARG E 2 45  ? 24.241  -26.891 43.549  1.00 63.20  ? 45  ARG F CB  1 
ATOM   7414  C  CG  . ARG E 2 45  ? 25.658  -26.454 43.269  1.00 66.10  ? 45  ARG F CG  1 
ATOM   7415  C  CD  . ARG E 2 45  ? 25.733  -24.968 43.024  1.00 75.61  ? 45  ARG F CD  1 
ATOM   7416  N  NE  . ARG E 2 45  ? 25.262  -24.238 44.190  1.00 76.26  ? 45  ARG F NE  1 
ATOM   7417  C  CZ  . ARG E 2 45  ? 25.532  -22.967 44.412  1.00 74.27  ? 45  ARG F CZ  1 
ATOM   7418  N  NH1 . ARG E 2 45  ? 26.274  -22.286 43.553  1.00 76.89  ? 45  ARG F NH1 1 
ATOM   7419  N  NH2 . ARG E 2 45  ? 25.070  -22.386 45.503  1.00 87.50  ? 45  ARG F NH2 1 
ATOM   7420  N  N   . TRP E 2 46  ? 25.963  -29.486 44.913  1.00 67.91  ? 46  TRP F N   1 
ATOM   7421  C  CA  . TRP E 2 46  ? 26.685  -29.949 46.078  1.00 63.79  ? 46  TRP F CA  1 
ATOM   7422  C  C   . TRP E 2 46  ? 28.034  -29.269 46.142  1.00 66.75  ? 46  TRP F C   1 
ATOM   7423  O  O   . TRP E 2 46  ? 28.340  -28.583 47.113  1.00 66.47  ? 46  TRP F O   1 
ATOM   7424  C  CB  . TRP E 2 46  ? 26.849  -31.464 46.022  1.00 64.50  ? 46  TRP F CB  1 
ATOM   7425  C  CG  . TRP E 2 46  ? 26.869  -32.065 47.384  1.00 66.47  ? 46  TRP F CG  1 
ATOM   7426  C  CD1 . TRP E 2 46  ? 27.906  -32.714 47.983  1.00 68.06  ? 46  TRP F CD1 1 
ATOM   7427  C  CD2 . TRP E 2 46  ? 25.821  -32.014 48.346  1.00 67.72  ? 46  TRP F CD2 1 
ATOM   7428  N  NE1 . TRP E 2 46  ? 27.556  -33.095 49.252  1.00 69.32  ? 46  TRP F NE1 1 
ATOM   7429  C  CE2 . TRP E 2 46  ? 26.279  -32.669 49.502  1.00 69.76  ? 46  TRP F CE2 1 
ATOM   7430  C  CE3 . TRP E 2 46  ? 24.530  -31.492 48.336  1.00 69.74  ? 46  TRP F CE3 1 
ATOM   7431  C  CZ2 . TRP E 2 46  ? 25.493  -32.811 50.639  1.00 72.05  ? 46  TRP F CZ2 1 
ATOM   7432  C  CZ3 . TRP E 2 46  ? 23.751  -31.640 49.459  1.00 73.43  ? 46  TRP F CZ3 1 
ATOM   7433  C  CH2 . TRP E 2 46  ? 24.234  -32.293 50.598  1.00 74.06  ? 46  TRP F CH2 1 
ATOM   7434  N  N   . ILE E 2 47  ? 28.845  -29.463 45.107  1.00 68.39  ? 47  ILE F N   1 
ATOM   7435  C  CA  . ILE E 2 47  ? 30.086  -28.721 44.974  1.00 72.34  ? 47  ILE F CA  1 
ATOM   7436  C  C   . ILE E 2 47  ? 30.139  -28.049 43.610  1.00 71.37  ? 47  ILE F C   1 
ATOM   7437  O  O   . ILE E 2 47  ? 29.802  -28.668 42.591  1.00 76.10  ? 47  ILE F O   1 
ATOM   7438  C  CB  . ILE E 2 47  ? 31.309  -29.638 45.120  1.00 81.98  ? 47  ILE F CB  1 
ATOM   7439  C  CG1 . ILE E 2 47  ? 31.460  -30.076 46.570  1.00 80.34  ? 47  ILE F CG1 1 
ATOM   7440  C  CG2 . ILE E 2 47  ? 32.573  -28.921 44.659  1.00 91.92  ? 47  ILE F CG2 1 
ATOM   7441  C  CD1 . ILE E 2 47  ? 32.533  -31.124 46.761  1.00 88.28  ? 47  ILE F CD1 1 
ATOM   7442  N  N   . TYR E 2 48  ? 30.592  -26.798 43.582  1.00 61.37  ? 48  TYR F N   1 
ATOM   7443  C  CA  . TYR E 2 48  ? 30.693  -26.075 42.325  1.00 56.93  ? 48  TYR F CA  1 
ATOM   7444  C  C   . TYR E 2 48  ? 32.019  -25.350 42.234  1.00 54.70  ? 48  TYR F C   1 
ATOM   7445  O  O   . TYR E 2 48  ? 32.711  -25.181 43.234  1.00 53.31  ? 48  TYR F O   1 
ATOM   7446  C  CB  . TYR E 2 48  ? 29.546  -25.082 42.188  1.00 58.49  ? 48  TYR F CB  1 
ATOM   7447  C  CG  . TYR E 2 48  ? 29.603  -23.968 43.208  1.00 62.01  ? 48  TYR F CG  1 
ATOM   7448  C  CD1 . TYR E 2 48  ? 29.177  -24.171 44.513  1.00 66.01  ? 48  TYR F CD1 1 
ATOM   7449  C  CD2 . TYR E 2 48  ? 30.093  -22.716 42.872  1.00 63.21  ? 48  TYR F CD2 1 
ATOM   7450  C  CE1 . TYR E 2 48  ? 29.220  -23.153 45.451  1.00 67.86  ? 48  TYR F CE1 1 
ATOM   7451  C  CE2 . TYR E 2 48  ? 30.154  -21.696 43.805  1.00 67.56  ? 48  TYR F CE2 1 
ATOM   7452  C  CZ  . TYR E 2 48  ? 29.714  -21.917 45.093  1.00 69.64  ? 48  TYR F CZ  1 
ATOM   7453  O  OH  . TYR E 2 48  ? 29.770  -20.902 46.023  1.00 68.05  ? 48  TYR F OH  1 
ATOM   7454  N  N   . ASP E 2 49  ? 32.348  -24.903 41.027  1.00 53.96  ? 49  ASP F N   1 
ATOM   7455  C  CA  . ASP E 2 49  ? 33.702  -24.490 40.685  1.00 61.09  ? 49  ASP F CA  1 
ATOM   7456  C  C   . ASP E 2 49  ? 34.759  -25.400 41.339  1.00 64.99  ? 49  ASP F C   1 
ATOM   7457  O  O   . ASP E 2 49  ? 35.617  -24.938 42.083  1.00 64.05  ? 49  ASP F O   1 
ATOM   7458  C  CB  . ASP E 2 49  ? 33.911  -23.017 41.039  1.00 66.43  ? 49  ASP F CB  1 
ATOM   7459  C  CG  . ASP E 2 49  ? 33.445  -22.058 39.915  1.00 71.48  ? 49  ASP F CG  1 
ATOM   7460  O  OD1 . ASP E 2 49  ? 32.796  -22.527 38.957  1.00 70.85  ? 49  ASP F OD1 1 
ATOM   7461  O  OD2 . ASP E 2 49  ? 33.748  -20.839 39.974  1.00 72.37  ? 49  ASP F OD2 1 
ATOM   7462  N  N   . THR E 2 50  ? 34.647  -26.704 41.068  1.00 65.89  ? 50  THR F N   1 
ATOM   7463  C  CA  . THR E 2 50  ? 35.659  -27.692 41.417  1.00 65.08  ? 50  THR F CA  1 
ATOM   7464  C  C   . THR E 2 50  ? 35.749  -28.027 42.907  1.00 74.64  ? 50  THR F C   1 
ATOM   7465  O  O   . THR E 2 50  ? 35.751  -29.211 43.292  1.00 76.25  ? 50  THR F O   1 
ATOM   7466  C  CB  . THR E 2 50  ? 37.028  -27.239 40.923  1.00 63.15  ? 50  THR F CB  1 
ATOM   7467  O  OG1 . THR E 2 50  ? 36.986  -27.143 39.495  1.00 64.07  ? 50  THR F OG1 1 
ATOM   7468  C  CG2 . THR E 2 50  ? 38.087  -28.222 41.334  1.00 63.70  ? 50  THR F CG2 1 
ATOM   7469  N  N   . SER E 2 51  ? 35.854  -27.000 43.744  1.00 72.39  ? 51  SER F N   1 
ATOM   7470  C  CA  . SER E 2 51  ? 36.126  -27.235 45.150  1.00 74.13  ? 51  SER F CA  1 
ATOM   7471  C  C   . SER E 2 51  ? 35.386  -26.330 46.112  1.00 72.51  ? 51  SER F C   1 
ATOM   7472  O  O   . SER E 2 51  ? 35.670  -26.362 47.308  1.00 70.58  ? 51  SER F O   1 
ATOM   7473  C  CB  . SER E 2 51  ? 37.614  -27.095 45.396  1.00 82.87  ? 51  SER F CB  1 
ATOM   7474  O  OG  . SER E 2 51  ? 38.040  -25.787 45.088  1.00 92.41  ? 51  SER F OG  1 
ATOM   7475  N  N   . LYS E 2 52  ? 34.425  -25.550 45.609  1.00 74.90  ? 52  LYS F N   1 
ATOM   7476  C  CA  . LYS E 2 52  ? 33.545  -24.752 46.472  1.00 73.23  ? 52  LYS F CA  1 
ATOM   7477  C  C   . LYS E 2 52  ? 32.336  -25.553 46.957  1.00 68.61  ? 52  LYS F C   1 
ATOM   7478  O  O   . LYS E 2 52  ? 31.643  -26.184 46.151  1.00 59.19  ? 52  LYS F O   1 
ATOM   7479  C  CB  . LYS E 2 52  ? 33.043  -23.512 45.735  1.00 75.24  ? 52  LYS F CB  1 
ATOM   7480  C  CG  . LYS E 2 52  ? 34.106  -22.467 45.479  1.00 87.15  ? 52  LYS F CG  1 
ATOM   7481  C  CD  . LYS E 2 52  ? 33.517  -21.219 44.846  1.00 97.74  ? 52  LYS F CD  1 
ATOM   7482  C  CE  . LYS E 2 52  ? 34.609  -20.211 44.527  1.00 108.93 ? 52  LYS F CE  1 
ATOM   7483  N  NZ  . LYS E 2 52  ? 34.095  -19.092 43.694  1.00 122.35 ? 52  LYS F NZ  1 
ATOM   7484  N  N   . LEU E 2 53  ? 32.055  -25.465 48.260  1.00 70.97  ? 53  LEU F N   1 
ATOM   7485  C  CA  . LEU E 2 53  ? 30.900  -26.147 48.860  1.00 77.43  ? 53  LEU F CA  1 
ATOM   7486  C  C   . LEU E 2 53  ? 29.611  -25.314 48.822  1.00 78.87  ? 53  LEU F C   1 
ATOM   7487  O  O   . LEU E 2 53  ? 29.603  -24.159 49.233  1.00 82.41  ? 53  LEU F O   1 
ATOM   7488  C  CB  . LEU E 2 53  ? 31.202  -26.516 50.313  1.00 81.41  ? 53  LEU F CB  1 
ATOM   7489  C  CG  . LEU E 2 53  ? 31.699  -27.947 50.521  1.00 83.74  ? 53  LEU F CG  1 
ATOM   7490  C  CD1 . LEU E 2 53  ? 32.960  -28.193 49.714  1.00 93.12  ? 53  LEU F CD1 1 
ATOM   7491  C  CD2 . LEU E 2 53  ? 31.950  -28.213 51.998  1.00 87.41  ? 53  LEU F CD2 1 
ATOM   7492  N  N   . ALA E 2 54  ? 28.515  -25.915 48.365  1.00 77.46  ? 54  ALA F N   1 
ATOM   7493  C  CA  . ALA E 2 54  ? 27.217  -25.256 48.422  1.00 72.78  ? 54  ALA F CA  1 
ATOM   7494  C  C   . ALA E 2 54  ? 26.784  -25.144 49.874  1.00 72.37  ? 54  ALA F C   1 
ATOM   7495  O  O   . ALA E 2 54  ? 27.344  -25.788 50.752  1.00 68.84  ? 54  ALA F O   1 
ATOM   7496  C  CB  . ALA E 2 54  ? 26.182  -26.025 47.618  1.00 71.79  ? 54  ALA F CB  1 
ATOM   7497  N  N   . SER E 2 55  ? 25.779  -24.321 50.118  1.00 78.06  ? 55  SER F N   1 
ATOM   7498  C  CA  . SER E 2 55  ? 25.458  -23.875 51.471  1.00 89.18  ? 55  SER F CA  1 
ATOM   7499  C  C   . SER E 2 55  ? 25.196  -25.026 52.453  1.00 84.98  ? 55  SER F C   1 
ATOM   7500  O  O   . SER E 2 55  ? 25.786  -25.087 53.539  1.00 83.45  ? 55  SER F O   1 
ATOM   7501  C  CB  . SER E 2 55  ? 24.248  -22.942 51.424  1.00 98.76  ? 55  SER F CB  1 
ATOM   7502  O  OG  . SER E 2 55  ? 23.989  -22.371 52.694  1.00 114.51 ? 55  SER F OG  1 
ATOM   7503  N  N   . GLY E 2 56  ? 24.310  -25.937 52.072  1.00 81.27  ? 56  GLY F N   1 
ATOM   7504  C  CA  . GLY E 2 56  ? 23.897  -27.006 52.980  1.00 89.84  ? 56  GLY F CA  1 
ATOM   7505  C  C   . GLY E 2 56  ? 24.993  -28.005 53.335  1.00 88.22  ? 56  GLY F C   1 
ATOM   7506  O  O   . GLY E 2 56  ? 24.918  -28.692 54.349  1.00 89.61  ? 56  GLY F O   1 
ATOM   7507  N  N   . VAL E 2 57  ? 26.037  -28.053 52.520  1.00 86.08  ? 57  VAL F N   1 
ATOM   7508  C  CA  . VAL E 2 57  ? 26.942  -29.186 52.492  1.00 83.18  ? 57  VAL F CA  1 
ATOM   7509  C  C   . VAL E 2 57  ? 27.882  -29.208 53.691  1.00 86.51  ? 57  VAL F C   1 
ATOM   7510  O  O   . VAL E 2 57  ? 28.543  -28.221 53.975  1.00 91.30  ? 57  VAL F O   1 
ATOM   7511  C  CB  . VAL E 2 57  ? 27.792  -29.147 51.215  1.00 83.55  ? 57  VAL F CB  1 
ATOM   7512  C  CG1 . VAL E 2 57  ? 28.708  -30.356 51.160  1.00 91.02  ? 57  VAL F CG1 1 
ATOM   7513  C  CG2 . VAL E 2 57  ? 26.905  -29.078 49.981  1.00 78.78  ? 57  VAL F CG2 1 
ATOM   7514  N  N   . PRO E 2 58  ? 27.979  -30.356 54.373  1.00 87.53  ? 58  PRO F N   1 
ATOM   7515  C  CA  . PRO E 2 58  ? 28.901  -30.462 55.489  1.00 90.46  ? 58  PRO F CA  1 
ATOM   7516  C  C   . PRO E 2 58  ? 30.346  -30.547 55.031  1.00 91.19  ? 58  PRO F C   1 
ATOM   7517  O  O   . PRO E 2 58  ? 30.618  -30.886 53.882  1.00 92.86  ? 58  PRO F O   1 
ATOM   7518  C  CB  . PRO E 2 58  ? 28.481  -31.762 56.165  1.00 91.16  ? 58  PRO F CB  1 
ATOM   7519  C  CG  . PRO E 2 58  ? 27.908  -32.581 55.067  1.00 90.03  ? 58  PRO F CG  1 
ATOM   7520  C  CD  . PRO E 2 58  ? 27.246  -31.610 54.134  1.00 86.53  ? 58  PRO F CD  1 
ATOM   7521  N  N   . ALA E 2 59  ? 31.262  -30.299 55.957  1.00 98.09  ? 59  ALA F N   1 
ATOM   7522  C  CA  . ALA E 2 59  ? 32.671  -30.142 55.641  1.00 96.01  ? 59  ALA F CA  1 
ATOM   7523  C  C   . ALA E 2 59  ? 33.344  -31.431 55.185  1.00 94.56  ? 59  ALA F C   1 
ATOM   7524  O  O   . ALA E 2 59  ? 34.374  -31.390 54.524  1.00 103.38 ? 59  ALA F O   1 
ATOM   7525  C  CB  . ALA E 2 59  ? 33.403  -29.592 56.850  1.00 102.26 ? 59  ALA F CB  1 
ATOM   7526  N  N   . ARG E 2 60  ? 32.785  -32.578 55.538  1.00 90.48  ? 60  ARG F N   1 
ATOM   7527  C  CA  . ARG E 2 60  ? 33.411  -33.832 55.169  1.00 89.14  ? 60  ARG F CA  1 
ATOM   7528  C  C   . ARG E 2 60  ? 33.514  -33.996 53.651  1.00 81.61  ? 60  ARG F C   1 
ATOM   7529  O  O   . ARG E 2 60  ? 34.305  -34.804 53.160  1.00 92.72  ? 60  ARG F O   1 
ATOM   7530  C  CB  . ARG E 2 60  ? 32.669  -35.012 55.797  1.00 96.91  ? 60  ARG F CB  1 
ATOM   7531  C  CG  . ARG E 2 60  ? 31.296  -35.306 55.225  1.00 98.64  ? 60  ARG F CG  1 
ATOM   7532  C  CD  . ARG E 2 60  ? 30.707  -36.516 55.945  1.00 101.25 ? 60  ARG F CD  1 
ATOM   7533  N  NE  . ARG E 2 60  ? 29.259  -36.602 55.826  1.00 97.02  ? 60  ARG F NE  1 
ATOM   7534  C  CZ  . ARG E 2 60  ? 28.415  -35.923 56.587  1.00 99.12  ? 60  ARG F CZ  1 
ATOM   7535  N  NH1 . ARG E 2 60  ? 28.875  -35.098 57.513  1.00 100.71 ? 60  ARG F NH1 1 
ATOM   7536  N  NH2 . ARG E 2 60  ? 27.109  -36.057 56.420  1.00 109.12 ? 60  ARG F NH2 1 
ATOM   7537  N  N   . PHE E 2 61  ? 32.720  -33.237 52.908  1.00 71.95  ? 61  PHE F N   1 
ATOM   7538  C  CA  . PHE E 2 61  ? 32.824  -33.243 51.453  1.00 70.24  ? 61  PHE F CA  1 
ATOM   7539  C  C   . PHE E 2 61  ? 33.901  -32.277 50.996  1.00 72.71  ? 61  PHE F C   1 
ATOM   7540  O  O   . PHE E 2 61  ? 34.074  -31.225 51.590  1.00 79.76  ? 61  PHE F O   1 
ATOM   7541  C  CB  . PHE E 2 61  ? 31.497  -32.859 50.813  1.00 69.49  ? 61  PHE F CB  1 
ATOM   7542  C  CG  . PHE E 2 61  ? 30.449  -33.921 50.918  1.00 70.85  ? 61  PHE F CG  1 
ATOM   7543  C  CD1 . PHE E 2 61  ? 29.635  -33.998 52.037  1.00 73.47  ? 61  PHE F CD1 1 
ATOM   7544  C  CD2 . PHE E 2 61  ? 30.285  -34.849 49.907  1.00 72.03  ? 61  PHE F CD2 1 
ATOM   7545  C  CE1 . PHE E 2 61  ? 28.677  -34.984 52.144  1.00 76.54  ? 61  PHE F CE1 1 
ATOM   7546  C  CE2 . PHE E 2 61  ? 29.320  -35.835 50.003  1.00 75.33  ? 61  PHE F CE2 1 
ATOM   7547  C  CZ  . PHE E 2 61  ? 28.516  -35.904 51.124  1.00 75.92  ? 61  PHE F CZ  1 
ATOM   7548  N  N   . SER E 2 62  ? 34.636  -32.654 49.953  1.00 74.59  ? 62  SER F N   1 
ATOM   7549  C  CA  . SER E 2 62  ? 35.596  -31.766 49.310  1.00 72.64  ? 62  SER F CA  1 
ATOM   7550  C  C   . SER E 2 62  ? 35.694  -32.127 47.839  1.00 73.29  ? 62  SER F C   1 
ATOM   7551  O  O   . SER E 2 62  ? 35.299  -33.221 47.435  1.00 78.85  ? 62  SER F O   1 
ATOM   7552  C  CB  . SER E 2 62  ? 36.966  -31.927 49.935  1.00 77.30  ? 62  SER F CB  1 
ATOM   7553  O  OG  . SER E 2 62  ? 37.736  -32.840 49.174  1.00 79.11  ? 62  SER F OG  1 
ATOM   7554  N  N   . GLY E 2 63  ? 36.212  -31.200 47.038  1.00 76.00  ? 63  GLY F N   1 
ATOM   7555  C  CA  . GLY E 2 63  ? 36.359  -31.417 45.599  1.00 74.21  ? 63  GLY F CA  1 
ATOM   7556  C  C   . GLY E 2 63  ? 37.745  -31.008 45.175  1.00 75.40  ? 63  GLY F C   1 
ATOM   7557  O  O   . GLY E 2 63  ? 38.377  -30.212 45.846  1.00 78.71  ? 63  GLY F O   1 
ATOM   7558  N  N   . SER E 2 64  ? 38.242  -31.586 44.091  1.00 79.92  ? 64  SER F N   1 
ATOM   7559  C  CA  . SER E 2 64  ? 39.495  -31.133 43.516  1.00 84.40  ? 64  SER F CA  1 
ATOM   7560  C  C   . SER E 2 64  ? 39.638  -31.618 42.089  1.00 80.03  ? 64  SER F C   1 
ATOM   7561  O  O   . SER E 2 64  ? 38.792  -32.363 41.587  1.00 80.65  ? 64  SER F O   1 
ATOM   7562  C  CB  . SER E 2 64  ? 40.672  -31.632 44.338  1.00 88.63  ? 64  SER F CB  1 
ATOM   7563  O  OG  . SER E 2 64  ? 40.917  -32.981 44.025  1.00 101.99 ? 64  SER F OG  1 
ATOM   7564  N  N   . GLY E 2 65  ? 40.720  -31.198 41.442  1.00 80.17  ? 65  GLY F N   1 
ATOM   7565  C  CA  . GLY E 2 65  ? 41.013  -31.666 40.102  1.00 86.76  ? 65  GLY F CA  1 
ATOM   7566  C  C   . GLY E 2 65  ? 41.511  -30.550 39.228  1.00 81.73  ? 65  GLY F C   1 
ATOM   7567  O  O   . GLY E 2 65  ? 41.687  -29.429 39.693  1.00 87.37  ? 65  GLY F O   1 
ATOM   7568  N  N   . SER E 2 66  ? 41.715  -30.860 37.954  1.00 78.95  ? 66  SER F N   1 
ATOM   7569  C  CA  . SER E 2 66  ? 42.115  -29.862 36.994  1.00 80.56  ? 66  SER F CA  1 
ATOM   7570  C  C   . SER E 2 66  ? 42.213  -30.488 35.623  1.00 77.51  ? 66  SER F C   1 
ATOM   7571  O  O   . SER E 2 66  ? 42.360  -31.685 35.502  1.00 78.72  ? 66  SER F O   1 
ATOM   7572  C  CB  . SER E 2 66  ? 43.466  -29.303 37.388  1.00 86.69  ? 66  SER F CB  1 
ATOM   7573  O  OG  . SER E 2 66  ? 44.416  -30.341 37.357  1.00 104.71 ? 66  SER F OG  1 
ATOM   7574  N  N   . GLY E 2 67  ? 42.177  -29.656 34.592  1.00 86.65  ? 67  GLY F N   1 
ATOM   7575  C  CA  . GLY E 2 67  ? 42.316  -30.119 33.219  1.00 88.85  ? 67  GLY F CA  1 
ATOM   7576  C  C   . GLY E 2 67  ? 41.276  -31.155 32.863  1.00 83.96  ? 67  GLY F C   1 
ATOM   7577  O  O   . GLY E 2 67  ? 40.123  -30.829 32.608  1.00 90.65  ? 67  GLY F O   1 
ATOM   7578  N  N   . THR E 2 68  ? 41.679  -32.416 32.895  1.00 88.28  ? 68  THR F N   1 
ATOM   7579  C  CA  . THR E 2 68  ? 40.848  -33.477 32.376  1.00 87.54  ? 68  THR F CA  1 
ATOM   7580  C  C   . THR E 2 68  ? 40.402  -34.494 33.440  1.00 79.18  ? 68  THR F C   1 
ATOM   7581  O  O   . THR E 2 68  ? 39.650  -35.405 33.145  1.00 77.47  ? 68  THR F O   1 
ATOM   7582  C  CB  . THR E 2 68  ? 41.560  -34.183 31.221  1.00 92.27  ? 68  THR F CB  1 
ATOM   7583  O  OG1 . THR E 2 68  ? 40.578  -34.804 30.390  1.00 106.90 ? 68  THR F OG1 1 
ATOM   7584  C  CG2 . THR E 2 68  ? 42.573  -35.202 31.733  1.00 92.67  ? 68  THR F CG2 1 
ATOM   7585  N  N   . SER E 2 69  ? 40.786  -34.266 34.691  1.00 77.85  ? 69  SER F N   1 
ATOM   7586  C  CA  . SER E 2 69  ? 40.539  -35.219 35.765  1.00 77.46  ? 69  SER F CA  1 
ATOM   7587  C  C   . SER E 2 69  ? 40.132  -34.575 37.093  1.00 71.92  ? 69  SER F C   1 
ATOM   7588  O  O   . SER E 2 69  ? 40.902  -33.877 37.734  1.00 70.67  ? 69  SER F O   1 
ATOM   7589  C  CB  . SER E 2 69  ? 41.785  -36.053 35.998  1.00 93.94  ? 69  SER F CB  1 
ATOM   7590  O  OG  . SER E 2 69  ? 41.710  -36.694 37.257  1.00 123.89 ? 69  SER F OG  1 
ATOM   7591  N  N   . TYR E 2 70  ? 38.921  -34.860 37.535  1.00 76.72  ? 70  TYR F N   1 
ATOM   7592  C  CA  . TYR E 2 70  ? 38.382  -34.220 38.723  1.00 72.95  ? 70  TYR F CA  1 
ATOM   7593  C  C   . TYR E 2 70  ? 37.806  -35.252 39.670  1.00 74.06  ? 70  TYR F C   1 
ATOM   7594  O  O   . TYR E 2 70  ? 37.478  -36.373 39.263  1.00 70.69  ? 70  TYR F O   1 
ATOM   7595  C  CB  . TYR E 2 70  ? 37.300  -33.240 38.326  1.00 71.28  ? 70  TYR F CB  1 
ATOM   7596  C  CG  . TYR E 2 70  ? 37.834  -32.038 37.611  1.00 77.43  ? 70  TYR F CG  1 
ATOM   7597  C  CD1 . TYR E 2 70  ? 38.059  -32.063 36.240  1.00 85.72  ? 70  TYR F CD1 1 
ATOM   7598  C  CD2 . TYR E 2 70  ? 38.146  -30.883 38.309  1.00 74.61  ? 70  TYR F CD2 1 
ATOM   7599  C  CE1 . TYR E 2 70  ? 38.555  -30.955 35.578  1.00 87.85  ? 70  TYR F CE1 1 
ATOM   7600  C  CE2 . TYR E 2 70  ? 38.642  -29.776 37.660  1.00 79.76  ? 70  TYR F CE2 1 
ATOM   7601  C  CZ  . TYR E 2 70  ? 38.841  -29.815 36.295  1.00 84.30  ? 70  TYR F CZ  1 
ATOM   7602  O  OH  . TYR E 2 70  ? 39.327  -28.706 35.645  1.00 86.85  ? 70  TYR F OH  1 
ATOM   7603  N  N   . SER E 2 71  ? 37.685  -34.876 40.939  1.00 71.28  ? 71  SER F N   1 
ATOM   7604  C  CA  . SER E 2 71  ? 37.275  -35.830 41.945  1.00 72.56  ? 71  SER F CA  1 
ATOM   7605  C  C   . SER E 2 71  ? 36.434  -35.194 43.039  1.00 68.30  ? 71  SER F C   1 
ATOM   7606  O  O   . SER E 2 71  ? 36.592  -34.028 43.353  1.00 66.22  ? 71  SER F O   1 
ATOM   7607  C  CB  . SER E 2 71  ? 38.498  -36.471 42.570  1.00 78.48  ? 71  SER F CB  1 
ATOM   7608  O  OG  . SER E 2 71  ? 38.939  -35.663 43.638  1.00 89.90  ? 71  SER F OG  1 
ATOM   7609  N  N   . LEU E 2 72  ? 35.525  -35.986 43.593  1.00 73.61  ? 72  LEU F N   1 
ATOM   7610  C  CA  . LEU E 2 72  ? 34.744  -35.611 44.759  1.00 72.32  ? 72  LEU F CA  1 
ATOM   7611  C  C   . LEU E 2 72  ? 35.037  -36.596 45.884  1.00 70.26  ? 72  LEU F C   1 
ATOM   7612  O  O   . LEU E 2 72  ? 35.074  -37.801 45.663  1.00 77.95  ? 72  LEU F O   1 
ATOM   7613  C  CB  . LEU E 2 72  ? 33.263  -35.663 44.424  1.00 73.12  ? 72  LEU F CB  1 
ATOM   7614  C  CG  . LEU E 2 72  ? 32.338  -34.980 45.428  1.00 78.13  ? 72  LEU F CG  1 
ATOM   7615  C  CD1 . LEU E 2 72  ? 30.920  -35.124 44.926  1.00 83.27  ? 72  LEU F CD1 1 
ATOM   7616  C  CD2 . LEU E 2 72  ? 32.452  -35.561 46.831  1.00 79.81  ? 72  LEU F CD2 1 
ATOM   7617  N  N   . THR E 2 73  ? 35.265  -36.082 47.085  1.00 68.84  ? 73  THR F N   1 
ATOM   7618  C  CA  . THR E 2 73  ? 35.750  -36.901 48.184  1.00 68.79  ? 73  THR F CA  1 
ATOM   7619  C  C   . THR E 2 73  ? 34.936  -36.688 49.433  1.00 68.70  ? 73  THR F C   1 
ATOM   7620  O  O   . THR E 2 73  ? 34.548  -35.573 49.744  1.00 66.89  ? 73  THR F O   1 
ATOM   7621  C  CB  . THR E 2 73  ? 37.205  -36.556 48.525  1.00 74.56  ? 73  THR F CB  1 
ATOM   7622  O  OG1 . THR E 2 73  ? 38.028  -36.789 47.377  1.00 85.88  ? 73  THR F OG1 1 
ATOM   7623  C  CG2 . THR E 2 73  ? 37.714  -37.385 49.711  1.00 75.22  ? 73  THR F CG2 1 
ATOM   7624  N  N   . ILE E 2 74  ? 34.687  -37.773 50.156  1.00 73.48  ? 74  ILE F N   1 
ATOM   7625  C  CA  . ILE E 2 74  ? 34.089  -37.699 51.487  1.00 70.48  ? 74  ILE F CA  1 
ATOM   7626  C  C   . ILE E 2 74  ? 35.093  -38.190 52.502  1.00 72.23  ? 74  ILE F C   1 
ATOM   7627  O  O   . ILE E 2 74  ? 35.558  -39.315 52.410  1.00 72.26  ? 74  ILE F O   1 
ATOM   7628  C  CB  . ILE E 2 74  ? 32.848  -38.586 51.591  1.00 67.22  ? 74  ILE F CB  1 
ATOM   7629  C  CG1 . ILE E 2 74  ? 31.930  -38.342 50.391  1.00 60.86  ? 74  ILE F CG1 1 
ATOM   7630  C  CG2 . ILE E 2 74  ? 32.143  -38.323 52.912  1.00 69.11  ? 74  ILE F CG2 1 
ATOM   7631  C  CD1 . ILE E 2 74  ? 30.572  -38.984 50.539  1.00 61.29  ? 74  ILE F CD1 1 
ATOM   7632  N  N   . SER E 2 75  ? 35.463  -37.331 53.436  1.00 76.09  ? 75  SER F N   1 
ATOM   7633  C  CA  . SER E 2 75  ? 36.536  -37.651 54.353  1.00 84.79  ? 75  SER F CA  1 
ATOM   7634  C  C   . SER E 2 75  ? 36.145  -38.843 55.182  1.00 88.04  ? 75  SER F C   1 
ATOM   7635  O  O   . SER E 2 75  ? 36.947  -39.756 55.393  1.00 98.69  ? 75  SER F O   1 
ATOM   7636  C  CB  . SER E 2 75  ? 36.868  -36.464 55.263  1.00 90.54  ? 75  SER F CB  1 
ATOM   7637  O  OG  . SER E 2 75  ? 35.767  -36.089 56.063  1.00 88.16  ? 75  SER F OG  1 
ATOM   7638  N  N   . SER E 2 76  ? 34.895  -38.845 55.625  1.00 90.17  ? 76  SER F N   1 
ATOM   7639  C  CA  . SER E 2 76  ? 34.373  -39.936 56.440  1.00 98.94  ? 76  SER F CA  1 
ATOM   7640  C  C   . SER E 2 76  ? 32.899  -40.202 56.134  1.00 97.00  ? 76  SER F C   1 
ATOM   7641  O  O   . SER E 2 76  ? 32.035  -39.416 56.506  1.00 97.35  ? 76  SER F O   1 
ATOM   7642  C  CB  . SER E 2 76  ? 34.550  -39.608 57.924  1.00 100.86 ? 76  SER F CB  1 
ATOM   7643  O  OG  . SER E 2 76  ? 33.939  -40.594 58.728  1.00 105.38 ? 76  SER F OG  1 
ATOM   7644  N  N   . MET E 2 77  ? 32.623  -41.321 55.468  1.00 95.67  ? 77  MET F N   1 
ATOM   7645  C  CA  . MET E 2 77  ? 31.268  -41.672 55.061  1.00 93.28  ? 77  MET F CA  1 
ATOM   7646  C  C   . MET E 2 77  ? 30.291  -41.581 56.214  1.00 96.66  ? 77  MET F C   1 
ATOM   7647  O  O   . MET E 2 77  ? 30.605  -41.956 57.344  1.00 94.41  ? 77  MET F O   1 
ATOM   7648  C  CB  . MET E 2 77  ? 31.226  -43.101 54.532  1.00 94.95  ? 77  MET F CB  1 
ATOM   7649  C  CG  . MET E 2 77  ? 29.843  -43.534 54.073  1.00 92.22  ? 77  MET F CG  1 
ATOM   7650  S  SD  . MET E 2 77  ? 29.460  -42.806 52.472  1.00 87.81  ? 77  MET F SD  1 
ATOM   7651  C  CE  . MET E 2 77  ? 27.895  -43.584 52.110  1.00 98.97  ? 77  MET F CE  1 
ATOM   7652  N  N   . GLU E 2 78  ? 29.098  -41.084 55.912  1.00 100.30 ? 78  GLU F N   1 
ATOM   7653  C  CA  . GLU E 2 78  ? 27.987  -41.152 56.843  1.00 106.72 ? 78  GLU F CA  1 
ATOM   7654  C  C   . GLU E 2 78  ? 26.774  -41.723 56.142  1.00 104.41 ? 78  GLU F C   1 
ATOM   7655  O  O   . GLU E 2 78  ? 26.780  -41.900 54.925  1.00 110.11 ? 78  GLU F O   1 
ATOM   7656  C  CB  . GLU E 2 78  ? 27.663  -39.769 57.392  1.00 110.25 ? 78  GLU F CB  1 
ATOM   7657  C  CG  . GLU E 2 78  ? 28.756  -39.219 58.284  1.00 118.06 ? 78  GLU F CG  1 
ATOM   7658  C  CD  . GLU E 2 78  ? 28.216  -38.660 59.575  1.00 131.42 ? 78  GLU F CD  1 
ATOM   7659  O  OE1 . GLU E 2 78  ? 27.243  -37.877 59.521  1.00 147.89 ? 78  GLU F OE1 1 
ATOM   7660  O  OE2 . GLU E 2 78  ? 28.756  -39.020 60.644  1.00 138.70 ? 78  GLU F OE2 1 
ATOM   7661  N  N   . ALA E 2 79  ? 25.732  -42.002 56.917  1.00 101.50 ? 79  ALA F N   1 
ATOM   7662  C  CA  . ALA E 2 79  ? 24.540  -42.659 56.398  1.00 96.48  ? 79  ALA F CA  1 
ATOM   7663  C  C   . ALA E 2 79  ? 23.804  -41.789 55.388  1.00 95.56  ? 79  ALA F C   1 
ATOM   7664  O  O   . ALA E 2 79  ? 23.376  -42.260 54.338  1.00 93.65  ? 79  ALA F O   1 
ATOM   7665  C  CB  . ALA E 2 79  ? 23.613  -43.015 57.544  1.00 99.06  ? 79  ALA F CB  1 
ATOM   7666  N  N   . GLU E 2 80  ? 23.649  -40.516 55.727  1.00 98.01  ? 80  GLU F N   1 
ATOM   7667  C  CA  . GLU E 2 80  ? 22.904  -39.582 54.904  1.00 91.47  ? 80  GLU F CA  1 
ATOM   7668  C  C   . GLU E 2 80  ? 23.672  -39.221 53.646  1.00 90.31  ? 80  GLU F C   1 
ATOM   7669  O  O   . GLU E 2 80  ? 23.203  -38.416 52.843  1.00 105.08 ? 80  GLU F O   1 
ATOM   7670  C  CB  . GLU E 2 80  ? 22.620  -38.317 55.704  1.00 95.16  ? 80  GLU F CB  1 
ATOM   7671  C  CG  . GLU E 2 80  ? 23.871  -37.537 56.069  1.00 100.14 ? 80  GLU F CG  1 
ATOM   7672  C  CD  . GLU E 2 80  ? 23.712  -36.733 57.350  1.00 108.22 ? 80  GLU F CD  1 
ATOM   7673  O  OE1 . GLU E 2 80  ? 23.286  -37.316 58.365  1.00 114.35 ? 80  GLU F OE1 1 
ATOM   7674  O  OE2 . GLU E 2 80  ? 24.016  -35.518 57.345  1.00 111.65 ? 80  GLU F OE2 1 
ATOM   7675  N  N   . ASP E 2 81  ? 24.859  -39.795 53.477  1.00 84.82  ? 81  ASP F N   1 
ATOM   7676  C  CA  . ASP E 2 81  ? 25.673  -39.497 52.305  1.00 77.64  ? 81  ASP F CA  1 
ATOM   7677  C  C   . ASP E 2 81  ? 25.352  -40.410 51.145  1.00 75.26  ? 81  ASP F C   1 
ATOM   7678  O  O   . ASP E 2 81  ? 25.734  -40.143 50.003  1.00 65.75  ? 81  ASP F O   1 
ATOM   7679  C  CB  . ASP E 2 81  ? 27.140  -39.608 52.650  1.00 79.47  ? 81  ASP F CB  1 
ATOM   7680  C  CG  . ASP E 2 81  ? 27.579  -38.528 53.595  1.00 83.28  ? 81  ASP F CG  1 
ATOM   7681  O  OD1 . ASP E 2 81  ? 26.804  -37.573 53.788  1.00 85.98  ? 81  ASP F OD1 1 
ATOM   7682  O  OD2 . ASP E 2 81  ? 28.701  -38.610 54.122  1.00 87.79  ? 81  ASP F OD2 1 
ATOM   7683  N  N   . ALA E 2 82  ? 24.640  -41.488 51.440  1.00 79.36  ? 82  ALA F N   1 
ATOM   7684  C  CA  . ALA E 2 82  ? 24.184  -42.375 50.398  1.00 79.62  ? 82  ALA F CA  1 
ATOM   7685  C  C   . ALA E 2 82  ? 23.366  -41.569 49.401  1.00 74.61  ? 82  ALA F C   1 
ATOM   7686  O  O   . ALA E 2 82  ? 22.335  -40.982 49.748  1.00 72.45  ? 82  ALA F O   1 
ATOM   7687  C  CB  . ALA E 2 82  ? 23.354  -43.502 50.989  1.00 88.32  ? 82  ALA F CB  1 
ATOM   7688  N  N   . ALA E 2 83  ? 23.826  -41.557 48.158  1.00 66.57  ? 83  ALA F N   1 
ATOM   7689  C  CA  . ALA E 2 83  ? 23.131  -40.842 47.119  1.00 67.06  ? 83  ALA F CA  1 
ATOM   7690  C  C   . ALA E 2 83  ? 23.792  -41.127 45.792  1.00 64.65  ? 83  ALA F C   1 
ATOM   7691  O  O   . ALA E 2 83  ? 24.766  -41.865 45.734  1.00 78.27  ? 83  ALA F O   1 
ATOM   7692  C  CB  . ALA E 2 83  ? 23.159  -39.361 47.425  1.00 70.13  ? 83  ALA F CB  1 
ATOM   7693  N  N   . THR E 2 84  ? 23.254  -40.561 44.722  1.00 63.66  ? 84  THR F N   1 
ATOM   7694  C  CA  . THR E 2 84  ? 23.958  -40.532 43.453  1.00 64.52  ? 84  THR F CA  1 
ATOM   7695  C  C   . THR E 2 84  ? 24.583  -39.160 43.249  1.00 66.45  ? 84  THR F C   1 
ATOM   7696  O  O   . THR E 2 84  ? 23.900  -38.141 43.367  1.00 67.01  ? 84  THR F O   1 
ATOM   7697  C  CB  . THR E 2 84  ? 23.013  -40.805 42.283  1.00 66.86  ? 84  THR F CB  1 
ATOM   7698  O  OG1 . THR E 2 84  ? 22.418  -42.104 42.427  1.00 63.67  ? 84  THR F OG1 1 
ATOM   7699  C  CG2 . THR E 2 84  ? 23.781  -40.736 40.980  1.00 70.46  ? 84  THR F CG2 1 
ATOM   7700  N  N   . TYR E 2 85  ? 25.875  -39.139 42.926  1.00 66.49  ? 85  TYR F N   1 
ATOM   7701  C  CA  . TYR E 2 85  ? 26.582  -37.886 42.653  1.00 65.98  ? 85  TYR F CA  1 
ATOM   7702  C  C   . TYR E 2 85  ? 26.909  -37.742 41.174  1.00 65.58  ? 85  TYR F C   1 
ATOM   7703  O  O   . TYR E 2 85  ? 27.401  -38.685 40.536  1.00 67.34  ? 85  TYR F O   1 
ATOM   7704  C  CB  . TYR E 2 85  ? 27.853  -37.823 43.480  1.00 65.61  ? 85  TYR F CB  1 
ATOM   7705  C  CG  . TYR E 2 85  ? 27.572  -37.860 44.958  1.00 67.40  ? 85  TYR F CG  1 
ATOM   7706  C  CD1 . TYR E 2 85  ? 27.190  -39.033 45.579  1.00 67.01  ? 85  TYR F CD1 1 
ATOM   7707  C  CD2 . TYR E 2 85  ? 27.654  -36.711 45.728  1.00 68.23  ? 85  TYR F CD2 1 
ATOM   7708  C  CE1 . TYR E 2 85  ? 26.922  -39.064 46.931  1.00 69.70  ? 85  TYR F CE1 1 
ATOM   7709  C  CE2 . TYR E 2 85  ? 27.380  -36.731 47.083  1.00 66.60  ? 85  TYR F CE2 1 
ATOM   7710  C  CZ  . TYR E 2 85  ? 27.015  -37.912 47.676  1.00 67.72  ? 85  TYR F CZ  1 
ATOM   7711  O  OH  . TYR E 2 85  ? 26.757  -37.945 49.022  1.00 65.33  ? 85  TYR F OH  1 
ATOM   7712  N  N   . TYR E 2 86  ? 26.601  -36.571 40.625  1.00 61.23  ? 86  TYR F N   1 
ATOM   7713  C  CA  . TYR E 2 86  ? 26.860  -36.304 39.213  1.00 66.64  ? 86  TYR F CA  1 
ATOM   7714  C  C   . TYR E 2 86  ? 27.875  -35.179 39.047  1.00 61.67  ? 86  TYR F C   1 
ATOM   7715  O  O   . TYR E 2 86  ? 27.803  -34.164 39.741  1.00 54.24  ? 86  TYR F O   1 
ATOM   7716  C  CB  . TYR E 2 86  ? 25.578  -35.880 38.505  1.00 66.85  ? 86  TYR F CB  1 
ATOM   7717  C  CG  . TYR E 2 86  ? 24.481  -36.913 38.453  1.00 60.20  ? 86  TYR F CG  1 
ATOM   7718  C  CD1 . TYR E 2 86  ? 24.330  -37.729 37.355  1.00 64.44  ? 86  TYR F CD1 1 
ATOM   7719  C  CD2 . TYR E 2 86  ? 23.573  -37.021 39.472  1.00 58.83  ? 86  TYR F CD2 1 
ATOM   7720  C  CE1 . TYR E 2 86  ? 23.309  -38.649 37.290  1.00 70.76  ? 86  TYR F CE1 1 
ATOM   7721  C  CE2 . TYR E 2 86  ? 22.552  -37.939 39.428  1.00 64.47  ? 86  TYR F CE2 1 
ATOM   7722  C  CZ  . TYR E 2 86  ? 22.412  -38.747 38.330  1.00 70.95  ? 86  TYR F CZ  1 
ATOM   7723  O  OH  . TYR E 2 86  ? 21.363  -39.653 38.277  1.00 84.21  ? 86  TYR F OH  1 
ATOM   7724  N  N   . CYS E 2 87  ? 28.797  -35.343 38.108  1.00 61.38  ? 87  CYS F N   1 
ATOM   7725  C  CA  . CYS E 2 87  ? 29.636  -34.238 37.734  1.00 65.62  ? 87  CYS F CA  1 
ATOM   7726  C  C   . CYS E 2 87  ? 29.056  -33.584 36.486  1.00 70.11  ? 87  CYS F C   1 
ATOM   7727  O  O   . CYS E 2 87  ? 28.294  -34.216 35.734  1.00 60.62  ? 87  CYS F O   1 
ATOM   7728  C  CB  . CYS E 2 87  ? 31.072  -34.692 37.512  1.00 66.42  ? 87  CYS F CB  1 
ATOM   7729  S  SG  . CYS E 2 87  ? 31.270  -35.927 36.225  1.00 75.60  ? 87  CYS F SG  1 
ATOM   7730  N  N   . GLN E 2 88  ? 29.376  -32.299 36.316  1.00 65.90  ? 88  GLN F N   1 
ATOM   7731  C  CA  . GLN E 2 88  ? 29.006  -31.560 35.124  1.00 62.58  ? 88  GLN F CA  1 
ATOM   7732  C  C   . GLN E 2 88  ? 29.951  -30.388 34.859  1.00 63.20  ? 88  GLN F C   1 
ATOM   7733  O  O   . GLN E 2 88  ? 30.579  -29.839 35.773  1.00 55.39  ? 88  GLN F O   1 
ATOM   7734  C  CB  . GLN E 2 88  ? 27.575  -31.049 35.234  1.00 68.70  ? 88  GLN F CB  1 
ATOM   7735  C  CG  . GLN E 2 88  ? 27.426  -29.742 36.011  1.00 76.22  ? 88  GLN F CG  1 
ATOM   7736  C  CD  . GLN E 2 88  ? 27.203  -28.503 35.152  1.00 74.38  ? 88  GLN F CD  1 
ATOM   7737  O  OE1 . GLN E 2 88  ? 26.900  -27.452 35.683  1.00 70.49  ? 88  GLN F OE1 1 
ATOM   7738  N  NE2 . GLN E 2 88  ? 27.356  -28.619 33.835  1.00 83.60  ? 88  GLN F NE2 1 
ATOM   7739  N  N   . GLN E 2 89  ? 29.992  -29.991 33.592  1.00 62.95  ? 89  GLN F N   1 
ATOM   7740  C  CA  . GLN E 2 89  ? 30.918  -29.001 33.096  1.00 61.44  ? 89  GLN F CA  1 
ATOM   7741  C  C   . GLN E 2 89  ? 30.182  -27.997 32.226  1.00 66.95  ? 89  GLN F C   1 
ATOM   7742  O  O   . GLN E 2 89  ? 29.202  -28.342 31.569  1.00 67.73  ? 89  GLN F O   1 
ATOM   7743  C  CB  . GLN E 2 89  ? 31.976  -29.700 32.260  1.00 68.24  ? 89  GLN F CB  1 
ATOM   7744  C  CG  . GLN E 2 89  ? 32.397  -28.960 30.996  1.00 75.43  ? 89  GLN F CG  1 
ATOM   7745  C  CD  . GLN E 2 89  ? 31.437  -29.126 29.827  1.00 78.47  ? 89  GLN F CD  1 
ATOM   7746  O  OE1 . GLN E 2 89  ? 30.706  -30.110 29.729  1.00 81.26  ? 89  GLN F OE1 1 
ATOM   7747  N  NE2 . GLN E 2 89  ? 31.479  -28.182 28.904  1.00 84.06  ? 89  GLN F NE2 1 
ATOM   7748  N  N   . TRP E 2 90  ? 30.659  -26.755 32.226  1.00 73.62  ? 90  TRP F N   1 
ATOM   7749  C  CA  . TRP E 2 90  ? 30.195  -25.742 31.283  1.00 70.07  ? 90  TRP F CA  1 
ATOM   7750  C  C   . TRP E 2 90  ? 31.353  -24.853 30.851  1.00 70.68  ? 90  TRP F C   1 
ATOM   7751  O  O   . TRP E 2 90  ? 31.204  -23.636 30.741  1.00 89.29  ? 90  TRP F O   1 
ATOM   7752  C  CB  . TRP E 2 90  ? 29.071  -24.884 31.887  1.00 70.46  ? 90  TRP F CB  1 
ATOM   7753  C  CG  . TRP E 2 90  ? 28.126  -24.327 30.836  1.00 69.10  ? 90  TRP F CG  1 
ATOM   7754  C  CD1 . TRP E 2 90  ? 28.395  -24.130 29.505  1.00 69.10  ? 90  TRP F CD1 1 
ATOM   7755  C  CD2 . TRP E 2 90  ? 26.767  -23.920 31.030  1.00 67.13  ? 90  TRP F CD2 1 
ATOM   7756  N  NE1 . TRP E 2 90  ? 27.286  -23.635 28.864  1.00 68.56  ? 90  TRP F NE1 1 
ATOM   7757  C  CE2 . TRP E 2 90  ? 26.274  -23.495 29.777  1.00 67.40  ? 90  TRP F CE2 1 
ATOM   7758  C  CE3 . TRP E 2 90  ? 25.918  -23.877 32.140  1.00 68.81  ? 90  TRP F CE3 1 
ATOM   7759  C  CZ2 . TRP E 2 90  ? 24.980  -23.028 29.609  1.00 67.54  ? 90  TRP F CZ2 1 
ATOM   7760  C  CZ3 . TRP E 2 90  ? 24.632  -23.410 31.971  1.00 65.27  ? 90  TRP F CZ3 1 
ATOM   7761  C  CH2 . TRP E 2 90  ? 24.174  -22.998 30.715  1.00 69.49  ? 90  TRP F CH2 1 
ATOM   7762  N  N   . SER E 2 91  ? 32.504  -25.466 30.603  1.00 68.97  ? 91  SER F N   1 
ATOM   7763  C  CA  . SER E 2 91  ? 33.615  -24.785 29.963  1.00 69.05  ? 91  SER F CA  1 
ATOM   7764  C  C   . SER E 2 91  ? 33.462  -24.777 28.438  1.00 71.16  ? 91  SER F C   1 
ATOM   7765  O  O   . SER E 2 91  ? 34.145  -24.037 27.730  1.00 95.25  ? 91  SER F O   1 
ATOM   7766  C  CB  . SER E 2 91  ? 34.938  -25.426 30.377  1.00 71.85  ? 91  SER F CB  1 
ATOM   7767  O  OG  . SER E 2 91  ? 35.168  -25.264 31.771  1.00 70.81  ? 91  SER F OG  1 
ATOM   7768  N  N   . ASN E 2 92  ? 32.525  -25.566 27.945  1.00 69.85  ? 92  ASN F N   1 
ATOM   7769  C  CA  . ASN E 2 92  ? 32.109  -25.504 26.554  1.00 77.62  ? 92  ASN F CA  1 
ATOM   7770  C  C   . ASN E 2 92  ? 30.614  -25.711 26.478  1.00 76.77  ? 92  ASN F C   1 
ATOM   7771  O  O   . ASN E 2 92  ? 30.077  -26.619 27.091  1.00 81.37  ? 92  ASN F O   1 
ATOM   7772  C  CB  . ASN E 2 92  ? 32.790  -26.601 25.746  1.00 86.62  ? 92  ASN F CB  1 
ATOM   7773  C  CG  . ASN E 2 92  ? 34.181  -26.214 25.303  1.00 101.95 ? 92  ASN F CG  1 
ATOM   7774  O  OD1 . ASN E 2 92  ? 35.173  -26.524 25.967  1.00 118.46 ? 92  ASN F OD1 1 
ATOM   7775  N  ND2 . ASN E 2 92  ? 34.261  -25.492 24.193  1.00 112.83 ? 92  ASN F ND2 1 
ATOM   7776  N  N   . SER E 2 93  ? 29.929  -24.883 25.718  1.00 80.75  ? 93  SER F N   1 
ATOM   7777  C  CA  . SER E 2 93  ? 28.546  -25.174 25.437  1.00 81.25  ? 93  SER F CA  1 
ATOM   7778  C  C   . SER E 2 93  ? 28.559  -26.305 24.418  1.00 78.75  ? 93  SER F C   1 
ATOM   7779  O  O   . SER E 2 93  ? 29.418  -26.335 23.543  1.00 89.73  ? 93  SER F O   1 
ATOM   7780  C  CB  . SER E 2 93  ? 27.811  -23.933 24.909  1.00 91.10  ? 93  SER F CB  1 
ATOM   7781  O  OG  . SER E 2 93  ? 27.589  -22.983 25.948  1.00 86.03  ? 93  SER F OG  1 
ATOM   7782  N  N   . PRO E 2 94  ? 27.641  -27.266 24.555  1.00 71.02  ? 94  PRO F N   1 
ATOM   7783  C  CA  . PRO E 2 94  ? 26.644  -27.304 25.607  1.00 68.67  ? 94  PRO F CA  1 
ATOM   7784  C  C   . PRO E 2 94  ? 27.178  -27.900 26.895  1.00 62.72  ? 94  PRO F C   1 
ATOM   7785  O  O   . PRO E 2 94  ? 28.082  -28.717 26.859  1.00 62.08  ? 94  PRO F O   1 
ATOM   7786  C  CB  . PRO E 2 94  ? 25.581  -28.221 25.027  1.00 70.64  ? 94  PRO F CB  1 
ATOM   7787  C  CG  . PRO E 2 94  ? 26.350  -29.158 24.176  1.00 70.02  ? 94  PRO F CG  1 
ATOM   7788  C  CD  . PRO E 2 94  ? 27.444  -28.342 23.575  1.00 70.14  ? 94  PRO F CD  1 
ATOM   7789  N  N   . PRO E 2 95  ? 26.587  -27.521 28.032  1.00 60.86  ? 95  PRO F N   1 
ATOM   7790  C  CA  . PRO E 2 95  ? 26.966  -28.156 29.272  1.00 60.04  ? 95  PRO F CA  1 
ATOM   7791  C  C   . PRO E 2 95  ? 26.643  -29.642 29.201  1.00 63.85  ? 95  PRO F C   1 
ATOM   7792  O  O   . PRO E 2 95  ? 25.750  -30.047 28.450  1.00 65.23  ? 95  PRO F O   1 
ATOM   7793  C  CB  . PRO E 2 95  ? 26.076  -27.458 30.302  1.00 58.80  ? 95  PRO F CB  1 
ATOM   7794  C  CG  . PRO E 2 95  ? 24.840  -27.132 29.540  1.00 62.53  ? 95  PRO F CG  1 
ATOM   7795  C  CD  . PRO E 2 95  ? 25.311  -26.792 28.153  1.00 65.06  ? 95  PRO F CD  1 
ATOM   7796  N  N   . THR E 2 96  ? 27.377  -30.446 29.966  1.00 67.23  ? 96  THR F N   1 
ATOM   7797  C  CA  . THR E 2 96  ? 27.163  -31.894 30.000  1.00 64.73  ? 96  THR F CA  1 
ATOM   7798  C  C   . THR E 2 96  ? 27.371  -32.488 31.388  1.00 59.25  ? 96  THR F C   1 
ATOM   7799  O  O   . THR E 2 96  ? 28.029  -31.901 32.254  1.00 52.05  ? 96  THR F O   1 
ATOM   7800  C  CB  . THR E 2 96  ? 28.100  -32.614 29.025  1.00 66.96  ? 96  THR F CB  1 
ATOM   7801  O  OG1 . THR E 2 96  ? 29.455  -32.237 29.297  1.00 71.86  ? 96  THR F OG1 1 
ATOM   7802  C  CG2 . THR E 2 96  ? 27.757  -32.247 27.594  1.00 72.58  ? 96  THR F CG2 1 
ATOM   7803  N  N   . PHE E 2 97  ? 26.803  -33.667 31.586  1.00 57.23  ? 97  PHE F N   1 
ATOM   7804  C  CA  . PHE E 2 97  ? 26.893  -34.340 32.866  1.00 59.39  ? 97  PHE F CA  1 
ATOM   7805  C  C   . PHE E 2 97  ? 27.635  -35.675 32.761  1.00 64.90  ? 97  PHE F C   1 
ATOM   7806  O  O   . PHE E 2 97  ? 27.615  -36.348 31.728  1.00 63.82  ? 97  PHE F O   1 
ATOM   7807  C  CB  . PHE E 2 97  ? 25.500  -34.635 33.376  1.00 59.39  ? 97  PHE F CB  1 
ATOM   7808  C  CG  . PHE E 2 97  ? 24.708  -33.427 33.755  1.00 60.82  ? 97  PHE F CG  1 
ATOM   7809  C  CD1 . PHE E 2 97  ? 24.744  -32.940 35.053  1.00 62.71  ? 97  PHE F CD1 1 
ATOM   7810  C  CD2 . PHE E 2 97  ? 23.841  -32.845 32.851  1.00 67.94  ? 97  PHE F CD2 1 
ATOM   7811  C  CE1 . PHE E 2 97  ? 23.954  -31.870 35.435  1.00 56.77  ? 97  PHE F CE1 1 
ATOM   7812  C  CE2 . PHE E 2 97  ? 23.046  -31.774 33.224  1.00 68.86  ? 97  PHE F CE2 1 
ATOM   7813  C  CZ  . PHE E 2 97  ? 23.108  -31.284 34.516  1.00 63.64  ? 97  PHE F CZ  1 
ATOM   7814  N  N   . GLY E 2 98  ? 28.251  -36.089 33.857  1.00 65.34  ? 98  GLY F N   1 
ATOM   7815  C  CA  . GLY E 2 98  ? 28.590  -37.488 33.999  1.00 68.59  ? 98  GLY F CA  1 
ATOM   7816  C  C   . GLY E 2 98  ? 27.311  -38.312 34.071  1.00 66.48  ? 98  GLY F C   1 
ATOM   7817  O  O   . GLY E 2 98  ? 26.235  -37.783 34.297  1.00 61.84  ? 98  GLY F O   1 
ATOM   7818  N  N   . ALA E 2 99  ? 27.430  -39.623 33.909  1.00 75.88  ? 99  ALA F N   1 
ATOM   7819  C  CA  . ALA E 2 99  ? 26.268  -40.494 34.015  1.00 68.72  ? 99  ALA F CA  1 
ATOM   7820  C  C   . ALA E 2 99  ? 25.954  -40.835 35.469  1.00 67.52  ? 99  ALA F C   1 
ATOM   7821  O  O   . ALA E 2 99  ? 25.007  -41.578 35.755  1.00 76.49  ? 99  ALA F O   1 
ATOM   7822  C  CB  . ALA E 2 99  ? 26.484  -41.748 33.206  1.00 72.10  ? 99  ALA F CB  1 
ATOM   7823  N  N   . GLY E 2 100 ? 26.715  -40.259 36.392  1.00 66.31  ? 100 GLY F N   1 
ATOM   7824  C  CA  . GLY E 2 100 ? 26.395  -40.360 37.811  1.00 70.41  ? 100 GLY F CA  1 
ATOM   7825  C  C   . GLY E 2 100 ? 27.075  -41.536 38.486  1.00 70.11  ? 100 GLY F C   1 
ATOM   7826  O  O   . GLY E 2 100 ? 27.379  -42.540 37.850  1.00 65.53  ? 100 GLY F O   1 
ATOM   7827  N  N   . ALA E 2 101 ? 27.312  -41.400 39.785  1.00 68.42  ? 101 ALA F N   1 
ATOM   7828  C  CA  . ALA E 2 101 ? 27.935  -42.449 40.570  1.00 64.86  ? 101 ALA F CA  1 
ATOM   7829  C  C   . ALA E 2 101 ? 27.093  -42.696 41.803  1.00 66.29  ? 101 ALA F C   1 
ATOM   7830  O  O   . ALA E 2 101 ? 26.941  -41.821 42.660  1.00 61.48  ? 101 ALA F O   1 
ATOM   7831  C  CB  . ALA E 2 101 ? 29.340  -42.051 40.969  1.00 62.51  ? 101 ALA F CB  1 
ATOM   7832  N  N   . LYS E 2 102 ? 26.536  -43.900 41.872  1.00 74.68  ? 102 LYS F N   1 
ATOM   7833  C  CA  . LYS E 2 102 ? 25.608  -44.277 42.928  1.00 74.87  ? 102 LYS F CA  1 
ATOM   7834  C  C   . LYS E 2 102 ? 26.395  -44.788 44.126  1.00 70.54  ? 102 LYS F C   1 
ATOM   7835  O  O   . LYS E 2 102 ? 27.276  -45.623 43.974  1.00 87.53  ? 102 LYS F O   1 
ATOM   7836  C  CB  . LYS E 2 102 ? 24.666  -45.352 42.401  1.00 77.59  ? 102 LYS F CB  1 
ATOM   7837  C  CG  . LYS E 2 102 ? 23.308  -45.409 43.076  1.00 95.77  ? 102 LYS F CG  1 
ATOM   7838  C  CD  . LYS E 2 102 ? 22.562  -46.649 42.586  1.00 125.51 ? 102 LYS F CD  1 
ATOM   7839  C  CE  . LYS E 2 102 ? 21.172  -46.800 43.183  1.00 127.72 ? 102 LYS F CE  1 
ATOM   7840  N  NZ  . LYS E 2 102 ? 20.174  -45.967 42.451  1.00 136.59 ? 102 LYS F NZ  1 
ATOM   7841  N  N   . LEU E 2 103 ? 26.131  -44.234 45.302  1.00 64.66  ? 103 LEU F N   1 
ATOM   7842  C  CA  . LEU E 2 103 ? 26.898  -44.571 46.490  1.00 67.49  ? 103 LEU F CA  1 
ATOM   7843  C  C   . LEU E 2 103 ? 25.980  -45.147 47.530  1.00 71.73  ? 103 LEU F C   1 
ATOM   7844  O  O   . LEU E 2 103 ? 25.187  -44.421 48.127  1.00 78.55  ? 103 LEU F O   1 
ATOM   7845  C  CB  . LEU E 2 103 ? 27.587  -43.336 47.069  1.00 70.47  ? 103 LEU F CB  1 
ATOM   7846  C  CG  . LEU E 2 103 ? 28.352  -43.510 48.392  1.00 73.18  ? 103 LEU F CG  1 
ATOM   7847  C  CD1 . LEU E 2 103 ? 29.591  -44.364 48.184  1.00 75.83  ? 103 LEU F CD1 1 
ATOM   7848  C  CD2 . LEU E 2 103 ? 28.747  -42.145 48.948  1.00 72.75  ? 103 LEU F CD2 1 
ATOM   7849  N  N   . GLU E 2 104 ? 26.083  -46.454 47.747  1.00 78.12  ? 104 GLU F N   1 
ATOM   7850  C  CA  . GLU E 2 104 ? 25.244  -47.137 48.729  1.00 83.47  ? 104 GLU F CA  1 
ATOM   7851  C  C   . GLU E 2 104 ? 26.020  -47.357 50.025  1.00 84.81  ? 104 GLU F C   1 
ATOM   7852  O  O   . GLU E 2 104 ? 27.248  -47.320 50.033  1.00 95.49  ? 104 GLU F O   1 
ATOM   7853  C  CB  . GLU E 2 104 ? 24.736  -48.469 48.177  1.00 90.15  ? 104 GLU F CB  1 
ATOM   7854  C  CG  . GLU E 2 104 ? 25.837  -49.418 47.718  1.00 110.97 ? 104 GLU F CG  1 
ATOM   7855  C  CD  . GLU E 2 104 ? 25.559  -50.888 48.056  1.00 129.71 ? 104 GLU F CD  1 
ATOM   7856  O  OE1 . GLU E 2 104 ? 24.970  -51.162 49.124  1.00 143.88 ? 104 GLU F OE1 1 
ATOM   7857  O  OE2 . GLU E 2 104 ? 25.952  -51.781 47.269  1.00 138.93 ? 104 GLU F OE2 1 
ATOM   7858  N  N   . LEU E 2 105 ? 25.305  -47.570 51.122  1.00 84.86  ? 105 LEU F N   1 
ATOM   7859  C  CA  . LEU E 2 105 ? 25.932  -47.910 52.406  1.00 91.74  ? 105 LEU F CA  1 
ATOM   7860  C  C   . LEU E 2 105 ? 26.327  -49.363 52.451  1.00 95.57  ? 105 LEU F C   1 
ATOM   7861  O  O   . LEU E 2 105 ? 25.517  -50.221 52.125  1.00 98.03  ? 105 LEU F O   1 
ATOM   7862  C  CB  . LEU E 2 105 ? 24.950  -47.716 53.545  1.00 98.12  ? 105 LEU F CB  1 
ATOM   7863  C  CG  . LEU E 2 105 ? 25.120  -46.465 54.383  1.00 99.24  ? 105 LEU F CG  1 
ATOM   7864  C  CD1 . LEU E 2 105 ? 23.800  -46.139 55.068  1.00 110.32 ? 105 LEU F CD1 1 
ATOM   7865  C  CD2 . LEU E 2 105 ? 26.233  -46.684 55.388  1.00 101.76 ? 105 LEU F CD2 1 
ATOM   7866  N  N   . LYS E 2 106 ? 27.527  -49.652 52.937  1.00 94.01  ? 106 LYS F N   1 
ATOM   7867  C  CA  . LYS E 2 106 ? 27.910  -51.034 53.176  1.00 96.78  ? 106 LYS F CA  1 
ATOM   7868  C  C   . LYS E 2 106 ? 27.403  -51.439 54.544  1.00 91.69  ? 106 LYS F C   1 
ATOM   7869  O  O   . LYS E 2 106 ? 27.244  -50.606 55.431  1.00 83.54  ? 106 LYS F O   1 
ATOM   7870  C  CB  . LYS E 2 106 ? 29.424  -51.227 53.098  1.00 104.72 ? 106 LYS F CB  1 
ATOM   7871  C  CG  . LYS E 2 106 ? 29.852  -52.609 52.628  1.00 108.92 ? 106 LYS F CG  1 
ATOM   7872  C  CD  . LYS E 2 106 ? 31.360  -52.808 52.751  1.00 127.80 ? 106 LYS F CD  1 
ATOM   7873  C  CE  . LYS E 2 106 ? 32.151  -51.779 51.945  1.00 136.77 ? 106 LYS F CE  1 
ATOM   7874  N  NZ  . LYS E 2 106 ? 33.625  -51.904 52.144  1.00 136.15 ? 106 LYS F NZ  1 
ATOM   7875  N  N   . ARG E 2 107 ? 27.133  -52.727 54.695  1.00 99.20  ? 107 ARG F N   1 
ATOM   7876  C  CA  . ARG E 2 107 ? 26.727  -53.285 55.978  1.00 103.68 ? 107 ARG F CA  1 
ATOM   7877  C  C   . ARG E 2 107 ? 26.994  -54.786 56.002  1.00 106.81 ? 107 ARG F C   1 
ATOM   7878  O  O   . ARG E 2 107 ? 27.329  -55.382 54.975  1.00 109.96 ? 107 ARG F O   1 
ATOM   7879  C  CB  . ARG E 2 107 ? 25.243  -53.035 56.222  1.00 104.82 ? 107 ARG F CB  1 
ATOM   7880  C  CG  . ARG E 2 107 ? 24.344  -53.611 55.138  1.00 108.08 ? 107 ARG F CG  1 
ATOM   7881  C  CD  . ARG E 2 107 ? 23.028  -54.079 55.723  1.00 104.24 ? 107 ARG F CD  1 
ATOM   7882  N  NE  . ARG E 2 107 ? 23.183  -55.315 56.484  1.00 100.57 ? 107 ARG F NE  1 
ATOM   7883  C  CZ  . ARG E 2 107 ? 22.417  -55.664 57.514  1.00 99.22  ? 107 ARG F CZ  1 
ATOM   7884  N  NH1 . ARG E 2 107 ? 21.437  -54.881 57.919  1.00 106.83 ? 107 ARG F NH1 1 
ATOM   7885  N  NH2 . ARG E 2 107 ? 22.629  -56.799 58.148  1.00 112.59 ? 107 ARG F NH2 1 
ATOM   7886  N  N   . ALA E 2 108 ? 26.833  -55.388 57.177  1.00 105.27 ? 108 ALA F N   1 
ATOM   7887  C  CA  . ALA E 2 108 ? 26.976  -56.831 57.325  1.00 106.28 ? 108 ALA F CA  1 
ATOM   7888  C  C   . ALA E 2 108 ? 26.080  -57.544 56.318  1.00 105.11 ? 108 ALA F C   1 
ATOM   7889  O  O   . ALA E 2 108 ? 24.976  -57.082 56.020  1.00 110.38 ? 108 ALA F O   1 
ATOM   7890  C  CB  . ALA E 2 108 ? 26.638  -57.256 58.747  1.00 98.61  ? 108 ALA F CB  1 
ATOM   7891  N  N   . ASP E 2 109 ? 26.563  -58.650 55.766  1.00 103.17 ? 109 ASP F N   1 
ATOM   7892  C  CA  . ASP E 2 109 ? 25.763  -59.396 54.810  1.00 98.27  ? 109 ASP F CA  1 
ATOM   7893  C  C   . ASP E 2 109 ? 24.521  -59.944 55.510  1.00 90.66  ? 109 ASP F C   1 
ATOM   7894  O  O   . ASP E 2 109 ? 24.509  -60.163 56.730  1.00 79.09  ? 109 ASP F O   1 
ATOM   7895  C  CB  . ASP E 2 109 ? 26.581  -60.519 54.179  1.00 106.32 ? 109 ASP F CB  1 
ATOM   7896  C  CG  . ASP E 2 109 ? 27.665  -60.001 53.267  1.00 115.13 ? 109 ASP F CG  1 
ATOM   7897  O  OD1 . ASP E 2 109 ? 27.555  -58.833 52.840  1.00 123.06 ? 109 ASP F OD1 1 
ATOM   7898  O  OD2 . ASP E 2 109 ? 28.625  -60.757 52.980  1.00 128.40 ? 109 ASP F OD2 1 
ATOM   7899  N  N   . ALA E 2 110 ? 23.453  -60.107 54.740  1.00 91.11  ? 110 ALA F N   1 
ATOM   7900  C  CA  . ALA E 2 110 ? 22.204  -60.643 55.266  1.00 88.73  ? 110 ALA F CA  1 
ATOM   7901  C  C   . ALA E 2 110 ? 21.573  -61.552 54.222  1.00 91.70  ? 110 ALA F C   1 
ATOM   7902  O  O   . ALA E 2 110 ? 21.522  -61.215 53.032  1.00 88.65  ? 110 ALA F O   1 
ATOM   7903  C  CB  . ALA E 2 110 ? 21.253  -59.512 55.625  1.00 84.42  ? 110 ALA F CB  1 
ATOM   7904  N  N   . ALA E 2 111 ? 21.090  -62.707 54.666  1.00 89.89  ? 111 ALA F N   1 
ATOM   7905  C  CA  . ALA E 2 111 ? 20.411  -63.617 53.767  1.00 87.45  ? 111 ALA F CA  1 
ATOM   7906  C  C   . ALA E 2 111 ? 18.981  -63.167 53.545  1.00 82.40  ? 111 ALA F C   1 
ATOM   7907  O  O   . ALA E 2 111 ? 18.354  -62.583 54.432  1.00 76.66  ? 111 ALA F O   1 
ATOM   7908  C  CB  . ALA E 2 111 ? 20.432  -65.018 54.329  1.00 96.74  ? 111 ALA F CB  1 
ATOM   7909  N  N   . PRO E 2 112 ? 18.460  -63.423 52.346  1.00 83.57  ? 112 PRO F N   1 
ATOM   7910  C  CA  . PRO E 2 112 ? 17.086  -63.048 52.097  1.00 89.26  ? 112 PRO F CA  1 
ATOM   7911  C  C   . PRO E 2 112 ? 16.161  -63.871 52.965  1.00 92.71  ? 112 PRO F C   1 
ATOM   7912  O  O   . PRO E 2 112 ? 16.370  -65.074 53.112  1.00 98.42  ? 112 PRO F O   1 
ATOM   7913  C  CB  . PRO E 2 112 ? 16.880  -63.385 50.610  1.00 90.32  ? 112 PRO F CB  1 
ATOM   7914  C  CG  . PRO E 2 112 ? 17.935  -64.373 50.279  1.00 88.85  ? 112 PRO F CG  1 
ATOM   7915  C  CD  . PRO E 2 112 ? 19.092  -64.061 51.182  1.00 86.82  ? 112 PRO F CD  1 
ATOM   7916  N  N   . THR E 2 113 ? 15.180  -63.215 53.572  1.00 91.88  ? 113 THR F N   1 
ATOM   7917  C  CA  . THR E 2 113 ? 14.014  -63.909 54.095  1.00 95.10  ? 113 THR F CA  1 
ATOM   7918  C  C   . THR E 2 113 ? 13.047  -64.146 52.943  1.00 92.58  ? 113 THR F C   1 
ATOM   7919  O  O   . THR E 2 113 ? 12.525  -63.188 52.371  1.00 106.71 ? 113 THR F O   1 
ATOM   7920  C  CB  . THR E 2 113 ? 13.311  -63.076 55.176  1.00 96.28  ? 113 THR F CB  1 
ATOM   7921  O  OG1 . THR E 2 113 ? 14.288  -62.519 56.065  1.00 106.76 ? 113 THR F OG1 1 
ATOM   7922  C  CG2 . THR E 2 113 ? 12.359  -63.933 55.964  1.00 99.33  ? 113 THR F CG2 1 
ATOM   7923  N  N   . VAL E 2 114 ? 12.815  -65.410 52.597  1.00 89.18  ? 114 VAL F N   1 
ATOM   7924  C  CA  . VAL E 2 114 ? 12.036  -65.742 51.405  1.00 92.78  ? 114 VAL F CA  1 
ATOM   7925  C  C   . VAL E 2 114 ? 10.638  -66.259 51.732  1.00 94.16  ? 114 VAL F C   1 
ATOM   7926  O  O   . VAL E 2 114 ? 10.446  -67.005 52.692  1.00 89.83  ? 114 VAL F O   1 
ATOM   7927  C  CB  . VAL E 2 114 ? 12.748  -66.786 50.547  1.00 97.04  ? 114 VAL F CB  1 
ATOM   7928  C  CG1 . VAL E 2 114 ? 11.954  -67.069 49.274  1.00 92.08  ? 114 VAL F CG1 1 
ATOM   7929  C  CG2 . VAL E 2 114 ? 14.152  -66.302 50.227  1.00 106.43 ? 114 VAL F CG2 1 
ATOM   7930  N  N   . SER E 2 115 ? 9.667   -65.830 50.928  1.00 93.79  ? 115 SER F N   1 
ATOM   7931  C  CA  . SER E 2 115 ? 8.283   -66.229 51.087  1.00 87.42  ? 115 SER F CA  1 
ATOM   7932  C  C   . SER E 2 115 ? 7.650   -66.399 49.724  1.00 88.61  ? 115 SER F C   1 
ATOM   7933  O  O   . SER E 2 115 ? 7.776   -65.537 48.854  1.00 80.07  ? 115 SER F O   1 
ATOM   7934  C  CB  . SER E 2 115 ? 7.511   -65.177 51.870  1.00 83.66  ? 115 SER F CB  1 
ATOM   7935  O  OG  . SER E 2 115 ? 7.898   -65.204 53.226  1.00 89.36  ? 115 SER F OG  1 
ATOM   7936  N  N   . ILE E 2 116 ? 6.955   -67.514 49.544  1.00 97.45  ? 116 ILE F N   1 
ATOM   7937  C  CA  . ILE E 2 116 ? 6.202   -67.729 48.319  1.00 98.99  ? 116 ILE F CA  1 
ATOM   7938  C  C   . ILE E 2 116 ? 4.707   -67.699 48.603  1.00 102.76 ? 116 ILE F C   1 
ATOM   7939  O  O   . ILE E 2 116 ? 4.266   -68.080 49.687  1.00 109.60 ? 116 ILE F O   1 
ATOM   7940  C  CB  . ILE E 2 116 ? 6.591   -69.044 47.639  1.00 94.11  ? 116 ILE F CB  1 
ATOM   7941  C  CG1 . ILE E 2 116 ? 5.928   -69.139 46.267  1.00 92.34  ? 116 ILE F CG1 1 
ATOM   7942  C  CG2 . ILE E 2 116 ? 6.216   -70.222 48.521  1.00 94.04  ? 116 ILE F CG2 1 
ATOM   7943  C  CD1 . ILE E 2 116 ? 6.443   -70.292 45.442  1.00 99.22  ? 116 ILE F CD1 1 
ATOM   7944  N  N   . PHE E 2 117 ? 3.942   -67.201 47.635  1.00 104.75 ? 117 PHE F N   1 
ATOM   7945  C  CA  . PHE E 2 117 ? 2.511   -67.026 47.798  1.00 105.36 ? 117 PHE F CA  1 
ATOM   7946  C  C   . PHE E 2 117 ? 1.760   -67.595 46.598  1.00 114.91 ? 117 PHE F C   1 
ATOM   7947  O  O   . PHE E 2 117 ? 2.024   -67.222 45.451  1.00 106.75 ? 117 PHE F O   1 
ATOM   7948  C  CB  . PHE E 2 117 ? 2.154   -65.551 47.965  1.00 98.11  ? 117 PHE F CB  1 
ATOM   7949  C  CG  . PHE E 2 117 ? 2.757   -64.912 49.176  1.00 95.28  ? 117 PHE F CG  1 
ATOM   7950  C  CD1 . PHE E 2 117 ? 2.192   -65.088 50.434  1.00 95.12  ? 117 PHE F CD1 1 
ATOM   7951  C  CD2 . PHE E 2 117 ? 3.875   -64.113 49.060  1.00 95.31  ? 117 PHE F CD2 1 
ATOM   7952  C  CE1 . PHE E 2 117 ? 2.742   -64.481 51.558  1.00 94.89  ? 117 PHE F CE1 1 
ATOM   7953  C  CE2 . PHE E 2 117 ? 4.429   -63.503 50.179  1.00 96.90  ? 117 PHE F CE2 1 
ATOM   7954  C  CZ  . PHE E 2 117 ? 3.861   -63.683 51.430  1.00 90.72  ? 117 PHE F CZ  1 
ATOM   7955  N  N   . PRO E 2 118 ? 0.795   -68.486 46.871  1.00 120.71 ? 118 PRO F N   1 
ATOM   7956  C  CA  . PRO E 2 118 ? -0.077  -69.048 45.851  1.00 111.84 ? 118 PRO F CA  1 
ATOM   7957  C  C   . PRO E 2 118 ? -1.158  -68.064 45.436  1.00 103.33 ? 118 PRO F C   1 
ATOM   7958  O  O   . PRO E 2 118 ? -1.531  -67.193 46.229  1.00 99.57  ? 118 PRO F O   1 
ATOM   7959  C  CB  . PRO E 2 118 ? -0.737  -70.236 46.559  1.00 121.40 ? 118 PRO F CB  1 
ATOM   7960  C  CG  . PRO E 2 118 ? -0.208  -70.258 47.961  1.00 122.43 ? 118 PRO F CG  1 
ATOM   7961  C  CD  . PRO E 2 118 ? 0.412   -68.929 48.221  1.00 119.38 ? 118 PRO F CD  1 
ATOM   7962  N  N   . PRO E 2 119 ? -1.684  -68.218 44.214  1.00 93.04  ? 119 PRO F N   1 
ATOM   7963  C  CA  . PRO E 2 119 ? -2.774  -67.366 43.752  1.00 93.73  ? 119 PRO F CA  1 
ATOM   7964  C  C   . PRO E 2 119 ? -3.946  -67.373 44.716  1.00 96.02  ? 119 PRO F C   1 
ATOM   7965  O  O   . PRO E 2 119 ? -4.293  -68.417 45.251  1.00 98.09  ? 119 PRO F O   1 
ATOM   7966  C  CB  . PRO E 2 119 ? -3.176  -67.989 42.417  1.00 89.30  ? 119 PRO F CB  1 
ATOM   7967  C  CG  . PRO E 2 119 ? -1.948  -68.671 41.934  1.00 88.44  ? 119 PRO F CG  1 
ATOM   7968  C  CD  . PRO E 2 119 ? -1.178  -69.104 43.156  1.00 89.30  ? 119 PRO F CD  1 
ATOM   7969  N  N   . SER E 2 120 ? -4.503  -66.194 44.973  1.00 105.41 ? 120 SER F N   1 
ATOM   7970  C  CA  . SER E 2 120 ? -5.708  -66.059 45.775  1.00 105.74 ? 120 SER F CA  1 
ATOM   7971  C  C   . SER E 2 120 ? -6.861  -66.700 45.040  1.00 109.98 ? 120 SER F C   1 
ATOM   7972  O  O   . SER E 2 120 ? -6.885  -66.749 43.806  1.00 103.09 ? 120 SER F O   1 
ATOM   7973  C  CB  . SER E 2 120 ? -6.034  -64.584 46.009  1.00 106.59 ? 120 SER F CB  1 
ATOM   7974  O  OG  . SER E 2 120 ? -6.197  -63.910 44.771  1.00 104.14 ? 120 SER F OG  1 
ATOM   7975  N  N   . SER E 2 121 ? -7.838  -67.159 45.808  1.00 114.52 ? 121 SER F N   1 
ATOM   7976  C  CA  . SER E 2 121 ? -9.078  -67.653 45.231  1.00 116.83 ? 121 SER F CA  1 
ATOM   7977  C  C   . SER E 2 121 ? -9.769  -66.560 44.416  1.00 115.46 ? 121 SER F C   1 
ATOM   7978  O  O   . SER E 2 121 ? -10.321 -66.833 43.352  1.00 109.59 ? 121 SER F O   1 
ATOM   7979  C  CB  . SER E 2 121 ? -10.010 -68.151 46.335  1.00 118.61 ? 121 SER F CB  1 
ATOM   7980  O  OG  . SER E 2 121 ? -10.148 -67.180 47.359  1.00 115.09 ? 121 SER F OG  1 
ATOM   7981  N  N   . GLU E 2 122 ? -9.715  -65.322 44.908  1.00 113.85 ? 122 GLU F N   1 
ATOM   7982  C  CA  . GLU E 2 122 ? -10.369 -64.200 44.240  1.00 113.24 ? 122 GLU F CA  1 
ATOM   7983  C  C   . GLU E 2 122 ? -9.860  -64.068 42.816  1.00 109.09 ? 122 GLU F C   1 
ATOM   7984  O  O   . GLU E 2 122 ? -10.625 -63.828 41.884  1.00 103.95 ? 122 GLU F O   1 
ATOM   7985  C  CB  . GLU E 2 122 ? -10.102 -62.882 44.984  1.00 117.28 ? 122 GLU F CB  1 
ATOM   7986  C  CG  . GLU E 2 122 ? -10.885 -62.698 46.275  1.00 125.39 ? 122 GLU F CG  1 
ATOM   7987  C  CD  . GLU E 2 122 ? -10.032 -62.861 47.524  1.00 124.69 ? 122 GLU F CD  1 
ATOM   7988  O  OE1 . GLU E 2 122 ? -9.345  -63.904 47.652  1.00 123.90 ? 122 GLU F OE1 1 
ATOM   7989  O  OE2 . GLU E 2 122 ? -10.060 -61.945 48.381  1.00 116.78 ? 122 GLU F OE2 1 
ATOM   7990  N  N   . GLN E 2 123 ? -8.550  -64.182 42.664  1.00 111.76 ? 123 GLN F N   1 
ATOM   7991  C  CA  . GLN E 2 123 ? -7.925  -63.955 41.378  1.00 118.08 ? 123 GLN F CA  1 
ATOM   7992  C  C   . GLN E 2 123 ? -8.306  -65.085 40.439  1.00 118.49 ? 123 GLN F C   1 
ATOM   7993  O  O   . GLN E 2 123 ? -8.647  -64.868 39.273  1.00 113.13 ? 123 GLN F O   1 
ATOM   7994  C  CB  . GLN E 2 123 ? -6.407  -63.894 41.547  1.00 116.56 ? 123 GLN F CB  1 
ATOM   7995  C  CG  . GLN E 2 123 ? -5.675  -63.438 40.308  1.00 116.82 ? 123 GLN F CG  1 
ATOM   7996  C  CD  . GLN E 2 123 ? -4.184  -63.623 40.430  1.00 119.30 ? 123 GLN F CD  1 
ATOM   7997  O  OE1 . GLN E 2 123 ? -3.678  -64.132 41.439  1.00 100.53 ? 123 GLN F OE1 1 
ATOM   7998  N  NE2 . GLN E 2 123 ? -3.460  -63.190 39.402  1.00 134.89 ? 123 GLN F NE2 1 
ATOM   7999  N  N   . LEU E 2 124 ? -8.261  -66.298 40.967  1.00 119.85 ? 124 LEU F N   1 
ATOM   8000  C  CA  . LEU E 2 124 ? -8.482  -67.469 40.152  1.00 124.53 ? 124 LEU F CA  1 
ATOM   8001  C  C   . LEU E 2 124 ? -9.843  -67.406 39.482  1.00 129.28 ? 124 LEU F C   1 
ATOM   8002  O  O   . LEU E 2 124 ? -9.975  -67.749 38.308  1.00 125.77 ? 124 LEU F O   1 
ATOM   8003  C  CB  . LEU E 2 124 ? -8.361  -68.726 41.004  1.00 124.47 ? 124 LEU F CB  1 
ATOM   8004  C  CG  . LEU E 2 124 ? -6.923  -69.047 41.403  1.00 122.24 ? 124 LEU F CG  1 
ATOM   8005  C  CD1 . LEU E 2 124 ? -6.882  -70.221 42.371  1.00 120.87 ? 124 LEU F CD1 1 
ATOM   8006  C  CD2 . LEU E 2 124 ? -6.094  -69.326 40.156  1.00 122.27 ? 124 LEU F CD2 1 
ATOM   8007  N  N   . THR E 2 125 ? -10.846 -66.932 40.216  1.00 131.04 ? 125 THR F N   1 
ATOM   8008  C  CA  . THR E 2 125 ? -12.209 -66.917 39.698  1.00 129.64 ? 125 THR F CA  1 
ATOM   8009  C  C   . THR E 2 125 ? -12.308 -66.018 38.468  1.00 133.48 ? 125 THR F C   1 
ATOM   8010  O  O   . THR E 2 125 ? -13.179 -66.211 37.622  1.00 136.31 ? 125 THR F O   1 
ATOM   8011  C  CB  . THR E 2 125 ? -13.237 -66.446 40.748  1.00 122.46 ? 125 THR F CB  1 
ATOM   8012  O  OG1 . THR E 2 125 ? -13.151 -65.026 40.902  1.00 131.52 ? 125 THR F OG1 1 
ATOM   8013  C  CG2 . THR E 2 125 ? -13.000 -67.117 42.090  1.00 118.22 ? 125 THR F CG2 1 
ATOM   8014  N  N   . SER E 2 126 ? -11.415 -65.040 38.363  1.00 127.97 ? 126 SER F N   1 
ATOM   8015  C  CA  . SER E 2 126 ? -11.427 -64.152 37.217  1.00 127.82 ? 126 SER F CA  1 
ATOM   8016  C  C   . SER E 2 126 ? -10.567 -64.685 36.070  1.00 127.58 ? 126 SER F C   1 
ATOM   8017  O  O   . SER E 2 126 ? -10.542 -64.096 34.993  1.00 127.12 ? 126 SER F O   1 
ATOM   8018  C  CB  . SER E 2 126 ? -10.950 -62.765 37.625  1.00 131.77 ? 126 SER F CB  1 
ATOM   8019  O  OG  . SER E 2 126 ? -9.727  -62.848 38.327  1.00 131.04 ? 126 SER F OG  1 
ATOM   8020  N  N   . GLY E 2 127 ? -9.864  -65.792 36.295  1.00 124.57 ? 127 GLY F N   1 
ATOM   8021  C  CA  . GLY E 2 127 ? -9.147  -66.469 35.212  1.00 125.32 ? 127 GLY F CA  1 
ATOM   8022  C  C   . GLY E 2 127 ? -7.654  -66.192 35.153  1.00 122.40 ? 127 GLY F C   1 
ATOM   8023  O  O   . GLY E 2 127 ? -6.955  -66.687 34.264  1.00 123.21 ? 127 GLY F O   1 
ATOM   8024  N  N   . GLY E 2 128 ? -7.150  -65.419 36.106  1.00 119.79 ? 128 GLY F N   1 
ATOM   8025  C  CA  . GLY E 2 128 ? -5.717  -65.137 36.168  1.00 117.26 ? 128 GLY F CA  1 
ATOM   8026  C  C   . GLY E 2 128 ? -5.086  -65.864 37.332  1.00 115.64 ? 128 GLY F C   1 
ATOM   8027  O  O   . GLY E 2 128 ? -5.791  -66.305 38.241  1.00 124.89 ? 128 GLY F O   1 
ATOM   8028  N  N   . ALA E 2 129 ? -3.763  -66.009 37.307  1.00 108.65 ? 129 ALA F N   1 
ATOM   8029  C  CA  . ALA E 2 129 ? -3.064  -66.686 38.395  1.00 111.14 ? 129 ALA F CA  1 
ATOM   8030  C  C   . ALA E 2 129 ? -1.638  -66.180 38.568  1.00 111.72 ? 129 ALA F C   1 
ATOM   8031  O  O   . ALA E 2 129 ? -0.740  -66.531 37.803  1.00 108.30 ? 129 ALA F O   1 
ATOM   8032  C  CB  . ALA E 2 129 ? -3.057  -68.179 38.158  1.00 112.57 ? 129 ALA F CB  1 
ATOM   8033  N  N   . SER E 2 130 ? -1.431  -65.366 39.595  1.00 109.40 ? 130 SER F N   1 
ATOM   8034  C  CA  . SER E 2 130 ? -0.125  -64.788 39.841  1.00 106.48 ? 130 SER F CA  1 
ATOM   8035  C  C   . SER E 2 130 ? 0.492   -65.448 41.052  1.00 101.70 ? 130 SER F C   1 
ATOM   8036  O  O   . SER E 2 130 ? -0.113  -65.477 42.133  1.00 91.84  ? 130 SER F O   1 
ATOM   8037  C  CB  . SER E 2 130 ? -0.230  -63.277 40.070  1.00 105.51 ? 130 SER F CB  1 
ATOM   8038  O  OG  . SER E 2 130 ? -0.527  -62.599 38.860  1.00 100.52 ? 130 SER F OG  1 
ATOM   8039  N  N   . VAL E 2 131 ? 1.704   -65.960 40.872  1.00 98.41  ? 131 VAL F N   1 
ATOM   8040  C  CA  . VAL E 2 131 ? 2.450   -66.529 41.979  1.00 102.89 ? 131 VAL F CA  1 
ATOM   8041  C  C   . VAL E 2 131 ? 3.572   -65.588 42.363  1.00 95.80  ? 131 VAL F C   1 
ATOM   8042  O  O   . VAL E 2 131 ? 4.372   -65.184 41.524  1.00 82.97  ? 131 VAL F O   1 
ATOM   8043  C  CB  . VAL E 2 131 ? 3.058   -67.885 41.619  1.00 114.97 ? 131 VAL F CB  1 
ATOM   8044  C  CG1 . VAL E 2 131 ? 3.500   -68.612 42.884  1.00 113.72 ? 131 VAL F CG1 1 
ATOM   8045  C  CG2 . VAL E 2 131 ? 2.056   -68.708 40.827  1.00 123.45 ? 131 VAL F CG2 1 
ATOM   8046  N  N   . VAL E 2 132 ? 3.629   -65.263 43.645  1.00 96.21  ? 132 VAL F N   1 
ATOM   8047  C  CA  . VAL E 2 132 ? 4.475   -64.189 44.111  1.00 97.09  ? 132 VAL F CA  1 
ATOM   8048  C  C   . VAL E 2 132 ? 5.511   -64.697 45.099  1.00 94.34  ? 132 VAL F C   1 
ATOM   8049  O  O   . VAL E 2 132 ? 5.205   -65.504 45.971  1.00 96.14  ? 132 VAL F O   1 
ATOM   8050  C  CB  . VAL E 2 132 ? 3.640   -63.082 44.785  1.00 98.88  ? 132 VAL F CB  1 
ATOM   8051  C  CG1 . VAL E 2 132 ? 4.547   -62.021 45.380  1.00 104.06 ? 132 VAL F CG1 1 
ATOM   8052  C  CG2 . VAL E 2 132 ? 2.685   -62.454 43.783  1.00 96.90  ? 132 VAL F CG2 1 
ATOM   8053  N  N   . CYS E 2 133 ? 6.726   -64.170 44.984  1.00 91.93  ? 133 CYS F N   1 
ATOM   8054  C  CA  . CYS E 2 133 ? 7.799   -64.495 45.908  1.00 89.35  ? 133 CYS F CA  1 
ATOM   8055  C  C   . CYS E 2 133 ? 8.478   -63.237 46.404  1.00 81.12  ? 133 CYS F C   1 
ATOM   8056  O  O   . CYS E 2 133 ? 8.884   -62.399 45.603  1.00 77.57  ? 133 CYS F O   1 
ATOM   8057  C  CB  . CYS E 2 133 ? 8.817   -65.357 45.194  1.00 106.89 ? 133 CYS F CB  1 
ATOM   8058  S  SG  . CYS E 2 133 ? 9.843   -66.386 46.266  1.00 117.85 ? 133 CYS F SG  1 
ATOM   8059  N  N   . PHE E 2 134 ? 8.572   -63.095 47.723  1.00 80.26  ? 134 PHE F N   1 
ATOM   8060  C  CA  . PHE E 2 134 ? 9.264   -61.963 48.333  1.00 81.72  ? 134 PHE F CA  1 
ATOM   8061  C  C   . PHE E 2 134 ? 10.617  -62.411 48.839  1.00 86.41  ? 134 PHE F C   1 
ATOM   8062  O  O   . PHE E 2 134 ? 10.716  -63.386 49.576  1.00 94.67  ? 134 PHE F O   1 
ATOM   8063  C  CB  . PHE E 2 134 ? 8.498   -61.390 49.533  1.00 79.10  ? 134 PHE F CB  1 
ATOM   8064  C  CG  . PHE E 2 134 ? 7.200   -60.738 49.181  1.00 72.66  ? 134 PHE F CG  1 
ATOM   8065  C  CD1 . PHE E 2 134 ? 6.888   -60.433 47.868  1.00 71.62  ? 134 PHE F CD1 1 
ATOM   8066  C  CD2 . PHE E 2 134 ? 6.310   -60.397 50.176  1.00 70.03  ? 134 PHE F CD2 1 
ATOM   8067  C  CE1 . PHE E 2 134 ? 5.694   -59.824 47.554  1.00 73.82  ? 134 PHE F CE1 1 
ATOM   8068  C  CE2 . PHE E 2 134 ? 5.110   -59.795 49.870  1.00 73.85  ? 134 PHE F CE2 1 
ATOM   8069  C  CZ  . PHE E 2 134 ? 4.804   -59.495 48.556  1.00 75.04  ? 134 PHE F CZ  1 
ATOM   8070  N  N   . LEU E 2 135 ? 11.650  -61.664 48.469  1.00 86.09  ? 135 LEU F N   1 
ATOM   8071  C  CA  . LEU E 2 135 ? 12.977  -61.875 49.006  1.00 80.92  ? 135 LEU F CA  1 
ATOM   8072  C  C   . LEU E 2 135 ? 13.354  -60.627 49.781  1.00 79.67  ? 135 LEU F C   1 
ATOM   8073  O  O   . LEU E 2 135 ? 13.644  -59.587 49.189  1.00 83.03  ? 135 LEU F O   1 
ATOM   8074  C  CB  . LEU E 2 135 ? 13.959  -62.127 47.868  1.00 83.84  ? 135 LEU F CB  1 
ATOM   8075  C  CG  . LEU E 2 135 ? 13.737  -63.408 47.064  1.00 88.48  ? 135 LEU F CG  1 
ATOM   8076  C  CD1 . LEU E 2 135 ? 12.601  -63.239 46.069  1.00 91.23  ? 135 LEU F CD1 1 
ATOM   8077  C  CD2 . LEU E 2 135 ? 15.016  -63.793 46.340  1.00 90.78  ? 135 LEU F CD2 1 
ATOM   8078  N  N   . ASN E 2 136 ? 13.332  -60.717 51.106  1.00 81.10  ? 136 ASN F N   1 
ATOM   8079  C  CA  . ASN E 2 136 ? 13.303  -59.516 51.933  1.00 85.13  ? 136 ASN F CA  1 
ATOM   8080  C  C   . ASN E 2 136 ? 14.510  -59.309 52.816  1.00 85.24  ? 136 ASN F C   1 
ATOM   8081  O  O   . ASN E 2 136 ? 15.028  -60.241 53.425  1.00 89.31  ? 136 ASN F O   1 
ATOM   8082  C  CB  . ASN E 2 136 ? 12.043  -59.484 52.798  1.00 86.34  ? 136 ASN F CB  1 
ATOM   8083  C  CG  . ASN E 2 136 ? 10.812  -59.097 52.003  1.00 89.25  ? 136 ASN F CG  1 
ATOM   8084  O  OD1 . ASN E 2 136 ? 10.870  -58.955 50.776  1.00 88.98  ? 136 ASN F OD1 1 
ATOM   8085  N  ND2 . ASN E 2 136 ? 9.688   -58.933 52.691  1.00 96.56  ? 136 ASN F ND2 1 
ATOM   8086  N  N   . ASN E 2 137 ? 14.941  -58.057 52.870  1.00 87.04  ? 137 ASN F N   1 
ATOM   8087  C  CA  . ASN E 2 137 ? 15.908  -57.596 53.852  1.00 87.52  ? 137 ASN F CA  1 
ATOM   8088  C  C   . ASN E 2 137 ? 17.233  -58.333 53.811  1.00 87.64  ? 137 ASN F C   1 
ATOM   8089  O  O   . ASN E 2 137 ? 17.704  -58.844 54.829  1.00 83.28  ? 137 ASN F O   1 
ATOM   8090  C  CB  . ASN E 2 137 ? 15.299  -57.651 55.244  1.00 86.52  ? 137 ASN F CB  1 
ATOM   8091  C  CG  . ASN E 2 137 ? 14.053  -56.810 55.347  1.00 89.95  ? 137 ASN F CG  1 
ATOM   8092  O  OD1 . ASN E 2 137 ? 12.952  -57.342 55.444  1.00 103.52 ? 137 ASN F OD1 1 
ATOM   8093  N  ND2 . ASN E 2 137 ? 14.212  -55.489 55.268  1.00 93.75  ? 137 ASN F ND2 1 
ATOM   8094  N  N   . PHE E 2 138 ? 17.843  -58.335 52.628  1.00 86.81  ? 138 PHE F N   1 
ATOM   8095  C  CA  . PHE E 2 138 ? 19.134  -58.963 52.416  1.00 83.28  ? 138 PHE F CA  1 
ATOM   8096  C  C   . PHE E 2 138 ? 20.169  -57.945 51.976  1.00 87.19  ? 138 PHE F C   1 
ATOM   8097  O  O   . PHE E 2 138 ? 19.818  -56.839 51.573  1.00 97.12  ? 138 PHE F O   1 
ATOM   8098  C  CB  . PHE E 2 138 ? 19.005  -60.034 51.352  1.00 79.55  ? 138 PHE F CB  1 
ATOM   8099  C  CG  . PHE E 2 138 ? 18.539  -59.517 50.025  1.00 74.29  ? 138 PHE F CG  1 
ATOM   8100  C  CD1 . PHE E 2 138 ? 17.196  -59.460 49.721  1.00 73.66  ? 138 PHE F CD1 1 
ATOM   8101  C  CD2 . PHE E 2 138 ? 19.444  -59.108 49.078  1.00 74.55  ? 138 PHE F CD2 1 
ATOM   8102  C  CE1 . PHE E 2 138 ? 16.761  -59.004 48.486  1.00 74.29  ? 138 PHE F CE1 1 
ATOM   8103  C  CE2 . PHE E 2 138 ? 19.020  -58.651 47.846  1.00 78.00  ? 138 PHE F CE2 1 
ATOM   8104  C  CZ  . PHE E 2 138 ? 17.674  -58.608 47.540  1.00 74.26  ? 138 PHE F CZ  1 
ATOM   8105  N  N   . TYR E 2 139 ? 21.443  -58.329 52.072  1.00 95.13  ? 139 TYR F N   1 
ATOM   8106  C  CA  . TYR E 2 139 ? 22.572  -57.515 51.601  1.00 93.49  ? 139 TYR F CA  1 
ATOM   8107  C  C   . TYR E 2 139 ? 23.764  -58.413 51.329  1.00 87.74  ? 139 TYR F C   1 
ATOM   8108  O  O   . TYR E 2 139 ? 24.067  -59.291 52.132  1.00 89.37  ? 139 TYR F O   1 
ATOM   8109  C  CB  . TYR E 2 139 ? 22.969  -56.462 52.641  1.00 98.13  ? 139 TYR F CB  1 
ATOM   8110  C  CG  . TYR E 2 139 ? 24.047  -55.529 52.141  1.00 104.89 ? 139 TYR F CG  1 
ATOM   8111  C  CD1 . TYR E 2 139 ? 25.380  -55.886 52.209  1.00 109.59 ? 139 TYR F CD1 1 
ATOM   8112  C  CD2 . TYR E 2 139 ? 23.726  -54.309 51.554  1.00 105.18 ? 139 TYR F CD2 1 
ATOM   8113  C  CE1 . TYR E 2 139 ? 26.372  -55.049 51.728  1.00 114.07 ? 139 TYR F CE1 1 
ATOM   8114  C  CE2 . TYR E 2 139 ? 24.712  -53.464 51.068  1.00 108.85 ? 139 TYR F CE2 1 
ATOM   8115  C  CZ  . TYR E 2 139 ? 26.040  -53.836 51.154  1.00 106.91 ? 139 TYR F CZ  1 
ATOM   8116  O  OH  . TYR E 2 139 ? 27.042  -53.009 50.670  1.00 97.55  ? 139 TYR F OH  1 
ATOM   8117  N  N   . PRO E 2 140 ? 24.471  -58.178 50.217  1.00 87.41  ? 140 PRO F N   1 
ATOM   8118  C  CA  . PRO E 2 140 ? 24.306  -57.063 49.305  1.00 86.15  ? 140 PRO F CA  1 
ATOM   8119  C  C   . PRO E 2 140 ? 23.189  -57.262 48.299  1.00 86.75  ? 140 PRO F C   1 
ATOM   8120  O  O   . PRO E 2 140 ? 22.436  -58.220 48.393  1.00 84.11  ? 140 PRO F O   1 
ATOM   8121  C  CB  . PRO E 2 140 ? 25.645  -57.030 48.576  1.00 92.94  ? 140 PRO F CB  1 
ATOM   8122  C  CG  . PRO E 2 140 ? 26.048  -58.460 48.495  1.00 92.37  ? 140 PRO F CG  1 
ATOM   8123  C  CD  . PRO E 2 140 ? 25.578  -59.060 49.800  1.00 92.61  ? 140 PRO F CD  1 
ATOM   8124  N  N   . LYS E 2 141 ? 23.110  -56.361 47.328  1.00 93.90  ? 141 LYS F N   1 
ATOM   8125  C  CA  . LYS E 2 141 ? 21.974  -56.294 46.423  1.00 98.93  ? 141 LYS F CA  1 
ATOM   8126  C  C   . LYS E 2 141 ? 22.022  -57.354 45.331  1.00 94.20  ? 141 LYS F C   1 
ATOM   8127  O  O   . LYS E 2 141 ? 20.986  -57.756 44.822  1.00 102.56 ? 141 LYS F O   1 
ATOM   8128  C  CB  . LYS E 2 141 ? 21.866  -54.900 45.785  1.00 110.88 ? 141 LYS F CB  1 
ATOM   8129  C  CG  . LYS E 2 141 ? 20.660  -54.758 44.863  1.00 123.38 ? 141 LYS F CG  1 
ATOM   8130  C  CD  . LYS E 2 141 ? 20.504  -53.368 44.269  1.00 126.70 ? 141 LYS F CD  1 
ATOM   8131  C  CE  . LYS E 2 141 ? 19.397  -53.372 43.219  1.00 135.13 ? 141 LYS F CE  1 
ATOM   8132  N  NZ  . LYS E 2 141 ? 18.964  -52.008 42.806  1.00 140.69 ? 141 LYS F NZ  1 
ATOM   8133  N  N   . ASP E 2 142 ? 23.208  -57.775 44.930  1.00 99.52  ? 142 ASP F N   1 
ATOM   8134  C  CA  . ASP E 2 142 ? 23.302  -58.818 43.927  1.00 113.83 ? 142 ASP F CA  1 
ATOM   8135  C  C   . ASP E 2 142 ? 22.511  -60.031 44.409  1.00 113.91 ? 142 ASP F C   1 
ATOM   8136  O  O   . ASP E 2 142 ? 22.768  -60.560 45.494  1.00 111.40 ? 142 ASP F O   1 
ATOM   8137  C  CB  . ASP E 2 142 ? 24.762  -59.208 43.694  1.00 129.04 ? 142 ASP F CB  1 
ATOM   8138  C  CG  . ASP E 2 142 ? 25.565  -58.098 43.065  1.00 128.85 ? 142 ASP F CG  1 
ATOM   8139  O  OD1 . ASP E 2 142 ? 24.949  -57.217 42.429  1.00 130.39 ? 142 ASP F OD1 1 
ATOM   8140  O  OD2 . ASP E 2 142 ? 26.805  -58.108 43.210  1.00 134.82 ? 142 ASP F OD2 1 
ATOM   8141  N  N   . ILE E 2 143 ? 21.549  -60.465 43.604  1.00 107.56 ? 143 ILE F N   1 
ATOM   8142  C  CA  . ILE E 2 143 ? 20.777  -61.655 43.924  1.00 105.49 ? 143 ILE F CA  1 
ATOM   8143  C  C   . ILE E 2 143 ? 20.132  -62.213 42.663  1.00 112.60 ? 143 ILE F C   1 
ATOM   8144  O  O   . ILE E 2 143 ? 19.899  -61.485 41.696  1.00 108.20 ? 143 ILE F O   1 
ATOM   8145  C  CB  . ILE E 2 143 ? 19.699  -61.372 44.991  1.00 99.97  ? 143 ILE F CB  1 
ATOM   8146  C  CG1 . ILE E 2 143 ? 19.139  -62.677 45.542  1.00 109.13 ? 143 ILE F CG1 1 
ATOM   8147  C  CG2 . ILE E 2 143 ? 18.563  -60.540 44.415  1.00 98.87  ? 143 ILE F CG2 1 
ATOM   8148  C  CD1 . ILE E 2 143 ? 18.395  -62.517 46.851  1.00 108.62 ? 143 ILE F CD1 1 
ATOM   8149  N  N   . ASN E 2 144 ? 19.881  -63.518 42.664  1.00 124.04 ? 144 ASN F N   1 
ATOM   8150  C  CA  . ASN E 2 144 ? 19.226  -64.159 41.540  1.00 123.13 ? 144 ASN F CA  1 
ATOM   8151  C  C   . ASN E 2 144 ? 18.060  -65.036 41.989  1.00 113.05 ? 144 ASN F C   1 
ATOM   8152  O  O   . ASN E 2 144 ? 18.134  -65.727 43.006  1.00 106.14 ? 144 ASN F O   1 
ATOM   8153  C  CB  . ASN E 2 144 ? 20.239  -64.964 40.724  1.00 132.40 ? 144 ASN F CB  1 
ATOM   8154  C  CG  . ASN E 2 144 ? 20.003  -64.831 39.235  1.00 138.62 ? 144 ASN F CG  1 
ATOM   8155  O  OD1 . ASN E 2 144 ? 18.927  -65.172 38.750  1.00 148.85 ? 144 ASN F OD1 1 
ATOM   8156  N  ND2 . ASN E 2 144 ? 20.982  -64.290 38.510  1.00 142.81 ? 144 ASN F ND2 1 
ATOM   8157  N  N   . VAL E 2 145 ? 16.968  -64.966 41.241  1.00 113.01 ? 145 VAL F N   1 
ATOM   8158  C  CA  . VAL E 2 145 ? 15.789  -65.782 41.510  1.00 117.80 ? 145 VAL F CA  1 
ATOM   8159  C  C   . VAL E 2 145 ? 15.533  -66.743 40.346  1.00 120.39 ? 145 VAL F C   1 
ATOM   8160  O  O   . VAL E 2 145 ? 15.728  -66.387 39.180  1.00 117.89 ? 145 VAL F O   1 
ATOM   8161  C  CB  . VAL E 2 145 ? 14.544  -64.896 41.770  1.00 111.03 ? 145 VAL F CB  1 
ATOM   8162  C  CG1 . VAL E 2 145 ? 13.274  -65.724 41.762  1.00 112.50 ? 145 VAL F CG1 1 
ATOM   8163  C  CG2 . VAL E 2 145 ? 14.679  -64.187 43.107  1.00 106.44 ? 145 VAL F CG2 1 
ATOM   8164  N  N   . LYS E 2 146 ? 15.100  -67.959 40.681  1.00 115.12 ? 146 LYS F N   1 
ATOM   8165  C  CA  . LYS E 2 146 ? 14.664  -68.940 39.693  1.00 122.21 ? 146 LYS F CA  1 
ATOM   8166  C  C   . LYS E 2 146 ? 13.294  -69.511 40.063  1.00 118.45 ? 146 LYS F C   1 
ATOM   8167  O  O   . LYS E 2 146 ? 13.054  -69.870 41.223  1.00 99.18  ? 146 LYS F O   1 
ATOM   8168  C  CB  . LYS E 2 146 ? 15.678  -70.080 39.597  1.00 146.25 ? 146 LYS F CB  1 
ATOM   8169  C  CG  . LYS E 2 146 ? 16.834  -69.809 38.645  1.00 162.70 ? 146 LYS F CG  1 
ATOM   8170  C  CD  . LYS E 2 146 ? 17.707  -71.040 38.426  1.00 164.93 ? 146 LYS F CD  1 
ATOM   8171  C  CE  . LYS E 2 146 ? 19.092  -70.649 37.930  1.00 172.38 ? 146 LYS F CE  1 
ATOM   8172  N  NZ  . LYS E 2 146 ? 19.931  -71.836 37.619  1.00 183.92 ? 146 LYS F NZ  1 
ATOM   8173  N  N   . TRP E 2 147 ? 12.404  -69.594 39.072  1.00 126.38 ? 147 TRP F N   1 
ATOM   8174  C  CA  . TRP E 2 147 ? 11.091  -70.210 39.262  1.00 138.76 ? 147 TRP F CA  1 
ATOM   8175  C  C   . TRP E 2 147 ? 11.090  -71.639 38.738  1.00 150.71 ? 147 TRP F C   1 
ATOM   8176  O  O   . TRP E 2 147 ? 11.655  -71.923 37.678  1.00 174.33 ? 147 TRP F O   1 
ATOM   8177  C  CB  . TRP E 2 147 ? 9.992   -69.412 38.541  1.00 139.33 ? 147 TRP F CB  1 
ATOM   8178  C  CG  . TRP E 2 147 ? 9.553   -68.190 39.293  1.00 125.14 ? 147 TRP F CG  1 
ATOM   8179  C  CD1 . TRP E 2 147 ? 9.957   -66.916 39.072  1.00 117.86 ? 147 TRP F CD1 1 
ATOM   8180  C  CD2 . TRP E 2 147 ? 8.647   -68.136 40.401  1.00 113.07 ? 147 TRP F CD2 1 
ATOM   8181  N  NE1 . TRP E 2 147 ? 9.368   -66.071 39.969  1.00 113.16 ? 147 TRP F NE1 1 
ATOM   8182  C  CE2 . TRP E 2 147 ? 8.560   -66.797 40.801  1.00 109.14 ? 147 TRP F CE2 1 
ATOM   8183  C  CE3 . TRP E 2 147 ? 7.900   -69.089 41.086  1.00 114.31 ? 147 TRP F CE3 1 
ATOM   8184  C  CZ2 . TRP E 2 147 ? 7.752   -66.383 41.855  1.00 108.69 ? 147 TRP F CZ2 1 
ATOM   8185  C  CZ3 . TRP E 2 147 ? 7.097   -68.676 42.130  1.00 111.38 ? 147 TRP F CZ3 1 
ATOM   8186  C  CH2 . TRP E 2 147 ? 7.033   -67.337 42.508  1.00 109.23 ? 147 TRP F CH2 1 
ATOM   8187  N  N   . LYS E 2 148 ? 10.447  -72.536 39.476  1.00 146.19 ? 148 LYS F N   1 
ATOM   8188  C  CA  . LYS E 2 148 ? 10.281  -73.905 39.013  1.00 151.65 ? 148 LYS F CA  1 
ATOM   8189  C  C   . LYS E 2 148 ? 8.840   -74.355 39.168  1.00 150.40 ? 148 LYS F C   1 
ATOM   8190  O  O   . LYS E 2 148 ? 8.206   -74.143 40.204  1.00 132.89 ? 148 LYS F O   1 
ATOM   8191  C  CB  . LYS E 2 148 ? 11.231  -74.852 39.750  1.00 157.50 ? 148 LYS F CB  1 
ATOM   8192  C  CG  . LYS E 2 148 ? 12.662  -74.796 39.233  1.00 158.33 ? 148 LYS F CG  1 
ATOM   8193  C  CD  . LYS E 2 148 ? 13.621  -75.592 40.103  1.00 154.84 ? 148 LYS F CD  1 
ATOM   8194  C  CE  . LYS E 2 148 ? 15.033  -75.523 39.550  1.00 150.11 ? 148 LYS F CE  1 
ATOM   8195  N  NZ  . LYS E 2 148 ? 15.947  -76.454 40.260  1.00 152.30 ? 148 LYS F NZ  1 
ATOM   8196  N  N   . ILE E 2 149 ? 8.334   -74.957 38.099  1.00 161.47 ? 149 ILE F N   1 
ATOM   8197  C  CA  . ILE E 2 149 ? 7.013   -75.559 38.092  1.00 162.78 ? 149 ILE F CA  1 
ATOM   8198  C  C   . ILE E 2 149 ? 7.210   -77.062 37.969  1.00 169.35 ? 149 ILE F C   1 
ATOM   8199  O  O   . ILE E 2 149 ? 7.813   -77.542 37.002  1.00 183.87 ? 149 ILE F O   1 
ATOM   8200  C  CB  . ILE E 2 149 ? 6.149   -75.039 36.919  1.00 163.39 ? 149 ILE F CB  1 
ATOM   8201  C  CG1 . ILE E 2 149 ? 6.923   -75.108 35.593  1.00 162.92 ? 149 ILE F CG1 1 
ATOM   8202  C  CG2 . ILE E 2 149 ? 5.689   -73.615 37.194  1.00 148.22 ? 149 ILE F CG2 1 
ATOM   8203  C  CD1 . ILE E 2 149 ? 6.073   -74.834 34.372  1.00 160.41 ? 149 ILE F CD1 1 
ATOM   8204  N  N   . ASP E 2 150 ? 6.740   -77.803 38.967  1.00 159.72 ? 150 ASP F N   1 
ATOM   8205  C  CA  . ASP E 2 150 ? 6.931   -79.245 38.989  1.00 154.02 ? 150 ASP F CA  1 
ATOM   8206  C  C   . ASP E 2 150 ? 8.404   -79.594 38.805  1.00 152.60 ? 150 ASP F C   1 
ATOM   8207  O  O   . ASP E 2 150 ? 8.740   -80.500 38.045  1.00 156.03 ? 150 ASP F O   1 
ATOM   8208  C  CB  . ASP E 2 150 ? 6.090   -79.900 37.889  1.00 149.72 ? 150 ASP F CB  1 
ATOM   8209  C  CG  . ASP E 2 150 ? 4.615   -79.916 38.219  1.00 143.64 ? 150 ASP F CG  1 
ATOM   8210  O  OD1 . ASP E 2 150 ? 4.269   -79.752 39.407  1.00 142.87 ? 150 ASP F OD1 1 
ATOM   8211  O  OD2 . ASP E 2 150 ? 3.804   -80.097 37.295  1.00 135.88 ? 150 ASP F OD2 1 
ATOM   8212  N  N   . GLY E 2 151 ? 9.278   -78.845 39.473  1.00 142.92 ? 151 GLY F N   1 
ATOM   8213  C  CA  . GLY E 2 151 ? 10.711  -79.114 39.441  1.00 134.94 ? 151 GLY F CA  1 
ATOM   8214  C  C   . GLY E 2 151 ? 11.424  -78.619 38.194  1.00 135.55 ? 151 GLY F C   1 
ATOM   8215  O  O   . GLY E 2 151 ? 12.647  -78.531 38.179  1.00 133.95 ? 151 GLY F O   1 
ATOM   8216  N  N   . SER E 2 152 ? 10.673  -78.315 37.138  1.00 142.33 ? 152 SER F N   1 
ATOM   8217  C  CA  . SER E 2 152 ? 11.271  -77.783 35.911  1.00 150.03 ? 152 SER F CA  1 
ATOM   8218  C  C   . SER E 2 152 ? 11.170  -76.245 35.831  1.00 158.28 ? 152 SER F C   1 
ATOM   8219  O  O   . SER E 2 152 ? 10.162  -75.635 36.217  1.00 157.58 ? 152 SER F O   1 
ATOM   8220  C  CB  . SER E 2 152 ? 10.655  -78.451 34.673  1.00 148.03 ? 152 SER F CB  1 
ATOM   8221  O  OG  . SER E 2 152 ? 9.244   -78.340 34.670  1.00 146.47 ? 152 SER F OG  1 
ATOM   8222  N  N   . GLU E 2 153 ? 12.233  -75.628 35.324  1.00 155.42 ? 153 GLU F N   1 
ATOM   8223  C  CA  . GLU E 2 153 ? 12.411  -74.184 35.411  1.00 147.10 ? 153 GLU F CA  1 
ATOM   8224  C  C   . GLU E 2 153 ? 11.530  -73.428 34.413  1.00 149.03 ? 153 GLU F C   1 
ATOM   8225  O  O   . GLU E 2 153 ? 11.319  -73.878 33.287  1.00 145.52 ? 153 GLU F O   1 
ATOM   8226  C  CB  . GLU E 2 153 ? 13.886  -73.840 35.187  1.00 150.97 ? 153 GLU F CB  1 
ATOM   8227  C  CG  . GLU E 2 153 ? 14.248  -72.383 35.431  1.00 154.79 ? 153 GLU F CG  1 
ATOM   8228  C  CD  . GLU E 2 153 ? 15.735  -72.100 35.265  1.00 156.66 ? 153 GLU F CD  1 
ATOM   8229  O  OE1 . GLU E 2 153 ? 16.515  -73.051 35.059  1.00 169.59 ? 153 GLU F OE1 1 
ATOM   8230  O  OE2 . GLU E 2 153 ? 16.131  -70.921 35.348  1.00 152.76 ? 153 GLU F OE2 1 
ATOM   8231  N  N   . ARG E 2 154 ? 11.017  -72.277 34.848  1.00 158.76 ? 154 ARG F N   1 
ATOM   8232  C  CA  . ARG E 2 154 ? 10.155  -71.429 34.021  1.00 156.18 ? 154 ARG F CA  1 
ATOM   8233  C  C   . ARG E 2 154 ? 10.664  -69.998 34.065  1.00 146.84 ? 154 ARG F C   1 
ATOM   8234  O  O   . ARG E 2 154 ? 10.913  -69.448 35.149  1.00 130.48 ? 154 ARG F O   1 
ATOM   8235  C  CB  . ARG E 2 154 ? 8.705   -71.470 34.515  1.00 162.10 ? 154 ARG F CB  1 
ATOM   8236  C  CG  . ARG E 2 154 ? 7.759   -70.510 33.793  1.00 165.71 ? 154 ARG F CG  1 
ATOM   8237  C  CD  . ARG E 2 154 ? 7.257   -71.068 32.464  1.00 173.62 ? 154 ARG F CD  1 
ATOM   8238  N  NE  . ARG E 2 154 ? 6.130   -70.298 31.931  1.00 171.99 ? 154 ARG F NE  1 
ATOM   8239  C  CZ  . ARG E 2 154 ? 5.437   -70.637 30.844  1.00 176.09 ? 154 ARG F CZ  1 
ATOM   8240  N  NH1 . ARG E 2 154 ? 4.420   -69.882 30.445  1.00 169.79 ? 154 ARG F NH1 1 
ATOM   8241  N  NH2 . ARG E 2 154 ? 5.765   -71.715 30.145  1.00 187.87 ? 154 ARG F NH2 1 
ATOM   8242  N  N   . GLN E 2 155 ? 10.811  -69.403 32.884  1.00 152.96 ? 155 GLN F N   1 
ATOM   8243  C  CA  . GLN E 2 155 ? 11.360  -68.061 32.757  1.00 165.46 ? 155 GLN F CA  1 
ATOM   8244  C  C   . GLN E 2 155 ? 10.573  -67.225 31.741  1.00 176.50 ? 155 GLN F C   1 
ATOM   8245  O  O   . GLN E 2 155 ? 11.149  -66.430 30.997  1.00 187.43 ? 155 GLN F O   1 
ATOM   8246  C  CB  . GLN E 2 155 ? 12.828  -68.155 32.344  1.00 165.88 ? 155 GLN F CB  1 
ATOM   8247  C  CG  . GLN E 2 155 ? 13.733  -67.142 33.025  1.00 167.58 ? 155 GLN F CG  1 
ATOM   8248  C  CD  . GLN E 2 155 ? 15.169  -67.612 33.099  1.00 166.95 ? 155 GLN F CD  1 
ATOM   8249  O  OE1 . GLN E 2 155 ? 15.540  -68.610 32.484  1.00 176.94 ? 155 GLN F OE1 1 
ATOM   8250  N  NE2 . GLN E 2 155 ? 15.988  -66.893 33.854  1.00 167.31 ? 155 GLN F NE2 1 
ATOM   8251  N  N   . ASN E 2 156 ? 9.256   -67.425 31.714  1.00 178.45 ? 156 ASN F N   1 
ATOM   8252  C  CA  . ASN E 2 156 ? 8.340   -66.603 30.922  1.00 165.87 ? 156 ASN F CA  1 
ATOM   8253  C  C   . ASN E 2 156 ? 7.200   -66.110 31.810  1.00 154.63 ? 156 ASN F C   1 
ATOM   8254  O  O   . ASN E 2 156 ? 6.699   -66.864 32.647  1.00 151.67 ? 156 ASN F O   1 
ATOM   8255  C  CB  . ASN E 2 156 ? 7.758   -67.424 29.765  1.00 168.15 ? 156 ASN F CB  1 
ATOM   8256  C  CG  . ASN E 2 156 ? 8.827   -68.095 28.920  1.00 167.91 ? 156 ASN F CG  1 
ATOM   8257  O  OD1 . ASN E 2 156 ? 9.602   -68.917 29.410  1.00 165.60 ? 156 ASN F OD1 1 
ATOM   8258  N  ND2 . ASN E 2 156 ? 8.849   -67.772 27.633  1.00 169.80 ? 156 ASN F ND2 1 
ATOM   8259  N  N   . GLY E 2 157 ? 6.788   -64.856 31.630  1.00 147.55 ? 157 GLY F N   1 
ATOM   8260  C  CA  . GLY E 2 157 ? 5.707   -64.289 32.437  1.00 137.07 ? 157 GLY F CA  1 
ATOM   8261  C  C   . GLY E 2 157 ? 6.144   -64.024 33.867  1.00 130.76 ? 157 GLY F C   1 
ATOM   8262  O  O   . GLY E 2 157 ? 5.327   -64.053 34.795  1.00 110.25 ? 157 GLY F O   1 
ATOM   8263  N  N   . VAL E 2 158 ? 7.445   -63.788 34.040  1.00 134.92 ? 158 VAL F N   1 
ATOM   8264  C  CA  . VAL E 2 158 ? 8.011   -63.414 35.338  1.00 131.24 ? 158 VAL F CA  1 
ATOM   8265  C  C   . VAL E 2 158 ? 8.368   -61.927 35.331  1.00 129.02 ? 158 VAL F C   1 
ATOM   8266  O  O   . VAL E 2 158 ? 8.939   -61.427 34.360  1.00 126.48 ? 158 VAL F O   1 
ATOM   8267  C  CB  . VAL E 2 158 ? 9.277   -64.234 35.676  1.00 122.64 ? 158 VAL F CB  1 
ATOM   8268  C  CG1 . VAL E 2 158 ? 9.945   -63.697 36.932  1.00 114.12 ? 158 VAL F CG1 1 
ATOM   8269  C  CG2 . VAL E 2 158 ? 8.932   -65.700 35.860  1.00 127.85 ? 158 VAL F CG2 1 
ATOM   8270  N  N   . LEU E 2 159 ? 8.016   -61.226 36.406  1.00 122.49 ? 159 LEU F N   1 
ATOM   8271  C  CA  . LEU E 2 159 ? 8.350   -59.813 36.546  1.00 118.39 ? 159 LEU F CA  1 
ATOM   8272  C  C   . LEU E 2 159 ? 8.929   -59.512 37.916  1.00 114.81 ? 159 LEU F C   1 
ATOM   8273  O  O   . LEU E 2 159 ? 8.414   -59.961 38.947  1.00 108.28 ? 159 LEU F O   1 
ATOM   8274  C  CB  . LEU E 2 159 ? 7.123   -58.936 36.310  1.00 119.27 ? 159 LEU F CB  1 
ATOM   8275  C  CG  . LEU E 2 159 ? 6.762   -58.745 34.840  1.00 121.64 ? 159 LEU F CG  1 
ATOM   8276  C  CD1 . LEU E 2 159 ? 5.503   -57.902 34.717  1.00 121.12 ? 159 LEU F CD1 1 
ATOM   8277  C  CD2 . LEU E 2 159 ? 7.926   -58.115 34.089  1.00 126.34 ? 159 LEU F CD2 1 
ATOM   8278  N  N   . ASN E 2 160 ? 9.997   -58.725 37.917  1.00 108.72 ? 160 ASN F N   1 
ATOM   8279  C  CA  . ASN E 2 160 ? 10.742  -58.470 39.133  1.00 104.05 ? 160 ASN F CA  1 
ATOM   8280  C  C   . ASN E 2 160 ? 10.728  -56.998 39.522  1.00 97.92  ? 160 ASN F C   1 
ATOM   8281  O  O   . ASN E 2 160 ? 10.546  -56.116 38.677  1.00 96.65  ? 160 ASN F O   1 
ATOM   8282  C  CB  . ASN E 2 160 ? 12.178  -58.961 38.961  1.00 104.30 ? 160 ASN F CB  1 
ATOM   8283  C  CG  . ASN E 2 160 ? 12.268  -60.466 38.873  1.00 102.25 ? 160 ASN F CG  1 
ATOM   8284  O  OD1 . ASN E 2 160 ? 11.284  -61.176 39.079  1.00 114.81 ? 160 ASN F OD1 1 
ATOM   8285  N  ND2 . ASN E 2 160 ? 13.452  -60.964 38.583  1.00 107.85 ? 160 ASN F ND2 1 
ATOM   8286  N  N   . SER E 2 161 ? 10.937  -56.740 40.808  1.00 88.74  ? 161 SER F N   1 
ATOM   8287  C  CA  . SER E 2 161 ? 10.969  -55.380 41.309  1.00 89.17  ? 161 SER F CA  1 
ATOM   8288  C  C   . SER E 2 161 ? 11.869  -55.300 42.536  1.00 95.29  ? 161 SER F C   1 
ATOM   8289  O  O   . SER E 2 161 ? 11.698  -56.063 43.489  1.00 90.41  ? 161 SER F O   1 
ATOM   8290  C  CB  . SER E 2 161 ? 9.557   -54.912 41.658  1.00 86.13  ? 161 SER F CB  1 
ATOM   8291  O  OG  . SER E 2 161 ? 9.379   -53.529 41.370  1.00 85.93  ? 161 SER F OG  1 
ATOM   8292  N  N   . TRP E 2 162 ? 12.836  -54.381 42.501  1.00 101.19 ? 162 TRP F N   1 
ATOM   8293  C  CA  . TRP E 2 162 ? 13.716  -54.147 43.646  1.00 95.46  ? 162 TRP F CA  1 
ATOM   8294  C  C   . TRP E 2 162 ? 13.329  -52.847 44.345  1.00 85.87  ? 162 TRP F C   1 
ATOM   8295  O  O   . TRP E 2 162 ? 12.944  -51.871 43.698  1.00 78.58  ? 162 TRP F O   1 
ATOM   8296  C  CB  . TRP E 2 162 ? 15.183  -54.077 43.200  1.00 101.37 ? 162 TRP F CB  1 
ATOM   8297  C  CG  . TRP E 2 162 ? 15.743  -55.367 42.636  1.00 102.91 ? 162 TRP F CG  1 
ATOM   8298  C  CD1 . TRP E 2 162 ? 16.613  -56.231 43.259  1.00 99.51  ? 162 TRP F CD1 1 
ATOM   8299  C  CD2 . TRP E 2 162 ? 15.518  -55.902 41.316  1.00 101.30 ? 162 TRP F CD2 1 
ATOM   8300  N  NE1 . TRP E 2 162 ? 16.920  -57.278 42.416  1.00 102.09 ? 162 TRP F NE1 1 
ATOM   8301  C  CE2 . TRP E 2 162 ? 16.263  -57.103 41.221  1.00 100.16 ? 162 TRP F CE2 1 
ATOM   8302  C  CE3 . TRP E 2 162 ? 14.755  -55.483 40.208  1.00 97.74  ? 162 TRP F CE3 1 
ATOM   8303  C  CZ2 . TRP E 2 162 ? 16.262  -57.894 40.067  1.00 99.39  ? 162 TRP F CZ2 1 
ATOM   8304  C  CZ3 . TRP E 2 162 ? 14.762  -56.264 39.061  1.00 98.87  ? 162 TRP F CZ3 1 
ATOM   8305  C  CH2 . TRP E 2 162 ? 15.513  -57.458 39.000  1.00 100.51 ? 162 TRP F CH2 1 
ATOM   8306  N  N   . THR E 2 163 ? 13.444  -52.835 45.667  1.00 78.01  ? 163 THR F N   1 
ATOM   8307  C  CA  . THR E 2 163 ? 13.397  -51.584 46.401  1.00 79.35  ? 163 THR F CA  1 
ATOM   8308  C  C   . THR E 2 163 ? 14.746  -50.866 46.367  1.00 83.28  ? 163 THR F C   1 
ATOM   8309  O  O   . THR E 2 163 ? 15.769  -51.465 46.051  1.00 86.58  ? 163 THR F O   1 
ATOM   8310  C  CB  . THR E 2 163 ? 13.031  -51.814 47.872  1.00 76.22  ? 163 THR F CB  1 
ATOM   8311  O  OG1 . THR E 2 163 ? 14.039  -52.607 48.509  1.00 69.17  ? 163 THR F OG1 1 
ATOM   8312  C  CG2 . THR E 2 163 ? 11.679  -52.484 47.983  1.00 77.19  ? 163 THR F CG2 1 
ATOM   8313  N  N   . ASP E 2 164 ? 14.740  -49.581 46.710  1.00 87.94  ? 164 ASP F N   1 
ATOM   8314  C  CA  . ASP E 2 164 ? 15.971  -48.873 47.047  1.00 89.14  ? 164 ASP F CA  1 
ATOM   8315  C  C   . ASP E 2 164 ? 16.492  -49.436 48.352  1.00 81.26  ? 164 ASP F C   1 
ATOM   8316  O  O   . ASP E 2 164 ? 15.765  -50.089 49.094  1.00 77.91  ? 164 ASP F O   1 
ATOM   8317  C  CB  . ASP E 2 164 ? 15.716  -47.374 47.233  1.00 97.54  ? 164 ASP F CB  1 
ATOM   8318  C  CG  . ASP E 2 164 ? 15.305  -46.687 45.954  1.00 109.14 ? 164 ASP F CG  1 
ATOM   8319  O  OD1 . ASP E 2 164 ? 15.497  -47.278 44.870  1.00 128.58 ? 164 ASP F OD1 1 
ATOM   8320  O  OD2 . ASP E 2 164 ? 14.776  -45.560 46.031  1.00 113.10 ? 164 ASP F OD2 1 
ATOM   8321  N  N   . GLN E 2 165 ? 17.748  -49.154 48.652  1.00 78.72  ? 165 GLN F N   1 
ATOM   8322  C  CA  . GLN E 2 165 ? 18.284  -49.509 49.952  1.00 77.19  ? 165 GLN F CA  1 
ATOM   8323  C  C   . GLN E 2 165 ? 17.357  -48.968 51.037  1.00 75.86  ? 165 GLN F C   1 
ATOM   8324  O  O   . GLN E 2 165 ? 16.915  -47.832 50.985  1.00 74.66  ? 165 GLN F O   1 
ATOM   8325  C  CB  . GLN E 2 165 ? 19.701  -48.961 50.110  1.00 79.01  ? 165 GLN F CB  1 
ATOM   8326  C  CG  . GLN E 2 165 ? 20.444  -49.443 51.349  1.00 78.45  ? 165 GLN F CG  1 
ATOM   8327  C  CD  . GLN E 2 165 ? 21.938  -49.213 51.237  1.00 84.35  ? 165 GLN F CD  1 
ATOM   8328  O  OE1 . GLN E 2 165 ? 22.376  -48.135 50.835  1.00 101.17 ? 165 GLN F OE1 1 
ATOM   8329  N  NE2 . GLN E 2 165 ? 22.728  -50.234 51.541  1.00 83.24  ? 165 GLN F NE2 1 
ATOM   8330  N  N   . ASP E 2 166 ? 17.043  -49.799 52.015  1.00 81.11  ? 166 ASP F N   1 
ATOM   8331  C  CA  . ASP E 2 166 ? 16.198  -49.371 53.111  1.00 90.83  ? 166 ASP F CA  1 
ATOM   8332  C  C   . ASP E 2 166 ? 16.940  -48.329 53.939  1.00 88.86  ? 166 ASP F C   1 
ATOM   8333  O  O   . ASP E 2 166 ? 18.141  -48.453 54.160  1.00 92.26  ? 166 ASP F O   1 
ATOM   8334  C  CB  . ASP E 2 166 ? 15.834  -50.567 53.983  1.00 98.61  ? 166 ASP F CB  1 
ATOM   8335  C  CG  . ASP E 2 166 ? 14.701  -50.268 54.933  1.00 106.60 ? 166 ASP F CG  1 
ATOM   8336  O  OD1 . ASP E 2 166 ? 13.533  -50.425 54.512  1.00 118.20 ? 166 ASP F OD1 1 
ATOM   8337  O  OD2 . ASP E 2 166 ? 14.981  -49.891 56.096  1.00 100.44 ? 166 ASP F OD2 1 
ATOM   8338  N  N   . SER E 2 167 ? 16.228  -47.311 54.406  1.00 93.66  ? 167 SER F N   1 
ATOM   8339  C  CA  . SER E 2 167 ? 16.875  -46.176 55.060  1.00 97.39  ? 167 SER F CA  1 
ATOM   8340  C  C   . SER E 2 167 ? 17.292  -46.481 56.498  1.00 101.92 ? 167 SER F C   1 
ATOM   8341  O  O   . SER E 2 167 ? 18.161  -45.811 57.053  1.00 105.58 ? 167 SER F O   1 
ATOM   8342  C  CB  . SER E 2 167 ? 15.958  -44.958 55.047  1.00 96.63  ? 167 SER F CB  1 
ATOM   8343  O  OG  . SER E 2 167 ? 14.681  -45.296 55.558  1.00 100.79 ? 167 SER F OG  1 
ATOM   8344  N  N   . LYS E 2 168 ? 16.689  -47.493 57.108  1.00 105.48 ? 168 LYS F N   1 
ATOM   8345  C  CA  . LYS E 2 168 ? 16.975  -47.772 58.512  1.00 109.61 ? 168 LYS F CA  1 
ATOM   8346  C  C   . LYS E 2 168 ? 17.854  -48.988 58.763  1.00 105.51 ? 168 LYS F C   1 
ATOM   8347  O  O   . LYS E 2 168 ? 18.649  -48.977 59.695  1.00 106.03 ? 168 LYS F O   1 
ATOM   8348  C  CB  . LYS E 2 168 ? 15.685  -47.868 59.314  1.00 121.45 ? 168 LYS F CB  1 
ATOM   8349  C  CG  . LYS E 2 168 ? 15.174  -46.498 59.722  1.00 140.36 ? 168 LYS F CG  1 
ATOM   8350  C  CD  . LYS E 2 168 ? 14.089  -46.578 60.783  1.00 150.10 ? 168 LYS F CD  1 
ATOM   8351  C  CE  . LYS E 2 168 ? 14.165  -45.410 61.758  1.00 150.20 ? 168 LYS F CE  1 
ATOM   8352  N  NZ  . LYS E 2 168 ? 13.947  -44.092 61.099  1.00 150.46 ? 168 LYS F NZ  1 
ATOM   8353  N  N   . ASP E 2 169 ? 17.716  -50.033 57.951  1.00 102.51 ? 169 ASP F N   1 
ATOM   8354  C  CA  . ASP E 2 169 ? 18.571  -51.214 58.090  1.00 97.96  ? 169 ASP F CA  1 
ATOM   8355  C  C   . ASP E 2 169 ? 19.533  -51.431 56.908  1.00 90.92  ? 169 ASP F C   1 
ATOM   8356  O  O   . ASP E 2 169 ? 20.338  -52.345 56.926  1.00 85.01  ? 169 ASP F O   1 
ATOM   8357  C  CB  . ASP E 2 169 ? 17.710  -52.462 58.312  1.00 103.29 ? 169 ASP F CB  1 
ATOM   8358  C  CG  . ASP E 2 169 ? 16.940  -52.872 57.079  1.00 104.90 ? 169 ASP F CG  1 
ATOM   8359  O  OD1 . ASP E 2 169 ? 16.891  -52.095 56.113  1.00 120.33 ? 169 ASP F OD1 1 
ATOM   8360  O  OD2 . ASP E 2 169 ? 16.375  -53.976 57.074  1.00 114.45 ? 169 ASP F OD2 1 
ATOM   8361  N  N   . SER E 2 170 ? 19.432  -50.606 55.874  1.00 91.06  ? 170 SER F N   1 
ATOM   8362  C  CA  . SER E 2 170 ? 20.386  -50.634 54.769  1.00 87.00  ? 170 SER F CA  1 
ATOM   8363  C  C   . SER E 2 170 ? 20.296  -51.912 53.952  1.00 83.90  ? 170 SER F C   1 
ATOM   8364  O  O   . SER E 2 170 ? 21.219  -52.263 53.214  1.00 95.99  ? 170 SER F O   1 
ATOM   8365  C  CB  . SER E 2 170 ? 21.808  -50.469 55.294  1.00 87.40  ? 170 SER F CB  1 
ATOM   8366  O  OG  . SER E 2 170 ? 21.925  -49.301 56.074  1.00 89.09  ? 170 SER F OG  1 
ATOM   8367  N  N   . THR E 2 171 ? 19.178  -52.606 54.058  1.00 79.52  ? 171 THR F N   1 
ATOM   8368  C  CA  . THR E 2 171 ? 19.012  -53.838 53.314  1.00 80.14  ? 171 THR F CA  1 
ATOM   8369  C  C   . THR E 2 171 ? 18.360  -53.560 51.983  1.00 78.90  ? 171 THR F C   1 
ATOM   8370  O  O   . THR E 2 171 ? 17.944  -52.446 51.711  1.00 96.48  ? 171 THR F O   1 
ATOM   8371  C  CB  . THR E 2 171 ? 18.143  -54.828 54.085  1.00 77.58  ? 171 THR F CB  1 
ATOM   8372  O  OG1 . THR E 2 171 ? 16.856  -54.250 54.320  1.00 76.70  ? 171 THR F OG1 1 
ATOM   8373  C  CG2 . THR E 2 171 ? 18.791  -55.169 55.409  1.00 80.70  ? 171 THR F CG2 1 
ATOM   8374  N  N   . TYR E 2 172 ? 18.259  -54.586 51.160  1.00 77.45  ? 172 TYR F N   1 
ATOM   8375  C  CA  . TYR E 2 172 ? 17.456  -54.518 49.961  1.00 81.31  ? 172 TYR F CA  1 
ATOM   8376  C  C   . TYR E 2 172 ? 16.382  -55.588 50.031  1.00 81.78  ? 172 TYR F C   1 
ATOM   8377  O  O   . TYR E 2 172 ? 16.476  -56.507 50.841  1.00 91.03  ? 172 TYR F O   1 
ATOM   8378  C  CB  . TYR E 2 172 ? 18.334  -54.735 48.741  1.00 84.85  ? 172 TYR F CB  1 
ATOM   8379  C  CG  . TYR E 2 172 ? 19.362  -53.658 48.546  1.00 86.86  ? 172 TYR F CG  1 
ATOM   8380  C  CD1 . TYR E 2 172 ? 20.600  -53.730 49.164  1.00 87.89  ? 172 TYR F CD1 1 
ATOM   8381  C  CD2 . TYR E 2 172 ? 19.094  -52.567 47.739  1.00 95.15  ? 172 TYR F CD2 1 
ATOM   8382  C  CE1 . TYR E 2 172 ? 21.544  -52.743 48.981  1.00 95.25  ? 172 TYR F CE1 1 
ATOM   8383  C  CE2 . TYR E 2 172 ? 20.032  -51.573 47.548  1.00 99.62  ? 172 TYR F CE2 1 
ATOM   8384  C  CZ  . TYR E 2 172 ? 21.256  -51.667 48.170  1.00 98.26  ? 172 TYR F CZ  1 
ATOM   8385  O  OH  . TYR E 2 172 ? 22.185  -50.673 47.979  1.00 102.94 ? 172 TYR F OH  1 
ATOM   8386  N  N   . SER E 2 173 ? 15.359  -55.456 49.192  1.00 79.61  ? 173 SER F N   1 
ATOM   8387  C  CA  . SER E 2 173 ? 14.308  -56.462 49.077  1.00 76.46  ? 173 SER F CA  1 
ATOM   8388  C  C   . SER E 2 173 ? 13.819  -56.487 47.627  1.00 81.09  ? 173 SER F C   1 
ATOM   8389  O  O   . SER E 2 173 ? 13.943  -55.491 46.907  1.00 83.45  ? 173 SER F O   1 
ATOM   8390  C  CB  . SER E 2 173 ? 13.149  -56.141 50.027  1.00 72.89  ? 173 SER F CB  1 
ATOM   8391  O  OG  . SER E 2 173 ? 13.614  -55.836 51.338  1.00 67.76  ? 173 SER F OG  1 
ATOM   8392  N  N   . MET E 2 174 ? 13.295  -57.625 47.185  1.00 83.97  ? 174 MET F N   1 
ATOM   8393  C  CA  . MET E 2 174 ? 12.717  -57.709 45.846  1.00 90.39  ? 174 MET F CA  1 
ATOM   8394  C  C   . MET E 2 174 ? 11.545  -58.670 45.786  1.00 94.06  ? 174 MET F C   1 
ATOM   8395  O  O   . MET E 2 174 ? 11.429  -59.578 46.602  1.00 93.98  ? 174 MET F O   1 
ATOM   8396  C  CB  . MET E 2 174 ? 13.765  -58.123 44.817  1.00 93.43  ? 174 MET F CB  1 
ATOM   8397  C  CG  . MET E 2 174 ? 13.859  -59.618 44.564  1.00 98.58  ? 174 MET F CG  1 
ATOM   8398  S  SD  . MET E 2 174 ? 14.661  -59.969 42.978  1.00 110.65 ? 174 MET F SD  1 
ATOM   8399  C  CE  . MET E 2 174 ? 13.253  -60.446 41.982  1.00 103.68 ? 174 MET F CE  1 
ATOM   8400  N  N   . SER E 2 175 ? 10.659  -58.427 44.827  1.00 97.19  ? 175 SER F N   1 
ATOM   8401  C  CA  . SER E 2 175 ? 9.541   -59.307 44.566  1.00 96.36  ? 175 SER F CA  1 
ATOM   8402  C  C   . SER E 2 175 ? 9.787   -59.943 43.225  1.00 95.16  ? 175 SER F C   1 
ATOM   8403  O  O   . SER E 2 175 ? 10.324  -59.299 42.325  1.00 84.27  ? 175 SER F O   1 
ATOM   8404  C  CB  . SER E 2 175 ? 8.229   -58.521 44.496  1.00 98.27  ? 175 SER F CB  1 
ATOM   8405  O  OG  . SER E 2 175 ? 8.006   -58.030 43.176  1.00 91.82  ? 175 SER F OG  1 
ATOM   8406  N  N   . SER E 2 176 ? 9.403   -61.209 43.099  1.00 101.35 ? 176 SER F N   1 
ATOM   8407  C  CA  . SER E 2 176 ? 9.323   -61.843 41.794  1.00 98.10  ? 176 SER F CA  1 
ATOM   8408  C  C   . SER E 2 176 ? 7.939   -62.407 41.599  1.00 96.35  ? 176 SER F C   1 
ATOM   8409  O  O   . SER E 2 176 ? 7.400   -63.048 42.506  1.00 88.28  ? 176 SER F O   1 
ATOM   8410  C  CB  . SER E 2 176 ? 10.358  -62.946 41.651  1.00 95.56  ? 176 SER F CB  1 
ATOM   8411  O  OG  . SER E 2 176 ? 10.498  -63.274 40.280  1.00 95.22  ? 176 SER F OG  1 
ATOM   8412  N  N   . THR E 2 177 ? 7.364   -62.149 40.425  1.00 97.06  ? 177 THR F N   1 
ATOM   8413  C  CA  . THR E 2 177 ? 5.968   -62.468 40.183  1.00 103.41 ? 177 THR F CA  1 
ATOM   8414  C  C   . THR E 2 177 ? 5.800   -63.239 38.899  1.00 104.49 ? 177 THR F C   1 
ATOM   8415  O  O   . THR E 2 177 ? 5.990   -62.714 37.804  1.00 106.74 ? 177 THR F O   1 
ATOM   8416  C  CB  . THR E 2 177 ? 5.081   -61.212 40.127  1.00 114.07 ? 177 THR F CB  1 
ATOM   8417  O  OG1 . THR E 2 177 ? 5.190   -60.504 41.366  1.00 125.69 ? 177 THR F OG1 1 
ATOM   8418  C  CG2 . THR E 2 177 ? 3.620   -61.592 39.893  1.00 113.56 ? 177 THR F CG2 1 
ATOM   8419  N  N   . LEU E 2 178 ? 5.429   -64.499 39.061  1.00 111.22 ? 178 LEU F N   1 
ATOM   8420  C  CA  . LEU E 2 178 ? 5.092   -65.356 37.950  1.00 120.95 ? 178 LEU F CA  1 
ATOM   8421  C  C   . LEU E 2 178 ? 3.603   -65.194 37.671  1.00 116.76 ? 178 LEU F C   1 
ATOM   8422  O  O   . LEU E 2 178 ? 2.763   -65.523 38.514  1.00 102.67 ? 178 LEU F O   1 
ATOM   8423  C  CB  . LEU E 2 178 ? 5.430   -66.807 38.308  1.00 130.88 ? 178 LEU F CB  1 
ATOM   8424  C  CG  . LEU E 2 178 ? 5.171   -67.889 37.263  1.00 131.54 ? 178 LEU F CG  1 
ATOM   8425  C  CD1 . LEU E 2 178 ? 5.735   -67.534 35.893  1.00 128.54 ? 178 LEU F CD1 1 
ATOM   8426  C  CD2 . LEU E 2 178 ? 5.770   -69.187 37.772  1.00 135.69 ? 178 LEU F CD2 1 
ATOM   8427  N  N   . THR E 2 179 ? 3.284   -64.642 36.506  1.00 113.12 ? 179 THR F N   1 
ATOM   8428  C  CA  . THR E 2 179 ? 1.897   -64.455 36.117  1.00 116.18 ? 179 THR F CA  1 
ATOM   8429  C  C   . THR E 2 179 ? 1.538   -65.450 35.048  1.00 120.29 ? 179 THR F C   1 
ATOM   8430  O  O   . THR E 2 179 ? 2.155   -65.476 33.985  1.00 121.86 ? 179 THR F O   1 
ATOM   8431  C  CB  . THR E 2 179 ? 1.646   -63.058 35.546  1.00 123.01 ? 179 THR F CB  1 
ATOM   8432  O  OG1 . THR E 2 179 ? 2.146   -62.074 36.460  1.00 144.79 ? 179 THR F OG1 1 
ATOM   8433  C  CG2 . THR E 2 179 ? 0.157   -62.843 35.306  1.00 115.12 ? 179 THR F CG2 1 
ATOM   8434  N  N   . LEU E 2 180 ? 0.546   -66.281 35.340  1.00 126.72 ? 180 LEU F N   1 
ATOM   8435  C  CA  . LEU E 2 180 ? 0.067   -67.268 34.384  1.00 127.31 ? 180 LEU F CA  1 
ATOM   8436  C  C   . LEU E 2 180 ? -1.415  -67.083 34.172  1.00 123.57 ? 180 LEU F C   1 
ATOM   8437  O  O   . LEU E 2 180 ? -2.083  -66.381 34.937  1.00 114.32 ? 180 LEU F O   1 
ATOM   8438  C  CB  . LEU E 2 180 ? 0.296   -68.685 34.911  1.00 135.63 ? 180 LEU F CB  1 
ATOM   8439  C  CG  . LEU E 2 180 ? 1.676   -69.025 35.473  1.00 141.99 ? 180 LEU F CG  1 
ATOM   8440  C  CD1 . LEU E 2 180 ? 1.597   -70.306 36.296  1.00 145.02 ? 180 LEU F CD1 1 
ATOM   8441  C  CD2 . LEU E 2 180 ? 2.699   -69.139 34.348  1.00 138.88 ? 180 LEU F CD2 1 
ATOM   8442  N  N   . THR E 2 181 ? -1.935  -67.765 33.159  1.00 128.02 ? 181 THR F N   1 
ATOM   8443  C  CA  . THR E 2 181 ? -3.372  -67.978 33.050  1.00 133.72 ? 181 THR F CA  1 
ATOM   8444  C  C   . THR E 2 181 ? -3.789  -69.109 33.996  1.00 133.02 ? 181 THR F C   1 
ATOM   8445  O  O   . THR E 2 181 ? -2.984  -69.981 34.330  1.00 136.09 ? 181 THR F O   1 
ATOM   8446  C  CB  . THR E 2 181 ? -3.800  -68.289 31.595  1.00 132.17 ? 181 THR F CB  1 
ATOM   8447  O  OG1 . THR E 2 181 ? -5.204  -68.584 31.553  1.00 131.58 ? 181 THR F OG1 1 
ATOM   8448  C  CG2 . THR E 2 181 ? -3.012  -69.456 31.019  1.00 131.08 ? 181 THR F CG2 1 
ATOM   8449  N  N   . LYS E 2 182 ? -5.033  -69.066 34.459  1.00 135.89 ? 182 LYS F N   1 
ATOM   8450  C  CA  . LYS E 2 182 ? -5.554  -70.098 35.352  1.00 146.58 ? 182 LYS F CA  1 
ATOM   8451  C  C   . LYS E 2 182 ? -5.317  -71.498 34.776  1.00 154.88 ? 182 LYS F C   1 
ATOM   8452  O  O   . LYS E 2 182 ? -4.995  -72.436 35.509  1.00 149.35 ? 182 LYS F O   1 
ATOM   8453  C  CB  . LYS E 2 182 ? -7.046  -69.877 35.579  1.00 153.00 ? 182 LYS F CB  1 
ATOM   8454  C  CG  . LYS E 2 182 ? -7.679  -70.805 36.602  1.00 154.90 ? 182 LYS F CG  1 
ATOM   8455  C  CD  . LYS E 2 182 ? -9.176  -70.903 36.361  1.00 157.81 ? 182 LYS F CD  1 
ATOM   8456  C  CE  . LYS E 2 182 ? -9.931  -71.384 37.587  1.00 151.07 ? 182 LYS F CE  1 
ATOM   8457  N  NZ  . LYS E 2 182 ? -11.379 -71.070 37.461  1.00 151.79 ? 182 LYS F NZ  1 
ATOM   8458  N  N   . ASP E 2 183 ? -5.495  -71.622 33.463  1.00 157.58 ? 183 ASP F N   1 
ATOM   8459  C  CA  . ASP E 2 183 ? -5.183  -72.846 32.723  1.00 150.81 ? 183 ASP F CA  1 
ATOM   8460  C  C   . ASP E 2 183 ? -3.820  -73.410 33.101  1.00 145.38 ? 183 ASP F C   1 
ATOM   8461  O  O   . ASP E 2 183 ? -3.720  -74.487 33.697  1.00 146.59 ? 183 ASP F O   1 
ATOM   8462  C  CB  . ASP E 2 183 ? -5.174  -72.544 31.220  1.00 145.59 ? 183 ASP F CB  1 
ATOM   8463  C  CG  . ASP E 2 183 ? -6.534  -72.697 30.578  1.00 147.94 ? 183 ASP F CG  1 
ATOM   8464  O  OD1 . ASP E 2 183 ? -7.553  -72.653 31.299  1.00 153.43 ? 183 ASP F OD1 1 
ATOM   8465  O  OD2 . ASP E 2 183 ? -6.584  -72.852 29.343  1.00 143.63 ? 183 ASP F OD2 1 
ATOM   8466  N  N   . GLU E 2 184 ? -2.772  -72.683 32.719  1.00 138.71 ? 184 GLU F N   1 
ATOM   8467  C  CA  . GLU E 2 184 ? -1.398  -73.108 32.965  1.00 135.47 ? 184 GLU F CA  1 
ATOM   8468  C  C   . GLU E 2 184 ? -1.182  -73.429 34.441  1.00 122.93 ? 184 GLU F C   1 
ATOM   8469  O  O   . GLU E 2 184 ? -0.508  -74.397 34.774  1.00 126.92 ? 184 GLU F O   1 
ATOM   8470  C  CB  . GLU E 2 184 ? -0.410  -72.024 32.534  1.00 146.50 ? 184 GLU F CB  1 
ATOM   8471  C  CG  . GLU E 2 184 ? -0.380  -71.731 31.041  1.00 162.50 ? 184 GLU F CG  1 
ATOM   8472  C  CD  . GLU E 2 184 ? 0.236   -70.373 30.718  1.00 188.17 ? 184 GLU F CD  1 
ATOM   8473  O  OE1 . GLU E 2 184 ? 0.222   -69.467 31.585  1.00 197.11 ? 184 GLU F OE1 1 
ATOM   8474  O  OE2 . GLU E 2 184 ? 0.739   -70.205 29.587  1.00 209.81 ? 184 GLU F OE2 1 
ATOM   8475  N  N   . TYR E 2 185 ? -1.774  -72.630 35.320  1.00 115.49 ? 185 TYR F N   1 
ATOM   8476  C  CA  . TYR E 2 185 ? -1.602  -72.827 36.754  1.00 115.68 ? 185 TYR F CA  1 
ATOM   8477  C  C   . TYR E 2 185 ? -2.112  -74.176 37.214  1.00 133.85 ? 185 TYR F C   1 
ATOM   8478  O  O   . TYR E 2 185 ? -1.432  -74.887 37.958  1.00 145.54 ? 185 TYR F O   1 
ATOM   8479  C  CB  . TYR E 2 185 ? -2.341  -71.761 37.542  1.00 107.62 ? 185 TYR F CB  1 
ATOM   8480  C  CG  . TYR E 2 185 ? -2.257  -71.969 39.039  1.00 98.79  ? 185 TYR F CG  1 
ATOM   8481  C  CD1 . TYR E 2 185 ? -1.025  -72.042 39.684  1.00 96.62  ? 185 TYR F CD1 1 
ATOM   8482  C  CD2 . TYR E 2 185 ? -3.404  -72.075 39.805  1.00 93.35  ? 185 TYR F CD2 1 
ATOM   8483  C  CE1 . TYR E 2 185 ? -0.942  -72.216 41.053  1.00 95.12  ? 185 TYR F CE1 1 
ATOM   8484  C  CE2 . TYR E 2 185 ? -3.334  -72.236 41.176  1.00 93.22  ? 185 TYR F CE2 1 
ATOM   8485  C  CZ  . TYR E 2 185 ? -2.107  -72.306 41.796  1.00 94.38  ? 185 TYR F CZ  1 
ATOM   8486  O  OH  . TYR E 2 185 ? -2.061  -72.473 43.167  1.00 97.58  ? 185 TYR F OH  1 
ATOM   8487  N  N   . GLU E 2 186 ? -3.325  -74.518 36.791  1.00 150.34 ? 186 GLU F N   1 
ATOM   8488  C  CA  . GLU E 2 186 ? -3.986  -75.722 37.283  1.00 153.48 ? 186 GLU F CA  1 
ATOM   8489  C  C   . GLU E 2 186 ? -3.396  -76.997 36.680  1.00 146.42 ? 186 GLU F C   1 
ATOM   8490  O  O   . GLU E 2 186 ? -3.685  -78.094 37.152  1.00 145.75 ? 186 GLU F O   1 
ATOM   8491  C  CB  . GLU E 2 186 ? -5.486  -75.653 37.003  1.00 158.48 ? 186 GLU F CB  1 
ATOM   8492  C  CG  . GLU E 2 186 ? -6.221  -74.662 37.889  1.00 156.40 ? 186 GLU F CG  1 
ATOM   8493  C  CD  . GLU E 2 186 ? -7.710  -74.631 37.614  1.00 164.88 ? 186 GLU F CD  1 
ATOM   8494  O  OE1 . GLU E 2 186 ? -8.128  -75.129 36.546  1.00 171.95 ? 186 GLU F OE1 1 
ATOM   8495  O  OE2 . GLU E 2 186 ? -8.464  -74.107 38.461  1.00 166.89 ? 186 GLU F OE2 1 
ATOM   8496  N  N   . ARG E 2 187 ? -2.569  -76.852 35.647  1.00 140.04 ? 187 ARG F N   1 
ATOM   8497  C  CA  . ARG E 2 187 ? -1.939  -78.003 35.008  1.00 137.42 ? 187 ARG F CA  1 
ATOM   8498  C  C   . ARG E 2 187 ? -0.817  -78.591 35.852  1.00 138.60 ? 187 ARG F C   1 
ATOM   8499  O  O   . ARG E 2 187 ? -0.546  -79.789 35.778  1.00 172.07 ? 187 ARG F O   1 
ATOM   8500  C  CB  . ARG E 2 187 ? -1.408  -77.640 33.622  1.00 132.29 ? 187 ARG F CB  1 
ATOM   8501  C  CG  . ARG E 2 187 ? -2.498  -77.210 32.661  1.00 134.63 ? 187 ARG F CG  1 
ATOM   8502  C  CD  . ARG E 2 187 ? -2.203  -77.650 31.239  1.00 142.83 ? 187 ARG F CD  1 
ATOM   8503  N  NE  . ARG E 2 187 ? -2.507  -76.584 30.294  1.00 156.93 ? 187 ARG F NE  1 
ATOM   8504  C  CZ  . ARG E 2 187 ? -1.641  -75.644 29.925  1.00 179.00 ? 187 ARG F CZ  1 
ATOM   8505  N  NH1 . ARG E 2 187 ? -0.401  -75.648 30.405  1.00 192.31 ? 187 ARG F NH1 1 
ATOM   8506  N  NH2 . ARG E 2 187 ? -2.011  -74.699 29.068  1.00 184.14 ? 187 ARG F NH2 1 
ATOM   8507  N  N   . HIS E 2 188 ? -0.175  -77.763 36.666  1.00 124.91 ? 188 HIS F N   1 
ATOM   8508  C  CA  . HIS E 2 188 ? 0.913   -78.238 37.510  1.00 122.06 ? 188 HIS F CA  1 
ATOM   8509  C  C   . HIS E 2 188 ? 0.586   -78.106 38.996  1.00 120.69 ? 188 HIS F C   1 
ATOM   8510  O  O   . HIS E 2 188 ? -0.434  -77.523 39.371  1.00 124.83 ? 188 HIS F O   1 
ATOM   8511  C  CB  . HIS E 2 188 ? 2.199   -77.514 37.144  1.00 121.45 ? 188 HIS F CB  1 
ATOM   8512  C  CG  . HIS E 2 188 ? 2.542   -77.623 35.688  1.00 132.87 ? 188 HIS F CG  1 
ATOM   8513  N  ND1 . HIS E 2 188 ? 3.203   -78.709 35.155  1.00 141.69 ? 188 HIS F ND1 1 
ATOM   8514  C  CD2 . HIS E 2 188 ? 2.270   -76.802 34.645  1.00 138.26 ? 188 HIS F CD2 1 
ATOM   8515  C  CE1 . HIS E 2 188 ? 3.345   -78.543 33.852  1.00 141.45 ? 188 HIS F CE1 1 
ATOM   8516  N  NE2 . HIS E 2 188 ? 2.780   -77.397 33.516  1.00 142.49 ? 188 HIS F NE2 1 
ATOM   8517  N  N   . ASN E 2 189 ? 1.416   -78.715 39.834  1.00 156.64 ? 189 ASN F N   1 
ATOM   8518  C  CA  . ASN E 2 189 ? 1.076   -78.894 41.244  1.00 156.83 ? 189 ASN F CA  1 
ATOM   8519  C  C   . ASN E 2 189 ? 2.100   -78.282 42.186  1.00 147.40 ? 189 ASN F C   1 
ATOM   8520  O  O   . ASN E 2 189 ? 1.731   -77.644 43.164  1.00 141.75 ? 189 ASN F O   1 
ATOM   8521  C  CB  . ASN E 2 189 ? 0.905   -80.383 41.564  1.00 165.55 ? 189 ASN F CB  1 
ATOM   8522  C  CG  . ASN E 2 189 ? 0.213   -80.621 42.896  1.00 172.87 ? 189 ASN F CG  1 
ATOM   8523  O  OD1 . ASN E 2 189 ? -0.944  -80.250 43.083  1.00 178.20 ? 189 ASN F OD1 1 
ATOM   8524  N  ND2 . ASN E 2 189 ? 0.921   -81.251 43.825  1.00 175.70 ? 189 ASN F ND2 1 
ATOM   8525  N  N   . SER E 2 190 ? 3.381   -78.499 41.901  1.00 146.28 ? 190 SER F N   1 
ATOM   8526  C  CA  . SER E 2 190 ? 4.460   -77.962 42.729  1.00 145.62 ? 190 SER F CA  1 
ATOM   8527  C  C   . SER E 2 190 ? 5.035   -76.668 42.139  1.00 145.45 ? 190 SER F C   1 
ATOM   8528  O  O   . SER E 2 190 ? 5.405   -76.617 40.962  1.00 144.95 ? 190 SER F O   1 
ATOM   8529  C  CB  . SER E 2 190 ? 5.571   -79.001 42.887  1.00 144.81 ? 190 SER F CB  1 
ATOM   8530  O  OG  . SER E 2 190 ? 6.611   -78.518 43.719  1.00 138.72 ? 190 SER F OG  1 
ATOM   8531  N  N   . TYR E 2 191 ? 5.107   -75.630 42.967  1.00 140.97 ? 191 TYR F N   1 
ATOM   8532  C  CA  . TYR E 2 191 ? 5.633   -74.335 42.546  1.00 135.07 ? 191 TYR F CA  1 
ATOM   8533  C  C   . TYR E 2 191 ? 6.731   -73.913 43.506  1.00 134.46 ? 191 TYR F C   1 
ATOM   8534  O  O   . TYR E 2 191 ? 6.511   -73.840 44.715  1.00 135.16 ? 191 TYR F O   1 
ATOM   8535  C  CB  . TYR E 2 191 ? 4.519   -73.287 42.517  1.00 128.55 ? 191 TYR F CB  1 
ATOM   8536  C  CG  . TYR E 2 191 ? 3.580   -73.430 41.345  1.00 124.95 ? 191 TYR F CG  1 
ATOM   8537  C  CD1 . TYR E 2 191 ? 3.878   -72.851 40.115  1.00 120.44 ? 191 TYR F CD1 1 
ATOM   8538  C  CD2 . TYR E 2 191 ? 2.407   -74.161 41.458  1.00 124.84 ? 191 TYR F CD2 1 
ATOM   8539  C  CE1 . TYR E 2 191 ? 3.022   -72.979 39.037  1.00 120.09 ? 191 TYR F CE1 1 
ATOM   8540  C  CE2 . TYR E 2 191 ? 1.547   -74.293 40.387  1.00 124.97 ? 191 TYR F CE2 1 
ATOM   8541  C  CZ  . TYR E 2 191 ? 1.861   -73.697 39.181  1.00 122.90 ? 191 TYR F CZ  1 
ATOM   8542  O  OH  . TYR E 2 191 ? 1.027   -73.829 38.100  1.00 123.44 ? 191 TYR F OH  1 
ATOM   8543  N  N   . THR E 2 192 ? 7.917   -73.648 42.972  1.00 131.52 ? 192 THR F N   1 
ATOM   8544  C  CA  . THR E 2 192 ? 9.057   -73.360 43.819  1.00 133.09 ? 192 THR F CA  1 
ATOM   8545  C  C   . THR E 2 192 ? 9.802   -72.126 43.371  1.00 128.57 ? 192 THR F C   1 
ATOM   8546  O  O   . THR E 2 192 ? 10.010  -71.882 42.178  1.00 123.68 ? 192 THR F O   1 
ATOM   8547  C  CB  . THR E 2 192 ? 10.058  -74.521 43.848  1.00 143.34 ? 192 THR F CB  1 
ATOM   8548  O  OG1 . THR E 2 192 ? 10.814  -74.530 42.632  1.00 158.35 ? 192 THR F OG1 1 
ATOM   8549  C  CG2 . THR E 2 192 ? 9.345   -75.838 43.999  1.00 147.63 ? 192 THR F CG2 1 
ATOM   8550  N  N   . CYS E 2 193 ? 10.215  -71.359 44.365  1.00 130.43 ? 193 CYS F N   1 
ATOM   8551  C  CA  . CYS E 2 193 ? 10.913  -70.111 44.153  1.00 130.64 ? 193 CYS F CA  1 
ATOM   8552  C  C   . CYS E 2 193 ? 12.290  -70.270 44.762  1.00 123.04 ? 193 CYS F C   1 
ATOM   8553  O  O   . CYS E 2 193 ? 12.416  -70.629 45.930  1.00 124.14 ? 193 CYS F O   1 
ATOM   8554  C  CB  . CYS E 2 193 ? 10.140  -68.995 44.849  1.00 137.65 ? 193 CYS F CB  1 
ATOM   8555  S  SG  . CYS E 2 193 ? 10.927  -67.383 44.877  1.00 138.42 ? 193 CYS F SG  1 
ATOM   8556  N  N   . GLU E 2 194 ? 13.321  -70.023 43.968  1.00 117.89 ? 194 GLU F N   1 
ATOM   8557  C  CA  . GLU E 2 194 ? 14.667  -70.394 44.356  1.00 120.10 ? 194 GLU F CA  1 
ATOM   8558  C  C   . GLU E 2 194 ? 15.620  -69.211 44.259  1.00 115.24 ? 194 GLU F C   1 
ATOM   8559  O  O   . GLU E 2 194 ? 15.820  -68.640 43.180  1.00 107.66 ? 194 GLU F O   1 
ATOM   8560  C  CB  . GLU E 2 194 ? 15.155  -71.531 43.468  1.00 129.90 ? 194 GLU F CB  1 
ATOM   8561  C  CG  . GLU E 2 194 ? 16.535  -72.051 43.825  1.00 135.41 ? 194 GLU F CG  1 
ATOM   8562  C  CD  . GLU E 2 194 ? 17.084  -72.971 42.751  1.00 141.45 ? 194 GLU F CD  1 
ATOM   8563  O  OE1 . GLU E 2 194 ? 16.329  -73.857 42.295  1.00 146.38 ? 194 GLU F OE1 1 
ATOM   8564  O  OE2 . GLU E 2 194 ? 18.252  -72.781 42.335  1.00 140.90 ? 194 GLU F OE2 1 
ATOM   8565  N  N   . ALA E 2 195 ? 16.241  -68.887 45.388  1.00 115.67 ? 195 ALA F N   1 
ATOM   8566  C  CA  . ALA E 2 195 ? 17.053  -67.680 45.515  1.00 115.52 ? 195 ALA F CA  1 
ATOM   8567  C  C   . ALA E 2 195 ? 18.536  -67.986 45.676  1.00 117.73 ? 195 ALA F C   1 
ATOM   8568  O  O   . ALA E 2 195 ? 18.940  -68.697 46.599  1.00 116.28 ? 195 ALA F O   1 
ATOM   8569  C  CB  . ALA E 2 195 ? 16.578  -66.860 46.701  1.00 114.09 ? 195 ALA F CB  1 
ATOM   8570  N  N   . THR E 2 196 ? 19.348  -67.403 44.801  1.00 118.34 ? 196 THR F N   1 
ATOM   8571  C  CA  . THR E 2 196 ? 20.789  -67.512 44.922  1.00 118.63 ? 196 THR F CA  1 
ATOM   8572  C  C   . THR E 2 196 ? 21.406  -66.184 45.364  1.00 112.76 ? 196 THR F C   1 
ATOM   8573  O  O   . THR E 2 196 ? 21.393  -65.197 44.622  1.00 102.46 ? 196 THR F O   1 
ATOM   8574  C  CB  . THR E 2 196 ? 21.416  -67.976 43.599  1.00 120.50 ? 196 THR F CB  1 
ATOM   8575  O  OG1 . THR E 2 196 ? 20.940  -69.289 43.295  1.00 126.07 ? 196 THR F OG1 1 
ATOM   8576  C  CG2 . THR E 2 196 ? 22.933  -67.999 43.703  1.00 121.05 ? 196 THR F CG2 1 
ATOM   8577  N  N   . HIS E 2 197 ? 21.954  -66.191 46.579  1.00 110.47 ? 197 HIS F N   1 
ATOM   8578  C  CA  . HIS E 2 197 ? 22.611  -65.034 47.153  1.00 108.15 ? 197 HIS F CA  1 
ATOM   8579  C  C   . HIS E 2 197 ? 23.979  -65.474 47.646  1.00 110.15 ? 197 HIS F C   1 
ATOM   8580  O  O   . HIS E 2 197 ? 24.175  -66.619 48.038  1.00 109.55 ? 197 HIS F O   1 
ATOM   8581  C  CB  . HIS E 2 197 ? 21.780  -64.470 48.315  1.00 107.32 ? 197 HIS F CB  1 
ATOM   8582  C  CG  . HIS E 2 197 ? 22.142  -63.065 48.717  1.00 104.62 ? 197 HIS F CG  1 
ATOM   8583  N  ND1 . HIS E 2 197 ? 22.553  -62.739 49.994  1.00 102.08 ? 197 HIS F ND1 1 
ATOM   8584  C  CD2 . HIS E 2 197 ? 22.134  -61.904 48.019  1.00 100.90 ? 197 HIS F CD2 1 
ATOM   8585  C  CE1 . HIS E 2 197 ? 22.808  -61.446 50.058  1.00 99.61  ? 197 HIS F CE1 1 
ATOM   8586  N  NE2 . HIS E 2 197 ? 22.565  -60.916 48.872  1.00 100.16 ? 197 HIS F NE2 1 
ATOM   8587  N  N   . LYS E 2 198 ? 24.917  -64.541 47.636  1.00 115.95 ? 198 LYS F N   1 
ATOM   8588  C  CA  . LYS E 2 198 ? 26.289  -64.824 48.024  1.00 120.51 ? 198 LYS F CA  1 
ATOM   8589  C  C   . LYS E 2 198 ? 26.429  -65.316 49.476  1.00 122.19 ? 198 LYS F C   1 
ATOM   8590  O  O   . LYS E 2 198 ? 27.428  -65.934 49.806  1.00 128.57 ? 198 LYS F O   1 
ATOM   8591  C  CB  . LYS E 2 198 ? 27.158  -63.585 47.791  1.00 121.89 ? 198 LYS F CB  1 
ATOM   8592  C  CG  . LYS E 2 198 ? 27.534  -62.820 49.043  1.00 124.12 ? 198 LYS F CG  1 
ATOM   8593  C  CD  . LYS E 2 198 ? 28.628  -61.826 48.719  1.00 131.66 ? 198 LYS F CD  1 
ATOM   8594  C  CE  . LYS E 2 198 ? 28.966  -60.962 49.918  1.00 139.28 ? 198 LYS F CE  1 
ATOM   8595  N  NZ  . LYS E 2 198 ? 29.740  -59.744 49.540  1.00 147.62 ? 198 LYS F NZ  1 
ATOM   8596  N  N   . THR E 2 199 ? 25.435  -65.063 50.330  1.00 120.96 ? 199 THR F N   1 
ATOM   8597  C  CA  . THR E 2 199 ? 25.504  -65.443 51.755  1.00 119.57 ? 199 THR F CA  1 
ATOM   8598  C  C   . THR E 2 199 ? 25.500  -66.948 51.983  1.00 123.69 ? 199 THR F C   1 
ATOM   8599  O  O   . THR E 2 199 ? 25.801  -67.420 53.080  1.00 121.00 ? 199 THR F O   1 
ATOM   8600  C  CB  . THR E 2 199 ? 24.315  -64.881 52.560  1.00 116.14 ? 199 THR F CB  1 
ATOM   8601  O  OG1 . THR E 2 199 ? 23.092  -65.090 51.839  1.00 113.97 ? 199 THR F OG1 1 
ATOM   8602  C  CG2 . THR E 2 199 ? 24.498  -63.419 52.813  1.00 115.70 ? 199 THR F CG2 1 
ATOM   8603  N  N   . SER E 2 200 ? 25.087  -67.695 50.969  1.00 128.56 ? 200 SER F N   1 
ATOM   8604  C  CA  . SER E 2 200 ? 25.178  -69.138 51.020  1.00 134.73 ? 200 SER F CA  1 
ATOM   8605  C  C   . SER E 2 200 ? 25.464  -69.683 49.627  1.00 138.64 ? 200 SER F C   1 
ATOM   8606  O  O   . SER E 2 200 ? 25.008  -69.139 48.619  1.00 131.51 ? 200 SER F O   1 
ATOM   8607  C  CB  . SER E 2 200 ? 23.894  -69.749 51.586  1.00 135.97 ? 200 SER F CB  1 
ATOM   8608  O  OG  . SER E 2 200 ? 24.092  -71.120 51.887  1.00 140.83 ? 200 SER F OG  1 
ATOM   8609  N  N   . THR E 2 201 ? 26.244  -70.756 49.582  1.00 145.67 ? 201 THR F N   1 
ATOM   8610  C  CA  . THR E 2 201 ? 26.577  -71.410 48.326  1.00 144.64 ? 201 THR F CA  1 
ATOM   8611  C  C   . THR E 2 201 ? 25.369  -72.198 47.827  1.00 140.52 ? 201 THR F C   1 
ATOM   8612  O  O   . THR E 2 201 ? 25.209  -72.423 46.627  1.00 139.72 ? 201 THR F O   1 
ATOM   8613  C  CB  . THR E 2 201 ? 27.752  -72.379 48.512  1.00 145.63 ? 201 THR F CB  1 
ATOM   8614  O  OG1 . THR E 2 201 ? 27.333  -73.466 49.344  1.00 150.09 ? 201 THR F OG1 1 
ATOM   8615  C  CG2 . THR E 2 201 ? 28.941  -71.674 49.156  1.00 145.84 ? 201 THR F CG2 1 
ATOM   8616  N  N   . SER E 2 202 ? 24.519  -72.608 48.762  1.00 135.13 ? 202 SER F N   1 
ATOM   8617  C  CA  . SER E 2 202 ? 23.340  -73.389 48.433  1.00 132.80 ? 202 SER F CA  1 
ATOM   8618  C  C   . SER E 2 202 ? 22.098  -72.515 48.381  1.00 126.73 ? 202 SER F C   1 
ATOM   8619  O  O   . SER E 2 202 ? 21.767  -71.854 49.373  1.00 121.56 ? 202 SER F O   1 
ATOM   8620  C  CB  . SER E 2 202 ? 23.140  -74.481 49.478  1.00 138.47 ? 202 SER F CB  1 
ATOM   8621  O  OG  . SER E 2 202 ? 23.302  -73.958 50.786  1.00 139.11 ? 202 SER F OG  1 
ATOM   8622  N  N   . PRO E 2 203 ? 21.391  -72.528 47.233  1.00 124.22 ? 203 PRO F N   1 
ATOM   8623  C  CA  . PRO E 2 203 ? 20.186  -71.730 47.057  1.00 124.12 ? 203 PRO F CA  1 
ATOM   8624  C  C   . PRO E 2 203 ? 19.228  -71.809 48.248  1.00 127.23 ? 203 PRO F C   1 
ATOM   8625  O  O   . PRO E 2 203 ? 19.229  -72.802 48.986  1.00 123.87 ? 203 PRO F O   1 
ATOM   8626  C  CB  . PRO E 2 203 ? 19.547  -72.336 45.802  1.00 121.60 ? 203 PRO F CB  1 
ATOM   8627  C  CG  . PRO E 2 203 ? 20.705  -72.819 45.000  1.00 121.65 ? 203 PRO F CG  1 
ATOM   8628  C  CD  . PRO E 2 203 ? 21.761  -73.239 45.994  1.00 123.76 ? 203 PRO F CD  1 
ATOM   8629  N  N   . ILE E 2 204 ? 18.461  -70.737 48.451  1.00 129.13 ? 204 ILE F N   1 
ATOM   8630  C  CA  . ILE E 2 204 ? 17.319  -70.760 49.358  1.00 126.90 ? 204 ILE F CA  1 
ATOM   8631  C  C   . ILE E 2 204 ? 16.056  -70.954 48.532  1.00 123.65 ? 204 ILE F C   1 
ATOM   8632  O  O   . ILE E 2 204 ? 15.812  -70.250 47.548  1.00 116.72 ? 204 ILE F O   1 
ATOM   8633  C  CB  . ILE E 2 204 ? 17.193  -69.471 50.192  1.00 124.65 ? 204 ILE F CB  1 
ATOM   8634  C  CG1 . ILE E 2 204 ? 18.468  -69.234 51.001  1.00 128.44 ? 204 ILE F CG1 1 
ATOM   8635  C  CG2 . ILE E 2 204 ? 16.001  -69.565 51.135  1.00 124.00 ? 204 ILE F CG2 1 
ATOM   8636  C  CD1 . ILE E 2 204 ? 18.404  -68.024 51.907  1.00 129.19 ? 204 ILE F CD1 1 
ATOM   8637  N  N   . VAL E 2 205 ? 15.258  -71.929 48.934  1.00 123.68 ? 205 VAL F N   1 
ATOM   8638  C  CA  . VAL E 2 205 ? 14.148  -72.357 48.118  1.00 120.48 ? 205 VAL F CA  1 
ATOM   8639  C  C   . VAL E 2 205 ? 12.891  -72.476 48.975  1.00 115.54 ? 205 VAL F C   1 
ATOM   8640  O  O   . VAL E 2 205 ? 12.903  -73.136 50.009  1.00 112.58 ? 205 VAL F O   1 
ATOM   8641  C  CB  . VAL E 2 205 ? 14.477  -73.691 47.422  1.00 121.11 ? 205 VAL F CB  1 
ATOM   8642  C  CG1 . VAL E 2 205 ? 15.020  -74.697 48.430  1.00 124.26 ? 205 VAL F CG1 1 
ATOM   8643  C  CG2 . VAL E 2 205 ? 13.255  -74.229 46.697  1.00 122.49 ? 205 VAL F CG2 1 
ATOM   8644  N  N   . LYS E 2 206 ? 11.836  -71.773 48.572  1.00 111.82 ? 206 LYS F N   1 
ATOM   8645  C  CA  . LYS E 2 206 ? 10.517  -71.977 49.140  1.00 112.83 ? 206 LYS F CA  1 
ATOM   8646  C  C   . LYS E 2 206 ? 9.603   -72.531 48.076  1.00 115.09 ? 206 LYS F C   1 
ATOM   8647  O  O   . LYS E 2 206 ? 9.628   -72.098 46.920  1.00 109.57 ? 206 LYS F O   1 
ATOM   8648  C  CB  . LYS E 2 206 ? 9.929   -70.677 49.680  1.00 113.07 ? 206 LYS F CB  1 
ATOM   8649  C  CG  . LYS E 2 206 ? 10.635  -70.136 50.908  1.00 114.25 ? 206 LYS F CG  1 
ATOM   8650  C  CD  . LYS E 2 206 ? 11.092  -71.255 51.827  1.00 117.49 ? 206 LYS F CD  1 
ATOM   8651  C  CE  . LYS E 2 206 ? 11.806  -70.708 53.046  1.00 119.76 ? 206 LYS F CE  1 
ATOM   8652  N  NZ  . LYS E 2 206 ? 10.867  -69.949 53.910  1.00 123.05 ? 206 LYS F NZ  1 
ATOM   8653  N  N   . SER E 2 207 ? 8.789   -73.495 48.479  1.00 121.11 ? 207 SER F N   1 
ATOM   8654  C  CA  . SER E 2 207 ? 7.908   -74.157 47.557  1.00 126.09 ? 207 SER F CA  1 
ATOM   8655  C  C   . SER E 2 207 ? 6.505   -74.284 48.142  1.00 124.73 ? 207 SER F C   1 
ATOM   8656  O  O   . SER E 2 207 ? 6.290   -74.053 49.335  1.00 118.83 ? 207 SER F O   1 
ATOM   8657  C  CB  . SER E 2 207 ? 8.469   -75.530 47.230  1.00 134.83 ? 207 SER F CB  1 
ATOM   8658  O  OG  . SER E 2 207 ? 7.603   -76.207 46.341  1.00 162.17 ? 207 SER F OG  1 
ATOM   8659  N  N   . PHE E 2 208 ? 5.548   -74.617 47.281  1.00 127.74 ? 208 PHE F N   1 
ATOM   8660  C  CA  . PHE E 2 208 ? 4.230   -75.037 47.731  1.00 137.18 ? 208 PHE F CA  1 
ATOM   8661  C  C   . PHE E 2 208 ? 3.567   -75.926 46.689  1.00 144.78 ? 208 PHE F C   1 
ATOM   8662  O  O   . PHE E 2 208 ? 3.833   -75.798 45.490  1.00 142.79 ? 208 PHE F O   1 
ATOM   8663  C  CB  . PHE E 2 208 ? 3.344   -73.826 48.029  1.00 139.43 ? 208 PHE F CB  1 
ATOM   8664  C  CG  . PHE E 2 208 ? 2.724   -73.198 46.804  1.00 141.81 ? 208 PHE F CG  1 
ATOM   8665  C  CD1 . PHE E 2 208 ? 1.582   -73.736 46.232  1.00 146.97 ? 208 PHE F CD1 1 
ATOM   8666  C  CD2 . PHE E 2 208 ? 3.256   -72.044 46.253  1.00 140.34 ? 208 PHE F CD2 1 
ATOM   8667  C  CE1 . PHE E 2 208 ? 1.003   -73.153 45.114  1.00 146.33 ? 208 PHE F CE1 1 
ATOM   8668  C  CE2 . PHE E 2 208 ? 2.684   -71.458 45.136  1.00 140.02 ? 208 PHE F CE2 1 
ATOM   8669  C  CZ  . PHE E 2 208 ? 1.553   -72.011 44.569  1.00 143.17 ? 208 PHE F CZ  1 
ATOM   8670  N  N   . ASN E 2 209 ? 2.704   -76.826 47.155  1.00 152.48 ? 209 ASN F N   1 
ATOM   8671  C  CA  . ASN E 2 209 ? 1.907   -77.665 46.262  1.00 157.68 ? 209 ASN F CA  1 
ATOM   8672  C  C   . ASN E 2 209 ? 0.477   -77.153 46.147  1.00 159.54 ? 209 ASN F C   1 
ATOM   8673  O  O   . ASN E 2 209 ? -0.145  -76.807 47.151  1.00 162.22 ? 209 ASN F O   1 
ATOM   8674  C  CB  . ASN E 2 209 ? 1.900   -79.112 46.753  1.00 162.39 ? 209 ASN F CB  1 
ATOM   8675  C  CG  . ASN E 2 209 ? 3.253   -79.773 46.620  1.00 161.37 ? 209 ASN F CG  1 
ATOM   8676  O  OD1 . ASN E 2 209 ? 4.194   -79.183 46.086  1.00 156.20 ? 209 ASN F OD1 1 
ATOM   8677  N  ND2 . ASN E 2 209 ? 3.362   -81.005 47.113  1.00 161.47 ? 209 ASN F ND2 1 
ATOM   8678  N  N   . ARG E 2 210 ? -0.039  -77.120 44.920  1.00 157.21 ? 210 ARG F N   1 
ATOM   8679  C  CA  . ARG E 2 210 ? -1.348  -76.525 44.641  1.00 155.65 ? 210 ARG F CA  1 
ATOM   8680  C  C   . ARG E 2 210 ? -2.440  -77.142 45.508  1.00 164.12 ? 210 ARG F C   1 
ATOM   8681  O  O   . ARG E 2 210 ? -3.435  -76.494 45.831  1.00 165.28 ? 210 ARG F O   1 
ATOM   8682  C  CB  . ARG E 2 210 ? -1.696  -76.682 43.158  1.00 150.90 ? 210 ARG F CB  1 
ATOM   8683  C  CG  . ARG E 2 210 ? -2.832  -75.786 42.697  1.00 150.42 ? 210 ARG F CG  1 
ATOM   8684  C  CD  . ARG E 2 210 ? -2.813  -75.614 41.187  1.00 149.56 ? 210 ARG F CD  1 
ATOM   8685  N  NE  . ARG E 2 210 ? -2.625  -76.892 40.525  1.00 149.34 ? 210 ARG F NE  1 
ATOM   8686  C  CZ  . ARG E 2 210 ? -3.567  -77.819 40.441  1.00 152.65 ? 210 ARG F CZ  1 
ATOM   8687  N  NH1 . ARG E 2 210 ? -4.764  -77.597 40.966  1.00 153.70 ? 210 ARG F NH1 1 
ATOM   8688  N  NH2 . ARG E 2 210 ? -3.308  -78.968 39.833  1.00 155.26 ? 210 ARG F NH2 1 
ATOM   8689  N  N   . ASN E 2 211 ? -2.227  -78.396 45.893  1.00 173.85 ? 211 ASN F N   1 
ATOM   8690  C  CA  . ASN E 2 211 ? -3.168  -79.154 46.708  1.00 176.50 ? 211 ASN F CA  1 
ATOM   8691  C  C   . ASN E 2 211 ? -3.489  -78.443 48.023  1.00 180.01 ? 211 ASN F C   1 
ATOM   8692  O  O   . ASN E 2 211 ? -2.796  -77.517 48.445  1.00 176.62 ? 211 ASN F O   1 
ATOM   8693  C  CB  . ASN E 2 211 ? -2.590  -80.543 46.982  1.00 171.85 ? 211 ASN F CB  1 
ATOM   8694  C  CG  . ASN E 2 211 ? -2.327  -81.326 45.707  1.00 171.50 ? 211 ASN F CG  1 
ATOM   8695  O  OD1 . ASN E 2 211 ? -2.958  -81.093 44.675  1.00 166.23 ? 211 ASN F OD1 1 
ATOM   8696  N  ND2 . ASN E 2 211 ? -1.411  -82.278 45.782  1.00 177.15 ? 211 ASN F ND2 1 
ATOM   8697  O  OXT . ASN E 2 211 ? -4.468  -78.762 48.691  1.00 187.63 ? 211 ASN F OXT 1 
ATOM   8698  N  N   . GLU F 3 1   ? 15.104  -17.125 50.251  1.00 162.76 ? 1   GLU G N   1 
ATOM   8699  C  CA  . GLU F 3 1   ? 14.951  -18.547 49.837  1.00 150.71 ? 1   GLU G CA  1 
ATOM   8700  C  C   . GLU F 3 1   ? 14.449  -18.610 48.404  1.00 136.50 ? 1   GLU G C   1 
ATOM   8701  O  O   . GLU F 3 1   ? 13.251  -18.471 48.151  1.00 138.28 ? 1   GLU G O   1 
ATOM   8702  C  CB  . GLU F 3 1   ? 13.982  -19.269 50.774  1.00 159.80 ? 1   GLU G CB  1 
ATOM   8703  C  CG  . GLU F 3 1   ? 13.746  -20.734 50.441  1.00 160.17 ? 1   GLU G CG  1 
ATOM   8704  C  CD  . GLU F 3 1   ? 12.926  -21.432 51.511  1.00 167.67 ? 1   GLU G CD  1 
ATOM   8705  O  OE1 . GLU F 3 1   ? 12.122  -22.319 51.163  1.00 171.76 ? 1   GLU G OE1 1 
ATOM   8706  O  OE2 . GLU F 3 1   ? 13.081  -21.085 52.704  1.00 161.66 ? 1   GLU G OE2 1 
ATOM   8707  N  N   . VAL F 3 2   ? 15.379  -18.782 47.471  1.00 116.16 ? 2   VAL G N   1 
ATOM   8708  C  CA  . VAL F 3 2   ? 15.030  -18.993 46.074  1.00 98.84  ? 2   VAL G CA  1 
ATOM   8709  C  C   . VAL F 3 2   ? 14.220  -20.273 45.914  1.00 91.78  ? 2   VAL G C   1 
ATOM   8710  O  O   . VAL F 3 2   ? 14.456  -21.252 46.623  1.00 93.10  ? 2   VAL G O   1 
ATOM   8711  C  CB  . VAL F 3 2   ? 16.283  -19.119 45.221  1.00 91.22  ? 2   VAL G CB  1 
ATOM   8712  C  CG1 . VAL F 3 2   ? 15.924  -19.611 43.830  1.00 94.11  ? 2   VAL G CG1 1 
ATOM   8713  C  CG2 . VAL F 3 2   ? 16.993  -17.787 45.163  1.00 86.95  ? 2   VAL G CG2 1 
ATOM   8714  N  N   . GLN F 3 3   ? 13.263  -20.257 44.989  1.00 79.02  ? 3   GLN G N   1 
ATOM   8715  C  CA  . GLN F 3 3   ? 12.412  -21.407 44.755  1.00 72.26  ? 3   GLN G CA  1 
ATOM   8716  C  C   . GLN F 3 3   ? 11.885  -21.467 43.345  1.00 65.27  ? 3   GLN G C   1 
ATOM   8717  O  O   . GLN F 3 3   ? 11.363  -20.495 42.827  1.00 67.43  ? 3   GLN G O   1 
ATOM   8718  C  CB  . GLN F 3 3   ? 11.230  -21.385 45.692  1.00 78.47  ? 3   GLN G CB  1 
ATOM   8719  C  CG  . GLN F 3 3   ? 11.536  -21.923 47.068  1.00 91.38  ? 3   GLN G CG  1 
ATOM   8720  C  CD  . GLN F 3 3   ? 10.267  -22.315 47.781  1.00 115.02 ? 3   GLN G CD  1 
ATOM   8721  O  OE1 . GLN F 3 3   ? 9.322   -22.818 47.159  1.00 115.59 ? 3   GLN G OE1 1 
ATOM   8722  N  NE2 . GLN F 3 3   ? 10.219  -22.064 49.086  1.00 137.74 ? 3   GLN G NE2 1 
ATOM   8723  N  N   . LEU F 3 4   ? 11.988  -22.640 42.742  1.00 68.66  ? 4   LEU G N   1 
ATOM   8724  C  CA  . LEU F 3 4   ? 11.396  -22.893 41.439  1.00 71.70  ? 4   LEU G CA  1 
ATOM   8725  C  C   . LEU F 3 4   ? 10.296  -23.917 41.632  1.00 75.97  ? 4   LEU G C   1 
ATOM   8726  O  O   . LEU F 3 4   ? 10.546  -25.027 42.093  1.00 76.83  ? 4   LEU G O   1 
ATOM   8727  C  CB  . LEU F 3 4   ? 12.439  -23.430 40.470  1.00 71.99  ? 4   LEU G CB  1 
ATOM   8728  C  CG  . LEU F 3 4   ? 13.435  -22.413 39.907  1.00 68.17  ? 4   LEU G CG  1 
ATOM   8729  C  CD1 . LEU F 3 4   ? 14.181  -21.680 41.003  1.00 72.25  ? 4   LEU G CD1 1 
ATOM   8730  C  CD2 . LEU F 3 4   ? 14.424  -23.131 39.026  1.00 69.44  ? 4   LEU G CD2 1 
ATOM   8731  N  N   . GLN F 3 5   ? 9.074   -23.521 41.305  1.00 78.95  ? 5   GLN G N   1 
ATOM   8732  C  CA  . GLN F 3 5   ? 7.907   -24.330 41.561  1.00 76.89  ? 5   GLN G CA  1 
ATOM   8733  C  C   . GLN F 3 5   ? 7.400   -24.814 40.219  1.00 74.85  ? 5   GLN G C   1 
ATOM   8734  O  O   . GLN F 3 5   ? 6.891   -24.031 39.426  1.00 80.49  ? 5   GLN G O   1 
ATOM   8735  C  CB  . GLN F 3 5   ? 6.837   -23.481 42.247  1.00 93.81  ? 5   GLN G CB  1 
ATOM   8736  C  CG  . GLN F 3 5   ? 5.634   -24.251 42.768  1.00 111.03 ? 5   GLN G CG  1 
ATOM   8737  C  CD  . GLN F 3 5   ? 5.975   -25.128 43.956  1.00 123.19 ? 5   GLN G CD  1 
ATOM   8738  O  OE1 . GLN F 3 5   ? 7.088   -25.074 44.484  1.00 145.90 ? 5   GLN G OE1 1 
ATOM   8739  N  NE2 . GLN F 3 5   ? 5.015   -25.937 44.389  1.00 124.71 ? 5   GLN G NE2 1 
ATOM   8740  N  N   . GLN F 3 6   ? 7.543   -26.103 39.947  1.00 73.57  ? 6   GLN G N   1 
ATOM   8741  C  CA  . GLN F 3 6   ? 7.038   -26.656 38.690  1.00 69.88  ? 6   GLN G CA  1 
ATOM   8742  C  C   . GLN F 3 6   ? 5.589   -27.101 38.812  1.00 73.49  ? 6   GLN G C   1 
ATOM   8743  O  O   . GLN F 3 6   ? 5.074   -27.354 39.916  1.00 69.89  ? 6   GLN G O   1 
ATOM   8744  C  CB  . GLN F 3 6   ? 7.920   -27.806 38.197  1.00 65.74  ? 6   GLN G CB  1 
ATOM   8745  C  CG  . GLN F 3 6   ? 9.242   -27.303 37.670  1.00 66.90  ? 6   GLN G CG  1 
ATOM   8746  C  CD  . GLN F 3 6   ? 10.213  -28.402 37.354  1.00 64.88  ? 6   GLN G CD  1 
ATOM   8747  O  OE1 . GLN F 3 6   ? 11.131  -28.680 38.128  1.00 64.24  ? 6   GLN G OE1 1 
ATOM   8748  N  NE2 . GLN F 3 6   ? 10.026  -29.036 36.207  1.00 72.60  ? 6   GLN G NE2 1 
ATOM   8749  N  N   . SER F 3 7   ? 4.933   -27.178 37.661  1.00 71.46  ? 7   SER G N   1 
ATOM   8750  C  CA  . SER F 3 7   ? 3.567   -27.650 37.594  1.00 72.95  ? 7   SER G CA  1 
ATOM   8751  C  C   . SER F 3 7   ? 3.544   -29.153 37.774  1.00 80.02  ? 7   SER G C   1 
ATOM   8752  O  O   . SER F 3 7   ? 4.573   -29.822 37.694  1.00 91.55  ? 7   SER G O   1 
ATOM   8753  C  CB  . SER F 3 7   ? 2.931   -27.280 36.252  1.00 72.05  ? 7   SER G CB  1 
ATOM   8754  O  OG  . SER F 3 7   ? 3.812   -27.532 35.173  1.00 65.12  ? 7   SER G OG  1 
ATOM   8755  N  N   . GLY F 3 8   ? 2.353   -29.685 37.988  1.00 84.51  ? 8   GLY G N   1 
ATOM   8756  C  CA  . GLY F 3 8   ? 2.213   -31.070 38.389  1.00 85.30  ? 8   GLY G CA  1 
ATOM   8757  C  C   . GLY F 3 8   ? 2.479   -32.055 37.274  1.00 78.47  ? 8   GLY G C   1 
ATOM   8758  O  O   . GLY F 3 8   ? 2.711   -31.665 36.129  1.00 72.21  ? 8   GLY G O   1 
ATOM   8759  N  N   . PRO F 3 9   ? 2.415   -33.348 37.605  1.00 75.65  ? 9   PRO G N   1 
ATOM   8760  C  CA  . PRO F 3 9   ? 2.622   -34.403 36.643  1.00 74.34  ? 9   PRO G CA  1 
ATOM   8761  C  C   . PRO F 3 9   ? 1.616   -34.314 35.516  1.00 75.54  ? 9   PRO G C   1 
ATOM   8762  O  O   . PRO F 3 9   ? 0.501   -33.851 35.732  1.00 84.76  ? 9   PRO G O   1 
ATOM   8763  C  CB  . PRO F 3 9   ? 2.384   -35.656 37.466  1.00 77.84  ? 9   PRO G CB  1 
ATOM   8764  C  CG  . PRO F 3 9   ? 1.450   -35.225 38.536  1.00 77.41  ? 9   PRO G CG  1 
ATOM   8765  C  CD  . PRO F 3 9   ? 1.932   -33.867 38.894  1.00 75.40  ? 9   PRO G CD  1 
ATOM   8766  N  N   . GLU F 3 10  ? 2.022   -34.726 34.321  1.00 78.09  ? 10  GLU G N   1 
ATOM   8767  C  CA  . GLU F 3 10  ? 1.166   -34.637 33.155  1.00 87.43  ? 10  GLU G CA  1 
ATOM   8768  C  C   . GLU F 3 10  ? 1.148   -35.944 32.398  1.00 84.94  ? 10  GLU G C   1 
ATOM   8769  O  O   . GLU F 3 10  ? 2.175   -36.612 32.249  1.00 80.54  ? 10  GLU G O   1 
ATOM   8770  C  CB  . GLU F 3 10  ? 1.623   -33.521 32.222  1.00 98.23  ? 10  GLU G CB  1 
ATOM   8771  C  CG  . GLU F 3 10  ? 1.427   -32.130 32.787  1.00 110.96 ? 10  GLU G CG  1 
ATOM   8772  C  CD  . GLU F 3 10  ? 1.136   -31.115 31.702  1.00 122.35 ? 10  GLU G CD  1 
ATOM   8773  O  OE1 . GLU F 3 10  ? 1.674   -29.992 31.773  1.00 119.65 ? 10  GLU G OE1 1 
ATOM   8774  O  OE2 . GLU F 3 10  ? 0.370   -31.444 30.771  1.00 137.16 ? 10  GLU G OE2 1 
ATOM   8775  N  N   . LEU F 3 11  ? -0.035  -36.285 31.904  1.00 84.32  ? 11  LEU G N   1 
ATOM   8776  C  CA  . LEU F 3 11  ? -0.262  -37.553 31.245  1.00 83.37  ? 11  LEU G CA  1 
ATOM   8777  C  C   . LEU F 3 11  ? -0.918  -37.309 29.896  1.00 83.21  ? 11  LEU G C   1 
ATOM   8778  O  O   . LEU F 3 11  ? -2.037  -36.806 29.836  1.00 98.04  ? 11  LEU G O   1 
ATOM   8779  C  CB  . LEU F 3 11  ? -1.159  -38.424 32.128  1.00 85.06  ? 11  LEU G CB  1 
ATOM   8780  C  CG  . LEU F 3 11  ? -1.833  -39.589 31.422  1.00 88.08  ? 11  LEU G CG  1 
ATOM   8781  C  CD1 . LEU F 3 11  ? -0.770  -40.491 30.817  1.00 90.98  ? 11  LEU G CD1 1 
ATOM   8782  C  CD2 . LEU F 3 11  ? -2.693  -40.344 32.410  1.00 90.67  ? 11  LEU G CD2 1 
ATOM   8783  N  N   . VAL F 3 12  ? -0.236  -37.684 28.817  1.00 81.13  ? 12  VAL G N   1 
ATOM   8784  C  CA  . VAL F 3 12  ? -0.695  -37.341 27.475  1.00 85.30  ? 12  VAL G CA  1 
ATOM   8785  C  C   . VAL F 3 12  ? -0.572  -38.496 26.496  1.00 88.70  ? 12  VAL G C   1 
ATOM   8786  O  O   . VAL F 3 12  ? 0.210   -39.422 26.699  1.00 85.86  ? 12  VAL G O   1 
ATOM   8787  C  CB  . VAL F 3 12  ? 0.091   -36.153 26.915  1.00 85.84  ? 12  VAL G CB  1 
ATOM   8788  C  CG1 . VAL F 3 12  ? 0.240   -35.085 27.980  1.00 87.93  ? 12  VAL G CG1 1 
ATOM   8789  C  CG2 . VAL F 3 12  ? 1.459   -36.595 26.444  1.00 82.32  ? 12  VAL G CG2 1 
ATOM   8790  N  N   . LYS F 3 13  ? -1.363  -38.433 25.431  1.00 96.78  ? 13  LYS G N   1 
ATOM   8791  C  CA  . LYS F 3 13  ? -1.378  -39.485 24.421  1.00 100.48 ? 13  LYS G CA  1 
ATOM   8792  C  C   . LYS F 3 13  ? -0.135  -39.393 23.534  1.00 98.05  ? 13  LYS G C   1 
ATOM   8793  O  O   . LYS F 3 13  ? 0.420   -38.316 23.346  1.00 89.55  ? 13  LYS G O   1 
ATOM   8794  C  CB  . LYS F 3 13  ? -2.634  -39.370 23.556  1.00 104.58 ? 13  LYS G CB  1 
ATOM   8795  C  CG  . LYS F 3 13  ? -3.930  -39.428 24.337  1.00 107.08 ? 13  LYS G CG  1 
ATOM   8796  C  CD  . LYS F 3 13  ? -4.224  -40.841 24.794  1.00 113.23 ? 13  LYS G CD  1 
ATOM   8797  C  CE  . LYS F 3 13  ? -5.565  -40.919 25.501  1.00 119.83 ? 13  LYS G CE  1 
ATOM   8798  N  NZ  . LYS F 3 13  ? -6.032  -42.326 25.636  1.00 131.14 ? 13  LYS G NZ  1 
ATOM   8799  N  N   . PRO F 3 14  ? 0.315   -40.536 23.000  1.00 102.32 ? 14  PRO G N   1 
ATOM   8800  C  CA  . PRO F 3 14  ? 1.362   -40.511 21.987  1.00 100.32 ? 14  PRO G CA  1 
ATOM   8801  C  C   . PRO F 3 14  ? 0.937   -39.645 20.819  1.00 102.53 ? 14  PRO G C   1 
ATOM   8802  O  O   . PRO F 3 14  ? -0.181  -39.776 20.339  1.00 109.27 ? 14  PRO G O   1 
ATOM   8803  C  CB  . PRO F 3 14  ? 1.466   -41.966 21.535  1.00 107.80 ? 14  PRO G CB  1 
ATOM   8804  C  CG  . PRO F 3 14  ? 0.826   -42.784 22.605  1.00 111.47 ? 14  PRO G CG  1 
ATOM   8805  C  CD  . PRO F 3 14  ? -0.138  -41.899 23.333  1.00 110.11 ? 14  PRO G CD  1 
ATOM   8806  N  N   . GLY F 3 15  ? 1.819   -38.768 20.361  1.00 104.45 ? 15  GLY G N   1 
ATOM   8807  C  CA  . GLY F 3 15  ? 1.502   -37.883 19.241  1.00 108.59 ? 15  GLY G CA  1 
ATOM   8808  C  C   . GLY F 3 15  ? 1.167   -36.479 19.701  1.00 106.28 ? 15  GLY G C   1 
ATOM   8809  O  O   . GLY F 3 15  ? 1.541   -35.496 19.059  1.00 104.99 ? 15  GLY G O   1 
ATOM   8810  N  N   . ALA F 3 16  ? 0.460   -36.386 20.820  1.00 105.18 ? 16  ALA G N   1 
ATOM   8811  C  CA  . ALA F 3 16  ? 0.141   -35.098 21.417  1.00 106.74 ? 16  ALA G CA  1 
ATOM   8812  C  C   . ALA F 3 16  ? 1.399   -34.355 21.828  1.00 99.16  ? 16  ALA G C   1 
ATOM   8813  O  O   . ALA F 3 16  ? 2.489   -34.924 21.843  1.00 102.14 ? 16  ALA G O   1 
ATOM   8814  C  CB  . ALA F 3 16  ? -0.765  -35.292 22.623  1.00 114.21 ? 16  ALA G CB  1 
ATOM   8815  N  N   . SER F 3 17  ? 1.240   -33.076 22.150  1.00 98.48  ? 17  SER G N   1 
ATOM   8816  C  CA  . SER F 3 17  ? 2.316   -32.286 22.723  1.00 96.27  ? 17  SER G CA  1 
ATOM   8817  C  C   . SER F 3 17  ? 1.907   -31.857 24.116  1.00 91.33  ? 17  SER G C   1 
ATOM   8818  O  O   . SER F 3 17  ? 0.808   -32.150 24.563  1.00 98.63  ? 17  SER G O   1 
ATOM   8819  C  CB  . SER F 3 17  ? 2.565   -31.054 21.873  1.00 99.80  ? 17  SER G CB  1 
ATOM   8820  O  OG  . SER F 3 17  ? 1.541   -30.110 22.086  1.00 110.25 ? 17  SER G OG  1 
ATOM   8821  N  N   . MET F 3 18  ? 2.776   -31.139 24.802  1.00 88.54  ? 18  MET G N   1 
ATOM   8822  C  CA  . MET F 3 18  ? 2.512   -30.819 26.186  1.00 91.36  ? 18  MET G CA  1 
ATOM   8823  C  C   . MET F 3 18  ? 3.363   -29.644 26.614  1.00 89.79  ? 18  MET G C   1 
ATOM   8824  O  O   . MET F 3 18  ? 4.478   -29.471 26.144  1.00 89.05  ? 18  MET G O   1 
ATOM   8825  C  CB  . MET F 3 18  ? 2.779   -32.046 27.056  1.00 93.67  ? 18  MET G CB  1 
ATOM   8826  C  CG  . MET F 3 18  ? 3.332   -31.768 28.444  1.00 97.65  ? 18  MET G CG  1 
ATOM   8827  S  SD  . MET F 3 18  ? 5.114   -31.473 28.414  1.00 106.06 ? 18  MET G SD  1 
ATOM   8828  C  CE  . MET F 3 18  ? 5.605   -32.163 29.999  1.00 100.04 ? 18  MET G CE  1 
ATOM   8829  N  N   . LYS F 3 19  ? 2.804   -28.824 27.492  1.00 86.77  ? 19  LYS G N   1 
ATOM   8830  C  CA  . LYS F 3 19  ? 3.473   -27.644 27.973  1.00 78.66  ? 19  LYS G CA  1 
ATOM   8831  C  C   . LYS F 3 19  ? 3.494   -27.736 29.477  1.00 78.27  ? 19  LYS G C   1 
ATOM   8832  O  O   . LYS F 3 19  ? 2.500   -28.104 30.092  1.00 87.37  ? 19  LYS G O   1 
ATOM   8833  C  CB  . LYS F 3 19  ? 2.694   -26.416 27.548  1.00 85.66  ? 19  LYS G CB  1 
ATOM   8834  C  CG  . LYS F 3 19  ? 3.482   -25.127 27.569  1.00 86.61  ? 19  LYS G CG  1 
ATOM   8835  C  CD  . LYS F 3 19  ? 2.710   -24.037 26.841  1.00 93.45  ? 19  LYS G CD  1 
ATOM   8836  C  CE  . LYS F 3 19  ? 3.569   -22.809 26.624  1.00 105.79 ? 19  LYS G CE  1 
ATOM   8837  N  NZ  . LYS F 3 19  ? 3.064   -21.966 25.507  1.00 122.81 ? 19  LYS G NZ  1 
ATOM   8838  N  N   . THR F 3 20  ? 4.627   -27.393 30.069  1.00 76.18  ? 20  THR G N   1 
ATOM   8839  C  CA  . THR F 3 20  ? 4.779   -27.454 31.516  1.00 72.42  ? 20  THR G CA  1 
ATOM   8840  C  C   . THR F 3 20  ? 5.466   -26.171 31.995  1.00 70.04  ? 20  THR G C   1 
ATOM   8841  O  O   . THR F 3 20  ? 6.119   -25.483 31.211  1.00 66.00  ? 20  THR G O   1 
ATOM   8842  C  CB  . THR F 3 20  ? 5.586   -28.701 31.924  1.00 73.25  ? 20  THR G CB  1 
ATOM   8843  O  OG1 . THR F 3 20  ? 5.508   -28.897 33.343  1.00 77.53  ? 20  THR G OG1 1 
ATOM   8844  C  CG2 . THR F 3 20  ? 7.042   -28.567 31.496  1.00 71.11  ? 20  THR G CG2 1 
ATOM   8845  N  N   . SER F 3 21  ? 5.321   -25.842 33.272  1.00 67.53  ? 21  SER G N   1 
ATOM   8846  C  CA  . SER F 3 21  ? 5.751   -24.535 33.746  1.00 65.17  ? 21  SER G CA  1 
ATOM   8847  C  C   . SER F 3 21  ? 6.591   -24.544 35.021  1.00 61.29  ? 21  SER G C   1 
ATOM   8848  O  O   . SER F 3 21  ? 6.543   -25.464 35.828  1.00 59.08  ? 21  SER G O   1 
ATOM   8849  C  CB  . SER F 3 21  ? 4.531   -23.631 33.946  1.00 71.59  ? 21  SER G CB  1 
ATOM   8850  O  OG  . SER F 3 21  ? 3.617   -24.190 34.866  1.00 72.64  ? 21  SER G OG  1 
ATOM   8851  N  N   . CYS F 3 22  ? 7.318   -23.455 35.206  1.00 67.50  ? 22  CYS G N   1 
ATOM   8852  C  CA  . CYS F 3 22  ? 8.249   -23.299 36.310  1.00 70.96  ? 22  CYS G CA  1 
ATOM   8853  C  C   . CYS F 3 22  ? 8.197   -21.838 36.765  1.00 69.41  ? 22  CYS G C   1 
ATOM   8854  O  O   . CYS F 3 22  ? 8.691   -20.950 36.076  1.00 59.83  ? 22  CYS G O   1 
ATOM   8855  C  CB  . CYS F 3 22  ? 9.651   -23.668 35.829  1.00 72.20  ? 22  CYS G CB  1 
ATOM   8856  S  SG  . CYS F 3 22  ? 10.996  -23.310 36.980  1.00 75.94  ? 22  CYS G SG  1 
ATOM   8857  N  N   . LYS F 3 23  ? 7.539   -21.590 37.892  1.00 69.07  ? 23  LYS G N   1 
ATOM   8858  C  CA  . LYS F 3 23  ? 7.459   -20.250 38.431  1.00 72.88  ? 23  LYS G CA  1 
ATOM   8859  C  C   . LYS F 3 23  ? 8.543   -20.026 39.465  1.00 74.63  ? 23  LYS G C   1 
ATOM   8860  O  O   . LYS F 3 23  ? 8.653   -20.772 40.436  1.00 75.83  ? 23  LYS G O   1 
ATOM   8861  C  CB  . LYS F 3 23  ? 6.122   -19.980 39.113  1.00 82.78  ? 23  LYS G CB  1 
ATOM   8862  C  CG  . LYS F 3 23  ? 6.145   -18.653 39.852  1.00 93.36  ? 23  LYS G CG  1 
ATOM   8863  C  CD  . LYS F 3 23  ? 4.762   -18.120 40.143  1.00 103.38 ? 23  LYS G CD  1 
ATOM   8864  C  CE  . LYS F 3 23  ? 4.844   -16.616 40.359  1.00 115.92 ? 23  LYS G CE  1 
ATOM   8865  N  NZ  . LYS F 3 23  ? 3.743   -15.883 39.671  1.00 129.85 ? 23  LYS G NZ  1 
ATOM   8866  N  N   . VAL F 3 24  ? 9.266   -18.928 39.316  1.00 73.83  ? 24  VAL G N   1 
ATOM   8867  C  CA  . VAL F 3 24  ? 10.316  -18.604 40.258  1.00 72.08  ? 24  VAL G CA  1 
ATOM   8868  C  C   . VAL F 3 24  ? 9.874   -17.578 41.281  1.00 74.60  ? 24  VAL G C   1 
ATOM   8869  O  O   . VAL F 3 24  ? 9.081   -16.694 40.981  1.00 83.48  ? 24  VAL G O   1 
ATOM   8870  C  CB  . VAL F 3 24  ? 11.538  -18.034 39.543  1.00 71.50  ? 24  VAL G CB  1 
ATOM   8871  C  CG1 . VAL F 3 24  ? 11.838  -18.827 38.289  1.00 77.47  ? 24  VAL G CG1 1 
ATOM   8872  C  CG2 . VAL F 3 24  ? 11.295  -16.589 39.187  1.00 75.42  ? 24  VAL G CG2 1 
ATOM   8873  N  N   . SER F 3 25  ? 10.432  -17.696 42.479  1.00 80.94  ? 25  SER G N   1 
ATOM   8874  C  CA  . SER F 3 25  ? 10.286  -16.702 43.527  1.00 87.63  ? 25  SER G CA  1 
ATOM   8875  C  C   . SER F 3 25  ? 11.513  -16.730 44.434  1.00 88.00  ? 25  SER G C   1 
ATOM   8876  O  O   . SER F 3 25  ? 12.240  -17.718 44.468  1.00 98.47  ? 25  SER G O   1 
ATOM   8877  C  CB  . SER F 3 25  ? 9.077   -17.043 44.361  1.00 97.41  ? 25  SER G CB  1 
ATOM   8878  O  OG  . SER F 3 25  ? 9.359   -18.196 45.123  1.00 101.55 ? 25  SER G OG  1 
ATOM   8879  N  N   . GLY F 3 26  ? 11.746  -15.643 45.161  1.00 91.29  ? 26  GLY G N   1 
ATOM   8880  C  CA  . GLY F 3 26  ? 12.967  -15.494 45.975  1.00 98.24  ? 26  GLY G CA  1 
ATOM   8881  C  C   . GLY F 3 26  ? 14.123  -14.730 45.306  1.00 99.87  ? 26  GLY G C   1 
ATOM   8882  O  O   . GLY F 3 26  ? 15.108  -14.375 45.967  1.00 91.43  ? 26  GLY G O   1 
ATOM   8883  N  N   . TYR F 3 27  ? 14.013  -14.496 43.996  1.00 98.44  ? 27  TYR G N   1 
ATOM   8884  C  CA  . TYR F 3 27  ? 14.980  -13.686 43.250  1.00 96.18  ? 27  TYR G CA  1 
ATOM   8885  C  C   . TYR F 3 27  ? 14.293  -13.081 42.032  1.00 94.27  ? 27  TYR G C   1 
ATOM   8886  O  O   . TYR F 3 27  ? 13.101  -13.287 41.826  1.00 106.96 ? 27  TYR G O   1 
ATOM   8887  C  CB  . TYR F 3 27  ? 16.175  -14.539 42.810  1.00 102.44 ? 27  TYR G CB  1 
ATOM   8888  C  CG  . TYR F 3 27  ? 15.908  -15.483 41.642  1.00 96.52  ? 27  TYR G CG  1 
ATOM   8889  C  CD1 . TYR F 3 27  ? 15.376  -16.764 41.851  1.00 91.40  ? 27  TYR G CD1 1 
ATOM   8890  C  CD2 . TYR F 3 27  ? 16.229  -15.107 40.333  1.00 83.33  ? 27  TYR G CD2 1 
ATOM   8891  C  CE1 . TYR F 3 27  ? 15.154  -17.627 40.785  1.00 85.27  ? 27  TYR G CE1 1 
ATOM   8892  C  CE2 . TYR F 3 27  ? 16.016  -15.964 39.262  1.00 74.34  ? 27  TYR G CE2 1 
ATOM   8893  C  CZ  . TYR F 3 27  ? 15.475  -17.218 39.485  1.00 81.02  ? 27  TYR G CZ  1 
ATOM   8894  O  OH  . TYR F 3 27  ? 15.248  -18.064 38.407  1.00 76.51  ? 27  TYR G OH  1 
ATOM   8895  N  N   . SER F 3 28  ? 15.021  -12.321 41.227  1.00 87.88  ? 28  SER G N   1 
ATOM   8896  C  CA  . SER F 3 28  ? 14.395  -11.722 40.067  1.00 87.06  ? 28  SER G CA  1 
ATOM   8897  C  C   . SER F 3 28  ? 14.568  -12.613 38.857  1.00 74.18  ? 28  SER G C   1 
ATOM   8898  O  O   . SER F 3 28  ? 15.676  -12.906 38.412  1.00 63.40  ? 28  SER G O   1 
ATOM   8899  C  CB  . SER F 3 28  ? 14.918  -10.311 39.802  1.00 109.90 ? 28  SER G CB  1 
ATOM   8900  O  OG  . SER F 3 28  ? 16.016  -10.305 38.908  1.00 127.24 ? 28  SER G OG  1 
ATOM   8901  N  N   . PHE F 3 29  ? 13.429  -13.047 38.346  1.00 73.44  ? 29  PHE G N   1 
ATOM   8902  C  CA  . PHE F 3 29  ? 13.336  -13.976 37.220  1.00 67.47  ? 29  PHE G CA  1 
ATOM   8903  C  C   . PHE F 3 29  ? 14.210  -13.602 36.049  1.00 64.90  ? 29  PHE G C   1 
ATOM   8904  O  O   . PHE F 3 29  ? 14.836  -14.462 35.451  1.00 71.43  ? 29  PHE G O   1 
ATOM   8905  C  CB  . PHE F 3 29  ? 11.890  -13.995 36.761  1.00 69.70  ? 29  PHE G CB  1 
ATOM   8906  C  CG  . PHE F 3 29  ? 11.600  -14.934 35.633  1.00 62.70  ? 29  PHE G CG  1 
ATOM   8907  C  CD1 . PHE F 3 29  ? 11.934  -16.254 35.709  1.00 62.55  ? 29  PHE G CD1 1 
ATOM   8908  C  CD2 . PHE F 3 29  ? 10.868  -14.498 34.542  1.00 68.24  ? 29  PHE G CD2 1 
ATOM   8909  C  CE1 . PHE F 3 29  ? 11.614  -17.117 34.678  1.00 65.21  ? 29  PHE G CE1 1 
ATOM   8910  C  CE2 . PHE F 3 29  ? 10.531  -15.350 33.516  1.00 66.70  ? 29  PHE G CE2 1 
ATOM   8911  C  CZ  . PHE F 3 29  ? 10.914  -16.665 33.579  1.00 64.13  ? 29  PHE G CZ  1 
ATOM   8912  N  N   . THR F 3 30  ? 14.226  -12.323 35.702  1.00 68.74  ? 30  THR G N   1 
ATOM   8913  C  CA  . THR F 3 30  ? 14.862  -11.890 34.463  1.00 70.62  ? 30  THR G CA  1 
ATOM   8914  C  C   . THR F 3 30  ? 16.359  -11.723 34.604  1.00 67.29  ? 30  THR G C   1 
ATOM   8915  O  O   . THR F 3 30  ? 17.039  -11.437 33.628  1.00 65.08  ? 30  THR G O   1 
ATOM   8916  C  CB  . THR F 3 30  ? 14.297  -10.548 33.983  1.00 74.88  ? 30  THR G CB  1 
ATOM   8917  O  OG1 . THR F 3 30  ? 14.406  -9.592  35.039  1.00 79.30  ? 30  THR G OG1 1 
ATOM   8918  C  CG2 . THR F 3 30  ? 12.842  -10.696 33.577  1.00 76.68  ? 30  THR G CG2 1 
ATOM   8919  N  N   . GLY F 3 31  ? 16.876  -11.919 35.811  1.00 71.92  ? 31  GLY G N   1 
ATOM   8920  C  CA  . GLY F 3 31  ? 18.291  -11.676 36.084  1.00 80.24  ? 31  GLY G CA  1 
ATOM   8921  C  C   . GLY F 3 31  ? 19.176  -12.884 35.829  1.00 78.05  ? 31  GLY G C   1 
ATOM   8922  O  O   . GLY F 3 31  ? 20.401  -12.752 35.754  1.00 81.19  ? 31  GLY G O   1 
ATOM   8923  N  N   . TYR F 3 32  ? 18.548  -14.053 35.688  1.00 68.67  ? 32  TYR G N   1 
ATOM   8924  C  CA  . TYR F 3 32  ? 19.266  -15.310 35.566  1.00 60.73  ? 32  TYR G CA  1 
ATOM   8925  C  C   . TYR F 3 32  ? 18.758  -16.178 34.432  1.00 61.90  ? 32  TYR G C   1 
ATOM   8926  O  O   . TYR F 3 32  ? 17.586  -16.110 34.062  1.00 59.93  ? 32  TYR G O   1 
ATOM   8927  C  CB  . TYR F 3 32  ? 19.146  -16.081 36.850  1.00 57.71  ? 32  TYR G CB  1 
ATOM   8928  C  CG  . TYR F 3 32  ? 19.813  -15.395 37.979  1.00 59.51  ? 32  TYR G CG  1 
ATOM   8929  C  CD1 . TYR F 3 32  ? 19.252  -14.288 38.562  1.00 66.45  ? 32  TYR G CD1 1 
ATOM   8930  C  CD2 . TYR F 3 32  ? 21.000  -15.868 38.483  1.00 68.32  ? 32  TYR G CD2 1 
ATOM   8931  C  CE1 . TYR F 3 32  ? 19.858  -13.671 39.635  1.00 74.23  ? 32  TYR G CE1 1 
ATOM   8932  C  CE2 . TYR F 3 32  ? 21.613  -15.264 39.556  1.00 71.35  ? 32  TYR G CE2 1 
ATOM   8933  C  CZ  . TYR F 3 32  ? 21.038  -14.170 40.125  1.00 72.73  ? 32  TYR G CZ  1 
ATOM   8934  O  OH  . TYR F 3 32  ? 21.665  -13.582 41.185  1.00 87.82  ? 32  TYR G OH  1 
ATOM   8935  N  N   . ILE F 3 33  ? 19.660  -17.008 33.913  1.00 60.50  ? 33  ILE G N   1 
ATOM   8936  C  CA  . ILE F 3 33  ? 19.363  -17.928 32.830  1.00 64.04  ? 33  ILE G CA  1 
ATOM   8937  C  C   . ILE F 3 33  ? 18.571  -19.129 33.343  1.00 66.05  ? 33  ILE G C   1 
ATOM   8938  O  O   . ILE F 3 33  ? 18.881  -19.668 34.414  1.00 58.94  ? 33  ILE G O   1 
ATOM   8939  C  CB  . ILE F 3 33  ? 20.673  -18.434 32.217  1.00 69.18  ? 33  ILE G CB  1 
ATOM   8940  C  CG1 . ILE F 3 33  ? 21.487  -17.250 31.695  1.00 72.77  ? 33  ILE G CG1 1 
ATOM   8941  C  CG2 . ILE F 3 33  ? 20.406  -19.454 31.116  1.00 72.11  ? 33  ILE G CG2 1 
ATOM   8942  C  CD1 . ILE F 3 33  ? 20.770  -16.436 30.637  1.00 78.18  ? 33  ILE G CD1 1 
ATOM   8943  N  N   . MET F 3 34  ? 17.541  -19.533 32.598  1.00 67.90  ? 34  MET G N   1 
ATOM   8944  C  CA  . MET F 3 34  ? 16.809  -20.756 32.933  1.00 70.95  ? 34  MET G CA  1 
ATOM   8945  C  C   . MET F 3 34  ? 17.170  -21.872 31.974  1.00 72.34  ? 34  MET G C   1 
ATOM   8946  O  O   . MET F 3 34  ? 17.259  -21.659 30.759  1.00 72.42  ? 34  MET G O   1 
ATOM   8947  C  CB  . MET F 3 34  ? 15.299  -20.535 32.911  1.00 71.98  ? 34  MET G CB  1 
ATOM   8948  C  CG  . MET F 3 34  ? 14.761  -19.844 34.156  1.00 92.76  ? 34  MET G CG  1 
ATOM   8949  S  SD  . MET F 3 34  ? 14.722  -20.804 35.689  1.00 91.33  ? 34  MET G SD  1 
ATOM   8950  C  CE  . MET F 3 34  ? 14.325  -22.408 35.043  1.00 73.31  ? 34  MET G CE  1 
ATOM   8951  N  N   . ASN F 3 35  ? 17.373  -23.061 32.536  1.00 70.95  ? 35  ASN G N   1 
ATOM   8952  C  CA  . ASN F 3 35  ? 17.611  -24.271 31.760  1.00 65.38  ? 35  ASN G CA  1 
ATOM   8953  C  C   . ASN F 3 35  ? 16.531  -25.324 32.024  1.00 66.76  ? 35  ASN G C   1 
ATOM   8954  O  O   . ASN F 3 35  ? 15.809  -25.267 33.017  1.00 66.90  ? 35  ASN G O   1 
ATOM   8955  C  CB  . ASN F 3 35  ? 18.960  -24.864 32.141  1.00 65.98  ? 35  ASN G CB  1 
ATOM   8956  C  CG  . ASN F 3 35  ? 20.073  -23.839 32.142  1.00 71.38  ? 35  ASN G CG  1 
ATOM   8957  O  OD1 . ASN F 3 35  ? 20.838  -23.744 31.180  1.00 78.41  ? 35  ASN G OD1 1 
ATOM   8958  N  ND2 . ASN F 3 35  ? 20.199  -23.090 33.237  1.00 68.95  ? 35  ASN G ND2 1 
ATOM   8959  N  N   . TRP F 3 36  ? 16.429  -26.298 31.136  1.00 67.60  ? 36  TRP G N   1 
ATOM   8960  C  CA  . TRP F 3 36  ? 15.629  -27.474 31.418  1.00 66.68  ? 36  TRP G CA  1 
ATOM   8961  C  C   . TRP F 3 36  ? 16.441  -28.738 31.230  1.00 66.19  ? 36  TRP G C   1 
ATOM   8962  O  O   . TRP F 3 36  ? 17.273  -28.834 30.342  1.00 63.41  ? 36  TRP G O   1 
ATOM   8963  C  CB  . TRP F 3 36  ? 14.404  -27.520 30.521  1.00 70.90  ? 36  TRP G CB  1 
ATOM   8964  C  CG  . TRP F 3 36  ? 13.447  -26.432 30.791  1.00 71.16  ? 36  TRP G CG  1 
ATOM   8965  C  CD1 . TRP F 3 36  ? 13.541  -25.144 30.375  1.00 76.91  ? 36  TRP G CD1 1 
ATOM   8966  C  CD2 . TRP F 3 36  ? 12.238  -26.527 31.540  1.00 66.84  ? 36  TRP G CD2 1 
ATOM   8967  N  NE1 . TRP F 3 36  ? 12.463  -24.425 30.816  1.00 78.21  ? 36  TRP G NE1 1 
ATOM   8968  C  CE2 . TRP F 3 36  ? 11.648  -25.256 31.537  1.00 74.02  ? 36  TRP G CE2 1 
ATOM   8969  C  CE3 . TRP F 3 36  ? 11.596  -27.565 32.213  1.00 67.46  ? 36  TRP G CE3 1 
ATOM   8970  C  CZ2 . TRP F 3 36  ? 10.446  -24.998 32.171  1.00 77.19  ? 36  TRP G CZ2 1 
ATOM   8971  C  CZ3 . TRP F 3 36  ? 10.413  -27.305 32.858  1.00 66.18  ? 36  TRP G CZ3 1 
ATOM   8972  C  CH2 . TRP F 3 36  ? 9.848   -26.034 32.834  1.00 76.08  ? 36  TRP G CH2 1 
ATOM   8973  N  N   . VAL F 3 37  ? 16.150  -29.725 32.060  1.00 76.20  ? 37  VAL G N   1 
ATOM   8974  C  CA  . VAL F 3 37  ? 16.927  -30.948 32.118  1.00 69.14  ? 37  VAL G CA  1 
ATOM   8975  C  C   . VAL F 3 37  ? 15.986  -32.142 32.138  1.00 65.93  ? 37  VAL G C   1 
ATOM   8976  O  O   . VAL F 3 37  ? 14.954  -32.128 32.814  1.00 58.85  ? 37  VAL G O   1 
ATOM   8977  C  CB  . VAL F 3 37  ? 17.810  -30.964 33.381  1.00 69.78  ? 37  VAL G CB  1 
ATOM   8978  C  CG1 . VAL F 3 37  ? 18.551  -32.278 33.495  1.00 72.32  ? 37  VAL G CG1 1 
ATOM   8979  C  CG2 . VAL F 3 37  ? 18.786  -29.798 33.348  1.00 70.72  ? 37  VAL G CG2 1 
ATOM   8980  N  N   . LYS F 3 38  ? 16.348  -33.168 31.379  1.00 66.28  ? 38  LYS G N   1 
ATOM   8981  C  CA  . LYS F 3 38  ? 15.564  -34.397 31.298  1.00 62.53  ? 38  LYS G CA  1 
ATOM   8982  C  C   . LYS F 3 38  ? 16.265  -35.486 32.068  1.00 60.48  ? 38  LYS G C   1 
ATOM   8983  O  O   . LYS F 3 38  ? 17.479  -35.628 31.992  1.00 64.86  ? 38  LYS G O   1 
ATOM   8984  C  CB  . LYS F 3 38  ? 15.410  -34.830 29.842  1.00 62.51  ? 38  LYS G CB  1 
ATOM   8985  C  CG  . LYS F 3 38  ? 14.769  -36.194 29.641  1.00 68.44  ? 38  LYS G CG  1 
ATOM   8986  C  CD  . LYS F 3 38  ? 14.472  -36.439 28.167  1.00 73.34  ? 38  LYS G CD  1 
ATOM   8987  C  CE  . LYS F 3 38  ? 14.006  -37.858 27.904  1.00 78.84  ? 38  LYS G CE  1 
ATOM   8988  N  NZ  . LYS F 3 38  ? 13.645  -38.053 26.476  1.00 87.63  ? 38  LYS G NZ  1 
ATOM   8989  N  N   . GLN F 3 39  ? 15.509  -36.251 32.830  1.00 62.82  ? 39  GLN G N   1 
ATOM   8990  C  CA  . GLN F 3 39  ? 16.060  -37.442 33.446  1.00 66.32  ? 39  GLN G CA  1 
ATOM   8991  C  C   . GLN F 3 39  ? 15.080  -38.579 33.253  1.00 68.17  ? 39  GLN G C   1 
ATOM   8992  O  O   . GLN F 3 39  ? 14.018  -38.593 33.866  1.00 59.40  ? 39  GLN G O   1 
ATOM   8993  C  CB  . GLN F 3 39  ? 16.324  -37.209 34.926  1.00 63.92  ? 39  GLN G CB  1 
ATOM   8994  C  CG  . GLN F 3 39  ? 17.048  -38.352 35.594  1.00 61.36  ? 39  GLN G CG  1 
ATOM   8995  C  CD  . GLN F 3 39  ? 17.396  -38.035 37.028  1.00 61.44  ? 39  GLN G CD  1 
ATOM   8996  O  OE1 . GLN F 3 39  ? 16.629  -37.391 37.732  1.00 58.45  ? 39  GLN G OE1 1 
ATOM   8997  N  NE2 . GLN F 3 39  ? 18.570  -38.466 37.462  1.00 67.87  ? 39  GLN G NE2 1 
ATOM   8998  N  N   . ARG F 3 40  ? 15.435  -39.499 32.359  1.00 83.57  ? 40  ARG G N   1 
ATOM   8999  C  CA  . ARG F 3 40  ? 14.610  -40.663 32.076  1.00 89.13  ? 40  ARG G CA  1 
ATOM   9000  C  C   . ARG F 3 40  ? 14.907  -41.701 33.132  1.00 93.78  ? 40  ARG G C   1 
ATOM   9001  O  O   . ARG F 3 40  ? 16.063  -41.945 33.456  1.00 92.06  ? 40  ARG G O   1 
ATOM   9002  C  CB  . ARG F 3 40  ? 14.886  -41.222 30.676  1.00 93.21  ? 40  ARG G CB  1 
ATOM   9003  C  CG  . ARG F 3 40  ? 13.671  -41.896 30.056  1.00 98.22  ? 40  ARG G CG  1 
ATOM   9004  C  CD  . ARG F 3 40  ? 13.933  -42.426 28.654  1.00 108.02 ? 40  ARG G CD  1 
ATOM   9005  N  NE  . ARG F 3 40  ? 13.265  -43.711 28.436  1.00 114.93 ? 40  ARG G NE  1 
ATOM   9006  C  CZ  . ARG F 3 40  ? 11.950  -43.870 28.307  1.00 110.03 ? 40  ARG G CZ  1 
ATOM   9007  N  NH1 . ARG F 3 40  ? 11.133  -42.828 28.348  1.00 115.41 ? 40  ARG G NH1 1 
ATOM   9008  N  NH2 . ARG F 3 40  ? 11.449  -45.076 28.122  1.00 115.27 ? 40  ARG G NH2 1 
ATOM   9009  N  N   . HIS F 3 41  ? 13.847  -42.340 33.618  1.00 112.34 ? 41  HIS G N   1 
ATOM   9010  C  CA  . HIS F 3 41  ? 13.824  -43.004 34.924  1.00 120.05 ? 41  HIS G CA  1 
ATOM   9011  C  C   . HIS F 3 41  ? 15.181  -43.335 35.538  1.00 105.19 ? 41  HIS G C   1 
ATOM   9012  O  O   . HIS F 3 41  ? 15.753  -44.390 35.284  1.00 90.85  ? 41  HIS G O   1 
ATOM   9013  C  CB  . HIS F 3 41  ? 12.935  -44.260 34.881  1.00 149.98 ? 41  HIS G CB  1 
ATOM   9014  C  CG  . HIS F 3 41  ? 13.278  -45.224 33.783  1.00 157.33 ? 41  HIS G CG  1 
ATOM   9015  N  ND1 . HIS F 3 41  ? 13.003  -44.977 32.455  1.00 141.11 ? 41  HIS G ND1 1 
ATOM   9016  C  CD2 . HIS F 3 41  ? 13.818  -46.465 33.829  1.00 190.62 ? 41  HIS G CD2 1 
ATOM   9017  C  CE1 . HIS F 3 41  ? 13.389  -46.009 31.727  1.00 152.82 ? 41  HIS G CE1 1 
ATOM   9018  N  NE2 . HIS F 3 41  ? 13.887  -46.926 32.537  1.00 191.89 ? 41  HIS G NE2 1 
ATOM   9019  N  N   . GLY F 3 42  ? 15.668  -42.398 36.352  1.00 112.16 ? 42  GLY G N   1 
ATOM   9020  C  CA  . GLY F 3 42  ? 16.797  -42.608 37.267  1.00 110.94 ? 42  GLY G CA  1 
ATOM   9021  C  C   . GLY F 3 42  ? 18.125  -42.833 36.583  1.00 112.41 ? 42  GLY G C   1 
ATOM   9022  O  O   . GLY F 3 42  ? 18.892  -43.699 36.978  1.00 153.52 ? 42  GLY G O   1 
ATOM   9023  N  N   . LYS F 3 43  ? 18.400  -42.052 35.552  1.00 108.74 ? 43  LYS G N   1 
ATOM   9024  C  CA  . LYS F 3 43  ? 19.570  -42.271 34.723  1.00 114.03 ? 43  LYS G CA  1 
ATOM   9025  C  C   . LYS F 3 43  ? 20.177  -40.929 34.346  1.00 107.50 ? 43  LYS G C   1 
ATOM   9026  O  O   . LYS F 3 43  ? 19.895  -39.920 34.983  1.00 106.81 ? 43  LYS G O   1 
ATOM   9027  C  CB  . LYS F 3 43  ? 19.194  -43.104 33.490  1.00 124.22 ? 43  LYS G CB  1 
ATOM   9028  C  CG  . LYS F 3 43  ? 19.035  -44.587 33.812  1.00 129.09 ? 43  LYS G CG  1 
ATOM   9029  C  CD  . LYS F 3 43  ? 18.640  -45.439 32.620  1.00 144.93 ? 43  LYS G CD  1 
ATOM   9030  C  CE  . LYS F 3 43  ? 18.258  -46.841 33.083  1.00 168.36 ? 43  LYS G CE  1 
ATOM   9031  N  NZ  . LYS F 3 43  ? 17.959  -47.786 31.970  1.00 179.68 ? 43  LYS G NZ  1 
ATOM   9032  N  N   . ASN F 3 44  ? 21.044  -40.900 33.347  1.00 108.52 ? 44  ASN G N   1 
ATOM   9033  C  CA  . ASN F 3 44  ? 21.811  -39.685 33.128  1.00 103.29 ? 44  ASN G CA  1 
ATOM   9034  C  C   . ASN F 3 44  ? 20.937  -38.454 32.901  1.00 90.02  ? 44  ASN G C   1 
ATOM   9035  O  O   . ASN F 3 44  ? 19.821  -38.541 32.377  1.00 81.00  ? 44  ASN G O   1 
ATOM   9036  C  CB  . ASN F 3 44  ? 22.859  -39.844 32.021  1.00 108.56 ? 44  ASN G CB  1 
ATOM   9037  C  CG  . ASN F 3 44  ? 22.410  -40.752 30.907  1.00 103.72 ? 44  ASN G CG  1 
ATOM   9038  O  OD1 . ASN F 3 44  ? 21.282  -40.667 30.434  1.00 109.52 ? 44  ASN G OD1 1 
ATOM   9039  N  ND2 . ASN F 3 44  ? 23.311  -41.613 30.461  1.00 104.90 ? 44  ASN G ND2 1 
ATOM   9040  N  N   . LEU F 3 45  ? 21.462  -37.321 33.364  1.00 80.78  ? 45  LEU G N   1 
ATOM   9041  C  CA  . LEU F 3 45  ? 20.816  -36.027 33.247  1.00 67.33  ? 45  LEU G CA  1 
ATOM   9042  C  C   . LEU F 3 45  ? 21.155  -35.420 31.902  1.00 64.93  ? 45  LEU G C   1 
ATOM   9043  O  O   . LEU F 3 45  ? 22.304  -35.418 31.504  1.00 73.02  ? 45  LEU G O   1 
ATOM   9044  C  CB  . LEU F 3 45  ? 21.324  -35.111 34.356  1.00 60.42  ? 45  LEU G CB  1 
ATOM   9045  C  CG  . LEU F 3 45  ? 20.978  -35.594 35.762  1.00 61.24  ? 45  LEU G CG  1 
ATOM   9046  C  CD1 . LEU F 3 45  ? 21.954  -35.082 36.805  1.00 60.20  ? 45  LEU G CD1 1 
ATOM   9047  C  CD2 . LEU F 3 45  ? 19.553  -35.186 36.108  1.00 60.01  ? 45  LEU G CD2 1 
ATOM   9048  N  N   . GLU F 3 46  ? 20.150  -34.922 31.199  1.00 64.84  ? 46  GLU G N   1 
ATOM   9049  C  CA  . GLU F 3 46  ? 20.330  -34.376 29.862  1.00 68.74  ? 46  GLU G CA  1 
ATOM   9050  C  C   . GLU F 3 46  ? 19.892  -32.926 29.845  1.00 67.75  ? 46  GLU G C   1 
ATOM   9051  O  O   . GLU F 3 46  ? 18.737  -32.614 30.124  1.00 69.36  ? 46  GLU G O   1 
ATOM   9052  C  CB  . GLU F 3 46  ? 19.478  -35.152 28.856  1.00 77.75  ? 46  GLU G CB  1 
ATOM   9053  C  CG  . GLU F 3 46  ? 20.094  -36.444 28.352  1.00 90.01  ? 46  GLU G CG  1 
ATOM   9054  C  CD  . GLU F 3 46  ? 19.243  -37.117 27.289  1.00 96.80  ? 46  GLU G CD  1 
ATOM   9055  O  OE1 . GLU F 3 46  ? 18.152  -37.636 27.642  1.00 96.32  ? 46  GLU G OE1 1 
ATOM   9056  O  OE2 . GLU F 3 46  ? 19.668  -37.122 26.106  1.00 95.39  ? 46  GLU G OE2 1 
ATOM   9057  N  N   . TRP F 3 47  ? 20.807  -32.038 29.499  1.00 67.93  ? 47  TRP G N   1 
ATOM   9058  C  CA  . TRP F 3 47  ? 20.461  -30.638 29.309  1.00 62.29  ? 47  TRP G CA  1 
ATOM   9059  C  C   . TRP F 3 47  ? 19.666  -30.489 28.008  1.00 65.59  ? 47  TRP G C   1 
ATOM   9060  O  O   . TRP F 3 47  ? 20.097  -30.939 26.941  1.00 70.64  ? 47  TRP G O   1 
ATOM   9061  C  CB  . TRP F 3 47  ? 21.740  -29.816 29.262  1.00 65.50  ? 47  TRP G CB  1 
ATOM   9062  C  CG  . TRP F 3 47  ? 21.561  -28.356 29.065  1.00 64.86  ? 47  TRP G CG  1 
ATOM   9063  C  CD1 . TRP F 3 47  ? 21.259  -27.436 30.015  1.00 64.88  ? 47  TRP G CD1 1 
ATOM   9064  C  CD2 . TRP F 3 47  ? 21.756  -27.629 27.848  1.00 65.18  ? 47  TRP G CD2 1 
ATOM   9065  N  NE1 . TRP F 3 47  ? 21.214  -26.182 29.460  1.00 61.22  ? 47  TRP G NE1 1 
ATOM   9066  C  CE2 . TRP F 3 47  ? 21.515  -26.276 28.130  1.00 59.48  ? 47  TRP G CE2 1 
ATOM   9067  C  CE3 . TRP F 3 47  ? 22.080  -27.997 26.538  1.00 70.79  ? 47  TRP G CE3 1 
ATOM   9068  C  CZ2 . TRP F 3 47  ? 21.600  -25.292 27.164  1.00 61.12  ? 47  TRP G CZ2 1 
ATOM   9069  C  CZ3 . TRP F 3 47  ? 22.158  -27.017 25.579  1.00 72.01  ? 47  TRP G CZ3 1 
ATOM   9070  C  CH2 . TRP F 3 47  ? 21.923  -25.679 25.896  1.00 66.98  ? 47  TRP G CH2 1 
ATOM   9071  N  N   . ILE F 3 48  ? 18.485  -29.890 28.104  1.00 65.97  ? 48  ILE G N   1 
ATOM   9072  C  CA  . ILE F 3 48  ? 17.607  -29.744 26.949  1.00 66.49  ? 48  ILE G CA  1 
ATOM   9073  C  C   . ILE F 3 48  ? 17.919  -28.450 26.227  1.00 67.48  ? 48  ILE G C   1 
ATOM   9074  O  O   . ILE F 3 48  ? 18.038  -28.416 25.004  1.00 65.47  ? 48  ILE G O   1 
ATOM   9075  C  CB  . ILE F 3 48  ? 16.133  -29.724 27.374  1.00 65.61  ? 48  ILE G CB  1 
ATOM   9076  C  CG1 . ILE F 3 48  ? 15.734  -31.080 27.929  1.00 70.32  ? 48  ILE G CG1 1 
ATOM   9077  C  CG2 . ILE F 3 48  ? 15.239  -29.401 26.189  1.00 73.44  ? 48  ILE G CG2 1 
ATOM   9078  C  CD1 . ILE F 3 48  ? 14.510  -31.031 28.806  1.00 72.45  ? 48  ILE G CD1 1 
ATOM   9079  N  N   . GLY F 3 49  ? 18.034  -27.377 26.998  1.00 72.02  ? 49  GLY G N   1 
ATOM   9080  C  CA  . GLY F 3 49  ? 18.331  -26.070 26.444  1.00 73.22  ? 49  GLY G CA  1 
ATOM   9081  C  C   . GLY F 3 49  ? 18.221  -24.980 27.487  1.00 66.93  ? 49  GLY G C   1 
ATOM   9082  O  O   . GLY F 3 49  ? 18.005  -25.253 28.673  1.00 58.89  ? 49  GLY G O   1 
ATOM   9083  N  N   . LEU F 3 50  ? 18.383  -23.736 27.049  1.00 62.60  ? 50  LEU G N   1 
ATOM   9084  C  CA  . LEU F 3 50  ? 18.235  -22.618 27.953  1.00 58.41  ? 50  LEU G CA  1 
ATOM   9085  C  C   . LEU F 3 50  ? 17.511  -21.485 27.291  1.00 59.60  ? 50  LEU G C   1 
ATOM   9086  O  O   . LEU F 3 50  ? 17.439  -21.392 26.069  1.00 65.30  ? 50  LEU G O   1 
ATOM   9087  C  CB  . LEU F 3 50  ? 19.597  -22.141 28.454  1.00 62.78  ? 50  LEU G CB  1 
ATOM   9088  C  CG  . LEU F 3 50  ? 20.558  -21.513 27.442  1.00 62.36  ? 50  LEU G CG  1 
ATOM   9089  C  CD1 . LEU F 3 50  ? 20.140  -20.091 27.119  1.00 68.64  ? 50  LEU G CD1 1 
ATOM   9090  C  CD2 . LEU F 3 50  ? 21.960  -21.514 28.021  1.00 60.21  ? 50  LEU G CD2 1 
ATOM   9091  N  N   . ILE F 3 51  ? 16.968  -20.616 28.125  1.00 64.46  ? 51  ILE G N   1 
ATOM   9092  C  CA  . ILE F 3 51  ? 16.376  -19.373 27.666  1.00 62.23  ? 51  ILE G CA  1 
ATOM   9093  C  C   . ILE F 3 51  ? 16.870  -18.278 28.592  1.00 63.17  ? 51  ILE G C   1 
ATOM   9094  O  O   . ILE F 3 51  ? 17.085  -18.509 29.796  1.00 64.48  ? 51  ILE G O   1 
ATOM   9095  C  CB  . ILE F 3 51  ? 14.843  -19.441 27.703  1.00 59.20  ? 51  ILE G CB  1 
ATOM   9096  C  CG1 . ILE F 3 51  ? 14.227  -18.237 27.005  1.00 66.58  ? 51  ILE G CG1 1 
ATOM   9097  C  CG2 . ILE F 3 51  ? 14.345  -19.522 29.136  1.00 54.91  ? 51  ILE G CG2 1 
ATOM   9098  C  CD1 . ILE F 3 51  ? 12.745  -18.412 26.756  1.00 68.02  ? 51  ILE G CD1 1 
ATOM   9099  N  N   . ASN F 3 52  ? 17.084  -17.103 28.016  1.00 62.32  ? 52  ASN G N   1 
ATOM   9100  C  CA  . ASN F 3 52  ? 17.358  -15.911 28.792  1.00 65.91  ? 52  ASN G CA  1 
ATOM   9101  C  C   . ASN F 3 52  ? 16.049  -15.163 28.946  1.00 65.50  ? 52  ASN G C   1 
ATOM   9102  O  O   . ASN F 3 52  ? 15.578  -14.559 27.995  1.00 74.45  ? 52  ASN G O   1 
ATOM   9103  C  CB  . ASN F 3 52  ? 18.384  -15.036 28.074  1.00 67.64  ? 52  ASN G CB  1 
ATOM   9104  C  CG  . ASN F 3 52  ? 18.779  -13.805 28.883  1.00 67.83  ? 52  ASN G CG  1 
ATOM   9105  O  OD1 . ASN F 3 52  ? 17.948  -13.181 29.538  1.00 66.87  ? 52  ASN G OD1 1 
ATOM   9106  N  ND2 . ASN F 3 52  ? 20.055  -13.446 28.826  1.00 71.31  ? 52  ASN G ND2 1 
ATOM   9107  N  N   . PRO F 3 53  ? 15.454  -15.201 30.140  1.00 61.94  ? 53  PRO G N   1 
ATOM   9108  C  CA  . PRO F 3 53  ? 14.121  -14.638 30.309  1.00 69.43  ? 53  PRO G CA  1 
ATOM   9109  C  C   . PRO F 3 53  ? 14.061  -13.134 29.964  1.00 72.68  ? 53  PRO G C   1 
ATOM   9110  O  O   . PRO F 3 53  ? 13.008  -12.612 29.555  1.00 68.33  ? 53  PRO G O   1 
ATOM   9111  C  CB  . PRO F 3 53  ? 13.822  -14.872 31.799  1.00 72.87  ? 53  PRO G CB  1 
ATOM   9112  C  CG  . PRO F 3 53  ? 14.839  -15.855 32.277  1.00 70.74  ? 53  PRO G CG  1 
ATOM   9113  C  CD  . PRO F 3 53  ? 16.041  -15.634 31.416  1.00 66.20  ? 53  PRO G CD  1 
ATOM   9114  N  N   . ASN F 3 54  ? 15.191  -12.452 30.101  1.00 64.83  ? 54  ASN G N   1 
ATOM   9115  C  CA  . ASN F 3 54  ? 15.229  -11.037 29.813  1.00 67.83  ? 54  ASN G CA  1 
ATOM   9116  C  C   . ASN F 3 54  ? 15.282  -10.714 28.328  1.00 67.83  ? 54  ASN G C   1 
ATOM   9117  O  O   . ASN F 3 54  ? 14.714  -9.714  27.892  1.00 80.90  ? 54  ASN G O   1 
ATOM   9118  C  CB  . ASN F 3 54  ? 16.407  -10.368 30.501  1.00 72.55  ? 54  ASN G CB  1 
ATOM   9119  C  CG  . ASN F 3 54  ? 16.221  -8.864  30.617  1.00 76.72  ? 54  ASN G CG  1 
ATOM   9120  O  OD1 . ASN F 3 54  ? 15.227  -8.391  31.172  1.00 73.40  ? 54  ASN G OD1 1 
ATOM   9121  N  ND2 . ASN F 3 54  ? 17.163  -8.105  30.071  1.00 80.45  ? 54  ASN G ND2 1 
ATOM   9122  N  N   . THR F 3 55  ? 15.972  -11.543 27.556  1.00 65.45  ? 55  THR G N   1 
ATOM   9123  C  CA  . THR F 3 55  ? 16.209  -11.262 26.136  1.00 70.44  ? 55  THR G CA  1 
ATOM   9124  C  C   . THR F 3 55  ? 15.389  -12.152 25.217  1.00 71.25  ? 55  THR G C   1 
ATOM   9125  O  O   . THR F 3 55  ? 15.280  -11.879 24.031  1.00 72.86  ? 55  THR G O   1 
ATOM   9126  C  CB  . THR F 3 55  ? 17.689  -11.463 25.770  1.00 72.96  ? 55  THR G CB  1 
ATOM   9127  O  OG1 . THR F 3 55  ? 18.036  -12.846 25.915  1.00 73.20  ? 55  THR G OG1 1 
ATOM   9128  C  CG2 . THR F 3 55  ? 18.575  -10.645 26.684  1.00 79.31  ? 55  THR G CG2 1 
ATOM   9129  N  N   . GLY F 3 56  ? 14.838  -13.233 25.760  1.00 78.95  ? 56  GLY G N   1 
ATOM   9130  C  CA  . GLY F 3 56  ? 14.085  -14.204 24.962  1.00 82.19  ? 56  GLY G CA  1 
ATOM   9131  C  C   . GLY F 3 56  ? 14.966  -15.182 24.210  1.00 78.92  ? 56  GLY G C   1 
ATOM   9132  O  O   . GLY F 3 56  ? 14.475  -16.054 23.499  1.00 81.54  ? 56  GLY G O   1 
ATOM   9133  N  N   . TYR F 3 57  ? 16.276  -15.053 24.384  1.00 80.53  ? 57  TYR G N   1 
ATOM   9134  C  CA  . TYR F 3 57  ? 17.225  -15.862 23.635  1.00 79.73  ? 57  TYR G CA  1 
ATOM   9135  C  C   . TYR F 3 57  ? 17.174  -17.311 24.081  1.00 76.05  ? 57  TYR G C   1 
ATOM   9136  O  O   . TYR F 3 57  ? 17.130  -17.594 25.275  1.00 81.22  ? 57  TYR G O   1 
ATOM   9137  C  CB  . TYR F 3 57  ? 18.643  -15.325 23.832  1.00 83.34  ? 57  TYR G CB  1 
ATOM   9138  C  CG  . TYR F 3 57  ? 19.705  -16.185 23.190  1.00 79.50  ? 57  TYR G CG  1 
ATOM   9139  C  CD1 . TYR F 3 57  ? 20.366  -17.152 23.919  1.00 76.73  ? 57  TYR G CD1 1 
ATOM   9140  C  CD2 . TYR F 3 57  ? 20.032  -16.038 21.847  1.00 81.42  ? 57  TYR G CD2 1 
ATOM   9141  C  CE1 . TYR F 3 57  ? 21.337  -17.946 23.335  1.00 78.46  ? 57  TYR G CE1 1 
ATOM   9142  C  CE2 . TYR F 3 57  ? 20.988  -16.832 21.248  1.00 83.47  ? 57  TYR G CE2 1 
ATOM   9143  C  CZ  . TYR F 3 57  ? 21.642  -17.786 21.998  1.00 83.68  ? 57  TYR G CZ  1 
ATOM   9144  O  OH  . TYR F 3 57  ? 22.617  -18.567 21.408  1.00 92.47  ? 57  TYR G OH  1 
ATOM   9145  N  N   . THR F 3 58  ? 17.187  -18.223 23.117  1.00 72.33  ? 58  THR G N   1 
ATOM   9146  C  CA  . THR F 3 58  ? 17.179  -19.648 23.414  1.00 69.23  ? 58  THR G CA  1 
ATOM   9147  C  C   . THR F 3 58  ? 18.254  -20.362 22.616  1.00 72.31  ? 58  THR G C   1 
ATOM   9148  O  O   . THR F 3 58  ? 18.484  -20.057 21.445  1.00 87.65  ? 58  THR G O   1 
ATOM   9149  C  CB  . THR F 3 58  ? 15.826  -20.303 23.052  1.00 70.98  ? 58  THR G CB  1 
ATOM   9150  O  OG1 . THR F 3 58  ? 15.525  -20.090 21.661  1.00 74.17  ? 58  THR G OG1 1 
ATOM   9151  C  CG2 . THR F 3 58  ? 14.714  -19.726 23.881  1.00 69.45  ? 58  THR G CG2 1 
ATOM   9152  N  N   . THR F 3 59  ? 18.907  -21.325 23.246  1.00 71.94  ? 59  THR G N   1 
ATOM   9153  C  CA  . THR F 3 59  ? 19.670  -22.328 22.506  1.00 79.08  ? 59  THR G CA  1 
ATOM   9154  C  C   . THR F 3 59  ? 19.278  -23.702 23.003  1.00 80.52  ? 59  THR G C   1 
ATOM   9155  O  O   . THR F 3 59  ? 18.821  -23.865 24.134  1.00 76.18  ? 59  THR G O   1 
ATOM   9156  C  CB  . THR F 3 59  ? 21.193  -22.176 22.652  1.00 79.76  ? 59  THR G CB  1 
ATOM   9157  O  OG1 . THR F 3 59  ? 21.527  -21.933 24.027  1.00 82.34  ? 59  THR G OG1 1 
ATOM   9158  C  CG2 . THR F 3 59  ? 21.688  -21.047 21.781  1.00 84.42  ? 59  THR G CG2 1 
ATOM   9159  N  N   . TYR F 3 60  ? 19.452  -24.689 22.143  1.00 83.49  ? 60  TYR G N   1 
ATOM   9160  C  CA  . TYR F 3 60  ? 19.016  -26.028 22.449  1.00 78.61  ? 60  TYR G CA  1 
ATOM   9161  C  C   . TYR F 3 60  ? 20.133  -27.009 22.202  1.00 79.85  ? 60  TYR G C   1 
ATOM   9162  O  O   . TYR F 3 60  ? 20.959  -26.836 21.304  1.00 80.45  ? 60  TYR G O   1 
ATOM   9163  C  CB  . TYR F 3 60  ? 17.827  -26.415 21.579  1.00 83.06  ? 60  TYR G CB  1 
ATOM   9164  C  CG  . TYR F 3 60  ? 16.610  -25.572 21.807  1.00 86.13  ? 60  TYR G CG  1 
ATOM   9165  C  CD1 . TYR F 3 60  ? 16.428  -24.389 21.121  1.00 96.37  ? 60  TYR G CD1 1 
ATOM   9166  C  CD2 . TYR F 3 60  ? 15.637  -25.960 22.699  1.00 90.47  ? 60  TYR G CD2 1 
ATOM   9167  C  CE1 . TYR F 3 60  ? 15.308  -23.612 21.323  1.00 90.43  ? 60  TYR G CE1 1 
ATOM   9168  C  CE2 . TYR F 3 60  ? 14.513  -25.190 22.902  1.00 89.89  ? 60  TYR G CE2 1 
ATOM   9169  C  CZ  . TYR F 3 60  ? 14.365  -24.015 22.218  1.00 83.44  ? 60  TYR G CZ  1 
ATOM   9170  O  OH  . TYR F 3 60  ? 13.256  -23.252 22.416  1.00 92.30  ? 60  TYR G OH  1 
ATOM   9171  N  N   . ASN F 3 61  ? 20.134  -28.054 23.011  1.00 77.04  ? 61  ASN G N   1 
ATOM   9172  C  CA  . ASN F 3 61  ? 20.766  -29.297 22.647  1.00 77.87  ? 61  ASN G CA  1 
ATOM   9173  C  C   . ASN F 3 61  ? 20.300  -29.794 21.275  1.00 80.59  ? 61  ASN G C   1 
ATOM   9174  O  O   . ASN F 3 61  ? 19.098  -29.901 21.011  1.00 80.64  ? 61  ASN G O   1 
ATOM   9175  C  CB  . ASN F 3 61  ? 20.434  -30.339 23.695  1.00 77.10  ? 61  ASN G CB  1 
ATOM   9176  C  CG  . ASN F 3 61  ? 21.368  -31.511 23.643  1.00 84.56  ? 61  ASN G CG  1 
ATOM   9177  O  OD1 . ASN F 3 61  ? 21.664  -32.035 22.568  1.00 86.89  ? 61  ASN G OD1 1 
ATOM   9178  N  ND2 . ASN F 3 61  ? 21.879  -31.906 24.802  1.00 91.93  ? 61  ASN G ND2 1 
ATOM   9179  N  N   . GLN F 3 62  ? 21.254  -30.088 20.401  1.00 87.55  ? 62  GLN G N   1 
ATOM   9180  C  CA  . GLN F 3 62  ? 20.940  -30.578 19.065  1.00 96.85  ? 62  GLN G CA  1 
ATOM   9181  C  C   . GLN F 3 62  ? 19.962  -31.749 19.124  1.00 97.20  ? 62  GLN G C   1 
ATOM   9182  O  O   . GLN F 3 62  ? 19.080  -31.876 18.277  1.00 103.75 ? 62  GLN G O   1 
ATOM   9183  C  CB  . GLN F 3 62  ? 22.217  -30.996 18.341  1.00 113.08 ? 62  GLN G CB  1 
ATOM   9184  C  CG  . GLN F 3 62  ? 22.128  -30.925 16.821  1.00 130.69 ? 62  GLN G CG  1 
ATOM   9185  C  CD  . GLN F 3 62  ? 21.896  -29.511 16.300  1.00 139.80 ? 62  GLN G CD  1 
ATOM   9186  O  OE1 . GLN F 3 62  ? 21.996  -28.532 17.044  1.00 139.00 ? 62  GLN G OE1 1 
ATOM   9187  N  NE2 . GLN F 3 62  ? 21.585  -29.400 15.013  1.00 145.34 ? 62  GLN G NE2 1 
ATOM   9188  N  N   . LYS F 3 63  ? 20.118  -32.600 20.132  1.00 99.66  ? 63  LYS G N   1 
ATOM   9189  C  CA  . LYS F 3 63  ? 19.201  -33.717 20.349  1.00 104.92 ? 63  LYS G CA  1 
ATOM   9190  C  C   . LYS F 3 63  ? 17.750  -33.278 20.389  1.00 96.19  ? 63  LYS G C   1 
ATOM   9191  O  O   . LYS F 3 63  ? 16.866  -34.007 19.962  1.00 106.23 ? 63  LYS G O   1 
ATOM   9192  C  CB  . LYS F 3 63  ? 19.530  -34.425 21.662  1.00 113.61 ? 63  LYS G CB  1 
ATOM   9193  C  CG  . LYS F 3 63  ? 20.506  -35.572 21.497  1.00 130.99 ? 63  LYS G CG  1 
ATOM   9194  C  CD  . LYS F 3 63  ? 20.457  -36.532 22.669  1.00 149.08 ? 63  LYS G CD  1 
ATOM   9195  C  CE  . LYS F 3 63  ? 21.560  -37.568 22.526  1.00 169.99 ? 63  LYS G CE  1 
ATOM   9196  N  NZ  . LYS F 3 63  ? 22.900  -36.938 22.348  1.00 169.09 ? 63  LYS G NZ  1 
ATOM   9197  N  N   . PHE F 3 64  ? 17.507  -32.094 20.929  1.00 87.42  ? 64  PHE G N   1 
ATOM   9198  C  CA  . PHE F 3 64  ? 16.160  -31.678 21.231  1.00 81.94  ? 64  PHE G CA  1 
ATOM   9199  C  C   . PHE F 3 64  ? 15.673  -30.583 20.314  1.00 81.81  ? 64  PHE G C   1 
ATOM   9200  O  O   . PHE F 3 64  ? 14.591  -30.055 20.518  1.00 81.05  ? 64  PHE G O   1 
ATOM   9201  C  CB  . PHE F 3 64  ? 16.092  -31.209 22.672  1.00 79.54  ? 64  PHE G CB  1 
ATOM   9202  C  CG  . PHE F 3 64  ? 16.254  -32.313 23.652  1.00 85.69  ? 64  PHE G CG  1 
ATOM   9203  C  CD1 . PHE F 3 64  ? 15.173  -33.094 24.010  1.00 87.24  ? 64  PHE G CD1 1 
ATOM   9204  C  CD2 . PHE F 3 64  ? 17.494  -32.608 24.178  1.00 92.45  ? 64  PHE G CD2 1 
ATOM   9205  C  CE1 . PHE F 3 64  ? 15.315  -34.128 24.907  1.00 89.54  ? 64  PHE G CE1 1 
ATOM   9206  C  CE2 . PHE F 3 64  ? 17.647  -33.645 25.073  1.00 95.05  ? 64  PHE G CE2 1 
ATOM   9207  C  CZ  . PHE F 3 64  ? 16.556  -34.407 25.438  1.00 92.86  ? 64  PHE G CZ  1 
ATOM   9208  N  N   . LYS F 3 65  ? 16.445  -30.270 19.282  1.00 84.84  ? 65  LYS G N   1 
ATOM   9209  C  CA  . LYS F 3 65  ? 16.158  -29.106 18.457  1.00 92.64  ? 65  LYS G CA  1 
ATOM   9210  C  C   . LYS F 3 65  ? 14.671  -29.011 18.091  1.00 98.11  ? 65  LYS G C   1 
ATOM   9211  O  O   . LYS F 3 65  ? 13.982  -28.089 18.509  1.00 119.08 ? 65  LYS G O   1 
ATOM   9212  C  CB  . LYS F 3 65  ? 17.021  -29.106 17.197  1.00 103.20 ? 65  LYS G CB  1 
ATOM   9213  C  CG  . LYS F 3 65  ? 17.081  -27.759 16.486  1.00 118.81 ? 65  LYS G CG  1 
ATOM   9214  C  CD  . LYS F 3 65  ? 18.500  -27.221 16.371  1.00 132.70 ? 65  LYS G CD  1 
ATOM   9215  C  CE  . LYS F 3 65  ? 18.979  -26.569 17.666  1.00 132.18 ? 65  LYS G CE  1 
ATOM   9216  N  NZ  . LYS F 3 65  ? 20.407  -26.154 17.577  1.00 130.89 ? 65  LYS G NZ  1 
ATOM   9217  N  N   . GLY F 3 66  ? 14.169  -29.959 17.319  1.00 95.75  ? 66  GLY G N   1 
ATOM   9218  C  CA  . GLY F 3 66  ? 12.774  -29.912 16.901  1.00 97.62  ? 66  GLY G CA  1 
ATOM   9219  C  C   . GLY F 3 66  ? 11.769  -30.320 17.969  1.00 94.25  ? 66  GLY G C   1 
ATOM   9220  O  O   . GLY F 3 66  ? 10.576  -30.238 17.733  1.00 96.96  ? 66  GLY G O   1 
ATOM   9221  N  N   . LYS F 3 67  ? 12.231  -30.773 19.133  1.00 90.09  ? 67  LYS G N   1 
ATOM   9222  C  CA  . LYS F 3 67  ? 11.334  -31.401 20.118  1.00 92.20  ? 67  LYS G CA  1 
ATOM   9223  C  C   . LYS F 3 67  ? 10.764  -30.373 21.059  1.00 88.03  ? 67  LYS G C   1 
ATOM   9224  O  O   . LYS F 3 67  ? 9.604   -30.454 21.452  1.00 98.43  ? 67  LYS G O   1 
ATOM   9225  C  CB  . LYS F 3 67  ? 12.074  -32.427 20.985  1.00 95.99  ? 67  LYS G CB  1 
ATOM   9226  C  CG  . LYS F 3 67  ? 11.793  -33.885 20.676  1.00 96.55  ? 67  LYS G CG  1 
ATOM   9227  C  CD  . LYS F 3 67  ? 10.549  -34.449 21.343  1.00 89.99  ? 67  LYS G CD  1 
ATOM   9228  C  CE  . LYS F 3 67  ? 10.135  -35.710 20.583  1.00 102.72 ? 67  LYS G CE  1 
ATOM   9229  N  NZ  . LYS F 3 67  ? 8.833   -36.321 20.969  1.00 104.90 ? 67  LYS G NZ  1 
ATOM   9230  N  N   . ALA F 3 68  ? 11.623  -29.453 21.479  1.00 84.24  ? 68  ALA G N   1 
ATOM   9231  C  CA  . ALA F 3 68  ? 11.360  -28.627 22.645  1.00 86.27  ? 68  ALA G CA  1 
ATOM   9232  C  C   . ALA F 3 68  ? 11.371  -27.135 22.300  1.00 85.02  ? 68  ALA G C   1 
ATOM   9233  O  O   . ALA F 3 68  ? 12.212  -26.663 21.531  1.00 87.54  ? 68  ALA G O   1 
ATOM   9234  C  CB  . ALA F 3 68  ? 12.385  -28.917 23.735  1.00 78.95  ? 68  ALA G CB  1 
ATOM   9235  N  N   . THR F 3 69  ? 10.425  -26.406 22.878  1.00 75.14  ? 69  THR G N   1 
ATOM   9236  C  CA  . THR F 3 69  ? 10.382  -24.972 22.738  1.00 72.23  ? 69  THR G CA  1 
ATOM   9237  C  C   . THR F 3 69  ? 10.321  -24.342 24.102  1.00 71.07  ? 69  THR G C   1 
ATOM   9238  O  O   . THR F 3 69  ? 9.403   -24.606 24.873  1.00 85.43  ? 69  THR G O   1 
ATOM   9239  C  CB  . THR F 3 69  ? 9.149   -24.527 21.953  1.00 76.61  ? 69  THR G CB  1 
ATOM   9240  O  OG1 . THR F 3 69  ? 9.035   -25.300 20.750  1.00 83.40  ? 69  THR G OG1 1 
ATOM   9241  C  CG2 . THR F 3 69  ? 9.265   -23.061 21.606  1.00 81.76  ? 69  THR G CG2 1 
ATOM   9242  N  N   . LEU F 3 70  ? 11.295  -23.493 24.391  1.00 69.08  ? 70  LEU G N   1 
ATOM   9243  C  CA  . LEU F 3 70  ? 11.312  -22.732 25.630  1.00 69.02  ? 70  LEU G CA  1 
ATOM   9244  C  C   . LEU F 3 70  ? 10.742  -21.321 25.442  1.00 71.04  ? 70  LEU G C   1 
ATOM   9245  O  O   . LEU F 3 70  ? 11.027  -20.637 24.450  1.00 72.46  ? 70  LEU G O   1 
ATOM   9246  C  CB  . LEU F 3 70  ? 12.741  -22.655 26.155  1.00 70.82  ? 70  LEU G CB  1 
ATOM   9247  C  CG  . LEU F 3 70  ? 13.405  -24.015 26.337  1.00 68.99  ? 70  LEU G CG  1 
ATOM   9248  C  CD1 . LEU F 3 70  ? 14.802  -23.846 26.917  1.00 66.89  ? 70  LEU G CD1 1 
ATOM   9249  C  CD2 . LEU F 3 70  ? 12.537  -24.918 27.210  1.00 66.41  ? 70  LEU G CD2 1 
ATOM   9250  N  N   . THR F 3 71  ? 9.913   -20.901 26.388  1.00 73.20  ? 71  THR G N   1 
ATOM   9251  C  CA  . THR F 3 71  ? 9.383   -19.543 26.399  1.00 75.96  ? 71  THR G CA  1 
ATOM   9252  C  C   . THR F 3 71  ? 9.302   -19.075 27.845  1.00 77.21  ? 71  THR G C   1 
ATOM   9253  O  O   . THR F 3 71  ? 9.456   -19.875 28.772  1.00 79.91  ? 71  THR G O   1 
ATOM   9254  C  CB  . THR F 3 71  ? 7.986   -19.475 25.758  1.00 79.21  ? 71  THR G CB  1 
ATOM   9255  O  OG1 . THR F 3 71  ? 7.108   -20.399 26.421  1.00 95.08  ? 71  THR G OG1 1 
ATOM   9256  C  CG2 . THR F 3 71  ? 8.045   -19.826 24.281  1.00 80.57  ? 71  THR G CG2 1 
ATOM   9257  N  N   . VAL F 3 72  ? 9.080   -17.782 28.045  1.00 74.41  ? 72  VAL G N   1 
ATOM   9258  C  CA  . VAL F 3 72  ? 8.876   -17.266 29.391  1.00 75.26  ? 72  VAL G CA  1 
ATOM   9259  C  C   . VAL F 3 72  ? 7.719   -16.295 29.398  1.00 78.55  ? 72  VAL G C   1 
ATOM   9260  O  O   . VAL F 3 72  ? 7.340   -15.773 28.355  1.00 82.71  ? 72  VAL G O   1 
ATOM   9261  C  CB  . VAL F 3 72  ? 10.114  -16.535 29.933  1.00 72.86  ? 72  VAL G CB  1 
ATOM   9262  C  CG1 . VAL F 3 72  ? 11.319  -17.446 29.911  1.00 73.28  ? 72  VAL G CG1 1 
ATOM   9263  C  CG2 . VAL F 3 72  ? 10.381  -15.279 29.131  1.00 77.80  ? 72  VAL G CG2 1 
ATOM   9264  N  N   . ASP F 3 73  ? 7.149   -16.083 30.579  1.00 81.72  ? 73  ASP G N   1 
ATOM   9265  C  CA  . ASP F 3 73  ? 6.231   -14.979 30.808  1.00 87.59  ? 73  ASP G CA  1 
ATOM   9266  C  C   . ASP F 3 73  ? 6.838   -14.068 31.858  1.00 83.09  ? 73  ASP G C   1 
ATOM   9267  O  O   . ASP F 3 73  ? 6.849   -14.393 33.053  1.00 80.14  ? 73  ASP G O   1 
ATOM   9268  C  CB  . ASP F 3 73  ? 4.866   -15.494 31.266  1.00 93.33  ? 73  ASP G CB  1 
ATOM   9269  C  CG  . ASP F 3 73  ? 3.884   -14.378 31.556  1.00 96.96  ? 73  ASP G CG  1 
ATOM   9270  O  OD1 . ASP F 3 73  ? 4.320   -13.267 31.919  1.00 97.23  ? 73  ASP G OD1 1 
ATOM   9271  O  OD2 . ASP F 3 73  ? 2.671   -14.622 31.417  1.00 103.43 ? 73  ASP G OD2 1 
ATOM   9272  N  N   . LYS F 3 74  ? 7.352   -12.930 31.408  1.00 78.54  ? 74  LYS G N   1 
ATOM   9273  C  CA  . LYS F 3 74  ? 8.095   -12.062 32.293  1.00 81.78  ? 74  LYS G CA  1 
ATOM   9274  C  C   . LYS F 3 74  ? 7.240   -11.598 33.454  1.00 86.98  ? 74  LYS G C   1 
ATOM   9275  O  O   . LYS F 3 74  ? 7.697   -11.580 34.596  1.00 91.50  ? 74  LYS G O   1 
ATOM   9276  C  CB  . LYS F 3 74  ? 8.628   -10.861 31.530  1.00 83.98  ? 74  LYS G CB  1 
ATOM   9277  C  CG  . LYS F 3 74  ? 9.799   -11.189 30.636  1.00 85.06  ? 74  LYS G CG  1 
ATOM   9278  C  CD  . LYS F 3 74  ? 10.377  -9.924  30.044  1.00 90.29  ? 74  LYS G CD  1 
ATOM   9279  C  CE  . LYS F 3 74  ? 10.799  -10.138 28.606  1.00 102.79 ? 74  LYS G CE  1 
ATOM   9280  N  NZ  . LYS F 3 74  ? 11.582  -8.977  28.099  1.00 117.60 ? 74  LYS G NZ  1 
ATOM   9281  N  N   . SER F 3 75  ? 6.000   -11.224 33.158  1.00 90.19  ? 75  SER G N   1 
ATOM   9282  C  CA  . SER F 3 75  ? 5.131   -10.617 34.149  1.00 94.48  ? 75  SER G CA  1 
ATOM   9283  C  C   . SER F 3 75  ? 4.859   -11.565 35.326  1.00 92.73  ? 75  SER G C   1 
ATOM   9284  O  O   . SER F 3 75  ? 4.819   -11.135 36.480  1.00 96.10  ? 75  SER G O   1 
ATOM   9285  C  CB  . SER F 3 75  ? 3.824   -10.170 33.492  1.00 100.23 ? 75  SER G CB  1 
ATOM   9286  O  OG  . SER F 3 75  ? 3.003   -11.273 33.151  1.00 104.73 ? 75  SER G OG  1 
ATOM   9287  N  N   . SER F 3 76  ? 4.685   -12.851 35.040  1.00 85.35  ? 76  SER G N   1 
ATOM   9288  C  CA  . SER F 3 76  ? 4.393   -13.820 36.093  1.00 83.23  ? 76  SER G CA  1 
ATOM   9289  C  C   . SER F 3 76  ? 5.645   -14.593 36.460  1.00 77.13  ? 76  SER G C   1 
ATOM   9290  O  O   . SER F 3 76  ? 5.580   -15.657 37.071  1.00 71.39  ? 76  SER G O   1 
ATOM   9291  C  CB  . SER F 3 76  ? 3.282   -14.778 35.655  1.00 81.95  ? 76  SER G CB  1 
ATOM   9292  O  OG  . SER F 3 76  ? 3.649   -15.503 34.499  1.00 77.18  ? 76  SER G OG  1 
ATOM   9293  N  N   . SER F 3 77  ? 6.789   -14.030 36.099  1.00 73.70  ? 77  SER G N   1 
ATOM   9294  C  CA  . SER F 3 77  ? 8.068   -14.698 36.272  1.00 77.45  ? 77  SER G CA  1 
ATOM   9295  C  C   . SER F 3 77  ? 7.966   -16.233 36.221  1.00 71.39  ? 77  SER G C   1 
ATOM   9296  O  O   . SER F 3 77  ? 8.317   -16.951 37.164  1.00 63.96  ? 77  SER G O   1 
ATOM   9297  C  CB  . SER F 3 77  ? 8.757   -14.199 37.545  1.00 81.14  ? 77  SER G CB  1 
ATOM   9298  O  OG  . SER F 3 77  ? 7.815   -13.824 38.519  1.00 89.77  ? 77  SER G OG  1 
ATOM   9299  N  N   . THR F 3 78  ? 7.523   -16.708 35.065  1.00 68.23  ? 78  THR G N   1 
ATOM   9300  C  CA  . THR F 3 78  ? 7.256   -18.109 34.842  1.00 69.66  ? 78  THR G CA  1 
ATOM   9301  C  C   . THR F 3 78  ? 7.964   -18.536 33.572  1.00 68.10  ? 78  THR G C   1 
ATOM   9302  O  O   . THR F 3 78  ? 7.964   -17.809 32.581  1.00 64.13  ? 78  THR G O   1 
ATOM   9303  C  CB  . THR F 3 78  ? 5.735   -18.354 34.678  1.00 70.79  ? 78  THR G CB  1 
ATOM   9304  O  OG1 . THR F 3 78  ? 5.079   -18.073 35.916  1.00 77.40  ? 78  THR G OG1 1 
ATOM   9305  C  CG2 . THR F 3 78  ? 5.430   -19.787 34.283  1.00 66.04  ? 78  THR G CG2 1 
ATOM   9306  N  N   . ALA F 3 79  ? 8.561   -19.723 33.599  1.00 71.02  ? 79  ALA G N   1 
ATOM   9307  C  CA  . ALA F 3 79  ? 9.200   -20.277 32.417  1.00 69.31  ? 79  ALA G CA  1 
ATOM   9308  C  C   . ALA F 3 79  ? 8.381   -21.453 31.938  1.00 69.57  ? 79  ALA G C   1 
ATOM   9309  O  O   . ALA F 3 79  ? 7.822   -22.195 32.747  1.00 63.79  ? 79  ALA G O   1 
ATOM   9310  C  CB  . ALA F 3 79  ? 10.616  -20.719 32.739  1.00 70.33  ? 79  ALA G CB  1 
ATOM   9311  N  N   . TYR F 3 80  ? 8.311   -21.614 30.619  1.00 75.37  ? 80  TYR G N   1 
ATOM   9312  C  CA  . TYR F 3 80  ? 7.564   -22.707 30.014  1.00 73.74  ? 80  TYR G CA  1 
ATOM   9313  C  C   . TYR F 3 80  ? 8.446   -23.592 29.150  1.00 71.99  ? 80  TYR G C   1 
ATOM   9314  O  O   . TYR F 3 80  ? 9.355   -23.108 28.489  1.00 83.63  ? 80  TYR G O   1 
ATOM   9315  C  CB  . TYR F 3 80  ? 6.448   -22.145 29.149  1.00 74.49  ? 80  TYR G CB  1 
ATOM   9316  C  CG  . TYR F 3 80  ? 5.375   -21.461 29.940  1.00 80.29  ? 80  TYR G CG  1 
ATOM   9317  C  CD1 . TYR F 3 80  ? 4.309   -22.176 30.450  1.00 91.88  ? 80  TYR G CD1 1 
ATOM   9318  C  CD2 . TYR F 3 80  ? 5.427   -20.103 30.187  1.00 84.28  ? 80  TYR G CD2 1 
ATOM   9319  C  CE1 . TYR F 3 80  ? 3.311   -21.554 31.180  1.00 104.67 ? 80  TYR G CE1 1 
ATOM   9320  C  CE2 . TYR F 3 80  ? 4.442   -19.474 30.926  1.00 90.51  ? 80  TYR G CE2 1 
ATOM   9321  C  CZ  . TYR F 3 80  ? 3.383   -20.202 31.416  1.00 95.39  ? 80  TYR G CZ  1 
ATOM   9322  O  OH  . TYR F 3 80  ? 2.393   -19.580 32.144  1.00 96.96  ? 80  TYR G OH  1 
ATOM   9323  N  N   . MET F 3 81  ? 8.156   -24.890 29.146  1.00 84.05  ? 81  MET G N   1 
ATOM   9324  C  CA  . MET F 3 81  ? 8.674   -25.799 28.124  1.00 77.94  ? 81  MET G CA  1 
ATOM   9325  C  C   . MET F 3 81  ? 7.559   -26.554 27.402  1.00 78.26  ? 81  MET G C   1 
ATOM   9326  O  O   . MET F 3 81  ? 6.703   -27.174 28.036  1.00 76.24  ? 81  MET G O   1 
ATOM   9327  C  CB  . MET F 3 81  ? 9.621   -26.816 28.740  1.00 77.39  ? 81  MET G CB  1 
ATOM   9328  C  CG  . MET F 3 81  ? 10.032  -27.888 27.745  1.00 83.78  ? 81  MET G CG  1 
ATOM   9329  S  SD  . MET F 3 81  ? 11.354  -28.937 28.354  1.00 85.27  ? 81  MET G SD  1 
ATOM   9330  C  CE  . MET F 3 81  ? 10.453  -29.904 29.559  1.00 92.70  ? 81  MET G CE  1 
ATOM   9331  N  N   . GLU F 3 82  ? 7.576   -26.500 26.074  1.00 80.47  ? 82  GLU G N   1 
ATOM   9332  C  CA  . GLU F 3 82  ? 6.667   -27.297 25.263  1.00 85.74  ? 82  GLU G CA  1 
ATOM   9333  C  C   . GLU F 3 82  ? 7.408   -28.440 24.575  1.00 88.16  ? 82  GLU G C   1 
ATOM   9334  O  O   . GLU F 3 82  ? 8.455   -28.230 23.978  1.00 89.71  ? 82  GLU G O   1 
ATOM   9335  C  CB  . GLU F 3 82  ? 6.000   -26.424 24.204  1.00 93.98  ? 82  GLU G CB  1 
ATOM   9336  C  CG  . GLU F 3 82  ? 4.730   -27.027 23.630  1.00 99.05  ? 82  GLU G CG  1 
ATOM   9337  C  CD  . GLU F 3 82  ? 3.984   -26.051 22.742  1.00 104.00 ? 82  GLU G CD  1 
ATOM   9338  O  OE1 . GLU F 3 82  ? 2.761   -26.237 22.574  1.00 116.39 ? 82  GLU G OE1 1 
ATOM   9339  O  OE2 . GLU F 3 82  ? 4.611   -25.097 22.227  1.00 99.91  ? 82  GLU G OE2 1 
ATOM   9340  N  N   . LEU F 3 83  ? 6.852   -29.644 24.662  1.00 93.57  ? 83  LEU G N   1 
ATOM   9341  C  CA  . LEU F 3 83  ? 7.398   -30.826 23.991  1.00 90.84  ? 83  LEU G CA  1 
ATOM   9342  C  C   . LEU F 3 83  ? 6.440   -31.331 22.920  1.00 95.46  ? 83  LEU G C   1 
ATOM   9343  O  O   . LEU F 3 83  ? 5.235   -31.446 23.159  1.00 100.81 ? 83  LEU G O   1 
ATOM   9344  C  CB  . LEU F 3 83  ? 7.620   -31.947 25.003  1.00 90.93  ? 83  LEU G CB  1 
ATOM   9345  C  CG  . LEU F 3 83  ? 8.701   -31.684 26.049  1.00 93.73  ? 83  LEU G CG  1 
ATOM   9346  C  CD1 . LEU F 3 83  ? 8.770   -32.842 27.045  1.00 91.27  ? 83  LEU G CD1 1 
ATOM   9347  C  CD2 . LEU F 3 83  ? 10.048  -31.435 25.383  1.00 90.60  ? 83  LEU G CD2 1 
ATOM   9348  N  N   . LEU F 3 84  ? 6.983   -31.693 21.764  1.00 95.48  ? 84  LEU G N   1 
ATOM   9349  C  CA  . LEU F 3 84  ? 6.157   -31.951 20.585  1.00 100.47 ? 84  LEU G CA  1 
ATOM   9350  C  C   . LEU F 3 84  ? 6.111   -33.421 20.159  1.00 102.77 ? 84  LEU G C   1 
ATOM   9351  O  O   . LEU F 3 84  ? 6.984   -34.202 20.510  1.00 100.29 ? 84  LEU G O   1 
ATOM   9352  C  CB  . LEU F 3 84  ? 6.650   -31.075 19.444  1.00 102.77 ? 84  LEU G CB  1 
ATOM   9353  C  CG  . LEU F 3 84  ? 6.748   -29.614 19.877  1.00 106.36 ? 84  LEU G CG  1 
ATOM   9354  C  CD1 . LEU F 3 84  ? 7.547   -28.815 18.867  1.00 112.73 ? 84  LEU G CD1 1 
ATOM   9355  C  CD2 . LEU F 3 84  ? 5.362   -29.016 20.064  1.00 112.49 ? 84  LEU G CD2 1 
ATOM   9356  N  N   . SER F 3 85  ? 5.076   -33.786 19.406  1.00 113.74 ? 85  SER G N   1 
ATOM   9357  C  CA  . SER F 3 85  ? 4.884   -35.162 18.923  1.00 116.68 ? 85  SER G CA  1 
ATOM   9358  C  C   . SER F 3 85  ? 5.516   -36.183 19.866  1.00 106.88 ? 85  SER G C   1 
ATOM   9359  O  O   . SER F 3 85  ? 6.532   -36.808 19.569  1.00 108.24 ? 85  SER G O   1 
ATOM   9360  C  CB  . SER F 3 85  ? 5.405   -35.322 17.494  1.00 120.48 ? 85  SER G CB  1 
ATOM   9361  O  OG  . SER F 3 85  ? 6.769   -34.979 17.411  1.00 121.13 ? 85  SER G OG  1 
ATOM   9362  N  N   . LEU F 3 86  ? 4.882   -36.346 21.014  1.00 101.97 ? 86  LEU G N   1 
ATOM   9363  C  CA  . LEU F 3 86  ? 5.442   -37.156 22.074  1.00 101.33 ? 86  LEU G CA  1 
ATOM   9364  C  C   . LEU F 3 86  ? 5.364   -38.638 21.750  1.00 102.72 ? 86  LEU G C   1 
ATOM   9365  O  O   . LEU F 3 86  ? 4.353   -39.128 21.245  1.00 106.78 ? 86  LEU G O   1 
ATOM   9366  C  CB  . LEU F 3 86  ? 4.716   -36.870 23.380  1.00 98.86  ? 86  LEU G CB  1 
ATOM   9367  C  CG  . LEU F 3 86  ? 4.965   -35.462 23.903  1.00 95.67  ? 86  LEU G CG  1 
ATOM   9368  C  CD1 . LEU F 3 86  ? 4.005   -35.135 25.025  1.00 100.46 ? 86  LEU G CD1 1 
ATOM   9369  C  CD2 . LEU F 3 86  ? 6.390   -35.351 24.388  1.00 93.96  ? 86  LEU G CD2 1 
ATOM   9370  N  N   . THR F 3 87  ? 6.450   -39.341 22.051  1.00 104.20 ? 87  THR G N   1 
ATOM   9371  C  CA  . THR F 3 87  ? 6.482   -40.799 21.997  1.00 108.66 ? 87  THR G CA  1 
ATOM   9372  C  C   . THR F 3 87  ? 6.808   -41.315 23.397  1.00 110.36 ? 87  THR G C   1 
ATOM   9373  O  O   . THR F 3 87  ? 7.068   -40.521 24.307  1.00 106.62 ? 87  THR G O   1 
ATOM   9374  C  CB  . THR F 3 87  ? 7.544   -41.294 21.004  1.00 107.89 ? 87  THR G CB  1 
ATOM   9375  O  OG1 . THR F 3 87  ? 8.851   -40.986 21.509  1.00 107.49 ? 87  THR G OG1 1 
ATOM   9376  C  CG2 . THR F 3 87  ? 7.351   -40.624 19.650  1.00 111.00 ? 87  THR G CG2 1 
ATOM   9377  N  N   . SER F 3 88  ? 6.783   -42.632 23.588  1.00 111.70 ? 88  SER G N   1 
ATOM   9378  C  CA  . SER F 3 88  ? 7.035   -43.183 24.915  1.00 105.44 ? 88  SER G CA  1 
ATOM   9379  C  C   . SER F 3 88  ? 8.461   -42.866 25.379  1.00 105.35 ? 88  SER G C   1 
ATOM   9380  O  O   . SER F 3 88  ? 8.709   -42.795 26.571  1.00 107.29 ? 88  SER G O   1 
ATOM   9381  C  CB  . SER F 3 88  ? 6.785   -44.674 24.930  1.00 102.71 ? 88  SER G CB  1 
ATOM   9382  O  OG  . SER F 3 88  ? 7.628   -45.286 23.989  1.00 118.97 ? 88  SER G OG  1 
ATOM   9383  N  N   . GLU F 3 89  ? 9.374   -42.619 24.436  1.00 116.33 ? 89  GLU G N   1 
ATOM   9384  C  CA  . GLU F 3 89  ? 10.759  -42.187 24.745  1.00 119.77 ? 89  GLU G CA  1 
ATOM   9385  C  C   . GLU F 3 89  ? 10.854  -40.885 25.543  1.00 107.62 ? 89  GLU G C   1 
ATOM   9386  O  O   . GLU F 3 89  ? 11.920  -40.525 26.064  1.00 98.80  ? 89  GLU G O   1 
ATOM   9387  C  CB  . GLU F 3 89  ? 11.544  -41.959 23.446  1.00 126.38 ? 89  GLU G CB  1 
ATOM   9388  C  CG  . GLU F 3 89  ? 11.801  -43.195 22.598  1.00 136.70 ? 89  GLU G CG  1 
ATOM   9389  C  CD  . GLU F 3 89  ? 12.564  -42.860 21.327  1.00 145.06 ? 89  GLU G CD  1 
ATOM   9390  O  OE1 . GLU F 3 89  ? 13.604  -42.171 21.416  1.00 136.91 ? 89  GLU G OE1 1 
ATOM   9391  O  OE2 . GLU F 3 89  ? 12.127  -43.282 20.236  1.00 152.79 ? 89  GLU G OE2 1 
ATOM   9392  N  N   . ASP F 3 90  ? 9.760   -40.144 25.573  1.00 102.66 ? 90  ASP G N   1 
ATOM   9393  C  CA  . ASP F 3 90  ? 9.757   -38.840 26.205  1.00 95.86  ? 90  ASP G CA  1 
ATOM   9394  C  C   . ASP F 3 90  ? 9.326   -38.950 27.660  1.00 87.19  ? 90  ASP G C   1 
ATOM   9395  O  O   . ASP F 3 90  ? 9.573   -38.044 28.450  1.00 82.02  ? 90  ASP G O   1 
ATOM   9396  C  CB  . ASP F 3 90  ? 8.842   -37.895 25.430  1.00 95.33  ? 90  ASP G CB  1 
ATOM   9397  C  CG  . ASP F 3 90  ? 9.359   -37.609 24.030  1.00 98.25  ? 90  ASP G CG  1 
ATOM   9398  O  OD1 . ASP F 3 90  ? 10.544  -37.237 23.901  1.00 85.04  ? 90  ASP G OD1 1 
ATOM   9399  O  OD2 . ASP F 3 90  ? 8.586   -37.779 23.056  1.00 114.97 ? 90  ASP G OD2 1 
ATOM   9400  N  N   . SER F 3 91  ? 8.684   -40.056 28.017  1.00 86.35  ? 91  SER G N   1 
ATOM   9401  C  CA  . SER F 3 91  ? 8.294   -40.267 29.401  1.00 87.17  ? 91  SER G CA  1 
ATOM   9402  C  C   . SER F 3 91  ? 9.517   -40.146 30.292  1.00 81.62  ? 91  SER G C   1 
ATOM   9403  O  O   . SER F 3 91  ? 10.454  -40.917 30.169  1.00 91.60  ? 91  SER G O   1 
ATOM   9404  C  CB  . SER F 3 91  ? 7.633   -41.626 29.578  1.00 90.38  ? 91  SER G CB  1 
ATOM   9405  O  OG  . SER F 3 91  ? 6.350   -41.630 28.974  1.00 102.11 ? 91  SER G OG  1 
ATOM   9406  N  N   . ALA F 3 92  ? 9.516   -39.144 31.160  1.00 78.12  ? 92  ALA G N   1 
ATOM   9407  C  CA  . ALA F 3 92  ? 10.658  -38.859 32.020  1.00 74.72  ? 92  ALA G CA  1 
ATOM   9408  C  C   . ALA F 3 92  ? 10.306  -37.816 33.060  1.00 66.23  ? 92  ALA G C   1 
ATOM   9409  O  O   . ALA F 3 92  ? 9.183   -37.329 33.107  1.00 70.76  ? 92  ALA G O   1 
ATOM   9410  C  CB  . ALA F 3 92  ? 11.839  -38.374 31.198  1.00 77.93  ? 92  ALA G CB  1 
ATOM   9411  N  N   . ILE F 3 93  ? 11.268  -37.504 33.915  1.00 61.16  ? 93  ILE G N   1 
ATOM   9412  C  CA  . ILE F 3 93  ? 11.159  -36.355 34.784  1.00 65.72  ? 93  ILE G CA  1 
ATOM   9413  C  C   . ILE F 3 93  ? 11.917  -35.187 34.152  1.00 67.73  ? 93  ILE G C   1 
ATOM   9414  O  O   . ILE F 3 93  ? 13.025  -35.350 33.645  1.00 76.20  ? 93  ILE G O   1 
ATOM   9415  C  CB  . ILE F 3 93  ? 11.707  -36.649 36.191  1.00 64.82  ? 93  ILE G CB  1 
ATOM   9416  C  CG1 . ILE F 3 93  ? 10.790  -37.626 36.903  1.00 63.10  ? 93  ILE G CG1 1 
ATOM   9417  C  CG2 . ILE F 3 93  ? 11.793  -35.373 37.024  1.00 67.87  ? 93  ILE G CG2 1 
ATOM   9418  C  CD1 . ILE F 3 93  ? 11.227  -37.898 38.325  1.00 66.84  ? 93  ILE G CD1 1 
ATOM   9419  N  N   . TYR F 3 94  ? 11.289  -34.018 34.169  1.00 63.14  ? 94  TYR G N   1 
ATOM   9420  C  CA  . TYR F 3 94  ? 11.863  -32.824 33.600  1.00 64.72  ? 94  TYR G CA  1 
ATOM   9421  C  C   . TYR F 3 94  ? 11.995  -31.774 34.693  1.00 65.90  ? 94  TYR G C   1 
ATOM   9422  O  O   . TYR F 3 94  ? 11.044  -31.505 35.435  1.00 60.14  ? 94  TYR G O   1 
ATOM   9423  C  CB  . TYR F 3 94  ? 10.979  -32.302 32.467  1.00 66.73  ? 94  TYR G CB  1 
ATOM   9424  C  CG  . TYR F 3 94  ? 10.952  -33.208 31.254  1.00 69.23  ? 94  TYR G CG  1 
ATOM   9425  C  CD1 . TYR F 3 94  ? 9.989   -34.191 31.122  1.00 73.98  ? 94  TYR G CD1 1 
ATOM   9426  C  CD2 . TYR F 3 94  ? 11.894  -33.086 30.251  1.00 67.92  ? 94  TYR G CD2 1 
ATOM   9427  C  CE1 . TYR F 3 94  ? 9.961   -35.034 30.022  1.00 72.51  ? 94  TYR G CE1 1 
ATOM   9428  C  CE2 . TYR F 3 94  ? 11.870  -33.912 29.143  1.00 69.96  ? 94  TYR G CE2 1 
ATOM   9429  C  CZ  . TYR F 3 94  ? 10.896  -34.880 29.029  1.00 73.14  ? 94  TYR G CZ  1 
ATOM   9430  O  OH  . TYR F 3 94  ? 10.864  -35.700 27.924  1.00 79.43  ? 94  TYR G OH  1 
ATOM   9431  N  N   . TYR F 3 95  ? 13.183  -31.185 34.789  1.00 63.46  ? 95  TYR G N   1 
ATOM   9432  C  CA  . TYR F 3 95  ? 13.434  -30.133 35.756  1.00 63.33  ? 95  TYR G CA  1 
ATOM   9433  C  C   . TYR F 3 95  ? 13.620  -28.805 35.063  1.00 64.08  ? 95  TYR G C   1 
ATOM   9434  O  O   . TYR F 3 95  ? 14.149  -28.760 33.958  1.00 75.04  ? 95  TYR G O   1 
ATOM   9435  C  CB  . TYR F 3 95  ? 14.707  -30.443 36.502  1.00 67.37  ? 95  TYR G CB  1 
ATOM   9436  C  CG  . TYR F 3 95  ? 14.688  -31.755 37.217  1.00 65.64  ? 95  TYR G CG  1 
ATOM   9437  C  CD1 . TYR F 3 95  ? 14.066  -31.875 38.442  1.00 67.04  ? 95  TYR G CD1 1 
ATOM   9438  C  CD2 . TYR F 3 95  ? 15.336  -32.854 36.700  1.00 68.71  ? 95  TYR G CD2 1 
ATOM   9439  C  CE1 . TYR F 3 95  ? 14.085  -33.058 39.135  1.00 69.63  ? 95  TYR G CE1 1 
ATOM   9440  C  CE2 . TYR F 3 95  ? 15.344  -34.055 37.380  1.00 72.90  ? 95  TYR G CE2 1 
ATOM   9441  C  CZ  . TYR F 3 95  ? 14.719  -34.141 38.600  1.00 68.81  ? 95  TYR G CZ  1 
ATOM   9442  O  OH  . TYR F 3 95  ? 14.696  -35.317 39.287  1.00 77.76  ? 95  TYR G OH  1 
ATOM   9443  N  N   . CYS F 3 96  ? 13.194  -27.721 35.699  1.00 65.98  ? 96  CYS G N   1 
ATOM   9444  C  CA  . CYS F 3 96  ? 13.739  -26.421 35.346  1.00 69.55  ? 96  CYS G CA  1 
ATOM   9445  C  C   . CYS F 3 96  ? 14.837  -26.158 36.354  1.00 67.40  ? 96  CYS G C   1 
ATOM   9446  O  O   . CYS F 3 96  ? 14.690  -26.496 37.527  1.00 69.46  ? 96  CYS G O   1 
ATOM   9447  C  CB  . CYS F 3 96  ? 12.677  -25.334 35.407  1.00 68.70  ? 96  CYS G CB  1 
ATOM   9448  S  SG  . CYS F 3 96  ? 12.053  -25.063 37.072  1.00 79.75  ? 96  CYS G SG  1 
ATOM   9449  N  N   . THR F 3 97  ? 15.959  -25.615 35.900  1.00 62.13  ? 97  THR G N   1 
ATOM   9450  C  CA  . THR F 3 97  ? 17.018  -25.240 36.823  1.00 62.14  ? 97  THR G CA  1 
ATOM   9451  C  C   . THR F 3 97  ? 17.721  -23.976 36.365  1.00 63.75  ? 97  THR G C   1 
ATOM   9452  O  O   . THR F 3 97  ? 17.790  -23.693 35.167  1.00 68.63  ? 97  THR G O   1 
ATOM   9453  C  CB  . THR F 3 97  ? 18.050  -26.360 36.980  1.00 67.90  ? 97  THR G CB  1 
ATOM   9454  O  OG1 . THR F 3 97  ? 19.091  -25.943 37.873  1.00 70.86  ? 97  THR G OG1 1 
ATOM   9455  C  CG2 . THR F 3 97  ? 18.647  -26.698 35.631  1.00 74.79  ? 97  THR G CG2 1 
ATOM   9456  N  N   . ARG F 3 98  ? 18.253  -23.235 37.336  1.00 59.77  ? 98  ARG G N   1 
ATOM   9457  C  CA  . ARG F 3 98  ? 18.788  -21.903 37.109  1.00 61.99  ? 98  ARG G CA  1 
ATOM   9458  C  C   . ARG F 3 98  ? 20.301  -21.929 37.015  1.00 59.65  ? 98  ARG G C   1 
ATOM   9459  O  O   . ARG F 3 98  ? 20.946  -22.722 37.691  1.00 73.00  ? 98  ARG G O   1 
ATOM   9460  C  CB  . ARG F 3 98  ? 18.403  -21.017 38.273  1.00 64.97  ? 98  ARG G CB  1 
ATOM   9461  C  CG  . ARG F 3 98  ? 18.536  -19.540 37.981  1.00 70.53  ? 98  ARG G CG  1 
ATOM   9462  C  CD  . ARG F 3 98  ? 18.333  -18.732 39.249  1.00 74.32  ? 98  ARG G CD  1 
ATOM   9463  N  NE  . ARG F 3 98  ? 19.482  -18.801 40.140  1.00 74.43  ? 98  ARG G NE  1 
ATOM   9464  C  CZ  . ARG F 3 98  ? 19.701  -17.948 41.132  1.00 76.33  ? 98  ARG G CZ  1 
ATOM   9465  N  NH1 . ARG F 3 98  ? 18.841  -16.965 41.373  1.00 78.86  ? 98  ARG G NH1 1 
ATOM   9466  N  NH2 . ARG F 3 98  ? 20.781  -18.077 41.882  1.00 80.83  ? 98  ARG G NH2 1 
ATOM   9467  N  N   . GLY F 3 99  ? 20.873  -21.063 36.192  1.00 55.88  ? 99  GLY G N   1 
ATOM   9468  C  CA  . GLY F 3 99  ? 22.328  -20.988 36.094  1.00 59.16  ? 99  GLY G CA  1 
ATOM   9469  C  C   . GLY F 3 99  ? 22.872  -20.731 34.695  1.00 61.31  ? 99  GLY G C   1 
ATOM   9470  O  O   . GLY F 3 99  ? 22.223  -21.038 33.683  1.00 65.11  ? 99  GLY G O   1 
ATOM   9471  N  N   . ASN F 3 100 ? 24.056  -20.127 34.640  1.00 59.05  ? 100 ASN G N   1 
ATOM   9472  C  CA  . ASN F 3 100 ? 24.734  -19.894 33.373  1.00 60.27  ? 100 ASN G CA  1 
ATOM   9473  C  C   . ASN F 3 100 ? 26.103  -20.509 33.372  1.00 63.85  ? 100 ASN G C   1 
ATOM   9474  O  O   . ASN F 3 100 ? 26.841  -20.357 32.403  1.00 67.26  ? 100 ASN G O   1 
ATOM   9475  C  CB  . ASN F 3 100 ? 24.839  -18.398 33.060  1.00 62.47  ? 100 ASN G CB  1 
ATOM   9476  C  CG  . ASN F 3 100 ? 25.704  -17.639 34.053  1.00 62.49  ? 100 ASN G CG  1 
ATOM   9477  O  OD1 . ASN F 3 100 ? 26.093  -18.173 35.074  1.00 72.02  ? 100 ASN G OD1 1 
ATOM   9478  N  ND2 . ASN F 3 100 ? 25.983  -16.371 33.762  1.00 62.91  ? 100 ASN G ND2 1 
ATOM   9479  N  N   . TYR F 3 101 ? 26.455  -21.186 34.465  1.00 65.98  ? 101 TYR G N   1 
ATOM   9480  C  CA  . TYR F 3 101 ? 27.633  -22.039 34.454  1.00 64.27  ? 101 TYR G CA  1 
ATOM   9481  C  C   . TYR F 3 101 ? 27.500  -23.254 35.363  1.00 62.92  ? 101 TYR G C   1 
ATOM   9482  O  O   . TYR F 3 101 ? 27.926  -24.341 34.974  1.00 63.43  ? 101 TYR G O   1 
ATOM   9483  C  CB  . TYR F 3 101 ? 28.884  -21.242 34.783  1.00 64.02  ? 101 TYR G CB  1 
ATOM   9484  C  CG  . TYR F 3 101 ? 29.003  -20.826 36.226  1.00 66.43  ? 101 TYR G CG  1 
ATOM   9485  C  CD1 . TYR F 3 101 ? 28.403  -19.677 36.683  1.00 66.69  ? 101 TYR G CD1 1 
ATOM   9486  C  CD2 . TYR F 3 101 ? 29.777  -21.549 37.116  1.00 73.44  ? 101 TYR G CD2 1 
ATOM   9487  C  CE1 . TYR F 3 101 ? 28.548  -19.272 37.994  1.00 71.56  ? 101 TYR G CE1 1 
ATOM   9488  C  CE2 . TYR F 3 101 ? 29.935  -21.141 38.426  1.00 70.16  ? 101 TYR G CE2 1 
ATOM   9489  C  CZ  . TYR F 3 101 ? 29.315  -20.006 38.855  1.00 67.65  ? 101 TYR G CZ  1 
ATOM   9490  O  OH  . TYR F 3 101 ? 29.430  -19.613 40.157  1.00 71.81  ? 101 TYR G OH  1 
ATOM   9491  N  N   . VAL F 3 102 ? 26.934  -23.072 36.560  1.00 61.50  ? 102 VAL G N   1 
ATOM   9492  C  CA  . VAL F 3 102 ? 26.470  -24.197 37.387  1.00 63.39  ? 102 VAL G CA  1 
ATOM   9493  C  C   . VAL F 3 102 ? 24.969  -24.078 37.642  1.00 62.94  ? 102 VAL G C   1 
ATOM   9494  O  O   . VAL F 3 102 ? 24.421  -22.978 37.645  1.00 67.17  ? 102 VAL G O   1 
ATOM   9495  C  CB  . VAL F 3 102 ? 27.241  -24.318 38.732  1.00 65.41  ? 102 VAL G CB  1 
ATOM   9496  C  CG1 . VAL F 3 102 ? 27.082  -23.090 39.582  1.00 69.59  ? 102 VAL G CG1 1 
ATOM   9497  C  CG2 . VAL F 3 102 ? 26.759  -25.518 39.521  1.00 70.98  ? 102 VAL G CG2 1 
ATOM   9498  N  N   . PHE F 3 103 ? 24.296  -25.208 37.822  1.00 62.92  ? 103 PHE G N   1 
ATOM   9499  C  CA  . PHE F 3 103 ? 22.850  -25.198 38.013  1.00 62.07  ? 103 PHE G CA  1 
ATOM   9500  C  C   . PHE F 3 103 ? 22.519  -25.193 39.500  1.00 63.80  ? 103 PHE G C   1 
ATOM   9501  O  O   . PHE F 3 103 ? 22.542  -26.226 40.157  1.00 61.55  ? 103 PHE G O   1 
ATOM   9502  C  CB  . PHE F 3 103 ? 22.221  -26.410 37.338  1.00 66.27  ? 103 PHE G CB  1 
ATOM   9503  C  CG  . PHE F 3 103 ? 22.545  -26.535 35.870  1.00 63.61  ? 103 PHE G CG  1 
ATOM   9504  C  CD1 . PHE F 3 103 ? 22.124  -25.576 34.969  1.00 66.03  ? 103 PHE G CD1 1 
ATOM   9505  C  CD2 . PHE F 3 103 ? 23.216  -27.634 35.389  1.00 59.57  ? 103 PHE G CD2 1 
ATOM   9506  C  CE1 . PHE F 3 103 ? 22.388  -25.706 33.619  1.00 61.63  ? 103 PHE G CE1 1 
ATOM   9507  C  CE2 . PHE F 3 103 ? 23.483  -27.764 34.045  1.00 59.85  ? 103 PHE G CE2 1 
ATOM   9508  C  CZ  . PHE F 3 103 ? 23.061  -26.804 33.158  1.00 58.12  ? 103 PHE G CZ  1 
ATOM   9509  N  N   . ASP F 3 104 ? 22.271  -24.010 40.047  1.00 72.48  ? 104 ASP G N   1 
ATOM   9510  C  CA  . ASP F 3 104 ? 22.357  -23.828 41.498  1.00 70.84  ? 104 ASP G CA  1 
ATOM   9511  C  C   . ASP F 3 104 ? 21.041  -24.036 42.192  1.00 63.60  ? 104 ASP G C   1 
ATOM   9512  O  O   . ASP F 3 104 ? 21.025  -24.347 43.378  1.00 60.23  ? 104 ASP G O   1 
ATOM   9513  C  CB  . ASP F 3 104 ? 22.963  -22.463 41.881  1.00 73.82  ? 104 ASP G CB  1 
ATOM   9514  C  CG  . ASP F 3 104 ? 22.275  -21.274 41.207  1.00 76.94  ? 104 ASP G CG  1 
ATOM   9515  O  OD1 . ASP F 3 104 ? 21.322  -21.451 40.409  1.00 85.32  ? 104 ASP G OD1 1 
ATOM   9516  O  OD2 . ASP F 3 104 ? 22.716  -20.136 41.482  1.00 77.70  ? 104 ASP G OD2 1 
ATOM   9517  N  N   . TYR F 3 105 ? 19.945  -23.867 41.455  1.00 63.89  ? 105 TYR G N   1 
ATOM   9518  C  CA  . TYR F 3 105 ? 18.616  -24.106 41.999  1.00 64.61  ? 105 TYR G CA  1 
ATOM   9519  C  C   . TYR F 3 105 ? 17.760  -24.839 40.997  1.00 66.59  ? 105 TYR G C   1 
ATOM   9520  O  O   . TYR F 3 105 ? 17.745  -24.495 39.817  1.00 68.47  ? 105 TYR G O   1 
ATOM   9521  C  CB  . TYR F 3 105 ? 17.955  -22.795 42.378  1.00 71.00  ? 105 TYR G CB  1 
ATOM   9522  C  CG  . TYR F 3 105 ? 18.642  -22.151 43.543  1.00 74.35  ? 105 TYR G CG  1 
ATOM   9523  C  CD1 . TYR F 3 105 ? 18.623  -22.746 44.790  1.00 79.40  ? 105 TYR G CD1 1 
ATOM   9524  C  CD2 . TYR F 3 105 ? 19.369  -20.992 43.383  1.00 80.16  ? 105 TYR G CD2 1 
ATOM   9525  C  CE1 . TYR F 3 105 ? 19.287  -22.189 45.857  1.00 82.30  ? 105 TYR G CE1 1 
ATOM   9526  C  CE2 . TYR F 3 105 ? 20.039  -20.425 44.447  1.00 85.91  ? 105 TYR G CE2 1 
ATOM   9527  C  CZ  . TYR F 3 105 ? 19.993  -21.032 45.682  1.00 84.89  ? 105 TYR G CZ  1 
ATOM   9528  O  OH  . TYR F 3 105 ? 20.666  -20.487 46.747  1.00 101.74 ? 105 TYR G OH  1 
ATOM   9529  N  N   . TRP F 3 106 ? 17.074  -25.870 41.473  1.00 64.74  ? 106 TRP G N   1 
ATOM   9530  C  CA  . TRP F 3 106 ? 16.287  -26.730 40.615  1.00 61.56  ? 106 TRP G CA  1 
ATOM   9531  C  C   . TRP F 3 106 ? 14.867  -26.729 41.099  1.00 60.05  ? 106 TRP G C   1 
ATOM   9532  O  O   . TRP F 3 106 ? 14.614  -26.714 42.297  1.00 62.77  ? 106 TRP G O   1 
ATOM   9533  C  CB  . TRP F 3 106 ? 16.791  -28.172 40.683  1.00 62.11  ? 106 TRP G CB  1 
ATOM   9534  C  CG  . TRP F 3 106 ? 18.178  -28.385 40.214  1.00 65.63  ? 106 TRP G CG  1 
ATOM   9535  C  CD1 . TRP F 3 106 ? 19.309  -27.817 40.713  1.00 67.86  ? 106 TRP G CD1 1 
ATOM   9536  C  CD2 . TRP F 3 106 ? 18.598  -29.264 39.161  1.00 65.08  ? 106 TRP G CD2 1 
ATOM   9537  N  NE1 . TRP F 3 106 ? 20.408  -28.261 40.012  1.00 68.29  ? 106 TRP G NE1 1 
ATOM   9538  C  CE2 . TRP F 3 106 ? 19.992  -29.147 39.054  1.00 65.15  ? 106 TRP G CE2 1 
ATOM   9539  C  CE3 . TRP F 3 106 ? 17.923  -30.117 38.281  1.00 62.09  ? 106 TRP G CE3 1 
ATOM   9540  C  CZ2 . TRP F 3 106 ? 20.717  -29.846 38.116  1.00 69.22  ? 106 TRP G CZ2 1 
ATOM   9541  C  CZ3 . TRP F 3 106 ? 18.647  -30.811 37.349  1.00 62.12  ? 106 TRP G CZ3 1 
ATOM   9542  C  CH2 . TRP F 3 106 ? 20.026  -30.678 37.273  1.00 68.75  ? 106 TRP G CH2 1 
ATOM   9543  N  N   . GLY F 3 107 ? 13.938  -26.825 40.168  1.00 59.11  ? 107 GLY G N   1 
ATOM   9544  C  CA  . GLY F 3 107 ? 12.572  -27.129 40.524  1.00 58.54  ? 107 GLY G CA  1 
ATOM   9545  C  C   . GLY F 3 107 ? 12.494  -28.527 41.094  1.00 54.44  ? 107 GLY G C   1 
ATOM   9546  O  O   . GLY F 3 107 ? 13.467  -29.271 41.082  1.00 46.74  ? 107 GLY G O   1 
ATOM   9547  N  N   . GLN F 3 108 ? 11.326  -28.878 41.610  1.00 59.37  ? 108 GLN G N   1 
ATOM   9548  C  CA  . GLN F 3 108 ? 11.151  -30.167 42.262  1.00 61.70  ? 108 GLN G CA  1 
ATOM   9549  C  C   . GLN F 3 108 ? 10.952  -31.241 41.218  1.00 61.50  ? 108 GLN G C   1 
ATOM   9550  O  O   . GLN F 3 108 ? 10.936  -32.423 41.536  1.00 61.33  ? 108 GLN G O   1 
ATOM   9551  C  CB  . GLN F 3 108 ? 9.967   -30.139 43.225  1.00 61.82  ? 108 GLN G CB  1 
ATOM   9552  C  CG  . GLN F 3 108 ? 8.611   -30.279 42.559  1.00 66.09  ? 108 GLN G CG  1 
ATOM   9553  C  CD  . GLN F 3 108 ? 8.065   -28.967 42.016  1.00 69.94  ? 108 GLN G CD  1 
ATOM   9554  O  OE1 . GLN F 3 108 ? 8.817   -28.037 41.758  1.00 74.38  ? 108 GLN G OE1 1 
ATOM   9555  N  NE2 . GLN F 3 108 ? 6.750   -28.903 41.816  1.00 70.86  ? 108 GLN G NE2 1 
ATOM   9556  N  N   . GLY F 3 109 ? 10.808  -30.820 39.965  1.00 65.72  ? 109 GLY G N   1 
ATOM   9557  C  CA  . GLY F 3 109 ? 10.675  -31.748 38.846  1.00 69.34  ? 109 GLY G CA  1 
ATOM   9558  C  C   . GLY F 3 109 ? 9.225   -31.956 38.482  1.00 68.91  ? 109 GLY G C   1 
ATOM   9559  O  O   . GLY F 3 109 ? 8.336   -31.702 39.292  1.00 65.97  ? 109 GLY G O   1 
ATOM   9560  N  N   . THR F 3 110 ? 8.985   -32.404 37.254  1.00 71.27  ? 110 THR G N   1 
ATOM   9561  C  CA  . THR F 3 110 ? 7.656   -32.828 36.856  1.00 82.97  ? 110 THR G CA  1 
ATOM   9562  C  C   . THR F 3 110 ? 7.759   -34.113 36.048  1.00 83.80  ? 110 THR G C   1 
ATOM   9563  O  O   . THR F 3 110 ? 8.641   -34.260 35.216  1.00 77.55  ? 110 THR G O   1 
ATOM   9564  C  CB  . THR F 3 110 ? 6.927   -31.740 36.042  1.00 78.20  ? 110 THR G CB  1 
ATOM   9565  O  OG1 . THR F 3 110 ? 5.684   -32.251 35.543  1.00 85.89  ? 110 THR G OG1 1 
ATOM   9566  C  CG2 . THR F 3 110 ? 7.766   -31.293 34.884  1.00 78.27  ? 110 THR G CG2 1 
ATOM   9567  N  N   . THR F 3 111 ? 6.856   -35.047 36.306  1.00 87.04  ? 111 THR G N   1 
ATOM   9568  C  CA  . THR F 3 111 ? 6.881   -36.320 35.613  1.00 83.96  ? 111 THR G CA  1 
ATOM   9569  C  C   . THR F 3 111 ? 5.932   -36.328 34.433  1.00 78.65  ? 111 THR G C   1 
ATOM   9570  O  O   . THR F 3 111 ? 4.749   -36.045 34.583  1.00 91.69  ? 111 THR G O   1 
ATOM   9571  C  CB  . THR F 3 111 ? 6.480   -37.448 36.555  1.00 84.77  ? 111 THR G CB  1 
ATOM   9572  O  OG1 . THR F 3 111 ? 7.448   -37.541 37.602  1.00 84.96  ? 111 THR G OG1 1 
ATOM   9573  C  CG2 . THR F 3 111 ? 6.400   -38.759 35.799  1.00 93.90  ? 111 THR G CG2 1 
ATOM   9574  N  N   . LEU F 3 112 ? 6.455   -36.655 33.260  1.00 71.00  ? 112 LEU G N   1 
ATOM   9575  C  CA  . LEU F 3 112 ? 5.632   -36.774 32.077  1.00 71.60  ? 112 LEU G CA  1 
ATOM   9576  C  C   . LEU F 3 112 ? 5.445   -38.239 31.759  1.00 83.76  ? 112 LEU G C   1 
ATOM   9577  O  O   . LEU F 3 112 ? 6.407   -39.008 31.747  1.00 86.41  ? 112 LEU G O   1 
ATOM   9578  C  CB  . LEU F 3 112 ? 6.275   -36.067 30.892  1.00 66.90  ? 112 LEU G CB  1 
ATOM   9579  C  CG  . LEU F 3 112 ? 5.734   -36.409 29.503  1.00 70.16  ? 112 LEU G CG  1 
ATOM   9580  C  CD1 . LEU F 3 112 ? 4.307   -35.934 29.319  1.00 76.48  ? 112 LEU G CD1 1 
ATOM   9581  C  CD2 . LEU F 3 112 ? 6.614   -35.778 28.446  1.00 75.09  ? 112 LEU G CD2 1 
ATOM   9582  N  N   . THR F 3 113 ? 4.197   -38.621 31.509  1.00 90.70  ? 113 THR G N   1 
ATOM   9583  C  CA  . THR F 3 113 ? 3.876   -39.984 31.138  1.00 87.71  ? 113 THR G CA  1 
ATOM   9584  C  C   . THR F 3 113 ? 3.138   -40.002 29.812  1.00 89.37  ? 113 THR G C   1 
ATOM   9585  O  O   . THR F 3 113 ? 2.092   -39.373 29.673  1.00 93.80  ? 113 THR G O   1 
ATOM   9586  C  CB  . THR F 3 113 ? 3.000   -40.631 32.207  1.00 85.81  ? 113 THR G CB  1 
ATOM   9587  O  OG1 . THR F 3 113 ? 3.700   -40.606 33.456  1.00 84.28  ? 113 THR G OG1 1 
ATOM   9588  C  CG2 . THR F 3 113 ? 2.675   -42.055 31.826  1.00 90.15  ? 113 THR G CG2 1 
ATOM   9589  N  N   . VAL F 3 114 ? 3.709   -40.697 28.834  1.00 88.64  ? 114 VAL G N   1 
ATOM   9590  C  CA  . VAL F 3 114 ? 3.128   -40.783 27.497  1.00 86.70  ? 114 VAL G CA  1 
ATOM   9591  C  C   . VAL F 3 114 ? 2.569   -42.178 27.285  1.00 86.61  ? 114 VAL G C   1 
ATOM   9592  O  O   . VAL F 3 114 ? 3.312   -43.148 27.308  1.00 92.73  ? 114 VAL G O   1 
ATOM   9593  C  CB  . VAL F 3 114 ? 4.195   -40.522 26.423  1.00 88.35  ? 114 VAL G CB  1 
ATOM   9594  C  CG1 . VAL F 3 114 ? 3.564   -40.557 25.043  1.00 89.08  ? 114 VAL G CG1 1 
ATOM   9595  C  CG2 . VAL F 3 114 ? 4.907   -39.191 26.679  1.00 94.40  ? 114 VAL G CG2 1 
ATOM   9596  N  N   . SER F 3 115 ? 1.263   -42.284 27.083  1.00 87.32  ? 115 SER G N   1 
ATOM   9597  C  CA  . SER F 3 115 ? 0.600   -43.584 27.126  1.00 89.50  ? 115 SER G CA  1 
ATOM   9598  C  C   . SER F 3 115 ? -0.800  -43.523 26.563  1.00 96.32  ? 115 SER G C   1 
ATOM   9599  O  O   . SER F 3 115 ? -1.454  -42.490 26.638  1.00 100.94 ? 115 SER G O   1 
ATOM   9600  C  CB  . SER F 3 115 ? 0.532   -44.097 28.567  1.00 85.65  ? 115 SER G CB  1 
ATOM   9601  O  OG  . SER F 3 115 ? -0.454  -45.117 28.733  1.00 87.54  ? 115 SER G OG  1 
ATOM   9602  N  N   . SER F 3 116 ? -1.265  -44.654 26.039  1.00 100.98 ? 116 SER G N   1 
ATOM   9603  C  CA  . SER F 3 116 ? -2.605  -44.758 25.482  1.00 103.32 ? 116 SER G CA  1 
ATOM   9604  C  C   . SER F 3 116 ? -3.625  -45.228 26.521  1.00 102.35 ? 116 SER G C   1 
ATOM   9605  O  O   . SER F 3 116 ? -4.825  -45.266 26.258  1.00 107.90 ? 116 SER G O   1 
ATOM   9606  C  CB  . SER F 3 116 ? -2.569  -45.722 24.304  1.00 107.04 ? 116 SER G CB  1 
ATOM   9607  O  OG  . SER F 3 116 ? -1.682  -45.240 23.307  1.00 109.51 ? 116 SER G OG  1 
ATOM   9608  N  N   . ALA F 3 117 ? -3.141  -45.561 27.710  1.00 101.37 ? 117 ALA G N   1 
ATOM   9609  C  CA  . ALA F 3 117 ? -3.952  -46.242 28.719  1.00 106.92 ? 117 ALA G CA  1 
ATOM   9610  C  C   . ALA F 3 117 ? -5.084  -45.385 29.260  1.00 107.33 ? 117 ALA G C   1 
ATOM   9611  O  O   . ALA F 3 117 ? -4.975  -44.162 29.300  1.00 124.11 ? 117 ALA G O   1 
ATOM   9612  C  CB  . ALA F 3 117 ? -3.063  -46.699 29.863  1.00 105.37 ? 117 ALA G CB  1 
ATOM   9613  N  N   . LYS F 3 118 ? -6.151  -46.041 29.708  1.00 103.95 ? 118 LYS G N   1 
ATOM   9614  C  CA  . LYS F 3 118 ? -7.274  -45.361 30.339  1.00 108.90 ? 118 LYS G CA  1 
ATOM   9615  C  C   . LYS F 3 118 ? -7.277  -45.557 31.848  1.00 105.06 ? 118 LYS G C   1 
ATOM   9616  O  O   . LYS F 3 118 ? -6.735  -46.530 32.344  1.00 107.57 ? 118 LYS G O   1 
ATOM   9617  C  CB  . LYS F 3 118 ? -8.572  -45.883 29.751  1.00 122.22 ? 118 LYS G CB  1 
ATOM   9618  C  CG  . LYS F 3 118 ? -8.595  -45.776 28.236  1.00 138.02 ? 118 LYS G CG  1 
ATOM   9619  C  CD  . LYS F 3 118 ? -9.998  -45.888 27.676  1.00 152.53 ? 118 LYS G CD  1 
ATOM   9620  C  CE  . LYS F 3 118 ? -10.063 -45.272 26.289  1.00 162.44 ? 118 LYS G CE  1 
ATOM   9621  N  NZ  . LYS F 3 118 ? -11.403 -45.477 25.680  1.00 185.39 ? 118 LYS G NZ  1 
ATOM   9622  N  N   . THR F 3 119 ? -7.876  -44.623 32.581  1.00 110.30 ? 119 THR G N   1 
ATOM   9623  C  CA  . THR F 3 119 ? -7.920  -44.733 34.037  1.00 110.29 ? 119 THR G CA  1 
ATOM   9624  C  C   . THR F 3 119 ? -8.593  -46.047 34.377  1.00 101.82 ? 119 THR G C   1 
ATOM   9625  O  O   . THR F 3 119 ? -9.720  -46.300 33.957  1.00 106.32 ? 119 THR G O   1 
ATOM   9626  C  CB  . THR F 3 119 ? -8.660  -43.553 34.721  1.00 111.89 ? 119 THR G CB  1 
ATOM   9627  O  OG1 . THR F 3 119 ? -7.915  -42.350 34.530  1.00 119.97 ? 119 THR G OG1 1 
ATOM   9628  C  CG2 . THR F 3 119 ? -8.814  -43.782 36.236  1.00 108.76 ? 119 THR G CG2 1 
ATOM   9629  N  N   . THR F 3 120 ? -7.874  -46.883 35.117  1.00 96.21  ? 120 THR G N   1 
ATOM   9630  C  CA  . THR F 3 120 ? -8.369  -48.183 35.525  1.00 101.41 ? 120 THR G CA  1 
ATOM   9631  C  C   . THR F 3 120 ? -8.106  -48.377 37.017  1.00 99.00  ? 120 THR G C   1 
ATOM   9632  O  O   . THR F 3 120 ? -6.982  -48.169 37.477  1.00 101.69 ? 120 THR G O   1 
ATOM   9633  C  CB  . THR F 3 120 ? -7.675  -49.319 34.729  1.00 101.07 ? 120 THR G CB  1 
ATOM   9634  O  OG1 . THR F 3 120 ? -7.799  -49.089 33.318  1.00 95.64  ? 120 THR G OG1 1 
ATOM   9635  C  CG2 . THR F 3 120 ? -8.294  -50.667 35.075  1.00 103.01 ? 120 THR G CG2 1 
ATOM   9636  N  N   . PRO F 3 121 ? -9.132  -48.802 37.776  1.00 91.05  ? 121 PRO G N   1 
ATOM   9637  C  CA  . PRO F 3 121 ? -8.900  -49.178 39.168  1.00 90.84  ? 121 PRO G CA  1 
ATOM   9638  C  C   . PRO F 3 121 ? -8.196  -50.533 39.281  1.00 89.46  ? 121 PRO G C   1 
ATOM   9639  O  O   . PRO F 3 121 ? -8.378  -51.387 38.418  1.00 92.45  ? 121 PRO G O   1 
ATOM   9640  C  CB  . PRO F 3 121 ? -10.311 -49.253 39.746  1.00 89.72  ? 121 PRO G CB  1 
ATOM   9641  C  CG  . PRO F 3 121 ? -11.159 -49.643 38.587  1.00 91.93  ? 121 PRO G CG  1 
ATOM   9642  C  CD  . PRO F 3 121 ? -10.525 -49.035 37.366  1.00 89.58  ? 121 PRO G CD  1 
ATOM   9643  N  N   . PRO F 3 122 ? -7.410  -50.728 40.350  1.00 85.68  ? 122 PRO G N   1 
ATOM   9644  C  CA  . PRO F 3 122 ? -6.631  -51.933 40.546  1.00 85.29  ? 122 PRO G CA  1 
ATOM   9645  C  C   . PRO F 3 122 ? -7.483  -53.073 41.069  1.00 86.51  ? 122 PRO G C   1 
ATOM   9646  O  O   . PRO F 3 122 ? -8.424  -52.831 41.814  1.00 92.19  ? 122 PRO G O   1 
ATOM   9647  C  CB  . PRO F 3 122 ? -5.640  -51.515 41.630  1.00 88.15  ? 122 PRO G CB  1 
ATOM   9648  C  CG  . PRO F 3 122 ? -6.395  -50.540 42.461  1.00 91.20  ? 122 PRO G CG  1 
ATOM   9649  C  CD  . PRO F 3 122 ? -7.353  -49.844 41.529  1.00 88.87  ? 122 PRO G CD  1 
ATOM   9650  N  N   . SER F 3 123 ? -7.151  -54.302 40.693  1.00 88.68  ? 123 SER G N   1 
ATOM   9651  C  CA  . SER F 3 123 ? -7.616  -55.477 41.425  1.00 89.77  ? 123 SER G CA  1 
ATOM   9652  C  C   . SER F 3 123 ? -6.676  -55.715 42.601  1.00 93.49  ? 123 SER G C   1 
ATOM   9653  O  O   . SER F 3 123 ? -5.448  -55.675 42.442  1.00 96.29  ? 123 SER G O   1 
ATOM   9654  C  CB  . SER F 3 123 ? -7.607  -56.703 40.527  1.00 90.12  ? 123 SER G CB  1 
ATOM   9655  O  OG  . SER F 3 123 ? -8.188  -56.421 39.276  1.00 92.93  ? 123 SER G OG  1 
ATOM   9656  N  N   . VAL F 3 124 ? -7.246  -55.945 43.779  1.00 92.83  ? 124 VAL G N   1 
ATOM   9657  C  CA  . VAL F 3 124 ? -6.446  -56.162 44.978  1.00 92.00  ? 124 VAL G CA  1 
ATOM   9658  C  C   . VAL F 3 124 ? -6.661  -57.570 45.469  1.00 89.69  ? 124 VAL G C   1 
ATOM   9659  O  O   . VAL F 3 124 ? -7.768  -57.951 45.805  1.00 87.77  ? 124 VAL G O   1 
ATOM   9660  C  CB  . VAL F 3 124 ? -6.807  -55.181 46.105  1.00 95.90  ? 124 VAL G CB  1 
ATOM   9661  C  CG1 . VAL F 3 124 ? -5.951  -55.436 47.338  1.00 97.64  ? 124 VAL G CG1 1 
ATOM   9662  C  CG2 . VAL F 3 124 ? -6.626  -53.752 45.625  1.00 94.77  ? 124 VAL G CG2 1 
ATOM   9663  N  N   . TYR F 3 125 ? -5.574  -58.322 45.531  1.00 93.67  ? 125 TYR G N   1 
ATOM   9664  C  CA  . TYR F 3 125 ? -5.612  -59.721 45.878  1.00 95.26  ? 125 TYR G CA  1 
ATOM   9665  C  C   . TYR F 3 125 ? -4.688  -59.945 47.063  1.00 100.06 ? 125 TYR G C   1 
ATOM   9666  O  O   . TYR F 3 125 ? -3.550  -59.471 47.073  1.00 104.51 ? 125 TYR G O   1 
ATOM   9667  C  CB  . TYR F 3 125 ? -5.119  -60.547 44.701  1.00 96.91  ? 125 TYR G CB  1 
ATOM   9668  C  CG  . TYR F 3 125 ? -5.915  -60.372 43.429  1.00 97.05  ? 125 TYR G CG  1 
ATOM   9669  C  CD1 . TYR F 3 125 ? -7.290  -60.527 43.423  1.00 101.49 ? 125 TYR G CD1 1 
ATOM   9670  C  CD2 . TYR F 3 125 ? -5.282  -60.115 42.220  1.00 97.15  ? 125 TYR G CD2 1 
ATOM   9671  C  CE1 . TYR F 3 125 ? -8.022  -60.404 42.253  1.00 104.41 ? 125 TYR G CE1 1 
ATOM   9672  C  CE2 . TYR F 3 125 ? -6.003  -59.995 41.043  1.00 98.36  ? 125 TYR G CE2 1 
ATOM   9673  C  CZ  . TYR F 3 125 ? -7.373  -60.138 41.067  1.00 103.07 ? 125 TYR G CZ  1 
ATOM   9674  O  OH  . TYR F 3 125 ? -8.107  -60.020 39.912  1.00 110.05 ? 125 TYR G OH  1 
ATOM   9675  N  N   . PRO F 3 126 ? -5.167  -60.677 48.066  1.00 99.49  ? 126 PRO G N   1 
ATOM   9676  C  CA  . PRO F 3 126 ? -4.374  -60.912 49.250  1.00 103.14 ? 126 PRO G CA  1 
ATOM   9677  C  C   . PRO F 3 126 ? -3.324  -61.971 48.986  1.00 107.06 ? 126 PRO G C   1 
ATOM   9678  O  O   . PRO F 3 126 ? -3.515  -62.828 48.123  1.00 108.95 ? 126 PRO G O   1 
ATOM   9679  C  CB  . PRO F 3 126 ? -5.401  -61.433 50.234  1.00 108.45 ? 126 PRO G CB  1 
ATOM   9680  C  CG  . PRO F 3 126 ? -6.327  -62.224 49.369  1.00 111.12 ? 126 PRO G CG  1 
ATOM   9681  C  CD  . PRO F 3 126 ? -6.354  -61.539 48.027  1.00 104.71 ? 126 PRO G CD  1 
ATOM   9682  N  N   . LEU F 3 127 ? -2.219  -61.899 49.718  1.00 109.27 ? 127 LEU G N   1 
ATOM   9683  C  CA  . LEU F 3 127 ? -1.172  -62.897 49.625  1.00 107.32 ? 127 LEU G CA  1 
ATOM   9684  C  C   . LEU F 3 127 ? -0.979  -63.516 50.989  1.00 112.63 ? 127 LEU G C   1 
ATOM   9685  O  O   . LEU F 3 127 ? -0.373  -62.912 51.878  1.00 109.15 ? 127 LEU G O   1 
ATOM   9686  C  CB  . LEU F 3 127 ? 0.133   -62.278 49.137  1.00 102.33 ? 127 LEU G CB  1 
ATOM   9687  C  CG  . LEU F 3 127 ? 0.035   -61.636 47.759  1.00 99.29  ? 127 LEU G CG  1 
ATOM   9688  C  CD1 . LEU F 3 127 ? 1.341   -60.932 47.443  1.00 95.79  ? 127 LEU G CD1 1 
ATOM   9689  C  CD2 . LEU F 3 127 ? -0.316  -62.666 46.688  1.00 99.62  ? 127 LEU G CD2 1 
ATOM   9690  N  N   . ALA F 3 128 ? -1.510  -64.727 51.136  1.00 117.43 ? 128 ALA G N   1 
ATOM   9691  C  CA  . ALA F 3 128 ? -1.339  -65.512 52.340  1.00 119.02 ? 128 ALA G CA  1 
ATOM   9692  C  C   . ALA F 3 128 ? -0.512  -66.730 52.010  1.00 124.87 ? 128 ALA G C   1 
ATOM   9693  O  O   . ALA F 3 128 ? -0.573  -67.229 50.882  1.00 125.80 ? 128 ALA G O   1 
ATOM   9694  C  CB  . ALA F 3 128 ? -2.687  -65.941 52.867  1.00 124.67 ? 128 ALA G CB  1 
ATOM   9695  N  N   . PRO F 3 129 ? 0.271   -67.211 52.990  1.00 133.72 ? 129 PRO G N   1 
ATOM   9696  C  CA  . PRO F 3 129 ? 1.022   -68.452 52.827  1.00 138.87 ? 129 PRO G CA  1 
ATOM   9697  C  C   . PRO F 3 129 ? 0.092   -69.658 52.734  1.00 140.08 ? 129 PRO G C   1 
ATOM   9698  O  O   . PRO F 3 129 ? 0.134   -70.383 51.744  1.00 141.76 ? 129 PRO G O   1 
ATOM   9699  C  CB  . PRO F 3 129 ? 1.876   -68.523 54.102  1.00 141.08 ? 129 PRO G CB  1 
ATOM   9700  C  CG  . PRO F 3 129 ? 1.886   -67.137 54.656  1.00 134.97 ? 129 PRO G CG  1 
ATOM   9701  C  CD  . PRO F 3 129 ? 0.564   -66.550 54.274  1.00 129.66 ? 129 PRO G CD  1 
ATOM   9702  N  N   . ASN F 3 136 ? 7.481   -70.631 62.529  1.00 204.15 ? 136 ASN G N   1 
ATOM   9703  C  CA  . ASN F 3 136 ? 8.531   -69.616 62.671  1.00 204.23 ? 136 ASN G CA  1 
ATOM   9704  C  C   . ASN F 3 136 ? 8.065   -68.384 63.455  1.00 202.36 ? 136 ASN G C   1 
ATOM   9705  O  O   . ASN F 3 136 ? 6.871   -68.080 63.515  1.00 212.75 ? 136 ASN G O   1 
ATOM   9706  C  CB  . ASN F 3 136 ? 9.050   -69.173 61.296  1.00 202.46 ? 136 ASN G CB  1 
ATOM   9707  C  CG  . ASN F 3 136 ? 9.080   -70.303 60.282  1.00 205.13 ? 136 ASN G CG  1 
ATOM   9708  O  OD1 . ASN F 3 136 ? 9.080   -70.062 59.073  1.00 201.77 ? 136 ASN G OD1 1 
ATOM   9709  N  ND2 . ASN F 3 136 ? 9.138   -71.542 60.767  1.00 203.19 ? 136 ASN G ND2 1 
ATOM   9710  N  N   . SER F 3 137 ? 9.025   -67.659 64.020  1.00 198.57 ? 137 SER G N   1 
ATOM   9711  C  CA  . SER F 3 137 ? 8.728   -66.524 64.890  1.00 193.57 ? 137 SER G CA  1 
ATOM   9712  C  C   . SER F 3 137 ? 8.048   -65.369 64.143  1.00 178.57 ? 137 SER G C   1 
ATOM   9713  O  O   . SER F 3 137 ? 7.129   -64.741 64.674  1.00 185.50 ? 137 SER G O   1 
ATOM   9714  C  CB  . SER F 3 137 ? 10.007  -66.038 65.582  1.00 200.86 ? 137 SER G CB  1 
ATOM   9715  O  OG  . SER F 3 137 ? 10.891  -65.421 64.661  1.00 202.78 ? 137 SER G OG  1 
ATOM   9716  N  N   . MET F 3 138 ? 8.504   -65.089 62.922  1.00 160.21 ? 138 MET G N   1 
ATOM   9717  C  CA  . MET F 3 138 ? 7.872   -64.071 62.077  1.00 150.24 ? 138 MET G CA  1 
ATOM   9718  C  C   . MET F 3 138 ? 7.090   -64.647 60.894  1.00 142.55 ? 138 MET G C   1 
ATOM   9719  O  O   . MET F 3 138 ? 7.426   -65.710 60.372  1.00 147.62 ? 138 MET G O   1 
ATOM   9720  C  CB  . MET F 3 138 ? 8.939   -63.113 61.559  1.00 148.73 ? 138 MET G CB  1 
ATOM   9721  C  CG  . MET F 3 138 ? 9.694   -62.404 62.669  1.00 154.35 ? 138 MET G CG  1 
ATOM   9722  S  SD  . MET F 3 138 ? 8.589   -61.561 63.816  1.00 148.13 ? 138 MET G SD  1 
ATOM   9723  C  CE  . MET F 3 138 ? 8.489   -59.942 63.050  1.00 141.54 ? 138 MET G CE  1 
ATOM   9724  N  N   . VAL F 3 139 ? 6.045   -63.931 60.484  1.00 131.12 ? 139 VAL G N   1 
ATOM   9725  C  CA  . VAL F 3 139 ? 5.278   -64.268 59.292  1.00 126.60 ? 139 VAL G CA  1 
ATOM   9726  C  C   . VAL F 3 139 ? 5.224   -63.099 58.327  1.00 121.18 ? 139 VAL G C   1 
ATOM   9727  O  O   . VAL F 3 139 ? 5.048   -61.962 58.758  1.00 118.33 ? 139 VAL G O   1 
ATOM   9728  C  CB  . VAL F 3 139 ? 3.831   -64.585 59.646  1.00 128.34 ? 139 VAL G CB  1 
ATOM   9729  C  CG1 . VAL F 3 139 ? 3.119   -65.143 58.426  1.00 127.56 ? 139 VAL G CG1 1 
ATOM   9730  C  CG2 . VAL F 3 139 ? 3.786   -65.560 60.801  1.00 141.49 ? 139 VAL G CG2 1 
ATOM   9731  N  N   . THR F 3 140 ? 5.330   -63.383 57.029  1.00 118.03 ? 140 THR G N   1 
ATOM   9732  C  CA  . THR F 3 140 ? 5.216   -62.350 56.006  1.00 112.78 ? 140 THR G CA  1 
ATOM   9733  C  C   . THR F 3 140 ? 3.953   -62.534 55.155  1.00 105.57 ? 140 THR G C   1 
ATOM   9734  O  O   . THR F 3 140 ? 3.701   -63.595 54.593  1.00 98.09  ? 140 THR G O   1 
ATOM   9735  C  CB  . THR F 3 140 ? 6.462   -62.307 55.096  1.00 114.59 ? 140 THR G CB  1 
ATOM   9736  O  OG1 . THR F 3 140 ? 7.611   -61.945 55.869  1.00 115.96 ? 140 THR G OG1 1 
ATOM   9737  C  CG2 . THR F 3 140 ? 6.292   -61.286 53.987  1.00 114.32 ? 140 THR G CG2 1 
ATOM   9738  N  N   . LEU F 3 141 ? 3.165   -61.469 55.082  1.00 106.02 ? 141 LEU G N   1 
ATOM   9739  C  CA  . LEU F 3 141 ? 1.953   -61.434 54.281  1.00 102.62 ? 141 LEU G CA  1 
ATOM   9740  C  C   . LEU F 3 141 ? 2.050   -60.303 53.264  1.00 98.85  ? 141 LEU G C   1 
ATOM   9741  O  O   . LEU F 3 141 ? 2.902   -59.412 53.391  1.00 89.37  ? 141 LEU G O   1 
ATOM   9742  C  CB  . LEU F 3 141 ? 0.756   -61.185 55.181  1.00 103.00 ? 141 LEU G CB  1 
ATOM   9743  C  CG  . LEU F 3 141 ? 0.649   -62.148 56.354  1.00 112.52 ? 141 LEU G CG  1 
ATOM   9744  C  CD1 . LEU F 3 141 ? -0.276  -61.589 57.426  1.00 112.71 ? 141 LEU G CD1 1 
ATOM   9745  C  CD2 . LEU F 3 141 ? 0.159   -63.498 55.845  1.00 123.74 ? 141 LEU G CD2 1 
ATOM   9746  N  N   . GLY F 3 142 ? 1.166   -60.327 52.270  1.00 95.61  ? 142 GLY G N   1 
ATOM   9747  C  CA  . GLY F 3 142 ? 1.283   -59.407 51.153  1.00 97.30  ? 142 GLY G CA  1 
ATOM   9748  C  C   . GLY F 3 142 ? -0.028  -58.956 50.536  1.00 96.66  ? 142 GLY G C   1 
ATOM   9749  O  O   . GLY F 3 142 ? -1.073  -59.531 50.793  1.00 105.96 ? 142 GLY G O   1 
ATOM   9750  N  N   . CYS F 3 143 ? 0.038   -57.901 49.732  1.00 94.77  ? 143 CYS G N   1 
ATOM   9751  C  CA  . CYS F 3 143 ? -1.072  -57.507 48.887  1.00 96.58  ? 143 CYS G CA  1 
ATOM   9752  C  C   . CYS F 3 143 ? -0.613  -57.335 47.462  1.00 96.19  ? 143 CYS G C   1 
ATOM   9753  O  O   . CYS F 3 143 ? 0.319   -56.583 47.204  1.00 105.68 ? 143 CYS G O   1 
ATOM   9754  C  CB  . CYS F 3 143 ? -1.716  -56.223 49.400  1.00 97.53  ? 143 CYS G CB  1 
ATOM   9755  S  SG  . CYS F 3 143 ? -3.202  -56.656 50.293  1.00 127.13 ? 143 CYS G SG  1 
ATOM   9756  N  N   . LEU F 3 144 ? -1.260  -58.042 46.542  1.00 94.79  ? 144 LEU G N   1 
ATOM   9757  C  CA  . LEU F 3 144 ? -1.023  -57.848 45.117  1.00 91.61  ? 144 LEU G CA  1 
ATOM   9758  C  C   . LEU F 3 144 ? -2.028  -56.841 44.588  1.00 91.81  ? 144 LEU G C   1 
ATOM   9759  O  O   . LEU F 3 144 ? -3.229  -56.997 44.766  1.00 100.89 ? 144 LEU G O   1 
ATOM   9760  C  CB  . LEU F 3 144 ? -1.163  -59.165 44.357  1.00 91.11  ? 144 LEU G CB  1 
ATOM   9761  C  CG  . LEU F 3 144 ? -0.925  -59.089 42.851  1.00 87.62  ? 144 LEU G CG  1 
ATOM   9762  C  CD1 . LEU F 3 144 ? 0.523   -58.734 42.557  1.00 86.04  ? 144 LEU G CD1 1 
ATOM   9763  C  CD2 . LEU F 3 144 ? -1.280  -60.412 42.198  1.00 89.98  ? 144 LEU G CD2 1 
ATOM   9764  N  N   . VAL F 3 145 ? -1.529  -55.791 43.961  1.00 87.52  ? 145 VAL G N   1 
ATOM   9765  C  CA  . VAL F 3 145 ? -2.380  -54.735 43.449  1.00 89.10  ? 145 VAL G CA  1 
ATOM   9766  C  C   . VAL F 3 145 ? -2.115  -54.604 41.962  1.00 93.05  ? 145 VAL G C   1 
ATOM   9767  O  O   . VAL F 3 145 ? -1.099  -54.031 41.563  1.00 93.23  ? 145 VAL G O   1 
ATOM   9768  C  CB  . VAL F 3 145 ? -2.024  -53.393 44.101  1.00 91.17  ? 145 VAL G CB  1 
ATOM   9769  C  CG1 . VAL F 3 145 ? -2.868  -52.283 43.513  1.00 95.18  ? 145 VAL G CG1 1 
ATOM   9770  C  CG2 . VAL F 3 145 ? -2.182  -53.460 45.611  1.00 90.18  ? 145 VAL G CG2 1 
ATOM   9771  N  N   . LYS F 3 146 ? -2.976  -55.163 41.124  1.00 95.57  ? 146 LYS G N   1 
ATOM   9772  C  CA  . LYS F 3 146 ? -2.619  -55.209 39.714  1.00 101.82 ? 146 LYS G CA  1 
ATOM   9773  C  C   . LYS F 3 146 ? -3.660  -54.683 38.750  1.00 102.24 ? 146 LYS G C   1 
ATOM   9774  O  O   . LYS F 3 146 ? -4.860  -54.733 39.009  1.00 105.10 ? 146 LYS G O   1 
ATOM   9775  C  CB  . LYS F 3 146 ? -2.176  -56.608 39.298  1.00 106.40 ? 146 LYS G CB  1 
ATOM   9776  C  CG  . LYS F 3 146 ? -3.270  -57.649 39.264  1.00 108.03 ? 146 LYS G CG  1 
ATOM   9777  C  CD  . LYS F 3 146 ? -2.740  -58.932 38.650  1.00 112.06 ? 146 LYS G CD  1 
ATOM   9778  C  CE  . LYS F 3 146 ? -2.180  -58.677 37.262  1.00 111.15 ? 146 LYS G CE  1 
ATOM   9779  N  NZ  . LYS F 3 146 ? -2.079  -59.931 36.474  1.00 118.75 ? 146 LYS G NZ  1 
ATOM   9780  N  N   . GLY F 3 147 ? -3.157  -54.171 37.631  1.00 106.12 ? 147 GLY G N   1 
ATOM   9781  C  CA  . GLY F 3 147 ? -3.986  -53.758 36.512  1.00 106.81 ? 147 GLY G CA  1 
ATOM   9782  C  C   . GLY F 3 147 ? -4.617  -52.410 36.749  1.00 102.64 ? 147 GLY G C   1 
ATOM   9783  O  O   . GLY F 3 147 ? -5.777  -52.208 36.425  1.00 113.99 ? 147 GLY G O   1 
ATOM   9784  N  N   . TYR F 3 148 ? -3.853  -51.485 37.319  1.00 98.39  ? 148 TYR G N   1 
ATOM   9785  C  CA  . TYR F 3 148 ? -4.348  -50.136 37.535  1.00 92.64  ? 148 TYR G CA  1 
ATOM   9786  C  C   . TYR F 3 148 ? -3.607  -49.164 36.654  1.00 94.74  ? 148 TYR G C   1 
ATOM   9787  O  O   . TYR F 3 148 ? -2.480  -49.428 36.228  1.00 94.18  ? 148 TYR G O   1 
ATOM   9788  C  CB  . TYR F 3 148 ? -4.229  -49.711 39.009  1.00 88.18  ? 148 TYR G CB  1 
ATOM   9789  C  CG  . TYR F 3 148 ? -2.819  -49.540 39.523  1.00 79.57  ? 148 TYR G CG  1 
ATOM   9790  C  CD1 . TYR F 3 148 ? -2.147  -50.588 40.107  1.00 81.85  ? 148 TYR G CD1 1 
ATOM   9791  C  CD2 . TYR F 3 148 ? -2.183  -48.321 39.459  1.00 79.28  ? 148 TYR G CD2 1 
ATOM   9792  C  CE1 . TYR F 3 148 ? -0.868  -50.436 40.587  1.00 83.88  ? 148 TYR G CE1 1 
ATOM   9793  C  CE2 . TYR F 3 148 ? -0.902  -48.156 39.938  1.00 82.09  ? 148 TYR G CE2 1 
ATOM   9794  C  CZ  . TYR F 3 148 ? -0.248  -49.215 40.501  1.00 82.49  ? 148 TYR G CZ  1 
ATOM   9795  O  OH  . TYR F 3 148 ? 1.037   -49.043 40.967  1.00 86.60  ? 148 TYR G OH  1 
ATOM   9796  N  N   . PHE F 3 149 ? -4.263  -48.039 36.383  1.00 97.15  ? 149 PHE G N   1 
ATOM   9797  C  CA  . PHE F 3 149 ? -3.642  -46.901 35.715  1.00 89.94  ? 149 PHE G CA  1 
ATOM   9798  C  C   . PHE F 3 149 ? -4.407  -45.660 36.095  1.00 83.42  ? 149 PHE G C   1 
ATOM   9799  O  O   . PHE F 3 149 ? -5.619  -45.682 36.115  1.00 86.53  ? 149 PHE G O   1 
ATOM   9800  C  CB  . PHE F 3 149 ? -3.690  -47.069 34.199  1.00 89.94  ? 149 PHE G CB  1 
ATOM   9801  C  CG  . PHE F 3 149 ? -2.955  -46.009 33.458  1.00 89.40  ? 149 PHE G CG  1 
ATOM   9802  C  CD1 . PHE F 3 149 ? -1.605  -46.144 33.184  1.00 87.88  ? 149 PHE G CD1 1 
ATOM   9803  C  CD2 . PHE F 3 149 ? -3.606  -44.865 33.054  1.00 97.51  ? 149 PHE G CD2 1 
ATOM   9804  C  CE1 . PHE F 3 149 ? -0.915  -45.156 32.517  1.00 88.71  ? 149 PHE G CE1 1 
ATOM   9805  C  CE2 . PHE F 3 149 ? -2.918  -43.866 32.388  1.00 97.73  ? 149 PHE G CE2 1 
ATOM   9806  C  CZ  . PHE F 3 149 ? -1.571  -44.014 32.121  1.00 89.94  ? 149 PHE G CZ  1 
ATOM   9807  N  N   . PRO F 3 150 ? -3.704  -44.562 36.368  1.00 87.70  ? 150 PRO G N   1 
ATOM   9808  C  CA  . PRO F 3 150 ? -2.262  -44.470 36.379  1.00 89.72  ? 150 PRO G CA  1 
ATOM   9809  C  C   . PRO F 3 150 ? -1.723  -44.498 37.791  1.00 88.09  ? 150 PRO G C   1 
ATOM   9810  O  O   . PRO F 3 150 ? -2.487  -44.619 38.751  1.00 84.81  ? 150 PRO G O   1 
ATOM   9811  C  CB  . PRO F 3 150 ? -2.012  -43.088 35.791  1.00 89.91  ? 150 PRO G CB  1 
ATOM   9812  C  CG  . PRO F 3 150 ? -3.163  -42.279 36.297  1.00 90.43  ? 150 PRO G CG  1 
ATOM   9813  C  CD  . PRO F 3 150 ? -4.322  -43.230 36.482  1.00 93.80  ? 150 PRO G CD  1 
ATOM   9814  N  N   . GLU F 3 151 ? -0.406  -44.386 37.901  1.00 87.22  ? 151 GLU G N   1 
ATOM   9815  C  CA  . GLU F 3 151 ? 0.244   -44.207 39.179  1.00 85.20  ? 151 GLU G CA  1 
ATOM   9816  C  C   . GLU F 3 151 ? -0.313  -42.962 39.807  1.00 80.69  ? 151 GLU G C   1 
ATOM   9817  O  O   . GLU F 3 151 ? -0.778  -42.084 39.097  1.00 94.14  ? 151 GLU G O   1 
ATOM   9818  C  CB  . GLU F 3 151 ? 1.735   -44.036 38.958  1.00 95.83  ? 151 GLU G CB  1 
ATOM   9819  C  CG  . GLU F 3 151 ? 2.422   -45.272 38.399  1.00 104.06 ? 151 GLU G CG  1 
ATOM   9820  C  CD  . GLU F 3 151 ? 3.240   -45.971 39.453  1.00 103.98 ? 151 GLU G CD  1 
ATOM   9821  O  OE1 . GLU F 3 151 ? 2.629   -46.536 40.399  1.00 89.64  ? 151 GLU G OE1 1 
ATOM   9822  O  OE2 . GLU F 3 151 ? 4.490   -45.899 39.342  1.00 103.42 ? 151 GLU G OE2 1 
ATOM   9823  N  N   . PRO F 3 152 ? -0.298  -42.884 41.140  1.00 81.99  ? 152 PRO G N   1 
ATOM   9824  C  CA  . PRO F 3 152 ? 0.157   -43.898 42.064  1.00 86.02  ? 152 PRO G CA  1 
ATOM   9825  C  C   . PRO F 3 152 ? -0.982  -44.654 42.709  1.00 81.01  ? 152 PRO G C   1 
ATOM   9826  O  O   . PRO F 3 152 ? -2.138  -44.292 42.531  1.00 88.56  ? 152 PRO G O   1 
ATOM   9827  C  CB  . PRO F 3 152 ? 0.842   -43.069 43.140  1.00 92.16  ? 152 PRO G CB  1 
ATOM   9828  C  CG  . PRO F 3 152 ? 0.012   -41.838 43.215  1.00 88.44  ? 152 PRO G CG  1 
ATOM   9829  C  CD  . PRO F 3 152 ? -0.556  -41.614 41.836  1.00 90.36  ? 152 PRO G CD  1 
ATOM   9830  N  N   . VAL F 3 153 ? -0.643  -45.701 43.452  1.00 81.31  ? 153 VAL G N   1 
ATOM   9831  C  CA  . VAL F 3 153 ? -1.520  -46.220 44.496  1.00 80.99  ? 153 VAL G CA  1 
ATOM   9832  C  C   . VAL F 3 153 ? -0.777  -46.106 45.802  1.00 74.69  ? 153 VAL G C   1 
ATOM   9833  O  O   . VAL F 3 153 ? 0.436   -45.924 45.813  1.00 72.46  ? 153 VAL G O   1 
ATOM   9834  C  CB  . VAL F 3 153 ? -1.898  -47.696 44.292  1.00 82.73  ? 153 VAL G CB  1 
ATOM   9835  C  CG1 . VAL F 3 153 ? -2.580  -47.894 42.947  1.00 92.83  ? 153 VAL G CG1 1 
ATOM   9836  C  CG2 . VAL F 3 153 ? -0.672  -48.564 44.390  1.00 84.91  ? 153 VAL G CG2 1 
ATOM   9837  N  N   . THR F 3 154 ? -1.509  -46.197 46.900  1.00 76.25  ? 154 THR G N   1 
ATOM   9838  C  CA  . THR F 3 154 ? -0.899  -46.243 48.210  1.00 83.94  ? 154 THR G CA  1 
ATOM   9839  C  C   . THR F 3 154 ? -1.450  -47.388 49.012  1.00 81.09  ? 154 THR G C   1 
ATOM   9840  O  O   . THR F 3 154 ? -2.654  -47.639 49.019  1.00 85.32  ? 154 THR G O   1 
ATOM   9841  C  CB  . THR F 3 154 ? -1.173  -44.964 49.005  1.00 94.48  ? 154 THR G CB  1 
ATOM   9842  O  OG1 . THR F 3 154 ? -2.579  -44.689 48.992  1.00 100.28 ? 154 THR G OG1 1 
ATOM   9843  C  CG2 . THR F 3 154 ? -0.415  -43.799 48.404  1.00 107.58 ? 154 THR G CG2 1 
ATOM   9844  N  N   . VAL F 3 155 ? -0.561  -48.037 49.742  1.00 80.43  ? 155 VAL G N   1 
ATOM   9845  C  CA  . VAL F 3 155 ? -0.920  -49.211 50.492  1.00 88.12  ? 155 VAL G CA  1 
ATOM   9846  C  C   . VAL F 3 155 ? -0.526  -49.047 51.965  1.00 86.18  ? 155 VAL G C   1 
ATOM   9847  O  O   . VAL F 3 155 ? 0.603   -48.700 52.282  1.00 89.92  ? 155 VAL G O   1 
ATOM   9848  C  CB  . VAL F 3 155 ? -0.237  -50.457 49.901  1.00 94.53  ? 155 VAL G CB  1 
ATOM   9849  C  CG1 . VAL F 3 155 ? -0.750  -51.701 50.599  1.00 99.52  ? 155 VAL G CG1 1 
ATOM   9850  C  CG2 . VAL F 3 155 ? -0.452  -50.557 48.388  1.00 92.02  ? 155 VAL G CG2 1 
ATOM   9851  N  N   . THR F 3 156 ? -1.480  -49.253 52.859  1.00 87.74  ? 156 THR G N   1 
ATOM   9852  C  CA  . THR F 3 156 ? -1.199  -49.276 54.288  1.00 89.10  ? 156 THR G CA  1 
ATOM   9853  C  C   . THR F 3 156 ? -1.738  -50.567 54.858  1.00 89.84  ? 156 THR G C   1 
ATOM   9854  O  O   . THR F 3 156 ? -2.428  -51.312 54.163  1.00 92.61  ? 156 THR G O   1 
ATOM   9855  C  CB  . THR F 3 156 ? -1.833  -48.069 55.044  1.00 94.47  ? 156 THR G CB  1 
ATOM   9856  O  OG1 . THR F 3 156 ? -3.270  -48.165 55.061  1.00 90.05  ? 156 THR G OG1 1 
ATOM   9857  C  CG2 . THR F 3 156 ? -1.420  -46.756 54.398  1.00 93.45  ? 156 THR G CG2 1 
ATOM   9858  N  N   . TRP F 3 157 ? -1.461  -50.808 56.134  1.00 90.46  ? 157 TRP G N   1 
ATOM   9859  C  CA  . TRP F 3 157 ? -1.839  -52.060 56.770  1.00 95.29  ? 157 TRP G CA  1 
ATOM   9860  C  C   . TRP F 3 157 ? -2.517  -51.821 58.115  1.00 96.64  ? 157 TRP G C   1 
ATOM   9861  O  O   . TRP F 3 157 ? -1.990  -51.110 58.972  1.00 99.54  ? 157 TRP G O   1 
ATOM   9862  C  CB  . TRP F 3 157 ? -0.600  -52.932 56.967  1.00 98.38  ? 157 TRP G CB  1 
ATOM   9863  C  CG  . TRP F 3 157 ? -0.013  -53.457 55.680  1.00 92.80  ? 157 TRP G CG  1 
ATOM   9864  C  CD1 . TRP F 3 157 ? 0.987   -52.896 54.946  1.00 88.54  ? 157 TRP G CD1 1 
ATOM   9865  C  CD2 . TRP F 3 157 ? -0.402  -54.640 54.985  1.00 89.96  ? 157 TRP G CD2 1 
ATOM   9866  N  NE1 . TRP F 3 157 ? 1.244   -53.655 53.836  1.00 83.69  ? 157 TRP G NE1 1 
ATOM   9867  C  CE2 . TRP F 3 157 ? 0.406   -54.737 53.840  1.00 87.14  ? 157 TRP G CE2 1 
ATOM   9868  C  CE3 . TRP F 3 157 ? -1.357  -55.629 55.220  1.00 96.92  ? 157 TRP G CE3 1 
ATOM   9869  C  CZ2 . TRP F 3 157 ? 0.293   -55.785 52.936  1.00 91.42  ? 157 TRP G CZ2 1 
ATOM   9870  C  CZ3 . TRP F 3 157 ? -1.465  -56.671 54.328  1.00 99.07  ? 157 TRP G CZ3 1 
ATOM   9871  C  CH2 . TRP F 3 157 ? -0.649  -56.740 53.194  1.00 95.80  ? 157 TRP G CH2 1 
ATOM   9872  N  N   . ASN F 3 158 ? -3.684  -52.432 58.291  1.00 97.79  ? 158 ASN G N   1 
ATOM   9873  C  CA  . ASN F 3 158 ? -4.527  -52.169 59.443  1.00 102.36 ? 158 ASN G CA  1 
ATOM   9874  C  C   . ASN F 3 158 ? -4.647  -50.674 59.671  1.00 104.83 ? 158 ASN G C   1 
ATOM   9875  O  O   . ASN F 3 158 ? -4.428  -50.188 60.782  1.00 110.75 ? 158 ASN G O   1 
ATOM   9876  C  CB  . ASN F 3 158 ? -4.002  -52.871 60.700  1.00 107.11 ? 158 ASN G CB  1 
ATOM   9877  C  CG  . ASN F 3 158 ? -4.257  -54.371 60.681  1.00 111.99 ? 158 ASN G CG  1 
ATOM   9878  O  OD1 . ASN F 3 158 ? -4.886  -54.889 59.760  1.00 112.29 ? 158 ASN G OD1 1 
ATOM   9879  N  ND2 . ASN F 3 158 ? -3.777  -55.073 61.701  1.00 112.48 ? 158 ASN G ND2 1 
ATOM   9880  N  N   . SER F 3 159 ? -4.995  -49.953 58.605  1.00 101.84 ? 159 SER G N   1 
ATOM   9881  C  CA  . SER F 3 159 ? -5.250  -48.524 58.683  1.00 105.07 ? 159 SER G CA  1 
ATOM   9882  C  C   . SER F 3 159 ? -4.067  -47.778 59.295  1.00 107.48 ? 159 SER G C   1 
ATOM   9883  O  O   . SER F 3 159 ? -4.244  -46.744 59.933  1.00 109.35 ? 159 SER G O   1 
ATOM   9884  C  CB  . SER F 3 159 ? -6.518  -48.255 59.500  1.00 111.13 ? 159 SER G CB  1 
ATOM   9885  O  OG  . SER F 3 159 ? -7.591  -49.089 59.089  1.00 109.76 ? 159 SER G OG  1 
ATOM   9886  N  N   . GLY F 3 160 ? -2.863  -48.308 59.098  1.00 111.06 ? 160 GLY G N   1 
ATOM   9887  C  CA  . GLY F 3 160 ? -1.641  -47.633 59.535  1.00 109.94 ? 160 GLY G CA  1 
ATOM   9888  C  C   . GLY F 3 160 ? -1.154  -48.040 60.915  1.00 111.67 ? 160 GLY G C   1 
ATOM   9889  O  O   . GLY F 3 160 ? -0.111  -47.583 61.361  1.00 117.59 ? 160 GLY G O   1 
ATOM   9890  N  N   . SER F 3 161 ? -1.897  -48.908 61.593  1.00 117.73 ? 161 SER G N   1 
ATOM   9891  C  CA  . SER F 3 161 ? -1.460  -49.434 62.887  1.00 124.90 ? 161 SER G CA  1 
ATOM   9892  C  C   . SER F 3 161 ? -0.269  -50.374 62.725  1.00 131.93 ? 161 SER G C   1 
ATOM   9893  O  O   . SER F 3 161 ? 0.486   -50.599 63.669  1.00 145.14 ? 161 SER G O   1 
ATOM   9894  C  CB  . SER F 3 161 ? -2.598  -50.163 63.595  1.00 124.88 ? 161 SER G CB  1 
ATOM   9895  O  OG  . SER F 3 161 ? -3.394  -49.252 64.331  1.00 125.20 ? 161 SER G OG  1 
ATOM   9896  N  N   . LEU F 3 162 ? -0.110  -50.922 61.525  1.00 129.75 ? 162 LEU G N   1 
ATOM   9897  C  CA  . LEU F 3 162 ? 1.083   -51.690 61.189  1.00 121.76 ? 162 LEU G CA  1 
ATOM   9898  C  C   . LEU F 3 162 ? 1.922   -50.867 60.242  1.00 117.43 ? 162 LEU G C   1 
ATOM   9899  O  O   . LEU F 3 162 ? 1.585   -50.772 59.069  1.00 118.55 ? 162 LEU G O   1 
ATOM   9900  C  CB  . LEU F 3 162 ? 0.713   -53.006 60.507  1.00 115.27 ? 162 LEU G CB  1 
ATOM   9901  C  CG  . LEU F 3 162 ? 0.023   -54.024 61.414  1.00 124.38 ? 162 LEU G CG  1 
ATOM   9902  C  CD1 . LEU F 3 162 ? -0.403  -55.240 60.602  1.00 123.78 ? 162 LEU G CD1 1 
ATOM   9903  C  CD2 . LEU F 3 162 ? 0.925   -54.428 62.574  1.00 130.90 ? 162 LEU G CD2 1 
ATOM   9904  N  N   . SER F 3 163 ? 3.003   -50.268 60.731  1.00 119.89 ? 163 SER G N   1 
ATOM   9905  C  CA  . SER F 3 163 ? 3.869   -49.472 59.851  1.00 125.12 ? 163 SER G CA  1 
ATOM   9906  C  C   . SER F 3 163 ? 5.316   -49.958 59.779  1.00 122.59 ? 163 SER G C   1 
ATOM   9907  O  O   . SER F 3 163 ? 6.026   -49.649 58.825  1.00 120.80 ? 163 SER G O   1 
ATOM   9908  C  CB  . SER F 3 163 ? 3.828   -47.989 60.233  1.00 129.24 ? 163 SER G CB  1 
ATOM   9909  O  OG  . SER F 3 163 ? 4.257   -47.789 61.563  1.00 145.41 ? 163 SER G OG  1 
ATOM   9910  N  N   . SER F 3 164 ? 5.763   -50.710 60.776  1.00 125.44 ? 164 SER G N   1 
ATOM   9911  C  CA  . SER F 3 164 ? 7.079   -51.314 60.688  1.00 126.94 ? 164 SER G CA  1 
ATOM   9912  C  C   . SER F 3 164 ? 6.933   -52.670 60.027  1.00 120.22 ? 164 SER G C   1 
ATOM   9913  O  O   . SER F 3 164 ? 5.896   -53.315 60.136  1.00 113.01 ? 164 SER G O   1 
ATOM   9914  C  CB  . SER F 3 164 ? 7.729   -51.453 62.067  1.00 131.01 ? 164 SER G CB  1 
ATOM   9915  O  OG  . SER F 3 164 ? 6.973   -52.312 62.896  1.00 128.08 ? 164 SER G OG  1 
ATOM   9916  N  N   . GLY F 3 165 ? 7.974   -53.085 59.322  1.00 121.75 ? 165 GLY G N   1 
ATOM   9917  C  CA  . GLY F 3 165 ? 7.964   -54.363 58.632  1.00 118.64 ? 165 GLY G CA  1 
ATOM   9918  C  C   . GLY F 3 165 ? 7.304   -54.303 57.270  1.00 109.03 ? 165 GLY G C   1 
ATOM   9919  O  O   . GLY F 3 165 ? 6.959   -55.345 56.702  1.00 106.60 ? 165 GLY G O   1 
ATOM   9920  N  N   . VAL F 3 166 ? 7.176   -53.094 56.719  1.00 98.16  ? 166 VAL G N   1 
ATOM   9921  C  CA  . VAL F 3 166 ? 6.434   -52.911 55.479  1.00 94.00  ? 166 VAL G CA  1 
ATOM   9922  C  C   . VAL F 3 166 ? 7.298   -52.426 54.331  1.00 88.26  ? 166 VAL G C   1 
ATOM   9923  O  O   . VAL F 3 166 ? 8.005   -51.444 54.463  1.00 97.35  ? 166 VAL G O   1 
ATOM   9924  C  CB  . VAL F 3 166 ? 5.299   -51.893 55.641  1.00 92.10  ? 166 VAL G CB  1 
ATOM   9925  C  CG1 . VAL F 3 166 ? 4.536   -51.755 54.326  1.00 88.07  ? 166 VAL G CG1 1 
ATOM   9926  C  CG2 . VAL F 3 166 ? 4.376   -52.318 56.774  1.00 95.54  ? 166 VAL G CG2 1 
ATOM   9927  N  N   . HIS F 3 167 ? 7.223   -53.119 53.201  1.00 90.49  ? 167 HIS G N   1 
ATOM   9928  C  CA  . HIS F 3 167 ? 7.799   -52.636 51.949  1.00 89.39  ? 167 HIS G CA  1 
ATOM   9929  C  C   . HIS F 3 167 ? 6.692   -52.641 50.947  1.00 86.15  ? 167 HIS G C   1 
ATOM   9930  O  O   . HIS F 3 167 ? 6.012   -53.653 50.762  1.00 90.51  ? 167 HIS G O   1 
ATOM   9931  C  CB  . HIS F 3 167 ? 8.886   -53.572 51.383  1.00 94.50  ? 167 HIS G CB  1 
ATOM   9932  C  CG  . HIS F 3 167 ? 9.694   -54.259 52.422  1.00 95.97  ? 167 HIS G CG  1 
ATOM   9933  N  ND1 . HIS F 3 167 ? 9.916   -55.615 52.400  1.00 99.54  ? 167 HIS G ND1 1 
ATOM   9934  C  CD2 . HIS F 3 167 ? 10.286  -53.791 53.543  1.00 105.65 ? 167 HIS G CD2 1 
ATOM   9935  C  CE1 . HIS F 3 167 ? 10.617  -55.955 53.466  1.00 115.92 ? 167 HIS G CE1 1 
ATOM   9936  N  NE2 . HIS F 3 167 ? 10.860  -54.866 54.173  1.00 118.94 ? 167 HIS G NE2 1 
ATOM   9937  N  N   . THR F 3 168 ? 6.563   -51.552 50.223  1.00 83.65  ? 168 THR G N   1 
ATOM   9938  C  CA  . THR F 3 168 ? 5.833   -51.623 48.989  1.00 86.39  ? 168 THR G CA  1 
ATOM   9939  C  C   . THR F 3 168 ? 6.832   -51.554 47.858  1.00 80.93  ? 168 THR G C   1 
ATOM   9940  O  O   . THR F 3 168 ? 7.711   -50.712 47.854  1.00 81.58  ? 168 THR G O   1 
ATOM   9941  C  CB  . THR F 3 168 ? 4.783   -50.514 48.895  1.00 92.87  ? 168 THR G CB  1 
ATOM   9942  O  OG1 . THR F 3 168 ? 3.914   -50.578 50.043  1.00 92.61  ? 168 THR G OG1 1 
ATOM   9943  C  CG2 . THR F 3 168 ? 3.970   -50.689 47.627  1.00 93.68  ? 168 THR G CG2 1 
ATOM   9944  N  N   . PHE F 3 169 ? 6.738   -52.496 46.936  1.00 83.00  ? 169 PHE G N   1 
ATOM   9945  C  CA  . PHE F 3 169 ? 7.668   -52.551 45.837  1.00 84.59  ? 169 PHE G CA  1 
ATOM   9946  C  C   . PHE F 3 169 ? 7.207   -51.594 44.742  1.00 85.72  ? 169 PHE G C   1 
ATOM   9947  O  O   . PHE F 3 169 ? 6.010   -51.323 44.592  1.00 82.89  ? 169 PHE G O   1 
ATOM   9948  C  CB  . PHE F 3 169 ? 7.792   -53.986 45.311  1.00 92.10  ? 169 PHE G CB  1 
ATOM   9949  C  CG  . PHE F 3 169 ? 8.280   -54.953 46.343  1.00 95.17  ? 169 PHE G CG  1 
ATOM   9950  C  CD1 . PHE F 3 169 ? 7.398   -55.560 47.209  1.00 91.55  ? 169 PHE G CD1 1 
ATOM   9951  C  CD2 . PHE F 3 169 ? 9.633   -55.201 46.490  1.00 102.36 ? 169 PHE G CD2 1 
ATOM   9952  C  CE1 . PHE F 3 169 ? 7.855   -56.400 48.202  1.00 96.60  ? 169 PHE G CE1 1 
ATOM   9953  C  CE2 . PHE F 3 169 ? 10.096  -56.059 47.474  1.00 105.28 ? 169 PHE G CE2 1 
ATOM   9954  C  CZ  . PHE F 3 169 ? 9.204   -56.658 48.333  1.00 101.11 ? 169 PHE G CZ  1 
ATOM   9955  N  N   . PRO F 3 170 ? 8.171   -51.041 44.002  1.00 83.37  ? 170 PRO G N   1 
ATOM   9956  C  CA  . PRO F 3 170 ? 7.927   -50.254 42.811  1.00 78.68  ? 170 PRO G CA  1 
ATOM   9957  C  C   . PRO F 3 170 ? 6.940   -50.904 41.864  1.00 77.55  ? 170 PRO G C   1 
ATOM   9958  O  O   . PRO F 3 170 ? 6.984   -52.111 41.649  1.00 82.64  ? 170 PRO G O   1 
ATOM   9959  C  CB  . PRO F 3 170 ? 9.292   -50.225 42.142  1.00 82.83  ? 170 PRO G CB  1 
ATOM   9960  C  CG  . PRO F 3 170 ? 10.260  -50.316 43.267  1.00 85.46  ? 170 PRO G CG  1 
ATOM   9961  C  CD  . PRO F 3 170 ? 9.608   -51.184 44.289  1.00 87.44  ? 170 PRO G CD  1 
ATOM   9962  N  N   . ALA F 3 171 ? 6.084   -50.093 41.267  1.00 74.90  ? 171 ALA G N   1 
ATOM   9963  C  CA  . ALA F 3 171 ? 5.219   -50.575 40.211  1.00 77.16  ? 171 ALA G CA  1 
ATOM   9964  C  C   . ALA F 3 171 ? 6.026   -50.951 38.975  1.00 73.29  ? 171 ALA G C   1 
ATOM   9965  O  O   . ALA F 3 171 ? 7.141   -50.492 38.786  1.00 80.24  ? 171 ALA G O   1 
ATOM   9966  C  CB  . ALA F 3 171 ? 4.179   -49.521 39.863  1.00 78.70  ? 171 ALA G CB  1 
ATOM   9967  N  N   . VAL F 3 172 ? 5.453   -51.816 38.155  1.00 75.91  ? 172 VAL G N   1 
ATOM   9968  C  CA  . VAL F 3 172 ? 6.015   -52.154 36.870  1.00 81.96  ? 172 VAL G CA  1 
ATOM   9969  C  C   . VAL F 3 172 ? 4.907   -52.243 35.843  1.00 87.23  ? 172 VAL G C   1 
ATOM   9970  O  O   . VAL F 3 172 ? 3.750   -52.531 36.167  1.00 93.05  ? 172 VAL G O   1 
ATOM   9971  C  CB  . VAL F 3 172 ? 6.734   -53.509 36.910  1.00 92.72  ? 172 VAL G CB  1 
ATOM   9972  C  CG1 . VAL F 3 172 ? 7.842   -53.482 37.951  1.00 100.68 ? 172 VAL G CG1 1 
ATOM   9973  C  CG2 . VAL F 3 172 ? 5.745   -54.634 37.185  1.00 95.44  ? 172 VAL G CG2 1 
ATOM   9974  N  N   . LEU F 3 173 ? 5.266   -52.011 34.593  1.00 102.39 ? 173 LEU G N   1 
ATOM   9975  C  CA  . LEU F 3 173 ? 4.292   -52.021 33.529  1.00 109.36 ? 173 LEU G CA  1 
ATOM   9976  C  C   . LEU F 3 173 ? 4.072   -53.433 33.045  1.00 116.03 ? 173 LEU G C   1 
ATOM   9977  O  O   . LEU F 3 173 ? 5.013   -54.137 32.711  1.00 122.14 ? 173 LEU G O   1 
ATOM   9978  C  CB  . LEU F 3 173 ? 4.739   -51.117 32.386  1.00 112.81 ? 173 LEU G CB  1 
ATOM   9979  C  CG  . LEU F 3 173 ? 4.077   -49.743 32.470  1.00 115.08 ? 173 LEU G CG  1 
ATOM   9980  C  CD1 . LEU F 3 173 ? 4.737   -48.765 31.510  1.00 121.45 ? 173 LEU G CD1 1 
ATOM   9981  C  CD2 . LEU F 3 173 ? 2.584   -49.871 32.189  1.00 118.52 ? 173 LEU G CD2 1 
ATOM   9982  N  N   . GLN F 3 174 ? 2.812   -53.840 33.032  1.00 130.82 ? 174 GLN G N   1 
ATOM   9983  C  CA  . GLN F 3 174 ? 2.413   -55.119 32.482  1.00 145.98 ? 174 GLN G CA  1 
ATOM   9984  C  C   . GLN F 3 174 ? 1.377   -54.824 31.408  1.00 150.57 ? 174 GLN G C   1 
ATOM   9985  O  O   . GLN F 3 174 ? 0.247   -54.444 31.720  1.00 147.06 ? 174 GLN G O   1 
ATOM   9986  C  CB  . GLN F 3 174 ? 1.819   -56.002 33.582  1.00 148.48 ? 174 GLN G CB  1 
ATOM   9987  C  CG  . GLN F 3 174 ? 1.940   -57.496 33.335  1.00 154.43 ? 174 GLN G CG  1 
ATOM   9988  C  CD  . GLN F 3 174 ? 1.458   -58.315 34.523  1.00 153.36 ? 174 GLN G CD  1 
ATOM   9989  O  OE1 . GLN F 3 174 ? 1.162   -57.771 35.592  1.00 137.15 ? 174 GLN G OE1 1 
ATOM   9990  N  NE2 . GLN F 3 174 ? 1.379   -59.631 34.342  1.00 153.70 ? 174 GLN G NE2 1 
ATOM   9991  N  N   . SER F 3 175 ? 1.786   -54.941 30.148  1.00 149.66 ? 175 SER G N   1 
ATOM   9992  C  CA  . SER F 3 175 ? 0.905   -54.651 29.024  1.00 149.98 ? 175 SER G CA  1 
ATOM   9993  C  C   . SER F 3 175 ? 0.075   -53.398 29.297  1.00 139.71 ? 175 SER G C   1 
ATOM   9994  O  O   . SER F 3 175 ? -1.157  -53.442 29.361  1.00 135.71 ? 175 SER G O   1 
ATOM   9995  C  CB  . SER F 3 175 ? -0.004  -55.849 28.733  1.00 160.33 ? 175 SER G CB  1 
ATOM   9996  O  OG  . SER F 3 175 ? -0.535  -56.397 29.930  1.00 169.53 ? 175 SER G OG  1 
ATOM   9997  N  N   . ASP F 3 176 ? 0.772   -52.285 29.500  1.00 132.00 ? 176 ASP G N   1 
ATOM   9998  C  CA  . ASP F 3 176 ? 0.146   -50.963 29.519  1.00 123.26 ? 176 ASP G CA  1 
ATOM   9999  C  C   . ASP F 3 176 ? -0.601  -50.643 30.817  1.00 108.99 ? 176 ASP G C   1 
ATOM   10000 O  O   . ASP F 3 176 ? -1.224  -49.596 30.915  1.00 115.41 ? 176 ASP G O   1 
ATOM   10001 C  CB  . ASP F 3 176 ? -0.789  -50.802 28.312  1.00 120.77 ? 176 ASP G CB  1 
ATOM   10002 C  CG  . ASP F 3 176 ? -0.122  -51.201 26.996  1.00 126.73 ? 176 ASP G CG  1 
ATOM   10003 O  OD1 . ASP F 3 176 ? 1.127   -51.280 26.944  1.00 122.33 ? 176 ASP G OD1 1 
ATOM   10004 O  OD2 . ASP F 3 176 ? -0.850  -51.466 26.018  1.00 130.25 ? 176 ASP G OD2 1 
ATOM   10005 N  N   . LEU F 3 177 ? -0.505  -51.512 31.820  1.00 97.47  ? 177 LEU G N   1 
ATOM   10006 C  CA  . LEU F 3 177 ? -1.061  -51.218 33.142  1.00 89.70  ? 177 LEU G CA  1 
ATOM   10007 C  C   . LEU F 3 177 ? -0.056  -51.527 34.225  1.00 85.44  ? 177 LEU G C   1 
ATOM   10008 O  O   . LEU F 3 177 ? 0.899   -52.257 34.001  1.00 84.46  ? 177 LEU G O   1 
ATOM   10009 C  CB  . LEU F 3 177 ? -2.320  -52.032 33.391  1.00 95.26  ? 177 LEU G CB  1 
ATOM   10010 C  CG  . LEU F 3 177 ? -3.458  -51.797 32.399  1.00 100.12 ? 177 LEU G CG  1 
ATOM   10011 C  CD1 . LEU F 3 177 ? -4.563  -52.821 32.618  1.00 107.48 ? 177 LEU G CD1 1 
ATOM   10012 C  CD2 . LEU F 3 177 ? -4.003  -50.394 32.538  1.00 95.77  ? 177 LEU G CD2 1 
ATOM   10013 N  N   . TYR F 3 178 ? -0.290  -50.982 35.413  1.00 87.74  ? 178 TYR G N   1 
ATOM   10014 C  CA  . TYR F 3 178 ? 0.684   -51.063 36.495  1.00 93.01  ? 178 TYR G CA  1 
ATOM   10015 C  C   . TYR F 3 178 ? 0.366   -52.189 37.444  1.00 91.27  ? 178 TYR G C   1 
ATOM   10016 O  O   . TYR F 3 178 ? -0.796  -52.533 37.654  1.00 102.45 ? 178 TYR G O   1 
ATOM   10017 C  CB  . TYR F 3 178 ? 0.759   -49.742 37.268  1.00 93.97  ? 178 TYR G CB  1 
ATOM   10018 C  CG  . TYR F 3 178 ? 1.444   -48.639 36.484  1.00 100.63 ? 178 TYR G CG  1 
ATOM   10019 C  CD1 . TYR F 3 178 ? 2.826   -48.553 36.425  1.00 107.07 ? 178 TYR G CD1 1 
ATOM   10020 C  CD2 . TYR F 3 178 ? 0.707   -47.719 35.762  1.00 104.01 ? 178 TYR G CD2 1 
ATOM   10021 C  CE1 . TYR F 3 178 ? 3.452   -47.561 35.692  1.00 114.17 ? 178 TYR G CE1 1 
ATOM   10022 C  CE2 . TYR F 3 178 ? 1.324   -46.724 35.024  1.00 106.22 ? 178 TYR G CE2 1 
ATOM   10023 C  CZ  . TYR F 3 178 ? 2.695   -46.652 34.992  1.00 112.24 ? 178 TYR G CZ  1 
ATOM   10024 O  OH  . TYR F 3 178 ? 3.312   -45.670 34.255  1.00 115.76 ? 178 TYR G OH  1 
ATOM   10025 N  N   . THR F 3 179 ? 1.412   -52.773 38.008  1.00 86.04  ? 179 THR G N   1 
ATOM   10026 C  CA  . THR F 3 179 ? 1.241   -53.757 39.046  1.00 86.75  ? 179 THR G CA  1 
ATOM   10027 C  C   . THR F 3 179 ? 2.283   -53.538 40.113  1.00 79.98  ? 179 THR G C   1 
ATOM   10028 O  O   . THR F 3 179 ? 3.432   -53.247 39.815  1.00 87.09  ? 179 THR G O   1 
ATOM   10029 C  CB  . THR F 3 179 ? 1.397   -55.176 38.488  1.00 94.35  ? 179 THR G CB  1 
ATOM   10030 O  OG1 . THR F 3 179 ? 0.470   -55.376 37.408  1.00 97.03  ? 179 THR G OG1 1 
ATOM   10031 C  CG2 . THR F 3 179 ? 1.153   -56.202 39.590  1.00 96.43  ? 179 THR G CG2 1 
ATOM   10032 N  N   . LEU F 3 180 ? 1.885   -53.672 41.364  1.00 74.44  ? 180 LEU G N   1 
ATOM   10033 C  CA  . LEU F 3 180 ? 2.856   -53.778 42.426  1.00 78.85  ? 180 LEU G CA  1 
ATOM   10034 C  C   . LEU F 3 180 ? 2.292   -54.668 43.497  1.00 73.85  ? 180 LEU G C   1 
ATOM   10035 O  O   . LEU F 3 180 ? 1.145   -55.079 43.415  1.00 71.15  ? 180 LEU G O   1 
ATOM   10036 C  CB  . LEU F 3 180 ? 3.185   -52.407 43.012  1.00 82.96  ? 180 LEU G CB  1 
ATOM   10037 C  CG  . LEU F 3 180 ? 2.056   -51.680 43.742  1.00 84.17  ? 180 LEU G CG  1 
ATOM   10038 C  CD1 . LEU F 3 180 ? 1.686   -52.338 45.062  1.00 85.40  ? 180 LEU G CD1 1 
ATOM   10039 C  CD2 . LEU F 3 180 ? 2.493   -50.256 44.001  1.00 89.47  ? 180 LEU G CD2 1 
ATOM   10040 N  N   . SER F 3 181 ? 3.110   -54.965 44.497  1.00 76.47  ? 181 SER G N   1 
ATOM   10041 C  CA  . SER F 3 181 ? 2.641   -55.615 45.705  1.00 78.43  ? 181 SER G CA  1 
ATOM   10042 C  C   . SER F 3 181 ? 3.283   -54.977 46.926  1.00 73.65  ? 181 SER G C   1 
ATOM   10043 O  O   . SER F 3 181 ? 4.268   -54.256 46.820  1.00 77.14  ? 181 SER G O   1 
ATOM   10044 C  CB  . SER F 3 181 ? 2.942   -57.121 45.656  1.00 86.14  ? 181 SER G CB  1 
ATOM   10045 O  OG  . SER F 3 181 ? 4.063   -57.394 44.836  1.00 93.94  ? 181 SER G OG  1 
ATOM   10046 N  N   . SER F 3 182 ? 2.723   -55.258 48.087  1.00 70.35  ? 182 SER G N   1 
ATOM   10047 C  CA  . SER F 3 182 ? 3.243   -54.725 49.336  1.00 76.03  ? 182 SER G CA  1 
ATOM   10048 C  C   . SER F 3 182 ? 3.421   -55.880 50.303  1.00 77.84  ? 182 SER G C   1 
ATOM   10049 O  O   . SER F 3 182 ? 2.560   -56.734 50.385  1.00 86.09  ? 182 SER G O   1 
ATOM   10050 C  CB  . SER F 3 182 ? 2.260   -53.702 49.918  1.00 77.71  ? 182 SER G CB  1 
ATOM   10051 O  OG  . SER F 3 182 ? 2.769   -53.057 51.087  1.00 80.04  ? 182 SER G OG  1 
ATOM   10052 N  N   . SER F 3 183 ? 4.537   -55.912 51.022  1.00 82.06  ? 183 SER G N   1 
ATOM   10053 C  CA  . SER F 3 183 ? 4.747   -56.917 52.054  1.00 86.38  ? 183 SER G CA  1 
ATOM   10054 C  C   . SER F 3 183 ? 4.658   -56.277 53.429  1.00 87.93  ? 183 SER G C   1 
ATOM   10055 O  O   . SER F 3 183 ? 4.926   -55.089 53.607  1.00 81.41  ? 183 SER G O   1 
ATOM   10056 C  CB  . SER F 3 183 ? 6.114   -57.606 51.895  1.00 95.08  ? 183 SER G CB  1 
ATOM   10057 O  OG  . SER F 3 183 ? 7.134   -56.946 52.635  1.00 100.82 ? 183 SER G OG  1 
ATOM   10058 N  N   . VAL F 3 184 ? 4.277   -57.084 54.406  1.00 95.99  ? 184 VAL G N   1 
ATOM   10059 C  CA  . VAL F 3 184 ? 4.339   -56.677 55.795  1.00 98.71  ? 184 VAL G CA  1 
ATOM   10060 C  C   . VAL F 3 184 ? 4.757   -57.898 56.581  1.00 103.44 ? 184 VAL G C   1 
ATOM   10061 O  O   . VAL F 3 184 ? 4.316   -59.005 56.282  1.00 108.25 ? 184 VAL G O   1 
ATOM   10062 C  CB  . VAL F 3 184 ? 2.976   -56.189 56.311  1.00 101.20 ? 184 VAL G CB  1 
ATOM   10063 C  CG1 . VAL F 3 184 ? 1.913   -57.270 56.141  1.00 98.46  ? 184 VAL G CG1 1 
ATOM   10064 C  CG2 . VAL F 3 184 ? 3.081   -55.760 57.765  1.00 100.85 ? 184 VAL G CG2 1 
ATOM   10065 N  N   . THR F 3 185 ? 5.629   -57.700 57.558  1.00 107.08 ? 185 THR G N   1 
ATOM   10066 C  CA  . THR F 3 185 ? 6.102   -58.793 58.387  1.00 106.35 ? 185 THR G CA  1 
ATOM   10067 C  C   . THR F 3 185 ? 5.649   -58.592 59.826  1.00 102.48 ? 185 THR G C   1 
ATOM   10068 O  O   . THR F 3 185 ? 5.860   -57.532 60.410  1.00 97.29  ? 185 THR G O   1 
ATOM   10069 C  CB  . THR F 3 185 ? 7.634   -58.908 58.313  1.00 110.66 ? 185 THR G CB  1 
ATOM   10070 O  OG1 . THR F 3 185 ? 8.007   -59.335 56.999  1.00 114.08 ? 185 THR G OG1 1 
ATOM   10071 C  CG2 . THR F 3 185 ? 8.160   -59.909 59.323  1.00 117.70 ? 185 THR G CG2 1 
ATOM   10072 N  N   . VAL F 3 186 ? 5.023   -59.625 60.384  1.00 109.28 ? 186 VAL G N   1 
ATOM   10073 C  CA  . VAL F 3 186 ? 4.511   -59.589 61.755  1.00 113.69 ? 186 VAL G CA  1 
ATOM   10074 C  C   . VAL F 3 186 ? 4.828   -60.868 62.535  1.00 113.12 ? 186 VAL G C   1 
ATOM   10075 O  O   . VAL F 3 186 ? 5.078   -61.933 61.945  1.00 105.13 ? 186 VAL G O   1 
ATOM   10076 C  CB  . VAL F 3 186 ? 2.983   -59.418 61.780  1.00 118.82 ? 186 VAL G CB  1 
ATOM   10077 C  CG1 . VAL F 3 186 ? 2.595   -58.106 61.120  1.00 123.85 ? 186 VAL G CG1 1 
ATOM   10078 C  CG2 . VAL F 3 186 ? 2.300   -60.602 61.103  1.00 115.54 ? 186 VAL G CG2 1 
ATOM   10079 N  N   . PRO F 3 187 ? 4.807   -60.768 63.875  1.00 109.71 ? 187 PRO G N   1 
ATOM   10080 C  CA  . PRO F 3 187 ? 5.018   -61.943 64.716  1.00 113.06 ? 187 PRO G CA  1 
ATOM   10081 C  C   . PRO F 3 187 ? 3.900   -62.954 64.514  1.00 115.92 ? 187 PRO G C   1 
ATOM   10082 O  O   . PRO F 3 187 ? 2.732   -62.563 64.443  1.00 125.90 ? 187 PRO G O   1 
ATOM   10083 C  CB  . PRO F 3 187 ? 5.015   -61.373 66.146  1.00 112.43 ? 187 PRO G CB  1 
ATOM   10084 C  CG  . PRO F 3 187 ? 4.420   -60.011 66.042  1.00 111.23 ? 187 PRO G CG  1 
ATOM   10085 C  CD  . PRO F 3 187 ? 4.730   -59.524 64.661  1.00 109.92 ? 187 PRO G CD  1 
ATOM   10086 N  N   . SER F 3 188 ? 4.256   -64.234 64.413  1.00 116.13 ? 188 SER G N   1 
ATOM   10087 C  CA  . SER F 3 188 ? 3.297   -65.272 64.039  1.00 120.71 ? 188 SER G CA  1 
ATOM   10088 C  C   . SER F 3 188 ? 2.267   -65.514 65.138  1.00 120.25 ? 188 SER G C   1 
ATOM   10089 O  O   . SER F 3 188 ? 1.207   -66.098 64.895  1.00 125.21 ? 188 SER G O   1 
ATOM   10090 C  CB  . SER F 3 188 ? 4.020   -66.577 63.711  1.00 120.28 ? 188 SER G CB  1 
ATOM   10091 O  OG  . SER F 3 188 ? 4.923   -66.905 64.743  1.00 127.81 ? 188 SER G OG  1 
ATOM   10092 N  N   . SER F 3 189 ? 2.571   -65.056 66.346  1.00 114.90 ? 189 SER G N   1 
ATOM   10093 C  CA  . SER F 3 189 ? 1.570   -65.018 67.398  1.00 119.00 ? 189 SER G CA  1 
ATOM   10094 C  C   . SER F 3 189 ? 0.435   -64.049 67.040  1.00 121.18 ? 189 SER G C   1 
ATOM   10095 O  O   . SER F 3 189 ? -0.695  -64.227 67.480  1.00 121.70 ? 189 SER G O   1 
ATOM   10096 C  CB  . SER F 3 189 ? 2.206   -64.625 68.730  1.00 123.11 ? 189 SER G CB  1 
ATOM   10097 O  OG  . SER F 3 189 ? 2.955   -63.431 68.603  1.00 133.32 ? 189 SER G OG  1 
ATOM   10098 N  N   . SER F 3 190 ? 0.728   -63.046 66.216  1.00 121.67 ? 190 SER G N   1 
ATOM   10099 C  CA  . SER F 3 190 ? -0.272  -62.038 65.844  1.00 118.14 ? 190 SER G CA  1 
ATOM   10100 C  C   . SER F 3 190 ? -1.199  -62.464 64.715  1.00 110.93 ? 190 SER G C   1 
ATOM   10101 O  O   . SER F 3 190 ? -2.275  -61.900 64.561  1.00 112.44 ? 190 SER G O   1 
ATOM   10102 C  CB  . SER F 3 190 ? 0.405   -60.737 65.431  1.00 117.56 ? 190 SER G CB  1 
ATOM   10103 O  OG  . SER F 3 190 ? 0.710   -59.962 66.570  1.00 128.09 ? 190 SER G OG  1 
ATOM   10104 N  N   . TRP F 3 191 ? -0.786  -63.440 63.918  1.00 108.22 ? 191 TRP G N   1 
ATOM   10105 C  CA  . TRP F 3 191 ? -1.582  -63.846 62.769  1.00 107.24 ? 191 TRP G CA  1 
ATOM   10106 C  C   . TRP F 3 191 ? -1.597  -65.355 62.604  1.00 119.40 ? 191 TRP G C   1 
ATOM   10107 O  O   . TRP F 3 191 ? -0.544  -65.996 62.565  1.00 116.82 ? 191 TRP G O   1 
ATOM   10108 C  CB  . TRP F 3 191 ? -1.048  -63.203 61.503  1.00 101.07 ? 191 TRP G CB  1 
ATOM   10109 C  CG  . TRP F 3 191 ? -1.885  -63.442 60.291  1.00 96.45  ? 191 TRP G CG  1 
ATOM   10110 C  CD1 . TRP F 3 191 ? -2.916  -62.678 59.852  1.00 102.26 ? 191 TRP G CD1 1 
ATOM   10111 C  CD2 . TRP F 3 191 ? -1.732  -64.495 59.335  1.00 95.59  ? 191 TRP G CD2 1 
ATOM   10112 N  NE1 . TRP F 3 191 ? -3.423  -63.190 58.681  1.00 104.49 ? 191 TRP G NE1 1 
ATOM   10113 C  CE2 . TRP F 3 191 ? -2.705  -64.301 58.338  1.00 96.92  ? 191 TRP G CE2 1 
ATOM   10114 C  CE3 . TRP F 3 191 ? -0.860  -65.574 59.219  1.00 104.37 ? 191 TRP G CE3 1 
ATOM   10115 C  CZ2 . TRP F 3 191 ? -2.843  -65.154 57.248  1.00 99.79  ? 191 TRP G CZ2 1 
ATOM   10116 C  CZ3 . TRP F 3 191 ? -0.990  -66.419 58.125  1.00 113.48 ? 191 TRP G CZ3 1 
ATOM   10117 C  CH2 . TRP F 3 191 ? -1.978  -66.205 57.158  1.00 109.11 ? 191 TRP G CH2 1 
ATOM   10118 N  N   . PRO F 3 192 ? -2.803  -65.922 62.444  1.00 129.78 ? 192 PRO G N   1 
ATOM   10119 C  CA  . PRO F 3 192 ? -4.038  -65.162 62.268  1.00 129.39 ? 192 PRO G CA  1 
ATOM   10120 C  C   . PRO F 3 192 ? -4.855  -64.928 63.552  1.00 123.15 ? 192 PRO G C   1 
ATOM   10121 O  O   . PRO F 3 192 ? -6.049  -64.653 63.467  1.00 123.75 ? 192 PRO G O   1 
ATOM   10122 C  CB  . PRO F 3 192 ? -4.823  -66.029 61.285  1.00 130.02 ? 192 PRO G CB  1 
ATOM   10123 C  CG  . PRO F 3 192 ? -4.411  -67.415 61.635  1.00 136.62 ? 192 PRO G CG  1 
ATOM   10124 C  CD  . PRO F 3 192 ? -3.012  -67.355 62.191  1.00 136.24 ? 192 PRO G CD  1 
ATOM   10125 N  N   . SER F 3 193 ? -4.220  -64.999 64.719  1.00 121.13 ? 193 SER G N   1 
ATOM   10126 C  CA  . SER F 3 193 ? -4.891  -64.653 65.976  1.00 126.69 ? 193 SER G CA  1 
ATOM   10127 C  C   . SER F 3 193 ? -5.572  -63.302 65.865  1.00 127.86 ? 193 SER G C   1 
ATOM   10128 O  O   . SER F 3 193 ? -6.674  -63.105 66.370  1.00 142.66 ? 193 SER G O   1 
ATOM   10129 C  CB  . SER F 3 193 ? -3.891  -64.586 67.129  1.00 129.40 ? 193 SER G CB  1 
ATOM   10130 O  OG  . SER F 3 193 ? -3.280  -65.840 67.355  1.00 137.96 ? 193 SER G OG  1 
ATOM   10131 N  N   . GLU F 3 194 ? -4.878  -62.363 65.237  1.00 128.37 ? 194 GLU G N   1 
ATOM   10132 C  CA  . GLU F 3 194 ? -5.430  -61.058 64.954  1.00 138.88 ? 194 GLU G CA  1 
ATOM   10133 C  C   . GLU F 3 194 ? -5.534  -60.892 63.438  1.00 134.12 ? 194 GLU G C   1 
ATOM   10134 O  O   . GLU F 3 194 ? -4.716  -61.414 62.677  1.00 133.98 ? 194 GLU G O   1 
ATOM   10135 C  CB  . GLU F 3 194 ? -4.544  -59.961 65.556  1.00 166.40 ? 194 GLU G CB  1 
ATOM   10136 C  CG  . GLU F 3 194 ? -5.244  -58.614 65.689  1.00 183.70 ? 194 GLU G CG  1 
ATOM   10137 C  CD  . GLU F 3 194 ? -4.287  -57.449 65.849  1.00 194.48 ? 194 GLU G CD  1 
ATOM   10138 O  OE1 . GLU F 3 194 ? -4.535  -56.601 66.733  1.00 190.65 ? 194 GLU G OE1 1 
ATOM   10139 O  OE2 . GLU F 3 194 ? -3.295  -57.376 65.092  1.00 199.77 ? 194 GLU G OE2 1 
ATOM   10140 N  N   . THR F 3 195 ? -6.547  -60.161 63.001  1.00 127.13 ? 195 THR G N   1 
ATOM   10141 C  CA  . THR F 3 195 ? -6.731  -59.901 61.587  1.00 119.19 ? 195 THR G CA  1 
ATOM   10142 C  C   . THR F 3 195 ? -5.682  -58.919 61.074  1.00 116.94 ? 195 THR G C   1 
ATOM   10143 O  O   . THR F 3 195 ? -5.212  -58.037 61.804  1.00 109.08 ? 195 THR G O   1 
ATOM   10144 C  CB  . THR F 3 195 ? -8.123  -59.321 61.326  1.00 121.35 ? 195 THR G CB  1 
ATOM   10145 O  OG1 . THR F 3 195 ? -8.279  -58.122 62.089  1.00 129.30 ? 195 THR G OG1 1 
ATOM   10146 C  CG2 . THR F 3 195 ? -9.192  -60.310 61.745  1.00 125.47 ? 195 THR G CG2 1 
ATOM   10147 N  N   . VAL F 3 196 ? -5.310  -59.105 59.812  1.00 118.52 ? 196 VAL G N   1 
ATOM   10148 C  CA  . VAL F 3 196 ? -4.461  -58.163 59.088  1.00 115.96 ? 196 VAL G CA  1 
ATOM   10149 C  C   . VAL F 3 196 ? -5.141  -57.830 57.768  1.00 112.70 ? 196 VAL G C   1 
ATOM   10150 O  O   . VAL F 3 196 ? -5.519  -58.724 57.010  1.00 121.74 ? 196 VAL G O   1 
ATOM   10151 C  CB  . VAL F 3 196 ? -3.067  -58.756 58.800  1.00 105.82 ? 196 VAL G CB  1 
ATOM   10152 C  CG1 . VAL F 3 196 ? -2.294  -57.896 57.807  1.00 98.37  ? 196 VAL G CG1 1 
ATOM   10153 C  CG2 . VAL F 3 196 ? -2.292  -58.918 60.097  1.00 104.93 ? 196 VAL G CG2 1 
ATOM   10154 N  N   . THR F 3 197 ? -5.319  -56.543 57.507  1.00 98.72  ? 197 THR G N   1 
ATOM   10155 C  CA  . THR F 3 197 ? -5.918  -56.108 56.262  1.00 95.31  ? 197 THR G CA  1 
ATOM   10156 C  C   . THR F 3 197 ? -5.049  -55.031 55.626  1.00 89.55  ? 197 THR G C   1 
ATOM   10157 O  O   . THR F 3 197 ? -4.535  -54.149 56.312  1.00 85.16  ? 197 THR G O   1 
ATOM   10158 C  CB  . THR F 3 197 ? -7.314  -55.534 56.504  1.00 99.88  ? 197 THR G CB  1 
ATOM   10159 O  OG1 . THR F 3 197 ? -7.191  -54.344 57.290  1.00 117.12 ? 197 THR G OG1 1 
ATOM   10160 C  CG2 . THR F 3 197 ? -8.187  -56.524 57.261  1.00 100.59 ? 197 THR G CG2 1 
ATOM   10161 N  N   . CYS F 3 198 ? -4.871  -55.110 54.314  1.00 84.01  ? 198 CYS G N   1 
ATOM   10162 C  CA  . CYS F 3 198 ? -4.160  -54.073 53.610  1.00 86.10  ? 198 CYS G CA  1 
ATOM   10163 C  C   . CYS F 3 198 ? -5.161  -53.102 53.019  1.00 88.11  ? 198 CYS G C   1 
ATOM   10164 O  O   . CYS F 3 198 ? -6.175  -53.514 52.465  1.00 90.85  ? 198 CYS G O   1 
ATOM   10165 C  CB  . CYS F 3 198 ? -3.282  -54.672 52.509  1.00 94.51  ? 198 CYS G CB  1 
ATOM   10166 S  SG  . CYS F 3 198 ? -4.058  -54.928 50.883  1.00 86.80  ? 198 CYS G SG  1 
ATOM   10167 N  N   . ASN F 3 199 ? -4.866  -51.810 53.140  1.00 87.33  ? 199 ASN G N   1 
ATOM   10168 C  CA  . ASN F 3 199 ? -5.733  -50.766 52.630  1.00 80.37  ? 199 ASN G CA  1 
ATOM   10169 C  C   . ASN F 3 199 ? -5.109  -50.154 51.395  1.00 77.38  ? 199 ASN G C   1 
ATOM   10170 O  O   . ASN F 3 199 ? -4.017  -49.618 51.460  1.00 82.70  ? 199 ASN G O   1 
ATOM   10171 C  CB  . ASN F 3 199 ? -5.926  -49.698 53.698  1.00 82.51  ? 199 ASN G CB  1 
ATOM   10172 C  CG  . ASN F 3 199 ? -6.016  -50.281 55.098  1.00 88.13  ? 199 ASN G CG  1 
ATOM   10173 O  OD1 . ASN F 3 199 ? -5.006  -50.438 55.786  1.00 90.73  ? 199 ASN G OD1 1 
ATOM   10174 N  ND2 . ASN F 3 199 ? -7.228  -50.602 55.531  1.00 92.12  ? 199 ASN G ND2 1 
ATOM   10175 N  N   . VAL F 3 200 ? -5.797  -50.252 50.268  1.00 79.86  ? 200 VAL G N   1 
ATOM   10176 C  CA  . VAL F 3 200 ? -5.276  -49.745 48.999  1.00 84.27  ? 200 VAL G CA  1 
ATOM   10177 C  C   . VAL F 3 200 ? -6.091  -48.571 48.500  1.00 89.35  ? 200 VAL G C   1 
ATOM   10178 O  O   . VAL F 3 200 ? -7.308  -48.680 48.361  1.00 95.26  ? 200 VAL G O   1 
ATOM   10179 C  CB  . VAL F 3 200 ? -5.311  -50.824 47.908  1.00 85.43  ? 200 VAL G CB  1 
ATOM   10180 C  CG1 . VAL F 3 200 ? -4.931  -50.243 46.545  1.00 80.59  ? 200 VAL G CG1 1 
ATOM   10181 C  CG2 . VAL F 3 200 ? -4.381  -51.951 48.300  1.00 93.77  ? 200 VAL G CG2 1 
ATOM   10182 N  N   . ALA F 3 201 ? -5.413  -47.462 48.208  1.00 87.28  ? 201 ALA G N   1 
ATOM   10183 C  CA  . ALA F 3 201 ? -6.058  -46.317 47.589  1.00 84.92  ? 201 ALA G CA  1 
ATOM   10184 C  C   . ALA F 3 201 ? -5.516  -46.058 46.178  1.00 81.46  ? 201 ALA G C   1 
ATOM   10185 O  O   . ALA F 3 201 ? -4.313  -46.059 45.963  1.00 81.30  ? 201 ALA G O   1 
ATOM   10186 C  CB  . ALA F 3 201 ? -5.883  -45.089 48.461  1.00 86.52  ? 201 ALA G CB  1 
ATOM   10187 N  N   . HIS F 3 202 ? -6.420  -45.862 45.221  1.00 82.33  ? 202 HIS G N   1 
ATOM   10188 C  CA  . HIS F 3 202 ? -6.063  -45.375 43.891  1.00 79.70  ? 202 HIS G CA  1 
ATOM   10189 C  C   . HIS F 3 202 ? -6.840  -44.092 43.611  1.00 89.55  ? 202 HIS G C   1 
ATOM   10190 O  O   . HIS F 3 202 ? -7.967  -44.130 43.104  1.00 91.19  ? 202 HIS G O   1 
ATOM   10191 C  CB  . HIS F 3 202 ? -6.389  -46.407 42.828  1.00 75.78  ? 202 HIS G CB  1 
ATOM   10192 C  CG  . HIS F 3 202 ? -5.931  -46.030 41.454  1.00 74.98  ? 202 HIS G CG  1 
ATOM   10193 N  ND1 . HIS F 3 202 ? -6.785  -45.978 40.372  1.00 75.02  ? 202 HIS G ND1 1 
ATOM   10194 C  CD2 . HIS F 3 202 ? -4.705  -45.705 40.980  1.00 75.45  ? 202 HIS G CD2 1 
ATOM   10195 C  CE1 . HIS F 3 202 ? -6.103  -45.652 39.288  1.00 75.63  ? 202 HIS G CE1 1 
ATOM   10196 N  NE2 . HIS F 3 202 ? -4.839  -45.477 39.630  1.00 75.97  ? 202 HIS G NE2 1 
ATOM   10197 N  N   . PRO F 3 203 ? -6.231  -42.947 43.949  1.00 88.43  ? 203 PRO G N   1 
ATOM   10198 C  CA  . PRO F 3 203 ? -6.845  -41.646 43.831  1.00 85.53  ? 203 PRO G CA  1 
ATOM   10199 C  C   . PRO F 3 203 ? -7.415  -41.382 42.449  1.00 85.32  ? 203 PRO G C   1 
ATOM   10200 O  O   . PRO F 3 203 ? -8.501  -40.822 42.339  1.00 99.02  ? 203 PRO G O   1 
ATOM   10201 C  CB  . PRO F 3 203 ? -5.688  -40.701 44.127  1.00 87.90  ? 203 PRO G CB  1 
ATOM   10202 C  CG  . PRO F 3 203 ? -4.817  -41.470 45.056  1.00 88.39  ? 203 PRO G CG  1 
ATOM   10203 C  CD  . PRO F 3 203 ? -4.878  -42.862 44.525  1.00 86.46  ? 203 PRO G CD  1 
ATOM   10204 N  N   . ALA F 3 204 ? -6.705  -41.772 41.402  1.00 79.96  ? 204 ALA G N   1 
ATOM   10205 C  CA  . ALA F 3 204 ? -7.156  -41.458 40.049  1.00 83.49  ? 204 ALA G CA  1 
ATOM   10206 C  C   . ALA F 3 204 ? -8.533  -42.020 39.724  1.00 89.60  ? 204 ALA G C   1 
ATOM   10207 O  O   . ALA F 3 204 ? -9.251  -41.456 38.914  1.00 107.07 ? 204 ALA G O   1 
ATOM   10208 C  CB  . ALA F 3 204 ? -6.155  -41.948 39.028  1.00 86.03  ? 204 ALA G CB  1 
ATOM   10209 N  N   . SER F 3 205 ? -8.897  -43.147 40.321  1.00 94.14  ? 205 SER G N   1 
ATOM   10210 C  CA  . SER F 3 205 ? -10.190 -43.769 40.033  1.00 95.68  ? 205 SER G CA  1 
ATOM   10211 C  C   . SER F 3 205 ? -11.145 -43.656 41.226  1.00 97.59  ? 205 SER G C   1 
ATOM   10212 O  O   . SER F 3 205 ? -12.234 -44.236 41.218  1.00 95.41  ? 205 SER G O   1 
ATOM   10213 C  CB  . SER F 3 205 ? -9.988  -45.235 39.664  1.00 96.15  ? 205 SER G CB  1 
ATOM   10214 O  OG  . SER F 3 205 ? -9.280  -45.913 40.688  1.00 99.59  ? 205 SER G OG  1 
ATOM   10215 N  N   . SER F 3 206 ? -10.730 -42.901 42.243  1.00 103.23 ? 206 SER G N   1 
ATOM   10216 C  CA  . SER F 3 206 ? -11.509 -42.733 43.479  1.00 108.56 ? 206 SER G CA  1 
ATOM   10217 C  C   . SER F 3 206 ? -11.801 -44.079 44.117  1.00 110.28 ? 206 SER G C   1 
ATOM   10218 O  O   . SER F 3 206 ? -12.917 -44.347 44.562  1.00 115.51 ? 206 SER G O   1 
ATOM   10219 C  CB  . SER F 3 206 ? -12.818 -41.986 43.211  1.00 113.32 ? 206 SER G CB  1 
ATOM   10220 O  OG  . SER F 3 206 ? -12.583 -40.600 43.034  1.00 119.48 ? 206 SER G OG  1 
ATOM   10221 N  N   . THR F 3 207 ? -10.773 -44.918 44.157  1.00 110.17 ? 207 THR G N   1 
ATOM   10222 C  CA  . THR F 3 207 ? -10.901 -46.294 44.598  1.00 93.87  ? 207 THR G CA  1 
ATOM   10223 C  C   . THR F 3 207 ? -10.195 -46.481 45.924  1.00 90.65  ? 207 THR G C   1 
ATOM   10224 O  O   . THR F 3 207 ? -9.012  -46.189 46.046  1.00 95.96  ? 207 THR G O   1 
ATOM   10225 C  CB  . THR F 3 207 ? -10.269 -47.232 43.570  1.00 88.83  ? 207 THR G CB  1 
ATOM   10226 O  OG1 . THR F 3 207 ? -11.058 -47.211 42.378  1.00 88.47  ? 207 THR G OG1 1 
ATOM   10227 C  CG2 . THR F 3 207 ? -10.178 -48.646 44.113  1.00 94.86  ? 207 THR G CG2 1 
ATOM   10228 N  N   . LYS F 3 208 ? -10.942 -46.938 46.920  1.00 93.01  ? 208 LYS G N   1 
ATOM   10229 C  CA  . LYS F 3 208 ? -10.395 -47.249 48.228  1.00 100.80 ? 208 LYS G CA  1 
ATOM   10230 C  C   . LYS F 3 208 ? -10.900 -48.638 48.630  1.00 96.38  ? 208 LYS G C   1 
ATOM   10231 O  O   . LYS F 3 208 ? -12.100 -48.874 48.703  1.00 102.55 ? 208 LYS G O   1 
ATOM   10232 C  CB  . LYS F 3 208 ? -10.804 -46.185 49.255  1.00 121.75 ? 208 LYS G CB  1 
ATOM   10233 C  CG  . LYS F 3 208 ? -9.866  -46.062 50.452  1.00 143.32 ? 208 LYS G CG  1 
ATOM   10234 C  CD  . LYS F 3 208 ? -10.510 -45.305 51.613  1.00 163.83 ? 208 LYS G CD  1 
ATOM   10235 C  CE  . LYS F 3 208 ? -11.129 -43.978 51.182  1.00 166.08 ? 208 LYS G CE  1 
ATOM   10236 N  NZ  . LYS F 3 208 ? -10.122 -42.973 50.733  1.00 168.44 ? 208 LYS G NZ  1 
ATOM   10237 N  N   . VAL F 3 209 ? -9.975  -49.565 48.841  1.00 95.80  ? 209 VAL G N   1 
ATOM   10238 C  CA  . VAL F 3 209 ? -10.308 -50.976 49.004  1.00 94.40  ? 209 VAL G CA  1 
ATOM   10239 C  C   . VAL F 3 209 ? -9.551  -51.549 50.195  1.00 92.44  ? 209 VAL G C   1 
ATOM   10240 O  O   . VAL F 3 209 ? -8.351  -51.315 50.344  1.00 106.26 ? 209 VAL G O   1 
ATOM   10241 C  CB  . VAL F 3 209 ? -9.932  -51.775 47.732  1.00 97.30  ? 209 VAL G CB  1 
ATOM   10242 C  CG1 . VAL F 3 209 ? -9.891  -53.269 48.012  1.00 98.89  ? 209 VAL G CG1 1 
ATOM   10243 C  CG2 . VAL F 3 209 ? -10.898 -51.468 46.594  1.00 99.50  ? 209 VAL G CG2 1 
ATOM   10244 N  N   . ASP F 3 210 ? -10.246 -52.317 51.029  1.00 93.21  ? 210 ASP G N   1 
ATOM   10245 C  CA  . ASP F 3 210 ? -9.605  -53.034 52.134  1.00 94.51  ? 210 ASP G CA  1 
ATOM   10246 C  C   . ASP F 3 210 ? -9.624  -54.532 51.872  1.00 94.75  ? 210 ASP G C   1 
ATOM   10247 O  O   . ASP F 3 210 ? -10.637 -55.070 51.446  1.00 101.46 ? 210 ASP G O   1 
ATOM   10248 C  CB  . ASP F 3 210 ? -10.313 -52.743 53.457  1.00 100.19 ? 210 ASP G CB  1 
ATOM   10249 C  CG  . ASP F 3 210 ? -10.166 -51.298 53.893  1.00 109.94 ? 210 ASP G CG  1 
ATOM   10250 O  OD1 . ASP F 3 210 ? -9.381  -50.549 53.263  1.00 119.18 ? 210 ASP G OD1 1 
ATOM   10251 O  OD2 . ASP F 3 210 ? -10.837 -50.911 54.877  1.00 110.98 ? 210 ASP G OD2 1 
ATOM   10252 N  N   . LYS F 3 211 ? -8.507  -55.206 52.133  1.00 100.12 ? 211 LYS G N   1 
ATOM   10253 C  CA  . LYS F 3 211 ? -8.413  -56.645 51.921  1.00 94.83  ? 211 LYS G CA  1 
ATOM   10254 C  C   . LYS F 3 211 ? -7.851  -57.334 53.147  1.00 96.33  ? 211 LYS G C   1 
ATOM   10255 O  O   . LYS F 3 211 ? -6.723  -57.100 53.543  1.00 106.12 ? 211 LYS G O   1 
ATOM   10256 C  CB  . LYS F 3 211 ? -7.557  -56.965 50.699  1.00 92.21  ? 211 LYS G CB  1 
ATOM   10257 C  CG  . LYS F 3 211 ? -8.375  -57.296 49.469  1.00 104.30 ? 211 LYS G CG  1 
ATOM   10258 C  CD  . LYS F 3 211 ? -9.012  -58.674 49.591  1.00 129.80 ? 211 LYS G CD  1 
ATOM   10259 C  CE  . LYS F 3 211 ? -10.431 -58.706 49.032  1.00 147.37 ? 211 LYS G CE  1 
ATOM   10260 N  NZ  . LYS F 3 211 ? -10.548 -58.035 47.705  1.00 153.14 ? 211 LYS G NZ  1 
ATOM   10261 N  N   . LYS F 3 212 ? -8.660  -58.198 53.735  1.00 112.03 ? 212 LYS G N   1 
ATOM   10262 C  CA  . LYS F 3 212 ? -8.240  -59.030 54.853  1.00 120.09 ? 212 LYS G CA  1 
ATOM   10263 C  C   . LYS F 3 212 ? -7.421  -60.220 54.361  1.00 114.84 ? 212 LYS G C   1 
ATOM   10264 O  O   . LYS F 3 212 ? -7.829  -60.949 53.450  1.00 109.47 ? 212 LYS G O   1 
ATOM   10265 C  CB  . LYS F 3 212 ? -9.475  -59.523 55.611  1.00 134.80 ? 212 LYS G CB  1 
ATOM   10266 C  CG  . LYS F 3 212 ? -9.185  -60.326 56.866  1.00 135.12 ? 212 LYS G CG  1 
ATOM   10267 C  CD  . LYS F 3 212 ? -10.485 -60.783 57.503  1.00 153.21 ? 212 LYS G CD  1 
ATOM   10268 C  CE  . LYS F 3 212 ? -10.255 -61.880 58.527  1.00 168.14 ? 212 LYS G CE  1 
ATOM   10269 N  NZ  . LYS F 3 212 ? -11.538 -62.425 59.055  1.00 177.94 ? 212 LYS G NZ  1 
ATOM   10270 N  N   . ILE F 3 213 ? -6.262  -60.415 54.974  1.00 107.92 ? 213 ILE G N   1 
ATOM   10271 C  CA  . ILE F 3 213 ? -5.456  -61.586 54.696  1.00 104.38 ? 213 ILE G CA  1 
ATOM   10272 C  C   . ILE F 3 213 ? -5.964  -62.766 55.518  1.00 107.11 ? 213 ILE G C   1 
ATOM   10273 O  O   . ILE F 3 213 ? -5.998  -62.719 56.754  1.00 100.63 ? 213 ILE G O   1 
ATOM   10274 C  CB  . ILE F 3 213 ? -3.974  -61.326 54.997  1.00 101.13 ? 213 ILE G CB  1 
ATOM   10275 C  CG1 . ILE F 3 213 ? -3.544  -59.985 54.399  1.00 98.09  ? 213 ILE G CG1 1 
ATOM   10276 C  CG2 . ILE F 3 213 ? -3.117  -62.448 54.434  1.00 97.24  ? 213 ILE G CG2 1 
ATOM   10277 C  CD1 . ILE F 3 213 ? -3.852  -59.856 52.920  1.00 96.13  ? 213 ILE G CD1 1 
ATOM   10278 N  N   . VAL F 3 214 ? -6.390  -63.807 54.808  1.00 109.35 ? 214 VAL G N   1 
ATOM   10279 C  CA  . VAL F 3 214 ? -6.957  -64.989 55.424  1.00 113.89 ? 214 VAL G CA  1 
ATOM   10280 C  C   . VAL F 3 214 ? -6.071  -66.175 55.094  1.00 114.92 ? 214 VAL G C   1 
ATOM   10281 O  O   . VAL F 3 214 ? -5.679  -66.337 53.936  1.00 110.43 ? 214 VAL G O   1 
ATOM   10282 C  CB  . VAL F 3 214 ? -8.372  -65.268 54.884  1.00 121.83 ? 214 VAL G CB  1 
ATOM   10283 C  CG1 . VAL F 3 214 ? -8.945  -66.523 55.523  1.00 135.73 ? 214 VAL G CG1 1 
ATOM   10284 C  CG2 . VAL F 3 214 ? -9.286  -64.081 55.145  1.00 125.79 ? 214 VAL G CG2 1 
ATOM   10285 N  N   . PRO F 3 215 ? -5.744  -67.000 56.108  1.00 117.27 ? 215 PRO G N   1 
ATOM   10286 C  CA  . PRO F 3 215 ? -4.875  -68.163 55.888  1.00 119.08 ? 215 PRO G CA  1 
ATOM   10287 C  C   . PRO F 3 215 ? -5.457  -69.184 54.913  1.00 123.83 ? 215 PRO G C   1 
ATOM   10288 O  O   . PRO F 3 215 ? -6.662  -69.426 54.914  1.00 118.80 ? 215 PRO G O   1 
ATOM   10289 C  CB  . PRO F 3 215 ? -4.755  -68.788 57.283  1.00 116.16 ? 215 PRO G CB  1 
ATOM   10290 C  CG  . PRO F 3 215 ? -5.905  -68.243 58.058  1.00 115.71 ? 215 PRO G CG  1 
ATOM   10291 C  CD  . PRO F 3 215 ? -6.139  -66.870 57.523  1.00 112.12 ? 215 PRO G CD  1 
ATOM   10292 N  N   . ARG F 3 216 ? -4.594  -69.775 54.095  1.00 134.32 ? 216 ARG G N   1 
ATOM   10293 C  CA  . ARG F 3 216 ? -4.973  -70.927 53.285  1.00 147.88 ? 216 ARG G CA  1 
ATOM   10294 C  C   . ARG F 3 216 ? -5.338  -72.100 54.191  1.00 152.63 ? 216 ARG G C   1 
ATOM   10295 O  O   . ARG F 3 216 ? -6.324  -72.797 53.960  1.00 165.19 ? 216 ARG G O   1 
ATOM   10296 C  CB  . ARG F 3 216 ? -3.820  -71.342 52.371  1.00 157.65 ? 216 ARG G CB  1 
ATOM   10297 C  CG  . ARG F 3 216 ? -3.208  -70.207 51.568  1.00 157.27 ? 216 ARG G CG  1 
ATOM   10298 C  CD  . ARG F 3 216 ? -4.214  -69.570 50.624  1.00 157.24 ? 216 ARG G CD  1 
ATOM   10299 N  NE  . ARG F 3 216 ? -4.836  -70.546 49.728  1.00 156.57 ? 216 ARG G NE  1 
ATOM   10300 C  CZ  . ARG F 3 216 ? -5.149  -70.307 48.457  1.00 153.11 ? 216 ARG G CZ  1 
ATOM   10301 N  NH1 . ARG F 3 216 ? -4.887  -69.127 47.907  1.00 156.51 ? 216 ARG G NH1 1 
ATOM   10302 N  NH2 . ARG F 3 216 ? -5.719  -71.258 47.729  1.00 149.91 ? 216 ARG G NH2 1 
HETATM 10303 TL TL  . TL  G 4 .   ? 29.239  -16.706 -3.584  1.00 230.50 ? 301 TL  A TL  1 
HETATM 10304 TL TL  . TL  H 4 .   ? 51.701  -9.080  2.130   1.00 115.40 ? 302 TL  A TL  1 
HETATM 10305 TL TL  . TL  I 4 .   ? 53.631  -9.461  -0.327  1.00 112.22 ? 303 TL  A TL  1 
HETATM 10306 TL TL  . TL  J 4 .   ? 55.822  -9.953  -3.207  1.00 117.86 ? 304 TL  A TL  1 
HETATM 10307 CA CA  . CA  K 5 .   ? 44.647  -25.571 11.375  1.00 131.02 ? 305 CA  A CA  1 
HETATM 10308 CA CA  . CA  L 5 .   ? 43.941  -19.824 16.557  1.00 117.73 ? 306 CA  A CA  1 
HETATM 10309 TL TL  . TL  M 4 .   ? 49.734  -8.586  4.651   1.00 118.91 ? 307 TL  A TL  1 
HETATM 10310 TL TL  . TL  N 4 .   ? 45.282  -7.067  9.826   1.00 240.19 ? 301 TL  B TL  1 
HETATM 10311 TL TL  . TL  O 4 .   ? 64.244  0.967   20.637  1.00 250.53 ? 302 TL  B TL  1 
HETATM 10312 C  C1  . D10 P 6 .   ? 64.212  -9.892  -2.862  1.00 123.06 ? 303 D10 B C1  1 
HETATM 10313 C  C2  . D10 P 6 .   ? 64.210  -8.715  -3.825  1.00 136.17 ? 303 D10 B C2  1 
HETATM 10314 C  C3  . D10 P 6 .   ? 62.899  -8.588  -4.607  1.00 137.90 ? 303 D10 B C3  1 
HETATM 10315 C  C4  . D10 P 6 .   ? 62.646  -9.773  -5.542  1.00 149.20 ? 303 D10 B C4  1 
HETATM 10316 C  C5  . D10 P 6 .   ? 61.319  -10.472 -5.244  1.00 139.38 ? 303 D10 B C5  1 
HETATM 10317 C  C6  . D10 P 6 .   ? 60.600  -10.884 -6.523  1.00 140.05 ? 303 D10 B C6  1 
HETATM 10318 C  C7  . D10 P 6 .   ? 60.082  -9.668  -7.285  1.00 136.90 ? 303 D10 B C7  1 
HETATM 10319 C  C8  . D10 P 6 .   ? 58.743  -9.183  -6.734  1.00 126.93 ? 303 D10 B C8  1 
HETATM 10320 C  C9  . D10 P 6 .   ? 57.561  -9.878  -7.414  1.00 119.22 ? 303 D10 B C9  1 
HETATM 10321 C  C10 . D10 P 6 .   ? 57.540  -11.368 -7.125  1.00 108.01 ? 303 D10 B C10 1 
HETATM 10322 CA CA  . CA  Q 5 .   ? -0.160  -28.808 31.192  1.00 111.80 ? 301 CA  G CA  1 
HETATM 10323 O  O   . HOH R 7 .   ? 44.983  -11.262 0.218   1.00 110.63 ? 401 HOH A O   1 
HETATM 10324 O  O   . HOH R 7 .   ? 33.171  0.291   26.098  1.00 92.69  ? 402 HOH A O   1 
HETATM 10325 O  O   . HOH R 7 .   ? 25.966  -8.364  37.617  1.00 88.03  ? 403 HOH A O   1 
HETATM 10326 O  O   . HOH R 7 .   ? 20.239  -2.743  30.554  1.00 86.13  ? 404 HOH A O   1 
HETATM 10327 O  O   . HOH R 7 .   ? 42.887  -10.053 -0.864  1.00 99.78  ? 405 HOH A O   1 
HETATM 10328 O  O   . HOH R 7 .   ? 24.663  3.002   25.644  1.00 83.85  ? 406 HOH A O   1 
HETATM 10329 O  O   . HOH R 7 .   ? 21.804  -1.235  34.674  1.00 79.13  ? 407 HOH A O   1 
HETATM 10330 O  O   . HOH R 7 .   ? 33.165  -7.014  36.767  1.00 69.13  ? 408 HOH A O   1 
HETATM 10331 O  O   . HOH R 7 .   ? 23.239  -10.562 24.260  1.00 70.64  ? 409 HOH A O   1 
HETATM 10332 O  O   . HOH R 7 .   ? 19.590  -10.340 30.243  1.00 88.10  ? 410 HOH A O   1 
HETATM 10333 O  O   . HOH R 7 .   ? 41.133  -22.365 6.577   1.00 95.45  ? 411 HOH A O   1 
HETATM 10334 O  O   . HOH R 7 .   ? 43.204  -14.458 16.130  1.00 82.15  ? 412 HOH A O   1 
HETATM 10335 O  O   . HOH R 7 .   ? 28.284  2.883   25.522  1.00 85.76  ? 413 HOH A O   1 
HETATM 10336 O  O   . HOH R 7 .   ? 25.753  -7.036  21.438  1.00 75.77  ? 414 HOH A O   1 
HETATM 10337 O  O   . HOH R 7 .   ? 22.966  -7.753  22.713  1.00 83.71  ? 415 HOH A O   1 
HETATM 10338 O  O   . HOH R 7 .   ? 43.133  -11.547 27.817  1.00 85.43  ? 416 HOH A O   1 
HETATM 10339 O  O   . HOH R 7 .   ? 45.180  -17.931 15.275  1.00 94.27  ? 417 HOH A O   1 
HETATM 10340 O  O   . HOH R 7 .   ? 22.978  5.496   25.485  1.00 95.19  ? 418 HOH A O   1 
HETATM 10341 O  O   . HOH R 7 .   ? 38.354  1.920   4.024   1.00 72.02  ? 419 HOH A O   1 
HETATM 10342 O  O   . HOH R 7 .   ? 33.812  6.798   8.399   1.00 96.27  ? 420 HOH A O   1 
HETATM 10343 O  O   . HOH R 7 .   ? 35.245  -6.854  32.855  1.00 81.53  ? 421 HOH A O   1 
HETATM 10344 O  O   . HOH R 7 .   ? 36.951  -0.270  30.847  1.00 67.14  ? 422 HOH A O   1 
HETATM 10345 O  O   . HOH R 7 .   ? 43.746  -4.510  25.677  1.00 88.91  ? 423 HOH A O   1 
HETATM 10346 O  O   . HOH R 7 .   ? 45.847  -14.621 14.361  1.00 80.91  ? 424 HOH A O   1 
HETATM 10347 O  O   . HOH R 7 .   ? 48.732  -16.084 15.692  1.00 84.47  ? 425 HOH A O   1 
HETATM 10348 O  O   . HOH S 7 .   ? 25.441  -20.103 29.965  1.00 60.95  ? 401 HOH B O   1 
HETATM 10349 O  O   . HOH S 7 .   ? 35.362  -18.052 22.981  1.00 82.05  ? 402 HOH B O   1 
HETATM 10350 O  O   . HOH S 7 .   ? 22.611  -17.364 35.321  1.00 51.77  ? 403 HOH B O   1 
HETATM 10351 O  O   . HOH S 7 .   ? 57.129  -7.230  9.609   1.00 77.07  ? 404 HOH B O   1 
HETATM 10352 O  O   . HOH S 7 .   ? 55.672  -6.471  7.380   1.00 83.25  ? 405 HOH B O   1 
HETATM 10353 O  O   . HOH S 7 .   ? 41.460  -21.945 32.037  1.00 68.12  ? 406 HOH B O   1 
HETATM 10354 O  O   . HOH S 7 .   ? 32.479  -18.525 23.967  1.00 51.35  ? 407 HOH B O   1 
HETATM 10355 O  O   . HOH S 7 .   ? 33.112  -8.037  33.914  1.00 50.80  ? 408 HOH B O   1 
HETATM 10356 O  O   . HOH S 7 .   ? 34.752  -10.752 34.256  1.00 51.69  ? 409 HOH B O   1 
HETATM 10357 O  O   . HOH S 7 .   ? 32.087  -21.767 32.853  1.00 73.14  ? 410 HOH B O   1 
HETATM 10358 O  O   . HOH S 7 .   ? 20.651  -11.209 23.554  1.00 96.25  ? 411 HOH B O   1 
HETATM 10359 O  O   . HOH S 7 .   ? 50.877  8.711   9.392   1.00 77.60  ? 412 HOH B O   1 
HETATM 10360 O  O   . HOH S 7 .   ? 26.571  -9.647  20.530  1.00 79.07  ? 413 HOH B O   1 
HETATM 10361 O  O   . HOH S 7 .   ? 43.683  -21.224 19.071  1.00 74.97  ? 414 HOH B O   1 
HETATM 10362 O  O   . HOH S 7 .   ? 51.902  -17.700 18.286  1.00 87.23  ? 415 HOH B O   1 
HETATM 10363 O  O   . HOH S 7 .   ? 45.315  -23.736 19.505  1.00 94.63  ? 416 HOH B O   1 
HETATM 10364 O  O   . HOH S 7 .   ? 48.356  9.476   8.193   1.00 97.41  ? 417 HOH B O   1 
HETATM 10365 O  O   . HOH S 7 .   ? 50.383  -29.820 14.275  1.00 113.53 ? 418 HOH B O   1 
HETATM 10366 O  O   . HOH S 7 .   ? 57.553  -2.144  20.337  1.00 91.72  ? 419 HOH B O   1 
HETATM 10367 O  O   . HOH S 7 .   ? 52.115  -1.771  12.365  1.00 99.86  ? 420 HOH B O   1 
HETATM 10368 O  O   . HOH S 7 .   ? 41.883  1.634   12.992  1.00 63.59  ? 421 HOH B O   1 
HETATM 10369 O  O   . HOH T 7 .   ? 20.944  50.647  41.561  1.00 108.79 ? 301 HOH D O   1 
HETATM 10370 O  O   . HOH T 7 .   ? 26.895  50.691  63.183  1.00 90.91  ? 302 HOH D O   1 
HETATM 10371 O  O   . HOH T 7 .   ? 24.917  45.332  62.736  1.00 113.09 ? 303 HOH D O   1 
HETATM 10372 O  O   . HOH T 7 .   ? 27.867  58.090  64.743  1.00 99.33  ? 304 HOH D O   1 
HETATM 10373 O  O   . HOH T 7 .   ? 15.532  12.981  21.559  1.00 76.30  ? 305 HOH D O   1 
HETATM 10374 O  O   . HOH T 7 .   ? 20.626  43.608  60.591  1.00 86.53  ? 306 HOH D O   1 
HETATM 10375 O  O   . HOH T 7 .   ? 26.711  16.135  32.989  1.00 109.71 ? 307 HOH D O   1 
HETATM 10376 O  O   . HOH T 7 .   ? 26.035  3.034   27.884  1.00 59.92  ? 308 HOH D O   1 
HETATM 10377 O  O   . HOH T 7 .   ? 21.454  39.969  44.584  1.00 82.16  ? 309 HOH D O   1 
HETATM 10378 O  O   . HOH T 7 .   ? 31.489  10.790  27.490  1.00 145.79 ? 310 HOH D O   1 
HETATM 10379 O  O   . HOH T 7 .   ? 25.441  20.007  32.129  1.00 90.39  ? 311 HOH D O   1 
HETATM 10380 O  O   . HOH T 7 .   ? 10.704  16.381  38.734  1.00 98.03  ? 312 HOH D O   1 
HETATM 10381 O  O   . HOH T 7 .   ? -2.630  36.083  32.605  1.00 127.62 ? 313 HOH D O   1 
HETATM 10382 O  O   . HOH T 7 .   ? 17.528  58.479  46.270  1.00 110.12 ? 314 HOH D O   1 
HETATM 10383 O  O   . HOH T 7 .   ? 20.858  45.112  62.951  1.00 86.93  ? 315 HOH D O   1 
HETATM 10384 O  O   . HOH T 7 .   ? 25.860  46.485  59.574  1.00 108.58 ? 316 HOH D O   1 
HETATM 10385 O  O   . HOH T 7 .   ? 23.746  7.718   24.076  1.00 75.19  ? 317 HOH D O   1 
HETATM 10386 O  O   . HOH T 7 .   ? 23.512  42.799  51.056  1.00 96.64  ? 318 HOH D O   1 
HETATM 10387 O  O   . HOH T 7 .   ? 12.212  46.973  30.249  1.00 87.54  ? 319 HOH D O   1 
HETATM 10388 O  O   . HOH T 7 .   ? 23.173  19.140  33.483  1.00 86.55  ? 320 HOH D O   1 
HETATM 10389 O  O   . HOH T 7 .   ? 11.538  4.972   33.856  1.00 62.73  ? 321 HOH D O   1 
HETATM 10390 O  O   . HOH T 7 .   ? 4.586   44.927  46.909  1.00 96.84  ? 322 HOH D O   1 
HETATM 10391 O  O   . HOH T 7 .   ? 15.433  1.669   30.322  1.00 82.13  ? 323 HOH D O   1 
HETATM 10392 O  O   . HOH U 7 .   ? 35.783  22.804  59.585  1.00 79.39  ? 301 HOH E O   1 
HETATM 10393 O  O   . HOH U 7 .   ? 34.343  25.369  48.295  1.00 115.82 ? 302 HOH E O   1 
HETATM 10394 O  O   . HOH U 7 .   ? 37.392  5.128   37.739  1.00 71.73  ? 303 HOH E O   1 
HETATM 10395 O  O   . HOH U 7 .   ? 26.918  1.655   32.226  1.00 62.98  ? 304 HOH E O   1 
HETATM 10396 O  O   . HOH U 7 .   ? 27.101  3.131   46.055  1.00 62.00  ? 305 HOH E O   1 
HETATM 10397 O  O   . HOH U 7 .   ? 19.451  2.148   31.863  1.00 63.10  ? 306 HOH E O   1 
HETATM 10398 O  O   . HOH U 7 .   ? 20.850  -1.759  41.798  1.00 56.57  ? 307 HOH E O   1 
HETATM 10399 O  O   . HOH U 7 .   ? 29.567  -6.181  46.417  1.00 79.44  ? 308 HOH E O   1 
HETATM 10400 O  O   . HOH U 7 .   ? 31.437  19.105  40.914  1.00 74.34  ? 309 HOH E O   1 
HETATM 10401 O  O   . HOH U 7 .   ? 17.626  15.356  52.438  1.00 75.00  ? 310 HOH E O   1 
HETATM 10402 O  O   . HOH U 7 .   ? 21.126  9.360   49.916  1.00 60.60  ? 311 HOH E O   1 
HETATM 10403 O  O   . HOH U 7 .   ? 13.115  38.365  50.481  1.00 99.67  ? 312 HOH E O   1 
HETATM 10404 O  O   . HOH U 7 .   ? 15.478  24.968  61.569  1.00 75.89  ? 313 HOH E O   1 
HETATM 10405 O  O   . HOH U 7 .   ? -6.572  50.040  58.266  1.00 101.87 ? 314 HOH E O   1 
HETATM 10406 O  O   . HOH U 7 .   ? 34.352  7.289   34.496  1.00 86.04  ? 315 HOH E O   1 
HETATM 10407 O  O   . HOH U 7 .   ? 36.504  -1.113  39.711  1.00 97.39  ? 316 HOH E O   1 
HETATM 10408 O  O   . HOH U 7 .   ? 28.333  14.454  34.391  1.00 71.21  ? 317 HOH E O   1 
HETATM 10409 O  O   . HOH U 7 .   ? 14.808  17.220  44.661  1.00 63.78  ? 318 HOH E O   1 
HETATM 10410 O  O   . HOH U 7 .   ? 3.471   51.989  57.929  1.00 83.25  ? 319 HOH E O   1 
HETATM 10411 O  O   . HOH U 7 .   ? -0.388  34.994  65.572  1.00 83.47  ? 320 HOH E O   1 
HETATM 10412 O  O   . HOH U 7 .   ? 12.443  42.512  65.941  1.00 96.57  ? 321 HOH E O   1 
HETATM 10413 O  O   . HOH U 7 .   ? 14.206  42.956  67.811  1.00 92.31  ? 322 HOH E O   1 
HETATM 10414 O  O   . HOH U 7 .   ? 20.759  19.316  54.395  1.00 76.94  ? 323 HOH E O   1 
HETATM 10415 O  O   . HOH U 7 .   ? 17.265  12.748  51.751  1.00 75.26  ? 324 HOH E O   1 
HETATM 10416 O  O   . HOH U 7 .   ? 17.293  9.710   57.511  1.00 106.12 ? 325 HOH E O   1 
HETATM 10417 O  O   . HOH U 7 .   ? 22.127  10.890  54.420  1.00 77.16  ? 326 HOH E O   1 
HETATM 10418 O  O   . HOH U 7 .   ? 12.191  9.282   43.610  1.00 92.48  ? 327 HOH E O   1 
HETATM 10419 O  O   . HOH U 7 .   ? 12.147  5.884   43.901  1.00 66.41  ? 328 HOH E O   1 
HETATM 10420 O  O   . HOH U 7 .   ? 31.068  4.133   50.314  1.00 66.72  ? 329 HOH E O   1 
HETATM 10421 O  O   . HOH U 7 .   ? 31.242  -2.758  47.420  1.00 102.14 ? 330 HOH E O   1 
HETATM 10422 O  O   . HOH U 7 .   ? 33.238  -1.695  45.649  1.00 85.03  ? 331 HOH E O   1 
HETATM 10423 O  O   . HOH U 7 .   ? 36.782  -1.330  42.625  1.00 104.16 ? 332 HOH E O   1 
HETATM 10424 O  O   . HOH U 7 .   ? 35.128  2.175   44.570  1.00 69.16  ? 333 HOH E O   1 
HETATM 10425 O  O   . HOH U 7 .   ? 19.070  -9.715  39.271  1.00 67.94  ? 334 HOH E O   1 
HETATM 10426 O  O   . HOH U 7 .   ? 11.401  7.329   46.518  1.00 63.06  ? 335 HOH E O   1 
HETATM 10427 O  O   . HOH U 7 .   ? 16.004  1.110   25.256  1.00 76.43  ? 336 HOH E O   1 
HETATM 10428 O  O   . HOH U 7 .   ? 34.369  0.604   46.885  1.00 69.18  ? 337 HOH E O   1 
HETATM 10429 O  O   . HOH U 7 .   ? -5.315  34.631  54.454  1.00 77.53  ? 338 HOH E O   1 
HETATM 10430 O  O   . HOH U 7 .   ? 21.211  24.808  55.913  1.00 94.44  ? 339 HOH E O   1 
HETATM 10431 O  O   . HOH U 7 .   ? 24.108  -5.532  38.227  1.00 103.38 ? 340 HOH E O   1 
HETATM 10432 O  O   . HOH U 7 .   ? 4.980   41.924  68.305  1.00 84.87  ? 341 HOH E O   1 
HETATM 10433 O  O   . HOH U 7 .   ? 25.352  9.159   57.872  1.00 61.02  ? 342 HOH E O   1 
HETATM 10434 O  O   . HOH U 7 .   ? 23.472  16.712  60.998  1.00 84.79  ? 343 HOH E O   1 
HETATM 10435 O  O   . HOH U 7 .   ? 30.848  -7.133  44.391  1.00 102.76 ? 344 HOH E O   1 
HETATM 10436 O  O   . HOH U 7 .   ? 35.321  11.300  34.040  1.00 83.86  ? 345 HOH E O   1 
HETATM 10437 O  O   . HOH U 7 .   ? 13.044  0.647   32.856  1.00 89.68  ? 346 HOH E O   1 
HETATM 10438 O  O   . HOH U 7 .   ? 1.458   47.771  49.140  1.00 83.18  ? 347 HOH E O   1 
HETATM 10439 O  O   . HOH U 7 .   ? 19.973  41.784  62.351  1.00 101.02 ? 348 HOH E O   1 
HETATM 10440 O  O   . HOH U 7 .   ? 19.935  -8.437  35.730  1.00 83.76  ? 349 HOH E O   1 
HETATM 10441 O  O   . HOH U 7 .   ? 22.696  -10.020 38.750  1.00 65.67  ? 350 HOH E O   1 
HETATM 10442 O  O   . HOH U 7 .   ? 37.761  -0.366  34.860  1.00 87.52  ? 351 HOH E O   1 
HETATM 10443 O  O   . HOH V 7 .   ? 35.680  -43.440 41.018  1.00 65.32  ? 301 HOH F O   1 
HETATM 10444 O  O   . HOH V 7 .   ? 35.979  -31.293 41.537  1.00 71.60  ? 302 HOH F O   1 
HETATM 10445 O  O   . HOH V 7 .   ? 12.141  -32.201 44.023  1.00 60.56  ? 303 HOH F O   1 
HETATM 10446 O  O   . HOH V 7 .   ? 23.022  -23.825 45.384  1.00 61.25  ? 304 HOH F O   1 
HETATM 10447 O  O   . HOH V 7 .   ? 41.124  -23.078 36.382  1.00 98.62  ? 305 HOH F O   1 
HETATM 10448 O  O   . HOH V 7 .   ? 30.642  -29.218 26.309  1.00 88.27  ? 306 HOH F O   1 
HETATM 10449 O  O   . HOH V 7 .   ? 35.316  -38.541 29.061  1.00 75.23  ? 307 HOH F O   1 
HETATM 10450 O  O   . HOH V 7 .   ? 28.416  -43.540 35.216  1.00 76.24  ? 308 HOH F O   1 
HETATM 10451 O  O   . HOH V 7 .   ? 25.023  -45.582 38.024  1.00 77.45  ? 309 HOH F O   1 
HETATM 10452 O  O   . HOH V 7 .   ? 39.058  -25.719 38.809  1.00 63.13  ? 310 HOH F O   1 
HETATM 10453 O  O   . HOH V 7 .   ? 31.841  -24.365 34.288  1.00 64.94  ? 311 HOH F O   1 
HETATM 10454 O  O   . HOH V 7 .   ? 29.360  -21.457 31.377  1.00 92.30  ? 312 HOH F O   1 
HETATM 10455 O  O   . HOH V 7 .   ? 18.422  -34.757 46.475  1.00 71.67  ? 313 HOH F O   1 
HETATM 10456 O  O   . HOH V 7 .   ? 14.717  -32.157 45.339  1.00 106.90 ? 314 HOH F O   1 
HETATM 10457 O  O   . HOH V 7 .   ? 16.770  -30.537 45.163  1.00 97.50  ? 315 HOH F O   1 
HETATM 10458 O  O   . HOH V 7 .   ? 20.543  -27.230 44.173  1.00 79.82  ? 316 HOH F O   1 
HETATM 10459 O  O   . HOH V 7 .   ? 29.885  -30.149 58.356  1.00 91.05  ? 317 HOH F O   1 
HETATM 10460 O  O   . HOH V 7 .   ? 32.075  -33.370 58.187  1.00 110.51 ? 318 HOH F O   1 
HETATM 10461 O  O   . HOH V 7 .   ? 36.206  -34.722 51.633  1.00 91.40  ? 319 HOH F O   1 
HETATM 10462 O  O   . HOH V 7 .   ? 37.948  -34.405 46.092  1.00 80.01  ? 320 HOH F O   1 
HETATM 10463 O  O   . HOH V 7 .   ? 25.203  -36.858 60.471  1.00 96.63  ? 321 HOH F O   1 
HETATM 10464 O  O   . HOH V 7 .   ? 23.656  -39.727 58.404  1.00 98.93  ? 322 HOH F O   1 
HETATM 10465 O  O   . HOH V 7 .   ? 21.281  -40.793 52.138  1.00 86.99  ? 323 HOH F O   1 
HETATM 10466 O  O   . HOH V 7 .   ? 31.890  -40.356 39.928  1.00 67.18  ? 324 HOH F O   1 
HETATM 10467 O  O   . HOH V 7 .   ? 25.724  -54.145 59.072  1.00 103.15 ? 325 HOH F O   1 
HETATM 10468 O  O   . HOH V 7 .   ? 12.840  -52.742 55.085  1.00 86.00  ? 326 HOH F O   1 
HETATM 10469 O  O   . HOH V 7 .   ? 33.359  -26.347 33.391  1.00 79.20  ? 327 HOH F O   1 
HETATM 10470 O  O   . HOH V 7 .   ? 31.961  -19.624 41.287  1.00 61.38  ? 328 HOH F O   1 
HETATM 10471 O  O   . HOH V 7 .   ? 24.242  -38.022 33.660  1.00 65.62  ? 329 HOH F O   1 
HETATM 10472 O  O   . HOH V 7 .   ? 32.965  -43.290 40.192  1.00 72.42  ? 330 HOH F O   1 
HETATM 10473 O  O   . HOH V 7 .   ? 35.934  -33.211 23.523  1.00 87.62  ? 331 HOH F O   1 
HETATM 10474 O  O   . HOH V 7 .   ? 25.185  -22.896 48.045  1.00 129.45 ? 332 HOH F O   1 
HETATM 10475 O  O   . HOH V 7 .   ? 24.895  -34.194 29.394  1.00 79.89  ? 333 HOH F O   1 
HETATM 10476 O  O   . HOH W 7 .   ? -6.856  -55.903 59.863  1.00 91.31  ? 401 HOH G O   1 
HETATM 10477 O  O   . HOH W 7 .   ? -7.718  -59.032 64.780  1.00 113.56 ? 402 HOH G O   1 
HETATM 10478 O  O   . HOH W 7 .   ? -8.583  -64.727 66.792  1.00 72.49  ? 403 HOH G O   1 
HETATM 10479 O  O   . HOH W 7 .   ? 3.284   -29.883 34.359  1.00 87.36  ? 404 HOH G O   1 
HETATM 10480 O  O   . HOH W 7 .   ? -4.032  -42.065 41.220  1.00 90.92  ? 405 HOH G O   1 
HETATM 10481 O  O   . HOH W 7 .   ? -7.495  -51.965 58.692  1.00 78.39  ? 406 HOH G O   1 
HETATM 10482 O  O   . HOH W 7 .   ? 0.200   -29.150 28.513  1.00 97.64  ? 407 HOH G O   1 
HETATM 10483 O  O   . HOH W 7 .   ? 7.630   -27.994 34.923  1.00 50.67  ? 408 HOH G O   1 
HETATM 10484 O  O   . HOH W 7 .   ? 25.354  -20.452 37.617  1.00 74.00  ? 409 HOH G O   1 
HETATM 10485 O  O   . HOH W 7 .   ? 11.833  -16.478 23.302  1.00 66.71  ? 410 HOH G O   1 
HETATM 10486 O  O   . HOH W 7 .   ? 12.428  -20.925 20.880  1.00 88.18  ? 411 HOH G O   1 
HETATM 10487 O  O   . HOH W 7 .   ? 26.505  -16.269 37.147  1.00 64.82  ? 412 HOH G O   1 
HETATM 10488 O  O   . HOH W 7 .   ? 10.639  -12.987 40.190  1.00 91.95  ? 413 HOH G O   1 
HETATM 10489 O  O   . HOH W 7 .   ? 15.554  -16.850 36.002  1.00 52.71  ? 414 HOH G O   1 
HETATM 10490 O  O   . HOH W 7 .   ? 20.117  -23.197 19.673  1.00 108.39 ? 415 HOH G O   1 
HETATM 10491 O  O   . HOH W 7 .   ? 14.368  -17.438 20.639  1.00 92.00  ? 416 HOH G O   1 
HETATM 10492 O  O   . HOH W 7 .   ? 17.666  -8.560  33.456  1.00 73.59  ? 417 HOH G O   1 
HETATM 10493 O  O   . HOH W 7 .   ? 12.592  -36.195 40.733  1.00 80.68  ? 418 HOH G O   1 
HETATM 10494 O  O   . HOH W 7 .   ? 13.852  -29.046 44.278  1.00 58.67  ? 419 HOH G O   1 
HETATM 10495 O  O   . HOH W 7 .   ? 7.930   -27.715 44.388  1.00 68.59  ? 420 HOH G O   1 
HETATM 10496 O  O   . HOH W 7 .   ? 17.666  -26.339 43.911  1.00 76.39  ? 421 HOH G O   1 
HETATM 10497 O  O   . HOH W 7 .   ? 5.386   -31.164 39.675  1.00 68.08  ? 422 HOH G O   1 
HETATM 10498 O  O   . HOH W 7 .   ? 17.768  -39.227 30.496  1.00 78.46  ? 423 HOH G O   1 
HETATM 10499 O  O   . HOH W 7 .   ? 9.997   -16.329 26.040  1.00 96.53  ? 424 HOH G O   1 
HETATM 10500 O  O   . HOH W 7 .   ? 17.146  -20.472 19.420  1.00 92.76  ? 425 HOH G O   1 
HETATM 10501 O  O   . HOH W 7 .   ? 23.741  -26.132 22.408  1.00 111.39 ? 426 HOH G O   1 
HETATM 10502 O  O   . HOH W 7 .   ? 0.311   -49.884 57.164  1.00 82.42  ? 427 HOH G O   1 
HETATM 10503 O  O   . HOH W 7 .   ? -7.545  -53.045 54.710  1.00 128.14 ? 428 HOH G O   1 
HETATM 10504 O  O   . HOH W 7 .   ? 18.986  -13.157 32.343  1.00 74.34  ? 429 HOH G O   1 
HETATM 10505 O  O   . HOH W 7 .   ? 11.467  -21.328 29.330  1.00 69.77  ? 430 HOH G O   1 
HETATM 10506 O  O   . HOH W 7 .   ? 14.219  -24.477 44.553  1.00 59.89  ? 431 HOH G O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1     N N   . ARG A 28  ? 2.1236 2.4323 1.9017 0.1061  0.7008  0.4150  28  ARG A N   
2     C CA  . ARG A 28  ? 2.3051 2.5248 2.0641 0.0694  0.7800  0.4315  28  ARG A CA  
3     C C   . ARG A 28  ? 2.4439 2.5904 2.2106 0.0216  0.8015  0.4127  28  ARG A C   
4     O O   . ARG A 28  ? 2.6863 2.8005 2.4489 0.0486  0.7853  0.4191  28  ARG A O   
5     C CB  . ARG A 28  ? 2.4120 2.5784 2.1308 0.1283  0.8257  0.4841  28  ARG A CB  
6     C CG  . ARG A 28  ? 2.4643 2.6947 2.1697 0.1749  0.8186  0.5078  28  ARG A CG  
7     C CD  . ARG A 28  ? 2.6199 2.7899 2.2823 0.2276  0.8787  0.5630  28  ARG A CD  
8     N NE  . ARG A 28  ? 2.7145 2.9121 2.3625 0.2402  0.9071  0.5847  28  ARG A NE  
9     C CZ  . ARG A 28  ? 2.9688 3.1088 2.5788 0.2745  0.9740  0.6334  28  ARG A CZ  
10    N NH1 . ARG A 28  ? 3.0643 3.1157 2.6455 0.3024  1.0203  0.6667  28  ARG A NH1 
11    N NH2 . ARG A 28  ? 3.0850 3.2556 2.6844 0.2838  0.9971  0.6510  28  ARG A NH2 
12    N N   . SER A 29  ? 2.5321 2.6538 2.3089 -0.0497 0.8419  0.3890  29  SER A N   
13    C CA  . SER A 29  ? 2.5467 2.5981 2.3298 -0.1023 0.8706  0.3676  29  SER A CA  
14    C C   . SER A 29  ? 2.6177 2.5534 2.3668 -0.0741 0.9259  0.4048  29  SER A C   
15    O O   . SER A 29  ? 2.5682 2.4572 2.3196 -0.0805 0.9221  0.3969  29  SER A O   
16    C CB  . SER A 29  ? 2.5408 2.5920 2.3381 -0.1851 0.9137  0.3347  29  SER A CB  
17    O OG  . SER A 29  ? 2.4130 2.5696 2.2456 -0.2176 0.8585  0.2930  29  SER A OG  
18    N N   . THR A 30  ? 2.6667 2.5571 2.3828 -0.0404 0.9793  0.4471  30  THR A N   
19    C CA  . THR A 30  ? 2.6894 2.4745 2.3674 0.0002  1.0349  0.4910  30  THR A CA  
20    C C   . THR A 30  ? 2.5844 2.3906 2.2584 0.0666  0.9818  0.5070  30  THR A C   
21    O O   . THR A 30  ? 2.5482 2.2843 2.2115 0.0721  1.0000  0.5145  30  THR A O   
22    C CB  . THR A 30  ? 2.7560 2.5054 2.3969 0.0405  1.0956  0.5402  30  THR A CB  
23    O OG1 . THR A 30  ? 2.8055 2.4635 2.4068 0.0945  1.1441  0.5881  30  THR A OG1 
24    C CG2 . THR A 30  ? 2.6656 2.5227 2.3088 0.0958  1.0423  0.5542  30  THR A CG2 
25    N N   . THR A 31  ? 2.5132 2.4197 2.1974 0.1135  0.9163  0.5084  31  THR A N   
26    C CA  . THR A 31  ? 2.4676 2.4088 2.1491 0.1769  0.8658  0.5205  31  THR A CA  
27    C C   . THR A 31  ? 2.4550 2.4044 2.1671 0.1446  0.8185  0.4810  31  THR A C   
28    O O   . THR A 31  ? 2.4861 2.4090 2.1910 0.1756  0.8087  0.4914  31  THR A O   
29    C CB  . THR A 31  ? 2.3396 2.3911 2.0276 0.2268  0.8086  0.5232  31  THR A CB  
30    O OG1 . THR A 31  ? 2.3328 2.4575 2.0576 0.1833  0.7580  0.4785  31  THR A OG1 
31    C CG2 . THR A 31  ? 2.3811 2.4329 2.0387 0.2626  0.8526  0.5633  31  THR A CG2 
32    N N   . LEU A 32  ? 2.3971 2.3888 2.1428 0.0852  0.7897  0.4370  32  LEU A N   
33    C CA  . LEU A 32  ? 2.2616 2.2650 2.0363 0.0538  0.7470  0.4000  32  LEU A CA  
34    C C   . LEU A 32  ? 2.2569 2.1600 2.0220 0.0228  0.7936  0.4004  32  LEU A C   
35    O O   . LEU A 32  ? 2.2616 2.1545 2.0370 0.0267  0.7654  0.3892  32  LEU A O   
36    C CB  . LEU A 32  ? 2.2272 2.3002 2.0361 -0.0004 0.7140  0.3566  32  LEU A CB  
37    C CG  . LEU A 32  ? 2.2050 2.3816 2.0292 0.0320  0.6530  0.3485  32  LEU A CG  
38    C CD1 . LEU A 32  ? 2.2375 2.4796 2.0927 -0.0190 0.6257  0.3086  32  LEU A CD1 
39    C CD2 . LEU A 32  ? 2.1290 2.3332 1.9587 0.0830  0.5994  0.3497  32  LEU A CD2 
40    N N   . LEU A 33  ? 2.3249 2.1516 2.0698 -0.0086 0.8676  0.4125  33  LEU A N   
41    C CA  . LEU A 33  ? 2.4769 2.1950 2.2060 -0.0332 0.9240  0.4175  33  LEU A CA  
42    C C   . LEU A 33  ? 2.5585 2.2304 2.2580 0.0390  0.9316  0.4607  33  LEU A C   
43    O O   . LEU A 33  ? 2.6058 2.2266 2.3036 0.0363  0.9352  0.4576  33  LEU A O   
44    C CB  . LEU A 33  ? 2.6049 2.2465 2.3143 -0.0761 1.0099  0.4247  33  LEU A CB  
45    C CG  . LEU A 33  ? 2.6961 2.2362 2.4010 -0.1358 1.0698  0.4065  33  LEU A CG  
46    C CD1 . LEU A 33  ? 2.7814 2.2683 2.4757 -0.1913 1.1489  0.4007  33  LEU A CD1 
47    C CD2 . LEU A 33  ? 2.7334 2.1778 2.4061 -0.0882 1.1026  0.4440  33  LEU A CD2 
48    N N   . ALA A 34  ? 2.5216 2.2177 2.1969 0.1049  0.9352  0.5011  34  ALA A N   
49    C CA  . ALA A 34  ? 2.4701 2.1539 2.1184 0.1830  0.9332  0.5422  34  ALA A CA  
50    C C   . ALA A 34  ? 2.3991 2.1500 2.0742 0.2004  0.8552  0.5182  34  ALA A C   
51    O O   . ALA A 34  ? 2.4008 2.1150 2.0664 0.2250  0.8569  0.5297  34  ALA A O   
52    C CB  . ALA A 34  ? 2.4249 2.1525 2.0479 0.2491  0.9403  0.5830  34  ALA A CB  
53    N N   . LEU A 35  ? 2.2968 2.1435 2.0051 0.1868  0.7900  0.4847  35  LEU A N   
54    C CA  . LEU A 35  ? 2.1468 2.0579 1.8821 0.2007  0.7181  0.4593  35  LEU A CA  
55    C C   . LEU A 35  ? 2.0833 1.9456 1.8364 0.1542  0.7144  0.4321  35  LEU A C   
56    O O   . LEU A 35  ? 2.0384 1.9003 1.7947 0.1794  0.6893  0.4324  35  LEU A O   
57    C CB  . LEU A 35  ? 2.0347 2.0450 1.8001 0.1895  0.6597  0.4282  35  LEU A CB  
58    C CG  . LEU A 35  ? 1.9463 2.0389 1.7273 0.2334  0.5929  0.4167  35  LEU A CG  
59    C CD1 . LEU A 35  ? 1.9494 2.0518 1.7014 0.3057  0.6022  0.4546  35  LEU A CD1 
60    C CD2 . LEU A 35  ? 1.8581 2.0374 1.6597 0.2287  0.5505  0.3938  35  LEU A CD2 
61    N N   . LEU A 36  ? 2.0918 1.9186 1.8567 0.0861  0.7406  0.4074  36  LEU A N   
62    C CA  . LEU A 36  ? 2.1402 1.9147 1.9178 0.0385  0.7486  0.3827  36  LEU A CA  
63    C C   . LEU A 36  ? 2.2589 1.9457 2.0072 0.0692  0.7897  0.4140  36  LEU A C   
64    O O   . LEU A 36  ? 2.2003 1.8772 1.9582 0.0730  0.7654  0.4044  36  LEU A O   
65    C CB  . LEU A 36  ? 2.1822 1.9236 1.9670 -0.0366 0.7913  0.3575  36  LEU A CB  
66    C CG  . LEU A 36  ? 2.2095 1.8867 2.0015 -0.0884 0.8145  0.3335  36  LEU A CG  
67    C CD1 . LEU A 36  ? 2.0870 1.8289 1.9150 -0.1056 0.7474  0.2970  36  LEU A CD1 
68    C CD2 . LEU A 36  ? 2.2577 1.8928 2.0486 -0.1594 0.8742  0.3128  36  LEU A CD2 
69    N N   . ALA A 37  ? 2.3824 2.0036 2.0936 0.0919  0.8556  0.4530  37  ALA A N   
70    C CA  . ALA A 37  ? 2.4420 1.9709 2.1194 0.1237  0.9067  0.4879  37  ALA A CA  
71    C C   . ALA A 37  ? 2.3708 1.9465 2.0418 0.1976  0.8641  0.5106  37  ALA A C   
72    O O   . ALA A 37  ? 2.3628 1.8944 2.0248 0.2136  0.8719  0.5196  37  ALA A O   
73    C CB  . ALA A 37  ? 2.5328 1.9857 2.1694 0.1398  0.9891  0.5291  37  ALA A CB  
74    N N   . LEU A 38  ? 2.2776 1.9479 1.9541 0.2409  0.8193  0.5170  38  LEU A N   
75    C CA  . LEU A 38  ? 2.2195 1.9544 1.8948 0.3059  0.7742  0.5298  38  LEU A CA  
76    C C   . LEU A 38  ? 2.0347 1.7964 1.7449 0.2805  0.7182  0.4909  38  LEU A C   
77    O O   . LEU A 38  ? 2.0550 1.7903 1.7576 0.3032  0.7197  0.5008  38  LEU A O   
78    C CB  . LEU A 38  ? 2.2097 2.0486 1.8900 0.3445  0.7342  0.5325  38  LEU A CB  
79    C CG  . LEU A 38  ? 2.1819 2.1057 1.8638 0.4081  0.6858  0.5384  38  LEU A CG  
80    C CD1 . LEU A 38  ? 2.2605 2.1472 1.9023 0.4705  0.7288  0.5869  38  LEU A CD1 
81    C CD2 . LEU A 38  ? 2.1142 2.1399 1.8020 0.4384  0.6497  0.5350  38  LEU A CD2 
82    N N   . VAL A 39  ? 1.8942 1.7084 1.6413 0.2353  0.6713  0.4483  39  VAL A N   
83    C CA  . VAL A 39  ? 1.8283 1.6625 1.6087 0.2063  0.6235  0.4112  39  VAL A CA  
84    C C   . VAL A 39  ? 1.8737 1.6175 1.6457 0.1821  0.6592  0.4136  39  VAL A C   
85    O O   . VAL A 39  ? 1.8360 1.5788 1.6116 0.2032  0.6394  0.4138  39  VAL A O   
86    C CB  . VAL A 39  ? 1.7898 1.6664 1.6040 0.1509  0.5913  0.3702  39  VAL A CB  
87    C CG1 . VAL A 39  ? 1.7778 1.6424 1.6197 0.1079  0.5665  0.3364  39  VAL A CG1 
88    C CG2 . VAL A 39  ? 1.7488 1.7233 1.5784 0.1794  0.5394  0.3600  39  VAL A CG2 
89    N N   . LEU A 40  ? 1.9446 1.6139 1.7056 0.1362  0.7138  0.4134  40  LEU A N   
90    C CA  . LEU A 40  ? 2.0079 1.5834 1.7581 0.1088  0.7564  0.4137  40  LEU A CA  
91    C C   . LEU A 40  ? 2.0639 1.6035 1.7860 0.1702  0.7733  0.4513  40  LEU A C   
92    O O   . LEU A 40  ? 2.0398 1.5496 1.7674 0.1639  0.7666  0.4430  40  LEU A O   
93    C CB  . LEU A 40  ? 2.1013 1.5944 1.8318 0.0651  0.8300  0.4183  40  LEU A CB  
94    C CG  . LEU A 40  ? 2.0974 1.6108 1.8571 -0.0130 0.8243  0.3727  40  LEU A CG  
95    C CD1 . LEU A 40  ? 2.1883 1.6072 1.9277 -0.0619 0.9058  0.3726  40  LEU A CD1 
96    C CD2 . LEU A 40  ? 2.0192 1.5650 1.8131 -0.0470 0.7747  0.3330  40  LEU A CD2 
97    N N   . LEU A 41  ? 2.1506 1.7003 1.8421 0.2321  0.7948  0.4933  41  LEU A N   
98    C CA  . LEU A 41  ? 2.1725 1.7044 1.8337 0.3003  0.8123  0.5338  41  LEU A CA  
99    C C   . LEU A 41  ? 2.0803 1.7033 1.7652 0.3326  0.7415  0.5190  41  LEU A C   
100   O O   . LEU A 41  ? 2.1072 1.7140 1.7819 0.3632  0.7439  0.5329  41  LEU A O   
101   C CB  . LEU A 41  ? 2.2400 1.7736 1.8615 0.3622  0.8534  0.5836  41  LEU A CB  
102   C CG  . LEU A 41  ? 2.3726 1.7937 1.9593 0.3449  0.9420  0.6109  41  LEU A CG  
103   C CD1 . LEU A 41  ? 2.4282 1.8619 1.9760 0.4140  0.9784  0.6632  41  LEU A CD1 
104   C CD2 . LEU A 41  ? 2.4527 1.7599 2.0176 0.3353  0.9971  0.6235  41  LEU A CD2 
105   N N   . TYR A 42  ? 2.0216 1.7397 1.7373 0.3258  0.6818  0.4904  42  TYR A N   
106   C CA  . TYR A 42  ? 1.9437 1.7474 1.6875 0.3441  0.6152  0.4667  42  TYR A CA  
107   C C   . TYR A 42  ? 1.8929 1.6647 1.6626 0.3002  0.5951  0.4356  42  TYR A C   
108   O O   . TYR A 42  ? 1.8002 1.6028 1.5799 0.3229  0.5651  0.4300  42  TYR A O   
109   C CB  . TYR A 42  ? 1.8898 1.7853 1.6613 0.3355  0.5637  0.4382  42  TYR A CB  
110   C CG  . TYR A 42  ? 1.8425 1.8301 1.6369 0.3641  0.5039  0.4175  42  TYR A CG  
111   C CD1 . TYR A 42  ? 1.8664 1.9151 1.6426 0.4295  0.4991  0.4407  42  TYR A CD1 
112   C CD2 . TYR A 42  ? 1.7976 1.8131 1.6312 0.3258  0.4556  0.3741  42  TYR A CD2 
113   C CE1 . TYR A 42  ? 1.8083 1.9461 1.6074 0.4502  0.4472  0.4158  42  TYR A CE1 
114   C CE2 . TYR A 42  ? 1.7375 1.8302 1.5926 0.3476  0.4070  0.3523  42  TYR A CE2 
115   C CZ  . TYR A 42  ? 1.7337 1.8882 1.5725 0.4068  0.4028  0.3707  42  TYR A CZ  
116   O OH  . TYR A 42  ? 1.6768 1.9133 1.5387 0.4230  0.3569  0.3430  42  TYR A OH  
117   N N   . LEU A 43  ? 1.9014 1.6178 1.6823 0.2370  0.6122  0.4143  43  LEU A N   
118   C CA  . LEU A 43  ? 1.8670 1.5512 1.6702 0.1932  0.5989  0.3860  43  LEU A CA  
119   C C   . LEU A 43  ? 1.9269 1.5290 1.7033 0.2087  0.6434  0.4112  43  LEU A C   
120   O O   . LEU A 43  ? 1.9827 1.5900 1.7695 0.2181  0.6202  0.4042  43  LEU A O   
121   C CB  . LEU A 43  ? 1.8780 1.5367 1.6979 0.1230  0.6091  0.3563  43  LEU A CB  
122   C CG  . LEU A 43  ? 1.8280 1.5692 1.6786 0.1023  0.5610  0.3265  43  LEU A CG  
123   C CD1 . LEU A 43  ? 1.8703 1.5916 1.7299 0.0391  0.5829  0.3041  43  LEU A CD1 
124   C CD2 . LEU A 43  ? 1.7426 1.5390 1.6264 0.1022  0.5005  0.2986  43  LEU A CD2 
125   N N   . VAL A 44  ? 1.9986 1.5214 1.7399 0.2111  0.7107  0.4405  44  VAL A N   
126   C CA  . VAL A 44  ? 2.1043 1.5362 1.8162 0.2247  0.7623  0.4658  44  VAL A CA  
127   C C   . VAL A 44  ? 2.1094 1.5810 1.8068 0.2983  0.7455  0.4953  44  VAL A C   
128   O O   . VAL A 44  ? 2.2201 1.6620 1.9150 0.3064  0.7474  0.4978  44  VAL A O   
129   C CB  . VAL A 44  ? 2.2304 1.5668 1.9019 0.2235  0.8454  0.4975  44  VAL A CB  
130   C CG1 . VAL A 44  ? 2.2768 1.5161 1.9137 0.2474  0.9021  0.5279  44  VAL A CG1 
131   C CG2 . VAL A 44  ? 2.2615 1.5621 1.9489 0.1436  0.8659  0.4626  44  VAL A CG2 
132   N N   . SER A 45  ? 2.0477 1.5952 1.7368 0.3513  0.7275  0.5152  45  SER A N   
133   C CA  . SER A 45  ? 2.0271 1.6348 1.7040 0.4225  0.7091  0.5398  45  SER A CA  
134   C C   . SER A 45  ? 1.9106 1.5847 1.6276 0.4090  0.6424  0.5016  45  SER A C   
135   O O   . SER A 45  ? 1.8703 1.5463 1.5820 0.4375  0.6392  0.5112  45  SER A O   
136   C CB  . SER A 45  ? 2.0295 1.7197 1.6926 0.4774  0.7001  0.5624  45  SER A CB  
137   O OG  . SER A 45  ? 2.0265 1.7981 1.7262 0.4494  0.6435  0.5238  45  SER A OG  
138   N N   . GLY A 46  ? 1.8570 1.5820 1.6133 0.3653  0.5925  0.4589  46  GLY A N   
139   C CA  . GLY A 46  ? 1.8101 1.5822 1.6052 0.3443  0.5363  0.4208  46  GLY A CA  
140   C C   . GLY A 46  ? 1.8510 1.5476 1.6485 0.3147  0.5524  0.4147  46  GLY A C   
141   O O   . GLY A 46  ? 1.8371 1.5553 1.6431 0.3331  0.5313  0.4111  46  GLY A O   
142   N N   . ALA A 47  ? 1.9196 1.5317 1.7102 0.2670  0.5909  0.4112  47  ALA A N   
143   C CA  . ALA A 47  ? 1.9462 1.4844 1.7389 0.2325  0.6098  0.4016  47  ALA A CA  
144   C C   . ALA A 47  ? 1.9791 1.4805 1.7418 0.2822  0.6394  0.4363  47  ALA A C   
145   O O   . ALA A 47  ? 1.9757 1.4746 1.7511 0.2794  0.6212  0.4256  47  ALA A O   
146   C CB  . ALA A 47  ? 2.0076 1.4628 1.7900 0.1786  0.6587  0.3954  47  ALA A CB  
147   N N   . LEU A 48  ? 2.0187 1.4949 1.7408 0.3312  0.6861  0.4800  48  LEU A N   
148   C CA  . LEU A 48  ? 2.1114 1.5521 1.7985 0.3869  0.7223  0.5201  48  LEU A CA  
149   C C   . LEU A 48  ? 2.0108 1.5465 1.7151 0.4280  0.6694  0.5153  48  LEU A C   
150   O O   . LEU A 48  ? 2.0583 1.5716 1.7561 0.4443  0.6760  0.5237  48  LEU A O   
151   C CB  . LEU A 48  ? 2.2431 1.6622 1.8837 0.4434  0.7765  0.5709  48  LEU A CB  
152   C CG  . LEU A 48  ? 2.3249 1.6329 1.9386 0.4116  0.8474  0.5847  48  LEU A CG  
153   C CD1 . LEU A 48  ? 2.3744 1.6852 1.9481 0.4708  0.8896  0.6329  48  LEU A CD1 
154   C CD2 . LEU A 48  ? 2.3979 1.5864 1.9891 0.3945  0.9042  0.5945  48  LEU A CD2 
155   N N   . VAL A 49  ? 1.8804 1.5236 1.6071 0.4429  0.6186  0.4994  49  VAL A N   
156   C CA  . VAL A 49  ? 1.8073 1.5535 1.5505 0.4820  0.5712  0.4914  49  VAL A CA  
157   C C   . VAL A 49  ? 1.7563 1.5120 1.5411 0.4367  0.5268  0.4486  49  VAL A C   
158   O O   . VAL A 49  ? 1.6600 1.4354 1.4473 0.4588  0.5167  0.4509  49  VAL A O   
159   C CB  . VAL A 49  ? 1.7243 1.5810 1.4809 0.5041  0.5326  0.4804  49  VAL A CB  
160   C CG1 . VAL A 49  ? 1.6753 1.6452 1.4539 0.5347  0.4832  0.4621  49  VAL A CG1 
161   C CG2 . VAL A 49  ? 1.7635 1.6190 1.4777 0.5556  0.5761  0.5260  49  VAL A CG2 
162   N N   . PHE A 50  ? 1.7601 1.5050 1.5766 0.3757  0.5021  0.4112  50  PHE A N   
163   C CA  . PHE A 50  ? 1.7118 1.4648 1.5668 0.3341