data_4WGK
# 
_entry.id   4WGK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WGK         
WWPDB D_1000203788 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WGK 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Airola, M.V.'         1 
'Pulkoski-Gross, M.J.' 2 
'Obeid, L.M.'          3 
'Hannun, Y.A.'         4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            23 
_citation.language                  ? 
_citation.page_first                1482 
_citation.page_last                 1491 
_citation.title                     'Structural Basis for Ceramide Recognition and Hydrolysis by Human Neutral Ceramidase.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2015.06.013 
_citation.pdbx_database_id_PubMed   26190575 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Airola, M.V.'         1 ? 
primary 'Allen, W.J.'          2 ? 
primary 'Pulkoski-Gross, M.J.' 3 ? 
primary 'Obeid, L.M.'          4 ? 
primary 'Rizzo, R.C.'          5 ? 
primary 'Hannun, Y.A.'         6 ? 
# 
_cell.entry_id           4WGK 
_cell.length_a           73.480 
_cell.length_b           156.630 
_cell.length_c           80.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.04 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4WGK 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Neutral ceramidase' 75980.609 2   3.5.1.23 ? ? ? 
2  branched    syn '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2   ? ? ? ? 
3  branched    syn 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   1   
?        ? ? ? 
4  non-polymer syn 'ZINC ION' 65.409    2   ?        ? ? ? 
5  non-polymer syn 'CALCIUM ION' 40.078    2   ?        ? ? ? 
6  non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   5   ?        ? ? ? 
7  non-polymer syn 'PHOSPHATE ION' 94.971    2   ?        ? ? ? 
8  non-polymer syn 'CITRIC ACID' 192.124   4   ?        ? ? ? 
9  non-polymer syn 'CHLORIDE ION' 35.453    1   ?        ? ? ? 
10 non-polymer syn 1,2-ETHANEDIOL 62.068    2   ?        ? ? ? 
11 water       nat water 18.015    494 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'NCDase, Acylsphingosine deacylase 2, BCDase, LCDase, hCD, N-acylsphingosine amidohydrolase 2, Non-lysosomal ceramidase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FSGYHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSK
YGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRS
PYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQ
GPFVAAFASSNLGDVSPNILGPRCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQE
VTGPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFWDTIRDQILGKPSEEIKEC
HKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTTMSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTH
YITTYEEYQAQRYEAASTIYGPHTLSAYIQLFRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDV
LQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIP
DTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTIHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FSGYHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSK
YGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRS
PYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQ
GPFVAAFASSNLGDVSPNILGPRCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQE
VTGPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFWDTIRDQILGKPSEEIKEC
HKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTTMSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTH
YITTYEEYQAQRYEAASTIYGPHTLSAYIQLFRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDV
LQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIP
DTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTIHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PHE n 
1 2   SER n 
1 3   GLY n 
1 4   TYR n 
1 5   HIS n 
1 6   ILE n 
1 7   GLY n 
1 8   VAL n 
1 9   GLY n 
1 10  ARG n 
1 11  ALA n 
1 12  ASP n 
1 13  CYS n 
1 14  THR n 
1 15  GLY n 
1 16  GLN n 
1 17  VAL n 
1 18  ALA n 
1 19  ASP n 
1 20  ILE n 
1 21  ASN n 
1 22  LEU n 
1 23  MET n 
1 24  GLY n 
1 25  TYR n 
1 26  GLY n 
1 27  LYS n 
1 28  SER n 
1 29  GLY n 
1 30  GLN n 
1 31  ASN n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  ILE n 
1 36  LEU n 
1 37  THR n 
1 38  ARG n 
1 39  LEU n 
1 40  TYR n 
1 41  SER n 
1 42  ARG n 
1 43  ALA n 
1 44  PHE n 
1 45  ILE n 
1 46  MET n 
1 47  ALA n 
1 48  GLU n 
1 49  PRO n 
1 50  ASP n 
1 51  GLY n 
1 52  SER n 
1 53  ASN n 
1 54  ARG n 
1 55  THR n 
1 56  VAL n 
1 57  PHE n 
1 58  VAL n 
1 59  SER n 
1 60  ILE n 
1 61  ASP n 
1 62  ILE n 
1 63  GLY n 
1 64  MET n 
1 65  VAL n 
1 66  SER n 
1 67  GLN n 
1 68  ARG n 
1 69  LEU n 
1 70  ARG n 
1 71  LEU n 
1 72  GLU n 
1 73  VAL n 
1 74  LEU n 
1 75  ASN n 
1 76  ARG n 
1 77  LEU n 
1 78  GLN n 
1 79  SER n 
1 80  LYS n 
1 81  TYR n 
1 82  GLY n 
1 83  SER n 
1 84  LEU n 
1 85  TYR n 
1 86  ARG n 
1 87  ARG n 
1 88  ASP n 
1 89  ASN n 
1 90  VAL n 
1 91  ILE n 
1 92  LEU n 
1 93  SER n 
1 94  GLY n 
1 95  THR n 
1 96  HIS n 
1 97  THR n 
1 98  HIS n 
1 99  SER n 
1 100 GLY n 
1 101 PRO n 
1 102 ALA n 
1 103 GLY n 
1 104 TYR n 
1 105 PHE n 
1 106 GLN n 
1 107 TYR n 
1 108 THR n 
1 109 VAL n 
1 110 PHE n 
1 111 VAL n 
1 112 ILE n 
1 113 ALA n 
1 114 SER n 
1 115 GLU n 
1 116 GLY n 
1 117 PHE n 
1 118 SER n 
1 119 ASN n 
1 120 GLN n 
1 121 THR n 
1 122 PHE n 
1 123 GLN n 
1 124 HIS n 
1 125 MET n 
1 126 VAL n 
1 127 THR n 
1 128 GLY n 
1 129 ILE n 
1 130 LEU n 
1 131 LYS n 
1 132 SER n 
1 133 ILE n 
1 134 ASP n 
1 135 ILE n 
1 136 ALA n 
1 137 HIS n 
1 138 THR n 
1 139 ASN n 
1 140 MET n 
1 141 LYS n 
1 142 PRO n 
1 143 GLY n 
1 144 LYS n 
1 145 ILE n 
1 146 PHE n 
1 147 ILE n 
1 148 ASN n 
1 149 LYS n 
1 150 GLY n 
1 151 ASN n 
1 152 VAL n 
1 153 ASP n 
1 154 GLY n 
1 155 VAL n 
1 156 GLN n 
1 157 ILE n 
1 158 ASN n 
1 159 ARG n 
1 160 SER n 
1 161 PRO n 
1 162 TYR n 
1 163 SER n 
1 164 TYR n 
1 165 LEU n 
1 166 GLN n 
1 167 ASN n 
1 168 PRO n 
1 169 GLN n 
1 170 SER n 
1 171 GLU n 
1 172 ARG n 
1 173 ALA n 
1 174 ARG n 
1 175 TYR n 
1 176 SER n 
1 177 SER n 
1 178 ASN n 
1 179 THR n 
1 180 ASP n 
1 181 LYS n 
1 182 GLU n 
1 183 MET n 
1 184 ILE n 
1 185 VAL n 
1 186 LEU n 
1 187 LYS n 
1 188 MET n 
1 189 VAL n 
1 190 ASP n 
1 191 LEU n 
1 192 ASN n 
1 193 GLY n 
1 194 ASP n 
1 195 ASP n 
1 196 LEU n 
1 197 GLY n 
1 198 LEU n 
1 199 ILE n 
1 200 SER n 
1 201 TRP n 
1 202 PHE n 
1 203 ALA n 
1 204 ILE n 
1 205 HIS n 
1 206 PRO n 
1 207 VAL n 
1 208 SER n 
1 209 MET n 
1 210 ASN n 
1 211 ASN n 
1 212 SER n 
1 213 ASN n 
1 214 HIS n 
1 215 LEU n 
1 216 VAL n 
1 217 ASN n 
1 218 SER n 
1 219 ASP n 
1 220 ASN n 
1 221 VAL n 
1 222 GLY n 
1 223 TYR n 
1 224 ALA n 
1 225 SER n 
1 226 TYR n 
1 227 LEU n 
1 228 LEU n 
1 229 GLU n 
1 230 GLN n 
1 231 GLU n 
1 232 LYS n 
1 233 ASN n 
1 234 LYS n 
1 235 GLY n 
1 236 TYR n 
1 237 LEU n 
1 238 PRO n 
1 239 GLY n 
1 240 GLN n 
1 241 GLY n 
1 242 PRO n 
1 243 PHE n 
1 244 VAL n 
1 245 ALA n 
1 246 ALA n 
1 247 PHE n 
1 248 ALA n 
1 249 SER n 
1 250 SER n 
1 251 ASN n 
1 252 LEU n 
1 253 GLY n 
1 254 ASP n 
1 255 VAL n 
1 256 SER n 
1 257 PRO n 
1 258 ASN n 
1 259 ILE n 
1 260 LEU n 
1 261 GLY n 
1 262 PRO n 
1 263 ARG n 
1 264 CYS n 
1 265 ILE n 
1 266 ASN n 
1 267 THR n 
1 268 GLY n 
1 269 GLU n 
1 270 SER n 
1 271 CYS n 
1 272 ASP n 
1 273 ASN n 
1 274 ALA n 
1 275 ASN n 
1 276 SER n 
1 277 THR n 
1 278 CYS n 
1 279 PRO n 
1 280 ILE n 
1 281 GLY n 
1 282 GLY n 
1 283 PRO n 
1 284 SER n 
1 285 MET n 
1 286 CYS n 
1 287 ILE n 
1 288 ALA n 
1 289 LYS n 
1 290 GLY n 
1 291 PRO n 
1 292 GLY n 
1 293 GLN n 
1 294 ASP n 
1 295 MET n 
1 296 PHE n 
1 297 ASP n 
1 298 SER n 
1 299 THR n 
1 300 GLN n 
1 301 ILE n 
1 302 ILE n 
1 303 GLY n 
1 304 ARG n 
1 305 ALA n 
1 306 MET n 
1 307 TYR n 
1 308 GLN n 
1 309 ARG n 
1 310 ALA n 
1 311 LYS n 
1 312 GLU n 
1 313 LEU n 
1 314 TYR n 
1 315 ALA n 
1 316 SER n 
1 317 ALA n 
1 318 SER n 
1 319 GLN n 
1 320 GLU n 
1 321 VAL n 
1 322 THR n 
1 323 GLY n 
1 324 PRO n 
1 325 LEU n 
1 326 ALA n 
1 327 SER n 
1 328 ALA n 
1 329 HIS n 
1 330 GLN n 
1 331 TRP n 
1 332 VAL n 
1 333 ASP n 
1 334 MET n 
1 335 THR n 
1 336 ASP n 
1 337 VAL n 
1 338 THR n 
1 339 VAL n 
1 340 TRP n 
1 341 LEU n 
1 342 ASN n 
1 343 SER n 
1 344 THR n 
1 345 HIS n 
1 346 ALA n 
1 347 SER n 
1 348 LYS n 
1 349 THR n 
1 350 CYS n 
1 351 LYS n 
1 352 PRO n 
1 353 ALA n 
1 354 LEU n 
1 355 GLY n 
1 356 TYR n 
1 357 SER n 
1 358 PHE n 
1 359 ALA n 
1 360 ALA n 
1 361 GLY n 
1 362 THR n 
1 363 ILE n 
1 364 ASP n 
1 365 GLY n 
1 366 VAL n 
1 367 GLY n 
1 368 GLY n 
1 369 LEU n 
1 370 ASN n 
1 371 PHE n 
1 372 THR n 
1 373 GLN n 
1 374 GLY n 
1 375 LYS n 
1 376 THR n 
1 377 GLU n 
1 378 GLY n 
1 379 ASP n 
1 380 PRO n 
1 381 PHE n 
1 382 TRP n 
1 383 ASP n 
1 384 THR n 
1 385 ILE n 
1 386 ARG n 
1 387 ASP n 
1 388 GLN n 
1 389 ILE n 
1 390 LEU n 
1 391 GLY n 
1 392 LYS n 
1 393 PRO n 
1 394 SER n 
1 395 GLU n 
1 396 GLU n 
1 397 ILE n 
1 398 LYS n 
1 399 GLU n 
1 400 CYS n 
1 401 HIS n 
1 402 LYS n 
1 403 PRO n 
1 404 LYS n 
1 405 PRO n 
1 406 ILE n 
1 407 LEU n 
1 408 LEU n 
1 409 HIS n 
1 410 THR n 
1 411 GLY n 
1 412 GLU n 
1 413 LEU n 
1 414 SER n 
1 415 LYS n 
1 416 PRO n 
1 417 HIS n 
1 418 PRO n 
1 419 TRP n 
1 420 HIS n 
1 421 PRO n 
1 422 ASP n 
1 423 ILE n 
1 424 VAL n 
1 425 ASP n 
1 426 VAL n 
1 427 GLN n 
1 428 ILE n 
1 429 ILE n 
1 430 THR n 
1 431 LEU n 
1 432 GLY n 
1 433 SER n 
1 434 LEU n 
1 435 ALA n 
1 436 ILE n 
1 437 THR n 
1 438 ALA n 
1 439 ILE n 
1 440 PRO n 
1 441 GLY n 
1 442 GLU n 
1 443 PHE n 
1 444 THR n 
1 445 THR n 
1 446 MET n 
1 447 SER n 
1 448 GLY n 
1 449 ARG n 
1 450 ARG n 
1 451 LEU n 
1 452 ARG n 
1 453 GLU n 
1 454 ALA n 
1 455 VAL n 
1 456 GLN n 
1 457 ALA n 
1 458 GLU n 
1 459 PHE n 
1 460 ALA n 
1 461 SER n 
1 462 HIS n 
1 463 GLY n 
1 464 MET n 
1 465 GLN n 
1 466 ASN n 
1 467 MET n 
1 468 THR n 
1 469 VAL n 
1 470 VAL n 
1 471 ILE n 
1 472 SER n 
1 473 GLY n 
1 474 LEU n 
1 475 CYS n 
1 476 ASN n 
1 477 VAL n 
1 478 TYR n 
1 479 THR n 
1 480 HIS n 
1 481 TYR n 
1 482 ILE n 
1 483 THR n 
1 484 THR n 
1 485 TYR n 
1 486 GLU n 
1 487 GLU n 
1 488 TYR n 
1 489 GLN n 
1 490 ALA n 
1 491 GLN n 
1 492 ARG n 
1 493 TYR n 
1 494 GLU n 
1 495 ALA n 
1 496 ALA n 
1 497 SER n 
1 498 THR n 
1 499 ILE n 
1 500 TYR n 
1 501 GLY n 
1 502 PRO n 
1 503 HIS n 
1 504 THR n 
1 505 LEU n 
1 506 SER n 
1 507 ALA n 
1 508 TYR n 
1 509 ILE n 
1 510 GLN n 
1 511 LEU n 
1 512 PHE n 
1 513 ARG n 
1 514 ASN n 
1 515 LEU n 
1 516 ALA n 
1 517 LYS n 
1 518 ALA n 
1 519 ILE n 
1 520 ALA n 
1 521 THR n 
1 522 ASP n 
1 523 THR n 
1 524 VAL n 
1 525 ALA n 
1 526 ASN n 
1 527 LEU n 
1 528 SER n 
1 529 ARG n 
1 530 GLY n 
1 531 PRO n 
1 532 GLU n 
1 533 PRO n 
1 534 PRO n 
1 535 PHE n 
1 536 PHE n 
1 537 LYS n 
1 538 GLN n 
1 539 LEU n 
1 540 ILE n 
1 541 VAL n 
1 542 PRO n 
1 543 LEU n 
1 544 ILE n 
1 545 PRO n 
1 546 SER n 
1 547 ILE n 
1 548 VAL n 
1 549 ASP n 
1 550 ARG n 
1 551 ALA n 
1 552 PRO n 
1 553 LYS n 
1 554 GLY n 
1 555 ARG n 
1 556 THR n 
1 557 PHE n 
1 558 GLY n 
1 559 ASP n 
1 560 VAL n 
1 561 LEU n 
1 562 GLN n 
1 563 PRO n 
1 564 ALA n 
1 565 LYS n 
1 566 PRO n 
1 567 GLU n 
1 568 TYR n 
1 569 ARG n 
1 570 VAL n 
1 571 GLY n 
1 572 GLU n 
1 573 VAL n 
1 574 ALA n 
1 575 GLU n 
1 576 VAL n 
1 577 ILE n 
1 578 PHE n 
1 579 VAL n 
1 580 GLY n 
1 581 ALA n 
1 582 ASN n 
1 583 PRO n 
1 584 LYS n 
1 585 ASN n 
1 586 SER n 
1 587 VAL n 
1 588 GLN n 
1 589 ASN n 
1 590 GLN n 
1 591 THR n 
1 592 HIS n 
1 593 GLN n 
1 594 THR n 
1 595 PHE n 
1 596 LEU n 
1 597 THR n 
1 598 VAL n 
1 599 GLU n 
1 600 LYS n 
1 601 TYR n 
1 602 GLU n 
1 603 ALA n 
1 604 THR n 
1 605 SER n 
1 606 THR n 
1 607 SER n 
1 608 TRP n 
1 609 GLN n 
1 610 ILE n 
1 611 VAL n 
1 612 CYS n 
1 613 ASN n 
1 614 ASP n 
1 615 ALA n 
1 616 SER n 
1 617 TRP n 
1 618 GLU n 
1 619 THR n 
1 620 ARG n 
1 621 PHE n 
1 622 TYR n 
1 623 TRP n 
1 624 HIS n 
1 625 LYS n 
1 626 GLY n 
1 627 LEU n 
1 628 LEU n 
1 629 GLY n 
1 630 LEU n 
1 631 SER n 
1 632 ASN n 
1 633 ALA n 
1 634 THR n 
1 635 VAL n 
1 636 GLU n 
1 637 TRP n 
1 638 HIS n 
1 639 ILE n 
1 640 PRO n 
1 641 ASP n 
1 642 THR n 
1 643 ALA n 
1 644 GLN n 
1 645 PRO n 
1 646 GLY n 
1 647 ILE n 
1 648 TYR n 
1 649 ARG n 
1 650 ILE n 
1 651 ARG n 
1 652 TYR n 
1 653 PHE n 
1 654 GLY n 
1 655 HIS n 
1 656 ASN n 
1 657 ARG n 
1 658 LYS n 
1 659 GLN n 
1 660 ASP n 
1 661 ILE n 
1 662 LEU n 
1 663 LYS n 
1 664 PRO n 
1 665 ALA n 
1 666 VAL n 
1 667 ILE n 
1 668 LEU n 
1 669 SER n 
1 670 PHE n 
1 671 GLU n 
1 672 GLY n 
1 673 THR n 
1 674 SER n 
1 675 PRO n 
1 676 ALA n 
1 677 PHE n 
1 678 GLU n 
1 679 VAL n 
1 680 VAL n 
1 681 THR n 
1 682 ILE n 
1 683 HIS n 
1 684 HIS n 
1 685 HIS n 
1 686 HIS n 
1 687 HIS n 
1 688 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   688 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ASAH2, HNAC1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ASAH2_HUMAN 
_struct_ref.pdbx_db_accession          Q9NR71 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FSGYHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSK
YGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRS
PYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQ
GPFVAAFASSNLGDVSPNILGPRCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQE
VTGPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFWDTIRDQILGKPSEEIKEC
HKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTTMSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTH
YITTYEEYQAQRYEAASTIYGPHTLSAYIQLFRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDV
LQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIP
DTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
;
_struct_ref.pdbx_align_begin           99 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WGK A 1 ? 682 ? Q9NR71 99 ? 780 ? 99 780 
2 1 4WGK B 1 ? 682 ? Q9NR71 99 ? 780 ? 99 780 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4WGK HIS A 683 ? UNP Q9NR71 ? ? 'expression tag' 781 1  
1 4WGK HIS A 684 ? UNP Q9NR71 ? ? 'expression tag' 782 2  
1 4WGK HIS A 685 ? UNP Q9NR71 ? ? 'expression tag' 783 3  
1 4WGK HIS A 686 ? UNP Q9NR71 ? ? 'expression tag' 784 4  
1 4WGK HIS A 687 ? UNP Q9NR71 ? ? 'expression tag' 785 5  
1 4WGK HIS A 688 ? UNP Q9NR71 ? ? 'expression tag' 786 6  
2 4WGK HIS B 683 ? UNP Q9NR71 ? ? 'expression tag' 781 7  
2 4WGK HIS B 684 ? UNP Q9NR71 ? ? 'expression tag' 782 8  
2 4WGK HIS B 685 ? UNP Q9NR71 ? ? 'expression tag' 783 9  
2 4WGK HIS B 686 ? UNP Q9NR71 ? ? 'expression tag' 784 10 
2 4WGK HIS B 687 ? UNP Q9NR71 ? ? 'expression tag' 785 11 
2 4WGK HIS B 688 ? UNP Q9NR71 ? ? 'expression tag' 786 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                     ?                 'C6 H12 O6'      180.156 
CA  non-polymer                  . 'CALCIUM ION'                            ?                 'Ca 2'           40.078  
CIT non-polymer                  . 'CITRIC ACID'                            ?                 'C6 H8 O7'       192.124 
CL  non-polymer                  . 'CHLORIDE ION'                           ?                 'Cl -1'          35.453  
CYS 'L-peptide linking'          y CYSTEINE                                 ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer                  . 1,2-ETHANEDIOL                           'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking'          y GLUTAMINE                                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ?                 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ?                 'C9 H11 N O2'    165.189 
PO4 non-polymer                  . 'PHOSPHATE ION'                          ?                 'O4 P -3'        94.971  
PRO 'L-peptide linking'          y PROLINE                                  ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer                  . 'ZINC ION'                               ?                 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WGK 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.89 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.48 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10% PEG 1000, 0.2M Lithium sulfate, 0.1M citrate phosphate buffer, pH 4.6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           193 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-08-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.987 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.987 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4WGK 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.582 
_reflns.d_resolution_low                 68.65 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       90770 
_reflns.number_obs                       49612 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             91.63 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  1.8 
_reflns.pdbx_Rmerge_I_obs                0.08051 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.47 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.582 
_reflns_shell.d_res_low                   2.674 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.91 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        87.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.3726 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4WGK 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.582 
_refine.ls_d_res_low                             68.65 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     49606 
_refine.ls_number_reflns_R_free                  1998 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    91.62 
_refine.ls_percent_reflns_R_free                 4.03 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1801 
_refine.ls_R_factor_R_free                       0.2227 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1784 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2ZWS 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.56 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.34 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10401 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         240 
_refine_hist.number_atoms_solvent             494 
_refine_hist.number_atoms_total               11135 
_refine_hist.d_res_high                       2.582 
_refine_hist.d_res_low                        68.65 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 10904 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.691  ? 14816 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.382 ? 3935  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.031  ? 1645  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 1920  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.5820 2.6466  . . 135 3202 87.00 . . . 0.3556 . 0.2638 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6466 2.7182  . . 139 3321 89.00 . . . 0.2692 . 0.2477 . . . . . . . . 
'X-RAY DIFFRACTION' 2.7182 2.7981  . . 138 3303 89.00 . . . 0.2853 . 0.2289 . . . . . . . . 
'X-RAY DIFFRACTION' 2.7981 2.8885  . . 138 3278 89.00 . . . 0.2853 . 0.2155 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8885 2.9917  . . 139 3292 89.00 . . . 0.2652 . 0.2147 . . . . . . . . 
'X-RAY DIFFRACTION' 2.9917 3.1115  . . 138 3285 89.00 . . . 0.2641 . 0.2021 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1115 3.2531  . . 137 3274 89.00 . . . 0.2553 . 0.1925 . . . . . . . . 
'X-RAY DIFFRACTION' 3.2531 3.4246  . . 139 3294 89.00 . . . 0.2376 . 0.1858 . . . . . . . . 
'X-RAY DIFFRACTION' 3.4246 3.6391  . . 140 3383 91.00 . . . 0.2045 . 0.1672 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6391 3.9201  . . 149 3547 95.00 . . . 0.2059 . 0.1480 . . . . . . . . 
'X-RAY DIFFRACTION' 3.9201 4.3145  . . 151 3598 97.00 . . . 0.1755 . 0.1430 . . . . . . . . 
'X-RAY DIFFRACTION' 4.3145 4.9387  . . 152 3606 97.00 . . . 0.1747 . 0.1377 . . . . . . . . 
'X-RAY DIFFRACTION' 4.9387 6.2216  . . 152 3615 97.00 . . . 0.2051 . 0.1682 . . . . . . . . 
'X-RAY DIFFRACTION' 6.2216 68.6772 . . 151 3610 96.00 . . . 0.1871 . 0.1790 . . . . . . . . 
# 
_struct.entry_id                     4WGK 
_struct.title                        'Crystal structure of human neutral ceramidase with Zn-bound phosphate' 
_struct.pdbx_descriptor              'human neutral ceramidase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4WGK 
_struct_keywords.text            'ceramidase, amidase, zinc, phosphate, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 2  ? 
F N N 4  ? 
G N N 5  ? 
H N N 6  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 8  ? 
M N N 4  ? 
N N N 5  ? 
O N N 6  ? 
P N N 6  ? 
Q N N 6  ? 
R N N 7  ? 
S N N 9  ? 
T N N 8  ? 
U N N 8  ? 
V N N 10 ? 
W N N 10 ? 
X N N 11 ? 
Y N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 66  ? GLY A 82  ? SER A 164 GLY A 180 1 ? 17 
HELX_P HELX_P2  AA2 TYR A 107 ? GLU A 115 ? TYR A 205 GLU A 213 1 ? 9  
HELX_P HELX_P3  AA3 SER A 118 ? THR A 138 ? SER A 216 THR A 236 1 ? 21 
HELX_P HELX_P4  AA4 SER A 160 ? LEU A 165 ? SER A 258 LEU A 263 1 ? 6  
HELX_P HELX_P5  AA5 PRO A 168 ? ALA A 173 ? PRO A 266 ALA A 271 1 ? 6  
HELX_P HELX_P6  AA6 SER A 218 ? ASN A 233 ? SER A 316 ASN A 331 1 ? 16 
HELX_P HELX_P7  AA7 GLY A 281 ? SER A 284 ? GLY A 379 SER A 382 5 ? 4  
HELX_P HELX_P8  AA8 ASP A 294 ? SER A 316 ? ASP A 392 SER A 414 1 ? 23 
HELX_P HELX_P9  AA9 SER A 357 ? ALA A 359 ? SER A 455 ALA A 457 5 ? 3  
HELX_P HELX_P10 AB1 ASP A 379 ? LEU A 390 ? ASP A 477 LEU A 488 1 ? 12 
HELX_P HELX_P11 AB2 SER A 394 ? LYS A 402 ? SER A 492 LYS A 500 1 ? 9  
HELX_P HELX_P12 AB3 HIS A 409 ? LEU A 413 ? HIS A 507 LEU A 511 5 ? 5  
HELX_P HELX_P13 AB4 THR A 444 ? HIS A 462 ? THR A 542 HIS A 560 1 ? 19 
HELX_P HELX_P14 AB5 THR A 484 ? GLN A 491 ? THR A 582 GLN A 589 1 ? 8  
HELX_P HELX_P15 AB6 ARG A 492 ? SER A 497 ? ARG A 590 SER A 595 1 ? 6  
HELX_P HELX_P16 AB7 HIS A 503 ? THR A 521 ? HIS A 601 THR A 619 1 ? 19 
HELX_P HELX_P17 AB8 THR A 523 ? LEU A 527 ? THR A 621 LEU A 625 5 ? 5  
HELX_P HELX_P18 AB9 ASN A 582 ? VAL A 587 ? ASN A 680 VAL A 685 5 ? 6  
HELX_P HELX_P19 AC1 SER B 66  ? GLY B 82  ? SER B 164 GLY B 180 1 ? 17 
HELX_P HELX_P20 AC2 TYR B 107 ? GLU B 115 ? TYR B 205 GLU B 213 1 ? 9  
HELX_P HELX_P21 AC3 SER B 118 ? ASN B 139 ? SER B 216 ASN B 237 1 ? 22 
HELX_P HELX_P22 AC4 SER B 160 ? LEU B 165 ? SER B 258 LEU B 263 1 ? 6  
HELX_P HELX_P23 AC5 PRO B 168 ? ALA B 173 ? PRO B 266 ALA B 271 1 ? 6  
HELX_P HELX_P24 AC6 SER B 218 ? ASN B 233 ? SER B 316 ASN B 331 1 ? 16 
HELX_P HELX_P25 AC7 GLY B 282 ? SER B 284 ? GLY B 380 SER B 382 5 ? 3  
HELX_P HELX_P26 AC8 ASP B 294 ? SER B 316 ? ASP B 392 SER B 414 1 ? 23 
HELX_P HELX_P27 AC9 SER B 357 ? ALA B 359 ? SER B 455 ALA B 457 5 ? 3  
HELX_P HELX_P28 AD1 ASP B 379 ? LEU B 390 ? ASP B 477 LEU B 488 1 ? 12 
HELX_P HELX_P29 AD2 SER B 394 ? LYS B 402 ? SER B 492 LYS B 500 1 ? 9  
HELX_P HELX_P30 AD3 HIS B 409 ? LEU B 413 ? HIS B 507 LEU B 511 5 ? 5  
HELX_P HELX_P31 AD4 THR B 444 ? HIS B 462 ? THR B 542 HIS B 560 1 ? 19 
HELX_P HELX_P32 AD5 THR B 484 ? GLN B 491 ? THR B 582 GLN B 589 1 ? 8  
HELX_P HELX_P33 AD6 ARG B 492 ? SER B 497 ? ARG B 590 SER B 595 1 ? 6  
HELX_P HELX_P34 AD7 HIS B 503 ? THR B 521 ? HIS B 601 THR B 619 1 ? 19 
HELX_P HELX_P35 AD8 THR B 523 ? LEU B 527 ? THR B 621 LEU B 625 5 ? 5  
HELX_P HELX_P36 AD9 ASN B 582 ? VAL B 587 ? ASN B 680 VAL B 685 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 264 SG  ? ? ? 1_555 A CYS 278 SG ? ? A CYS 362 A CYS 376 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf2  disulf ?    ? A CYS 271 SG  ? ? ? 1_555 A CYS 286 SG ? ? A CYS 369 A CYS 384 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf3  disulf ?    ? A CYS 350 SG  ? ? ? 1_555 A CYS 400 SG ? ? A CYS 448 A CYS 498 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf4  disulf ?    ? B CYS 264 SG  ? ? ? 1_555 B CYS 278 SG ? ? B CYS 362 B CYS 376 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf5  disulf ?    ? B CYS 271 SG  ? ? ? 1_555 B CYS 286 SG ? ? B CYS 369 B CYS 384 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf6  disulf ?    ? B CYS 350 SG  ? ? ? 1_555 B CYS 400 SG ? ? B CYS 448 B CYS 498 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
covale1  covale one  ? A ASN 119 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 217 A NAG 806 1_555 ? ? ? ? ? ? ? 1.403 ? N-Glycosylation 
covale2  covale one  ? A ASN 210 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 308 D NAG 1   1_555 ? ? ? ? ? ? ? 1.402 ? N-Glycosylation 
covale3  covale one  ? A ASN 342 ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 440 A NAG 805 1_555 ? ? ? ? ? ? ? 1.403 ? N-Glycosylation 
covale4  covale one  ? A ASN 632 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 730 C NAG 1   1_555 ? ? ? ? ? ? ? 1.395 ? N-Glycosylation 
covale5  covale one  ? B ASN 53  ND2 ? ? ? 1_555 Q NAG .   C1 ? ? B ASN 151 B NAG 807 1_555 ? ? ? ? ? ? ? 1.400 ? N-Glycosylation 
covale6  covale one  ? B ASN 119 ND2 ? ? ? 1_555 P NAG .   C1 ? ? B ASN 217 B NAG 806 1_555 ? ? ? ? ? ? ? 1.406 ? N-Glycosylation 
covale7  covale one  ? B ASN 210 ND2 ? ? ? 1_555 O NAG .   C1 ? ? B ASN 308 B NAG 803 1_555 ? ? ? ? ? ? ? 1.397 ? N-Glycosylation 
covale8  covale one  ? B ASN 632 ND2 ? ? ? 1_555 E NAG .   C1 ? ? B ASN 730 E NAG 1   1_555 ? ? ? ? ? ? ? 1.394 ? N-Glycosylation 
covale9  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.403 ? ?               
covale10 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.406 ? ?               
covale11 covale both ? D NAG .   O4  ? ? ? 1_555 D BMA .   C1 ? ? D NAG 2   D BMA 3   1_555 ? ? ? ? ? ? ? 1.411 ? ?               
covale12 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.399 ? ?               
metalc1  metalc ?    ? A LEU 36  O   ? ? ? 1_555 G CA  .   CA ? ? A LEU 134 A CA  802 1_555 ? ? ? ? ? ? ? 2.358 ? ?               
metalc2  metalc ?    ? A HIS 96  NE2 ? ? ? 1_555 F ZN  .   ZN ? ? A HIS 194 A ZN  801 1_555 ? ? ? ? ? ? ? 2.085 ? ?               
metalc3  metalc ?    ? A HIS 205 NE2 ? ? ? 1_555 F ZN  .   ZN ? ? A HIS 303 A ZN  801 1_555 ? ? ? ? ? ? ? 2.094 ? ?               
metalc4  metalc ?    ? A GLU 442 OE1 ? ? ? 1_555 F ZN  .   ZN ? ? A GLU 540 A ZN  801 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
metalc5  metalc ?    ? A GLU 442 OE2 ? ? ? 1_555 F ZN  .   ZN ? ? A GLU 540 A ZN  801 1_555 ? ? ? ? ? ? ? 2.561 ? ?               
metalc6  metalc ?    ? A TYR 481 OH  ? ? ? 1_555 F ZN  .   ZN ? ? A TYR 579 A ZN  801 1_555 ? ? ? ? ? ? ? 2.352 ? ?               
metalc7  metalc ?    ? A ASP 614 O   ? ? ? 1_555 G CA  .   CA ? ? A ASP 712 A CA  802 1_555 ? ? ? ? ? ? ? 2.439 ? ?               
metalc8  metalc ?    ? A SER 616 O   ? ? ? 1_555 G CA  .   CA ? ? A SER 714 A CA  802 1_555 ? ? ? ? ? ? ? 2.302 ? ?               
metalc9  metalc ?    ? A THR 619 O   ? ? ? 1_555 G CA  .   CA ? ? A THR 717 A CA  802 1_555 ? ? ? ? ? ? ? 2.428 ? ?               
metalc10 metalc ?    ? A THR 619 OG1 ? ? ? 1_555 G CA  .   CA ? ? A THR 717 A CA  802 1_555 ? ? ? ? ? ? ? 2.690 ? ?               
metalc11 metalc ?    ? F ZN  .   ZN  ? ? ? 1_555 J PO4 .   O2 ? ? A ZN  801 A PO4 810 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
metalc12 metalc ?    ? G CA  .   CA  ? ? ? 1_555 X HOH .   O  ? ? A CA  802 A HOH 977 1_555 ? ? ? ? ? ? ? 2.173 ? ?               
metalc13 metalc ?    ? B LEU 36  O   ? ? ? 1_555 N CA  .   CA ? ? B LEU 134 B CA  802 1_555 ? ? ? ? ? ? ? 2.501 ? ?               
metalc14 metalc ?    ? B HIS 96  NE2 ? ? ? 1_555 M ZN  .   ZN ? ? B HIS 194 B ZN  801 1_555 ? ? ? ? ? ? ? 2.162 ? ?               
metalc15 metalc ?    ? B HIS 205 NE2 ? ? ? 1_555 M ZN  .   ZN ? ? B HIS 303 B ZN  801 1_555 ? ? ? ? ? ? ? 2.011 ? ?               
metalc16 metalc ?    ? B GLU 442 OE1 ? ? ? 1_555 M ZN  .   ZN ? ? B GLU 540 B ZN  801 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
metalc17 metalc ?    ? B TYR 481 OH  ? ? ? 1_555 M ZN  .   ZN ? ? B TYR 579 B ZN  801 1_555 ? ? ? ? ? ? ? 2.327 ? ?               
metalc18 metalc ?    ? B ASP 614 O   ? ? ? 1_555 N CA  .   CA ? ? B ASP 712 B CA  802 1_555 ? ? ? ? ? ? ? 2.408 ? ?               
metalc19 metalc ?    ? B SER 616 O   ? ? ? 1_555 N CA  .   CA ? ? B SER 714 B CA  802 1_555 ? ? ? ? ? ? ? 2.622 ? ?               
metalc20 metalc ?    ? B THR 619 O   ? ? ? 1_555 N CA  .   CA ? ? B THR 717 B CA  802 1_555 ? ? ? ? ? ? ? 2.391 ? ?               
metalc21 metalc ?    ? B THR 619 OG1 ? ? ? 1_555 N CA  .   CA ? ? B THR 717 B CA  802 1_555 ? ? ? ? ? ? ? 2.566 ? ?               
metalc22 metalc ?    ? M ZN  .   ZN  ? ? ? 1_555 R PO4 .   O4 ? ? B ZN  801 B PO4 808 1_555 ? ? ? ? ? ? ? 2.073 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 402 A . ? LYS 500 A PRO 403 A ? PRO 501 A 1 2.97  
2 LYS 415 A . ? LYS 513 A PRO 416 A ? PRO 514 A 1 -1.70 
3 LYS 402 B . ? LYS 500 B PRO 403 B ? PRO 501 B 1 4.09  
4 LYS 415 B . ? LYS 513 B PRO 416 B ? PRO 514 B 1 -1.47 
5 GLN 588 B . ? GLN 686 B ASN 589 B ? ASN 687 B 1 -3.72 
6 ASN 589 B . ? ASN 687 B GLN 590 B ? GLN 688 B 1 -0.37 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 7 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
AB4 ? 4 ? 
AB5 ? 8 ? 
AB6 ? 6 ? 
AB7 ? 4 ? 
AB8 ? 7 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 5 ? 
AC8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? anti-parallel 
AB5 6 7 ? anti-parallel 
AB5 7 8 ? parallel      
AB6 1 2 ? parallel      
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? parallel      
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? anti-parallel 
AB8 6 7 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? parallel      
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? parallel      
AC7 1 2 ? parallel      
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 90  ? GLY A 94  ? VAL A 188 GLY A 192 
AA1 2 THR A 55  ? ILE A 60  ? THR A 153 ILE A 158 
AA1 3 TYR A 40  ? ALA A 47  ? TYR A 138 ALA A 145 
AA1 4 TYR A 4   ? ASP A 12  ? TYR A 102 ASP A 110 
AA1 5 LYS A 141 ? ASN A 151 ? LYS A 239 ASN A 249 
AA1 6 GLU A 182 ? ASP A 190 ? GLU A 280 ASP A 288 
AA1 7 ASP A 195 ? TRP A 201 ? ASP A 293 TRP A 299 
AA1 8 VAL A 244 ? ALA A 248 ? VAL A 342 ALA A 346 
AA2 1 VAL A 90  ? GLY A 94  ? VAL A 188 GLY A 192 
AA2 2 THR A 55  ? ILE A 60  ? THR A 153 ILE A 158 
AA2 3 TYR A 40  ? ALA A 47  ? TYR A 138 ALA A 145 
AA2 4 TYR A 4   ? ASP A 12  ? TYR A 102 ASP A 110 
AA2 5 LYS A 141 ? ASN A 151 ? LYS A 239 ASN A 249 
AA2 6 GLN A 319 ? VAL A 321 ? GLN A 417 VAL A 419 
AA3 1 GLY A 100 ? PRO A 101 ? GLY A 198 PRO A 199 
AA3 2 ALA A 18  ? MET A 23  ? ALA A 116 MET A 121 
AA3 3 ASN A 31  ? ILE A 35  ? ASN A 129 ILE A 133 
AA3 4 LEU A 215 ? VAL A 216 ? LEU A 313 VAL A 314 
AA4 1 GLY A 100 ? PRO A 101 ? GLY A 198 PRO A 199 
AA4 2 ALA A 18  ? MET A 23  ? ALA A 116 MET A 121 
AA4 3 ASN A 31  ? ILE A 35  ? ASN A 129 ILE A 133 
AA4 4 THR A 619 ? LYS A 625 ? THR A 717 LYS A 723 
AA4 5 SER A 631 ? HIS A 638 ? SER A 729 HIS A 736 
AA4 6 VAL A 573 ? VAL A 579 ? VAL A 671 VAL A 677 
AA4 7 VAL A 560 ? GLN A 562 ? VAL A 658 GLN A 660 
AA5 1 ILE A 157 ? ASN A 158 ? ILE A 255 ASN A 256 
AA5 2 VAL A 255 ? SER A 256 ? VAL A 353 SER A 354 
AA6 1 PRO A 262 ? CYS A 264 ? PRO A 360 CYS A 362 
AA6 2 CYS A 286 ? ALA A 288 ? CYS A 384 ALA A 386 
AA7 1 LEU A 325 ? ASP A 333 ? LEU A 423 ASP A 431 
AA7 2 ILE A 423 ? LEU A 431 ? ILE A 521 LEU A 529 
AA7 3 LEU A 434 ? ALA A 438 ? LEU A 532 ALA A 536 
AA7 4 THR A 468 ? SER A 472 ? THR A 566 SER A 570 
AA8 1 THR A 338 ? TRP A 340 ? THR A 436 TRP A 438 
AA8 2 ALA A 346 ? LYS A 348 ? ALA A 444 LYS A 446 
AA9 1 LEU A 354 ? GLY A 355 ? LEU A 452 GLY A 453 
AA9 2 ILE A 406 ? LEU A 408 ? ILE A 504 LEU A 506 
AB1 1 GLY A 361 ? THR A 362 ? GLY A 459 THR A 460 
AB1 2 GLY A 365 ? VAL A 366 ? GLY A 463 VAL A 464 
AB2 1 GLU A 442 ? PHE A 443 ? GLU A 540 PHE A 541 
AB2 2 TYR A 481 ? ILE A 482 ? TYR A 579 ILE A 580 
AB3 1 GLU A 567 ? ARG A 569 ? GLU A 665 ARG A 667 
AB3 2 PHE A 677 ? VAL A 680 ? PHE A 775 VAL A 778 
AB3 3 GLY A 646 ? LYS A 658 ? GLY A 744 LYS A 756 
AB3 4 LEU A 596 ? GLU A 602 ? LEU A 694 GLU A 700 
AB3 5 SER A 607 ? ASN A 613 ? SER A 705 ASN A 711 
AB4 1 GLU A 567 ? ARG A 569 ? GLU A 665 ARG A 667 
AB4 2 PHE A 677 ? VAL A 680 ? PHE A 775 VAL A 778 
AB4 3 GLY A 646 ? LYS A 658 ? GLY A 744 LYS A 756 
AB4 4 VAL A 666 ? THR A 673 ? VAL A 764 THR A 771 
AB5 1 VAL B 90  ? GLY B 94  ? VAL B 188 GLY B 192 
AB5 2 THR B 55  ? ILE B 60  ? THR B 153 ILE B 158 
AB5 3 TYR B 40  ? ALA B 47  ? TYR B 138 ALA B 145 
AB5 4 TYR B 4   ? ASP B 12  ? TYR B 102 ASP B 110 
AB5 5 LYS B 141 ? ASN B 151 ? LYS B 239 ASN B 249 
AB5 6 GLU B 182 ? ASP B 190 ? GLU B 280 ASP B 288 
AB5 7 ASP B 195 ? TRP B 201 ? ASP B 293 TRP B 299 
AB5 8 VAL B 244 ? ALA B 248 ? VAL B 342 ALA B 346 
AB6 1 VAL B 90  ? GLY B 94  ? VAL B 188 GLY B 192 
AB6 2 THR B 55  ? ILE B 60  ? THR B 153 ILE B 158 
AB6 3 TYR B 40  ? ALA B 47  ? TYR B 138 ALA B 145 
AB6 4 TYR B 4   ? ASP B 12  ? TYR B 102 ASP B 110 
AB6 5 LYS B 141 ? ASN B 151 ? LYS B 239 ASN B 249 
AB6 6 GLN B 319 ? VAL B 321 ? GLN B 417 VAL B 419 
AB7 1 GLY B 100 ? PRO B 101 ? GLY B 198 PRO B 199 
AB7 2 ALA B 18  ? MET B 23  ? ALA B 116 MET B 121 
AB7 3 ASN B 31  ? ILE B 35  ? ASN B 129 ILE B 133 
AB7 4 LEU B 215 ? VAL B 216 ? LEU B 313 VAL B 314 
AB8 1 GLY B 100 ? PRO B 101 ? GLY B 198 PRO B 199 
AB8 2 ALA B 18  ? MET B 23  ? ALA B 116 MET B 121 
AB8 3 ASN B 31  ? ILE B 35  ? ASN B 129 ILE B 133 
AB8 4 THR B 619 ? LYS B 625 ? THR B 717 LYS B 723 
AB8 5 SER B 631 ? HIS B 638 ? SER B 729 HIS B 736 
AB8 6 VAL B 573 ? VAL B 579 ? VAL B 671 VAL B 677 
AB8 7 VAL B 560 ? GLN B 562 ? VAL B 658 GLN B 660 
AB9 1 ILE B 157 ? ASN B 158 ? ILE B 255 ASN B 256 
AB9 2 VAL B 255 ? SER B 256 ? VAL B 353 SER B 354 
AC1 1 PRO B 262 ? CYS B 264 ? PRO B 360 CYS B 362 
AC1 2 CYS B 286 ? ALA B 288 ? CYS B 384 ALA B 386 
AC2 1 LEU B 325 ? ASP B 333 ? LEU B 423 ASP B 431 
AC2 2 ILE B 423 ? LEU B 431 ? ILE B 521 LEU B 529 
AC2 3 LEU B 434 ? ALA B 438 ? LEU B 532 ALA B 536 
AC2 4 THR B 468 ? SER B 472 ? THR B 566 SER B 570 
AC3 1 THR B 338 ? TRP B 340 ? THR B 436 TRP B 438 
AC3 2 ALA B 346 ? LYS B 348 ? ALA B 444 LYS B 446 
AC4 1 LEU B 354 ? GLY B 355 ? LEU B 452 GLY B 453 
AC4 2 ILE B 406 ? LEU B 408 ? ILE B 504 LEU B 506 
AC5 1 GLY B 361 ? THR B 362 ? GLY B 459 THR B 460 
AC5 2 GLY B 365 ? VAL B 366 ? GLY B 463 VAL B 464 
AC6 1 GLU B 442 ? PHE B 443 ? GLU B 540 PHE B 541 
AC6 2 TYR B 481 ? ILE B 482 ? TYR B 579 ILE B 580 
AC7 1 GLU B 567 ? ARG B 569 ? GLU B 665 ARG B 667 
AC7 2 PHE B 677 ? VAL B 680 ? PHE B 775 VAL B 778 
AC7 3 GLY B 646 ? LYS B 658 ? GLY B 744 LYS B 756 
AC7 4 LEU B 596 ? GLU B 602 ? LEU B 694 GLU B 700 
AC7 5 SER B 607 ? ASN B 613 ? SER B 705 ASN B 711 
AC8 1 GLU B 567 ? ARG B 569 ? GLU B 665 ARG B 667 
AC8 2 PHE B 677 ? VAL B 680 ? PHE B 775 VAL B 778 
AC8 3 GLY B 646 ? LYS B 658 ? GLY B 744 LYS B 756 
AC8 4 VAL B 666 ? THR B 673 ? VAL B 764 THR B 771 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O SER A 93  ? O SER A 191 N ILE A 60  ? N ILE A 158 
AA1 2 3 O SER A 59  ? O SER A 157 N ARG A 42  ? N ARG A 140 
AA1 3 4 O SER A 41  ? O SER A 139 N ALA A 11  ? N ALA A 109 
AA1 4 5 N ILE A 6   ? N ILE A 104 O LYS A 141 ? O LYS A 239 
AA1 5 6 N GLY A 150 ? N GLY A 248 O MET A 183 ? O MET A 281 
AA1 6 7 N LEU A 186 ? N LEU A 284 O ILE A 199 ? O ILE A 297 
AA1 7 8 N SER A 200 ? N SER A 298 O ALA A 246 ? O ALA A 344 
AA2 1 2 O SER A 93  ? O SER A 191 N ILE A 60  ? N ILE A 158 
AA2 2 3 O SER A 59  ? O SER A 157 N ARG A 42  ? N ARG A 140 
AA2 3 4 O SER A 41  ? O SER A 139 N ALA A 11  ? N ALA A 109 
AA2 4 5 N ILE A 6   ? N ILE A 104 O LYS A 141 ? O LYS A 239 
AA2 5 6 N ILE A 145 ? N ILE A 243 O VAL A 321 ? O VAL A 419 
AA3 1 2 O GLY A 100 ? O GLY A 198 N MET A 23  ? N MET A 121 
AA3 2 3 N ILE A 20  ? N ILE A 118 O ALA A 32  ? O ALA A 130 
AA3 3 4 N GLY A 34  ? N GLY A 132 O VAL A 216 ? O VAL A 314 
AA4 1 2 O GLY A 100 ? O GLY A 198 N MET A 23  ? N MET A 121 
AA4 2 3 N ILE A 20  ? N ILE A 118 O ALA A 32  ? O ALA A 130 
AA4 3 4 N GLN A 33  ? N GLN A 131 O TRP A 623 ? O TRP A 721 
AA4 4 5 N TYR A 622 ? N TYR A 720 O THR A 634 ? O THR A 732 
AA4 5 6 O TRP A 637 ? O TRP A 735 N ALA A 574 ? N ALA A 672 
AA4 6 7 O ILE A 577 ? O ILE A 675 N LEU A 561 ? N LEU A 659 
AA5 1 2 N ILE A 157 ? N ILE A 255 O SER A 256 ? O SER A 354 
AA6 1 2 N ARG A 263 ? N ARG A 361 O ILE A 287 ? O ILE A 385 
AA7 1 2 N ALA A 326 ? N ALA A 424 O THR A 430 ? O THR A 528 
AA7 2 3 N ILE A 429 ? N ILE A 527 O ILE A 436 ? O ILE A 534 
AA7 3 4 N ALA A 435 ? N ALA A 533 O THR A 468 ? O THR A 566 
AA8 1 2 N VAL A 339 ? N VAL A 437 O SER A 347 ? O SER A 445 
AA9 1 2 N LEU A 354 ? N LEU A 452 O LEU A 407 ? O LEU A 505 
AB1 1 2 N THR A 362 ? N THR A 460 O GLY A 365 ? O GLY A 463 
AB2 1 2 N GLU A 442 ? N GLU A 540 O ILE A 482 ? O ILE A 580 
AB3 1 2 N TYR A 568 ? N TYR A 666 O VAL A 680 ? O VAL A 778 
AB3 2 3 O PHE A 677 ? O PHE A 775 N TYR A 648 ? N TYR A 746 
AB3 3 4 O ILE A 647 ? O ILE A 745 N TYR A 601 ? N TYR A 699 
AB3 4 5 N VAL A 598 ? N VAL A 696 O VAL A 611 ? O VAL A 709 
AB4 1 2 N TYR A 568 ? N TYR A 666 O VAL A 680 ? O VAL A 778 
AB4 2 3 O PHE A 677 ? O PHE A 775 N TYR A 648 ? N TYR A 746 
AB4 3 4 N TYR A 652 ? N TYR A 750 O GLY A 672 ? O GLY A 770 
AB5 1 2 O SER B 93  ? O SER B 191 N ILE B 60  ? N ILE B 158 
AB5 2 3 O SER B 59  ? O SER B 157 N ARG B 42  ? N ARG B 140 
AB5 3 4 O ILE B 45  ? O ILE B 143 N GLY B 7   ? N GLY B 105 
AB5 4 5 N ILE B 6   ? N ILE B 104 O LYS B 141 ? O LYS B 239 
AB5 5 6 N GLY B 150 ? N GLY B 248 O MET B 183 ? O MET B 281 
AB5 6 7 N LEU B 186 ? N LEU B 284 O ILE B 199 ? O ILE B 297 
AB5 7 8 N SER B 200 ? N SER B 298 O ALA B 248 ? O ALA B 346 
AB6 1 2 O SER B 93  ? O SER B 191 N ILE B 60  ? N ILE B 158 
AB6 2 3 O SER B 59  ? O SER B 157 N ARG B 42  ? N ARG B 140 
AB6 3 4 O ILE B 45  ? O ILE B 143 N GLY B 7   ? N GLY B 105 
AB6 4 5 N ILE B 6   ? N ILE B 104 O LYS B 141 ? O LYS B 239 
AB6 5 6 N ILE B 145 ? N ILE B 243 O VAL B 321 ? O VAL B 419 
AB7 1 2 O GLY B 100 ? O GLY B 198 N MET B 23  ? N MET B 121 
AB7 2 3 N ILE B 20  ? N ILE B 118 O ALA B 32  ? O ALA B 130 
AB7 3 4 N GLY B 34  ? N GLY B 132 O VAL B 216 ? O VAL B 314 
AB8 1 2 O GLY B 100 ? O GLY B 198 N MET B 23  ? N MET B 121 
AB8 2 3 N ILE B 20  ? N ILE B 118 O ALA B 32  ? O ALA B 130 
AB8 3 4 N GLN B 33  ? N GLN B 131 O TRP B 623 ? O TRP B 721 
AB8 4 5 N TYR B 622 ? N TYR B 720 O THR B 634 ? O THR B 732 
AB8 5 6 O TRP B 637 ? O TRP B 735 N ALA B 574 ? N ALA B 672 
AB8 6 7 O ILE B 577 ? O ILE B 675 N LEU B 561 ? N LEU B 659 
AB9 1 2 N ILE B 157 ? N ILE B 255 O SER B 256 ? O SER B 354 
AC1 1 2 N ARG B 263 ? N ARG B 361 O ILE B 287 ? O ILE B 385 
AC2 1 2 N VAL B 332 ? N VAL B 430 O VAL B 424 ? O VAL B 522 
AC2 2 3 N LEU B 431 ? N LEU B 529 O LEU B 434 ? O LEU B 532 
AC2 3 4 N ALA B 435 ? N ALA B 533 O THR B 468 ? O THR B 566 
AC3 1 2 N VAL B 339 ? N VAL B 437 O SER B 347 ? O SER B 445 
AC4 1 2 N LEU B 354 ? N LEU B 452 O LEU B 407 ? O LEU B 505 
AC5 1 2 N THR B 362 ? N THR B 460 O GLY B 365 ? O GLY B 463 
AC6 1 2 N GLU B 442 ? N GLU B 540 O ILE B 482 ? O ILE B 580 
AC7 1 2 N TYR B 568 ? N TYR B 666 O VAL B 680 ? O VAL B 778 
AC7 2 3 O PHE B 677 ? O PHE B 775 N TYR B 648 ? N TYR B 746 
AC7 3 4 O ILE B 647 ? O ILE B 745 N TYR B 601 ? N TYR B 699 
AC7 4 5 N LYS B 600 ? N LYS B 698 O GLN B 609 ? O GLN B 707 
AC8 1 2 N TYR B 568 ? N TYR B 666 O VAL B 680 ? O VAL B 778 
AC8 2 3 O PHE B 677 ? O PHE B 775 N TYR B 648 ? N TYR B 746 
AC8 3 4 N LYS B 658 ? N LYS B 756 O VAL B 666 ? O VAL B 764 
# 
_atom_sites.entry_id                    4WGK 
_atom_sites.fract_transf_matrix[1][1]   0.013609 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004432 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006384 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013092 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1  2   ? -37.946 -15.299 136.223 1.00 78.47  ? 100  SER A N   1 
ATOM   2     C  CA  . SER A 1  2   ? -38.441 -14.217 135.381 1.00 78.48  ? 100  SER A CA  1 
ATOM   3     C  C   . SER A 1  2   ? -37.457 -13.896 134.261 1.00 76.94  ? 100  SER A C   1 
ATOM   4     O  O   . SER A 1  2   ? -37.805 -13.966 133.082 1.00 79.50  ? 100  SER A O   1 
ATOM   5     C  CB  . SER A 1  2   ? -38.714 -12.968 136.219 1.00 79.07  ? 100  SER A CB  1 
ATOM   6     O  OG  . SER A 1  2   ? -37.557 -12.574 136.934 1.00 79.41  ? 100  SER A OG  1 
ATOM   7     N  N   . GLY A 1  3   ? -36.227 -13.548 134.631 1.00 71.09  ? 101  GLY A N   1 
ATOM   8     C  CA  . GLY A 1  3   ? -35.199 -13.271 133.645 1.00 62.35  ? 101  GLY A CA  1 
ATOM   9     C  C   . GLY A 1  3   ? -34.221 -14.416 133.459 1.00 53.52  ? 101  GLY A C   1 
ATOM   10    O  O   . GLY A 1  3   ? -34.364 -15.477 134.064 1.00 55.88  ? 101  GLY A O   1 
ATOM   11    N  N   . TYR A 1  4   ? -33.214 -14.189 132.623 1.00 44.75  ? 102  TYR A N   1 
ATOM   12    C  CA  . TYR A 1  4   ? -32.250 -15.224 132.260 1.00 40.07  ? 102  TYR A CA  1 
ATOM   13    C  C   . TYR A 1  4   ? -31.123 -15.415 133.274 1.00 38.99  ? 102  TYR A C   1 
ATOM   14    O  O   . TYR A 1  4   ? -30.796 -14.508 134.040 1.00 34.72  ? 102  TYR A O   1 
ATOM   15    C  CB  . TYR A 1  4   ? -31.638 -14.907 130.895 1.00 36.66  ? 102  TYR A CB  1 
ATOM   16    C  CG  . TYR A 1  4   ? -32.657 -14.633 129.815 1.00 31.82  ? 102  TYR A CG  1 
ATOM   17    C  CD1 . TYR A 1  4   ? -33.440 -15.655 129.298 1.00 32.13  ? 102  TYR A CD1 1 
ATOM   18    C  CD2 . TYR A 1  4   ? -32.834 -13.353 129.309 1.00 30.59  ? 102  TYR A CD2 1 
ATOM   19    C  CE1 . TYR A 1  4   ? -34.371 -15.409 128.311 1.00 34.10  ? 102  TYR A CE1 1 
ATOM   20    C  CE2 . TYR A 1  4   ? -33.761 -13.097 128.321 1.00 33.29  ? 102  TYR A CE2 1 
ATOM   21    C  CZ  . TYR A 1  4   ? -34.528 -14.129 127.825 1.00 35.03  ? 102  TYR A CZ  1 
ATOM   22    O  OH  . TYR A 1  4   ? -35.457 -13.882 126.839 1.00 37.57  ? 102  TYR A OH  1 
ATOM   23    N  N   . HIS A 1  5   ? -30.534 -16.607 133.268 1.00 41.08  ? 103  HIS A N   1 
ATOM   24    C  CA  . HIS A 1  5   ? -29.227 -16.815 133.879 1.00 38.43  ? 103  HIS A CA  1 
ATOM   25    C  C   . HIS A 1  5   ? -28.185 -16.627 132.788 1.00 37.20  ? 103  HIS A C   1 
ATOM   26    O  O   . HIS A 1  5   ? -28.282 -17.230 131.722 1.00 37.78  ? 103  HIS A O   1 
ATOM   27    C  CB  . HIS A 1  5   ? -29.110 -18.205 134.511 1.00 40.46  ? 103  HIS A CB  1 
ATOM   28    C  CG  . HIS A 1  5   ? -29.810 -18.335 135.828 1.00 45.86  ? 103  HIS A CG  1 
ATOM   29    N  ND1 . HIS A 1  5   ? -29.529 -17.519 136.903 1.00 48.40  ? 103  HIS A ND1 1 
ATOM   30    C  CD2 . HIS A 1  5   ? -30.773 -19.190 136.246 1.00 50.27  ? 103  HIS A CD2 1 
ATOM   31    C  CE1 . HIS A 1  5   ? -30.292 -17.863 137.925 1.00 50.00  ? 103  HIS A CE1 1 
ATOM   32    N  NE2 . HIS A 1  5   ? -31.056 -18.874 137.553 1.00 52.80  ? 103  HIS A NE2 1 
ATOM   33    N  N   . ILE A 1  6   ? -27.188 -15.792 133.058 1.00 38.01  ? 104  ILE A N   1 
ATOM   34    C  CA  . ILE A 1  6   ? -26.215 -15.419 132.038 1.00 32.46  ? 104  ILE A CA  1 
ATOM   35    C  C   . ILE A 1  6   ? -24.781 -15.702 132.466 1.00 34.96  ? 104  ILE A C   1 
ATOM   36    O  O   . ILE A 1  6   ? -24.369 -15.335 133.565 1.00 40.77  ? 104  ILE A O   1 
ATOM   37    C  CB  . ILE A 1  6   ? -26.334 -13.923 131.685 1.00 28.30  ? 104  ILE A CB  1 
ATOM   38    C  CG1 . ILE A 1  6   ? -27.782 -13.566 131.343 1.00 28.13  ? 104  ILE A CG1 1 
ATOM   39    C  CG2 . ILE A 1  6   ? -25.394 -13.564 130.542 1.00 27.30  ? 104  ILE A CG2 1 
ATOM   40    C  CD1 . ILE A 1  6   ? -28.003 -12.091 131.105 1.00 27.21  ? 104  ILE A CD1 1 
ATOM   41    N  N   . GLY A 1  7   ? -24.025 -16.358 131.590 1.00 30.22  ? 105  GLY A N   1 
ATOM   42    C  CA  . GLY A 1  7   ? -22.609 -16.576 131.819 1.00 27.05  ? 105  GLY A CA  1 
ATOM   43    C  C   . GLY A 1  7   ? -21.782 -16.122 130.633 1.00 25.81  ? 105  GLY A C   1 
ATOM   44    O  O   . GLY A 1  7   ? -22.199 -16.268 129.483 1.00 23.07  ? 105  GLY A O   1 
ATOM   45    N  N   . VAL A 1  8   ? -20.604 -15.572 130.912 1.00 25.77  ? 106  VAL A N   1 
ATOM   46    C  CA  . VAL A 1  8   ? -19.702 -15.100 129.865 1.00 25.06  ? 106  VAL A CA  1 
ATOM   47    C  C   . VAL A 1  8   ? -18.273 -15.534 130.172 1.00 27.91  ? 106  VAL A C   1 
ATOM   48    O  O   . VAL A 1  8   ? -17.905 -15.723 131.334 1.00 26.53  ? 106  VAL A O   1 
ATOM   49    C  CB  . VAL A 1  8   ? -19.744 -13.560 129.701 1.00 26.53  ? 106  VAL A CB  1 
ATOM   50    C  CG1 . VAL A 1  8   ? -21.151 -13.088 129.355 1.00 28.58  ? 106  VAL A CG1 1 
ATOM   51    C  CG2 . VAL A 1  8   ? -19.233 -12.868 130.955 1.00 29.53  ? 106  VAL A CG2 1 
ATOM   52    N  N   . GLY A 1  9   ? -17.472 -15.709 129.127 1.00 27.03  ? 107  GLY A N   1 
ATOM   53    C  CA  . GLY A 1  9   ? -16.091 -16.118 129.296 1.00 18.24  ? 107  GLY A CA  1 
ATOM   54    C  C   . GLY A 1  9   ? -15.221 -15.804 128.096 1.00 22.29  ? 107  GLY A C   1 
ATOM   55    O  O   . GLY A 1  9   ? -15.685 -15.818 126.956 1.00 24.96  ? 107  GLY A O   1 
ATOM   56    N  N   . ARG A 1  10  ? -13.950 -15.522 128.361 1.00 19.06  ? 108  ARG A N   1 
ATOM   57    C  CA  . ARG A 1  10  ? -12.975 -15.261 127.311 1.00 17.85  ? 108  ARG A CA  1 
ATOM   58    C  C   . ARG A 1  10  ? -11.719 -16.085 127.564 1.00 22.46  ? 108  ARG A C   1 
ATOM   59    O  O   . ARG A 1  10  ? -11.232 -16.159 128.692 1.00 25.84  ? 108  ARG A O   1 
ATOM   60    C  CB  . ARG A 1  10  ? -12.625 -13.774 127.247 1.00 17.37  ? 108  ARG A CB  1 
ATOM   61    C  CG  . ARG A 1  10  ? -11.590 -13.424 126.186 1.00 16.41  ? 108  ARG A CG  1 
ATOM   62    C  CD  . ARG A 1  10  ? -11.048 -12.014 126.364 1.00 16.35  ? 108  ARG A CD  1 
ATOM   63    N  NE  . ARG A 1  10  ? -10.520 -11.807 127.709 1.00 24.59  ? 108  ARG A NE  1 
ATOM   64    C  CZ  . ARG A 1  10  ? -11.144 -11.124 128.663 1.00 21.52  ? 108  ARG A CZ  1 
ATOM   65    N  NH1 . ARG A 1  10  ? -12.322 -10.564 128.419 1.00 21.08  ? 108  ARG A NH1 1 
ATOM   66    N  NH2 . ARG A 1  10  ? -10.587 -10.998 129.859 1.00 20.89  ? 108  ARG A NH2 1 
ATOM   67    N  N   . ALA A 1  11  ? -11.192 -16.704 126.514 1.00 19.89  ? 109  ALA A N   1 
ATOM   68    C  CA  . ALA A 1  11  ? -10.018 -17.551 126.657 1.00 20.39  ? 109  ALA A CA  1 
ATOM   69    C  C   . ALA A 1  11  ? -9.112  -17.476 125.438 1.00 22.16  ? 109  ALA A C   1 
ATOM   70    O  O   . ALA A 1  11  ? -9.583  -17.362 124.307 1.00 16.80  ? 109  ALA A O   1 
ATOM   71    C  CB  . ALA A 1  11  ? -10.436 -18.986 126.911 1.00 17.98  ? 109  ALA A CB  1 
ATOM   72    N  N   . ASP A 1  12  ? -7.808  -17.551 125.684 1.00 21.73  ? 110  ASP A N   1 
ATOM   73    C  CA  . ASP A 1  12  ? -6.812  -17.551 124.621 1.00 17.45  ? 110  ASP A CA  1 
ATOM   74    C  C   . ASP A 1  12  ? -6.949  -18.785 123.733 1.00 17.60  ? 110  ASP A C   1 
ATOM   75    O  O   . ASP A 1  12  ? -6.902  -19.918 124.215 1.00 18.14  ? 110  ASP A O   1 
ATOM   76    C  CB  . ASP A 1  12  ? -5.406  -17.487 125.221 1.00 22.57  ? 110  ASP A CB  1 
ATOM   77    C  CG  . ASP A 1  12  ? -4.322  -17.387 124.167 1.00 25.50  ? 110  ASP A CG  1 
ATOM   78    O  OD1 . ASP A 1  12  ? -4.618  -16.939 123.040 1.00 21.06  ? 110  ASP A OD1 1 
ATOM   79    O  OD2 . ASP A 1  12  ? -3.169  -17.762 124.469 1.00 33.81  ? 110  ASP A OD2 1 
ATOM   80    N  N   . CYS A 1  13  ? -7.119  -18.561 122.435 1.00 17.23  ? 111  CYS A N   1 
ATOM   81    C  CA  . CYS A 1  13  ? -7.197  -19.659 121.478 1.00 26.20  ? 111  CYS A CA  1 
ATOM   82    C  C   . CYS A 1  13  ? -6.185  -19.461 120.354 1.00 24.28  ? 111  CYS A C   1 
ATOM   83    O  O   . CYS A 1  13  ? -6.392  -19.912 119.227 1.00 25.61  ? 111  CYS A O   1 
ATOM   84    C  CB  . CYS A 1  13  ? -8.615  -19.783 120.910 1.00 17.07  ? 111  CYS A CB  1 
ATOM   85    S  SG  . CYS A 1  13  ? -9.139  -18.417 119.846 1.00 34.31  ? 111  CYS A SG  1 
ATOM   86    N  N   . THR A 1  14  ? -5.085  -18.788 120.678 1.00 24.98  ? 112  THR A N   1 
ATOM   87    C  CA  . THR A 1  14  ? -4.035  -18.501 119.709 1.00 20.73  ? 112  THR A CA  1 
ATOM   88    C  C   . THR A 1  14  ? -3.185  -19.733 119.428 1.00 24.45  ? 112  THR A C   1 
ATOM   89    O  O   . THR A 1  14  ? -2.670  -20.362 120.349 1.00 29.67  ? 112  THR A O   1 
ATOM   90    C  CB  . THR A 1  14  ? -3.114  -17.364 120.198 1.00 20.49  ? 112  THR A CB  1 
ATOM   91    O  OG1 . THR A 1  14  ? -3.904  -16.232 120.583 1.00 22.00  ? 112  THR A OG1 1 
ATOM   92    C  CG2 . THR A 1  14  ? -2.137  -16.956 119.104 1.00 18.05  ? 112  THR A CG2 1 
ATOM   93    N  N   . GLY A 1  15  ? -3.032  -20.071 118.153 1.00 25.02  ? 113  GLY A N   1 
ATOM   94    C  CA  . GLY A 1  15  ? -2.179  -21.179 117.766 1.00 27.41  ? 113  GLY A CA  1 
ATOM   95    C  C   . GLY A 1  15  ? -0.720  -20.766 117.810 1.00 35.02  ? 113  GLY A C   1 
ATOM   96    O  O   . GLY A 1  15  ? -0.352  -19.837 118.530 1.00 39.52  ? 113  GLY A O   1 
ATOM   97    N  N   . GLN A 1  16  ? 0.119   -21.447 117.039 1.00 36.40  ? 114  GLN A N   1 
ATOM   98    C  CA  . GLN A 1  16  ? 1.527   -21.078 116.985 1.00 37.19  ? 114  GLN A CA  1 
ATOM   99    C  C   . GLN A 1  16  ? 1.711   -19.852 116.101 1.00 35.51  ? 114  GLN A C   1 
ATOM   100   O  O   . GLN A 1  16  ? 0.958   -19.638 115.150 1.00 38.22  ? 114  GLN A O   1 
ATOM   101   C  CB  . GLN A 1  16  ? 2.385   -22.243 116.485 1.00 40.25  ? 114  GLN A CB  1 
ATOM   102   C  CG  . GLN A 1  16  ? 2.111   -22.678 115.060 1.00 45.98  ? 114  GLN A CG  1 
ATOM   103   C  CD  . GLN A 1  16  ? 2.922   -23.897 114.667 1.00 53.74  ? 114  GLN A CD  1 
ATOM   104   O  OE1 . GLN A 1  16  ? 2.611   -25.019 115.067 1.00 57.03  ? 114  GLN A OE1 1 
ATOM   105   N  NE2 . GLN A 1  16  ? 3.973   -23.682 113.883 1.00 56.72  ? 114  GLN A NE2 1 
ATOM   106   N  N   . VAL A 1  17  ? 2.711   -19.042 116.429 1.00 32.22  ? 115  VAL A N   1 
ATOM   107   C  CA  . VAL A 1  17  ? 2.917   -17.772 115.749 1.00 26.52  ? 115  VAL A CA  1 
ATOM   108   C  C   . VAL A 1  17  ? 4.156   -17.815 114.862 1.00 24.23  ? 115  VAL A C   1 
ATOM   109   O  O   . VAL A 1  17  ? 4.639   -16.781 114.403 1.00 22.72  ? 115  VAL A O   1 
ATOM   110   C  CB  . VAL A 1  17  ? 3.057   -16.614 116.759 1.00 25.10  ? 115  VAL A CB  1 
ATOM   111   C  CG1 . VAL A 1  17  ? 1.825   -16.535 117.653 1.00 20.33  ? 115  VAL A CG1 1 
ATOM   112   C  CG2 . VAL A 1  17  ? 4.320   -16.782 117.593 1.00 21.40  ? 115  VAL A CG2 1 
ATOM   113   N  N   . ALA A 1  18  ? 4.657   -19.021 114.617 1.00 30.86  ? 116  ALA A N   1 
ATOM   114   C  CA  . ALA A 1  18  ? 5.836   -19.212 113.779 1.00 37.39  ? 116  ALA A CA  1 
ATOM   115   C  C   . ALA A 1  18  ? 5.769   -20.536 113.028 1.00 44.78  ? 116  ALA A C   1 
ATOM   116   O  O   . ALA A 1  18  ? 5.038   -21.446 113.426 1.00 46.79  ? 116  ALA A O   1 
ATOM   117   C  CB  . ALA A 1  18  ? 7.099   -19.145 114.619 1.00 34.58  ? 116  ALA A CB  1 
ATOM   118   N  N   . ASP A 1  19  ? 6.536   -20.627 111.943 1.00 44.41  ? 117  ASP A N   1 
ATOM   119   C  CA  . ASP A 1  19  ? 6.623   -21.836 111.126 1.00 42.39  ? 117  ASP A CA  1 
ATOM   120   C  C   . ASP A 1  19  ? 5.252   -22.306 110.652 1.00 40.65  ? 117  ASP A C   1 
ATOM   121   O  O   . ASP A 1  19  ? 4.972   -23.505 110.617 1.00 43.77  ? 117  ASP A O   1 
ATOM   122   C  CB  . ASP A 1  19  ? 7.321   -22.963 111.896 1.00 41.03  ? 117  ASP A CB  1 
ATOM   123   C  CG  . ASP A 1  19  ? 8.832   -22.862 111.834 1.00 43.63  ? 117  ASP A CG  1 
ATOM   124   O  OD1 . ASP A 1  19  ? 9.343   -21.820 111.368 1.00 44.66  ? 117  ASP A OD1 1 
ATOM   125   O  OD2 . ASP A 1  19  ? 9.511   -23.825 112.244 1.00 44.18  ? 117  ASP A OD2 1 
ATOM   126   N  N   . ILE A 1  20  ? 4.402   -21.354 110.284 1.00 33.74  ? 118  ILE A N   1 
ATOM   127   C  CA  . ILE A 1  20  ? 3.050   -21.662 109.840 1.00 33.44  ? 118  ILE A CA  1 
ATOM   128   C  C   . ILE A 1  20  ? 2.509   -20.489 109.029 1.00 36.37  ? 118  ILE A C   1 
ATOM   129   O  O   . ILE A 1  20  ? 2.952   -19.353 109.198 1.00 39.91  ? 118  ILE A O   1 
ATOM   130   C  CB  . ILE A 1  20  ? 2.118   -21.968 111.037 1.00 35.52  ? 118  ILE A CB  1 
ATOM   131   C  CG1 . ILE A 1  20  ? 0.816   -22.624 110.572 1.00 36.18  ? 118  ILE A CG1 1 
ATOM   132   C  CG2 . ILE A 1  20  ? 1.856   -20.710 111.858 1.00 34.64  ? 118  ILE A CG2 1 
ATOM   133   C  CD1 . ILE A 1  20  ? 0.079   -23.346 111.677 1.00 35.76  ? 118  ILE A CD1 1 
ATOM   134   N  N   . ASN A 1  21  ? 1.565   -20.766 108.138 1.00 36.01  ? 119  ASN A N   1 
ATOM   135   C  CA  . ASN A 1  21  ? 0.972   -19.724 107.311 1.00 38.12  ? 119  ASN A CA  1 
ATOM   136   C  C   . ASN A 1  21  ? -0.223  -19.066 107.993 1.00 31.38  ? 119  ASN A C   1 
ATOM   137   O  O   . ASN A 1  21  ? -0.848  -19.655 108.874 1.00 27.39  ? 119  ASN A O   1 
ATOM   138   C  CB  . ASN A 1  21  ? 0.540   -20.299 105.962 1.00 49.51  ? 119  ASN A CB  1 
ATOM   139   C  CG  . ASN A 1  21  ? 1.717   -20.688 105.090 1.00 61.78  ? 119  ASN A CG  1 
ATOM   140   O  OD1 . ASN A 1  21  ? 2.758   -20.030 105.100 1.00 63.92  ? 119  ASN A OD1 1 
ATOM   141   N  ND2 . ASN A 1  21  ? 1.558   -21.765 104.331 1.00 67.42  ? 119  ASN A ND2 1 
ATOM   142   N  N   . LEU A 1  22  ? -0.530  -17.838 107.588 1.00 31.82  ? 120  LEU A N   1 
ATOM   143   C  CA  . LEU A 1  22  ? -1.731  -17.160 108.058 1.00 31.84  ? 120  LEU A CA  1 
ATOM   144   C  C   . LEU A 1  22  ? -2.904  -17.493 107.141 1.00 34.78  ? 120  LEU A C   1 
ATOM   145   O  O   . LEU A 1  22  ? -2.753  -17.543 105.921 1.00 36.61  ? 120  LEU A O   1 
ATOM   146   C  CB  . LEU A 1  22  ? -1.512  -15.648 108.127 1.00 26.68  ? 120  LEU A CB  1 
ATOM   147   C  CG  . LEU A 1  22  ? -0.406  -15.170 109.072 1.00 25.60  ? 120  LEU A CG  1 
ATOM   148   C  CD1 . LEU A 1  22  ? -0.267  -13.656 109.018 1.00 23.93  ? 120  LEU A CD1 1 
ATOM   149   C  CD2 . LEU A 1  22  ? -0.669  -15.635 110.498 1.00 24.81  ? 120  LEU A CD2 1 
ATOM   150   N  N   . MET A 1  23  ? -4.069  -17.733 107.736 1.00 35.20  ? 121  MET A N   1 
ATOM   151   C  CA  . MET A 1  23  ? -5.238  -18.174 106.982 1.00 37.81  ? 121  MET A CA  1 
ATOM   152   C  C   . MET A 1  23  ? -6.126  -17.003 106.568 1.00 39.11  ? 121  MET A C   1 
ATOM   153   O  O   . MET A 1  23  ? -6.374  -16.091 107.355 1.00 37.78  ? 121  MET A O   1 
ATOM   154   C  CB  . MET A 1  23  ? -6.052  -19.179 107.801 1.00 41.16  ? 121  MET A CB  1 
ATOM   155   C  CG  . MET A 1  23  ? -7.191  -19.833 107.030 1.00 42.56  ? 121  MET A CG  1 
ATOM   156   S  SD  . MET A 1  23  ? -6.621  -21.173 105.962 1.00 92.14  ? 121  MET A SD  1 
ATOM   157   C  CE  . MET A 1  23  ? -6.747  -20.410 104.347 1.00 38.93  ? 121  MET A CE  1 
ATOM   158   N  N   . GLY A 1  24  ? -6.603  -17.034 105.328 1.00 45.19  ? 122  GLY A N   1 
ATOM   159   C  CA  . GLY A 1  24  ? -7.558  -16.046 104.861 1.00 43.44  ? 122  GLY A CA  1 
ATOM   160   C  C   . GLY A 1  24  ? -7.314  -15.550 103.448 1.00 37.88  ? 122  GLY A C   1 
ATOM   161   O  O   . GLY A 1  24  ? -8.169  -15.705 102.575 1.00 39.83  ? 122  GLY A O   1 
ATOM   162   N  N   . TYR A 1  25  ? -6.143  -14.968 103.212 1.00 28.10  ? 123  TYR A N   1 
ATOM   163   C  CA  . TYR A 1  25  ? -5.841  -14.378 101.914 1.00 29.02  ? 123  TYR A CA  1 
ATOM   164   C  C   . TYR A 1  25  ? -5.438  -15.431 100.893 1.00 36.45  ? 123  TYR A C   1 
ATOM   165   O  O   . TYR A 1  25  ? -5.428  -15.166 99.692  1.00 39.21  ? 123  TYR A O   1 
ATOM   166   C  CB  . TYR A 1  25  ? -4.732  -13.335 102.040 1.00 26.53  ? 123  TYR A CB  1 
ATOM   167   C  CG  . TYR A 1  25  ? -5.147  -12.067 102.751 1.00 25.83  ? 123  TYR A CG  1 
ATOM   168   C  CD1 . TYR A 1  25  ? -6.069  -11.197 102.180 1.00 24.80  ? 123  TYR A CD1 1 
ATOM   169   C  CD2 . TYR A 1  25  ? -4.613  -11.734 103.990 1.00 24.44  ? 123  TYR A CD2 1 
ATOM   170   C  CE1 . TYR A 1  25  ? -6.448  -10.035 102.824 1.00 23.01  ? 123  TYR A CE1 1 
ATOM   171   C  CE2 . TYR A 1  25  ? -4.984  -10.575 104.638 1.00 25.60  ? 123  TYR A CE2 1 
ATOM   172   C  CZ  . TYR A 1  25  ? -5.902  -9.730  104.053 1.00 25.03  ? 123  TYR A CZ  1 
ATOM   173   O  OH  . TYR A 1  25  ? -6.274  -8.574  104.701 1.00 25.66  ? 123  TYR A OH  1 
ATOM   174   N  N   . GLY A 1  26  ? -5.118  -16.628 101.376 1.00 38.66  ? 124  GLY A N   1 
ATOM   175   C  CA  . GLY A 1  26  ? -4.626  -17.687 100.516 1.00 43.01  ? 124  GLY A CA  1 
ATOM   176   C  C   . GLY A 1  26  ? -3.398  -17.251 99.741  1.00 50.33  ? 124  GLY A C   1 
ATOM   177   O  O   . GLY A 1  26  ? -3.197  -17.655 98.596  1.00 50.09  ? 124  GLY A O   1 
ATOM   178   N  N   . LYS A 1  27  ? -2.573  -16.419 100.370 1.00 54.20  ? 125  LYS A N   1 
ATOM   179   C  CA  . LYS A 1  27  ? -1.335  -15.968 99.752  1.00 53.78  ? 125  LYS A CA  1 
ATOM   180   C  C   . LYS A 1  27  ? -0.239  -16.986 100.015 1.00 56.51  ? 125  LYS A C   1 
ATOM   181   O  O   . LYS A 1  27  ? -0.188  -17.595 101.084 1.00 54.84  ? 125  LYS A O   1 
ATOM   182   C  CB  . LYS A 1  27  ? -0.928  -14.589 100.276 1.00 50.89  ? 125  LYS A CB  1 
ATOM   183   C  CG  . LYS A 1  27  ? -0.079  -13.795 99.295  1.00 51.78  ? 125  LYS A CG  1 
ATOM   184   C  CD  . LYS A 1  27  ? -0.799  -13.659 97.961  1.00 55.65  ? 125  LYS A CD  1 
ATOM   185   C  CE  . LYS A 1  27  ? 0.060   -12.969 96.916  1.00 57.40  ? 125  LYS A CE  1 
ATOM   186   N  NZ  . LYS A 1  27  ? -0.633  -12.904 95.597  1.00 57.09  ? 125  LYS A NZ  1 
ATOM   187   N  N   . SER A 1  28  ? 0.633   -17.169 99.030  1.00 61.08  ? 126  SER A N   1 
ATOM   188   C  CA  . SER A 1  28  ? 1.651   -18.212 99.083  1.00 60.88  ? 126  SER A CA  1 
ATOM   189   C  C   . SER A 1  28  ? 2.649   -18.015 100.221 1.00 55.46  ? 126  SER A C   1 
ATOM   190   O  O   . SER A 1  28  ? 2.847   -18.910 101.043 1.00 58.32  ? 126  SER A O   1 
ATOM   191   C  CB  . SER A 1  28  ? 2.397   -18.280 97.748  1.00 63.76  ? 126  SER A CB  1 
ATOM   192   O  OG  . SER A 1  28  ? 3.221   -19.430 97.681  1.00 67.04  ? 126  SER A OG  1 
ATOM   193   N  N   . GLY A 1  29  ? 3.270   -16.842 100.267 1.00 44.94  ? 127  GLY A N   1 
ATOM   194   C  CA  . GLY A 1  29  ? 4.343   -16.592 101.212 1.00 38.40  ? 127  GLY A CA  1 
ATOM   195   C  C   . GLY A 1  29  ? 3.967   -15.900 102.509 1.00 31.56  ? 127  GLY A C   1 
ATOM   196   O  O   . GLY A 1  29  ? 4.849   -15.458 103.246 1.00 27.82  ? 127  GLY A O   1 
ATOM   197   N  N   . GLN A 1  30  ? 2.675   -15.807 102.807 1.00 29.61  ? 128  GLN A N   1 
ATOM   198   C  CA  . GLN A 1  30  ? 2.248   -15.104 104.013 1.00 31.26  ? 128  GLN A CA  1 
ATOM   199   C  C   . GLN A 1  30  ? 2.340   -15.997 105.247 1.00 33.48  ? 128  GLN A C   1 
ATOM   200   O  O   . GLN A 1  30  ? 1.325   -16.432 105.791 1.00 29.03  ? 128  GLN A O   1 
ATOM   201   C  CB  . GLN A 1  30  ? 0.823   -14.569 103.862 1.00 23.33  ? 128  GLN A CB  1 
ATOM   202   C  CG  . GLN A 1  30  ? 0.508   -13.436 104.830 1.00 23.48  ? 128  GLN A CG  1 
ATOM   203   C  CD  . GLN A 1  30  ? -0.978  -13.173 104.987 1.00 26.27  ? 128  GLN A CD  1 
ATOM   204   O  OE1 . GLN A 1  30  ? -1.814  -13.927 104.487 1.00 31.69  ? 128  GLN A OE1 1 
ATOM   205   N  NE2 . GLN A 1  30  ? -1.314  -12.097 105.690 1.00 22.06  ? 128  GLN A NE2 1 
ATOM   206   N  N   . ASN A 1  31  ? 3.568   -16.261 105.682 1.00 37.54  ? 129  ASN A N   1 
ATOM   207   C  CA  . ASN A 1  31  ? 3.804   -17.063 106.876 1.00 35.85  ? 129  ASN A CA  1 
ATOM   208   C  C   . ASN A 1  31  ? 3.851   -16.195 108.128 1.00 30.51  ? 129  ASN A C   1 
ATOM   209   O  O   . ASN A 1  31  ? 4.150   -15.003 108.056 1.00 30.00  ? 129  ASN A O   1 
ATOM   210   C  CB  . ASN A 1  31  ? 5.105   -17.858 106.744 1.00 38.93  ? 129  ASN A CB  1 
ATOM   211   C  CG  . ASN A 1  31  ? 6.335   -16.967 106.694 1.00 39.27  ? 129  ASN A CG  1 
ATOM   212   O  OD1 . ASN A 1  31  ? 6.302   -15.867 106.142 1.00 38.02  ? 129  ASN A OD1 1 
ATOM   213   N  ND2 . ASN A 1  31  ? 7.432   -17.444 107.273 1.00 40.59  ? 129  ASN A ND2 1 
ATOM   214   N  N   . ALA A 1  32  ? 3.555   -16.800 109.273 1.00 26.09  ? 130  ALA A N   1 
ATOM   215   C  CA  . ALA A 1  32  ? 3.614   -16.100 110.550 1.00 23.92  ? 130  ALA A CA  1 
ATOM   216   C  C   . ALA A 1  32  ? 5.056   -15.920 111.014 1.00 25.13  ? 130  ALA A C   1 
ATOM   217   O  O   . ALA A 1  32  ? 5.858   -16.853 110.960 1.00 26.68  ? 130  ALA A O   1 
ATOM   218   C  CB  . ALA A 1  32  ? 2.810   -16.847 111.600 1.00 21.66  ? 130  ALA A CB  1 
ATOM   219   N  N   . GLN A 1  33  ? 5.382   -14.710 111.457 1.00 23.89  ? 131  GLN A N   1 
ATOM   220   C  CA  . GLN A 1  33  ? 6.715   -14.409 111.964 1.00 23.41  ? 131  GLN A CA  1 
ATOM   221   C  C   . GLN A 1  33  ? 6.633   -13.792 113.353 1.00 24.97  ? 131  GLN A C   1 
ATOM   222   O  O   . GLN A 1  33  ? 7.584   -13.168 113.822 1.00 26.09  ? 131  GLN A O   1 
ATOM   223   C  CB  . GLN A 1  33  ? 7.457   -13.462 111.020 1.00 24.03  ? 131  GLN A CB  1 
ATOM   224   C  CG  . GLN A 1  33  ? 7.767   -14.046 109.655 1.00 30.39  ? 131  GLN A CG  1 
ATOM   225   C  CD  . GLN A 1  33  ? 8.221   -12.988 108.670 1.00 33.30  ? 131  GLN A CD  1 
ATOM   226   O  OE1 . GLN A 1  33  ? 8.638   -11.897 109.061 1.00 32.70  ? 131  GLN A OE1 1 
ATOM   227   N  NE2 . GLN A 1  33  ? 8.144   -13.305 107.383 1.00 38.32  ? 131  GLN A NE2 1 
ATOM   228   N  N   . GLY A 1  34  ? 5.490   -13.969 114.007 1.00 21.88  ? 132  GLY A N   1 
ATOM   229   C  CA  . GLY A 1  34  ? 5.284   -13.404 115.325 1.00 25.29  ? 132  GLY A CA  1 
ATOM   230   C  C   . GLY A 1  34  ? 3.839   -13.044 115.611 1.00 27.39  ? 132  GLY A C   1 
ATOM   231   O  O   . GLY A 1  34  ? 2.921   -13.545 114.960 1.00 31.49  ? 132  GLY A O   1 
ATOM   232   N  N   . ILE A 1  35  ? 3.639   -12.157 116.580 1.00 25.26  ? 133  ILE A N   1 
ATOM   233   C  CA  . ILE A 1  35  ? 2.300   -11.834 117.054 1.00 24.39  ? 133  ILE A CA  1 
ATOM   234   C  C   . ILE A 1  35  ? 2.130   -10.338 117.330 1.00 24.92  ? 133  ILE A C   1 
ATOM   235   O  O   . ILE A 1  35  ? 3.001   -9.697  117.918 1.00 19.02  ? 133  ILE A O   1 
ATOM   236   C  CB  . ILE A 1  35  ? 1.960   -12.646 118.329 1.00 21.71  ? 133  ILE A CB  1 
ATOM   237   C  CG1 . ILE A 1  35  ? 0.583   -12.260 118.872 1.00 20.58  ? 133  ILE A CG1 1 
ATOM   238   C  CG2 . ILE A 1  35  ? 3.022   -12.450 119.398 1.00 19.35  ? 133  ILE A CG2 1 
ATOM   239   C  CD1 . ILE A 1  35  ? 0.093   -13.174 119.976 1.00 22.39  ? 133  ILE A CD1 1 
ATOM   240   N  N   . LEU A 1  36  ? 1.006   -9.787  116.881 1.00 20.76  ? 134  LEU A N   1 
ATOM   241   C  CA  . LEU A 1  36  ? 0.657   -8.401  117.166 1.00 19.04  ? 134  LEU A CA  1 
ATOM   242   C  C   . LEU A 1  36  ? -0.296  -8.346  118.354 1.00 18.46  ? 134  LEU A C   1 
ATOM   243   O  O   . LEU A 1  36  ? -0.177  -7.480  119.218 1.00 17.78  ? 134  LEU A O   1 
ATOM   244   C  CB  . LEU A 1  36  ? 0.024   -7.733  115.943 1.00 20.20  ? 134  LEU A CB  1 
ATOM   245   C  CG  . LEU A 1  36  ? -0.619  -6.359  116.168 1.00 19.65  ? 134  LEU A CG  1 
ATOM   246   C  CD1 . LEU A 1  36  ? 0.405   -5.357  116.683 1.00 21.68  ? 134  LEU A CD1 1 
ATOM   247   C  CD2 . LEU A 1  36  ? -1.283  -5.851  114.898 1.00 17.52  ? 134  LEU A CD2 1 
ATOM   248   N  N   . THR A 1  37  ? -1.247  -9.274  118.383 1.00 17.60  ? 135  THR A N   1 
ATOM   249   C  CA  . THR A 1  37  ? -2.146  -9.426  119.522 1.00 17.72  ? 135  THR A CA  1 
ATOM   250   C  C   . THR A 1  37  ? -2.667  -10.857 119.601 1.00 18.17  ? 135  THR A C   1 
ATOM   251   O  O   . THR A 1  37  ? -2.592  -11.607 118.629 1.00 16.75  ? 135  THR A O   1 
ATOM   252   C  CB  . THR A 1  37  ? -3.337  -8.452  119.448 1.00 21.05  ? 135  THR A CB  1 
ATOM   253   O  OG1 . THR A 1  37  ? -4.074  -8.503  120.676 1.00 20.59  ? 135  THR A OG1 1 
ATOM   254   C  CG2 . THR A 1  37  ? -4.256  -8.821  118.298 1.00 16.08  ? 135  THR A CG2 1 
ATOM   255   N  N   . ARG A 1  38  ? -3.196  -11.232 120.759 1.00 23.41  ? 136  ARG A N   1 
ATOM   256   C  CA  . ARG A 1  38  ? -3.685  -12.591 120.963 1.00 23.18  ? 136  ARG A CA  1 
ATOM   257   C  C   . ARG A 1  38  ? -5.064  -12.807 120.344 1.00 26.42  ? 136  ARG A C   1 
ATOM   258   O  O   . ARG A 1  38  ? -5.807  -11.857 120.098 1.00 15.85  ? 136  ARG A O   1 
ATOM   259   C  CB  . ARG A 1  38  ? -3.727  -12.922 122.457 1.00 22.67  ? 136  ARG A CB  1 
ATOM   260   C  CG  . ARG A 1  38  ? -2.358  -13.066 123.098 1.00 22.55  ? 136  ARG A CG  1 
ATOM   261   C  CD  . ARG A 1  38  ? -1.907  -14.516 123.088 1.00 22.15  ? 136  ARG A CD  1 
ATOM   262   N  NE  . ARG A 1  38  ? -0.483  -14.654 123.374 1.00 23.05  ? 136  ARG A NE  1 
ATOM   263   C  CZ  . ARG A 1  38  ? 0.155   -15.818 123.438 1.00 26.00  ? 136  ARG A CZ  1 
ATOM   264   N  NH1 . ARG A 1  38  ? -0.508  -16.950 123.243 1.00 27.16  ? 136  ARG A NH1 1 
ATOM   265   N  NH2 . ARG A 1  38  ? 1.454   -15.851 123.702 1.00 26.63  ? 136  ARG A NH2 1 
ATOM   266   N  N   . LEU A 1  39  ? -5.392  -14.070 120.092 1.00 24.50  ? 137  LEU A N   1 
ATOM   267   C  CA  . LEU A 1  39  ? -6.708  -14.441 119.587 1.00 20.97  ? 137  LEU A CA  1 
ATOM   268   C  C   . LEU A 1  39  ? -7.516  -15.114 120.686 1.00 18.84  ? 137  LEU A C   1 
ATOM   269   O  O   . LEU A 1  39  ? -7.034  -16.031 121.350 1.00 16.38  ? 137  LEU A O   1 
ATOM   270   C  CB  . LEU A 1  39  ? -6.582  -15.368 118.378 1.00 20.50  ? 137  LEU A CB  1 
ATOM   271   C  CG  . LEU A 1  39  ? -5.618  -14.909 117.287 1.00 22.01  ? 137  LEU A CG  1 
ATOM   272   C  CD1 . LEU A 1  39  ? -5.515  -15.951 116.187 1.00 16.66  ? 137  LEU A CD1 1 
ATOM   273   C  CD2 . LEU A 1  39  ? -6.069  -13.571 116.721 1.00 22.40  ? 137  LEU A CD2 1 
ATOM   274   N  N   . TYR A 1  40  ? -8.749  -14.660 120.877 1.00 19.08  ? 138  TYR A N   1 
ATOM   275   C  CA  . TYR A 1  40  ? -9.571  -15.191 121.954 1.00 19.13  ? 138  TYR A CA  1 
ATOM   276   C  C   . TYR A 1  40  ? -10.844 -15.860 121.462 1.00 21.29  ? 138  TYR A C   1 
ATOM   277   O  O   . TYR A 1  40  ? -11.391 -15.508 120.418 1.00 23.25  ? 138  TYR A O   1 
ATOM   278   C  CB  . TYR A 1  40  ? -9.936  -14.081 122.942 1.00 19.47  ? 138  TYR A CB  1 
ATOM   279   C  CG  . TYR A 1  40  ? -8.744  -13.314 123.461 1.00 27.52  ? 138  TYR A CG  1 
ATOM   280   C  CD1 . TYR A 1  40  ? -7.986  -13.805 124.515 1.00 30.71  ? 138  TYR A CD1 1 
ATOM   281   C  CD2 . TYR A 1  40  ? -8.382  -12.094 122.903 1.00 30.14  ? 138  TYR A CD2 1 
ATOM   282   C  CE1 . TYR A 1  40  ? -6.895  -13.107 124.995 1.00 31.74  ? 138  TYR A CE1 1 
ATOM   283   C  CE2 . TYR A 1  40  ? -7.292  -11.388 123.378 1.00 33.52  ? 138  TYR A CE2 1 
ATOM   284   C  CZ  . TYR A 1  40  ? -6.553  -11.900 124.424 1.00 34.29  ? 138  TYR A CZ  1 
ATOM   285   O  OH  . TYR A 1  40  ? -5.468  -11.204 124.901 1.00 37.11  ? 138  TYR A OH  1 
ATOM   286   N  N   . SER A 1  41  ? -11.295 -16.842 122.231 1.00 22.81  ? 139  SER A N   1 
ATOM   287   C  CA  . SER A 1  41  ? -12.629 -17.390 122.080 1.00 22.52  ? 139  SER A CA  1 
ATOM   288   C  C   . SER A 1  41  ? -13.511 -16.754 123.145 1.00 24.44  ? 139  SER A C   1 
ATOM   289   O  O   . SER A 1  41  ? -13.130 -16.685 124.313 1.00 16.34  ? 139  SER A O   1 
ATOM   290   C  CB  . SER A 1  41  ? -12.620 -18.915 122.208 1.00 22.69  ? 139  SER A CB  1 
ATOM   291   O  OG  . SER A 1  41  ? -13.935 -19.441 122.168 1.00 21.58  ? 139  SER A OG  1 
ATOM   292   N  N   . ARG A 1  42  ? -14.671 -16.256 122.737 1.00 23.06  ? 140  ARG A N   1 
ATOM   293   C  CA  . ARG A 1  42  ? -15.570 -15.586 123.666 1.00 20.30  ? 140  ARG A CA  1 
ATOM   294   C  C   . ARG A 1  42  ? -16.948 -16.234 123.652 1.00 17.87  ? 140  ARG A C   1 
ATOM   295   O  O   . ARG A 1  42  ? -17.663 -16.186 122.649 1.00 17.85  ? 140  ARG A O   1 
ATOM   296   C  CB  . ARG A 1  42  ? -15.666 -14.095 123.340 1.00 21.28  ? 140  ARG A CB  1 
ATOM   297   C  CG  . ARG A 1  42  ? -14.472 -13.287 123.835 1.00 19.21  ? 140  ARG A CG  1 
ATOM   298   C  CD  . ARG A 1  42  ? -14.560 -11.830 123.418 1.00 20.50  ? 140  ARG A CD  1 
ATOM   299   N  NE  . ARG A 1  42  ? -13.710 -11.548 122.266 1.00 28.95  ? 140  ARG A NE  1 
ATOM   300   C  CZ  . ARG A 1  42  ? -12.524 -10.951 122.338 1.00 24.54  ? 140  ARG A CZ  1 
ATOM   301   N  NH1 . ARG A 1  42  ? -12.048 -10.557 123.511 1.00 19.88  ? 140  ARG A NH1 1 
ATOM   302   N  NH2 . ARG A 1  42  ? -11.818 -10.740 121.236 1.00 25.96  ? 140  ARG A NH2 1 
ATOM   303   N  N   . ALA A 1  43  ? -17.310 -16.847 124.775 1.00 19.95  ? 141  ALA A N   1 
ATOM   304   C  CA  . ALA A 1  43  ? -18.539 -17.625 124.862 1.00 22.50  ? 141  ALA A CA  1 
ATOM   305   C  C   . ALA A 1  43  ? -19.600 -16.921 125.701 1.00 21.89  ? 141  ALA A C   1 
ATOM   306   O  O   . ALA A 1  43  ? -19.294 -16.274 126.703 1.00 22.93  ? 141  ALA A O   1 
ATOM   307   C  CB  . ALA A 1  43  ? -18.247 -19.004 125.434 1.00 17.50  ? 141  ALA A CB  1 
ATOM   308   N  N   . PHE A 1  44  ? -20.851 -17.054 125.276 1.00 20.62  ? 142  PHE A N   1 
ATOM   309   C  CA  . PHE A 1  44  ? -21.983 -16.484 125.996 1.00 22.82  ? 142  PHE A CA  1 
ATOM   310   C  C   . PHE A 1  44  ? -23.057 -17.546 126.194 1.00 24.43  ? 142  PHE A C   1 
ATOM   311   O  O   . PHE A 1  44  ? -23.578 -18.104 125.229 1.00 22.06  ? 142  PHE A O   1 
ATOM   312   C  CB  . PHE A 1  44  ? -22.556 -15.278 125.248 1.00 23.99  ? 142  PHE A CB  1 
ATOM   313   C  CG  . PHE A 1  44  ? -21.555 -14.187 124.997 1.00 25.60  ? 142  PHE A CG  1 
ATOM   314   C  CD1 . PHE A 1  44  ? -20.700 -14.249 123.908 1.00 28.02  ? 142  PHE A CD1 1 
ATOM   315   C  CD2 . PHE A 1  44  ? -21.469 -13.099 125.849 1.00 26.24  ? 142  PHE A CD2 1 
ATOM   316   C  CE1 . PHE A 1  44  ? -19.777 -13.248 123.676 1.00 28.59  ? 142  PHE A CE1 1 
ATOM   317   C  CE2 . PHE A 1  44  ? -20.550 -12.094 125.621 1.00 30.43  ? 142  PHE A CE2 1 
ATOM   318   C  CZ  . PHE A 1  44  ? -19.703 -12.168 124.534 1.00 29.95  ? 142  PHE A CZ  1 
ATOM   319   N  N   . ILE A 1  45  ? -23.381 -17.820 127.453 1.00 23.12  ? 143  ILE A N   1 
ATOM   320   C  CA  . ILE A 1  45  ? -24.353 -18.853 127.784 1.00 20.31  ? 143  ILE A CA  1 
ATOM   321   C  C   . ILE A 1  45  ? -25.590 -18.269 128.457 1.00 23.11  ? 143  ILE A C   1 
ATOM   322   O  O   . ILE A 1  45  ? -25.500 -17.641 129.511 1.00 20.99  ? 143  ILE A O   1 
ATOM   323   C  CB  . ILE A 1  45  ? -23.734 -19.925 128.703 1.00 24.67  ? 143  ILE A CB  1 
ATOM   324   C  CG1 . ILE A 1  45  ? -22.442 -20.467 128.087 1.00 19.82  ? 143  ILE A CG1 1 
ATOM   325   C  CG2 . ILE A 1  45  ? -24.726 -21.050 128.961 1.00 21.12  ? 143  ILE A CG2 1 
ATOM   326   C  CD1 . ILE A 1  45  ? -21.870 -21.662 128.814 1.00 20.40  ? 143  ILE A CD1 1 
ATOM   327   N  N   . MET A 1  46  ? -26.746 -18.478 127.835 1.00 25.31  ? 144  MET A N   1 
ATOM   328   C  CA  . MET A 1  46  ? -28.016 -18.075 128.424 1.00 28.85  ? 144  MET A CA  1 
ATOM   329   C  C   . MET A 1  46  ? -28.800 -19.303 128.868 1.00 30.72  ? 144  MET A C   1 
ATOM   330   O  O   . MET A 1  46  ? -28.717 -20.358 128.243 1.00 35.95  ? 144  MET A O   1 
ATOM   331   C  CB  . MET A 1  46  ? -28.846 -17.254 127.433 1.00 30.96  ? 144  MET A CB  1 
ATOM   332   C  CG  . MET A 1  46  ? -28.385 -15.815 127.254 1.00 30.81  ? 144  MET A CG  1 
ATOM   333   S  SD  . MET A 1  46  ? -26.736 -15.677 126.545 1.00 51.72  ? 144  MET A SD  1 
ATOM   334   C  CE  . MET A 1  46  ? -26.939 -16.621 125.034 1.00 45.18  ? 144  MET A CE  1 
ATOM   335   N  N   . ALA A 1  47  ? -29.555 -19.164 129.951 1.00 27.62  ? 145  ALA A N   1 
ATOM   336   C  CA  . ALA A 1  47  ? -30.397 -20.248 130.436 1.00 31.44  ? 145  ALA A CA  1 
ATOM   337   C  C   . ALA A 1  47  ? -31.682 -19.705 131.041 1.00 34.30  ? 145  ALA A C   1 
ATOM   338   O  O   . ALA A 1  47  ? -31.729 -18.564 131.500 1.00 35.97  ? 145  ALA A O   1 
ATOM   339   C  CB  . ALA A 1  47  ? -29.645 -21.092 131.456 1.00 33.56  ? 145  ALA A CB  1 
ATOM   340   N  N   . GLU A 1  48  ? -32.727 -20.525 131.034 1.00 36.87  ? 146  GLU A N   1 
ATOM   341   C  CA  . GLU A 1  48  ? -33.974 -20.176 131.706 1.00 44.02  ? 146  GLU A CA  1 
ATOM   342   C  C   . GLU A 1  48  ? -33.725 -20.086 133.210 1.00 51.67  ? 146  GLU A C   1 
ATOM   343   O  O   . GLU A 1  48  ? -32.755 -20.661 133.707 1.00 50.33  ? 146  GLU A O   1 
ATOM   344   C  CB  . GLU A 1  48  ? -35.065 -21.208 131.392 1.00 43.13  ? 146  GLU A CB  1 
ATOM   345   C  CG  . GLU A 1  48  ? -35.365 -21.385 129.908 1.00 42.85  ? 146  GLU A CG  1 
ATOM   346   C  CD  . GLU A 1  48  ? -36.250 -20.292 129.334 1.00 40.58  ? 146  GLU A CD  1 
ATOM   347   O  OE1 . GLU A 1  48  ? -36.410 -19.236 129.981 1.00 45.25  ? 146  GLU A OE1 1 
ATOM   348   O  OE2 . GLU A 1  48  ? -36.782 -20.490 128.221 1.00 34.57  ? 146  GLU A OE2 1 
ATOM   349   N  N   . PRO A 1  49  ? -34.583 -19.339 133.930 1.00 58.45  ? 147  PRO A N   1 
ATOM   350   C  CA  . PRO A 1  49  ? -34.501 -19.189 135.389 1.00 60.46  ? 147  PRO A CA  1 
ATOM   351   C  C   . PRO A 1  49  ? -34.183 -20.486 136.138 1.00 61.43  ? 147  PRO A C   1 
ATOM   352   O  O   . PRO A 1  49  ? -33.417 -20.459 137.101 1.00 65.13  ? 147  PRO A O   1 
ATOM   353   C  CB  . PRO A 1  49  ? -35.900 -18.690 135.754 1.00 61.07  ? 147  PRO A CB  1 
ATOM   354   C  CG  . PRO A 1  49  ? -36.326 -17.896 134.566 1.00 59.31  ? 147  PRO A CG  1 
ATOM   355   C  CD  . PRO A 1  49  ? -35.610 -18.452 133.352 1.00 58.60  ? 147  PRO A CD  1 
ATOM   356   N  N   . ASP A 1  50  ? -34.753 -21.601 135.696 1.00 57.77  ? 148  ASP A N   1 
ATOM   357   C  CA  . ASP A 1  50  ? -34.532 -22.883 136.356 1.00 56.75  ? 148  ASP A CA  1 
ATOM   358   C  C   . ASP A 1  50  ? -33.230 -23.552 135.915 1.00 54.29  ? 148  ASP A C   1 
ATOM   359   O  O   . ASP A 1  50  ? -32.825 -24.569 136.481 1.00 54.13  ? 148  ASP A O   1 
ATOM   360   C  CB  . ASP A 1  50  ? -35.714 -23.819 136.097 1.00 61.79  ? 148  ASP A CB  1 
ATOM   361   C  CG  . ASP A 1  50  ? -35.869 -24.171 134.630 1.00 65.14  ? 148  ASP A CG  1 
ATOM   362   O  OD1 . ASP A 1  50  ? -35.346 -23.425 133.776 1.00 65.91  ? 148  ASP A OD1 1 
ATOM   363   O  OD2 . ASP A 1  50  ? -36.517 -25.195 134.328 1.00 67.11  ? 148  ASP A OD2 1 
ATOM   364   N  N   . GLY A 1  51  ? -32.576 -22.980 134.906 1.00 52.72  ? 149  GLY A N   1 
ATOM   365   C  CA  . GLY A 1  51  ? -31.320 -23.520 134.409 1.00 48.45  ? 149  GLY A CA  1 
ATOM   366   C  C   . GLY A 1  51  ? -31.474 -24.407 133.187 1.00 42.68  ? 149  GLY A C   1 
ATOM   367   O  O   . GLY A 1  51  ? -30.495 -24.956 132.677 1.00 35.59  ? 149  GLY A O   1 
ATOM   368   N  N   . SER A 1  52  ? -32.707 -24.548 132.715 1.00 44.72  ? 150  SER A N   1 
ATOM   369   C  CA  . SER A 1  52  ? -32.995 -25.393 131.561 1.00 43.54  ? 150  SER A CA  1 
ATOM   370   C  C   . SER A 1  52  ? -32.916 -24.615 130.252 1.00 42.83  ? 150  SER A C   1 
ATOM   371   O  O   . SER A 1  52  ? -32.807 -23.388 130.255 1.00 37.94  ? 150  SER A O   1 
ATOM   372   C  CB  . SER A 1  52  ? -34.377 -26.029 131.699 1.00 41.06  ? 150  SER A CB  1 
ATOM   373   O  OG  . SER A 1  52  ? -35.395 -25.043 131.670 1.00 38.48  ? 150  SER A OG  1 
ATOM   374   N  N   . ASN A 1  53  ? -32.967 -25.346 129.141 1.00 45.72  ? 151  ASN A N   1 
ATOM   375   C  CA  . ASN A 1  53  ? -32.999 -24.758 127.802 1.00 45.08  ? 151  ASN A CA  1 
ATOM   376   C  C   . ASN A 1  53  ? -31.843 -23.796 127.534 1.00 39.80  ? 151  ASN A C   1 
ATOM   377   O  O   . ASN A 1  53  ? -32.060 -22.645 127.157 1.00 40.61  ? 151  ASN A O   1 
ATOM   378   C  CB  . ASN A 1  53  ? -34.331 -24.037 127.575 1.00 48.67  ? 151  ASN A CB  1 
ATOM   379   C  CG  . ASN A 1  53  ? -35.506 -24.993 127.498 1.00 51.85  ? 151  ASN A CG  1 
ATOM   380   O  OD1 . ASN A 1  53  ? -35.337 -26.180 127.218 1.00 55.09  ? 151  ASN A OD1 1 
ATOM   381   N  ND2 . ASN A 1  53  ? -36.704 -24.479 127.743 1.00 52.49  ? 151  ASN A ND2 1 
ATOM   382   N  N   . ARG A 1  54  ? -30.615 -24.269 127.727 1.00 33.35  ? 152  ARG A N   1 
ATOM   383   C  CA  . ARG A 1  54  ? -29.444 -23.417 127.549 1.00 25.92  ? 152  ARG A CA  1 
ATOM   384   C  C   . ARG A 1  54  ? -29.121 -23.163 126.096 1.00 22.94  ? 152  ARG A C   1 
ATOM   385   O  O   . ARG A 1  54  ? -29.399 -23.987 125.227 1.00 23.71  ? 152  ARG A O   1 
ATOM   386   C  CB  . ARG A 1  54  ? -28.213 -24.031 128.215 1.00 26.87  ? 152  ARG A CB  1 
ATOM   387   C  CG  . ARG A 1  54  ? -28.459 -24.525 129.612 1.00 31.68  ? 152  ARG A CG  1 
ATOM   388   C  CD  . ARG A 1  54  ? -27.159 -24.760 130.326 1.00 37.82  ? 152  ARG A CD  1 
ATOM   389   N  NE  . ARG A 1  54  ? -27.365 -25.059 131.733 1.00 44.84  ? 152  ARG A NE  1 
ATOM   390   C  CZ  . ARG A 1  54  ? -26.394 -25.058 132.635 1.00 46.35  ? 152  ARG A CZ  1 
ATOM   391   N  NH1 . ARG A 1  54  ? -25.146 -24.784 132.268 1.00 44.66  ? 152  ARG A NH1 1 
ATOM   392   N  NH2 . ARG A 1  54  ? -26.671 -25.344 133.899 1.00 49.02  ? 152  ARG A NH2 1 
ATOM   393   N  N   . THR A 1  55  ? -28.511 -22.012 125.851 1.00 21.31  ? 153  THR A N   1 
ATOM   394   C  CA  . THR A 1  55  ? -28.022 -21.670 124.529 1.00 26.41  ? 153  THR A CA  1 
ATOM   395   C  C   . THR A 1  55  ? -26.600 -21.129 124.636 1.00 25.29  ? 153  THR A C   1 
ATOM   396   O  O   . THR A 1  55  ? -26.286 -20.374 125.556 1.00 26.86  ? 153  THR A O   1 
ATOM   397   C  CB  . THR A 1  55  ? -28.914 -20.629 123.842 1.00 29.17  ? 153  THR A CB  1 
ATOM   398   O  OG1 . THR A 1  55  ? -29.002 -19.458 124.663 1.00 30.93  ? 153  THR A OG1 1 
ATOM   399   C  CG2 . THR A 1  55  ? -30.313 -21.194 123.597 1.00 26.08  ? 153  THR A CG2 1 
ATOM   400   N  N   . VAL A 1  56  ? -25.740 -21.519 123.700 1.00 25.05  ? 154  VAL A N   1 
ATOM   401   C  CA  . VAL A 1  56  ? -24.366 -21.027 123.678 1.00 20.98  ? 154  VAL A CA  1 
ATOM   402   C  C   . VAL A 1  56  ? -24.003 -20.360 122.358 1.00 18.02  ? 154  VAL A C   1 
ATOM   403   O  O   . VAL A 1  56  ? -24.113 -20.968 121.292 1.00 17.92  ? 154  VAL A O   1 
ATOM   404   C  CB  . VAL A 1  56  ? -23.355 -22.157 123.941 1.00 24.18  ? 154  VAL A CB  1 
ATOM   405   C  CG1 . VAL A 1  56  ? -21.950 -21.593 124.059 1.00 18.37  ? 154  VAL A CG1 1 
ATOM   406   C  CG2 . VAL A 1  56  ? -23.728 -22.913 125.195 1.00 27.13  ? 154  VAL A CG2 1 
ATOM   407   N  N   . PHE A 1  57  ? -23.567 -19.108 122.440 1.00 20.56  ? 155  PHE A N   1 
ATOM   408   C  CA  . PHE A 1  57  ? -23.001 -18.423 121.288 1.00 17.08  ? 155  PHE A CA  1 
ATOM   409   C  C   . PHE A 1  57  ? -21.524 -18.140 121.530 1.00 22.33  ? 155  PHE A C   1 
ATOM   410   O  O   . PHE A 1  57  ? -21.154 -17.528 122.533 1.00 16.79  ? 155  PHE A O   1 
ATOM   411   C  CB  . PHE A 1  57  ? -23.746 -17.120 120.995 1.00 17.03  ? 155  PHE A CB  1 
ATOM   412   C  CG  . PHE A 1  57  ? -23.151 -16.327 119.865 1.00 21.79  ? 155  PHE A CG  1 
ATOM   413   C  CD1 . PHE A 1  57  ? -23.457 -16.636 118.549 1.00 20.52  ? 155  PHE A CD1 1 
ATOM   414   C  CD2 . PHE A 1  57  ? -22.278 -15.279 120.116 1.00 18.68  ? 155  PHE A CD2 1 
ATOM   415   C  CE1 . PHE A 1  57  ? -22.908 -15.914 117.507 1.00 19.29  ? 155  PHE A CE1 1 
ATOM   416   C  CE2 . PHE A 1  57  ? -21.724 -14.554 119.078 1.00 18.72  ? 155  PHE A CE2 1 
ATOM   417   C  CZ  . PHE A 1  57  ? -22.040 -14.871 117.772 1.00 18.93  ? 155  PHE A CZ  1 
ATOM   418   N  N   . VAL A 1  58  ? -20.679 -18.590 120.610 1.00 16.46  ? 156  VAL A N   1 
ATOM   419   C  CA  . VAL A 1  58  ? -19.244 -18.391 120.747 1.00 19.31  ? 156  VAL A CA  1 
ATOM   420   C  C   . VAL A 1  58  ? -18.679 -17.637 119.552 1.00 17.82  ? 156  VAL A C   1 
ATOM   421   O  O   . VAL A 1  58  ? -18.777 -18.096 118.414 1.00 18.94  ? 156  VAL A O   1 
ATOM   422   C  CB  . VAL A 1  58  ? -18.497 -19.733 120.897 1.00 23.09  ? 156  VAL A CB  1 
ATOM   423   C  CG1 . VAL A 1  58  ? -17.023 -19.488 121.162 1.00 16.34  ? 156  VAL A CG1 1 
ATOM   424   C  CG2 . VAL A 1  58  ? -19.109 -20.565 122.013 1.00 17.01  ? 156  VAL A CG2 1 
ATOM   425   N  N   . SER A 1  59  ? -18.095 -16.474 119.818 1.00 16.52  ? 157  SER A N   1 
ATOM   426   C  CA  . SER A 1  59  ? -17.418 -15.704 118.784 1.00 17.15  ? 157  SER A CA  1 
ATOM   427   C  C   . SER A 1  59  ? -15.914 -15.920 118.901 1.00 17.45  ? 157  SER A C   1 
ATOM   428   O  O   . SER A 1  59  ? -15.316 -15.635 119.940 1.00 15.29  ? 157  SER A O   1 
ATOM   429   C  CB  . SER A 1  59  ? -17.765 -14.218 118.889 1.00 18.49  ? 157  SER A CB  1 
ATOM   430   O  OG  . SER A 1  59  ? -17.240 -13.497 117.787 1.00 15.03  ? 157  SER A OG  1 
ATOM   431   N  N   . ILE A 1  60  ? -15.312 -16.429 117.832 1.00 16.46  ? 158  ILE A N   1 
ATOM   432   C  CA  . ILE A 1  60  ? -13.919 -16.855 117.861 1.00 15.34  ? 158  ILE A CA  1 
ATOM   433   C  C   . ILE A 1  60  ? -13.040 -16.030 116.928 1.00 19.19  ? 158  ILE A C   1 
ATOM   434   O  O   . ILE A 1  60  ? -13.351 -15.876 115.748 1.00 20.88  ? 158  ILE A O   1 
ATOM   435   C  CB  . ILE A 1  60  ? -13.794 -18.342 117.478 1.00 15.66  ? 158  ILE A CB  1 
ATOM   436   C  CG1 . ILE A 1  60  ? -14.824 -19.173 118.247 1.00 15.86  ? 158  ILE A CG1 1 
ATOM   437   C  CG2 . ILE A 1  60  ? -12.382 -18.847 117.736 1.00 15.92  ? 158  ILE A CG2 1 
ATOM   438   C  CD1 . ILE A 1  60  ? -15.130 -20.511 117.613 1.00 16.20  ? 158  ILE A CD1 1 
ATOM   439   N  N   . ASP A 1  61  ? -11.948 -15.494 117.468 1.00 23.23  ? 159  ASP A N   1 
ATOM   440   C  CA  . ASP A 1  61  ? -10.961 -14.783 116.659 1.00 24.37  ? 159  ASP A CA  1 
ATOM   441   C  C   . ASP A 1  61  ? -10.269 -15.748 115.704 1.00 25.49  ? 159  ASP A C   1 
ATOM   442   O  O   . ASP A 1  61  ? -9.173  -16.235 115.983 1.00 31.49  ? 159  ASP A O   1 
ATOM   443   C  CB  . ASP A 1  61  ? -9.921  -14.094 117.545 1.00 23.73  ? 159  ASP A CB  1 
ATOM   444   C  CG  . ASP A 1  61  ? -10.502 -12.949 118.346 1.00 27.21  ? 159  ASP A CG  1 
ATOM   445   O  OD1 . ASP A 1  61  ? -11.383 -12.238 117.818 1.00 28.14  ? 159  ASP A OD1 1 
ATOM   446   O  OD2 . ASP A 1  61  ? -10.067 -12.753 119.500 1.00 27.61  ? 159  ASP A OD2 1 
ATOM   447   N  N   . ILE A 1  62  ? -10.917 -16.017 114.577 1.00 19.76  ? 160  ILE A N   1 
ATOM   448   C  CA  . ILE A 1  62  ? -10.421 -16.993 113.618 1.00 17.30  ? 160  ILE A CA  1 
ATOM   449   C  C   . ILE A 1  62  ? -11.005 -16.678 112.244 1.00 22.39  ? 160  ILE A C   1 
ATOM   450   O  O   . ILE A 1  62  ? -12.058 -16.042 112.141 1.00 25.55  ? 160  ILE A O   1 
ATOM   451   C  CB  . ILE A 1  62  ? -10.780 -18.436 114.049 1.00 22.90  ? 160  ILE A CB  1 
ATOM   452   C  CG1 . ILE A 1  62  ? -9.916  -19.465 113.317 1.00 24.33  ? 160  ILE A CG1 1 
ATOM   453   C  CG2 . ILE A 1  62  ? -12.268 -18.711 113.856 1.00 24.49  ? 160  ILE A CG2 1 
ATOM   454   C  CD1 . ILE A 1  62  ? -10.132 -20.884 113.802 1.00 23.34  ? 160  ILE A CD1 1 
ATOM   455   N  N   . GLY A 1  63  ? -10.317 -17.101 111.190 1.00 21.45  ? 161  GLY A N   1 
ATOM   456   C  CA  . GLY A 1  63  ? -10.766 -16.816 109.839 1.00 18.86  ? 161  GLY A CA  1 
ATOM   457   C  C   . GLY A 1  63  ? -12.070 -17.514 109.514 1.00 21.08  ? 161  GLY A C   1 
ATOM   458   O  O   . GLY A 1  63  ? -12.990 -16.905 108.972 1.00 18.26  ? 161  GLY A O   1 
ATOM   459   N  N   . MET A 1  64  ? -12.147 -18.798 109.854 1.00 27.00  ? 162  MET A N   1 
ATOM   460   C  CA  . MET A 1  64  ? -13.334 -19.612 109.600 1.00 26.54  ? 162  MET A CA  1 
ATOM   461   C  C   . MET A 1  64  ? -13.477 -20.668 110.687 1.00 27.46  ? 162  MET A C   1 
ATOM   462   O  O   . MET A 1  64  ? -12.481 -21.141 111.234 1.00 28.32  ? 162  MET A O   1 
ATOM   463   C  CB  . MET A 1  64  ? -13.264 -20.308 108.234 1.00 27.77  ? 162  MET A CB  1 
ATOM   464   C  CG  . MET A 1  64  ? -12.981 -19.408 107.043 1.00 30.90  ? 162  MET A CG  1 
ATOM   465   S  SD  . MET A 1  64  ? -11.221 -19.234 106.701 1.00 53.30  ? 162  MET A SD  1 
ATOM   466   C  CE  . MET A 1  64  ? -11.266 -18.346 105.145 1.00 46.12  ? 162  MET A CE  1 
ATOM   467   N  N   . VAL A 1  65  ? -14.713 -21.033 111.009 1.00 24.87  ? 163  VAL A N   1 
ATOM   468   C  CA  . VAL A 1  65  ? -14.955 -22.220 111.819 1.00 23.83  ? 163  VAL A CA  1 
ATOM   469   C  C   . VAL A 1  65  ? -15.111 -23.414 110.885 1.00 27.42  ? 163  VAL A C   1 
ATOM   470   O  O   . VAL A 1  65  ? -15.955 -23.402 109.989 1.00 32.33  ? 163  VAL A O   1 
ATOM   471   C  CB  . VAL A 1  65  ? -16.204 -22.079 112.705 1.00 25.26  ? 163  VAL A CB  1 
ATOM   472   C  CG1 . VAL A 1  65  ? -16.501 -23.396 113.410 1.00 17.26  ? 163  VAL A CG1 1 
ATOM   473   C  CG2 . VAL A 1  65  ? -16.008 -20.964 113.718 1.00 23.06  ? 163  VAL A CG2 1 
ATOM   474   N  N   . SER A 1  66  ? -14.296 -24.441 111.094 1.00 25.67  ? 164  SER A N   1 
ATOM   475   C  CA  . SER A 1  66  ? -14.292 -25.598 110.208 1.00 27.90  ? 164  SER A CA  1 
ATOM   476   C  C   . SER A 1  66  ? -15.155 -26.729 110.750 1.00 19.27  ? 164  SER A C   1 
ATOM   477   O  O   . SER A 1  66  ? -15.438 -26.787 111.946 1.00 19.79  ? 164  SER A O   1 
ATOM   478   C  CB  . SER A 1  66  ? -12.862 -26.097 109.986 1.00 19.51  ? 164  SER A CB  1 
ATOM   479   O  OG  . SER A 1  66  ? -12.319 -26.649 111.172 1.00 19.65  ? 164  SER A OG  1 
ATOM   480   N  N   . GLN A 1  67  ? -15.578 -27.615 109.851 1.00 19.87  ? 165  GLN A N   1 
ATOM   481   C  CA  . GLN A 1  67  ? -16.355 -28.792 110.216 1.00 24.81  ? 165  GLN A CA  1 
ATOM   482   C  C   . GLN A 1  67  ? -15.642 -29.595 111.298 1.00 28.18  ? 165  GLN A C   1 
ATOM   483   O  O   . GLN A 1  67  ? -16.245 -29.978 112.299 1.00 28.28  ? 165  GLN A O   1 
ATOM   484   C  CB  . GLN A 1  67  ? -16.603 -29.666 108.985 1.00 32.46  ? 165  GLN A CB  1 
ATOM   485   C  CG  . GLN A 1  67  ? -17.584 -30.806 109.204 1.00 41.16  ? 165  GLN A CG  1 
ATOM   486   C  CD  . GLN A 1  67  ? -19.029 -30.357 109.098 1.00 45.28  ? 165  GLN A CD  1 
ATOM   487   O  OE1 . GLN A 1  67  ? -19.588 -29.793 110.040 1.00 51.06  ? 165  GLN A OE1 1 
ATOM   488   N  NE2 . GLN A 1  67  ? -19.642 -30.601 107.943 1.00 37.93  ? 165  GLN A NE2 1 
ATOM   489   N  N   . ARG A 1  68  ? -14.349 -29.831 111.092 1.00 30.77  ? 166  ARG A N   1 
ATOM   490   C  CA  . ARG A 1  68  ? -13.545 -30.607 112.029 1.00 25.96  ? 166  ARG A CA  1 
ATOM   491   C  C   . ARG A 1  68  ? -13.446 -29.938 113.395 1.00 24.72  ? 166  ARG A C   1 
ATOM   492   O  O   . ARG A 1  68  ? -13.465 -30.611 114.428 1.00 22.65  ? 166  ARG A O   1 
ATOM   493   C  CB  . ARG A 1  68  ? -12.142 -30.838 111.471 1.00 29.09  ? 166  ARG A CB  1 
ATOM   494   C  CG  . ARG A 1  68  ? -11.259 -31.664 112.387 1.00 37.61  ? 166  ARG A CG  1 
ATOM   495   C  CD  . ARG A 1  68  ? -9.907  -31.952 111.771 1.00 43.63  ? 166  ARG A CD  1 
ATOM   496   N  NE  . ARG A 1  68  ? -9.163  -32.929 112.561 1.00 51.63  ? 166  ARG A NE  1 
ATOM   497   C  CZ  . ARG A 1  68  ? -9.300  -34.246 112.446 1.00 57.79  ? 166  ARG A CZ  1 
ATOM   498   N  NH1 . ARG A 1  68  ? -10.157 -34.753 111.570 1.00 58.33  ? 166  ARG A NH1 1 
ATOM   499   N  NH2 . ARG A 1  68  ? -8.580  -35.056 113.210 1.00 60.55  ? 166  ARG A NH2 1 
ATOM   500   N  N   . LEU A 1  69  ? -13.338 -28.614 113.398 1.00 25.29  ? 167  LEU A N   1 
ATOM   501   C  CA  . LEU A 1  69  ? -13.257 -27.871 114.647 1.00 26.77  ? 167  LEU A CA  1 
ATOM   502   C  C   . LEU A 1  69  ? -14.542 -28.023 115.449 1.00 25.51  ? 167  LEU A C   1 
ATOM   503   O  O   . LEU A 1  69  ? -14.504 -28.323 116.639 1.00 26.57  ? 167  LEU A O   1 
ATOM   504   C  CB  . LEU A 1  69  ? -12.970 -26.391 114.382 1.00 26.63  ? 167  LEU A CB  1 
ATOM   505   C  CG  . LEU A 1  69  ? -12.616 -25.580 115.630 1.00 28.08  ? 167  LEU A CG  1 
ATOM   506   C  CD1 . LEU A 1  69  ? -11.260 -25.998 116.169 1.00 28.62  ? 167  LEU A CD1 1 
ATOM   507   C  CD2 . LEU A 1  69  ? -12.638 -24.090 115.328 1.00 29.35  ? 167  LEU A CD2 1 
ATOM   508   N  N   . ARG A 1  70  ? -15.676 -27.831 114.785 1.00 23.02  ? 168  ARG A N   1 
ATOM   509   C  CA  . ARG A 1  70  ? -16.973 -27.921 115.446 1.00 26.02  ? 168  ARG A CA  1 
ATOM   510   C  C   . ARG A 1  70  ? -17.234 -29.320 115.993 1.00 26.08  ? 168  ARG A C   1 
ATOM   511   O  O   . ARG A 1  70  ? -17.701 -29.474 117.122 1.00 28.91  ? 168  ARG A O   1 
ATOM   512   C  CB  . ARG A 1  70  ? -18.097 -27.531 114.488 1.00 19.02  ? 168  ARG A CB  1 
ATOM   513   C  CG  . ARG A 1  70  ? -19.480 -27.882 115.006 1.00 19.19  ? 168  ARG A CG  1 
ATOM   514   C  CD  . ARG A 1  70  ? -20.568 -27.237 114.180 1.00 23.29  ? 168  ARG A CD  1 
ATOM   515   N  NE  . ARG A 1  70  ? -21.892 -27.739 114.526 1.00 25.87  ? 168  ARG A NE  1 
ATOM   516   C  CZ  . ARG A 1  70  ? -22.703 -27.164 115.409 1.00 25.06  ? 168  ARG A CZ  1 
ATOM   517   N  NH1 . ARG A 1  70  ? -22.328 -26.060 116.041 1.00 18.81  ? 168  ARG A NH1 1 
ATOM   518   N  NH2 . ARG A 1  70  ? -23.891 -27.696 115.659 1.00 26.63  ? 168  ARG A NH2 1 
ATOM   519   N  N   . LEU A 1  71  ? -16.921 -30.337 115.196 1.00 24.85  ? 169  LEU A N   1 
ATOM   520   C  CA  . LEU A 1  71  ? -17.179 -31.716 115.590 1.00 25.66  ? 169  LEU A CA  1 
ATOM   521   C  C   . LEU A 1  71  ? -16.330 -32.117 116.790 1.00 24.41  ? 169  LEU A C   1 
ATOM   522   O  O   . LEU A 1  71  ? -16.813 -32.781 117.706 1.00 26.63  ? 169  LEU A O   1 
ATOM   523   C  CB  . LEU A 1  71  ? -16.916 -32.669 114.423 1.00 22.26  ? 169  LEU A CB  1 
ATOM   524   C  CG  . LEU A 1  71  ? -17.885 -32.577 113.241 1.00 33.11  ? 169  LEU A CG  1 
ATOM   525   C  CD1 . LEU A 1  71  ? -17.498 -33.565 112.149 1.00 32.68  ? 169  LEU A CD1 1 
ATOM   526   C  CD2 . LEU A 1  71  ? -19.325 -32.796 113.692 1.00 25.38  ? 169  LEU A CD2 1 
ATOM   527   N  N   . GLU A 1  72  ? -15.066 -31.708 116.781 1.00 27.27  ? 170  GLU A N   1 
ATOM   528   C  CA  . GLU A 1  72  ? -14.165 -31.977 117.895 1.00 26.73  ? 170  GLU A CA  1 
ATOM   529   C  C   . GLU A 1  72  ? -14.644 -31.292 119.170 1.00 25.27  ? 170  GLU A C   1 
ATOM   530   O  O   . GLU A 1  72  ? -14.708 -31.913 120.231 1.00 26.66  ? 170  GLU A O   1 
ATOM   531   C  CB  . GLU A 1  72  ? -12.742 -31.532 117.554 1.00 24.59  ? 170  GLU A CB  1 
ATOM   532   C  CG  . GLU A 1  72  ? -11.701 -31.988 118.560 1.00 25.37  ? 170  GLU A CG  1 
ATOM   533   C  CD  . GLU A 1  72  ? -11.680 -33.495 118.732 1.00 31.65  ? 170  GLU A CD  1 
ATOM   534   O  OE1 . GLU A 1  72  ? -11.876 -34.216 117.730 1.00 30.77  ? 170  GLU A OE1 1 
ATOM   535   O  OE2 . GLU A 1  72  ? -11.467 -33.960 119.871 1.00 37.61  ? 170  GLU A OE2 1 
ATOM   536   N  N   . VAL A 1  73  ? -14.976 -30.010 119.056 1.00 24.57  ? 171  VAL A N   1 
ATOM   537   C  CA  . VAL A 1  73  ? -15.497 -29.237 120.179 1.00 25.72  ? 171  VAL A CA  1 
ATOM   538   C  C   . VAL A 1  73  ? -16.767 -29.860 120.756 1.00 27.17  ? 171  VAL A C   1 
ATOM   539   O  O   . VAL A 1  73  ? -16.890 -30.018 121.971 1.00 28.95  ? 171  VAL A O   1 
ATOM   540   C  CB  . VAL A 1  73  ? -15.787 -27.776 119.768 1.00 24.09  ? 171  VAL A CB  1 
ATOM   541   C  CG1 . VAL A 1  73  ? -16.602 -27.066 120.837 1.00 23.50  ? 171  VAL A CG1 1 
ATOM   542   C  CG2 . VAL A 1  73  ? -14.486 -27.033 119.502 1.00 22.82  ? 171  VAL A CG2 1 
ATOM   543   N  N   . LEU A 1  74  ? -17.697 -30.233 119.882 1.00 25.82  ? 172  LEU A N   1 
ATOM   544   C  CA  . LEU A 1  74  ? -18.968 -30.806 120.319 1.00 25.71  ? 172  LEU A CA  1 
ATOM   545   C  C   . LEU A 1  74  ? -18.807 -32.139 121.046 1.00 22.45  ? 172  LEU A C   1 
ATOM   546   O  O   . LEU A 1  74  ? -19.549 -32.429 121.984 1.00 34.73  ? 172  LEU A O   1 
ATOM   547   C  CB  . LEU A 1  74  ? -19.911 -30.990 119.129 1.00 26.65  ? 172  LEU A CB  1 
ATOM   548   C  CG  . LEU A 1  74  ? -20.540 -29.722 118.553 1.00 20.49  ? 172  LEU A CG  1 
ATOM   549   C  CD1 . LEU A 1  74  ? -21.311 -30.040 117.283 1.00 20.58  ? 172  LEU A CD1 1 
ATOM   550   C  CD2 . LEU A 1  74  ? -21.437 -29.061 119.584 1.00 20.35  ? 172  LEU A CD2 1 
ATOM   551   N  N   . ASN A 1  75  ? -17.846 -32.947 120.611 1.00 26.67  ? 173  ASN A N   1 
ATOM   552   C  CA  . ASN A 1  75  ? -17.589 -34.238 121.242 1.00 33.56  ? 173  ASN A CA  1 
ATOM   553   C  C   . ASN A 1  75  ? -17.102 -34.071 122.672 1.00 30.31  ? 173  ASN A C   1 
ATOM   554   O  O   . ASN A 1  75  ? -17.538 -34.780 123.582 1.00 28.84  ? 173  ASN A O   1 
ATOM   555   C  CB  . ASN A 1  75  ? -16.566 -35.037 120.438 1.00 42.08  ? 173  ASN A CB  1 
ATOM   556   C  CG  . ASN A 1  75  ? -17.104 -35.488 119.100 1.00 52.68  ? 173  ASN A CG  1 
ATOM   557   O  OD1 . ASN A 1  75  ? -18.313 -35.652 118.928 1.00 58.68  ? 173  ASN A OD1 1 
ATOM   558   N  ND2 . ASN A 1  75  ? -16.209 -35.695 118.142 1.00 54.59  ? 173  ASN A ND2 1 
ATOM   559   N  N   . ARG A 1  76  ? -16.193 -33.120 122.854 1.00 28.48  ? 174  ARG A N   1 
ATOM   560   C  CA  . ARG A 1  76  ? -15.600 -32.853 124.154 1.00 32.23  ? 174  ARG A CA  1 
ATOM   561   C  C   . ARG A 1  76  ? -16.603 -32.176 125.079 1.00 32.25  ? 174  ARG A C   1 
ATOM   562   O  O   . ARG A 1  76  ? -16.571 -32.378 126.291 1.00 36.11  ? 174  ARG A O   1 
ATOM   563   C  CB  . ARG A 1  76  ? -14.344 -31.997 123.991 1.00 36.00  ? 174  ARG A CB  1 
ATOM   564   C  CG  . ARG A 1  76  ? -13.309 -32.638 123.082 1.00 37.65  ? 174  ARG A CG  1 
ATOM   565   C  CD  . ARG A 1  76  ? -12.001 -31.887 123.102 1.00 43.24  ? 174  ARG A CD  1 
ATOM   566   N  NE  . ARG A 1  76  ? -11.017 -32.485 122.208 1.00 50.28  ? 174  ARG A NE  1 
ATOM   567   C  CZ  . ARG A 1  76  ? -9.759  -32.074 122.116 1.00 50.10  ? 174  ARG A CZ  1 
ATOM   568   N  NH1 . ARG A 1  76  ? -9.340  -31.065 122.865 1.00 48.14  ? 174  ARG A NH1 1 
ATOM   569   N  NH2 . ARG A 1  76  ? -8.922  -32.670 121.280 1.00 50.21  ? 174  ARG A NH2 1 
ATOM   570   N  N   . LEU A 1  77  ? -17.499 -31.381 124.500 1.00 30.87  ? 175  LEU A N   1 
ATOM   571   C  CA  . LEU A 1  77  ? -18.593 -30.780 125.258 1.00 29.56  ? 175  LEU A CA  1 
ATOM   572   C  C   . LEU A 1  77  ? -19.512 -31.853 125.832 1.00 32.94  ? 175  LEU A C   1 
ATOM   573   O  O   . LEU A 1  77  ? -19.951 -31.755 126.978 1.00 35.47  ? 175  LEU A O   1 
ATOM   574   C  CB  . LEU A 1  77  ? -19.392 -29.810 124.383 1.00 25.07  ? 175  LEU A CB  1 
ATOM   575   C  CG  . LEU A 1  77  ? -18.736 -28.454 124.103 1.00 23.82  ? 175  LEU A CG  1 
ATOM   576   C  CD1 . LEU A 1  77  ? -19.598 -27.616 123.172 1.00 20.27  ? 175  LEU A CD1 1 
ATOM   577   C  CD2 . LEU A 1  77  ? -18.454 -27.709 125.400 1.00 21.01  ? 175  LEU A CD2 1 
ATOM   578   N  N   . GLN A 1  78  ? -19.799 -32.877 125.032 1.00 32.69  ? 176  GLN A N   1 
ATOM   579   C  CA  . GLN A 1  78  ? -20.632 -33.987 125.484 1.00 33.19  ? 176  GLN A CA  1 
ATOM   580   C  C   . GLN A 1  78  ? -19.967 -34.762 126.614 1.00 31.56  ? 176  GLN A C   1 
ATOM   581   O  O   . GLN A 1  78  ? -20.614 -35.115 127.599 1.00 32.37  ? 176  GLN A O   1 
ATOM   582   C  CB  . GLN A 1  78  ? -20.953 -34.940 124.331 1.00 38.01  ? 176  GLN A CB  1 
ATOM   583   C  CG  . GLN A 1  78  ? -21.914 -36.054 124.730 1.00 47.30  ? 176  GLN A CG  1 
ATOM   584   C  CD  . GLN A 1  78  ? -22.057 -37.124 123.669 1.00 55.86  ? 176  GLN A CD  1 
ATOM   585   O  OE1 . GLN A 1  78  ? -21.974 -36.846 122.474 1.00 59.19  ? 176  GLN A OE1 1 
ATOM   586   N  NE2 . GLN A 1  78  ? -22.263 -38.362 124.104 1.00 59.10  ? 176  GLN A NE2 1 
ATOM   587   N  N   . SER A 1  79  ? -18.673 -35.027 126.457 1.00 30.74  ? 177  SER A N   1 
ATOM   588   C  CA  . SER A 1  79  ? -17.898 -35.744 127.464 1.00 33.29  ? 177  SER A CA  1 
ATOM   589   C  C   . SER A 1  79  ? -17.978 -35.082 128.834 1.00 32.17  ? 177  SER A C   1 
ATOM   590   O  O   . SER A 1  79  ? -18.113 -35.759 129.852 1.00 38.52  ? 177  SER A O   1 
ATOM   591   C  CB  . SER A 1  79  ? -16.435 -35.855 127.030 1.00 35.21  ? 177  SER A CB  1 
ATOM   592   O  OG  . SER A 1  79  ? -16.312 -36.610 125.839 1.00 38.57  ? 177  SER A OG  1 
ATOM   593   N  N   . LYS A 1  80  ? -17.896 -33.756 128.854 1.00 30.92  ? 178  LYS A N   1 
ATOM   594   C  CA  . LYS A 1  80  ? -17.864 -33.017 130.109 1.00 33.89  ? 178  LYS A CA  1 
ATOM   595   C  C   . LYS A 1  80  ? -19.249 -32.585 130.598 1.00 37.44  ? 178  LYS A C   1 
ATOM   596   O  O   . LYS A 1  80  ? -19.500 -32.557 131.803 1.00 43.78  ? 178  LYS A O   1 
ATOM   597   C  CB  . LYS A 1  80  ? -16.962 -31.787 129.971 1.00 33.16  ? 178  LYS A CB  1 
ATOM   598   C  CG  . LYS A 1  80  ? -16.817 -30.988 131.253 1.00 39.59  ? 178  LYS A CG  1 
ATOM   599   C  CD  . LYS A 1  80  ? -15.678 -29.989 131.168 1.00 41.11  ? 178  LYS A CD  1 
ATOM   600   C  CE  . LYS A 1  80  ? -15.268 -29.521 132.554 1.00 47.47  ? 178  LYS A CE  1 
ATOM   601   N  NZ  . LYS A 1  80  ? -14.002 -28.737 132.530 1.00 52.37  ? 178  LYS A NZ  1 
ATOM   602   N  N   . TYR A 1  81  ? -20.151 -32.265 129.674 1.00 31.82  ? 179  TYR A N   1 
ATOM   603   C  CA  . TYR A 1  81  ? -21.425 -31.661 130.062 1.00 32.38  ? 179  TYR A CA  1 
ATOM   604   C  C   . TYR A 1  81  ? -22.658 -32.501 129.738 1.00 35.25  ? 179  TYR A C   1 
ATOM   605   O  O   . TYR A 1  81  ? -23.773 -32.141 130.116 1.00 36.64  ? 179  TYR A O   1 
ATOM   606   C  CB  . TYR A 1  81  ? -21.564 -30.288 129.405 1.00 29.13  ? 179  TYR A CB  1 
ATOM   607   C  CG  . TYR A 1  81  ? -20.506 -29.309 129.853 1.00 28.53  ? 179  TYR A CG  1 
ATOM   608   C  CD1 . TYR A 1  81  ? -20.566 -28.723 131.110 1.00 30.18  ? 179  TYR A CD1 1 
ATOM   609   C  CD2 . TYR A 1  81  ? -19.442 -28.976 129.023 1.00 26.46  ? 179  TYR A CD2 1 
ATOM   610   C  CE1 . TYR A 1  81  ? -19.599 -27.831 131.528 1.00 33.76  ? 179  TYR A CE1 1 
ATOM   611   C  CE2 . TYR A 1  81  ? -18.471 -28.084 129.432 1.00 23.61  ? 179  TYR A CE2 1 
ATOM   612   C  CZ  . TYR A 1  81  ? -18.555 -27.515 130.685 1.00 23.45  ? 179  TYR A CZ  1 
ATOM   613   O  OH  . TYR A 1  81  ? -17.595 -26.628 131.102 1.00 23.13  ? 179  TYR A OH  1 
ATOM   614   N  N   . GLY A 1  82  ? -22.466 -33.614 129.039 1.00 33.57  ? 180  GLY A N   1 
ATOM   615   C  CA  . GLY A 1  82  ? -23.580 -34.480 128.699 1.00 34.72  ? 180  GLY A CA  1 
ATOM   616   C  C   . GLY A 1  82  ? -24.533 -33.865 127.692 1.00 35.69  ? 180  GLY A C   1 
ATOM   617   O  O   . GLY A 1  82  ? -24.142 -33.546 126.569 1.00 35.70  ? 180  GLY A O   1 
ATOM   618   N  N   . SER A 1  83  ? -25.787 -33.693 128.098 1.00 36.24  ? 181  SER A N   1 
ATOM   619   C  CA  . SER A 1  83  ? -26.823 -33.197 127.196 1.00 37.22  ? 181  SER A CA  1 
ATOM   620   C  C   . SER A 1  83  ? -27.003 -31.685 127.280 1.00 36.14  ? 181  SER A C   1 
ATOM   621   O  O   . SER A 1  83  ? -27.870 -31.124 126.610 1.00 40.89  ? 181  SER A O   1 
ATOM   622   C  CB  . SER A 1  83  ? -28.157 -33.886 127.495 1.00 40.31  ? 181  SER A CB  1 
ATOM   623   O  OG  . SER A 1  83  ? -28.043 -35.294 127.390 1.00 45.46  ? 181  SER A OG  1 
ATOM   624   N  N   . LEU A 1  84  ? -26.187 -31.029 128.100 1.00 29.27  ? 182  LEU A N   1 
ATOM   625   C  CA  . LEU A 1  84  ? -26.316 -29.591 128.310 1.00 27.55  ? 182  LEU A CA  1 
ATOM   626   C  C   . LEU A 1  84  ? -26.046 -28.810 127.032 1.00 28.86  ? 182  LEU A C   1 
ATOM   627   O  O   . LEU A 1  84  ? -26.833 -27.947 126.640 1.00 23.27  ? 182  LEU A O   1 
ATOM   628   C  CB  . LEU A 1  84  ? -25.367 -29.114 129.413 1.00 28.34  ? 182  LEU A CB  1 
ATOM   629   C  CG  . LEU A 1  84  ? -25.805 -29.340 130.861 1.00 34.08  ? 182  LEU A CG  1 
ATOM   630   C  CD1 . LEU A 1  84  ? -24.808 -28.709 131.820 1.00 26.02  ? 182  LEU A CD1 1 
ATOM   631   C  CD2 . LEU A 1  84  ? -27.204 -28.788 131.094 1.00 26.36  ? 182  LEU A CD2 1 
ATOM   632   N  N   . TYR A 1  85  ? -24.935 -29.130 126.376 1.00 26.67  ? 183  TYR A N   1 
ATOM   633   C  CA  . TYR A 1  85  ? -24.534 -28.418 125.172 1.00 25.36  ? 183  TYR A CA  1 
ATOM   634   C  C   . TYR A 1  85  ? -24.441 -29.362 123.981 1.00 25.54  ? 183  TYR A C   1 
ATOM   635   O  O   . TYR A 1  85  ? -23.538 -30.196 123.899 1.00 25.89  ? 183  TYR A O   1 
ATOM   636   C  CB  . TYR A 1  85  ? -23.202 -27.708 125.409 1.00 23.34  ? 183  TYR A CB  1 
ATOM   637   C  CG  . TYR A 1  85  ? -23.213 -26.886 126.677 1.00 22.90  ? 183  TYR A CG  1 
ATOM   638   C  CD1 . TYR A 1  85  ? -24.110 -25.841 126.836 1.00 24.01  ? 183  TYR A CD1 1 
ATOM   639   C  CD2 . TYR A 1  85  ? -22.340 -27.164 127.719 1.00 25.25  ? 183  TYR A CD2 1 
ATOM   640   C  CE1 . TYR A 1  85  ? -24.135 -25.087 127.993 1.00 25.77  ? 183  TYR A CE1 1 
ATOM   641   C  CE2 . TYR A 1  85  ? -22.357 -26.415 128.883 1.00 27.23  ? 183  TYR A CE2 1 
ATOM   642   C  CZ  . TYR A 1  85  ? -23.258 -25.378 129.013 1.00 27.37  ? 183  TYR A CZ  1 
ATOM   643   O  OH  . TYR A 1  85  ? -23.286 -24.626 130.164 1.00 27.35  ? 183  TYR A OH  1 
ATOM   644   N  N   . ARG A 1  86  ? -25.392 -29.222 123.063 1.00 26.06  ? 184  ARG A N   1 
ATOM   645   C  CA  . ARG A 1  86  ? -25.543 -30.144 121.945 1.00 25.84  ? 184  ARG A CA  1 
ATOM   646   C  C   . ARG A 1  86  ? -25.265 -29.443 120.621 1.00 26.18  ? 184  ARG A C   1 
ATOM   647   O  O   . ARG A 1  86  ? -24.884 -28.272 120.597 1.00 30.20  ? 184  ARG A O   1 
ATOM   648   C  CB  . ARG A 1  86  ? -26.949 -30.742 121.936 1.00 26.41  ? 184  ARG A CB  1 
ATOM   649   C  CG  . ARG A 1  86  ? -27.420 -31.243 123.290 1.00 24.94  ? 184  ARG A CG  1 
ATOM   650   C  CD  . ARG A 1  86  ? -28.920 -31.468 123.290 1.00 24.43  ? 184  ARG A CD  1 
ATOM   651   N  NE  . ARG A 1  86  ? -29.651 -30.234 123.018 1.00 24.52  ? 184  ARG A NE  1 
ATOM   652   C  CZ  . ARG A 1  86  ? -29.961 -29.328 123.939 1.00 23.91  ? 184  ARG A CZ  1 
ATOM   653   N  NH1 . ARG A 1  86  ? -29.611 -29.519 125.203 1.00 28.63  ? 184  ARG A NH1 1 
ATOM   654   N  NH2 . ARG A 1  86  ? -30.626 -28.234 123.596 1.00 23.52  ? 184  ARG A NH2 1 
ATOM   655   N  N   . ARG A 1  87  ? -25.454 -30.163 119.521 1.00 25.50  ? 185  ARG A N   1 
ATOM   656   C  CA  . ARG A 1  87  ? -25.259 -29.592 118.192 1.00 26.87  ? 185  ARG A CA  1 
ATOM   657   C  C   . ARG A 1  87  ? -26.261 -28.474 117.886 1.00 25.19  ? 185  ARG A C   1 
ATOM   658   O  O   . ARG A 1  87  ? -25.989 -27.600 117.066 1.00 24.47  ? 185  ARG A O   1 
ATOM   659   C  CB  . ARG A 1  87  ? -25.364 -30.684 117.119 1.00 28.36  ? 185  ARG A CB  1 
ATOM   660   C  CG  . ARG A 1  87  ? -26.778 -31.198 116.884 1.00 31.14  ? 185  ARG A CG  1 
ATOM   661   C  CD  . ARG A 1  87  ? -26.831 -32.190 115.731 1.00 35.82  ? 185  ARG A CD  1 
ATOM   662   N  NE  . ARG A 1  87  ? -26.543 -33.553 116.167 1.00 43.25  ? 185  ARG A NE  1 
ATOM   663   C  CZ  . ARG A 1  87  ? -27.473 -34.476 116.393 1.00 45.43  ? 185  ARG A CZ  1 
ATOM   664   N  NH1 . ARG A 1  87  ? -28.755 -34.187 116.217 1.00 45.20  ? 185  ARG A NH1 1 
ATOM   665   N  NH2 . ARG A 1  87  ? -27.121 -35.692 116.790 1.00 44.52  ? 185  ARG A NH2 1 
ATOM   666   N  N   . ASP A 1  88  ? -27.415 -28.506 118.549 1.00 25.54  ? 186  ASP A N   1 
ATOM   667   C  CA  . ASP A 1  88  ? -28.505 -27.585 118.230 1.00 24.68  ? 186  ASP A CA  1 
ATOM   668   C  C   . ASP A 1  88  ? -28.466 -26.264 118.998 1.00 25.11  ? 186  ASP A C   1 
ATOM   669   O  O   . ASP A 1  88  ? -28.924 -25.240 118.492 1.00 24.48  ? 186  ASP A O   1 
ATOM   670   C  CB  . ASP A 1  88  ? -29.857 -28.268 118.464 1.00 24.40  ? 186  ASP A CB  1 
ATOM   671   C  CG  . ASP A 1  88  ? -30.047 -28.713 119.900 1.00 28.33  ? 186  ASP A CG  1 
ATOM   672   O  OD1 . ASP A 1  88  ? -29.514 -29.781 120.268 1.00 28.54  ? 186  ASP A OD1 1 
ATOM   673   O  OD2 . ASP A 1  88  ? -30.732 -27.998 120.661 1.00 22.48  ? 186  ASP A OD2 1 
ATOM   674   N  N   . ASN A 1  89  ? -27.930 -26.285 120.213 1.00 20.58  ? 187  ASN A N   1 
ATOM   675   C  CA  . ASN A 1  89  ? -27.915 -25.087 121.047 1.00 20.33  ? 187  ASN A CA  1 
ATOM   676   C  C   . ASN A 1  89  ? -26.521 -24.482 121.211 1.00 24.32  ? 187  ASN A C   1 
ATOM   677   O  O   . ASN A 1  89  ? -26.286 -23.689 122.122 1.00 25.22  ? 187  ASN A O   1 
ATOM   678   C  CB  . ASN A 1  89  ? -28.512 -25.393 122.421 1.00 21.07  ? 187  ASN A CB  1 
ATOM   679   C  CG  . ASN A 1  89  ? -27.715 -26.429 123.186 1.00 21.45  ? 187  ASN A CG  1 
ATOM   680   O  OD1 . ASN A 1  89  ? -27.122 -27.333 122.596 1.00 23.74  ? 187  ASN A OD1 1 
ATOM   681   N  ND2 . ASN A 1  89  ? -27.693 -26.301 124.508 1.00 21.88  ? 187  ASN A ND2 1 
ATOM   682   N  N   . VAL A 1  90  ? -25.601 -24.856 120.330 1.00 20.42  ? 188  VAL A N   1 
ATOM   683   C  CA  . VAL A 1  90  ? -24.262 -24.277 120.342 1.00 19.05  ? 188  VAL A CA  1 
ATOM   684   C  C   . VAL A 1  90  ? -23.887 -23.705 118.979 1.00 22.09  ? 188  VAL A C   1 
ATOM   685   O  O   . VAL A 1  90  ? -23.832 -24.430 117.986 1.00 21.26  ? 188  VAL A O   1 
ATOM   686   C  CB  . VAL A 1  90  ? -23.199 -25.312 120.759 1.00 20.31  ? 188  VAL A CB  1 
ATOM   687   C  CG1 . VAL A 1  90  ? -21.802 -24.716 120.649 1.00 18.51  ? 188  VAL A CG1 1 
ATOM   688   C  CG2 . VAL A 1  90  ? -23.464 -25.810 122.171 1.00 20.87  ? 188  VAL A CG2 1 
ATOM   689   N  N   . ILE A 1  91  ? -23.634 -22.401 118.936 1.00 17.74  ? 189  ILE A N   1 
ATOM   690   C  CA  . ILE A 1  91  ? -23.157 -21.756 117.718 1.00 20.19  ? 189  ILE A CA  1 
ATOM   691   C  C   . ILE A 1  91  ? -21.689 -21.356 117.845 1.00 20.71  ? 189  ILE A C   1 
ATOM   692   O  O   . ILE A 1  91  ? -21.311 -20.630 118.765 1.00 17.59  ? 189  ILE A O   1 
ATOM   693   C  CB  . ILE A 1  91  ? -23.989 -20.507 117.371 1.00 19.47  ? 189  ILE A CB  1 
ATOM   694   C  CG1 . ILE A 1  91  ? -25.418 -20.901 117.001 1.00 22.52  ? 189  ILE A CG1 1 
ATOM   695   C  CG2 . ILE A 1  91  ? -23.355 -19.744 116.222 1.00 16.95  ? 189  ILE A CG2 1 
ATOM   696   C  CD1 . ILE A 1  91  ? -26.358 -19.721 116.860 1.00 23.21  ? 189  ILE A CD1 1 
ATOM   697   N  N   . LEU A 1  92  ? -20.866 -21.831 116.915 1.00 23.98  ? 190  LEU A N   1 
ATOM   698   C  CA  . LEU A 1  92  ? -19.463 -21.437 116.864 1.00 23.52  ? 190  LEU A CA  1 
ATOM   699   C  C   . LEU A 1  92  ? -19.236 -20.529 115.663 1.00 24.50  ? 190  LEU A C   1 
ATOM   700   O  O   . LEU A 1  92  ? -19.310 -20.977 114.520 1.00 23.12  ? 190  LEU A O   1 
ATOM   701   C  CB  . LEU A 1  92  ? -18.554 -22.666 116.788 1.00 21.98  ? 190  LEU A CB  1 
ATOM   702   C  CG  . LEU A 1  92  ? -18.723 -23.716 117.889 1.00 20.45  ? 190  LEU A CG  1 
ATOM   703   C  CD1 . LEU A 1  92  ? -17.756 -24.872 117.688 1.00 21.21  ? 190  LEU A CD1 1 
ATOM   704   C  CD2 . LEU A 1  92  ? -18.539 -23.094 119.265 1.00 18.35  ? 190  LEU A CD2 1 
ATOM   705   N  N   . SER A 1  93  ? -18.953 -19.257 115.924 1.00 15.93  ? 191  SER A N   1 
ATOM   706   C  CA  . SER A 1  93  ? -18.836 -18.272 114.854 1.00 17.12  ? 191  SER A CA  1 
ATOM   707   C  C   . SER A 1  93  ? -17.442 -17.666 114.782 1.00 15.53  ? 191  SER A C   1 
ATOM   708   O  O   . SER A 1  93  ? -16.861 -17.293 115.800 1.00 15.40  ? 191  SER A O   1 
ATOM   709   C  CB  . SER A 1  93  ? -19.871 -17.160 115.038 1.00 20.07  ? 191  SER A CB  1 
ATOM   710   O  OG  . SER A 1  93  ? -19.713 -16.145 114.061 1.00 19.28  ? 191  SER A OG  1 
ATOM   711   N  N   . GLY A 1  94  ? -16.916 -17.559 113.567 1.00 15.59  ? 192  GLY A N   1 
ATOM   712   C  CA  . GLY A 1  94  ? -15.614 -16.959 113.351 1.00 15.51  ? 192  GLY A CA  1 
ATOM   713   C  C   . GLY A 1  94  ? -15.728 -15.486 113.016 1.00 18.39  ? 192  GLY A C   1 
ATOM   714   O  O   . GLY A 1  94  ? -16.596 -15.080 112.244 1.00 16.63  ? 192  GLY A O   1 
ATOM   715   N  N   . THR A 1  95  ? -14.846 -14.685 113.604 1.00 19.42  ? 193  THR A N   1 
ATOM   716   C  CA  . THR A 1  95  ? -14.829 -13.245 113.372 1.00 18.18  ? 193  THR A CA  1 
ATOM   717   C  C   . THR A 1  95  ? -14.363 -12.896 111.964 1.00 19.90  ? 193  THR A C   1 
ATOM   718   O  O   . THR A 1  95  ? -14.621 -11.791 111.488 1.00 22.41  ? 193  THR A O   1 
ATOM   719   C  CB  . THR A 1  95  ? -13.924 -12.523 114.379 1.00 17.07  ? 193  THR A CB  1 
ATOM   720   O  OG1 . THR A 1  95  ? -12.583 -13.014 114.254 1.00 19.85  ? 193  THR A OG1 1 
ATOM   721   C  CG2 . THR A 1  95  ? -14.421 -12.753 115.798 1.00 16.53  ? 193  THR A CG2 1 
ATOM   722   N  N   . HIS A 1  96  ? -13.653 -13.838 111.339 1.00 19.33  ? 194  HIS A N   1 
ATOM   723   C  CA  . HIS A 1  96  ? -13.145 -13.736 109.964 1.00 17.61  ? 194  HIS A CA  1 
ATOM   724   C  C   . HIS A 1  96  ? -11.873 -12.896 109.859 1.00 15.94  ? 194  HIS A C   1 
ATOM   725   O  O   . HIS A 1  96  ? -11.608 -12.291 108.821 1.00 16.13  ? 194  HIS A O   1 
ATOM   726   C  CB  . HIS A 1  96  ? -14.212 -13.175 109.015 1.00 14.84  ? 194  HIS A CB  1 
ATOM   727   C  CG  . HIS A 1  96  ? -13.986 -13.521 107.577 1.00 13.11  ? 194  HIS A CG  1 
ATOM   728   N  ND1 . HIS A 1  96  ? -13.486 -14.741 107.176 1.00 13.32  ? 194  HIS A ND1 1 
ATOM   729   C  CD2 . HIS A 1  96  ? -14.190 -12.807 106.445 1.00 12.25  ? 194  HIS A CD2 1 
ATOM   730   C  CE1 . HIS A 1  96  ? -13.392 -14.764 105.859 1.00 17.51  ? 194  HIS A CE1 1 
ATOM   731   N  NE2 . HIS A 1  96  ? -13.813 -13.603 105.391 1.00 13.31  ? 194  HIS A NE2 1 
ATOM   732   N  N   . THR A 1  97  ? -11.091 -12.847 110.932 1.00 17.36  ? 195  THR A N   1 
ATOM   733   C  CA  . THR A 1  97  ? -9.767  -12.237 110.854 1.00 22.92  ? 195  THR A CA  1 
ATOM   734   C  C   . THR A 1  97  ? -8.891  -12.995 109.857 1.00 23.21  ? 195  THR A C   1 
ATOM   735   O  O   . THR A 1  97  ? -8.893  -14.224 109.822 1.00 22.30  ? 195  THR A O   1 
ATOM   736   C  CB  . THR A 1  97  ? -9.064  -12.194 112.228 1.00 26.14  ? 195  THR A CB  1 
ATOM   737   O  OG1 . THR A 1  97  ? -7.704  -11.775 112.053 1.00 21.12  ? 195  THR A OG1 1 
ATOM   738   C  CG2 . THR A 1  97  ? -9.082  -13.564 112.892 1.00 12.62  ? 195  THR A CG2 1 
ATOM   739   N  N   . HIS A 1  98  ? -8.148  -12.253 109.043 1.00 20.95  ? 196  HIS A N   1 
ATOM   740   C  CA  . HIS A 1  98  ? -7.274  -12.862 108.048 1.00 17.28  ? 196  HIS A CA  1 
ATOM   741   C  C   . HIS A 1  98  ? -5.833  -12.929 108.538 1.00 20.31  ? 196  HIS A C   1 
ATOM   742   O  O   . HIS A 1  98  ? -4.904  -13.068 107.742 1.00 20.71  ? 196  HIS A O   1 
ATOM   743   C  CB  . HIS A 1  98  ? -7.344  -12.090 106.729 1.00 16.34  ? 196  HIS A CB  1 
ATOM   744   C  CG  . HIS A 1  98  ? -8.593  -12.346 105.946 1.00 16.73  ? 196  HIS A CG  1 
ATOM   745   N  ND1 . HIS A 1  98  ? -9.852  -12.242 106.496 1.00 17.01  ? 196  HIS A ND1 1 
ATOM   746   C  CD2 . HIS A 1  98  ? -8.777  -12.700 104.652 1.00 16.54  ? 196  HIS A CD2 1 
ATOM   747   C  CE1 . HIS A 1  98  ? -10.758 -12.524 105.577 1.00 17.70  ? 196  HIS A CE1 1 
ATOM   748   N  NE2 . HIS A 1  98  ? -10.131 -12.804 104.448 1.00 19.53  ? 196  HIS A NE2 1 
ATOM   749   N  N   . SER A 1  99  ? -5.652  -12.826 109.851 1.00 22.93  ? 197  SER A N   1 
ATOM   750   C  CA  . SER A 1  99  ? -4.319  -12.848 110.439 1.00 15.25  ? 197  SER A CA  1 
ATOM   751   C  C   . SER A 1  99  ? -4.209  -13.897 111.537 1.00 22.20  ? 197  SER A C   1 
ATOM   752   O  O   . SER A 1  99  ? -3.501  -13.702 112.524 1.00 25.00  ? 197  SER A O   1 
ATOM   753   C  CB  . SER A 1  99  ? -3.958  -11.471 110.988 1.00 17.98  ? 197  SER A CB  1 
ATOM   754   O  OG  . SER A 1  99  ? -3.928  -10.507 109.950 1.00 21.42  ? 197  SER A OG  1 
ATOM   755   N  N   . GLY A 1  100 ? -4.908  -15.010 111.353 1.00 19.66  ? 198  GLY A N   1 
ATOM   756   C  CA  . GLY A 1  100 ? -4.830  -16.125 112.278 1.00 17.73  ? 198  GLY A CA  1 
ATOM   757   C  C   . GLY A 1  100 ? -4.103  -17.299 111.652 1.00 21.78  ? 198  GLY A C   1 
ATOM   758   O  O   . GLY A 1  100 ? -4.067  -17.425 110.428 1.00 23.83  ? 198  GLY A O   1 
ATOM   759   N  N   . PRO A 1  101 ? -3.506  -18.160 112.490 1.00 23.75  ? 199  PRO A N   1 
ATOM   760   C  CA  . PRO A 1  101 ? -2.771  -19.341 112.022 1.00 28.68  ? 199  PRO A CA  1 
ATOM   761   C  C   . PRO A 1  101 ? -3.662  -20.330 111.273 1.00 31.22  ? 199  PRO A C   1 
ATOM   762   O  O   . PRO A 1  101 ? -4.812  -20.535 111.660 1.00 32.99  ? 199  PRO A O   1 
ATOM   763   C  CB  . PRO A 1  101 ? -2.244  -19.964 113.320 1.00 29.77  ? 199  PRO A CB  1 
ATOM   764   C  CG  . PRO A 1  101 ? -2.253  -18.853 114.314 1.00 26.95  ? 199  PRO A CG  1 
ATOM   765   C  CD  . PRO A 1  101 ? -3.430  -18.007 113.952 1.00 22.01  ? 199  PRO A CD  1 
ATOM   766   N  N   . ALA A 1  102 ? -3.131  -20.926 110.209 1.00 35.49  ? 200  ALA A N   1 
ATOM   767   C  CA  . ALA A 1  102 ? -3.892  -21.867 109.391 1.00 34.75  ? 200  ALA A CA  1 
ATOM   768   C  C   . ALA A 1  102 ? -3.721  -23.302 109.882 1.00 35.17  ? 200  ALA A C   1 
ATOM   769   O  O   . ALA A 1  102 ? -3.082  -23.546 110.903 1.00 31.50  ? 200  ALA A O   1 
ATOM   770   C  CB  . ALA A 1  102 ? -3.470  -21.757 107.932 1.00 29.08  ? 200  ALA A CB  1 
ATOM   771   N  N   . GLY A 1  103 ? -4.304  -24.247 109.151 1.00 44.46  ? 201  GLY A N   1 
ATOM   772   C  CA  . GLY A 1  103 ? -4.115  -25.660 109.434 1.00 50.91  ? 201  GLY A CA  1 
ATOM   773   C  C   . GLY A 1  103 ? -5.058  -26.237 110.473 1.00 51.77  ? 201  GLY A C   1 
ATOM   774   O  O   . GLY A 1  103 ? -4.617  -26.870 111.432 1.00 52.65  ? 201  GLY A O   1 
ATOM   775   N  N   . TYR A 1  104 ? -6.356  -26.023 110.288 1.00 52.20  ? 202  TYR A N   1 
ATOM   776   C  CA  . TYR A 1  104 ? -7.356  -26.579 111.194 1.00 51.39  ? 202  TYR A CA  1 
ATOM   777   C  C   . TYR A 1  104 ? -8.577  -27.085 110.430 1.00 50.89  ? 202  TYR A C   1 
ATOM   778   O  O   . TYR A 1  104 ? -9.682  -27.141 110.971 1.00 48.11  ? 202  TYR A O   1 
ATOM   779   C  CB  . TYR A 1  104 ? -7.771  -25.540 112.240 1.00 51.08  ? 202  TYR A CB  1 
ATOM   780   C  CG  . TYR A 1  104 ? -8.144  -24.192 111.665 1.00 54.51  ? 202  TYR A CG  1 
ATOM   781   C  CD1 . TYR A 1  104 ? -7.181  -23.210 111.464 1.00 53.84  ? 202  TYR A CD1 1 
ATOM   782   C  CD2 . TYR A 1  104 ? -9.460  -23.899 111.331 1.00 56.39  ? 202  TYR A CD2 1 
ATOM   783   C  CE1 . TYR A 1  104 ? -7.518  -21.977 110.941 1.00 53.96  ? 202  TYR A CE1 1 
ATOM   784   C  CE2 . TYR A 1  104 ? -9.806  -22.669 110.809 1.00 56.92  ? 202  TYR A CE2 1 
ATOM   785   C  CZ  . TYR A 1  104 ? -8.831  -21.711 110.614 1.00 56.33  ? 202  TYR A CZ  1 
ATOM   786   O  OH  . TYR A 1  104 ? -9.172  -20.482 110.093 1.00 54.45  ? 202  TYR A OH  1 
ATOM   787   N  N   . PHE A 1  105 ? -8.364  -27.458 109.172 1.00 56.30  ? 203  PHE A N   1 
ATOM   788   C  CA  . PHE A 1  105 ? -9.435  -27.956 108.314 1.00 61.35  ? 203  PHE A CA  1 
ATOM   789   C  C   . PHE A 1  105 ? -9.234  -29.433 107.986 1.00 63.43  ? 203  PHE A C   1 
ATOM   790   O  O   . PHE A 1  105 ? -8.121  -29.951 108.084 1.00 65.26  ? 203  PHE A O   1 
ATOM   791   C  CB  . PHE A 1  105 ? -9.506  -27.156 107.013 1.00 64.02  ? 203  PHE A CB  1 
ATOM   792   C  CG  . PHE A 1  105 ? -9.811  -25.698 107.203 1.00 66.28  ? 203  PHE A CG  1 
ATOM   793   C  CD1 . PHE A 1  105 ? -11.117 -25.238 107.149 1.00 66.84  ? 203  PHE A CD1 1 
ATOM   794   C  CD2 . PHE A 1  105 ? -8.790  -24.783 107.401 1.00 66.96  ? 203  PHE A CD2 1 
ATOM   795   C  CE1 . PHE A 1  105 ? -11.402 -23.894 107.311 1.00 65.47  ? 203  PHE A CE1 1 
ATOM   796   C  CE2 . PHE A 1  105 ? -9.068  -23.438 107.562 1.00 67.50  ? 203  PHE A CE2 1 
ATOM   797   C  CZ  . PHE A 1  105 ? -10.377 -22.993 107.516 1.00 66.77  ? 203  PHE A CZ  1 
ATOM   798   N  N   . GLN A 1  106 ? -10.311 -30.109 107.598 1.00 64.43  ? 204  GLN A N   1 
ATOM   799   C  CA  . GLN A 1  106 ? -10.217 -31.504 107.178 1.00 70.28  ? 204  GLN A CA  1 
ATOM   800   C  C   . GLN A 1  106 ? -10.426 -31.660 105.668 1.00 74.94  ? 204  GLN A C   1 
ATOM   801   O  O   . GLN A 1  106 ? -9.878  -32.575 105.056 1.00 77.66  ? 204  GLN A O   1 
ATOM   802   C  CB  . GLN A 1  106 ? -11.220 -32.373 107.949 1.00 71.96  ? 204  GLN A CB  1 
ATOM   803   C  CG  . GLN A 1  106 ? -12.674 -32.216 107.528 1.00 71.04  ? 204  GLN A CG  1 
ATOM   804   C  CD  . GLN A 1  106 ? -13.608 -33.089 108.347 1.00 68.74  ? 204  GLN A CD  1 
ATOM   805   O  OE1 . GLN A 1  106 ? -13.167 -33.864 109.197 1.00 70.14  ? 204  GLN A OE1 1 
ATOM   806   N  NE2 . GLN A 1  106 ? -14.905 -32.968 108.092 1.00 65.06  ? 204  GLN A NE2 1 
ATOM   807   N  N   . TYR A 1  107 ? -11.218 -30.770 105.074 1.00 75.81  ? 205  TYR A N   1 
ATOM   808   C  CA  . TYR A 1  107 ? -11.481 -30.823 103.636 1.00 75.63  ? 205  TYR A CA  1 
ATOM   809   C  C   . TYR A 1  107 ? -10.284 -30.323 102.825 1.00 75.23  ? 205  TYR A C   1 
ATOM   810   O  O   . TYR A 1  107 ? -9.637  -29.345 103.196 1.00 75.54  ? 205  TYR A O   1 
ATOM   811   C  CB  . TYR A 1  107 ? -12.739 -30.025 103.291 1.00 71.91  ? 205  TYR A CB  1 
ATOM   812   C  CG  . TYR A 1  107 ? -14.007 -30.668 103.810 1.00 69.44  ? 205  TYR A CG  1 
ATOM   813   C  CD1 . TYR A 1  107 ? -14.571 -31.758 103.159 1.00 68.49  ? 205  TYR A CD1 1 
ATOM   814   C  CD2 . TYR A 1  107 ? -14.637 -30.189 104.952 1.00 68.32  ? 205  TYR A CD2 1 
ATOM   815   C  CE1 . TYR A 1  107 ? -15.725 -32.354 103.630 1.00 69.60  ? 205  TYR A CE1 1 
ATOM   816   C  CE2 . TYR A 1  107 ? -15.794 -30.779 105.430 1.00 68.89  ? 205  TYR A CE2 1 
ATOM   817   C  CZ  . TYR A 1  107 ? -16.334 -31.860 104.765 1.00 69.23  ? 205  TYR A CZ  1 
ATOM   818   O  OH  . TYR A 1  107 ? -17.486 -32.450 105.235 1.00 67.46  ? 205  TYR A OH  1 
ATOM   819   N  N   . THR A 1  108 ? -10.015 -31.002 101.711 1.00 72.38  ? 206  THR A N   1 
ATOM   820   C  CA  . THR A 1  108 ? -8.751  -30.878 100.983 1.00 72.48  ? 206  THR A CA  1 
ATOM   821   C  C   . THR A 1  108 ? -8.415  -29.465 100.497 1.00 73.22  ? 206  THR A C   1 
ATOM   822   O  O   . THR A 1  108 ? -7.253  -29.056 100.546 1.00 73.94  ? 206  THR A O   1 
ATOM   823   C  CB  . THR A 1  108 ? -8.738  -31.824 99.763  1.00 72.71  ? 206  THR A CB  1 
ATOM   824   O  OG1 . THR A 1  108 ? -9.047  -33.158 100.186 1.00 74.39  ? 206  THR A OG1 1 
ATOM   825   C  CG2 . THR A 1  108 ? -7.378  -31.815 99.078  1.00 71.86  ? 206  THR A CG2 1 
ATOM   826   N  N   . VAL A 1  109 ? -9.420  -28.727 100.033 1.00 73.31  ? 207  VAL A N   1 
ATOM   827   C  CA  . VAL A 1  109 ? -9.208  -27.373 99.520  1.00 75.06  ? 207  VAL A CA  1 
ATOM   828   C  C   . VAL A 1  109 ? -8.505  -26.476 100.533 1.00 74.91  ? 207  VAL A C   1 
ATOM   829   O  O   . VAL A 1  109 ? -7.545  -25.778 100.205 1.00 73.77  ? 207  VAL A O   1 
ATOM   830   C  CB  . VAL A 1  109 ? -10.539 -26.702 99.113  1.00 73.87  ? 207  VAL A CB  1 
ATOM   831   C  CG1 . VAL A 1  109 ? -10.331 -25.220 98.825  1.00 72.16  ? 207  VAL A CG1 1 
ATOM   832   C  CG2 . VAL A 1  109 ? -11.132 -27.396 97.910  1.00 74.16  ? 207  VAL A CG2 1 
ATOM   833   N  N   . PHE A 1  110 ? -8.981  -26.514 101.771 1.00 76.22  ? 208  PHE A N   1 
ATOM   834   C  CA  . PHE A 1  110 ? -8.446  -25.651 102.812 1.00 76.81  ? 208  PHE A CA  1 
ATOM   835   C  C   . PHE A 1  110 ? -7.146  -26.217 103.375 1.00 80.22  ? 208  PHE A C   1 
ATOM   836   O  O   . PHE A 1  110 ? -6.364  -25.496 103.994 1.00 82.33  ? 208  PHE A O   1 
ATOM   837   C  CB  . PHE A 1  110 ? -9.470  -25.475 103.927 1.00 73.83  ? 208  PHE A CB  1 
ATOM   838   C  CG  . PHE A 1  110 ? -10.872 -25.265 103.434 1.00 71.69  ? 208  PHE A CG  1 
ATOM   839   C  CD1 . PHE A 1  110 ? -11.230 -24.090 102.796 1.00 67.48  ? 208  PHE A CD1 1 
ATOM   840   C  CD2 . PHE A 1  110 ? -11.833 -26.249 103.606 1.00 73.31  ? 208  PHE A CD2 1 
ATOM   841   C  CE1 . PHE A 1  110 ? -12.521 -23.899 102.341 1.00 67.77  ? 208  PHE A CE1 1 
ATOM   842   C  CE2 . PHE A 1  110 ? -13.125 -26.064 103.154 1.00 73.00  ? 208  PHE A CE2 1 
ATOM   843   C  CZ  . PHE A 1  110 ? -13.470 -24.888 102.520 1.00 70.32  ? 208  PHE A CZ  1 
ATOM   844   N  N   . VAL A 1  111 ? -6.921  -27.510 103.157 1.00 80.35  ? 209  VAL A N   1 
ATOM   845   C  CA  . VAL A 1  111 ? -5.680  -28.150 103.577 1.00 78.91  ? 209  VAL A CA  1 
ATOM   846   C  C   . VAL A 1  111 ? -4.555  -27.760 102.623 1.00 80.16  ? 209  VAL A C   1 
ATOM   847   O  O   . VAL A 1  111 ? -3.412  -27.563 103.038 1.00 81.66  ? 209  VAL A O   1 
ATOM   848   C  CB  . VAL A 1  111 ? -5.818  -29.689 103.630 1.00 75.92  ? 209  VAL A CB  1 
ATOM   849   C  CG1 . VAL A 1  111 ? -4.495  -30.336 104.020 1.00 74.31  ? 209  VAL A CG1 1 
ATOM   850   C  CG2 . VAL A 1  111 ? -6.913  -30.091 104.604 1.00 74.25  ? 209  VAL A CG2 1 
ATOM   851   N  N   . ILE A 1  112 ? -4.894  -27.633 101.344 1.00 79.23  ? 210  ILE A N   1 
ATOM   852   C  CA  . ILE A 1  112 ? -3.943  -27.173 100.337 1.00 78.40  ? 210  ILE A CA  1 
ATOM   853   C  C   . ILE A 1  112 ? -3.552  -25.723 100.608 1.00 79.79  ? 210  ILE A C   1 
ATOM   854   O  O   . ILE A 1  112 ? -2.371  -25.372 100.571 1.00 83.14  ? 210  ILE A O   1 
ATOM   855   C  CB  . ILE A 1  112 ? -4.521  -27.297 98.912  1.00 75.68  ? 210  ILE A CB  1 
ATOM   856   C  CG1 . ILE A 1  112 ? -4.618  -28.767 98.501  1.00 76.44  ? 210  ILE A CG1 1 
ATOM   857   C  CG2 . ILE A 1  112 ? -3.674  -26.522 97.915  1.00 74.03  ? 210  ILE A CG2 1 
ATOM   858   C  CD1 . ILE A 1  112 ? -5.352  -28.988 97.196  1.00 77.42  ? 210  ILE A CD1 1 
ATOM   859   N  N   . ALA A 1  113 ? -4.552  -24.888 100.881 1.00 77.63  ? 211  ALA A N   1 
ATOM   860   C  CA  . ALA A 1  113 ? -4.329  -23.485 101.221 1.00 74.94  ? 211  ALA A CA  1 
ATOM   861   C  C   . ALA A 1  113 ? -3.448  -23.335 102.461 1.00 77.49  ? 211  ALA A C   1 
ATOM   862   O  O   . ALA A 1  113 ? -2.501  -22.548 102.472 1.00 77.52  ? 211  ALA A O   1 
ATOM   863   C  CB  . ALA A 1  113 ? -5.662  -22.777 101.431 1.00 68.67  ? 211  ALA A CB  1 
ATOM   864   N  N   . SER A 1  114 ? -3.773  -24.094 103.504 1.00 79.12  ? 212  SER A N   1 
ATOM   865   C  CA  . SER A 1  114 ? -3.018  -24.069 104.753 1.00 78.33  ? 212  SER A CA  1 
ATOM   866   C  C   . SER A 1  114 ? -1.651  -24.738 104.623 1.00 80.37  ? 212  SER A C   1 
ATOM   867   O  O   . SER A 1  114 ? -0.806  -24.609 105.511 1.00 81.29  ? 212  SER A O   1 
ATOM   868   C  CB  . SER A 1  114 ? -3.818  -24.745 105.869 1.00 76.67  ? 212  SER A CB  1 
ATOM   869   O  OG  . SER A 1  114 ? -5.067  -24.104 106.065 1.00 73.69  ? 212  SER A OG  1 
ATOM   870   N  N   . GLU A 1  115 ? -1.456  -25.456 103.517 1.00 81.20  ? 213  GLU A N   1 
ATOM   871   C  CA  . GLU A 1  115 ? -0.250  -26.247 103.272 1.00 81.40  ? 213  GLU A CA  1 
ATOM   872   C  C   . GLU A 1  115 ? -0.061  -27.327 104.334 1.00 77.69  ? 213  GLU A C   1 
ATOM   873   O  O   . GLU A 1  115 ? 1.065   -27.635 104.726 1.00 79.64  ? 213  GLU A O   1 
ATOM   874   C  CB  . GLU A 1  115 ? 0.995   -25.355 103.201 1.00 85.38  ? 213  GLU A CB  1 
ATOM   875   C  CG  . GLU A 1  115 ? 1.012   -24.396 102.021 1.00 89.87  ? 213  GLU A CG  1 
ATOM   876   C  CD  . GLU A 1  115 ? 2.315   -23.625 101.920 1.00 94.99  ? 213  GLU A CD  1 
ATOM   877   O  OE1 . GLU A 1  115 ? 3.231   -23.898 102.724 1.00 96.60  ? 213  GLU A OE1 1 
ATOM   878   O  OE2 . GLU A 1  115 ? 2.422   -22.747 101.038 1.00 97.27  ? 213  GLU A OE2 1 
ATOM   879   N  N   . GLY A 1  116 ? -1.169  -27.897 104.797 1.00 71.63  ? 214  GLY A N   1 
ATOM   880   C  CA  . GLY A 1  116 ? -1.125  -28.995 105.746 1.00 66.61  ? 214  GLY A CA  1 
ATOM   881   C  C   . GLY A 1  116 ? -2.040  -28.818 106.943 1.00 61.42  ? 214  GLY A C   1 
ATOM   882   O  O   . GLY A 1  116 ? -2.840  -27.884 107.000 1.00 60.12  ? 214  GLY A O   1 
ATOM   883   N  N   . PHE A 1  117 ? -1.915  -29.728 107.904 1.00 57.70  ? 215  PHE A N   1 
ATOM   884   C  CA  . PHE A 1  117 ? -2.709  -29.688 109.126 1.00 52.51  ? 215  PHE A CA  1 
ATOM   885   C  C   . PHE A 1  117 ? -1.808  -29.589 110.351 1.00 50.13  ? 215  PHE A C   1 
ATOM   886   O  O   . PHE A 1  117 ? -0.887  -30.387 110.521 1.00 52.88  ? 215  PHE A O   1 
ATOM   887   C  CB  . PHE A 1  117 ? -3.606  -30.926 109.222 1.00 53.72  ? 215  PHE A CB  1 
ATOM   888   C  CG  . PHE A 1  117 ? -4.384  -31.022 110.508 1.00 52.44  ? 215  PHE A CG  1 
ATOM   889   C  CD1 . PHE A 1  117 ? -5.588  -30.353 110.658 1.00 52.11  ? 215  PHE A CD1 1 
ATOM   890   C  CD2 . PHE A 1  117 ? -3.920  -31.800 111.558 1.00 48.36  ? 215  PHE A CD2 1 
ATOM   891   C  CE1 . PHE A 1  117 ? -6.308  -30.446 111.837 1.00 48.10  ? 215  PHE A CE1 1 
ATOM   892   C  CE2 . PHE A 1  117 ? -4.634  -31.897 112.739 1.00 44.40  ? 215  PHE A CE2 1 
ATOM   893   C  CZ  . PHE A 1  117 ? -5.829  -31.220 112.879 1.00 44.94  ? 215  PHE A CZ  1 
ATOM   894   N  N   . SER A 1  118 ? -2.082  -28.608 111.205 1.00 45.34  ? 216  SER A N   1 
ATOM   895   C  CA  . SER A 1  118 ? -1.288  -28.399 112.408 1.00 44.67  ? 216  SER A CA  1 
ATOM   896   C  C   . SER A 1  118 ? -2.044  -28.844 113.655 1.00 47.40  ? 216  SER A C   1 
ATOM   897   O  O   . SER A 1  118 ? -2.948  -28.148 114.118 1.00 49.29  ? 216  SER A O   1 
ATOM   898   C  CB  . SER A 1  118 ? -0.884  -26.928 112.535 1.00 41.23  ? 216  SER A CB  1 
ATOM   899   O  OG  . SER A 1  118 ? -0.180  -26.694 113.744 1.00 38.97  ? 216  SER A OG  1 
ATOM   900   N  N   . ASN A 1  119 ? -1.682  -30.011 114.182 1.00 47.36  ? 217  ASN A N   1 
ATOM   901   C  CA  . ASN A 1  119 ? -2.317  -30.538 115.385 1.00 46.24  ? 217  ASN A CA  1 
ATOM   902   C  C   . ASN A 1  119 ? -2.175  -29.578 116.564 1.00 43.67  ? 217  ASN A C   1 
ATOM   903   O  O   . ASN A 1  119 ? -3.134  -29.345 117.296 1.00 41.38  ? 217  ASN A O   1 
ATOM   904   C  CB  . ASN A 1  119 ? -1.734  -31.909 115.748 1.00 48.66  ? 217  ASN A CB  1 
ATOM   905   C  CG  . ASN A 1  119 ? -2.605  -32.672 116.731 1.00 56.02  ? 217  ASN A CG  1 
ATOM   906   O  OD1 . ASN A 1  119 ? -3.824  -32.503 116.756 1.00 54.30  ? 217  ASN A OD1 1 
ATOM   907   N  ND2 . ASN A 1  119 ? -1.980  -33.514 117.550 1.00 68.81  ? 217  ASN A ND2 1 
ATOM   908   N  N   . GLN A 1  120 ? -0.978  -29.019 116.731 1.00 44.55  ? 218  GLN A N   1 
ATOM   909   C  CA  . GLN A 1  120 ? -0.710  -28.048 117.792 1.00 46.15  ? 218  GLN A CA  1 
ATOM   910   C  C   . GLN A 1  120 ? -1.694  -26.883 117.769 1.00 38.34  ? 218  GLN A C   1 
ATOM   911   O  O   . GLN A 1  120 ? -2.395  -26.632 118.747 1.00 36.46  ? 218  GLN A O   1 
ATOM   912   C  CB  . GLN A 1  120 ? 0.717   -27.507 117.681 1.00 53.46  ? 218  GLN A CB  1 
ATOM   913   C  CG  . GLN A 1  120 ? 1.779   -28.365 118.347 1.00 62.99  ? 218  GLN A CG  1 
ATOM   914   C  CD  . GLN A 1  120 ? 3.113   -27.649 118.467 1.00 69.65  ? 218  GLN A CD  1 
ATOM   915   O  OE1 . GLN A 1  120 ? 3.267   -26.515 118.011 1.00 71.92  ? 218  GLN A OE1 1 
ATOM   916   N  NE2 . GLN A 1  120 ? 4.085   -28.309 119.086 1.00 70.51  ? 218  GLN A NE2 1 
ATOM   917   N  N   . THR A 1  121 ? -1.731  -26.176 116.645 1.00 32.16  ? 219  THR A N   1 
ATOM   918   C  CA  . THR A 1  121 ? -2.631  -25.045 116.460 1.00 28.48  ? 219  THR A CA  1 
ATOM   919   C  C   . THR A 1  121 ? -4.087  -25.459 116.663 1.00 30.28  ? 219  THR A C   1 
ATOM   920   O  O   . THR A 1  121 ? -4.853  -24.770 117.337 1.00 26.23  ? 219  THR A O   1 
ATOM   921   C  CB  . THR A 1  121 ? -2.459  -24.426 115.059 1.00 28.88  ? 219  THR A CB  1 
ATOM   922   O  OG1 . THR A 1  121 ? -1.170  -23.807 114.962 1.00 34.23  ? 219  THR A OG1 1 
ATOM   923   C  CG2 . THR A 1  121 ? -3.528  -23.390 114.791 1.00 22.99  ? 219  THR A CG2 1 
ATOM   924   N  N   . PHE A 1  122 ? -4.455  -26.596 116.080 1.00 33.41  ? 220  PHE A N   1 
ATOM   925   C  CA  . PHE A 1  122 ? -5.814  -27.117 116.176 1.00 31.51  ? 220  PHE A CA  1 
ATOM   926   C  C   . PHE A 1  122 ? -6.247  -27.390 117.615 1.00 30.09  ? 220  PHE A C   1 
ATOM   927   O  O   . PHE A 1  122 ? -7.338  -26.994 118.024 1.00 30.89  ? 220  PHE A O   1 
ATOM   928   C  CB  . PHE A 1  122 ? -5.949  -28.397 115.345 1.00 26.95  ? 220  PHE A CB  1 
ATOM   929   C  CG  . PHE A 1  122 ? -7.305  -29.033 115.426 1.00 25.45  ? 220  PHE A CG  1 
ATOM   930   C  CD1 . PHE A 1  122 ? -8.362  -28.536 114.681 1.00 27.88  ? 220  PHE A CD1 1 
ATOM   931   C  CD2 . PHE A 1  122 ? -7.523  -30.134 116.237 1.00 23.72  ? 220  PHE A CD2 1 
ATOM   932   C  CE1 . PHE A 1  122 ? -9.612  -29.120 114.750 1.00 25.87  ? 220  PHE A CE1 1 
ATOM   933   C  CE2 . PHE A 1  122 ? -8.771  -30.721 116.310 1.00 26.23  ? 220  PHE A CE2 1 
ATOM   934   C  CZ  . PHE A 1  122 ? -9.817  -30.213 115.565 1.00 25.43  ? 220  PHE A CZ  1 
ATOM   935   N  N   . GLN A 1  123 ? -5.390  -28.060 118.381 1.00 26.65  ? 221  GLN A N   1 
ATOM   936   C  CA  . GLN A 1  123 ? -5.734  -28.440 119.748 1.00 28.20  ? 221  GLN A CA  1 
ATOM   937   C  C   . GLN A 1  123 ? -5.887  -27.237 120.674 1.00 32.40  ? 221  GLN A C   1 
ATOM   938   O  O   . GLN A 1  123 ? -6.795  -27.204 121.506 1.00 37.58  ? 221  GLN A O   1 
ATOM   939   C  CB  . GLN A 1  123 ? -4.685  -29.397 120.319 1.00 26.87  ? 221  GLN A CB  1 
ATOM   940   C  CG  . GLN A 1  123 ? -4.624  -30.748 119.622 1.00 28.10  ? 221  GLN A CG  1 
ATOM   941   C  CD  . GLN A 1  123 ? -5.918  -31.532 119.738 1.00 29.82  ? 221  GLN A CD  1 
ATOM   942   O  OE1 . GLN A 1  123 ? -6.662  -31.387 120.708 1.00 30.67  ? 221  GLN A OE1 1 
ATOM   943   N  NE2 . GLN A 1  123 ? -6.191  -32.370 118.745 1.00 29.63  ? 221  GLN A NE2 1 
ATOM   944   N  N   . HIS A 1  124 ? -5.013  -26.246 120.529 1.00 31.21  ? 222  HIS A N   1 
ATOM   945   C  CA  A HIS A 1  124 ? -5.064  -25.052 121.368 0.53 32.12  ? 222  HIS A CA  1 
ATOM   946   C  CA  B HIS A 1  124 ? -5.076  -25.065 121.379 0.47 31.79  ? 222  HIS A CA  1 
ATOM   947   C  C   . HIS A 1  124 ? -6.290  -24.209 121.035 1.00 30.33  ? 222  HIS A C   1 
ATOM   948   O  O   . HIS A 1  124 ? -6.804  -23.483 121.886 1.00 29.80  ? 222  HIS A O   1 
ATOM   949   C  CB  A HIS A 1  124 ? -3.790  -24.216 121.211 0.53 33.72  ? 222  HIS A CB  1 
ATOM   950   C  CB  B HIS A 1  124 ? -3.785  -24.255 121.262 0.47 33.55  ? 222  HIS A CB  1 
ATOM   951   C  CG  A HIS A 1  124 ? -3.626  -23.164 122.265 0.53 34.08  ? 222  HIS A CG  1 
ATOM   952   C  CG  B HIS A 1  124 ? -2.620  -24.886 121.959 0.47 36.46  ? 222  HIS A CG  1 
ATOM   953   N  ND1 A HIS A 1  124 ? -3.666  -21.814 121.986 0.53 32.18  ? 222  HIS A ND1 1 
ATOM   954   N  ND1 B HIS A 1  124 ? -2.137  -24.427 123.166 0.47 38.19  ? 222  HIS A ND1 1 
ATOM   955   C  CD2 A HIS A 1  124 ? -3.427  -23.265 123.601 0.53 35.58  ? 222  HIS A CD2 1 
ATOM   956   C  CD2 B HIS A 1  124 ? -1.857  -25.955 121.631 0.47 38.20  ? 222  HIS A CD2 1 
ATOM   957   C  CE1 A HIS A 1  124 ? -3.495  -21.130 123.104 0.53 30.66  ? 222  HIS A CE1 1 
ATOM   958   C  CE1 B HIS A 1  124 ? -1.118  -25.178 123.544 0.47 39.55  ? 222  HIS A CE1 1 
ATOM   959   N  NE2 A HIS A 1  124 ? -3.348  -21.987 124.098 0.53 32.94  ? 222  HIS A NE2 1 
ATOM   960   N  NE2 B HIS A 1  124 ? -0.928  -26.112 122.630 0.47 39.62  ? 222  HIS A NE2 1 
ATOM   961   N  N   . MET A 1  125 ? -6.745  -24.297 119.789 1.00 31.32  ? 223  MET A N   1 
ATOM   962   C  CA  . MET A 1  125 ? -7.990  -23.652 119.398 1.00 31.93  ? 223  MET A CA  1 
ATOM   963   C  C   . MET A 1  125 ? -9.149  -24.299 120.138 1.00 34.35  ? 223  MET A C   1 
ATOM   964   O  O   . MET A 1  125 ? -10.014 -23.616 120.684 1.00 34.85  ? 223  MET A O   1 
ATOM   965   C  CB  . MET A 1  125 ? -8.219  -23.751 117.891 1.00 33.40  ? 223  MET A CB  1 
ATOM   966   C  CG  . MET A 1  125 ? -7.600  -22.631 117.086 1.00 34.44  ? 223  MET A CG  1 
ATOM   967   S  SD  . MET A 1  125 ? -7.549  -23.021 115.326 1.00 57.61  ? 223  MET A SD  1 
ATOM   968   C  CE  . MET A 1  125 ? -6.595  -21.644 114.701 1.00 45.65  ? 223  MET A CE  1 
ATOM   969   N  N   . VAL A 1  126 ? -9.153  -25.628 120.148 1.00 30.91  ? 224  VAL A N   1 
ATOM   970   C  CA  . VAL A 1  126 ? -10.219 -26.389 120.782 1.00 28.34  ? 224  VAL A CA  1 
ATOM   971   C  C   . VAL A 1  126 ? -10.253 -26.143 122.288 1.00 30.04  ? 224  VAL A C   1 
ATOM   972   O  O   . VAL A 1  126 ? -11.307 -25.839 122.846 1.00 31.81  ? 224  VAL A O   1 
ATOM   973   C  CB  . VAL A 1  126 ? -10.073 -27.899 120.511 1.00 25.02  ? 224  VAL A CB  1 
ATOM   974   C  CG1 . VAL A 1  126 ? -11.083 -28.687 121.331 1.00 24.49  ? 224  VAL A CG1 1 
ATOM   975   C  CG2 . VAL A 1  126 ? -10.248 -28.189 119.029 1.00 21.53  ? 224  VAL A CG2 1 
ATOM   976   N  N   . THR A 1  127 ? -9.099  -26.257 122.940 1.00 26.83  ? 225  THR A N   1 
ATOM   977   C  CA  . THR A 1  127 ? -9.034  -26.047 124.384 1.00 26.55  ? 225  THR A CA  1 
ATOM   978   C  C   . THR A 1  127 ? -9.363  -24.598 124.716 1.00 27.98  ? 225  THR A C   1 
ATOM   979   O  O   . THR A 1  127 ? -9.943  -24.313 125.762 1.00 32.64  ? 225  THR A O   1 
ATOM   980   C  CB  . THR A 1  127 ? -7.652  -26.406 124.969 1.00 26.23  ? 225  THR A CB  1 
ATOM   981   O  OG1 . THR A 1  127 ? -6.659  -25.519 124.444 1.00 33.24  ? 225  THR A OG1 1 
ATOM   982   C  CG2 . THR A 1  127 ? -7.281  -27.839 124.627 1.00 21.92  ? 225  THR A CG2 1 
ATOM   983   N  N   . GLY A 1  128 ? -8.994  -23.689 123.819 1.00 23.11  ? 226  GLY A N   1 
ATOM   984   C  CA  . GLY A 1  128 ? -9.308  -22.282 123.987 1.00 20.21  ? 226  GLY A CA  1 
ATOM   985   C  C   . GLY A 1  128 ? -10.807 -22.052 123.944 1.00 25.69  ? 226  GLY A C   1 
ATOM   986   O  O   . GLY A 1  128 ? -11.362 -21.351 124.791 1.00 30.70  ? 226  GLY A O   1 
ATOM   987   N  N   . ILE A 1  129 ? -11.464 -22.650 122.956 1.00 24.15  ? 227  ILE A N   1 
ATOM   988   C  CA  . ILE A 1  129 ? -12.914 -22.553 122.830 1.00 24.55  ? 227  ILE A CA  1 
ATOM   989   C  C   . ILE A 1  129 ? -13.600 -23.199 124.032 1.00 26.81  ? 227  ILE A C   1 
ATOM   990   O  O   . ILE A 1  129 ? -14.547 -22.642 124.589 1.00 26.70  ? 227  ILE A O   1 
ATOM   991   C  CB  . ILE A 1  129 ? -13.414 -23.213 121.528 1.00 23.22  ? 227  ILE A CB  1 
ATOM   992   C  CG1 . ILE A 1  129 ? -12.930 -22.422 120.313 1.00 17.13  ? 227  ILE A CG1 1 
ATOM   993   C  CG2 . ILE A 1  129 ? -14.931 -23.296 121.514 1.00 28.10  ? 227  ILE A CG2 1 
ATOM   994   C  CD1 . ILE A 1  129 ? -13.031 -23.185 119.012 1.00 17.33  ? 227  ILE A CD1 1 
ATOM   995   N  N   . LEU A 1  130 ? -13.101 -24.362 124.443 1.00 25.40  ? 228  LEU A N   1 
ATOM   996   C  CA  . LEU A 1  130 ? -13.663 -25.069 125.589 1.00 21.87  ? 228  LEU A CA  1 
ATOM   997   C  C   . LEU A 1  130 ? -13.468 -24.286 126.883 1.00 25.15  ? 228  LEU A C   1 
ATOM   998   O  O   . LEU A 1  130 ? -14.360 -24.251 127.729 1.00 29.59  ? 228  LEU A O   1 
ATOM   999   C  CB  . LEU A 1  130 ? -13.040 -26.459 125.726 1.00 19.32  ? 228  LEU A CB  1 
ATOM   1000  C  CG  . LEU A 1  130 ? -13.370 -27.472 124.629 1.00 19.71  ? 228  LEU A CG  1 
ATOM   1001  C  CD1 . LEU A 1  130 ? -12.564 -28.742 124.823 1.00 22.87  ? 228  LEU A CD1 1 
ATOM   1002  C  CD2 . LEU A 1  130 ? -14.856 -27.775 124.613 1.00 19.60  ? 228  LEU A CD2 1 
ATOM   1003  N  N   . LYS A 1  131 ? -12.309 -23.650 127.027 1.00 26.88  ? 229  LYS A N   1 
ATOM   1004  C  CA  . LYS A 1  131 ? -12.007 -22.880 128.229 1.00 31.19  ? 229  LYS A CA  1 
ATOM   1005  C  C   . LYS A 1  131 ? -12.963 -21.700 128.374 1.00 26.70  ? 229  LYS A C   1 
ATOM   1006  O  O   . LYS A 1  131 ? -13.440 -21.411 129.471 1.00 24.80  ? 229  LYS A O   1 
ATOM   1007  C  CB  . LYS A 1  131 ? -10.562 -22.379 128.204 1.00 39.66  ? 229  LYS A CB  1 
ATOM   1008  C  CG  . LYS A 1  131 ? -10.158 -21.568 129.427 1.00 49.50  ? 229  LYS A CG  1 
ATOM   1009  C  CD  . LYS A 1  131 ? -8.706  -21.120 129.340 1.00 60.88  ? 229  LYS A CD  1 
ATOM   1010  C  CE  . LYS A 1  131 ? -8.303  -20.294 130.554 1.00 68.22  ? 229  LYS A CE  1 
ATOM   1011  N  NZ  . LYS A 1  131 ? -6.988  -19.616 130.364 1.00 70.49  ? 229  LYS A NZ  1 
ATOM   1012  N  N   . SER A 1  132 ? -13.237 -21.022 127.263 1.00 21.55  ? 230  SER A N   1 
ATOM   1013  C  CA  . SER A 1  132 ? -14.160 -19.892 127.264 1.00 22.31  ? 230  SER A CA  1 
ATOM   1014  C  C   . SER A 1  132 ? -15.559 -20.333 127.677 1.00 24.77  ? 230  SER A C   1 
ATOM   1015  O  O   . SER A 1  132 ? -16.245 -19.637 128.426 1.00 25.28  ? 230  SER A O   1 
ATOM   1016  C  CB  . SER A 1  132 ? -14.202 -19.227 125.887 1.00 20.13  ? 230  SER A CB  1 
ATOM   1017  O  OG  . SER A 1  132 ? -14.708 -20.112 124.905 1.00 23.65  ? 230  SER A OG  1 
ATOM   1018  N  N   . ILE A 1  133 ? -15.975 -21.494 127.182 1.00 25.67  ? 231  ILE A N   1 
ATOM   1019  C  CA  . ILE A 1  133 ? -17.275 -22.054 127.529 1.00 26.01  ? 231  ILE A CA  1 
ATOM   1020  C  C   . ILE A 1  133 ? -17.323 -22.461 129.003 1.00 25.05  ? 231  ILE A C   1 
ATOM   1021  O  O   . ILE A 1  133 ? -18.313 -22.204 129.688 1.00 26.86  ? 231  ILE A O   1 
ATOM   1022  C  CB  . ILE A 1  133 ? -17.618 -23.267 126.631 1.00 27.04  ? 231  ILE A CB  1 
ATOM   1023  C  CG1 . ILE A 1  133 ? -17.833 -22.809 125.186 1.00 25.48  ? 231  ILE A CG1 1 
ATOM   1024  C  CG2 . ILE A 1  133 ? -18.847 -24.002 127.149 1.00 21.85  ? 231  ILE A CG2 1 
ATOM   1025  C  CD1 . ILE A 1  133 ? -18.015 -23.942 124.201 1.00 24.11  ? 231  ILE A CD1 1 
ATOM   1026  N  N   . ASP A 1  134 ? -16.250 -23.078 129.492 1.00 24.84  ? 232  ASP A N   1 
ATOM   1027  C  CA  . ASP A 1  134 ? -16.185 -23.504 130.891 1.00 36.16  ? 232  ASP A CA  1 
ATOM   1028  C  C   . ASP A 1  134 ? -16.254 -22.323 131.858 1.00 32.72  ? 232  ASP A C   1 
ATOM   1029  O  O   . ASP A 1  134 ? -16.877 -22.416 132.915 1.00 35.33  ? 232  ASP A O   1 
ATOM   1030  C  CB  . ASP A 1  134 ? -14.908 -24.309 131.159 1.00 51.05  ? 232  ASP A CB  1 
ATOM   1031  C  CG  . ASP A 1  134 ? -14.842 -25.590 130.349 1.00 64.53  ? 232  ASP A CG  1 
ATOM   1032  O  OD1 . ASP A 1  134 ? -15.902 -26.056 129.883 1.00 66.97  ? 232  ASP A OD1 1 
ATOM   1033  O  OD2 . ASP A 1  134 ? -13.730 -26.136 130.183 1.00 70.83  ? 232  ASP A OD2 1 
ATOM   1034  N  N   . ILE A 1  135 ? -15.612 -21.217 131.495 1.00 26.72  ? 233  ILE A N   1 
ATOM   1035  C  CA  . ILE A 1  135 ? -15.639 -20.016 132.325 1.00 25.71  ? 233  ILE A CA  1 
ATOM   1036  C  C   . ILE A 1  135 ? -17.057 -19.465 132.423 1.00 27.63  ? 233  ILE A C   1 
ATOM   1037  O  O   . ILE A 1  135 ? -17.538 -19.157 133.514 1.00 28.92  ? 233  ILE A O   1 
ATOM   1038  C  CB  . ILE A 1  135 ? -14.692 -18.927 131.781 1.00 24.84  ? 233  ILE A CB  1 
ATOM   1039  C  CG1 . ILE A 1  135 ? -13.238 -19.380 131.916 1.00 17.37  ? 233  ILE A CG1 1 
ATOM   1040  C  CG2 . ILE A 1  135 ? -14.891 -17.621 132.530 1.00 16.52  ? 233  ILE A CG2 1 
ATOM   1041  C  CD1 . ILE A 1  135 ? -12.254 -18.503 131.176 1.00 16.78  ? 233  ILE A CD1 1 
ATOM   1042  N  N   . ALA A 1  136 ? -17.723 -19.348 131.279 1.00 25.99  ? 234  ALA A N   1 
ATOM   1043  C  CA  . ALA A 1  136 ? -19.101 -18.875 131.234 1.00 24.94  ? 234  ALA A CA  1 
ATOM   1044  C  C   . ALA A 1  136 ? -20.024 -19.810 132.011 1.00 26.65  ? 234  ALA A C   1 
ATOM   1045  O  O   . ALA A 1  136 ? -20.926 -19.362 132.718 1.00 22.41  ? 234  ALA A O   1 
ATOM   1046  C  CB  . ALA A 1  136 ? -19.567 -18.748 129.795 1.00 25.40  ? 234  ALA A CB  1 
ATOM   1047  N  N   . HIS A 1  137 ? -19.785 -21.109 131.869 1.00 31.32  ? 235  HIS A N   1 
ATOM   1048  C  CA  . HIS A 1  137 ? -20.577 -22.135 132.540 1.00 31.29  ? 235  HIS A CA  1 
ATOM   1049  C  C   . HIS A 1  137 ? -20.484 -22.031 134.062 1.00 33.46  ? 235  HIS A C   1 
ATOM   1050  O  O   . HIS A 1  137 ? -21.492 -22.130 134.762 1.00 32.34  ? 235  HIS A O   1 
ATOM   1051  C  CB  . HIS A 1  137 ? -20.129 -23.526 132.078 1.00 27.52  ? 235  HIS A CB  1 
ATOM   1052  C  CG  . HIS A 1  137 ? -20.794 -24.654 132.805 1.00 28.15  ? 235  HIS A CG  1 
ATOM   1053  N  ND1 . HIS A 1  137 ? -21.948 -25.254 132.350 1.00 22.80  ? 235  HIS A ND1 1 
ATOM   1054  C  CD2 . HIS A 1  137 ? -20.457 -25.302 133.945 1.00 29.86  ? 235  HIS A CD2 1 
ATOM   1055  C  CE1 . HIS A 1  137 ? -22.298 -26.218 133.183 1.00 22.05  ? 235  HIS A CE1 1 
ATOM   1056  N  NE2 . HIS A 1  137 ? -21.411 -26.268 134.159 1.00 27.79  ? 235  HIS A NE2 1 
ATOM   1057  N  N   . THR A 1  138 ? -19.271 -21.833 134.568 1.00 31.07  ? 236  THR A N   1 
ATOM   1058  C  CA  . THR A 1  138 ? -19.037 -21.819 136.008 1.00 29.98  ? 236  THR A CA  1 
ATOM   1059  C  C   . THR A 1  138 ? -19.222 -20.433 136.622 1.00 33.18  ? 236  THR A C   1 
ATOM   1060  O  O   . THR A 1  138 ? -19.006 -20.247 137.820 1.00 40.61  ? 236  THR A O   1 
ATOM   1061  C  CB  . THR A 1  138 ? -17.621 -22.325 136.351 1.00 29.54  ? 236  THR A CB  1 
ATOM   1062  O  OG1 . THR A 1  138 ? -16.644 -21.493 135.712 1.00 33.28  ? 236  THR A OG1 1 
ATOM   1063  C  CG2 . THR A 1  138 ? -17.439 -23.759 135.884 1.00 26.04  ? 236  THR A CG2 1 
ATOM   1064  N  N   . ASN A 1  139 ? -19.611 -19.459 135.806 1.00 28.78  ? 237  ASN A N   1 
ATOM   1065  C  CA  . ASN A 1  139 ? -19.818 -18.102 136.301 1.00 28.73  ? 237  ASN A CA  1 
ATOM   1066  C  C   . ASN A 1  139 ? -21.144 -17.490 135.858 1.00 29.92  ? 237  ASN A C   1 
ATOM   1067  O  O   . ASN A 1  139 ? -21.209 -16.301 135.545 1.00 28.11  ? 237  ASN A O   1 
ATOM   1068  C  CB  . ASN A 1  139 ? -18.662 -17.199 135.866 1.00 29.41  ? 237  ASN A CB  1 
ATOM   1069  C  CG  . ASN A 1  139 ? -17.365 -17.530 136.581 1.00 30.23  ? 237  ASN A CG  1 
ATOM   1070  O  OD1 . ASN A 1  139 ? -17.080 -16.995 137.651 1.00 32.65  ? 237  ASN A OD1 1 
ATOM   1071  N  ND2 . ASN A 1  139 ? -16.572 -18.417 135.991 1.00 26.92  ? 237  ASN A ND2 1 
ATOM   1072  N  N   . MET A 1  140 ? -22.197 -18.300 135.832 1.00 31.57  ? 238  MET A N   1 
ATOM   1073  C  CA  . MET A 1  140 ? -23.518 -17.811 135.449 1.00 26.89  ? 238  MET A CA  1 
ATOM   1074  C  C   . MET A 1  140 ? -24.194 -17.076 136.600 1.00 28.25  ? 238  MET A C   1 
ATOM   1075  O  O   . MET A 1  140 ? -24.026 -17.436 137.764 1.00 31.27  ? 238  MET A O   1 
ATOM   1076  C  CB  . MET A 1  140 ? -24.403 -18.967 134.975 1.00 19.85  ? 238  MET A CB  1 
ATOM   1077  C  CG  . MET A 1  140 ? -23.844 -19.731 133.790 1.00 18.87  ? 238  MET A CG  1 
ATOM   1078  S  SD  . MET A 1  140 ? -25.019 -20.907 133.102 1.00 34.07  ? 238  MET A SD  1 
ATOM   1079  C  CE  . MET A 1  140 ? -26.268 -19.798 132.456 1.00 35.32  ? 238  MET A CE  1 
ATOM   1080  N  N   . LYS A 1  141 ? -24.961 -16.044 136.264 1.00 28.27  ? 239  LYS A N   1 
ATOM   1081  C  CA  . LYS A 1  141 ? -25.611 -15.201 137.262 1.00 28.63  ? 239  LYS A CA  1 
ATOM   1082  C  C   . LYS A 1  141 ? -26.998 -14.786 136.794 1.00 29.50  ? 239  LYS A C   1 
ATOM   1083  O  O   . LYS A 1  141 ? -27.242 -14.672 135.593 1.00 27.42  ? 239  LYS A O   1 
ATOM   1084  C  CB  . LYS A 1  141 ? -24.776 -13.953 137.568 1.00 32.24  ? 239  LYS A CB  1 
ATOM   1085  C  CG  . LYS A 1  141 ? -23.404 -14.228 138.160 1.00 39.49  ? 239  LYS A CG  1 
ATOM   1086  C  CD  . LYS A 1  141 ? -22.592 -12.950 138.290 1.00 42.09  ? 239  LYS A CD  1 
ATOM   1087  C  CE  . LYS A 1  141 ? -21.291 -13.202 139.033 1.00 49.65  ? 239  LYS A CE  1 
ATOM   1088  N  NZ  . LYS A 1  141 ? -20.523 -11.945 139.249 1.00 57.52  ? 239  LYS A NZ  1 
ATOM   1089  N  N   . PRO A 1  142 ? -27.921 -14.568 137.743 1.00 32.00  ? 240  PRO A N   1 
ATOM   1090  C  CA  . PRO A 1  142 ? -29.216 -13.987 137.381 1.00 32.01  ? 240  PRO A CA  1 
ATOM   1091  C  C   . PRO A 1  142 ? -29.031 -12.585 136.818 1.00 34.17  ? 240  PRO A C   1 
ATOM   1092  O  O   . PRO A 1  142 ? -28.335 -11.771 137.423 1.00 38.41  ? 240  PRO A O   1 
ATOM   1093  C  CB  . PRO A 1  142 ? -29.974 -13.948 138.713 1.00 34.44  ? 240  PRO A CB  1 
ATOM   1094  C  CG  . PRO A 1  142 ? -29.290 -14.958 139.575 1.00 38.22  ? 240  PRO A CG  1 
ATOM   1095  C  CD  . PRO A 1  142 ? -27.849 -14.923 139.170 1.00 36.08  ? 240  PRO A CD  1 
ATOM   1096  N  N   . GLY A 1  143 ? -29.641 -12.308 135.672 1.00 32.96  ? 241  GLY A N   1 
ATOM   1097  C  CA  . GLY A 1  143 ? -29.473 -11.019 135.032 1.00 34.40  ? 241  GLY A CA  1 
ATOM   1098  C  C   . GLY A 1  143 ? -30.473 -10.754 133.927 1.00 34.64  ? 241  GLY A C   1 
ATOM   1099  O  O   . GLY A 1  143 ? -31.412 -11.523 133.723 1.00 33.50  ? 241  GLY A O   1 
ATOM   1100  N  N   . LYS A 1  144 ? -30.266 -9.655  133.211 1.00 35.80  ? 242  LYS A N   1 
ATOM   1101  C  CA  . LYS A 1  144 ? -31.155 -9.270  132.124 1.00 36.86  ? 242  LYS A CA  1 
ATOM   1102  C  C   . LYS A 1  144 ? -30.378 -9.010  130.840 1.00 33.64  ? 242  LYS A C   1 
ATOM   1103  O  O   . LYS A 1  144 ? -29.172 -8.763  130.868 1.00 33.38  ? 242  LYS A O   1 
ATOM   1104  C  CB  . LYS A 1  144 ? -31.972 -8.034  132.507 1.00 38.50  ? 242  LYS A CB  1 
ATOM   1105  C  CG  . LYS A 1  144 ? -32.889 -8.247  133.699 1.00 41.08  ? 242  LYS A CG  1 
ATOM   1106  C  CD  . LYS A 1  144 ? -33.638 -6.976  134.057 1.00 48.70  ? 242  LYS A CD  1 
ATOM   1107  C  CE  . LYS A 1  144 ? -34.657 -7.232  135.154 1.00 57.01  ? 242  LYS A CE  1 
ATOM   1108  N  NZ  . LYS A 1  144 ? -35.596 -6.088  135.313 1.00 63.11  ? 242  LYS A NZ  1 
ATOM   1109  N  N   . ILE A 1  145 ? -31.081 -9.068  129.714 1.00 28.76  ? 243  ILE A N   1 
ATOM   1110  C  CA  . ILE A 1  145 ? -30.480 -8.790  128.418 1.00 26.43  ? 243  ILE A CA  1 
ATOM   1111  C  C   . ILE A 1  145 ? -31.176 -7.621  127.733 1.00 27.72  ? 243  ILE A C   1 
ATOM   1112  O  O   . ILE A 1  145 ? -32.404 -7.572  127.659 1.00 28.45  ? 243  ILE A O   1 
ATOM   1113  C  CB  . ILE A 1  145 ? -30.535 -10.020 127.494 1.00 28.87  ? 243  ILE A CB  1 
ATOM   1114  C  CG1 . ILE A 1  145 ? -29.825 -11.209 128.143 1.00 28.48  ? 243  ILE A CG1 1 
ATOM   1115  C  CG2 . ILE A 1  145 ? -29.896 -9.712  126.156 1.00 32.42  ? 243  ILE A CG2 1 
ATOM   1116  C  CD1 . ILE A 1  145 ? -29.967 -12.498 127.367 1.00 26.31  ? 243  ILE A CD1 1 
ATOM   1117  N  N   . PHE A 1  146 ? -30.383 -6.678  127.237 1.00 28.01  ? 244  PHE A N   1 
ATOM   1118  C  CA  . PHE A 1  146 ? -30.915 -5.533  126.512 1.00 28.91  ? 244  PHE A CA  1 
ATOM   1119  C  C   . PHE A 1  146 ? -30.337 -5.485  125.103 1.00 27.67  ? 244  PHE A C   1 
ATOM   1120  O  O   . PHE A 1  146 ? -29.266 -6.032  124.847 1.00 27.59  ? 244  PHE A O   1 
ATOM   1121  C  CB  . PHE A 1  146 ? -30.610 -4.233  127.261 1.00 27.14  ? 244  PHE A CB  1 
ATOM   1122  C  CG  . PHE A 1  146 ? -31.250 -4.151  128.620 1.00 27.86  ? 244  PHE A CG  1 
ATOM   1123  C  CD1 . PHE A 1  146 ? -30.641 -4.724  129.725 1.00 25.72  ? 244  PHE A CD1 1 
ATOM   1124  C  CD2 . PHE A 1  146 ? -32.460 -3.499  128.790 1.00 27.82  ? 244  PHE A CD2 1 
ATOM   1125  C  CE1 . PHE A 1  146 ? -31.230 -4.653  130.973 1.00 25.68  ? 244  PHE A CE1 1 
ATOM   1126  C  CE2 . PHE A 1  146 ? -33.054 -3.424  130.036 1.00 24.81  ? 244  PHE A CE2 1 
ATOM   1127  C  CZ  . PHE A 1  146 ? -32.438 -4.001  131.129 1.00 24.28  ? 244  PHE A CZ  1 
ATOM   1128  N  N   . ILE A 1  147 ? -31.051 -4.835  124.190 1.00 23.72  ? 245  ILE A N   1 
ATOM   1129  C  CA  . ILE A 1  147 ? -30.616 -4.768  122.802 1.00 21.86  ? 245  ILE A CA  1 
ATOM   1130  C  C   . ILE A 1  147 ? -30.764 -3.344  122.272 1.00 21.78  ? 245  ILE A C   1 
ATOM   1131  O  O   . ILE A 1  147 ? -31.680 -2.616  122.654 1.00 21.09  ? 245  ILE A O   1 
ATOM   1132  C  CB  . ILE A 1  147 ? -31.407 -5.762  121.909 1.00 27.54  ? 245  ILE A CB  1 
ATOM   1133  C  CG1 . ILE A 1  147 ? -30.763 -5.887  120.524 1.00 18.79  ? 245  ILE A CG1 1 
ATOM   1134  C  CG2 . ILE A 1  147 ? -32.878 -5.370  121.812 1.00 18.71  ? 245  ILE A CG2 1 
ATOM   1135  C  CD1 . ILE A 1  147 ? -31.334 -7.006  119.688 1.00 16.65  ? 245  ILE A CD1 1 
ATOM   1136  N  N   . ASN A 1  148 ? -29.840 -2.944  121.406 1.00 18.79  ? 246  ASN A N   1 
ATOM   1137  C  CA  . ASN A 1  148 ? -29.860 -1.609  120.826 1.00 19.50  ? 246  ASN A CA  1 
ATOM   1138  C  C   . ASN A 1  148 ? -29.332 -1.632  119.397 1.00 19.78  ? 246  ASN A C   1 
ATOM   1139  O  O   . ASN A 1  148 ? -28.536 -2.496  119.033 1.00 21.82  ? 246  ASN A O   1 
ATOM   1140  C  CB  . ASN A 1  148 ? -29.040 -0.644  121.685 1.00 19.91  ? 246  ASN A CB  1 
ATOM   1141  C  CG  . ASN A 1  148 ? -29.464 0.803   121.509 1.00 21.59  ? 246  ASN A CG  1 
ATOM   1142  O  OD1 . ASN A 1  148 ? -30.231 1.134   120.604 1.00 21.33  ? 246  ASN A OD1 1 
ATOM   1143  N  ND2 . ASN A 1  148 ? -28.973 1.672   122.383 1.00 21.55  ? 246  ASN A ND2 1 
ATOM   1144  N  N   . LYS A 1  149 ? -29.781 -0.677  118.591 1.00 20.37  ? 247  LYS A N   1 
ATOM   1145  C  CA  . LYS A 1  149 ? -29.392 -0.626  117.188 1.00 24.18  ? 247  LYS A CA  1 
ATOM   1146  C  C   . LYS A 1  149 ? -28.975 0.784   116.802 1.00 26.77  ? 247  LYS A C   1 
ATOM   1147  O  O   . LYS A 1  149 ? -29.530 1.768   117.296 1.00 28.89  ? 247  LYS A O   1 
ATOM   1148  C  CB  . LYS A 1  149 ? -30.538 -1.083  116.278 1.00 29.99  ? 247  LYS A CB  1 
ATOM   1149  C  CG  . LYS A 1  149 ? -31.328 -2.286  116.774 1.00 36.64  ? 247  LYS A CG  1 
ATOM   1150  C  CD  . LYS A 1  149 ? -32.424 -2.666  115.784 1.00 40.87  ? 247  LYS A CD  1 
ATOM   1151  C  CE  . LYS A 1  149 ? -33.435 -3.616  116.407 1.00 41.61  ? 247  LYS A CE  1 
ATOM   1152  N  NZ  . LYS A 1  149 ? -32.769 -4.815  116.977 1.00 42.96  ? 247  LYS A NZ  1 
ATOM   1153  N  N   . GLY A 1  150 ? -27.991 0.875   115.916 1.00 25.38  ? 248  GLY A N   1 
ATOM   1154  C  CA  . GLY A 1  150 ? -27.530 2.156   115.418 1.00 26.44  ? 248  GLY A CA  1 
ATOM   1155  C  C   . GLY A 1  150 ? -26.624 1.979   114.220 1.00 25.71  ? 248  GLY A C   1 
ATOM   1156  O  O   . GLY A 1  150 ? -26.064 0.903   114.009 1.00 24.36  ? 248  GLY A O   1 
ATOM   1157  N  N   . ASN A 1  151 ? -26.481 3.037   113.432 1.00 26.46  ? 249  ASN A N   1 
ATOM   1158  C  CA  . ASN A 1  151 ? -25.635 2.992   112.247 1.00 30.84  ? 249  ASN A CA  1 
ATOM   1159  C  C   . ASN A 1  151 ? -24.186 3.343   112.561 1.00 29.29  ? 249  ASN A C   1 
ATOM   1160  O  O   . ASN A 1  151 ? -23.911 4.166   113.436 1.00 29.82  ? 249  ASN A O   1 
ATOM   1161  C  CB  . ASN A 1  151 ? -26.175 3.937   111.172 1.00 34.80  ? 249  ASN A CB  1 
ATOM   1162  C  CG  . ASN A 1  151 ? -27.468 3.443   110.556 1.00 36.29  ? 249  ASN A CG  1 
ATOM   1163  O  OD1 . ASN A 1  151 ? -27.780 2.254   110.607 1.00 37.76  ? 249  ASN A OD1 1 
ATOM   1164  N  ND2 . ASN A 1  151 ? -28.229 4.358   109.968 1.00 37.07  ? 249  ASN A ND2 1 
ATOM   1165  N  N   . VAL A 1  152 ? -23.263 2.710   111.842 1.00 25.27  ? 250  VAL A N   1 
ATOM   1166  C  CA  . VAL A 1  152 ? -21.847 3.038   111.945 1.00 25.40  ? 250  VAL A CA  1 
ATOM   1167  C  C   . VAL A 1  152 ? -21.382 3.605   110.608 1.00 29.16  ? 250  VAL A C   1 
ATOM   1168  O  O   . VAL A 1  152 ? -21.423 2.919   109.586 1.00 29.16  ? 250  VAL A O   1 
ATOM   1169  C  CB  . VAL A 1  152 ? -20.996 1.812   112.321 1.00 21.66  ? 250  VAL A CB  1 
ATOM   1170  C  CG1 . VAL A 1  152 ? -19.549 2.221   112.535 1.00 20.19  ? 250  VAL A CG1 1 
ATOM   1171  C  CG2 . VAL A 1  152 ? -21.552 1.148   113.571 1.00 19.63  ? 250  VAL A CG2 1 
ATOM   1172  N  N   . ASP A 1  153 ? -20.939 4.857   110.619 1.00 32.47  ? 251  ASP A N   1 
ATOM   1173  C  CA  . ASP A 1  153 ? -20.631 5.561   109.377 1.00 35.85  ? 251  ASP A CA  1 
ATOM   1174  C  C   . ASP A 1  153 ? -19.154 5.527   108.995 1.00 32.53  ? 251  ASP A C   1 
ATOM   1175  O  O   . ASP A 1  153 ? -18.274 5.561   109.856 1.00 33.06  ? 251  ASP A O   1 
ATOM   1176  C  CB  . ASP A 1  153 ? -21.091 7.016   109.481 1.00 42.08  ? 251  ASP A CB  1 
ATOM   1177  C  CG  . ASP A 1  153 ? -22.594 7.160   109.378 1.00 48.90  ? 251  ASP A CG  1 
ATOM   1178  O  OD1 . ASP A 1  153 ? -23.216 6.386   108.618 1.00 50.50  ? 251  ASP A OD1 1 
ATOM   1179  O  OD2 . ASP A 1  153 ? -23.155 8.043   110.060 1.00 53.25  ? 251  ASP A OD2 1 
ATOM   1180  N  N   . GLY A 1  154 ? -18.896 5.448   107.693 1.00 27.45  ? 252  GLY A N   1 
ATOM   1181  C  CA  . GLY A 1  154 ? -17.566 5.664   107.154 1.00 23.26  ? 252  GLY A CA  1 
ATOM   1182  C  C   . GLY A 1  154 ? -16.533 4.586   107.417 1.00 23.76  ? 252  GLY A C   1 
ATOM   1183  O  O   . GLY A 1  154 ? -15.336 4.853   107.371 1.00 26.30  ? 252  GLY A O   1 
ATOM   1184  N  N   . VAL A 1  155 ? -16.978 3.366   107.686 1.00 22.91  ? 253  VAL A N   1 
ATOM   1185  C  CA  . VAL A 1  155 ? -16.042 2.286   107.967 1.00 21.22  ? 253  VAL A CA  1 
ATOM   1186  C  C   . VAL A 1  155 ? -16.164 1.163   106.951 1.00 19.98  ? 253  VAL A C   1 
ATOM   1187  O  O   . VAL A 1  155 ? -15.504 0.132   107.076 1.00 22.46  ? 253  VAL A O   1 
ATOM   1188  C  CB  . VAL A 1  155 ? -16.252 1.711   109.379 1.00 20.96  ? 253  VAL A CB  1 
ATOM   1189  C  CG1 . VAL A 1  155 ? -16.020 2.785   110.413 1.00 19.94  ? 253  VAL A CG1 1 
ATOM   1190  C  CG2 . VAL A 1  155 ? -17.656 1.127   109.520 1.00 16.05  ? 253  VAL A CG2 1 
ATOM   1191  N  N   . GLN A 1  156 ? -17.023 1.349   105.956 1.00 19.63  ? 254  GLN A N   1 
ATOM   1192  C  CA  . GLN A 1  156 ? -17.251 0.288   104.989 1.00 20.21  ? 254  GLN A CA  1 
ATOM   1193  C  C   . GLN A 1  156 ? -17.627 0.746   103.583 1.00 20.15  ? 254  GLN A C   1 
ATOM   1194  O  O   . GLN A 1  156 ? -18.313 1.755   103.386 1.00 24.17  ? 254  GLN A O   1 
ATOM   1195  C  CB  . GLN A 1  156 ? -18.343 -0.638  105.496 1.00 22.10  ? 254  GLN A CB  1 
ATOM   1196  C  CG  . GLN A 1  156 ? -19.530 0.105   106.057 1.00 29.69  ? 254  GLN A CG  1 
ATOM   1197  C  CD  . GLN A 1  156 ? -20.658 -0.816  106.471 1.00 32.40  ? 254  GLN A CD  1 
ATOM   1198  O  OE1 . GLN A 1  156 ? -21.829 -0.478  106.336 1.00 32.37  ? 254  GLN A OE1 1 
ATOM   1199  N  NE2 . GLN A 1  156 ? -20.308 -1.991  106.971 1.00 29.71  ? 254  GLN A NE2 1 
ATOM   1200  N  N   . ILE A 1  157 ? -17.173 -0.027  102.606 1.00 19.34  ? 255  ILE A N   1 
ATOM   1201  C  CA  . ILE A 1  157 ? -17.641 0.110   101.238 1.00 22.22  ? 255  ILE A CA  1 
ATOM   1202  C  C   . ILE A 1  157 ? -18.041 -1.253  100.680 1.00 24.06  ? 255  ILE A C   1 
ATOM   1203  O  O   . ILE A 1  157 ? -17.664 -2.295  101.220 1.00 19.59  ? 255  ILE A O   1 
ATOM   1204  C  CB  . ILE A 1  157 ? -16.573 0.732   100.342 1.00 24.01  ? 255  ILE A CB  1 
ATOM   1205  C  CG1 . ILE A 1  157 ? -15.329 -0.154  100.322 1.00 27.30  ? 255  ILE A CG1 1 
ATOM   1206  C  CG2 . ILE A 1  157 ? -16.231 2.131   100.826 1.00 26.53  ? 255  ILE A CG2 1 
ATOM   1207  C  CD1 . ILE A 1  157 ? -14.304 0.274   99.308  1.00 28.81  ? 255  ILE A CD1 1 
ATOM   1208  N  N   . ASN A 1  158 ? -18.818 -1.240  99.604  1.00 24.56  ? 256  ASN A N   1 
ATOM   1209  C  CA  . ASN A 1  158 ? -19.149 -2.470  98.901  1.00 18.53  ? 256  ASN A CA  1 
ATOM   1210  C  C   . ASN A 1  158 ? -18.064 -2.762  97.872  1.00 21.06  ? 256  ASN A C   1 
ATOM   1211  O  O   . ASN A 1  158 ? -17.795 -1.937  96.999  1.00 27.05  ? 256  ASN A O   1 
ATOM   1212  C  CB  . ASN A 1  158 ? -20.520 -2.357  98.233  1.00 18.11  ? 256  ASN A CB  1 
ATOM   1213  C  CG  . ASN A 1  158 ? -21.072 -3.700  97.796  1.00 23.93  ? 256  ASN A CG  1 
ATOM   1214  O  OD1 . ASN A 1  158 ? -20.397 -4.473  97.118  1.00 27.83  ? 256  ASN A OD1 1 
ATOM   1215  N  ND2 . ASN A 1  158 ? -22.309 -3.985  98.189  1.00 22.50  ? 256  ASN A ND2 1 
ATOM   1216  N  N   . ARG A 1  159 ? -17.432 -3.928  97.976  1.00 18.97  ? 257  ARG A N   1 
ATOM   1217  C  CA  . ARG A 1  159 ? -16.306 -4.244  97.102  1.00 19.63  ? 257  ARG A CA  1 
ATOM   1218  C  C   . ARG A 1  159 ? -16.768 -4.912  95.809  1.00 21.09  ? 257  ARG A C   1 
ATOM   1219  O  O   . ARG A 1  159 ? -15.951 -5.279  94.964  1.00 19.67  ? 257  ARG A O   1 
ATOM   1220  C  CB  . ARG A 1  159 ? -15.295 -5.135  97.827  1.00 15.35  ? 257  ARG A CB  1 
ATOM   1221  C  CG  . ARG A 1  159 ? -15.780 -6.540  98.128  1.00 13.81  ? 257  ARG A CG  1 
ATOM   1222  C  CD  . ARG A 1  159 ? -14.740 -7.303  98.932  1.00 13.50  ? 257  ARG A CD  1 
ATOM   1223  N  NE  . ARG A 1  159 ? -15.092 -8.709  99.094  1.00 22.76  ? 257  ARG A NE  1 
ATOM   1224  C  CZ  . ARG A 1  159 ? -14.369 -9.583  99.787  1.00 24.60  ? 257  ARG A CZ  1 
ATOM   1225  N  NH1 . ARG A 1  159 ? -13.253 -9.193  100.390 1.00 25.82  ? 257  ARG A NH1 1 
ATOM   1226  N  NH2 . ARG A 1  159 ? -14.762 -10.847 99.879  1.00 19.33  ? 257  ARG A NH2 1 
ATOM   1227  N  N   . SER A 1  160 ? -18.081 -5.067  95.664  1.00 20.00  ? 258  SER A N   1 
ATOM   1228  C  CA  . SER A 1  160 ? -18.681 -5.519  94.410  1.00 19.70  ? 258  SER A CA  1 
ATOM   1229  C  C   . SER A 1  160 ? -19.991 -4.784  94.147  1.00 21.46  ? 258  SER A C   1 
ATOM   1230  O  O   . SER A 1  160 ? -21.053 -5.405  94.088  1.00 26.27  ? 258  SER A O   1 
ATOM   1231  C  CB  . SER A 1  160 ? -18.924 -7.031  94.430  1.00 18.41  ? 258  SER A CB  1 
ATOM   1232  O  OG  . SER A 1  160 ? -17.708 -7.756  94.388  1.00 14.29  ? 258  SER A OG  1 
ATOM   1233  N  N   . PRO A 1  161 ? -19.918 -3.454  93.984  1.00 20.61  ? 259  PRO A N   1 
ATOM   1234  C  CA  . PRO A 1  161 ? -21.130 -2.630  93.910  1.00 23.30  ? 259  PRO A CA  1 
ATOM   1235  C  C   . PRO A 1  161 ? -21.966 -2.889  92.657  1.00 26.17  ? 259  PRO A C   1 
ATOM   1236  O  O   . PRO A 1  161 ? -23.190 -2.773  92.712  1.00 29.76  ? 259  PRO A O   1 
ATOM   1237  C  CB  . PRO A 1  161 ? -20.579 -1.201  93.917  1.00 24.42  ? 259  PRO A CB  1 
ATOM   1238  C  CG  . PRO A 1  161 ? -19.219 -1.325  93.338  1.00 21.35  ? 259  PRO A CG  1 
ATOM   1239  C  CD  . PRO A 1  161 ? -18.695 -2.651  93.801  1.00 17.33  ? 259  PRO A CD  1 
ATOM   1240  N  N   . TYR A 1  162 ? -21.321 -3.235  91.548  1.00 27.35  ? 260  TYR A N   1 
ATOM   1241  C  CA  . TYR A 1  162 ? -22.041 -3.461  90.297  1.00 27.19  ? 260  TYR A CA  1 
ATOM   1242  C  C   . TYR A 1  162 ? -22.828 -4.765  90.334  1.00 25.61  ? 260  TYR A C   1 
ATOM   1243  O  O   . TYR A 1  162 ? -23.859 -4.892  89.675  1.00 26.00  ? 260  TYR A O   1 
ATOM   1244  C  CB  . TYR A 1  162 ? -21.071 -3.447  89.115  1.00 25.33  ? 260  TYR A CB  1 
ATOM   1245  C  CG  . TYR A 1  162 ? -20.413 -2.101  88.928  1.00 25.95  ? 260  TYR A CG  1 
ATOM   1246  C  CD1 . TYR A 1  162 ? -21.087 -1.062  88.302  1.00 25.59  ? 260  TYR A CD1 1 
ATOM   1247  C  CD2 . TYR A 1  162 ? -19.131 -1.858  89.406  1.00 28.15  ? 260  TYR A CD2 1 
ATOM   1248  C  CE1 . TYR A 1  162 ? -20.497 0.176   88.138  1.00 31.44  ? 260  TYR A CE1 1 
ATOM   1249  C  CE2 . TYR A 1  162 ? -18.532 -0.622  89.248  1.00 29.38  ? 260  TYR A CE2 1 
ATOM   1250  C  CZ  . TYR A 1  162 ? -19.220 0.391   88.613  1.00 31.44  ? 260  TYR A CZ  1 
ATOM   1251  O  OH  . TYR A 1  162 ? -18.630 1.623   88.452  1.00 32.36  ? 260  TYR A OH  1 
ATOM   1252  N  N   . SER A 1  163 ? -22.346 -5.728  91.113  1.00 22.24  ? 261  SER A N   1 
ATOM   1253  C  CA  . SER A 1  163 ? -23.077 -6.973  91.306  1.00 20.98  ? 261  SER A CA  1 
ATOM   1254  C  C   . SER A 1  163 ? -24.289 -6.717  92.190  1.00 25.22  ? 261  SER A C   1 
ATOM   1255  O  O   . SER A 1  163 ? -25.342 -7.326  92.007  1.00 26.47  ? 261  SER A O   1 
ATOM   1256  C  CB  . SER A 1  163 ? -22.183 -8.049  91.920  1.00 18.87  ? 261  SER A CB  1 
ATOM   1257  O  OG  . SER A 1  163 ? -21.131 -8.394  91.037  1.00 20.40  ? 261  SER A OG  1 
ATOM   1258  N  N   . TYR A 1  164 ? -24.129 -5.811  93.149  1.00 25.83  ? 262  TYR A N   1 
ATOM   1259  C  CA  . TYR A 1  164 ? -25.232 -5.386  94.002  1.00 22.17  ? 262  TYR A CA  1 
ATOM   1260  C  C   . TYR A 1  164 ? -26.343 -4.762  93.163  1.00 21.96  ? 262  TYR A C   1 
ATOM   1261  O  O   . TYR A 1  164 ? -27.525 -4.952  93.441  1.00 21.49  ? 262  TYR A O   1 
ATOM   1262  C  CB  . TYR A 1  164 ? -24.743 -4.392  95.061  1.00 17.67  ? 262  TYR A CB  1 
ATOM   1263  C  CG  . TYR A 1  164 ? -25.843 -3.826  95.933  1.00 17.48  ? 262  TYR A CG  1 
ATOM   1264  C  CD1 . TYR A 1  164 ? -26.281 -4.505  97.062  1.00 19.22  ? 262  TYR A CD1 1 
ATOM   1265  C  CD2 . TYR A 1  164 ? -26.443 -2.610  95.627  1.00 16.43  ? 262  TYR A CD2 1 
ATOM   1266  C  CE1 . TYR A 1  164 ? -27.287 -3.989  97.859  1.00 20.12  ? 262  TYR A CE1 1 
ATOM   1267  C  CE2 . TYR A 1  164 ? -27.448 -2.088  96.416  1.00 16.88  ? 262  TYR A CE2 1 
ATOM   1268  C  CZ  . TYR A 1  164 ? -27.867 -2.780  97.531  1.00 20.81  ? 262  TYR A CZ  1 
ATOM   1269  O  OH  . TYR A 1  164 ? -28.868 -2.260  98.319  1.00 20.72  ? 262  TYR A OH  1 
ATOM   1270  N  N   . LEU A 1  165 ? -25.948 -4.019  92.133  1.00 20.31  ? 263  LEU A N   1 
ATOM   1271  C  CA  . LEU A 1  165 ? -26.896 -3.319  91.272  1.00 24.01  ? 263  LEU A CA  1 
ATOM   1272  C  C   . LEU A 1  165 ? -27.703 -4.273  90.397  1.00 25.16  ? 263  LEU A C   1 
ATOM   1273  O  O   . LEU A 1  165 ? -28.728 -3.891  89.831  1.00 26.67  ? 263  LEU A O   1 
ATOM   1274  C  CB  . LEU A 1  165 ? -26.159 -2.308  90.394  1.00 17.66  ? 263  LEU A CB  1 
ATOM   1275  C  CG  . LEU A 1  165 ? -25.547 -1.124  91.147  1.00 21.49  ? 263  LEU A CG  1 
ATOM   1276  C  CD1 . LEU A 1  165 ? -24.667 -0.292  90.225  1.00 18.58  ? 263  LEU A CD1 1 
ATOM   1277  C  CD2 . LEU A 1  165 ? -26.631 -0.271  91.796  1.00 21.35  ? 263  LEU A CD2 1 
ATOM   1278  N  N   . GLN A 1  166 ? -27.242 -5.516  90.292  1.00 24.24  ? 264  GLN A N   1 
ATOM   1279  C  CA  . GLN A 1  166 ? -27.950 -6.530  89.521  1.00 23.96  ? 264  GLN A CA  1 
ATOM   1280  C  C   . GLN A 1  166 ? -29.235 -6.941  90.226  1.00 23.35  ? 264  GLN A C   1 
ATOM   1281  O  O   . GLN A 1  166 ? -30.152 -7.478  89.605  1.00 21.21  ? 264  GLN A O   1 
ATOM   1282  C  CB  . GLN A 1  166 ? -27.060 -7.754  89.292  1.00 23.72  ? 264  GLN A CB  1 
ATOM   1283  C  CG  . GLN A 1  166 ? -25.835 -7.480  88.441  1.00 23.90  ? 264  GLN A CG  1 
ATOM   1284  C  CD  . GLN A 1  166 ? -26.191 -6.909  87.085  1.00 24.27  ? 264  GLN A CD  1 
ATOM   1285  O  OE1 . GLN A 1  166 ? -26.926 -7.526  86.313  1.00 22.92  ? 264  GLN A OE1 1 
ATOM   1286  N  NE2 . GLN A 1  166 ? -25.670 -5.724  86.786  1.00 23.67  ? 264  GLN A NE2 1 
ATOM   1287  N  N   . ASN A 1  167 ? -29.296 -6.680  91.527  1.00 24.59  ? 265  ASN A N   1 
ATOM   1288  C  CA  . ASN A 1  167 ? -30.496 -6.954  92.307  1.00 24.19  ? 265  ASN A CA  1 
ATOM   1289  C  C   . ASN A 1  167 ? -31.651 -6.067  91.852  1.00 24.35  ? 265  ASN A C   1 
ATOM   1290  O  O   . ASN A 1  167 ? -31.423 -4.962  91.359  1.00 24.51  ? 265  ASN A O   1 
ATOM   1291  C  CB  . ASN A 1  167 ? -30.221 -6.749  93.799  1.00 19.46  ? 265  ASN A CB  1 
ATOM   1292  C  CG  . ASN A 1  167 ? -29.241 -7.759  94.351  1.00 16.92  ? 265  ASN A CG  1 
ATOM   1293  O  OD1 . ASN A 1  167 ? -29.386 -8.961  94.133  1.00 14.91  ? 265  ASN A OD1 1 
ATOM   1294  N  ND2 . ASN A 1  167 ? -28.241 -7.279  95.083  1.00 16.78  ? 265  ASN A ND2 1 
ATOM   1295  N  N   . PRO A 1  168 ? -32.896 -6.554  92.009  1.00 23.70  ? 266  PRO A N   1 
ATOM   1296  C  CA  . PRO A 1  168 ? -34.095 -5.820  91.577  1.00 23.24  ? 266  PRO A CA  1 
ATOM   1297  C  C   . PRO A 1  168 ? -34.177 -4.405  92.149  1.00 24.53  ? 266  PRO A C   1 
ATOM   1298  O  O   . PRO A 1  168 ? -33.873 -4.189  93.321  1.00 22.14  ? 266  PRO A O   1 
ATOM   1299  C  CB  . PRO A 1  168 ? -35.241 -6.689  92.101  1.00 21.25  ? 266  PRO A CB  1 
ATOM   1300  C  CG  . PRO A 1  168 ? -34.672 -8.063  92.123  1.00 21.51  ? 266  PRO A CG  1 
ATOM   1301  C  CD  . PRO A 1  168 ? -33.237 -7.889  92.535  1.00 21.69  ? 266  PRO A CD  1 
ATOM   1302  N  N   . GLN A 1  169 ? -34.571 -3.455  91.306  1.00 29.96  ? 267  GLN A N   1 
ATOM   1303  C  CA  . GLN A 1  169 ? -34.666 -2.049  91.689  1.00 30.81  ? 267  GLN A CA  1 
ATOM   1304  C  C   . GLN A 1  169 ? -35.543 -1.788  92.910  1.00 32.62  ? 267  GLN A C   1 
ATOM   1305  O  O   . GLN A 1  169 ? -35.147 -1.062  93.824  1.00 35.38  ? 267  GLN A O   1 
ATOM   1306  C  CB  . GLN A 1  169 ? -35.195 -1.236  90.510  1.00 31.06  ? 267  GLN A CB  1 
ATOM   1307  C  CG  . GLN A 1  169 ? -35.882 0.057   90.902  1.00 33.94  ? 267  GLN A CG  1 
ATOM   1308  C  CD  . GLN A 1  169 ? -34.930 1.115   91.401  1.00 44.42  ? 267  GLN A CD  1 
ATOM   1309  O  OE1 . GLN A 1  169 ? -33.716 1.017   91.220  1.00 55.34  ? 267  GLN A OE1 1 
ATOM   1310  N  NE2 . GLN A 1  169 ? -35.479 2.143   92.034  1.00 43.52  ? 267  GLN A NE2 1 
ATOM   1311  N  N   . SER A 1  170 ? -36.728 -2.390  92.926  1.00 28.51  ? 268  SER A N   1 
ATOM   1312  C  CA  . SER A 1  170 ? -37.672 -2.189  94.015  1.00 25.65  ? 268  SER A CA  1 
ATOM   1313  C  C   . SER A 1  170 ? -37.075 -2.665  95.340  1.00 27.68  ? 268  SER A C   1 
ATOM   1314  O  O   . SER A 1  170 ? -37.324 -2.083  96.398  1.00 31.17  ? 268  SER A O   1 
ATOM   1315  C  CB  . SER A 1  170 ? -38.986 -2.917  93.712  1.00 23.08  ? 268  SER A CB  1 
ATOM   1316  O  OG  . SER A 1  170 ? -38.782 -4.298  93.504  1.00 22.94  ? 268  SER A OG  1 
ATOM   1317  N  N   . GLU A 1  171 ? -36.281 -3.727  95.272  1.00 22.76  ? 269  GLU A N   1 
ATOM   1318  C  CA  . GLU A 1  171 ? -35.605 -4.226  96.456  1.00 20.72  ? 269  GLU A CA  1 
ATOM   1319  C  C   . GLU A 1  171 ? -34.538 -3.231  96.904  1.00 20.71  ? 269  GLU A C   1 
ATOM   1320  O  O   . GLU A 1  171 ? -34.508 -2.833  98.067  1.00 21.20  ? 269  GLU A O   1 
ATOM   1321  C  CB  . GLU A 1  171 ? -34.982 -5.595  96.182  1.00 19.05  ? 269  GLU A CB  1 
ATOM   1322  C  CG  . GLU A 1  171 ? -34.311 -6.223  97.387  1.00 18.43  ? 269  GLU A CG  1 
ATOM   1323  C  CD  . GLU A 1  171 ? -33.587 -7.508  97.043  1.00 25.41  ? 269  GLU A CD  1 
ATOM   1324  O  OE1 . GLU A 1  171 ? -33.755 -8.498  97.782  1.00 29.28  ? 269  GLU A OE1 1 
ATOM   1325  O  OE2 . GLU A 1  171 ? -32.842 -7.529  96.039  1.00 27.66  ? 269  GLU A OE2 1 
ATOM   1326  N  N   . ARG A 1  172 ? -33.689 -2.804  95.973  1.00 20.69  ? 270  ARG A N   1 
ATOM   1327  C  CA  . ARG A 1  172 ? -32.623 -1.853  96.285  1.00 23.36  ? 270  ARG A CA  1 
ATOM   1328  C  C   . ARG A 1  172 ? -33.176 -0.511  96.763  1.00 26.50  ? 270  ARG A C   1 
ATOM   1329  O  O   . ARG A 1  172 ? -32.540 0.185   97.555  1.00 28.46  ? 270  ARG A O   1 
ATOM   1330  C  CB  . ARG A 1  172 ? -31.710 -1.640  95.074  1.00 21.69  ? 270  ARG A CB  1 
ATOM   1331  C  CG  . ARG A 1  172 ? -30.684 -2.744  94.881  1.00 22.06  ? 270  ARG A CG  1 
ATOM   1332  C  CD  . ARG A 1  172 ? -29.762 -2.492  93.690  1.00 21.84  ? 270  ARG A CD  1 
ATOM   1333  N  NE  . ARG A 1  172 ? -30.453 -2.508  92.402  1.00 24.77  ? 270  ARG A NE  1 
ATOM   1334  C  CZ  . ARG A 1  172 ? -30.655 -1.430  91.650  1.00 25.11  ? 270  ARG A CZ  1 
ATOM   1335  N  NH1 . ARG A 1  172 ? -30.221 -0.245  92.057  1.00 25.84  ? 270  ARG A NH1 1 
ATOM   1336  N  NH2 . ARG A 1  172 ? -31.287 -1.533  90.489  1.00 24.85  ? 270  ARG A NH2 1 
ATOM   1337  N  N   . ALA A 1  173 ? -34.365 -0.157  96.283  1.00 26.41  ? 271  ALA A N   1 
ATOM   1338  C  CA  . ALA A 1  173 ? -35.005 1.103   96.652  1.00 29.33  ? 271  ALA A CA  1 
ATOM   1339  C  C   . ALA A 1  173 ? -35.434 1.141   98.119  1.00 26.45  ? 271  ALA A C   1 
ATOM   1340  O  O   . ALA A 1  173 ? -35.661 2.213   98.676  1.00 30.70  ? 271  ALA A O   1 
ATOM   1341  C  CB  . ALA A 1  173 ? -36.203 1.363   95.750  1.00 20.10  ? 271  ALA A CB  1 
ATOM   1342  N  N   . ARG A 1  174 ? -35.553 -0.030  98.738  1.00 23.53  ? 272  ARG A N   1 
ATOM   1343  C  CA  . ARG A 1  174 ? -35.999 -0.121  100.127 1.00 21.44  ? 272  ARG A CA  1 
ATOM   1344  C  C   . ARG A 1  174 ? -34.865 0.084   101.132 1.00 23.18  ? 272  ARG A C   1 
ATOM   1345  O  O   . ARG A 1  174 ? -35.095 0.071   102.341 1.00 21.64  ? 272  ARG A O   1 
ATOM   1346  C  CB  . ARG A 1  174 ? -36.673 -1.469  100.387 1.00 19.86  ? 272  ARG A CB  1 
ATOM   1347  C  CG  . ARG A 1  174 ? -37.949 -1.684  99.591  1.00 21.53  ? 272  ARG A CG  1 
ATOM   1348  C  CD  . ARG A 1  174 ? -38.405 -3.127  99.677  1.00 24.39  ? 272  ARG A CD  1 
ATOM   1349  N  NE  . ARG A 1  174 ? -38.002 -3.741  100.940 1.00 29.57  ? 272  ARG A NE  1 
ATOM   1350  C  CZ  . ARG A 1  174 ? -37.667 -5.019  101.079 1.00 32.89  ? 272  ARG A CZ  1 
ATOM   1351  N  NH1 . ARG A 1  174 ? -37.672 -5.827  100.026 1.00 34.94  ? 272  ARG A NH1 1 
ATOM   1352  N  NH2 . ARG A 1  174 ? -37.318 -5.488  102.269 1.00 33.26  ? 272  ARG A NH2 1 
ATOM   1353  N  N   . TYR A 1  175 ? -33.644 0.260   100.636 1.00 24.68  ? 273  TYR A N   1 
ATOM   1354  C  CA  . TYR A 1  175 ? -32.489 0.451   101.512 1.00 20.18  ? 273  TYR A CA  1 
ATOM   1355  C  C   . TYR A 1  175 ? -31.737 1.732   101.167 1.00 20.96  ? 273  TYR A C   1 
ATOM   1356  O  O   . TYR A 1  175 ? -31.789 2.208   100.032 1.00 28.92  ? 273  TYR A O   1 
ATOM   1357  C  CB  . TYR A 1  175 ? -31.544 -0.753  101.428 1.00 19.17  ? 273  TYR A CB  1 
ATOM   1358  C  CG  . TYR A 1  175 ? -32.223 -2.085  101.667 1.00 18.28  ? 273  TYR A CG  1 
ATOM   1359  C  CD1 . TYR A 1  175 ? -32.399 -2.578  102.954 1.00 16.13  ? 273  TYR A CD1 1 
ATOM   1360  C  CD2 . TYR A 1  175 ? -32.689 -2.847  100.604 1.00 16.91  ? 273  TYR A CD2 1 
ATOM   1361  C  CE1 . TYR A 1  175 ? -33.022 -3.794  103.174 1.00 15.68  ? 273  TYR A CE1 1 
ATOM   1362  C  CE2 . TYR A 1  175 ? -33.313 -4.063  100.814 1.00 15.74  ? 273  TYR A CE2 1 
ATOM   1363  C  CZ  . TYR A 1  175 ? -33.476 -4.532  102.099 1.00 15.49  ? 273  TYR A CZ  1 
ATOM   1364  O  OH  . TYR A 1  175 ? -34.096 -5.742  102.308 1.00 23.66  ? 273  TYR A OH  1 
ATOM   1365  N  N   . SER A 1  176 ? -31.040 2.288   102.153 1.00 18.53  ? 274  SER A N   1 
ATOM   1366  C  CA  . SER A 1  176 ? -30.333 3.553   101.975 1.00 19.15  ? 274  SER A CA  1 
ATOM   1367  C  C   . SER A 1  176 ? -28.896 3.375   101.491 1.00 21.95  ? 274  SER A C   1 
ATOM   1368  O  O   . SER A 1  176 ? -28.273 4.328   101.027 1.00 24.63  ? 274  SER A O   1 
ATOM   1369  C  CB  . SER A 1  176 ? -30.330 4.344   103.285 1.00 19.62  ? 274  SER A CB  1 
ATOM   1370  O  OG  . SER A 1  176 ? -31.649 4.596   103.733 1.00 29.40  ? 274  SER A OG  1 
ATOM   1371  N  N   . SER A 1  177 ? -28.370 2.159   101.596 1.00 24.64  ? 275  SER A N   1 
ATOM   1372  C  CA  . SER A 1  177 ? -26.982 1.904   101.222 1.00 26.29  ? 275  SER A CA  1 
ATOM   1373  C  C   . SER A 1  177 ? -26.775 0.493   100.674 1.00 24.30  ? 275  SER A C   1 
ATOM   1374  O  O   . SER A 1  177 ? -27.651 -0.367  100.796 1.00 22.26  ? 275  SER A O   1 
ATOM   1375  C  CB  . SER A 1  177 ? -26.063 2.135   102.423 1.00 30.33  ? 275  SER A CB  1 
ATOM   1376  O  OG  . SER A 1  177 ? -24.708 1.910   102.078 1.00 40.12  ? 275  SER A OG  1 
ATOM   1377  N  N   . ASN A 1  178 ? -25.610 0.262   100.073 1.00 22.28  ? 276  ASN A N   1 
ATOM   1378  C  CA  . ASN A 1  178 ? -25.273 -1.054  99.540  1.00 21.62  ? 276  ASN A CA  1 
ATOM   1379  C  C   . ASN A 1  178 ? -24.465 -1.889  100.535 1.00 18.91  ? 276  ASN A C   1 
ATOM   1380  O  O   . ASN A 1  178 ? -23.926 -2.939  100.188 1.00 17.71  ? 276  ASN A O   1 
ATOM   1381  C  CB  . ASN A 1  178 ? -24.513 -0.919  98.215  1.00 25.31  ? 276  ASN A CB  1 
ATOM   1382  C  CG  . ASN A 1  178 ? -23.257 -0.072  98.336  1.00 28.91  ? 276  ASN A CG  1 
ATOM   1383  O  OD1 . ASN A 1  178 ? -22.880 0.359   99.426  1.00 37.16  ? 276  ASN A OD1 1 
ATOM   1384  N  ND2 . ASN A 1  178 ? -22.599 0.165   97.207  1.00 20.71  ? 276  ASN A ND2 1 
ATOM   1385  N  N   . THR A 1  179 ? -24.385 -1.401  101.769 1.00 15.36  ? 277  THR A N   1 
ATOM   1386  C  CA  . THR A 1  179 ? -23.816 -2.156  102.884 1.00 14.85  ? 277  THR A CA  1 
ATOM   1387  C  C   . THR A 1  179 ? -24.721 -2.002  104.108 1.00 19.77  ? 277  THR A C   1 
ATOM   1388  O  O   . THR A 1  179 ? -25.410 -0.992  104.242 1.00 22.84  ? 277  THR A O   1 
ATOM   1389  C  CB  . THR A 1  179 ? -22.388 -1.685  103.236 1.00 18.97  ? 277  THR A CB  1 
ATOM   1390  O  OG1 . THR A 1  179 ? -22.411 -0.290  103.556 1.00 22.01  ? 277  THR A OG1 1 
ATOM   1391  C  CG2 . THR A 1  179 ? -21.433 -1.910  102.070 1.00 18.41  ? 277  THR A CG2 1 
ATOM   1392  N  N   . ASP A 1  180 ? -24.734 -2.999  104.992 1.00 14.48  ? 278  ASP A N   1 
ATOM   1393  C  CA  . ASP A 1  180 ? -25.533 -2.911  106.215 1.00 15.82  ? 278  ASP A CA  1 
ATOM   1394  C  C   . ASP A 1  180 ? -24.809 -2.097  107.282 1.00 21.91  ? 278  ASP A C   1 
ATOM   1395  O  O   . ASP A 1  180 ? -24.015 -2.639  108.052 1.00 22.88  ? 278  ASP A O   1 
ATOM   1396  C  CB  . ASP A 1  180 ? -25.847 -4.305  106.763 1.00 14.07  ? 278  ASP A CB  1 
ATOM   1397  C  CG  . ASP A 1  180 ? -26.984 -4.990  106.025 1.00 16.79  ? 278  ASP A CG  1 
ATOM   1398  O  OD1 . ASP A 1  180 ? -27.788 -4.295  105.369 1.00 14.33  ? 278  ASP A OD1 1 
ATOM   1399  O  OD2 . ASP A 1  180 ? -27.077 -6.235  106.112 1.00 13.60  ? 278  ASP A OD2 1 
ATOM   1400  N  N   . LYS A 1  181 ? -25.135 -0.812  107.374 1.00 22.24  ? 279  LYS A N   1 
ATOM   1401  C  CA  . LYS A 1  181 ? -24.456 0.082   108.307 1.00 17.84  ? 279  LYS A CA  1 
ATOM   1402  C  C   . LYS A 1  181 ? -24.890 -0.133  109.753 1.00 18.94  ? 279  LYS A C   1 
ATOM   1403  O  O   . LYS A 1  181 ? -24.218 0.324   110.676 1.00 19.56  ? 279  LYS A O   1 
ATOM   1404  C  CB  . LYS A 1  181 ? -24.690 1.544   107.914 1.00 18.88  ? 279  LYS A CB  1 
ATOM   1405  C  CG  . LYS A 1  181 ? -24.060 1.941   106.591 1.00 25.25  ? 279  LYS A CG  1 
ATOM   1406  C  CD  . LYS A 1  181 ? -24.236 3.425   106.327 1.00 32.43  ? 279  LYS A CD  1 
ATOM   1407  C  CE  . LYS A 1  181 ? -23.495 3.849   105.071 1.00 44.14  ? 279  LYS A CE  1 
ATOM   1408  N  NZ  . LYS A 1  181 ? -23.640 5.306   104.802 1.00 49.00  ? 279  LYS A NZ  1 
ATOM   1409  N  N   . GLU A 1  182 ? -26.001 -0.837  109.945 1.00 18.77  ? 280  GLU A N   1 
ATOM   1410  C  CA  . GLU A 1  182 ? -26.568 -1.042  111.275 1.00 21.66  ? 280  GLU A CA  1 
ATOM   1411  C  C   . GLU A 1  182 ? -25.738 -1.979  112.150 1.00 21.61  ? 280  GLU A C   1 
ATOM   1412  O  O   . GLU A 1  182 ? -25.431 -3.103  111.757 1.00 16.31  ? 280  GLU A O   1 
ATOM   1413  C  CB  . GLU A 1  182 ? -27.988 -1.597  111.162 1.00 23.03  ? 280  GLU A CB  1 
ATOM   1414  C  CG  . GLU A 1  182 ? -28.656 -1.869  112.496 1.00 25.45  ? 280  GLU A CG  1 
ATOM   1415  C  CD  . GLU A 1  182 ? -30.121 -2.244  112.343 1.00 32.06  ? 280  GLU A CD  1 
ATOM   1416  O  OE1 . GLU A 1  182 ? -30.999 -1.396  112.612 1.00 32.69  ? 280  GLU A OE1 1 
ATOM   1417  O  OE2 . GLU A 1  182 ? -30.404 -3.396  111.951 1.00 35.80  ? 280  GLU A OE2 1 
ATOM   1418  N  N   . MET A 1  183 ? -25.365 -1.501  113.333 1.00 23.47  ? 281  MET A N   1 
ATOM   1419  C  CA  . MET A 1  183 ? -24.758 -2.355  114.347 1.00 23.96  ? 281  MET A CA  1 
ATOM   1420  C  C   . MET A 1  183 ? -25.812 -2.767  115.368 1.00 28.42  ? 281  MET A C   1 
ATOM   1421  O  O   . MET A 1  183 ? -26.645 -1.956  115.767 1.00 29.10  ? 281  MET A O   1 
ATOM   1422  C  CB  . MET A 1  183 ? -23.594 -1.645  115.044 1.00 18.56  ? 281  MET A CB  1 
ATOM   1423  C  CG  . MET A 1  183 ? -22.990 -2.439  116.198 1.00 15.84  ? 281  MET A CG  1 
ATOM   1424  S  SD  . MET A 1  183 ? -21.698 -1.549  117.084 1.00 30.73  ? 281  MET A SD  1 
ATOM   1425  C  CE  . MET A 1  183 ? -20.386 -1.562  115.866 1.00 15.85  ? 281  MET A CE  1 
ATOM   1426  N  N   . ILE A 1  184 ? -25.777 -4.028  115.785 1.00 27.68  ? 282  ILE A N   1 
ATOM   1427  C  CA  . ILE A 1  184 ? -26.699 -4.508  116.806 1.00 25.30  ? 282  ILE A CA  1 
ATOM   1428  C  C   . ILE A 1  184 ? -25.934 -4.971  118.038 1.00 22.55  ? 282  ILE A C   1 
ATOM   1429  O  O   . ILE A 1  184 ? -25.203 -5.962  117.998 1.00 22.90  ? 282  ILE A O   1 
ATOM   1430  C  CB  . ILE A 1  184 ? -27.582 -5.651  116.280 1.00 21.54  ? 282  ILE A CB  1 
ATOM   1431  C  CG1 . ILE A 1  184 ? -28.543 -5.119  115.216 1.00 18.76  ? 282  ILE A CG1 1 
ATOM   1432  C  CG2 . ILE A 1  184 ? -28.354 -6.297  117.420 1.00 20.40  ? 282  ILE A CG2 1 
ATOM   1433  C  CD1 . ILE A 1  184 ? -29.269 -6.194  114.455 1.00 21.42  ? 282  ILE A CD1 1 
ATOM   1434  N  N   . VAL A 1  185 ? -26.103 -4.236  119.132 1.00 21.17  ? 283  VAL A N   1 
ATOM   1435  C  CA  . VAL A 1  185 ? -25.419 -4.542  120.379 1.00 20.99  ? 283  VAL A CA  1 
ATOM   1436  C  C   . VAL A 1  185 ? -26.333 -5.300  121.331 1.00 22.31  ? 283  VAL A C   1 
ATOM   1437  O  O   . VAL A 1  185 ? -27.469 -4.892  121.572 1.00 21.63  ? 283  VAL A O   1 
ATOM   1438  C  CB  . VAL A 1  185 ? -24.913 -3.258  121.070 1.00 21.88  ? 283  VAL A CB  1 
ATOM   1439  C  CG1 . VAL A 1  185 ? -24.281 -3.583  122.416 1.00 17.56  ? 283  VAL A CG1 1 
ATOM   1440  C  CG2 . VAL A 1  185 ? -23.925 -2.530  120.174 1.00 22.84  ? 283  VAL A CG2 1 
ATOM   1441  N  N   . LEU A 1  186 ? -25.827 -6.405  121.868 1.00 24.47  ? 284  LEU A N   1 
ATOM   1442  C  CA  . LEU A 1  186 ? -26.552 -7.171  122.870 1.00 23.75  ? 284  LEU A CA  1 
ATOM   1443  C  C   . LEU A 1  186 ? -25.909 -6.953  124.234 1.00 25.54  ? 284  LEU A C   1 
ATOM   1444  O  O   . LEU A 1  186 ? -24.778 -7.373  124.470 1.00 27.73  ? 284  LEU A O   1 
ATOM   1445  C  CB  . LEU A 1  186 ? -26.569 -8.657  122.511 1.00 21.17  ? 284  LEU A CB  1 
ATOM   1446  C  CG  . LEU A 1  186 ? -27.656 -9.499  123.178 1.00 24.81  ? 284  LEU A CG  1 
ATOM   1447  C  CD1 . LEU A 1  186 ? -29.034 -9.046  122.719 1.00 21.05  ? 284  LEU A CD1 1 
ATOM   1448  C  CD2 . LEU A 1  186 ? -27.443 -10.974 122.880 1.00 25.05  ? 284  LEU A CD2 1 
ATOM   1449  N  N   . LYS A 1  187 ? -26.638 -6.293  125.127 1.00 25.57  ? 285  LYS A N   1 
ATOM   1450  C  CA  . LYS A 1  187 ? -26.104 -5.900  126.427 1.00 23.60  ? 285  LYS A CA  1 
ATOM   1451  C  C   . LYS A 1  187 ? -26.525 -6.870  127.529 1.00 24.75  ? 285  LYS A C   1 
ATOM   1452  O  O   . LYS A 1  187 ? -27.690 -7.261  127.616 1.00 26.16  ? 285  LYS A O   1 
ATOM   1453  C  CB  . LYS A 1  187 ? -26.557 -4.479  126.765 1.00 24.25  ? 285  LYS A CB  1 
ATOM   1454  C  CG  . LYS A 1  187 ? -26.335 -4.055  128.204 1.00 25.14  ? 285  LYS A CG  1 
ATOM   1455  C  CD  . LYS A 1  187 ? -26.621 -2.571  128.367 1.00 26.21  ? 285  LYS A CD  1 
ATOM   1456  C  CE  . LYS A 1  187 ? -26.225 -2.068  129.742 1.00 27.08  ? 285  LYS A CE  1 
ATOM   1457  N  NZ  . LYS A 1  187 ? -26.550 -0.625  129.898 1.00 31.12  ? 285  LYS A NZ  1 
ATOM   1458  N  N   . MET A 1  188 ? -25.568 -7.254  128.368 1.00 21.70  ? 286  MET A N   1 
ATOM   1459  C  CA  . MET A 1  188 ? -25.828 -8.212  129.436 1.00 24.39  ? 286  MET A CA  1 
ATOM   1460  C  C   . MET A 1  188 ? -25.368 -7.692  130.795 1.00 29.06  ? 286  MET A C   1 
ATOM   1461  O  O   . MET A 1  188 ? -24.195 -7.376  130.990 1.00 32.29  ? 286  MET A O   1 
ATOM   1462  C  CB  . MET A 1  188 ? -25.149 -9.546  129.123 1.00 23.73  ? 286  MET A CB  1 
ATOM   1463  C  CG  . MET A 1  188 ? -25.813 -10.312 127.989 1.00 26.89  ? 286  MET A CG  1 
ATOM   1464  S  SD  . MET A 1  188 ? -24.726 -11.526 127.220 1.00 44.09  ? 286  MET A SD  1 
ATOM   1465  C  CE  . MET A 1  188 ? -23.795 -10.474 126.111 1.00 52.78  ? 286  MET A CE  1 
ATOM   1466  N  N   . VAL A 1  189 ? -26.311 -7.601  131.728 1.00 28.73  ? 287  VAL A N   1 
ATOM   1467  C  CA  . VAL A 1  189 ? -26.028 -7.129  133.078 1.00 30.24  ? 287  VAL A CA  1 
ATOM   1468  C  C   . VAL A 1  189 ? -26.623 -8.075  134.117 1.00 32.28  ? 287  VAL A C   1 
ATOM   1469  O  O   . VAL A 1  189 ? -27.545 -8.834  133.813 1.00 33.53  ? 287  VAL A O   1 
ATOM   1470  C  CB  . VAL A 1  189 ? -26.585 -5.708  133.312 1.00 33.08  ? 287  VAL A CB  1 
ATOM   1471  C  CG1 . VAL A 1  189 ? -25.957 -4.720  132.339 1.00 22.66  ? 287  VAL A CG1 1 
ATOM   1472  C  CG2 . VAL A 1  189 ? -28.103 -5.702  133.188 1.00 23.37  ? 287  VAL A CG2 1 
ATOM   1473  N  N   . ASP A 1  190 ? -26.092 -8.039  135.336 1.00 31.16  ? 288  ASP A N   1 
ATOM   1474  C  CA  . ASP A 1  190 ? -26.691 -8.783  136.438 1.00 36.65  ? 288  ASP A CA  1 
ATOM   1475  C  C   . ASP A 1  190 ? -27.834 -7.977  137.056 1.00 38.91  ? 288  ASP A C   1 
ATOM   1476  O  O   . ASP A 1  190 ? -28.106 -6.856  136.629 1.00 41.68  ? 288  ASP A O   1 
ATOM   1477  C  CB  . ASP A 1  190 ? -25.637 -9.150  137.494 1.00 42.16  ? 288  ASP A CB  1 
ATOM   1478  C  CG  . ASP A 1  190 ? -24.943 -7.935  138.095 1.00 49.44  ? 288  ASP A CG  1 
ATOM   1479  O  OD1 . ASP A 1  190 ? -25.357 -6.788  137.822 1.00 53.66  ? 288  ASP A OD1 1 
ATOM   1480  O  OD2 . ASP A 1  190 ? -23.974 -8.135  138.856 1.00 49.55  ? 288  ASP A OD2 1 
ATOM   1481  N  N   . LEU A 1  191 ? -28.498 -8.544  138.057 1.00 38.51  ? 289  LEU A N   1 
ATOM   1482  C  CA  . LEU A 1  191 ? -29.659 -7.890  138.650 1.00 39.24  ? 289  LEU A CA  1 
ATOM   1483  C  C   . LEU A 1  191 ? -29.273 -6.641  139.441 1.00 45.23  ? 289  LEU A C   1 
ATOM   1484  O  O   . LEU A 1  191 ? -30.113 -5.782  139.707 1.00 45.15  ? 289  LEU A O   1 
ATOM   1485  C  CB  . LEU A 1  191 ? -30.426 -8.864  139.546 1.00 36.79  ? 289  LEU A CB  1 
ATOM   1486  C  CG  . LEU A 1  191 ? -31.019 -10.083 138.835 1.00 37.68  ? 289  LEU A CG  1 
ATOM   1487  C  CD1 . LEU A 1  191 ? -31.834 -10.933 139.800 1.00 40.06  ? 289  LEU A CD1 1 
ATOM   1488  C  CD2 . LEU A 1  191 ? -31.858 -9.665  137.635 1.00 33.94  ? 289  LEU A CD2 1 
ATOM   1489  N  N   . ASN A 1  192 ? -28.003 -6.545  139.820 1.00 49.95  ? 290  ASN A N   1 
ATOM   1490  C  CA  . ASN A 1  192 ? -27.497 -5.346  140.478 1.00 52.87  ? 290  ASN A CA  1 
ATOM   1491  C  C   . ASN A 1  192 ? -27.172 -4.241  139.483 1.00 52.38  ? 290  ASN A C   1 
ATOM   1492  O  O   . ASN A 1  192 ? -26.806 -3.132  139.867 1.00 51.79  ? 290  ASN A O   1 
ATOM   1493  C  CB  . ASN A 1  192 ? -26.262 -5.679  141.314 1.00 54.09  ? 290  ASN A CB  1 
ATOM   1494  C  CG  . ASN A 1  192 ? -26.610 -6.424  142.584 1.00 58.12  ? 290  ASN A CG  1 
ATOM   1495  O  OD1 . ASN A 1  192 ? -27.562 -6.070  143.279 1.00 59.12  ? 290  ASN A OD1 1 
ATOM   1496  N  ND2 . ASN A 1  192 ? -25.846 -7.469  142.892 1.00 60.49  ? 290  ASN A ND2 1 
ATOM   1497  N  N   . GLY A 1  193 ? -27.300 -4.564  138.202 1.00 52.24  ? 291  GLY A N   1 
ATOM   1498  C  CA  . GLY A 1  193 ? -27.117 -3.598  137.136 1.00 48.73  ? 291  GLY A CA  1 
ATOM   1499  C  C   . GLY A 1  193 ? -25.706 -3.403  136.627 1.00 45.74  ? 291  GLY A C   1 
ATOM   1500  O  O   . GLY A 1  193 ? -25.474 -2.578  135.751 1.00 45.31  ? 291  GLY A O   1 
ATOM   1501  N  N   . ASP A 1  194 ? -24.761 -4.159  137.170 1.00 42.82  ? 292  ASP A N   1 
ATOM   1502  C  CA  . ASP A 1  194 ? -23.374 -4.072  136.727 1.00 46.41  ? 292  ASP A CA  1 
ATOM   1503  C  C   . ASP A 1  194 ? -23.152 -4.870  135.447 1.00 43.09  ? 292  ASP A C   1 
ATOM   1504  O  O   . ASP A 1  194 ? -23.888 -5.809  135.151 1.00 41.91  ? 292  ASP A O   1 
ATOM   1505  C  CB  . ASP A 1  194 ? -22.426 -4.537  137.833 1.00 56.76  ? 292  ASP A CB  1 
ATOM   1506  C  CG  . ASP A 1  194 ? -22.368 -3.562  138.981 1.00 67.59  ? 292  ASP A CG  1 
ATOM   1507  O  OD1 . ASP A 1  194 ? -22.605 -2.356  138.742 1.00 71.28  ? 292  ASP A OD1 1 
ATOM   1508  O  OD2 . ASP A 1  194 ? -22.080 -3.990  140.116 1.00 72.42  ? 292  ASP A OD2 1 
ATOM   1509  N  N   . ASP A 1  195 ? -22.104 -4.504  134.716 1.00 40.73  ? 293  ASP A N   1 
ATOM   1510  C  CA  . ASP A 1  195 ? -21.855 -5.021  133.376 1.00 36.79  ? 293  ASP A CA  1 
ATOM   1511  C  C   . ASP A 1  195 ? -21.259 -6.422  133.365 1.00 33.26  ? 293  ASP A C   1 
ATOM   1512  O  O   . ASP A 1  195 ? -20.263 -6.689  134.035 1.00 33.87  ? 293  ASP A O   1 
ATOM   1513  C  CB  . ASP A 1  195 ? -20.913 -4.079  132.627 1.00 38.41  ? 293  ASP A CB  1 
ATOM   1514  C  CG  . ASP A 1  195 ? -21.480 -2.684  132.478 1.00 43.31  ? 293  ASP A CG  1 
ATOM   1515  O  OD1 . ASP A 1  195 ? -22.687 -2.564  132.177 1.00 42.69  ? 293  ASP A OD1 1 
ATOM   1516  O  OD2 . ASP A 1  195 ? -20.714 -1.710  132.645 1.00 49.14  ? 293  ASP A OD2 1 
ATOM   1517  N  N   . LEU A 1  196 ? -21.881 -7.313  132.598 1.00 29.75  ? 294  LEU A N   1 
ATOM   1518  C  CA  . LEU A 1  196 ? -21.385 -8.675  132.440 1.00 26.23  ? 294  LEU A CA  1 
ATOM   1519  C  C   . LEU A 1  196 ? -20.621 -8.843  131.128 1.00 24.74  ? 294  LEU A C   1 
ATOM   1520  O  O   . LEU A 1  196 ? -19.495 -9.342  131.113 1.00 18.86  ? 294  LEU A O   1 
ATOM   1521  C  CB  . LEU A 1  196 ? -22.538 -9.677  132.498 1.00 22.28  ? 294  LEU A CB  1 
ATOM   1522  C  CG  . LEU A 1  196 ? -23.334 -9.747  133.800 1.00 26.83  ? 294  LEU A CG  1 
ATOM   1523  C  CD1 . LEU A 1  196 ? -24.441 -10.789 133.696 1.00 26.13  ? 294  LEU A CD1 1 
ATOM   1524  C  CD2 . LEU A 1  196 ? -22.415 -10.049 134.971 1.00 28.08  ? 294  LEU A CD2 1 
ATOM   1525  N  N   . GLY A 1  197 ? -21.240 -8.428  130.028 1.00 19.18  ? 295  GLY A N   1 
ATOM   1526  C  CA  . GLY A 1  197 ? -20.626 -8.561  128.722 1.00 20.91  ? 295  GLY A CA  1 
ATOM   1527  C  C   . GLY A 1  197 ? -21.471 -7.985  127.604 1.00 23.84  ? 295  GLY A C   1 
ATOM   1528  O  O   . GLY A 1  197 ? -22.575 -7.502  127.844 1.00 28.79  ? 295  GLY A O   1 
ATOM   1529  N  N   . LEU A 1  198 ? -20.957 -8.037  126.378 1.00 22.70  ? 296  LEU A N   1 
ATOM   1530  C  CA  . LEU A 1  198 ? -21.728 -7.594  125.223 1.00 24.63  ? 296  LEU A CA  1 
ATOM   1531  C  C   . LEU A 1  198 ? -21.368 -8.357  123.953 1.00 25.26  ? 296  LEU A C   1 
ATOM   1532  O  O   . LEU A 1  198 ? -20.250 -8.848  123.803 1.00 18.79  ? 296  LEU A O   1 
ATOM   1533  C  CB  . LEU A 1  198 ? -21.543 -6.083  125.001 1.00 25.68  ? 296  LEU A CB  1 
ATOM   1534  C  CG  . LEU A 1  198 ? -20.264 -5.498  124.382 1.00 24.18  ? 296  LEU A CG  1 
ATOM   1535  C  CD1 . LEU A 1  198 ? -20.277 -5.517  122.852 1.00 16.28  ? 296  LEU A CD1 1 
ATOM   1536  C  CD2 . LEU A 1  198 ? -20.032 -4.081  124.890 1.00 23.56  ? 296  LEU A CD2 1 
ATOM   1537  N  N   . ILE A 1  199 ? -22.332 -8.439  123.040 1.00 28.78  ? 297  ILE A N   1 
ATOM   1538  C  CA  . ILE A 1  199 ? -22.090 -8.962  121.701 1.00 27.26  ? 297  ILE A CA  1 
ATOM   1539  C  C   . ILE A 1  199 ? -22.477 -7.900  120.681 1.00 24.72  ? 297  ILE A C   1 
ATOM   1540  O  O   . ILE A 1  199 ? -23.521 -7.260  120.809 1.00 17.31  ? 297  ILE A O   1 
ATOM   1541  C  CB  . ILE A 1  199 ? -22.887 -10.258 121.423 1.00 21.90  ? 297  ILE A CB  1 
ATOM   1542  C  CG1 . ILE A 1  199 ? -22.624 -11.305 122.505 1.00 17.43  ? 297  ILE A CG1 1 
ATOM   1543  C  CG2 . ILE A 1  199 ? -22.535 -10.822 120.055 1.00 21.18  ? 297  ILE A CG2 1 
ATOM   1544  C  CD1 . ILE A 1  199 ? -23.568 -12.483 122.448 1.00 15.51  ? 297  ILE A CD1 1 
ATOM   1545  N  N   . SER A 1  200 ? -21.639 -7.714  119.667 1.00 26.62  ? 298  SER A N   1 
ATOM   1546  C  CA  . SER A 1  200 ? -21.904 -6.704  118.653 1.00 24.49  ? 298  SER A CA  1 
ATOM   1547  C  C   . SER A 1  200 ? -21.855 -7.291  117.251 1.00 26.33  ? 298  SER A C   1 
ATOM   1548  O  O   . SER A 1  200 ? -20.783 -7.602  116.733 1.00 32.34  ? 298  SER A O   1 
ATOM   1549  C  CB  . SER A 1  200 ? -20.902 -5.556  118.768 1.00 24.13  ? 298  SER A CB  1 
ATOM   1550  O  OG  . SER A 1  200 ? -20.965 -4.711  117.633 1.00 25.09  ? 298  SER A OG  1 
ATOM   1551  N  N   . TRP A 1  201 ? -23.024 -7.434  116.635 1.00 22.17  ? 299  TRP A N   1 
ATOM   1552  C  CA  . TRP A 1  201 ? -23.101 -7.892  115.255 1.00 21.53  ? 299  TRP A CA  1 
ATOM   1553  C  C   . TRP A 1  201 ? -22.948 -6.704  114.313 1.00 20.52  ? 299  TRP A C   1 
ATOM   1554  O  O   . TRP A 1  201 ? -23.630 -5.690  114.463 1.00 21.95  ? 299  TRP A O   1 
ATOM   1555  C  CB  . TRP A 1  201 ? -24.420 -8.625  114.993 1.00 18.58  ? 299  TRP A CB  1 
ATOM   1556  C  CG  . TRP A 1  201 ? -24.450 -10.034 115.521 1.00 16.59  ? 299  TRP A CG  1 
ATOM   1557  C  CD1 . TRP A 1  201 ? -23.978 -11.150 114.896 1.00 17.34  ? 299  TRP A CD1 1 
ATOM   1558  C  CD2 . TRP A 1  201 ? -24.994 -10.476 116.772 1.00 18.35  ? 299  TRP A CD2 1 
ATOM   1559  N  NE1 . TRP A 1  201 ? -24.184 -12.259 115.682 1.00 17.60  ? 299  TRP A NE1 1 
ATOM   1560  C  CE2 . TRP A 1  201 ? -24.807 -11.872 116.839 1.00 18.47  ? 299  TRP A CE2 1 
ATOM   1561  C  CE3 . TRP A 1  201 ? -25.618 -9.828  117.843 1.00 17.77  ? 299  TRP A CE3 1 
ATOM   1562  C  CZ2 . TRP A 1  201 ? -25.220 -12.630 117.933 1.00 19.95  ? 299  TRP A CZ2 1 
ATOM   1563  C  CZ3 . TRP A 1  201 ? -26.028 -10.583 118.930 1.00 16.22  ? 299  TRP A CZ3 1 
ATOM   1564  C  CH2 . TRP A 1  201 ? -25.828 -11.969 118.966 1.00 19.83  ? 299  TRP A CH2 1 
ATOM   1565  N  N   . PHE A 1  202 ? -22.043 -6.834  113.349 1.00 15.61  ? 300  PHE A N   1 
ATOM   1566  C  CA  . PHE A 1  202 ? -21.769 -5.762  112.400 1.00 13.93  ? 300  PHE A CA  1 
ATOM   1567  C  C   . PHE A 1  202 ? -21.025 -6.321  111.193 1.00 13.07  ? 300  PHE A C   1 
ATOM   1568  O  O   . PHE A 1  202 ? -20.038 -7.038  111.343 1.00 15.38  ? 300  PHE A O   1 
ATOM   1569  C  CB  . PHE A 1  202 ? -20.957 -4.646  113.068 1.00 14.41  ? 300  PHE A CB  1 
ATOM   1570  C  CG  . PHE A 1  202 ? -20.701 -3.462  112.179 1.00 15.68  ? 300  PHE A CG  1 
ATOM   1571  C  CD1 . PHE A 1  202 ? -21.721 -2.576  111.877 1.00 14.77  ? 300  PHE A CD1 1 
ATOM   1572  C  CD2 . PHE A 1  202 ? -19.443 -3.234  111.648 1.00 16.79  ? 300  PHE A CD2 1 
ATOM   1573  C  CE1 . PHE A 1  202 ? -21.493 -1.485  111.062 1.00 15.16  ? 300  PHE A CE1 1 
ATOM   1574  C  CE2 . PHE A 1  202 ? -19.208 -2.144  110.830 1.00 16.78  ? 300  PHE A CE2 1 
ATOM   1575  C  CZ  . PHE A 1  202 ? -20.235 -1.269  110.537 1.00 15.53  ? 300  PHE A CZ  1 
ATOM   1576  N  N   . ALA A 1  203 ? -21.509 -5.997  109.997 1.00 15.05  ? 301  ALA A N   1 
ATOM   1577  C  CA  . ALA A 1  203 ? -20.960 -6.556  108.764 1.00 15.01  ? 301  ALA A CA  1 
ATOM   1578  C  C   . ALA A 1  203 ? -19.708 -5.820  108.286 1.00 16.49  ? 301  ALA A C   1 
ATOM   1579  O  O   . ALA A 1  203 ? -19.784 -4.666  107.865 1.00 13.40  ? 301  ALA A O   1 
ATOM   1580  C  CB  . ALA A 1  203 ? -22.019 -6.546  107.671 1.00 12.80  ? 301  ALA A CB  1 
ATOM   1581  N  N   . ILE A 1  204 ? -18.566 -6.503  108.337 1.00 12.71  ? 302  ILE A N   1 
ATOM   1582  C  CA  . ILE A 1  204 ? -17.315 -5.950  107.829 1.00 14.57  ? 302  ILE A CA  1 
ATOM   1583  C  C   . ILE A 1  204 ? -16.227 -7.022  107.734 1.00 13.24  ? 302  ILE A C   1 
ATOM   1584  O  O   . ILE A 1  204 ? -16.108 -7.881  108.608 1.00 14.82  ? 302  ILE A O   1 
ATOM   1585  C  CB  . ILE A 1  204 ? -16.818 -4.769  108.710 1.00 13.35  ? 302  ILE A CB  1 
ATOM   1586  C  CG1 . ILE A 1  204 ? -15.689 -4.004  108.013 1.00 13.65  ? 302  ILE A CG1 1 
ATOM   1587  C  CG2 . ILE A 1  204 ? -16.392 -5.241  110.094 1.00 13.25  ? 302  ILE A CG2 1 
ATOM   1588  C  CD1 . ILE A 1  204 ? -15.386 -2.674  108.659 1.00 14.21  ? 302  ILE A CD1 1 
ATOM   1589  N  N   . HIS A 1  205 ? -15.462 -6.991  106.646 1.00 13.90  ? 303  HIS A N   1 
ATOM   1590  C  CA  . HIS A 1  205 ? -14.304 -7.867  106.493 1.00 12.98  ? 303  HIS A CA  1 
ATOM   1591  C  C   . HIS A 1  205 ? -13.157 -7.411  107.380 1.00 19.06  ? 303  HIS A C   1 
ATOM   1592  O  O   . HIS A 1  205 ? -12.690 -6.283  107.257 1.00 13.05  ? 303  HIS A O   1 
ATOM   1593  C  CB  . HIS A 1  205 ? -13.831 -7.909  105.037 1.00 16.36  ? 303  HIS A CB  1 
ATOM   1594  C  CG  . HIS A 1  205 ? -14.245 -9.141  104.295 1.00 18.26  ? 303  HIS A CG  1 
ATOM   1595  N  ND1 . HIS A 1  205 ? -15.489 -9.285  103.719 1.00 19.46  ? 303  HIS A ND1 1 
ATOM   1596  C  CD2 . HIS A 1  205 ? -13.571 -10.284 104.025 1.00 16.15  ? 303  HIS A CD2 1 
ATOM   1597  C  CE1 . HIS A 1  205 ? -15.565 -10.465 103.131 1.00 19.83  ? 303  HIS A CE1 1 
ATOM   1598  N  NE2 . HIS A 1  205 ? -14.414 -11.091 103.302 1.00 16.32  ? 303  HIS A NE2 1 
ATOM   1599  N  N   . PRO A 1  206 ? -12.702 -8.287  108.285 1.00 18.92  ? 304  PRO A N   1 
ATOM   1600  C  CA  . PRO A 1  206 ? -11.503 -7.972  109.066 1.00 15.44  ? 304  PRO A CA  1 
ATOM   1601  C  C   . PRO A 1  206 ? -10.248 -8.193  108.231 1.00 19.96  ? 304  PRO A C   1 
ATOM   1602  O  O   . PRO A 1  206 ? -9.500  -9.143  108.470 1.00 12.66  ? 304  PRO A O   1 
ATOM   1603  C  CB  . PRO A 1  206 ? -11.570 -8.954  110.244 1.00 17.61  ? 304  PRO A CB  1 
ATOM   1604  C  CG  . PRO A 1  206 ? -12.930 -9.585  110.174 1.00 12.13  ? 304  PRO A CG  1 
ATOM   1605  C  CD  . PRO A 1  206 ? -13.354 -9.520  108.749 1.00 12.06  ? 304  PRO A CD  1 
ATOM   1606  N  N   . VAL A 1  207 ? -10.027 -7.314  107.258 1.00 17.71  ? 305  VAL A N   1 
ATOM   1607  C  CA  . VAL A 1  207 ? -8.892  -7.437  106.354 1.00 17.98  ? 305  VAL A CA  1 
ATOM   1608  C  C   . VAL A 1  207 ? -8.085  -6.140  106.302 1.00 21.22  ? 305  VAL A C   1 
ATOM   1609  O  O   . VAL A 1  207 ? -7.335  -5.903  105.353 1.00 19.23  ? 305  VAL A O   1 
ATOM   1610  C  CB  . VAL A 1  207 ? -9.343  -7.815  104.929 1.00 14.29  ? 305  VAL A CB  1 
ATOM   1611  C  CG1 . VAL A 1  207 ? -9.967  -9.200  104.917 1.00 14.49  ? 305  VAL A CG1 1 
ATOM   1612  C  CG2 . VAL A 1  207 ? -10.319 -6.791  104.389 1.00 13.38  ? 305  VAL A CG2 1 
ATOM   1613  N  N   . SER A 1  208 ? -8.249  -5.301  107.322 1.00 21.80  ? 306  SER A N   1 
ATOM   1614  C  CA  . SER A 1  208 ? -7.506  -4.049  107.417 1.00 21.35  ? 306  SER A CA  1 
ATOM   1615  C  C   . SER A 1  208 ? -6.001  -4.308  107.450 1.00 25.48  ? 306  SER A C   1 
ATOM   1616  O  O   . SER A 1  208 ? -5.210  -3.513  106.938 1.00 15.16  ? 306  SER A O   1 
ATOM   1617  C  CB  . SER A 1  208 ? -7.937  -3.266  108.654 1.00 26.03  ? 306  SER A CB  1 
ATOM   1618  O  OG  . SER A 1  208 ? -9.226  -2.701  108.486 1.00 31.22  ? 306  SER A OG  1 
ATOM   1619  N  N   . MET A 1  209 ? -5.610  -5.422  108.060 1.00 19.42  ? 307  MET A N   1 
ATOM   1620  C  CA  . MET A 1  209 ? -4.241  -5.904  107.952 1.00 16.41  ? 307  MET A CA  1 
ATOM   1621  C  C   . MET A 1  209 ? -4.147  -6.729  106.677 1.00 16.48  ? 307  MET A C   1 
ATOM   1622  O  O   . MET A 1  209 ? -4.735  -7.807  106.592 1.00 14.06  ? 307  MET A O   1 
ATOM   1623  C  CB  . MET A 1  209 ? -3.847  -6.741  109.170 1.00 14.42  ? 307  MET A CB  1 
ATOM   1624  C  CG  . MET A 1  209 ? -3.980  -6.018  110.503 1.00 23.48  ? 307  MET A CG  1 
ATOM   1625  S  SD  . MET A 1  209 ? -2.750  -4.719  110.743 1.00 27.55  ? 307  MET A SD  1 
ATOM   1626  C  CE  . MET A 1  209 ? -1.253  -5.692  110.869 1.00 15.39  ? 307  MET A CE  1 
ATOM   1627  N  N   . ASN A 1  210 ? -3.428  -6.225  105.679 1.00 18.09  ? 308  ASN A N   1 
ATOM   1628  C  CA  . ASN A 1  210 ? -3.431  -6.874  104.373 1.00 21.98  ? 308  ASN A CA  1 
ATOM   1629  C  C   . ASN A 1  210 ? -2.519  -8.103  104.321 1.00 19.16  ? 308  ASN A C   1 
ATOM   1630  O  O   . ASN A 1  210 ? -1.951  -8.506  105.336 1.00 17.62  ? 308  ASN A O   1 
ATOM   1631  C  CB  . ASN A 1  210 ? -3.063  -5.869  103.272 1.00 27.62  ? 308  ASN A CB  1 
ATOM   1632  C  CG  . ASN A 1  210 ? -1.647  -5.316  103.398 1.00 34.07  ? 308  ASN A CG  1 
ATOM   1633  O  OD1 . ASN A 1  210 ? -0.770  -5.915  104.019 1.00 36.58  ? 308  ASN A OD1 1 
ATOM   1634  N  ND2 . ASN A 1  210 ? -1.423  -4.156  102.786 1.00 37.62  ? 308  ASN A ND2 1 
ATOM   1635  N  N   . ASN A 1  211 ? -2.379  -8.694  103.139 1.00 21.80  ? 309  ASN A N   1 
ATOM   1636  C  CA  . ASN A 1  211 ? -1.663  -9.961  103.007 1.00 22.43  ? 309  ASN A CA  1 
ATOM   1637  C  C   . ASN A 1  211 ? -0.140  -9.824  102.974 1.00 20.98  ? 309  ASN A C   1 
ATOM   1638  O  O   . ASN A 1  211 ? 0.572   -10.796 102.729 1.00 22.62  ? 309  ASN A O   1 
ATOM   1639  C  CB  . ASN A 1  211 ? -2.153  -10.705 101.758 1.00 24.92  ? 309  ASN A CB  1 
ATOM   1640  C  CG  . ASN A 1  211 ? -1.955  -9.913  100.484 1.00 30.00  ? 309  ASN A CG  1 
ATOM   1641  O  OD1 . ASN A 1  211 ? -1.305  -8.869  100.479 1.00 35.15  ? 309  ASN A OD1 1 
ATOM   1642  N  ND2 . ASN A 1  211 ? -2.528  -10.403 99.391  1.00 29.79  ? 309  ASN A ND2 1 
ATOM   1643  N  N   . SER A 1  212 ? 0.350   -8.617  103.231 1.00 16.70  ? 310  SER A N   1 
ATOM   1644  C  CA  . SER A 1  212 ? 1.779   -8.396  103.397 1.00 16.43  ? 310  SER A CA  1 
ATOM   1645  C  C   . SER A 1  212 ? 2.178   -8.628  104.849 1.00 19.55  ? 310  SER A C   1 
ATOM   1646  O  O   . SER A 1  212 ? 3.361   -8.697  105.181 1.00 22.12  ? 310  SER A O   1 
ATOM   1647  C  CB  . SER A 1  212 ? 2.167   -6.984  102.957 1.00 16.94  ? 310  SER A CB  1 
ATOM   1648  O  OG  . SER A 1  212 ? 1.963   -6.813  101.566 1.00 23.11  ? 310  SER A OG  1 
ATOM   1649  N  N   . ASN A 1  213 ? 1.172   -8.748  105.710 1.00 18.62  ? 311  ASN A N   1 
ATOM   1650  C  CA  . ASN A 1  213 ? 1.379   -8.870  107.149 1.00 21.42  ? 311  ASN A CA  1 
ATOM   1651  C  C   . ASN A 1  213 ? 1.809   -10.272 107.577 1.00 25.76  ? 311  ASN A C   1 
ATOM   1652  O  O   . ASN A 1  213 ? 1.363   -11.269 107.009 1.00 27.52  ? 311  ASN A O   1 
ATOM   1653  C  CB  . ASN A 1  213 ? 0.101   -8.472  107.888 1.00 18.48  ? 311  ASN A CB  1 
ATOM   1654  C  CG  . ASN A 1  213 ? 0.128   -8.857  109.349 1.00 23.79  ? 311  ASN A CG  1 
ATOM   1655  O  OD1 . ASN A 1  213 ? 0.900   -8.306  110.133 1.00 26.08  ? 311  ASN A OD1 1 
ATOM   1656  N  ND2 . ASN A 1  213 ? -0.712  -9.813  109.725 1.00 24.08  ? 311  ASN A ND2 1 
ATOM   1657  N  N   . HIS A 1  214 ? 2.673   -10.341 108.587 1.00 28.28  ? 312  HIS A N   1 
ATOM   1658  C  CA  . HIS A 1  214 ? 3.142   -11.622 109.107 1.00 26.11  ? 312  HIS A CA  1 
ATOM   1659  C  C   . HIS A 1  214 ? 2.891   -11.754 110.606 1.00 23.16  ? 312  HIS A C   1 
ATOM   1660  O  O   . HIS A 1  214 ? 3.244   -12.762 111.216 1.00 22.89  ? 312  HIS A O   1 
ATOM   1661  C  CB  . HIS A 1  214 ? 4.631   -11.803 108.809 1.00 24.87  ? 312  HIS A CB  1 
ATOM   1662  C  CG  . HIS A 1  214 ? 4.958   -11.789 107.349 1.00 25.11  ? 312  HIS A CG  1 
ATOM   1663  N  ND1 . HIS A 1  214 ? 4.751   -12.878 106.531 1.00 26.47  ? 312  HIS A ND1 1 
ATOM   1664  C  CD2 . HIS A 1  214 ? 5.463   -10.813 106.558 1.00 23.10  ? 312  HIS A CD2 1 
ATOM   1665  C  CE1 . HIS A 1  214 ? 5.122   -12.577 105.299 1.00 26.87  ? 312  HIS A CE1 1 
ATOM   1666  N  NE2 . HIS A 1  214 ? 5.557   -11.330 105.289 1.00 26.14  ? 312  HIS A NE2 1 
ATOM   1667  N  N   . LEU A 1  215 ? 2.277   -10.733 111.193 1.00 20.41  ? 313  LEU A N   1 
ATOM   1668  C  CA  . LEU A 1  215 ? 1.972   -10.742 112.619 1.00 20.56  ? 313  LEU A CA  1 
ATOM   1669  C  C   . LEU A 1  215 ? 0.548   -11.214 112.886 1.00 22.37  ? 313  LEU A C   1 
ATOM   1670  O  O   . LEU A 1  215 ? -0.409  -10.685 112.322 1.00 14.61  ? 313  LEU A O   1 
ATOM   1671  C  CB  . LEU A 1  215 ? 2.191   -9.355  113.225 1.00 19.04  ? 313  LEU A CB  1 
ATOM   1672  C  CG  . LEU A 1  215 ? 3.558   -9.085  113.863 1.00 24.88  ? 313  LEU A CG  1 
ATOM   1673  C  CD1 . LEU A 1  215 ? 4.677   -9.754  113.087 1.00 29.19  ? 313  LEU A CD1 1 
ATOM   1674  C  CD2 . LEU A 1  215 ? 3.808   -7.588  113.973 1.00 25.20  ? 313  LEU A CD2 1 
ATOM   1675  N  N   . VAL A 1  216 ? 0.423   -12.225 113.740 1.00 24.62  ? 314  VAL A N   1 
ATOM   1676  C  CA  . VAL A 1  216 ? -0.877  -12.723 114.175 1.00 20.36  ? 314  VAL A CA  1 
ATOM   1677  C  C   . VAL A 1  216 ? -1.669  -11.635 114.894 1.00 20.12  ? 314  VAL A C   1 
ATOM   1678  O  O   . VAL A 1  216 ? -1.160  -10.989 115.810 1.00 21.24  ? 314  VAL A O   1 
ATOM   1679  C  CB  . VAL A 1  216 ? -0.726  -13.939 115.109 1.00 17.00  ? 314  VAL A CB  1 
ATOM   1680  C  CG1 . VAL A 1  216 ? -2.078  -14.348 115.683 1.00 15.68  ? 314  VAL A CG1 1 
ATOM   1681  C  CG2 . VAL A 1  216 ? -0.080  -15.099 114.370 1.00 14.75  ? 314  VAL A CG2 1 
ATOM   1682  N  N   . ASN A 1  217 ? -2.915  -11.442 114.473 1.00 17.38  ? 315  ASN A N   1 
ATOM   1683  C  CA  . ASN A 1  217 ? -3.793  -10.461 115.093 1.00 16.56  ? 315  ASN A CA  1 
ATOM   1684  C  C   . ASN A 1  217 ? -5.254  -10.724 114.749 1.00 17.28  ? 315  ASN A C   1 
ATOM   1685  O  O   . ASN A 1  217 ? -5.559  -11.555 113.895 1.00 18.86  ? 315  ASN A O   1 
ATOM   1686  C  CB  . ASN A 1  217 ? -3.400  -9.040  114.678 1.00 17.32  ? 315  ASN A CB  1 
ATOM   1687  C  CG  . ASN A 1  217 ? -3.678  -8.758  113.214 1.00 17.88  ? 315  ASN A CG  1 
ATOM   1688  O  OD1 . ASN A 1  217 ? -4.809  -8.457  112.831 1.00 16.39  ? 315  ASN A OD1 1 
ATOM   1689  N  ND2 . ASN A 1  217 ? -2.642  -8.841  112.388 1.00 16.32  ? 315  ASN A ND2 1 
ATOM   1690  N  N   . SER A 1  218 ? -6.155  -10.016 115.420 1.00 22.08  ? 316  SER A N   1 
ATOM   1691  C  CA  . SER A 1  218 ? -7.587  -10.217 115.225 1.00 20.87  ? 316  SER A CA  1 
ATOM   1692  C  C   . SER A 1  218 ? -8.213  -9.105  114.384 1.00 20.65  ? 316  SER A C   1 
ATOM   1693  O  O   . SER A 1  218 ? -9.436  -9.005  114.288 1.00 21.48  ? 316  SER A O   1 
ATOM   1694  C  CB  . SER A 1  218 ? -8.290  -10.328 116.576 1.00 17.47  ? 316  SER A CB  1 
ATOM   1695  O  OG  . SER A 1  218 ? -7.855  -9.317  117.468 1.00 17.43  ? 316  SER A OG  1 
ATOM   1696  N  N   . ASP A 1  219 ? -7.358  -8.274  113.791 1.00 19.10  ? 317  ASP A N   1 
ATOM   1697  C  CA  . ASP A 1  219 ? -7.767  -7.222  112.857 1.00 18.26  ? 317  ASP A CA  1 
ATOM   1698  C  C   . ASP A 1  219 ? -8.706  -6.202  113.504 1.00 17.20  ? 317  ASP A C   1 
ATOM   1699  O  O   . ASP A 1  219 ? -8.709  -6.038  114.723 1.00 23.68  ? 317  ASP A O   1 
ATOM   1700  C  CB  . ASP A 1  219 ? -8.421  -7.834  111.612 1.00 19.25  ? 317  ASP A CB  1 
ATOM   1701  C  CG  . ASP A 1  219 ? -8.184  -7.006  110.359 1.00 25.50  ? 317  ASP A CG  1 
ATOM   1702  O  OD1 . ASP A 1  219 ? -8.905  -6.004  110.160 1.00 24.92  ? 317  ASP A OD1 1 
ATOM   1703  O  OD2 . ASP A 1  219 ? -7.279  -7.357  109.572 1.00 13.51  ? 317  ASP A OD2 1 
ATOM   1704  N  N   . ASN A 1  220 ? -9.491  -5.514  112.679 1.00 17.11  ? 318  ASN A N   1 
ATOM   1705  C  CA  . ASN A 1  220 ? -10.291 -4.376  113.133 1.00 18.30  ? 318  ASN A CA  1 
ATOM   1706  C  C   . ASN A 1  220 ? -11.332 -4.723  114.196 1.00 17.86  ? 318  ASN A C   1 
ATOM   1707  O  O   . ASN A 1  220 ? -11.438 -4.033  115.211 1.00 14.53  ? 318  ASN A O   1 
ATOM   1708  C  CB  . ASN A 1  220 ? -10.980 -3.706  111.938 1.00 18.04  ? 318  ASN A CB  1 
ATOM   1709  C  CG  . ASN A 1  220 ? -11.641 -4.704  111.004 1.00 20.88  ? 318  ASN A CG  1 
ATOM   1710  O  OD1 . ASN A 1  220 ? -12.197 -5.710  111.440 1.00 21.56  ? 318  ASN A OD1 1 
ATOM   1711  N  ND2 . ASN A 1  220 ? -11.587 -4.423  109.707 1.00 13.80  ? 318  ASN A ND2 1 
ATOM   1712  N  N   . VAL A 1  221 ? -12.099 -5.786  113.968 1.00 16.74  ? 319  VAL A N   1 
ATOM   1713  C  CA  . VAL A 1  221 ? -13.122 -6.188  114.928 1.00 18.62  ? 319  VAL A CA  1 
ATOM   1714  C  C   . VAL A 1  221 ? -12.484 -6.687  116.220 1.00 20.04  ? 319  VAL A C   1 
ATOM   1715  O  O   . VAL A 1  221 ? -13.071 -6.573  117.294 1.00 20.90  ? 319  VAL A O   1 
ATOM   1716  C  CB  . VAL A 1  221 ? -14.055 -7.279  114.350 1.00 17.87  ? 319  VAL A CB  1 
ATOM   1717  C  CG1 . VAL A 1  221 ? -14.824 -6.741  113.149 1.00 13.08  ? 319  VAL A CG1 1 
ATOM   1718  C  CG2 . VAL A 1  221 ? -13.273 -8.532  113.982 1.00 12.73  ? 319  VAL A CG2 1 
ATOM   1719  N  N   . GLY A 1  222 ? -11.277 -7.235  116.110 1.00 19.28  ? 320  GLY A N   1 
ATOM   1720  C  CA  . GLY A 1  222 ? -10.531 -7.662  117.277 1.00 17.47  ? 320  GLY A CA  1 
ATOM   1721  C  C   . GLY A 1  222 ? -10.075 -6.481  118.105 1.00 19.54  ? 320  GLY A C   1 
ATOM   1722  O  O   . GLY A 1  222 ? -10.114 -6.517  119.335 1.00 21.82  ? 320  GLY A O   1 
ATOM   1723  N  N   . TYR A 1  223 ? -9.641  -5.428  117.421 1.00 14.61  ? 321  TYR A N   1 
ATOM   1724  C  CA  . TYR A 1  223 ? -9.188  -4.211  118.082 1.00 18.00  ? 321  TYR A CA  1 
ATOM   1725  C  C   . TYR A 1  223 ? -10.353 -3.505  118.763 1.00 19.64  ? 321  TYR A C   1 
ATOM   1726  O  O   . TYR A 1  223 ? -10.188 -2.892  119.818 1.00 21.81  ? 321  TYR A O   1 
ATOM   1727  C  CB  . TYR A 1  223 ? -8.514  -3.273  117.078 1.00 16.96  ? 321  TYR A CB  1 
ATOM   1728  C  CG  . TYR A 1  223 ? -7.976  -1.997  117.688 1.00 17.82  ? 321  TYR A CG  1 
ATOM   1729  C  CD1 . TYR A 1  223 ? -6.944  -2.030  118.618 1.00 16.75  ? 321  TYR A CD1 1 
ATOM   1730  C  CD2 . TYR A 1  223 ? -8.499  -0.759  117.332 1.00 16.51  ? 321  TYR A CD2 1 
ATOM   1731  C  CE1 . TYR A 1  223 ? -6.448  -0.866  119.178 1.00 18.35  ? 321  TYR A CE1 1 
ATOM   1732  C  CE2 . TYR A 1  223 ? -8.010  0.409   117.887 1.00 18.72  ? 321  TYR A CE2 1 
ATOM   1733  C  CZ  . TYR A 1  223 ? -6.985  0.350   118.809 1.00 19.84  ? 321  TYR A CZ  1 
ATOM   1734  O  OH  . TYR A 1  223 ? -6.497  1.513   119.362 1.00 22.99  ? 321  TYR A OH  1 
ATOM   1735  N  N   . ALA A 1  224 ? -11.530 -3.589  118.150 1.00 17.52  ? 322  ALA A N   1 
ATOM   1736  C  CA  . ALA A 1  224 ? -12.737 -2.999  118.719 1.00 18.03  ? 322  ALA A CA  1 
ATOM   1737  C  C   . ALA A 1  224 ? -13.119 -3.714  120.010 1.00 18.11  ? 322  ALA A C   1 
ATOM   1738  O  O   . ALA A 1  224 ? -13.457 -3.076  121.009 1.00 19.43  ? 322  ALA A O   1 
ATOM   1739  C  CB  . ALA A 1  224 ? -13.876 -3.055  117.721 1.00 16.97  ? 322  ALA A CB  1 
ATOM   1740  N  N   . SER A 1  225 ? -13.056 -5.042  119.981 1.00 19.23  ? 323  SER A N   1 
ATOM   1741  C  CA  . SER A 1  225 ? -13.273 -5.856  121.172 1.00 23.52  ? 323  SER A CA  1 
ATOM   1742  C  C   . SER A 1  225 ? -12.228 -5.525  122.231 1.00 26.20  ? 323  SER A C   1 
ATOM   1743  O  O   . SER A 1  225 ? -12.522 -5.480  123.426 1.00 24.61  ? 323  SER A O   1 
ATOM   1744  C  CB  . SER A 1  225 ? -13.226 -7.345  120.826 1.00 26.40  ? 323  SER A CB  1 
ATOM   1745  O  OG  . SER A 1  225 ? -14.191 -7.670  119.841 1.00 29.71  ? 323  SER A OG  1 
ATOM   1746  N  N   . TYR A 1  226 ? -11.002 -5.302  121.768 1.00 25.99  ? 324  TYR A N   1 
ATOM   1747  C  CA  . TYR A 1  226 ? -9.878  -4.954  122.626 1.00 22.75  ? 324  TYR A CA  1 
ATOM   1748  C  C   . TYR A 1  226 ? -10.136 -3.645  123.372 1.00 23.10  ? 324  TYR A C   1 
ATOM   1749  O  O   . TYR A 1  226 ? -9.916  -3.558  124.580 1.00 21.93  ? 324  TYR A O   1 
ATOM   1750  C  CB  . TYR A 1  226 ? -8.602  -4.864  121.783 1.00 23.72  ? 324  TYR A CB  1 
ATOM   1751  C  CG  . TYR A 1  226 ? -7.392  -4.277  122.476 1.00 21.85  ? 324  TYR A CG  1 
ATOM   1752  C  CD1 . TYR A 1  226 ? -6.558  -5.069  123.255 1.00 23.41  ? 324  TYR A CD1 1 
ATOM   1753  C  CD2 . TYR A 1  226 ? -7.061  -2.936  122.318 1.00 20.10  ? 324  TYR A CD2 1 
ATOM   1754  C  CE1 . TYR A 1  226 ? -5.441  -4.538  123.877 1.00 24.58  ? 324  TYR A CE1 1 
ATOM   1755  C  CE2 . TYR A 1  226 ? -5.948  -2.397  122.934 1.00 21.01  ? 324  TYR A CE2 1 
ATOM   1756  C  CZ  . TYR A 1  226 ? -5.141  -3.201  123.712 1.00 23.77  ? 324  TYR A CZ  1 
ATOM   1757  O  OH  . TYR A 1  226 ? -4.031  -2.666  124.326 1.00 24.50  ? 324  TYR A OH  1 
ATOM   1758  N  N   . LEU A 1  227 ? -10.619 -2.635  122.654 1.00 24.15  ? 325  LEU A N   1 
ATOM   1759  C  CA  . LEU A 1  227 ? -10.901 -1.335  123.260 1.00 21.88  ? 325  LEU A CA  1 
ATOM   1760  C  C   . LEU A 1  227 ? -12.073 -1.397  124.237 1.00 27.82  ? 325  LEU A C   1 
ATOM   1761  O  O   . LEU A 1  227 ? -12.019 -0.805  125.316 1.00 28.36  ? 325  LEU A O   1 
ATOM   1762  C  CB  . LEU A 1  227 ? -11.183 -0.286  122.182 1.00 19.09  ? 325  LEU A CB  1 
ATOM   1763  C  CG  . LEU A 1  227 ? -10.025 0.115   121.268 1.00 19.98  ? 325  LEU A CG  1 
ATOM   1764  C  CD1 . LEU A 1  227 ? -10.485 1.153   120.255 1.00 19.61  ? 325  LEU A CD1 1 
ATOM   1765  C  CD2 . LEU A 1  227 ? -8.852  0.637   122.081 1.00 18.42  ? 325  LEU A CD2 1 
ATOM   1766  N  N   . LEU A 1  228 ? -13.132 -2.107  123.855 1.00 31.31  ? 326  LEU A N   1 
ATOM   1767  C  CA  . LEU A 1  228 ? -14.297 -2.260  124.723 1.00 33.12  ? 326  LEU A CA  1 
ATOM   1768  C  C   . LEU A 1  228 ? -13.936 -2.919  126.051 1.00 29.32  ? 326  LEU A C   1 
ATOM   1769  O  O   . LEU A 1  228 ? -14.342 -2.453  127.116 1.00 31.17  ? 326  LEU A O   1 
ATOM   1770  C  CB  . LEU A 1  228 ? -15.389 -3.077  124.026 1.00 32.64  ? 326  LEU A CB  1 
ATOM   1771  C  CG  . LEU A 1  228 ? -16.193 -2.403  122.913 1.00 29.71  ? 326  LEU A CG  1 
ATOM   1772  C  CD1 . LEU A 1  228 ? -17.016 -3.432  122.166 1.00 24.73  ? 326  LEU A CD1 1 
ATOM   1773  C  CD2 . LEU A 1  228 ? -17.095 -1.322  123.489 1.00 30.77  ? 326  LEU A CD2 1 
ATOM   1774  N  N   . GLU A 1  229 ? -13.167 -3.999  125.982 1.00 25.80  ? 327  GLU A N   1 
ATOM   1775  C  CA  . GLU A 1  229 ? -12.783 -4.735  127.180 1.00 25.57  ? 327  GLU A CA  1 
ATOM   1776  C  C   . GLU A 1  229 ? -11.831 -3.923  128.057 1.00 24.96  ? 327  GLU A C   1 
ATOM   1777  O  O   . GLU A 1  229 ? -11.976 -3.895  129.279 1.00 24.46  ? 327  GLU A O   1 
ATOM   1778  C  CB  . GLU A 1  229 ? -12.147 -6.076  126.800 1.00 24.67  ? 327  GLU A CB  1 
ATOM   1779  C  CG  . GLU A 1  229 ? -13.134 -7.083  126.225 1.00 29.25  ? 327  GLU A CG  1 
ATOM   1780  C  CD  . GLU A 1  229 ? -12.496 -8.425  125.909 1.00 34.36  ? 327  GLU A CD  1 
ATOM   1781  O  OE1 . GLU A 1  229 ? -13.219 -9.444  125.918 1.00 33.98  ? 327  GLU A OE1 1 
ATOM   1782  O  OE2 . GLU A 1  229 ? -11.275 -8.460  125.642 1.00 36.89  ? 327  GLU A OE2 1 
ATOM   1783  N  N   . GLN A 1  230 ? -10.869 -3.251  127.432 1.00 19.80  ? 328  GLN A N   1 
ATOM   1784  C  CA  . GLN A 1  230 ? -9.893  -2.461  128.174 1.00 25.24  ? 328  GLN A CA  1 
ATOM   1785  C  C   . GLN A 1  230 ? -10.530 -1.254  128.857 1.00 28.51  ? 328  GLN A C   1 
ATOM   1786  O  O   . GLN A 1  230 ? -10.072 -0.816  129.912 1.00 25.83  ? 328  GLN A O   1 
ATOM   1787  C  CB  . GLN A 1  230 ? -8.763  -2.001  127.252 1.00 29.87  ? 328  GLN A CB  1 
ATOM   1788  C  CG  . GLN A 1  230 ? -7.764  -3.095  126.910 1.00 32.49  ? 328  GLN A CG  1 
ATOM   1789  C  CD  . GLN A 1  230 ? -7.047  -3.630  128.135 1.00 29.66  ? 328  GLN A CD  1 
ATOM   1790  O  OE1 . GLN A 1  230 ? -7.415  -4.672  128.680 1.00 23.20  ? 328  GLN A OE1 1 
ATOM   1791  N  NE2 . GLN A 1  230 ? -6.014  -2.918  128.574 1.00 31.14  ? 328  GLN A NE2 1 
ATOM   1792  N  N   . GLU A 1  231 ? -11.589 -0.722  128.258 1.00 33.64  ? 329  GLU A N   1 
ATOM   1793  C  CA  . GLU A 1  231 ? -12.292 0.413   128.844 1.00 38.08  ? 329  GLU A CA  1 
ATOM   1794  C  C   . GLU A 1  231 ? -13.077 0.001   130.084 1.00 37.71  ? 329  GLU A C   1 
ATOM   1795  O  O   . GLU A 1  231 ? -13.049 0.694   131.100 1.00 41.55  ? 329  GLU A O   1 
ATOM   1796  C  CB  . GLU A 1  231 ? -13.226 1.058   127.819 1.00 41.81  ? 329  GLU A CB  1 
ATOM   1797  C  CG  . GLU A 1  231 ? -13.621 2.479   128.175 1.00 49.86  ? 329  GLU A CG  1 
ATOM   1798  C  CD  . GLU A 1  231 ? -14.895 2.925   127.489 1.00 59.41  ? 329  GLU A CD  1 
ATOM   1799  O  OE1 . GLU A 1  231 ? -15.625 2.061   126.957 1.00 59.91  ? 329  GLU A OE1 1 
ATOM   1800  O  OE2 . GLU A 1  231 ? -15.164 4.144   127.480 1.00 65.70  ? 329  GLU A OE2 1 
ATOM   1801  N  N   . LYS A 1  232 ? -13.774 -1.127  129.996 1.00 32.03  ? 330  LYS A N   1 
ATOM   1802  C  CA  . LYS A 1  232 ? -14.566 -1.621  131.118 1.00 32.63  ? 330  LYS A CA  1 
ATOM   1803  C  C   . LYS A 1  232 ? -13.692 -2.223  132.214 1.00 33.96  ? 330  LYS A C   1 
ATOM   1804  O  O   . LYS A 1  232 ? -13.875 -1.932  133.396 1.00 38.41  ? 330  LYS A O   1 
ATOM   1805  C  CB  . LYS A 1  232 ? -15.582 -2.665  130.638 1.00 34.10  ? 330  LYS A CB  1 
ATOM   1806  C  CG  . LYS A 1  232 ? -16.757 -2.100  129.850 1.00 39.05  ? 330  LYS A CG  1 
ATOM   1807  C  CD  . LYS A 1  232 ? -17.792 -1.466  130.774 1.00 42.43  ? 330  LYS A CD  1 
ATOM   1808  C  CE  . LYS A 1  232 ? -18.503 -0.298  130.106 1.00 42.79  ? 330  LYS A CE  1 
ATOM   1809  N  NZ  . LYS A 1  232 ? -19.059 -0.674  128.776 1.00 40.34  ? 330  LYS A NZ  1 
ATOM   1810  N  N   . ASN A 1  233 ? -12.739 -3.060  131.816 1.00 32.62  ? 331  ASN A N   1 
ATOM   1811  C  CA  . ASN A 1  233 ? -11.861 -3.732  132.769 1.00 33.83  ? 331  ASN A CA  1 
ATOM   1812  C  C   . ASN A 1  233 ? -10.666 -2.882  133.198 1.00 35.48  ? 331  ASN A C   1 
ATOM   1813  O  O   . ASN A 1  233 ? -9.516  -3.283  133.014 1.00 32.41  ? 331  ASN A O   1 
ATOM   1814  C  CB  . ASN A 1  233 ? -11.363 -5.053  132.181 1.00 29.78  ? 331  ASN A CB  1 
ATOM   1815  C  CG  . ASN A 1  233 ? -12.486 -6.036  131.927 1.00 29.29  ? 331  ASN A CG  1 
ATOM   1816  O  OD1 . ASN A 1  233 ? -13.417 -6.151  132.723 1.00 30.21  ? 331  ASN A OD1 1 
ATOM   1817  N  ND2 . ASN A 1  233 ? -12.405 -6.749  130.811 1.00 19.13  ? 331  ASN A ND2 1 
ATOM   1818  N  N   . LYS A 1  234 ? -10.944 -1.710  133.762 1.00 36.36  ? 332  LYS A N   1 
ATOM   1819  C  CA  . LYS A 1  234 ? -9.894  -0.819  134.251 1.00 35.53  ? 332  LYS A CA  1 
ATOM   1820  C  C   . LYS A 1  234 ? -8.969  -1.519  135.244 1.00 34.70  ? 332  LYS A C   1 
ATOM   1821  O  O   . LYS A 1  234 ? -9.424  -2.185  136.173 1.00 34.74  ? 332  LYS A O   1 
ATOM   1822  C  CB  . LYS A 1  234 ? -10.497 0.432   134.893 1.00 39.45  ? 332  LYS A CB  1 
ATOM   1823  C  CG  . LYS A 1  234 ? -11.206 1.355   133.914 1.00 45.05  ? 332  LYS A CG  1 
ATOM   1824  C  CD  . LYS A 1  234 ? -11.794 2.564   134.624 1.00 49.77  ? 332  LYS A CD  1 
ATOM   1825  C  CE  . LYS A 1  234 ? -10.696 3.427   135.238 1.00 49.57  ? 332  LYS A CE  1 
ATOM   1826  N  NZ  . LYS A 1  234 ? -11.236 4.627   135.943 1.00 47.63  ? 332  LYS A NZ  1 
ATOM   1827  N  N   . GLY A 1  235 ? -7.666  -1.366  135.032 1.00 34.27  ? 333  GLY A N   1 
ATOM   1828  C  CA  . GLY A 1  235 ? -6.672  -1.962  135.905 1.00 32.56  ? 333  GLY A CA  1 
ATOM   1829  C  C   . GLY A 1  235 ? -6.249  -3.357  135.484 1.00 36.42  ? 333  GLY A C   1 
ATOM   1830  O  O   . GLY A 1  235 ? -5.331  -3.934  136.064 1.00 41.39  ? 333  GLY A O   1 
ATOM   1831  N  N   . TYR A 1  236 ? -6.915  -3.901  134.472 1.00 34.81  ? 334  TYR A N   1 
ATOM   1832  C  CA  . TYR A 1  236 ? -6.576  -5.226  133.968 1.00 32.52  ? 334  TYR A CA  1 
ATOM   1833  C  C   . TYR A 1  236 ? -5.728  -5.145  132.703 1.00 33.66  ? 334  TYR A C   1 
ATOM   1834  O  O   . TYR A 1  236 ? -5.915  -4.253  131.874 1.00 34.39  ? 334  TYR A O   1 
ATOM   1835  C  CB  . TYR A 1  236 ? -7.842  -6.037  133.688 1.00 31.49  ? 334  TYR A CB  1 
ATOM   1836  C  CG  . TYR A 1  236 ? -8.568  -6.512  134.925 1.00 31.09  ? 334  TYR A CG  1 
ATOM   1837  C  CD1 . TYR A 1  236 ? -8.185  -7.679  135.572 1.00 27.45  ? 334  TYR A CD1 1 
ATOM   1838  C  CD2 . TYR A 1  236 ? -9.646  -5.802  135.439 1.00 29.84  ? 334  TYR A CD2 1 
ATOM   1839  C  CE1 . TYR A 1  236 ? -8.848  -8.123  136.699 1.00 24.07  ? 334  TYR A CE1 1 
ATOM   1840  C  CE2 . TYR A 1  236 ? -10.316 -6.238  136.566 1.00 27.86  ? 334  TYR A CE2 1 
ATOM   1841  C  CZ  . TYR A 1  236 ? -9.913  -7.400  137.192 1.00 27.73  ? 334  TYR A CZ  1 
ATOM   1842  O  OH  . TYR A 1  236 ? -10.577 -7.840  138.314 1.00 30.72  ? 334  TYR A OH  1 
ATOM   1843  N  N   . LEU A 1  237 ? -4.800  -6.087  132.561 1.00 31.39  ? 335  LEU A N   1 
ATOM   1844  C  CA  . LEU A 1  237 ? -3.996  -6.206  131.350 1.00 28.19  ? 335  LEU A CA  1 
ATOM   1845  C  C   . LEU A 1  237 ? -4.850  -6.770  130.219 1.00 27.55  ? 335  LEU A C   1 
ATOM   1846  O  O   . LEU A 1  237 ? -5.859  -7.424  130.480 1.00 25.11  ? 335  LEU A O   1 
ATOM   1847  C  CB  . LEU A 1  237 ? -2.778  -7.100  131.599 1.00 26.21  ? 335  LEU A CB  1 
ATOM   1848  C  CG  . LEU A 1  237 ? -1.659  -6.521  132.466 1.00 26.20  ? 335  LEU A CG  1 
ATOM   1849  C  CD1 . LEU A 1  237 ? -0.732  -7.628  132.937 1.00 21.15  ? 335  LEU A CD1 1 
ATOM   1850  C  CD2 . LEU A 1  237 ? -0.886  -5.458  131.700 1.00 22.80  ? 335  LEU A CD2 1 
ATOM   1851  N  N   . PRO A 1  238 ? -4.459  -6.505  128.959 1.00 26.99  ? 336  PRO A N   1 
ATOM   1852  C  CA  . PRO A 1  238 ? -5.169  -7.073  127.808 1.00 25.02  ? 336  PRO A CA  1 
ATOM   1853  C  C   . PRO A 1  238 ? -5.357  -8.585  127.915 1.00 23.42  ? 336  PRO A C   1 
ATOM   1854  O  O   . PRO A 1  238 ? -4.413  -9.303  128.246 1.00 22.79  ? 336  PRO A O   1 
ATOM   1855  C  CB  . PRO A 1  238 ? -4.255  -6.717  126.636 1.00 22.01  ? 336  PRO A CB  1 
ATOM   1856  C  CG  . PRO A 1  238 ? -3.632  -5.437  127.052 1.00 18.72  ? 336  PRO A CG  1 
ATOM   1857  C  CD  . PRO A 1  238 ? -3.396  -5.575  128.535 1.00 21.81  ? 336  PRO A CD  1 
ATOM   1858  N  N   . GLY A 1  239 ? -6.571  -9.051  127.635 1.00 21.11  ? 337  GLY A N   1 
ATOM   1859  C  CA  . GLY A 1  239 ? -6.893  -10.461 127.743 1.00 16.91  ? 337  GLY A CA  1 
ATOM   1860  C  C   . GLY A 1  239 ? -7.369  -10.846 129.130 1.00 17.40  ? 337  GLY A C   1 
ATOM   1861  O  O   . GLY A 1  239 ? -7.801  -11.976 129.354 1.00 18.68  ? 337  GLY A O   1 
ATOM   1862  N  N   . GLN A 1  240 ? -7.288  -9.902  130.063 1.00 18.08  ? 338  GLN A N   1 
ATOM   1863  C  CA  . GLN A 1  240 ? -7.751  -10.128 131.428 1.00 28.64  ? 338  GLN A CA  1 
ATOM   1864  C  C   . GLN A 1  240 ? -8.903  -9.192  131.788 1.00 31.31  ? 338  GLN A C   1 
ATOM   1865  O  O   . GLN A 1  240 ? -9.117  -8.174  131.129 1.00 34.91  ? 338  GLN A O   1 
ATOM   1866  C  CB  . GLN A 1  240 ? -6.600  -9.952  132.420 1.00 26.41  ? 338  GLN A CB  1 
ATOM   1867  C  CG  . GLN A 1  240 ? -5.464  -10.938 132.233 1.00 28.91  ? 338  GLN A CG  1 
ATOM   1868  C  CD  . GLN A 1  240 ? -4.304  -10.664 133.166 1.00 39.26  ? 338  GLN A CD  1 
ATOM   1869  O  OE1 . GLN A 1  240 ? -4.490  -10.470 134.367 1.00 47.75  ? 338  GLN A OE1 1 
ATOM   1870  N  NE2 . GLN A 1  240 ? -3.095  -10.651 132.617 1.00 41.51  ? 338  GLN A NE2 1 
ATOM   1871  N  N   . GLY A 1  241 ? -9.641  -9.542  132.836 1.00 29.25  ? 339  GLY A N   1 
ATOM   1872  C  CA  . GLY A 1  241 ? -10.785 -8.757  133.258 1.00 30.67  ? 339  GLY A CA  1 
ATOM   1873  C  C   . GLY A 1  241 ? -12.086 -9.512  133.068 1.00 31.98  ? 339  GLY A C   1 
ATOM   1874  O  O   . GLY A 1  241 ? -12.229 -10.277 132.116 1.00 34.24  ? 339  GLY A O   1 
ATOM   1875  N  N   . PRO A 1  242 ? -13.050 -9.294  133.973 1.00 29.52  ? 340  PRO A N   1 
ATOM   1876  C  CA  . PRO A 1  242 ? -14.318 -10.033 133.968 1.00 27.05  ? 340  PRO A CA  1 
ATOM   1877  C  C   . PRO A 1  242 ? -15.210 -9.719  132.766 1.00 22.01  ? 340  PRO A C   1 
ATOM   1878  O  O   . PRO A 1  242 ? -15.829 -10.631 132.218 1.00 19.41  ? 340  PRO A O   1 
ATOM   1879  C  CB  . PRO A 1  242 ? -14.984 -9.583  135.271 1.00 28.41  ? 340  PRO A CB  1 
ATOM   1880  C  CG  . PRO A 1  242 ? -14.405 -8.236  135.544 1.00 26.31  ? 340  PRO A CG  1 
ATOM   1881  C  CD  . PRO A 1  242 ? -12.986 -8.312  135.069 1.00 27.73  ? 340  PRO A CD  1 
ATOM   1882  N  N   . PHE A 1  243 ? -15.267 -8.454  132.360 1.00 22.99  ? 341  PHE A N   1 
ATOM   1883  C  CA  . PHE A 1  243 ? -16.122 -8.043  131.249 1.00 22.49  ? 341  PHE A CA  1 
ATOM   1884  C  C   . PHE A 1  243 ? -15.654 -8.649  129.930 1.00 23.20  ? 341  PHE A C   1 
ATOM   1885  O  O   . PHE A 1  243 ? -14.469 -8.612  129.600 1.00 28.20  ? 341  PHE A O   1 
ATOM   1886  C  CB  . PHE A 1  243 ? -16.164 -6.517  131.141 1.00 24.53  ? 341  PHE A CB  1 
ATOM   1887  C  CG  . PHE A 1  243 ? -17.164 -6.007  130.144 1.00 25.63  ? 341  PHE A CG  1 
ATOM   1888  C  CD1 . PHE A 1  243 ? -18.496 -5.855  130.496 1.00 26.43  ? 341  PHE A CD1 1 
ATOM   1889  C  CD2 . PHE A 1  243 ? -16.775 -5.680  128.854 1.00 23.72  ? 341  PHE A CD2 1 
ATOM   1890  C  CE1 . PHE A 1  243 ? -19.421 -5.384  129.581 1.00 23.83  ? 341  PHE A CE1 1 
ATOM   1891  C  CE2 . PHE A 1  243 ? -17.695 -5.211  127.935 1.00 22.22  ? 341  PHE A CE2 1 
ATOM   1892  C  CZ  . PHE A 1  243 ? -19.020 -5.063  128.299 1.00 20.75  ? 341  PHE A CZ  1 
ATOM   1893  N  N   . VAL A 1  244 ? -16.599 -9.203  129.179 1.00 21.77  ? 342  VAL A N   1 
ATOM   1894  C  CA  . VAL A 1  244 ? -16.298 -9.844  127.905 1.00 22.12  ? 342  VAL A CA  1 
ATOM   1895  C  C   . VAL A 1  244 ? -17.036 -9.166  126.757 1.00 23.26  ? 342  VAL A C   1 
ATOM   1896  O  O   . VAL A 1  244 ? -18.262 -9.076  126.764 1.00 26.83  ? 342  VAL A O   1 
ATOM   1897  C  CB  . VAL A 1  244 ? -16.669 -11.339 127.933 1.00 19.71  ? 342  VAL A CB  1 
ATOM   1898  C  CG1 . VAL A 1  244 ? -16.440 -11.972 126.573 1.00 18.42  ? 342  VAL A CG1 1 
ATOM   1899  C  CG2 . VAL A 1  244 ? -15.880 -12.063 129.015 1.00 16.69  ? 342  VAL A CG2 1 
ATOM   1900  N  N   . ALA A 1  245 ? -16.286 -8.700  125.765 1.00 20.98  ? 343  ALA A N   1 
ATOM   1901  C  CA  . ALA A 1  245 ? -16.876 -7.979  124.645 1.00 22.04  ? 343  ALA A CA  1 
ATOM   1902  C  C   . ALA A 1  245 ? -16.500 -8.631  123.323 1.00 20.44  ? 343  ALA A C   1 
ATOM   1903  O  O   . ALA A 1  245 ? -15.338 -8.614  122.919 1.00 17.50  ? 343  ALA A O   1 
ATOM   1904  C  CB  . ALA A 1  245 ? -16.442 -6.521  124.663 1.00 18.76  ? 343  ALA A CB  1 
ATOM   1905  N  N   . ALA A 1  246 ? -17.490 -9.216  122.656 1.00 16.44  ? 344  ALA A N   1 
ATOM   1906  C  CA  . ALA A 1  246 ? -17.245 -9.920  121.407 1.00 16.88  ? 344  ALA A CA  1 
ATOM   1907  C  C   . ALA A 1  246 ? -17.930 -9.247  120.229 1.00 20.23  ? 344  ALA A C   1 
ATOM   1908  O  O   . ALA A 1  246 ? -19.136 -9.006  120.252 1.00 27.03  ? 344  ALA A O   1 
ATOM   1909  C  CB  . ALA A 1  246 ? -17.706 -11.367 121.521 1.00 13.71  ? 344  ALA A CB  1 
ATOM   1910  N  N   . PHE A 1  247 ? -17.148 -8.939  119.201 1.00 19.26  ? 345  PHE A N   1 
ATOM   1911  C  CA  . PHE A 1  247 ? -17.705 -8.559  117.914 1.00 15.71  ? 345  PHE A CA  1 
ATOM   1912  C  C   . PHE A 1  247 ? -17.992 -9.811  117.104 1.00 25.09  ? 345  PHE A C   1 
ATOM   1913  O  O   . PHE A 1  247 ? -17.115 -10.651 116.912 1.00 37.49  ? 345  PHE A O   1 
ATOM   1914  C  CB  . PHE A 1  247 ? -16.754 -7.635  117.157 1.00 16.19  ? 345  PHE A CB  1 
ATOM   1915  C  CG  . PHE A 1  247 ? -17.017 -6.177  117.387 1.00 19.23  ? 345  PHE A CG  1 
ATOM   1916  C  CD1 . PHE A 1  247 ? -16.746 -5.597  118.614 1.00 21.01  ? 345  PHE A CD1 1 
ATOM   1917  C  CD2 . PHE A 1  247 ? -17.536 -5.386  116.376 1.00 22.43  ? 345  PHE A CD2 1 
ATOM   1918  C  CE1 . PHE A 1  247 ? -16.990 -4.255  118.828 1.00 24.69  ? 345  PHE A CE1 1 
ATOM   1919  C  CE2 . PHE A 1  247 ? -17.780 -4.042  116.584 1.00 22.81  ? 345  PHE A CE2 1 
ATOM   1920  C  CZ  . PHE A 1  247 ? -17.506 -3.477  117.811 1.00 23.54  ? 345  PHE A CZ  1 
ATOM   1921  N  N   . ALA A 1  248 ? -19.224 -9.934  116.632 1.00 24.43  ? 346  ALA A N   1 
ATOM   1922  C  CA  . ALA A 1  248 ? -19.617 -11.101 115.863 1.00 23.35  ? 346  ALA A CA  1 
ATOM   1923  C  C   . ALA A 1  248 ? -19.713 -10.754 114.386 1.00 22.92  ? 346  ALA A C   1 
ATOM   1924  O  O   . ALA A 1  248 ? -20.238 -9.703  114.020 1.00 28.65  ? 346  ALA A O   1 
ATOM   1925  C  CB  . ALA A 1  248 ? -20.937 -11.650 116.372 1.00 24.28  ? 346  ALA A CB  1 
ATOM   1926  N  N   . SER A 1  249 ? -19.190 -11.633 113.540 1.00 19.77  ? 347  SER A N   1 
ATOM   1927  C  CA  . SER A 1  249 ? -19.276 -11.437 112.099 1.00 18.81  ? 347  SER A CA  1 
ATOM   1928  C  C   . SER A 1  249 ? -20.728 -11.519 111.639 1.00 20.92  ? 347  SER A C   1 
ATOM   1929  O  O   . SER A 1  249 ? -21.560 -12.162 112.281 1.00 16.82  ? 347  SER A O   1 
ATOM   1930  C  CB  . SER A 1  249 ? -18.418 -12.468 111.362 1.00 12.76  ? 347  SER A CB  1 
ATOM   1931  O  OG  . SER A 1  249 ? -18.837 -13.784 111.663 1.00 13.55  ? 347  SER A OG  1 
ATOM   1932  N  N   . SER A 1  250 ? -21.026 -10.854 110.528 1.00 22.26  ? 348  SER A N   1 
ATOM   1933  C  CA  . SER A 1  250 ? -22.382 -10.814 109.996 1.00 21.54  ? 348  SER A CA  1 
ATOM   1934  C  C   . SER A 1  250 ? -22.366 -11.142 108.508 1.00 21.85  ? 348  SER A C   1 
ATOM   1935  O  O   . SER A 1  250 ? -21.574 -11.970 108.059 1.00 25.98  ? 348  SER A O   1 
ATOM   1936  C  CB  . SER A 1  250 ? -23.017 -9.443  110.234 1.00 21.47  ? 348  SER A CB  1 
ATOM   1937  O  OG  . SER A 1  250 ? -24.418 -9.492  110.038 1.00 25.70  ? 348  SER A OG  1 
ATOM   1938  N  N   . ASN A 1  251 ? -23.238 -10.497 107.742 1.00 18.47  ? 349  ASN A N   1 
ATOM   1939  C  CA  . ASN A 1  251 ? -23.221 -10.668 106.297 1.00 19.42  ? 349  ASN A CA  1 
ATOM   1940  C  C   . ASN A 1  251 ? -22.162 -9.758  105.677 1.00 19.21  ? 349  ASN A C   1 
ATOM   1941  O  O   . ASN A 1  251 ? -22.466 -8.702  105.123 1.00 18.45  ? 349  ASN A O   1 
ATOM   1942  C  CB  . ASN A 1  251 ? -24.609 -10.400 105.702 1.00 22.96  ? 349  ASN A CB  1 
ATOM   1943  C  CG  . ASN A 1  251 ? -25.182 -9.064  106.125 1.00 22.26  ? 349  ASN A CG  1 
ATOM   1944  O  OD1 . ASN A 1  251 ? -24.945 -8.597  107.238 1.00 25.72  ? 349  ASN A OD1 1 
ATOM   1945  N  ND2 . ASN A 1  251 ? -25.949 -8.443  105.237 1.00 20.60  ? 349  ASN A ND2 1 
ATOM   1946  N  N   . LEU A 1  252 ? -20.911 -10.196 105.773 1.00 19.22  ? 350  LEU A N   1 
ATOM   1947  C  CA  . LEU A 1  252 ? -19.769 -9.376  105.389 1.00 19.21  ? 350  LEU A CA  1 
ATOM   1948  C  C   . LEU A 1  252 ? -19.261 -9.679  103.985 1.00 21.99  ? 350  LEU A C   1 
ATOM   1949  O  O   . LEU A 1  252 ? -18.221 -9.158  103.574 1.00 25.81  ? 350  LEU A O   1 
ATOM   1950  C  CB  . LEU A 1  252 ? -18.625 -9.562  106.395 1.00 19.05  ? 350  LEU A CB  1 
ATOM   1951  C  CG  . LEU A 1  252 ? -18.324 -10.964 106.958 1.00 18.76  ? 350  LEU A CG  1 
ATOM   1952  C  CD1 . LEU A 1  252 ? -18.100 -12.027 105.880 1.00 12.85  ? 350  LEU A CD1 1 
ATOM   1953  C  CD2 . LEU A 1  252 ? -17.124 -10.909 107.894 1.00 11.45  ? 350  LEU A CD2 1 
ATOM   1954  N  N   . GLY A 1  253 ? -19.997 -10.521 103.264 1.00 17.41  ? 351  GLY A N   1 
ATOM   1955  C  CA  . GLY A 1  253 ? -19.548 -11.077 101.998 1.00 18.67  ? 351  GLY A CA  1 
ATOM   1956  C  C   . GLY A 1  253 ? -18.956 -10.096 101.004 1.00 24.72  ? 351  GLY A C   1 
ATOM   1957  O  O   . GLY A 1  253 ? -17.923 -10.373 100.393 1.00 24.00  ? 351  GLY A O   1 
ATOM   1958  N  N   . ASP A 1  254 ? -19.595 -8.941  100.853 1.00 12.37  ? 352  ASP A N   1 
ATOM   1959  C  CA  . ASP A 1  254 ? -19.132 -7.944  99.894  1.00 12.82  ? 352  ASP A CA  1 
ATOM   1960  C  C   . ASP A 1  254 ? -18.797 -6.618  100.568 1.00 13.14  ? 352  ASP A C   1 
ATOM   1961  O  O   . ASP A 1  254 ? -18.847 -5.564  99.935  1.00 22.19  ? 352  ASP A O   1 
ATOM   1962  C  CB  . ASP A 1  254 ? -20.185 -7.725  98.804  1.00 17.33  ? 352  ASP A CB  1 
ATOM   1963  C  CG  . ASP A 1  254 ? -21.540 -7.340  99.368  1.00 18.26  ? 352  ASP A CG  1 
ATOM   1964  O  OD1 . ASP A 1  254 ? -21.781 -7.583  100.569 1.00 17.05  ? 352  ASP A OD1 1 
ATOM   1965  O  OD2 . ASP A 1  254 ? -22.366 -6.796  98.607  1.00 21.21  ? 352  ASP A OD2 1 
ATOM   1966  N  N   . VAL A 1  255 ? -18.439 -6.678  101.847 1.00 12.95  ? 353  VAL A N   1 
ATOM   1967  C  CA  . VAL A 1  255 ? -18.182 -5.473  102.630 1.00 13.83  ? 353  VAL A CA  1 
ATOM   1968  C  C   . VAL A 1  255 ? -16.706 -5.344  102.998 1.00 13.71  ? 353  VAL A C   1 
ATOM   1969  O  O   . VAL A 1  255 ? -16.138 -6.227  103.639 1.00 13.68  ? 353  VAL A O   1 
ATOM   1970  C  CB  . VAL A 1  255 ? -19.029 -5.454  103.917 1.00 13.17  ? 353  VAL A CB  1 
ATOM   1971  C  CG1 . VAL A 1  255 ? -18.843 -4.141  104.659 1.00 13.62  ? 353  VAL A CG1 1 
ATOM   1972  C  CG2 . VAL A 1  255 ? -20.495 -5.687  103.586 1.00 13.12  ? 353  VAL A CG2 1 
ATOM   1973  N  N   . SER A 1  256 ? -16.092 -4.241  102.578 1.00 14.37  ? 354  SER A N   1 
ATOM   1974  C  CA  . SER A 1  256 ? -14.673 -3.995  102.823 1.00 14.30  ? 354  SER A CA  1 
ATOM   1975  C  C   . SER A 1  256 ? -14.451 -2.830  103.789 1.00 16.78  ? 354  SER A C   1 
ATOM   1976  O  O   . SER A 1  256 ? -15.226 -1.877  103.802 1.00 17.54  ? 354  SER A O   1 
ATOM   1977  C  CB  . SER A 1  256 ? -13.952 -3.725  101.499 1.00 14.30  ? 354  SER A CB  1 
ATOM   1978  O  OG  . SER A 1  256 ? -12.606 -3.339  101.713 1.00 14.55  ? 354  SER A OG  1 
ATOM   1979  N  N   . PRO A 1  257 ? -13.388 -2.908  104.605 1.00 14.99  ? 355  PRO A N   1 
ATOM   1980  C  CA  . PRO A 1  257 ? -13.011 -1.827  105.521 1.00 17.79  ? 355  PRO A CA  1 
ATOM   1981  C  C   . PRO A 1  257 ? -12.060 -0.826  104.877 1.00 22.79  ? 355  PRO A C   1 
ATOM   1982  O  O   . PRO A 1  257 ? -11.696 0.171   105.500 1.00 26.06  ? 355  PRO A O   1 
ATOM   1983  C  CB  . PRO A 1  257 ? -12.307 -2.571  106.649 1.00 16.41  ? 355  PRO A CB  1 
ATOM   1984  C  CG  . PRO A 1  257 ? -11.619 -3.683  105.932 1.00 17.80  ? 355  PRO A CG  1 
ATOM   1985  C  CD  . PRO A 1  257 ? -12.568 -4.111  104.828 1.00 13.92  ? 355  PRO A CD  1 
ATOM   1986  N  N   . ASN A 1  258 ? -11.663 -1.098  103.639 1.00 21.26  ? 356  ASN A N   1 
ATOM   1987  C  CA  . ASN A 1  258 ? -10.694 -0.263  102.945 1.00 19.06  ? 356  ASN A CA  1 
ATOM   1988  C  C   . ASN A 1  258 ? -11.403 0.864   102.206 1.00 21.69  ? 356  ASN A C   1 
ATOM   1989  O  O   . ASN A 1  258 ? -11.564 0.829   100.985 1.00 22.03  ? 356  ASN A O   1 
ATOM   1990  C  CB  . ASN A 1  258 ? -9.858  -1.108  101.988 1.00 18.93  ? 356  ASN A CB  1 
ATOM   1991  C  CG  . ASN A 1  258 ? -9.066  -2.187  102.710 1.00 21.09  ? 356  ASN A CG  1 
ATOM   1992  O  OD1 . ASN A 1  258 ? -8.520  -1.953  103.790 1.00 15.37  ? 356  ASN A OD1 1 
ATOM   1993  N  ND2 . ASN A 1  258 ? -9.006  -3.376  102.121 1.00 14.99  ? 356  ASN A ND2 1 
ATOM   1994  N  N   . ILE A 1  259 ? -11.799 1.879   102.970 1.00 22.23  ? 357  ILE A N   1 
ATOM   1995  C  CA  . ILE A 1  259 ? -12.781 2.864   102.531 1.00 20.82  ? 357  ILE A CA  1 
ATOM   1996  C  C   . ILE A 1  259 ? -12.264 3.869   101.507 1.00 20.70  ? 357  ILE A C   1 
ATOM   1997  O  O   . ILE A 1  259 ? -13.048 4.637   100.948 1.00 20.99  ? 357  ILE A O   1 
ATOM   1998  C  CB  . ILE A 1  259 ? -13.336 3.646   103.736 1.00 20.31  ? 357  ILE A CB  1 
ATOM   1999  C  CG1 . ILE A 1  259 ? -12.211 4.399   104.450 1.00 22.56  ? 357  ILE A CG1 1 
ATOM   2000  C  CG2 . ILE A 1  259 ? -14.047 2.707   104.695 1.00 16.87  ? 357  ILE A CG2 1 
ATOM   2001  C  CD1 . ILE A 1  259 ? -12.688 5.273   105.587 1.00 18.31  ? 357  ILE A CD1 1 
ATOM   2002  N  N   . LEU A 1  260 ? -10.960 3.868   101.248 1.00 19.45  ? 358  LEU A N   1 
ATOM   2003  C  CA  . LEU A 1  260 ? -10.415 4.743   100.213 1.00 21.71  ? 358  LEU A CA  1 
ATOM   2004  C  C   . LEU A 1  260 ? -10.841 4.274   98.823  1.00 25.95  ? 358  LEU A C   1 
ATOM   2005  O  O   . LEU A 1  260 ? -10.680 4.994   97.836  1.00 27.82  ? 358  LEU A O   1 
ATOM   2006  C  CB  . LEU A 1  260 ? -8.891  4.819   100.298 1.00 22.85  ? 358  LEU A CB  1 
ATOM   2007  C  CG  . LEU A 1  260 ? -8.290  5.491   101.534 1.00 26.35  ? 358  LEU A CG  1 
ATOM   2008  C  CD1 . LEU A 1  260 ? -6.787  5.666   101.363 1.00 22.37  ? 358  LEU A CD1 1 
ATOM   2009  C  CD2 . LEU A 1  260 ? -8.961  6.826   101.819 1.00 19.89  ? 358  LEU A CD2 1 
ATOM   2010  N  N   . GLY A 1  261 ? -11.376 3.059   98.754  1.00 27.60  ? 359  GLY A N   1 
ATOM   2011  C  CA  . GLY A 1  261 ? -11.913 2.528   97.517  1.00 26.09  ? 359  GLY A CA  1 
ATOM   2012  C  C   . GLY A 1  261 ? -10.839 1.946   96.624  1.00 25.57  ? 359  GLY A C   1 
ATOM   2013  O  O   . GLY A 1  261 ? -9.650  2.118   96.888  1.00 25.14  ? 359  GLY A O   1 
ATOM   2014  N  N   . PRO A 1  262 ? -11.252 1.262   95.548  1.00 23.52  ? 360  PRO A N   1 
ATOM   2015  C  CA  . PRO A 1  262 ? -10.298 0.617   94.642  1.00 22.94  ? 360  PRO A CA  1 
ATOM   2016  C  C   . PRO A 1  262 ? -9.597  1.624   93.731  1.00 27.82  ? 360  PRO A C   1 
ATOM   2017  O  O   . PRO A 1  262 ? -10.251 2.349   92.981  1.00 29.10  ? 360  PRO A O   1 
ATOM   2018  C  CB  . PRO A 1  262 ? -11.176 -0.341  93.836  1.00 22.22  ? 360  PRO A CB  1 
ATOM   2019  C  CG  . PRO A 1  262 ? -12.527 0.282   93.850  1.00 17.97  ? 360  PRO A CG  1 
ATOM   2020  C  CD  . PRO A 1  262 ? -12.652 1.019   95.155  1.00 18.37  ? 360  PRO A CD  1 
ATOM   2021  N  N   . ARG A 1  263 ? -8.271  1.671   93.810  1.00 29.61  ? 361  ARG A N   1 
ATOM   2022  C  CA  . ARG A 1  263 ? -7.482  2.556   92.961  1.00 24.89  ? 361  ARG A CA  1 
ATOM   2023  C  C   . ARG A 1  263 ? -6.289  1.828   92.348  1.00 26.95  ? 361  ARG A C   1 
ATOM   2024  O  O   . ARG A 1  263 ? -5.767  0.876   92.927  1.00 28.36  ? 361  ARG A O   1 
ATOM   2025  C  CB  . ARG A 1  263 ? -7.011  3.780   93.748  1.00 22.15  ? 361  ARG A CB  1 
ATOM   2026  C  CG  . ARG A 1  263 ? -8.141  4.695   94.190  1.00 27.49  ? 361  ARG A CG  1 
ATOM   2027  C  CD  . ARG A 1  263 ? -7.622  6.050   94.637  1.00 37.35  ? 361  ARG A CD  1 
ATOM   2028  N  NE  . ARG A 1  263 ? -8.711  6.972   94.950  1.00 44.82  ? 361  ARG A NE  1 
ATOM   2029  C  CZ  . ARG A 1  263 ? -9.299  7.765   94.060  1.00 46.74  ? 361  ARG A CZ  1 
ATOM   2030  N  NH1 . ARG A 1  263 ? -8.906  7.753   92.794  1.00 45.40  ? 361  ARG A NH1 1 
ATOM   2031  N  NH2 . ARG A 1  263 ? -10.282 8.572   94.437  1.00 47.15  ? 361  ARG A NH2 1 
ATOM   2032  N  N   . CYS A 1  264 ? -5.875  2.281   91.169  1.00 24.94  ? 362  CYS A N   1 
ATOM   2033  C  CA  . CYS A 1  264 ? -4.697  1.746   90.492  1.00 26.44  ? 362  CYS A CA  1 
ATOM   2034  C  C   . CYS A 1  264 ? -3.403  2.242   91.129  1.00 32.01  ? 362  CYS A C   1 
ATOM   2035  O  O   . CYS A 1  264 ? -3.190  3.445   91.258  1.00 34.67  ? 362  CYS A O   1 
ATOM   2036  C  CB  . CYS A 1  264 ? -4.719  2.115   89.007  1.00 25.33  ? 362  CYS A CB  1 
ATOM   2037  S  SG  . CYS A 1  264 ? -6.165  1.515   88.112  1.00 39.38  ? 362  CYS A SG  1 
ATOM   2038  N  N   . ILE A 1  265 ? -2.542  1.308   91.523  1.00 30.39  ? 363  ILE A N   1 
ATOM   2039  C  CA  . ILE A 1  265 ? -1.315  1.643   92.239  1.00 33.07  ? 363  ILE A CA  1 
ATOM   2040  C  C   . ILE A 1  265 ? -0.384  2.528   91.412  1.00 36.94  ? 363  ILE A C   1 
ATOM   2041  O  O   . ILE A 1  265 ? 0.327   3.372   91.955  1.00 42.83  ? 363  ILE A O   1 
ATOM   2042  C  CB  . ILE A 1  265 ? -0.545  0.369   92.648  1.00 34.86  ? 363  ILE A CB  1 
ATOM   2043  C  CG1 . ILE A 1  265 ? -1.467  -0.610  93.374  1.00 35.41  ? 363  ILE A CG1 1 
ATOM   2044  C  CG2 . ILE A 1  265 ? 0.656   0.712   93.520  1.00 35.47  ? 363  ILE A CG2 1 
ATOM   2045  C  CD1 . ILE A 1  265 ? -0.786  -1.905  93.744  1.00 38.99  ? 363  ILE A CD1 1 
ATOM   2046  N  N   . ASN A 1  266 ? -0.406  2.349   90.096  1.00 35.40  ? 364  ASN A N   1 
ATOM   2047  C  CA  . ASN A 1  266 ? 0.490   3.096   89.221  1.00 37.56  ? 364  ASN A CA  1 
ATOM   2048  C  C   . ASN A 1  266 ? 0.013   4.517   88.917  1.00 37.96  ? 364  ASN A C   1 
ATOM   2049  O  O   . ASN A 1  266 ? 0.815   5.451   88.886  1.00 41.80  ? 364  ASN A O   1 
ATOM   2050  C  CB  . ASN A 1  266 ? 0.704   2.331   87.910  1.00 39.87  ? 364  ASN A CB  1 
ATOM   2051  C  CG  . ASN A 1  266 ? -0.596  1.869   87.281  1.00 42.24  ? 364  ASN A CG  1 
ATOM   2052  O  OD1 . ASN A 1  266 ? -1.682  2.230   87.734  1.00 43.74  ? 364  ASN A OD1 1 
ATOM   2053  N  ND2 . ASN A 1  266 ? -0.489  1.068   86.227  1.00 43.24  ? 364  ASN A ND2 1 
ATOM   2054  N  N   . THR A 1  267 ? -1.287  4.679   88.692  1.00 31.21  ? 365  THR A N   1 
ATOM   2055  C  CA  . THR A 1  267 ? -1.828  5.972   88.280  1.00 26.52  ? 365  THR A CA  1 
ATOM   2056  C  C   . THR A 1  267 ? -2.631  6.674   89.374  1.00 28.06  ? 365  THR A C   1 
ATOM   2057  O  O   . THR A 1  267 ? -2.839  7.885   89.314  1.00 33.10  ? 365  THR A O   1 
ATOM   2058  C  CB  . THR A 1  267 ? -2.721  5.826   87.033  1.00 25.75  ? 365  THR A CB  1 
ATOM   2059  O  OG1 . THR A 1  267 ? -3.904  5.095   87.374  1.00 28.84  ? 365  THR A OG1 1 
ATOM   2060  C  CG2 . THR A 1  267 ? -1.980  5.086   85.931  1.00 26.23  ? 365  THR A CG2 1 
ATOM   2061  N  N   . GLY A 1  268 ? -3.091  5.918   90.364  1.00 24.03  ? 366  GLY A N   1 
ATOM   2062  C  CA  . GLY A 1  268 ? -3.904  6.485   91.426  1.00 23.65  ? 366  GLY A CA  1 
ATOM   2063  C  C   . GLY A 1  268 ? -5.340  6.681   90.983  1.00 25.45  ? 366  GLY A C   1 
ATOM   2064  O  O   . GLY A 1  268 ? -6.172  7.196   91.730  1.00 23.92  ? 366  GLY A O   1 
ATOM   2065  N  N   . GLU A 1  269 ? -5.629  6.250   89.760  1.00 29.06  ? 367  GLU A N   1 
ATOM   2066  C  CA  . GLU A 1  269 ? -6.959  6.376   89.180  1.00 32.86  ? 367  GLU A CA  1 
ATOM   2067  C  C   . GLU A 1  269 ? -7.921  5.405   89.851  1.00 36.31  ? 367  GLU A C   1 
ATOM   2068  O  O   . GLU A 1  269 ? -7.501  4.388   90.398  1.00 38.85  ? 367  GLU A O   1 
ATOM   2069  C  CB  . GLU A 1  269 ? -6.896  6.116   87.669  1.00 36.54  ? 367  GLU A CB  1 
ATOM   2070  C  CG  . GLU A 1  269 ? -8.223  6.190   86.929  1.00 43.27  ? 367  GLU A CG  1 
ATOM   2071  C  CD  . GLU A 1  269 ? -8.142  5.591   85.539  1.00 49.45  ? 367  GLU A CD  1 
ATOM   2072  O  OE1 . GLU A 1  269 ? -7.123  4.933   85.235  1.00 50.92  ? 367  GLU A OE1 1 
ATOM   2073  O  OE2 . GLU A 1  269 ? -9.094  5.778   84.753  1.00 51.03  ? 367  GLU A OE2 1 
ATOM   2074  N  N   . SER A 1  270 ? -9.212  5.717   89.805  1.00 34.71  ? 368  SER A N   1 
ATOM   2075  C  CA  . SER A 1  270 ? -10.224 4.823   90.346  1.00 32.60  ? 368  SER A CA  1 
ATOM   2076  C  C   . SER A 1  270 ? -10.416 3.623   89.430  1.00 32.97  ? 368  SER A C   1 
ATOM   2077  O  O   . SER A 1  270 ? -10.610 3.775   88.224  1.00 34.18  ? 368  SER A O   1 
ATOM   2078  C  CB  . SER A 1  270 ? -11.552 5.558   90.530  1.00 34.42  ? 368  SER A CB  1 
ATOM   2079  O  OG  . SER A 1  270 ? -12.597 4.650   90.833  1.00 36.83  ? 368  SER A OG  1 
ATOM   2080  N  N   . CYS A 1  271 ? -10.356 2.428   90.006  1.00 31.73  ? 369  CYS A N   1 
ATOM   2081  C  CA  . CYS A 1  271 ? -10.659 1.217   89.258  1.00 29.15  ? 369  CYS A CA  1 
ATOM   2082  C  C   . CYS A 1  271 ? -11.941 0.591   89.795  1.00 25.48  ? 369  CYS A C   1 
ATOM   2083  O  O   . CYS A 1  271 ? -12.060 -0.630  89.898  1.00 23.71  ? 369  CYS A O   1 
ATOM   2084  C  CB  . CYS A 1  271 ? -9.495  0.222   89.322  1.00 24.69  ? 369  CYS A CB  1 
ATOM   2085  S  SG  . CYS A 1  271 ? -8.987  -0.262  90.983  1.00 35.68  ? 369  CYS A SG  1 
ATOM   2086  N  N   . ASP A 1  272 ? -12.899 1.448   90.134  1.00 24.52  ? 370  ASP A N   1 
ATOM   2087  C  CA  . ASP A 1  272 ? -14.221 1.006   90.558  1.00 23.56  ? 370  ASP A CA  1 
ATOM   2088  C  C   . ASP A 1  272 ? -15.036 0.639   89.323  1.00 25.05  ? 370  ASP A C   1 
ATOM   2089  O  O   . ASP A 1  272 ? -15.893 1.404   88.877  1.00 25.78  ? 370  ASP A O   1 
ATOM   2090  C  CB  . ASP A 1  272 ? -14.928 2.093   91.371  1.00 25.48  ? 370  ASP A CB  1 
ATOM   2091  C  CG  . ASP A 1  272 ? -16.304 1.662   91.860  1.00 33.17  ? 370  ASP A CG  1 
ATOM   2092  O  OD1 . ASP A 1  272 ? -16.587 0.446   91.875  1.00 35.55  ? 370  ASP A OD1 1 
ATOM   2093  O  OD2 . ASP A 1  272 ? -17.109 2.547   92.222  1.00 35.81  ? 370  ASP A OD2 1 
ATOM   2094  N  N   . ASN A 1  273 ? -14.751 -0.532  88.766  1.00 25.38  ? 371  ASN A N   1 
ATOM   2095  C  CA  . ASN A 1  273 ? -15.430 -1.001  87.569  1.00 24.79  ? 371  ASN A CA  1 
ATOM   2096  C  C   . ASN A 1  273 ? -15.854 -2.454  87.722  1.00 22.39  ? 371  ASN A C   1 
ATOM   2097  O  O   . ASN A 1  273 ? -15.574 -3.083  88.741  1.00 26.29  ? 371  ASN A O   1 
ATOM   2098  C  CB  . ASN A 1  273 ? -14.530 -0.840  86.342  1.00 26.69  ? 371  ASN A CB  1 
ATOM   2099  C  CG  . ASN A 1  273 ? -13.122 -1.356  86.579  1.00 26.57  ? 371  ASN A CG  1 
ATOM   2100  O  OD1 . ASN A 1  273 ? -12.909 -2.559  86.726  1.00 28.75  ? 371  ASN A OD1 1 
ATOM   2101  N  ND2 . ASN A 1  273 ? -12.154 -0.447  86.615  1.00 21.99  ? 371  ASN A ND2 1 
ATOM   2102  N  N   . ALA A 1  274 ? -16.524 -2.984  86.704  1.00 21.54  ? 372  ALA A N   1 
ATOM   2103  C  CA  . ALA A 1  274 ? -17.095 -4.326  86.776  1.00 23.11  ? 372  ALA A CA  1 
ATOM   2104  C  C   . ALA A 1  274 ? -16.029 -5.415  86.884  1.00 27.34  ? 372  ALA A C   1 
ATOM   2105  O  O   . ALA A 1  274 ? -16.287 -6.492  87.421  1.00 17.59  ? 372  ALA A O   1 
ATOM   2106  C  CB  . ALA A 1  274 ? -17.983 -4.580  85.566  1.00 18.95  ? 372  ALA A CB  1 
ATOM   2107  N  N   . ASN A 1  275 ? -14.833 -5.134  86.375  1.00 30.75  ? 373  ASN A N   1 
ATOM   2108  C  CA  . ASN A 1  275 ? -13.757 -6.121  86.364  1.00 33.72  ? 373  ASN A CA  1 
ATOM   2109  C  C   . ASN A 1  275 ? -12.759 -5.944  87.504  1.00 32.88  ? 373  ASN A C   1 
ATOM   2110  O  O   . ASN A 1  275 ? -11.922 -6.817  87.734  1.00 32.67  ? 373  ASN A O   1 
ATOM   2111  C  CB  . ASN A 1  275 ? -13.011 -6.073  85.030  1.00 42.63  ? 373  ASN A CB  1 
ATOM   2112  C  CG  . ASN A 1  275 ? -13.860 -6.554  83.871  1.00 54.64  ? 373  ASN A CG  1 
ATOM   2113  O  OD1 . ASN A 1  275 ? -14.893 -7.197  84.067  1.00 64.35  ? 373  ASN A OD1 1 
ATOM   2114  N  ND2 . ASN A 1  275 ? -13.422 -6.251  82.652  1.00 52.44  ? 373  ASN A ND2 1 
ATOM   2115  N  N   . SER A 1  276 ? -12.865 -4.826  88.219  1.00 32.47  ? 374  SER A N   1 
ATOM   2116  C  CA  . SER A 1  276 ? -11.862 -4.425  89.204  1.00 29.39  ? 374  SER A CA  1 
ATOM   2117  C  C   . SER A 1  276 ? -10.466 -4.492  88.592  1.00 27.57  ? 374  SER A C   1 
ATOM   2118  O  O   . SER A 1  276 ? -9.576  -5.164  89.114  1.00 26.99  ? 374  SER A O   1 
ATOM   2119  C  CB  . SER A 1  276 ? -11.938 -5.308  90.452  1.00 26.32  ? 374  SER A CB  1 
ATOM   2120  O  OG  . SER A 1  276 ? -13.153 -5.100  91.148  1.00 28.62  ? 374  SER A OG  1 
ATOM   2121  N  N   . THR A 1  277 ? -10.285 -3.784  87.482  1.00 28.04  ? 375  THR A N   1 
ATOM   2122  C  CA  . THR A 1  277 ? -9.048  -3.858  86.717  1.00 32.47  ? 375  THR A CA  1 
ATOM   2123  C  C   . THR A 1  277 ? -8.537  -2.476  86.319  1.00 34.07  ? 375  THR A C   1 
ATOM   2124  O  O   . THR A 1  277 ? -9.287  -1.498  86.317  1.00 32.74  ? 375  THR A O   1 
ATOM   2125  C  CB  . THR A 1  277 ? -9.228  -4.709  85.442  1.00 34.96  ? 375  THR A CB  1 
ATOM   2126  O  OG1 . THR A 1  277 ? -7.948  -4.983  84.860  1.00 39.87  ? 375  THR A OG1 1 
ATOM   2127  C  CG2 . THR A 1  277 ? -10.092 -3.975  84.429  1.00 34.29  ? 375  THR A CG2 1 
ATOM   2128  N  N   . CYS A 1  278 ? -7.253  -2.408  85.984  1.00 33.52  ? 376  CYS A N   1 
ATOM   2129  C  CA  . CYS A 1  278 ? -6.625  -1.161  85.564  1.00 29.46  ? 376  CYS A CA  1 
ATOM   2130  C  C   . CYS A 1  278 ? -6.169  -1.273  84.112  1.00 26.04  ? 376  CYS A C   1 
ATOM   2131  O  O   . CYS A 1  278 ? -5.695  -2.329  83.692  1.00 26.05  ? 376  CYS A O   1 
ATOM   2132  C  CB  . CYS A 1  278 ? -5.446  -0.819  86.477  1.00 30.08  ? 376  CYS A CB  1 
ATOM   2133  S  SG  . CYS A 1  278 ? -5.907  -0.500  88.196  1.00 45.99  ? 376  CYS A SG  1 
ATOM   2134  N  N   . PRO A 1  279 ? -6.315  -0.182  83.341  1.00 25.67  ? 377  PRO A N   1 
ATOM   2135  C  CA  . PRO A 1  279 ? -5.940  -0.158  81.921  1.00 31.52  ? 377  PRO A CA  1 
ATOM   2136  C  C   . PRO A 1  279 ? -4.483  -0.548  81.687  1.00 32.66  ? 377  PRO A C   1 
ATOM   2137  O  O   . PRO A 1  279 ? -4.171  -1.194  80.687  1.00 33.53  ? 377  PRO A O   1 
ATOM   2138  C  CB  . PRO A 1  279 ? -6.188  1.303   81.517  1.00 33.52  ? 377  PRO A CB  1 
ATOM   2139  C  CG  . PRO A 1  279 ? -6.196  2.068   82.801  1.00 25.42  ? 377  PRO A CG  1 
ATOM   2140  C  CD  . PRO A 1  279 ? -6.793  1.132   83.801  1.00 24.24  ? 377  PRO A CD  1 
ATOM   2141  N  N   . ILE A 1  280 ? -3.606  -0.152  82.601  1.00 31.16  ? 378  ILE A N   1 
ATOM   2142  C  CA  . ILE A 1  280 ? -2.208  -0.555  82.536  1.00 33.03  ? 378  ILE A CA  1 
ATOM   2143  C  C   . ILE A 1  280 ? -1.831  -1.397  83.751  1.00 37.51  ? 378  ILE A C   1 
ATOM   2144  O  O   . ILE A 1  280 ? -1.795  -0.897  84.875  1.00 39.04  ? 378  ILE A O   1 
ATOM   2145  C  CB  . ILE A 1  280 ? -1.270  0.657   82.441  1.00 32.67  ? 378  ILE A CB  1 
ATOM   2146  C  CG1 . ILE A 1  280 ? -1.614  1.497   81.209  1.00 32.37  ? 378  ILE A CG1 1 
ATOM   2147  C  CG2 . ILE A 1  280 ? 0.177   0.202   82.381  1.00 33.54  ? 378  ILE A CG2 1 
ATOM   2148  C  CD1 . ILE A 1  280 ? -0.822  2.780   81.104  1.00 32.21  ? 378  ILE A CD1 1 
ATOM   2149  N  N   . GLY A 1  281 ? -1.557  -2.677  83.520  1.00 40.68  ? 379  GLY A N   1 
ATOM   2150  C  CA  . GLY A 1  281 ? -1.127  -3.569  84.583  1.00 43.56  ? 379  GLY A CA  1 
ATOM   2151  C  C   . GLY A 1  281 ? -2.166  -4.594  85.002  1.00 45.56  ? 379  GLY A C   1 
ATOM   2152  O  O   . GLY A 1  281 ? -1.840  -5.580  85.663  1.00 48.25  ? 379  GLY A O   1 
ATOM   2153  N  N   . GLY A 1  282 ? -3.418  -4.367  84.618  1.00 43.86  ? 380  GLY A N   1 
ATOM   2154  C  CA  . GLY A 1  282 ? -4.478  -5.317  84.899  1.00 42.01  ? 380  GLY A CA  1 
ATOM   2155  C  C   . GLY A 1  282 ? -4.979  -5.308  86.332  1.00 41.38  ? 380  GLY A C   1 
ATOM   2156  O  O   . GLY A 1  282 ? -4.851  -4.304  87.034  1.00 44.03  ? 380  GLY A O   1 
ATOM   2157  N  N   . PRO A 1  283 ? -5.551  -6.439  86.774  1.00 38.61  ? 381  PRO A N   1 
ATOM   2158  C  CA  . PRO A 1  283 ? -6.212  -6.596  88.076  1.00 37.44  ? 381  PRO A CA  1 
ATOM   2159  C  C   . PRO A 1  283 ? -5.265  -6.434  89.263  1.00 35.12  ? 381  PRO A C   1 
ATOM   2160  O  O   . PRO A 1  283 ? -5.684  -5.950  90.313  1.00 34.34  ? 381  PRO A O   1 
ATOM   2161  C  CB  . PRO A 1  283 ? -6.765  -8.023  88.018  1.00 38.07  ? 381  PRO A CB  1 
ATOM   2162  C  CG  . PRO A 1  283 ? -5.904  -8.725  87.034  1.00 39.10  ? 381  PRO A CG  1 
ATOM   2163  C  CD  . PRO A 1  283 ? -5.546  -7.696  86.005  1.00 39.23  ? 381  PRO A CD  1 
ATOM   2164  N  N   . SER A 1  284 ? -4.010  -6.839  89.099  1.00 36.18  ? 382  SER A N   1 
ATOM   2165  C  CA  . SER A 1  284 ? -3.040  -6.783  90.190  1.00 33.99  ? 382  SER A CA  1 
ATOM   2166  C  C   . SER A 1  284 ? -2.739  -5.349  90.628  1.00 30.90  ? 382  SER A C   1 
ATOM   2167  O  O   . SER A 1  284 ? -2.203  -5.125  91.713  1.00 29.40  ? 382  SER A O   1 
ATOM   2168  C  CB  . SER A 1  284 ? -1.745  -7.488  89.780  1.00 35.65  ? 382  SER A CB  1 
ATOM   2169  O  OG  . SER A 1  284 ? -1.302  -7.042  88.511  1.00 39.40  ? 382  SER A OG  1 
ATOM   2170  N  N   . MET A 1  285 ? -3.092  -4.381  89.787  1.00 31.07  ? 383  MET A N   1 
ATOM   2171  C  CA  . MET A 1  285 ? -2.879  -2.972  90.103  1.00 31.11  ? 383  MET A CA  1 
ATOM   2172  C  C   . MET A 1  285 ? -4.084  -2.355  90.808  1.00 30.88  ? 383  MET A C   1 
ATOM   2173  O  O   . MET A 1  285 ? -3.983  -1.275  91.388  1.00 26.83  ? 383  MET A O   1 
ATOM   2174  C  CB  . MET A 1  285 ? -2.567  -2.175  88.833  1.00 31.61  ? 383  MET A CB  1 
ATOM   2175  C  CG  . MET A 1  285 ? -1.257  -2.526  88.133  1.00 33.23  ? 383  MET A CG  1 
ATOM   2176  S  SD  . MET A 1  285 ? 0.215   -2.044  89.066  1.00 32.75  ? 383  MET A SD  1 
ATOM   2177  C  CE  . MET A 1  285 ? 0.626   -3.571  89.911  1.00 48.61  ? 383  MET A CE  1 
ATOM   2178  N  N   . CYS A 1  286 ? -5.222  -3.041  90.758  1.00 30.23  ? 384  CYS A N   1 
ATOM   2179  C  CA  . CYS A 1  286 ? -6.450  -2.515  91.344  1.00 28.07  ? 384  CYS A CA  1 
ATOM   2180  C  C   . CYS A 1  286 ? -6.597  -2.965  92.796  1.00 27.20  ? 384  CYS A C   1 
ATOM   2181  O  O   . CYS A 1  286 ? -6.899  -4.126  93.068  1.00 27.15  ? 384  CYS A O   1 
ATOM   2182  C  CB  . CYS A 1  286 ? -7.661  -2.952  90.518  1.00 18.92  ? 384  CYS A CB  1 
ATOM   2183  S  SG  . CYS A 1  286 ? -9.235  -2.275  91.072  1.00 25.95  ? 384  CYS A SG  1 
ATOM   2184  N  N   . ILE A 1  287 ? -6.392  -2.034  93.724  1.00 27.88  ? 385  ILE A N   1 
ATOM   2185  C  CA  . ILE A 1  287 ? -6.356  -2.352  95.149  1.00 25.62  ? 385  ILE A CA  1 
ATOM   2186  C  C   . ILE A 1  287 ? -7.032  -1.261  95.983  1.00 28.78  ? 385  ILE A C   1 
ATOM   2187  O  O   . ILE A 1  287 ? -6.872  -0.072  95.706  1.00 35.26  ? 385  ILE A O   1 
ATOM   2188  C  CB  . ILE A 1  287 ? -4.892  -2.540  95.635  1.00 34.38  ? 385  ILE A CB  1 
ATOM   2189  C  CG1 . ILE A 1  287 ? -4.291  -3.822  95.057  1.00 33.17  ? 385  ILE A CG1 1 
ATOM   2190  C  CG2 . ILE A 1  287 ? -4.802  -2.549  97.156  1.00 36.11  ? 385  ILE A CG2 1 
ATOM   2191  C  CD1 . ILE A 1  287 ? -2.916  -4.146  95.592  1.00 36.67  ? 385  ILE A CD1 1 
ATOM   2192  N  N   . ALA A 1  288 ? -7.790  -1.670  96.998  1.00 25.95  ? 386  ALA A N   1 
ATOM   2193  C  CA  . ALA A 1  288 ? -8.412  -0.728  97.923  1.00 21.17  ? 386  ALA A CA  1 
ATOM   2194  C  C   . ALA A 1  288 ? -7.597  -0.618  99.213  1.00 19.59  ? 386  ALA A C   1 
ATOM   2195  O  O   . ALA A 1  288 ? -7.188  -1.628  99.788  1.00 16.42  ? 386  ALA A O   1 
ATOM   2196  C  CB  . ALA A 1  288 ? -9.841  -1.148  98.227  1.00 19.93  ? 386  ALA A CB  1 
ATOM   2197  N  N   . LYS A 1  289 ? -7.374  0.612   99.666  1.00 17.33  ? 387  LYS A N   1 
ATOM   2198  C  CA  . LYS A 1  289 ? -6.525  0.865   100.829 1.00 26.61  ? 387  LYS A CA  1 
ATOM   2199  C  C   . LYS A 1  289 ? -7.329  1.386   102.017 1.00 21.02  ? 387  LYS A C   1 
ATOM   2200  O  O   . LYS A 1  289 ? -8.439  1.890   101.854 1.00 18.30  ? 387  LYS A O   1 
ATOM   2201  C  CB  . LYS A 1  289 ? -5.428  1.869   100.473 1.00 28.59  ? 387  LYS A CB  1 
ATOM   2202  C  CG  . LYS A 1  289 ? -4.404  1.351   99.477  1.00 32.19  ? 387  LYS A CG  1 
ATOM   2203  C  CD  . LYS A 1  289 ? -3.294  2.364   99.244  1.00 35.51  ? 387  LYS A CD  1 
ATOM   2204  C  CE  . LYS A 1  289 ? -2.121  1.748   98.494  1.00 41.40  ? 387  LYS A CE  1 
ATOM   2205  N  NZ  . LYS A 1  289 ? -1.131  2.788   98.088  1.00 47.59  ? 387  LYS A NZ  1 
ATOM   2206  N  N   . GLY A 1  290 ? -6.766  1.248   103.214 1.00 20.32  ? 388  GLY A N   1 
ATOM   2207  C  CA  . GLY A 1  290 ? -7.399  1.752   104.421 1.00 21.90  ? 388  GLY A CA  1 
ATOM   2208  C  C   . GLY A 1  290 ? -7.112  3.227   104.643 1.00 23.05  ? 388  GLY A C   1 
ATOM   2209  O  O   . GLY A 1  290 ? -6.360  3.833   103.882 1.00 21.82  ? 388  GLY A O   1 
ATOM   2210  N  N   . PRO A 1  291 ? -7.703  3.811   105.697 1.00 21.74  ? 389  PRO A N   1 
ATOM   2211  C  CA  . PRO A 1  291 ? -7.620  5.247   105.994 1.00 25.59  ? 389  PRO A CA  1 
ATOM   2212  C  C   . PRO A 1  291 ? -6.306  5.682   106.650 1.00 29.20  ? 389  PRO A C   1 
ATOM   2213  O  O   . PRO A 1  291 ? -6.039  6.881   106.728 1.00 28.43  ? 389  PRO A O   1 
ATOM   2214  C  CB  . PRO A 1  291 ? -8.790  5.478   106.966 1.00 18.67  ? 389  PRO A CB  1 
ATOM   2215  C  CG  . PRO A 1  291 ? -9.538  4.177   107.039 1.00 20.37  ? 389  PRO A CG  1 
ATOM   2216  C  CD  . PRO A 1  291 ? -8.582  3.111   106.643 1.00 19.31  ? 389  PRO A CD  1 
ATOM   2217  N  N   . GLY A 1  292 ? -5.507  4.732   107.124 1.00 31.92  ? 390  GLY A N   1 
ATOM   2218  C  CA  . GLY A 1  292 ? -4.331  5.062   107.910 1.00 36.66  ? 390  GLY A CA  1 
ATOM   2219  C  C   . GLY A 1  292 ? -3.039  5.276   107.140 1.00 38.22  ? 390  GLY A C   1 
ATOM   2220  O  O   . GLY A 1  292 ? -3.010  5.213   105.912 1.00 37.78  ? 390  GLY A O   1 
ATOM   2221  N  N   . GLN A 1  293 ? -1.965  5.538   107.881 1.00 39.31  ? 391  GLN A N   1 
ATOM   2222  C  CA  . GLN A 1  293 ? -0.641  5.723   107.297 1.00 39.97  ? 391  GLN A CA  1 
ATOM   2223  C  C   . GLN A 1  293 ? -0.045  4.374   106.901 1.00 36.13  ? 391  GLN A C   1 
ATOM   2224  O  O   . GLN A 1  293 ? 0.769   4.281   105.984 1.00 40.29  ? 391  GLN A O   1 
ATOM   2225  C  CB  . GLN A 1  293 ? 0.286   6.435   108.283 1.00 45.22  ? 391  GLN A CB  1 
ATOM   2226  C  CG  . GLN A 1  293 ? -0.145  7.851   108.640 1.00 53.37  ? 391  GLN A CG  1 
ATOM   2227  C  CD  . GLN A 1  293 ? -0.141  8.784   107.445 1.00 62.94  ? 391  GLN A CD  1 
ATOM   2228  O  OE1 . GLN A 1  293 ? 0.889   8.980   106.799 1.00 70.80  ? 391  GLN A OE1 1 
ATOM   2229  N  NE2 . GLN A 1  293 ? -1.296  9.369   107.147 1.00 60.21  ? 391  GLN A NE2 1 
ATOM   2230  N  N   . ASP A 1  294 ? -0.460  3.332   107.614 1.00 29.23  ? 392  ASP A N   1 
ATOM   2231  C  CA  . ASP A 1  294 ? -0.101  1.958   107.285 1.00 24.63  ? 392  ASP A CA  1 
ATOM   2232  C  C   . ASP A 1  294 ? -1.269  1.039   107.634 1.00 23.18  ? 392  ASP A C   1 
ATOM   2233  O  O   . ASP A 1  294 ? -2.346  1.520   107.983 1.00 17.73  ? 392  ASP A O   1 
ATOM   2234  C  CB  . ASP A 1  294 ? 1.182   1.539   108.011 1.00 24.41  ? 392  ASP A CB  1 
ATOM   2235  C  CG  . ASP A 1  294 ? 1.132   1.804   109.509 1.00 29.36  ? 392  ASP A CG  1 
ATOM   2236  O  OD1 . ASP A 1  294 ? 0.026   1.890   110.080 1.00 30.10  ? 392  ASP A OD1 1 
ATOM   2237  O  OD2 . ASP A 1  294 ? 2.215   1.931   110.118 1.00 33.14  ? 392  ASP A OD2 1 
ATOM   2238  N  N   . MET A 1  295 ? -1.069  -0.272  107.537 1.00 26.30  ? 393  MET A N   1 
ATOM   2239  C  CA  . MET A 1  295 ? -2.159  -1.204  107.810 1.00 28.26  ? 393  MET A CA  1 
ATOM   2240  C  C   . MET A 1  295 ? -2.505  -1.219  109.297 1.00 26.96  ? 393  MET A C   1 
ATOM   2241  O  O   . MET A 1  295 ? -3.660  -1.421  109.665 1.00 29.20  ? 393  MET A O   1 
ATOM   2242  C  CB  . MET A 1  295 ? -1.820  -2.625  107.337 1.00 29.85  ? 393  MET A CB  1 
ATOM   2243  C  CG  . MET A 1  295 ? -0.619  -3.264  108.015 1.00 33.40  ? 393  MET A CG  1 
ATOM   2244  S  SD  . MET A 1  295 ? -0.191  -4.866  107.300 1.00 27.67  ? 393  MET A SD  1 
ATOM   2245  C  CE  . MET A 1  295 ? 1.150   -4.405  106.209 1.00 27.71  ? 393  MET A CE  1 
ATOM   2246  N  N   . PHE A 1  296 ? -1.504  -1.002  110.146 1.00 26.68  ? 394  PHE A N   1 
ATOM   2247  C  CA  . PHE A 1  296 ? -1.730  -0.926  111.584 1.00 24.93  ? 394  PHE A CA  1 
ATOM   2248  C  C   . PHE A 1  296 ? -2.644  0.245   111.923 1.00 22.97  ? 394  PHE A C   1 
ATOM   2249  O  O   . PHE A 1  296 ? -3.571  0.112   112.721 1.00 20.85  ? 394  PHE A O   1 
ATOM   2250  C  CB  . PHE A 1  296 ? -0.409  -0.779  112.345 1.00 28.51  ? 394  PHE A CB  1 
ATOM   2251  C  CG  . PHE A 1  296 ? 0.550   -1.917  112.139 1.00 27.55  ? 394  PHE A CG  1 
ATOM   2252  C  CD1 . PHE A 1  296 ? 0.489   -3.047  112.939 1.00 28.70  ? 394  PHE A CD1 1 
ATOM   2253  C  CD2 . PHE A 1  296 ? 1.527   -1.847  111.160 1.00 26.16  ? 394  PHE A CD2 1 
ATOM   2254  C  CE1 . PHE A 1  296 ? 1.375   -4.093  112.757 1.00 32.80  ? 394  PHE A CE1 1 
ATOM   2255  C  CE2 . PHE A 1  296 ? 2.418   -2.889  110.974 1.00 33.11  ? 394  PHE A CE2 1 
ATOM   2256  C  CZ  . PHE A 1  296 ? 2.341   -4.014  111.774 1.00 35.23  ? 394  PHE A CZ  1 
ATOM   2257  N  N   . ASP A 1  297 ? -2.375  1.391   111.306 1.00 22.70  ? 395  ASP A N   1 
ATOM   2258  C  CA  . ASP A 1  297 ? -3.152  2.596   111.564 1.00 24.56  ? 395  ASP A CA  1 
ATOM   2259  C  C   . ASP A 1  297 ? -4.568  2.456   111.015 1.00 19.72  ? 395  ASP A C   1 
ATOM   2260  O  O   . ASP A 1  297 ? -5.534  2.832   111.676 1.00 19.68  ? 395  ASP A O   1 
ATOM   2261  C  CB  . ASP A 1  297 ? -2.459  3.821   110.959 1.00 24.63  ? 395  ASP A CB  1 
ATOM   2262  C  CG  . ASP A 1  297 ? -3.073  5.129   111.422 1.00 25.00  ? 395  ASP A CG  1 
ATOM   2263  O  OD1 . ASP A 1  297 ? -3.654  5.155   112.527 1.00 26.62  ? 395  ASP A OD1 1 
ATOM   2264  O  OD2 . ASP A 1  297 ? -2.965  6.133   110.687 1.00 24.25  ? 395  ASP A OD2 1 
ATOM   2265  N  N   . SER A 1  298 ? -4.683  1.908   109.808 1.00 19.17  ? 396  SER A N   1 
ATOM   2266  C  CA  . SER A 1  298 ? -5.985  1.642   109.201 1.00 19.61  ? 396  SER A CA  1 
ATOM   2267  C  C   . SER A 1  298 ? -6.836  0.719   110.069 1.00 19.32  ? 396  SER A C   1 
ATOM   2268  O  O   . SER A 1  298 ? -8.019  0.978   110.289 1.00 19.08  ? 396  SER A O   1 
ATOM   2269  C  CB  . SER A 1  298 ? -5.817  1.033   107.808 1.00 20.94  ? 396  SER A CB  1 
ATOM   2270  O  OG  . SER A 1  298 ? -5.283  1.980   106.901 1.00 26.79  ? 396  SER A OG  1 
ATOM   2271  N  N   . THR A 1  299 ? -6.222  -0.357  110.553 1.00 17.86  ? 397  THR A N   1 
ATOM   2272  C  CA  . THR A 1  299 ? -6.902  -1.322  111.408 1.00 20.74  ? 397  THR A CA  1 
ATOM   2273  C  C   . THR A 1  299 ? -7.464  -0.662  112.665 1.00 23.74  ? 397  THR A C   1 
ATOM   2274  O  O   . THR A 1  299 ? -8.587  -0.949  113.083 1.00 19.30  ? 397  THR A O   1 
ATOM   2275  C  CB  . THR A 1  299 ? -5.955  -2.467  111.819 1.00 17.46  ? 397  THR A CB  1 
ATOM   2276  O  OG1 . THR A 1  299 ? -5.463  -3.128  110.648 1.00 17.19  ? 397  THR A OG1 1 
ATOM   2277  C  CG2 . THR A 1  299 ? -6.675  -3.474  112.702 1.00 17.15  ? 397  THR A CG2 1 
ATOM   2278  N  N   . GLN A 1  300 ? -6.680  0.229   113.260 1.00 18.53  ? 398  GLN A N   1 
ATOM   2279  C  CA  . GLN A 1  300 ? -7.084  0.879   114.497 1.00 27.74  ? 398  GLN A CA  1 
ATOM   2280  C  C   . GLN A 1  300 ? -8.122  1.968   114.249 1.00 27.26  ? 398  GLN A C   1 
ATOM   2281  O  O   . GLN A 1  300 ? -9.019  2.167   115.065 1.00 26.97  ? 398  GLN A O   1 
ATOM   2282  C  CB  . GLN A 1  300 ? -5.868  1.464   115.217 1.00 27.98  ? 398  GLN A CB  1 
ATOM   2283  C  CG  . GLN A 1  300 ? -4.917  0.407   115.757 1.00 30.17  ? 398  GLN A CG  1 
ATOM   2284  C  CD  . GLN A 1  300 ? -3.770  0.997   116.553 1.00 28.98  ? 398  GLN A CD  1 
ATOM   2285  O  OE1 . GLN A 1  300 ? -3.142  0.310   117.357 1.00 28.80  ? 398  GLN A OE1 1 
ATOM   2286  N  NE2 . GLN A 1  300 ? -3.490  2.277   116.331 1.00 29.96  ? 398  GLN A NE2 1 
ATOM   2287  N  N   . ILE A 1  301 ? -8.004  2.665   113.122 1.00 24.26  ? 399  ILE A N   1 
ATOM   2288  C  CA  . ILE A 1  301 ? -8.966  3.704   112.768 1.00 22.74  ? 399  ILE A CA  1 
ATOM   2289  C  C   . ILE A 1  301 ? -10.351 3.105   112.560 1.00 22.55  ? 399  ILE A C   1 
ATOM   2290  O  O   . ILE A 1  301 ? -11.343 3.606   113.093 1.00 21.75  ? 399  ILE A O   1 
ATOM   2291  C  CB  . ILE A 1  301 ? -8.540  4.466   111.499 1.00 25.28  ? 399  ILE A CB  1 
ATOM   2292  C  CG1 . ILE A 1  301 ? -7.361  5.390   111.806 1.00 20.49  ? 399  ILE A CG1 1 
ATOM   2293  C  CG2 . ILE A 1  301 ? -9.696  5.288   110.955 1.00 19.58  ? 399  ILE A CG2 1 
ATOM   2294  C  CD1 . ILE A 1  301 ? -6.683  5.938   110.572 1.00 20.78  ? 399  ILE A CD1 1 
ATOM   2295  N  N   . ILE A 1  302 ? -10.409 2.023   111.791 1.00 20.24  ? 400  ILE A N   1 
ATOM   2296  C  CA  . ILE A 1  302 ? -11.661 1.322   111.546 1.00 20.34  ? 400  ILE A CA  1 
ATOM   2297  C  C   . ILE A 1  302 ? -12.168 0.665   112.828 1.00 21.01  ? 400  ILE A C   1 
ATOM   2298  O  O   . ILE A 1  302 ? -13.350 0.757   113.159 1.00 25.93  ? 400  ILE A O   1 
ATOM   2299  C  CB  . ILE A 1  302 ? -11.504 0.256   110.446 1.00 21.21  ? 400  ILE A CB  1 
ATOM   2300  C  CG1 . ILE A 1  302 ? -11.076 0.912   109.130 1.00 21.22  ? 400  ILE A CG1 1 
ATOM   2301  C  CG2 . ILE A 1  302 ? -12.796 -0.531  110.269 1.00 19.14  ? 400  ILE A CG2 1 
ATOM   2302  C  CD1 . ILE A 1  302 ? -12.052 1.948   108.615 1.00 16.76  ? 400  ILE A CD1 1 
ATOM   2303  N  N   . GLY A 1  303 ? -11.261 0.009   113.544 1.00 19.49  ? 401  GLY A N   1 
ATOM   2304  C  CA  . GLY A 1  303 ? -11.595 -0.661  114.788 1.00 19.74  ? 401  GLY A CA  1 
ATOM   2305  C  C   . GLY A 1  303 ? -12.121 0.270   115.866 1.00 22.35  ? 401  GLY A C   1 
ATOM   2306  O  O   . GLY A 1  303 ? -13.047 -0.081  116.596 1.00 23.93  ? 401  GLY A O   1 
ATOM   2307  N  N   . ARG A 1  304 ? -11.532 1.458   115.968 1.00 22.00  ? 402  ARG A N   1 
ATOM   2308  C  CA  . ARG A 1  304 ? -11.941 2.432   116.978 1.00 23.34  ? 402  ARG A CA  1 
ATOM   2309  C  C   . ARG A 1  304 ? -13.341 2.966   116.703 1.00 23.82  ? 402  ARG A C   1 
ATOM   2310  O  O   . ARG A 1  304 ? -14.141 3.140   117.623 1.00 26.45  ? 402  ARG A O   1 
ATOM   2311  C  CB  . ARG A 1  304 ? -10.945 3.593   117.039 1.00 21.85  ? 402  ARG A CB  1 
ATOM   2312  C  CG  . ARG A 1  304 ? -11.422 4.779   117.861 1.00 25.11  ? 402  ARG A CG  1 
ATOM   2313  C  CD  . ARG A 1  304 ? -10.287 5.735   118.178 1.00 28.62  ? 402  ARG A CD  1 
ATOM   2314  N  NE  . ARG A 1  304 ? -9.406  5.215   119.219 1.00 33.08  ? 402  ARG A NE  1 
ATOM   2315  C  CZ  . ARG A 1  304 ? -9.673  5.282   120.519 1.00 36.15  ? 402  ARG A CZ  1 
ATOM   2316  N  NH1 . ARG A 1  304 ? -10.796 5.852   120.936 1.00 37.51  ? 402  ARG A NH1 1 
ATOM   2317  N  NH2 . ARG A 1  304 ? -8.818  4.784   121.402 1.00 36.35  ? 402  ARG A NH2 1 
ATOM   2318  N  N   . ALA A 1  305 ? -13.629 3.219   115.432 1.00 22.62  ? 403  ALA A N   1 
ATOM   2319  C  CA  . ALA A 1  305 ? -14.933 3.720   115.023 1.00 21.99  ? 403  ALA A CA  1 
ATOM   2320  C  C   . ALA A 1  305 ? -16.045 2.747   115.407 1.00 23.93  ? 403  ALA A C   1 
ATOM   2321  O  O   . ALA A 1  305 ? -17.085 3.156   115.923 1.00 28.78  ? 403  ALA A O   1 
ATOM   2322  C  CB  . ALA A 1  305 ? -14.950 3.985   113.535 1.00 18.40  ? 403  ALA A CB  1 
ATOM   2323  N  N   . MET A 1  306 ? -15.823 1.461   115.149 1.00 20.66  ? 404  MET A N   1 
ATOM   2324  C  CA  . MET A 1  306 ? -16.792 0.437   115.522 1.00 17.72  ? 404  MET A CA  1 
ATOM   2325  C  C   . MET A 1  306 ? -16.929 0.353   117.039 1.00 18.85  ? 404  MET A C   1 
ATOM   2326  O  O   . MET A 1  306 ? -18.034 0.209   117.564 1.00 17.57  ? 404  MET A O   1 
ATOM   2327  C  CB  . MET A 1  306 ? -16.394 -0.925  114.953 1.00 16.38  ? 404  MET A CB  1 
ATOM   2328  C  CG  . MET A 1  306 ? -16.444 -1.006  113.435 1.00 17.68  ? 404  MET A CG  1 
ATOM   2329  S  SD  . MET A 1  306 ? -16.126 -2.673  112.823 1.00 24.82  ? 404  MET A SD  1 
ATOM   2330  C  CE  . MET A 1  306 ? -14.441 -2.925  113.374 1.00 15.22  ? 404  MET A CE  1 
ATOM   2331  N  N   . TYR A 1  307 ? -15.800 0.444   117.737 1.00 18.08  ? 405  TYR A N   1 
ATOM   2332  C  CA  . TYR A 1  307 ? -15.790 0.448   119.197 1.00 19.31  ? 405  TYR A CA  1 
ATOM   2333  C  C   . TYR A 1  307 ? -16.595 1.615   119.753 1.00 22.38  ? 405  TYR A C   1 
ATOM   2334  O  O   . TYR A 1  307 ? -17.333 1.464   120.728 1.00 25.45  ? 405  TYR A O   1 
ATOM   2335  C  CB  . TYR A 1  307 ? -14.353 0.508   119.730 1.00 20.89  ? 405  TYR A CB  1 
ATOM   2336  C  CG  . TYR A 1  307 ? -14.204 1.312   121.006 1.00 20.88  ? 405  TYR A CG  1 
ATOM   2337  C  CD1 . TYR A 1  307 ? -14.533 0.765   122.239 1.00 24.08  ? 405  TYR A CD1 1 
ATOM   2338  C  CD2 . TYR A 1  307 ? -13.732 2.620   120.976 1.00 21.18  ? 405  TYR A CD2 1 
ATOM   2339  C  CE1 . TYR A 1  307 ? -14.402 1.496   123.406 1.00 22.08  ? 405  TYR A CE1 1 
ATOM   2340  C  CE2 . TYR A 1  307 ? -13.598 3.359   122.136 1.00 24.04  ? 405  TYR A CE2 1 
ATOM   2341  C  CZ  . TYR A 1  307 ? -13.934 2.792   123.348 1.00 23.57  ? 405  TYR A CZ  1 
ATOM   2342  O  OH  . TYR A 1  307 ? -13.801 3.524   124.505 1.00 24.02  ? 405  TYR A OH  1 
ATOM   2343  N  N   . GLN A 1  308 ? -16.440 2.780   119.132 1.00 22.80  ? 406  GLN A N   1 
ATOM   2344  C  CA  . GLN A 1  308 ? -17.094 3.991   119.608 1.00 27.92  ? 406  GLN A CA  1 
ATOM   2345  C  C   . GLN A 1  308 ? -18.612 3.868   119.539 1.00 27.88  ? 406  GLN A C   1 
ATOM   2346  O  O   . GLN A 1  308 ? -19.313 4.220   120.486 1.00 26.70  ? 406  GLN A O   1 
ATOM   2347  C  CB  . GLN A 1  308 ? -16.629 5.206   118.806 1.00 30.86  ? 406  GLN A CB  1 
ATOM   2348  C  CG  . GLN A 1  308 ? -17.163 6.523   119.344 1.00 33.28  ? 406  GLN A CG  1 
ATOM   2349  C  CD  . GLN A 1  308 ? -16.787 6.744   120.797 1.00 31.96  ? 406  GLN A CD  1 
ATOM   2350  O  OE1 . GLN A 1  308 ? -15.667 6.448   121.212 1.00 33.94  ? 406  GLN A OE1 1 
ATOM   2351  N  NE2 . GLN A 1  308 ? -17.728 7.258   121.581 1.00 28.45  ? 406  GLN A NE2 1 
ATOM   2352  N  N   . ARG A 1  309 ? -19.113 3.357   118.419 1.00 29.03  ? 407  ARG A N   1 
ATOM   2353  C  CA  . ARG A 1  309 ? -20.548 3.172   118.247 1.00 33.12  ? 407  ARG A CA  1 
ATOM   2354  C  C   . ARG A 1  309 ? -21.060 2.068   119.161 1.00 33.77  ? 407  ARG A C   1 
ATOM   2355  O  O   . ARG A 1  309 ? -22.155 2.168   119.712 1.00 37.15  ? 407  ARG A O   1 
ATOM   2356  C  CB  . ARG A 1  309 ? -20.880 2.850   116.788 1.00 34.89  ? 407  ARG A CB  1 
ATOM   2357  C  CG  . ARG A 1  309 ? -20.769 4.041   115.850 1.00 37.97  ? 407  ARG A CG  1 
ATOM   2358  C  CD  . ARG A 1  309 ? -21.786 5.113   116.206 1.00 36.27  ? 407  ARG A CD  1 
ATOM   2359  N  NE  . ARG A 1  309 ? -23.148 4.694   115.890 1.00 31.87  ? 407  ARG A NE  1 
ATOM   2360  C  CZ  . ARG A 1  309 ? -24.204 4.954   116.653 1.00 34.43  ? 407  ARG A CZ  1 
ATOM   2361  N  NH1 . ARG A 1  309 ? -24.057 5.624   117.787 1.00 34.30  ? 407  ARG A NH1 1 
ATOM   2362  N  NH2 . ARG A 1  309 ? -25.408 4.537   116.286 1.00 36.21  ? 407  ARG A NH2 1 
ATOM   2363  N  N   . ALA A 1  310 ? -20.257 1.022   119.324 1.00 29.90  ? 408  ALA A N   1 
ATOM   2364  C  CA  . ALA A 1  310 ? -20.604 -0.083  120.210 1.00 27.55  ? 408  ALA A CA  1 
ATOM   2365  C  C   . ALA A 1  310 ? -20.726 0.399   121.650 1.00 27.16  ? 408  ALA A C   1 
ATOM   2366  O  O   . ALA A 1  310 ? -21.604 -0.044  122.392 1.00 27.11  ? 408  ALA A O   1 
ATOM   2367  C  CB  . ALA A 1  310 ? -19.569 -1.196  120.108 1.00 27.07  ? 408  ALA A CB  1 
ATOM   2368  N  N   . LYS A 1  311 ? -19.840 1.311   122.037 1.00 26.51  ? 409  LYS A N   1 
ATOM   2369  C  CA  . LYS A 1  311 ? -19.842 1.863   123.386 1.00 27.46  ? 409  LYS A CA  1 
ATOM   2370  C  C   . LYS A 1  311 ? -21.086 2.707   123.633 1.00 30.60  ? 409  LYS A C   1 
ATOM   2371  O  O   . LYS A 1  311 ? -21.723 2.602   124.681 1.00 33.35  ? 409  LYS A O   1 
ATOM   2372  C  CB  . LYS A 1  311 ? -18.586 2.702   123.624 1.00 26.49  ? 409  LYS A CB  1 
ATOM   2373  C  CG  . LYS A 1  311 ? -18.439 3.192   125.054 1.00 30.29  ? 409  LYS A CG  1 
ATOM   2374  C  CD  . LYS A 1  311 ? -17.385 4.281   125.165 1.00 33.56  ? 409  LYS A CD  1 
ATOM   2375  C  CE  . LYS A 1  311 ? -17.828 5.371   126.129 1.00 42.94  ? 409  LYS A CE  1 
ATOM   2376  N  NZ  . LYS A 1  311 ? -16.878 6.517   126.167 1.00 47.54  ? 409  LYS A NZ  1 
ATOM   2377  N  N   . GLU A 1  312 ? -21.416 3.551   122.661 1.00 27.21  ? 410  GLU A N   1 
ATOM   2378  C  CA  . GLU A 1  312 ? -22.585 4.418   122.746 1.00 26.62  ? 410  GLU A CA  1 
ATOM   2379  C  C   . GLU A 1  312 ? -23.890 3.627   122.826 1.00 26.48  ? 410  GLU A C   1 
ATOM   2380  O  O   . GLU A 1  312 ? -24.751 3.921   123.655 1.00 28.08  ? 410  GLU A O   1 
ATOM   2381  C  CB  . GLU A 1  312 ? -22.620 5.368   121.547 1.00 25.53  ? 410  GLU A CB  1 
ATOM   2382  C  CG  . GLU A 1  312 ? -21.529 6.426   121.567 1.00 31.37  ? 410  GLU A CG  1 
ATOM   2383  C  CD  . GLU A 1  312 ? -21.367 7.125   120.231 1.00 36.64  ? 410  GLU A CD  1 
ATOM   2384  O  OE1 . GLU A 1  312 ? -22.135 6.810   119.297 1.00 38.90  ? 410  GLU A OE1 1 
ATOM   2385  O  OE2 . GLU A 1  312 ? -20.476 7.993   120.115 1.00 36.85  ? 410  GLU A OE2 1 
ATOM   2386  N  N   . LEU A 1  313 ? -24.027 2.621   121.968 1.00 23.26  ? 411  LEU A N   1 
ATOM   2387  C  CA  . LEU A 1  313 ? -25.235 1.802   121.938 1.00 22.06  ? 411  LEU A CA  1 
ATOM   2388  C  C   . LEU A 1  313 ? -25.407 0.998   123.220 1.00 21.15  ? 411  LEU A C   1 
ATOM   2389  O  O   . LEU A 1  313 ? -26.525 0.810   123.697 1.00 21.49  ? 411  LEU A O   1 
ATOM   2390  C  CB  . LEU A 1  313 ? -25.214 0.859   120.735 1.00 19.52  ? 411  LEU A CB  1 
ATOM   2391  C  CG  . LEU A 1  313 ? -25.320 1.537   119.368 1.00 19.17  ? 411  LEU A CG  1 
ATOM   2392  C  CD1 . LEU A 1  313 ? -24.995 0.555   118.255 1.00 18.06  ? 411  LEU A CD1 1 
ATOM   2393  C  CD2 . LEU A 1  313 ? -26.701 2.145   119.179 1.00 19.59  ? 411  LEU A CD2 1 
ATOM   2394  N  N   . TYR A 1  314 ? -24.296 0.523   123.769 1.00 21.96  ? 412  TYR A N   1 
ATOM   2395  C  CA  . TYR A 1  314 ? -24.319 -0.223  125.020 1.00 22.92  ? 412  TYR A CA  1 
ATOM   2396  C  C   . TYR A 1  314 ? -24.827 0.656   126.158 1.00 30.00  ? 412  TYR A C   1 
ATOM   2397  O  O   . TYR A 1  314 ? -25.706 0.256   126.923 1.00 31.17  ? 412  TYR A O   1 
ATOM   2398  C  CB  . TYR A 1  314 ? -22.925 -0.765  125.345 1.00 22.45  ? 412  TYR A CB  1 
ATOM   2399  C  CG  . TYR A 1  314 ? -22.867 -1.628  126.585 1.00 22.34  ? 412  TYR A CG  1 
ATOM   2400  C  CD1 . TYR A 1  314 ? -22.649 -1.070  127.839 1.00 23.63  ? 412  TYR A CD1 1 
ATOM   2401  C  CD2 . TYR A 1  314 ? -23.024 -3.004  126.500 1.00 24.84  ? 412  TYR A CD2 1 
ATOM   2402  C  CE1 . TYR A 1  314 ? -22.595 -1.858  128.970 1.00 24.33  ? 412  TYR A CE1 1 
ATOM   2403  C  CE2 . TYR A 1  314 ? -22.967 -3.800  127.625 1.00 22.46  ? 412  TYR A CE2 1 
ATOM   2404  C  CZ  . TYR A 1  314 ? -22.756 -3.223  128.857 1.00 23.75  ? 412  TYR A CZ  1 
ATOM   2405  O  OH  . TYR A 1  314 ? -22.703 -4.017  129.977 1.00 24.57  ? 412  TYR A OH  1 
ATOM   2406  N  N   . ALA A 1  315 ? -24.266 1.856   126.259 1.00 23.74  ? 413  ALA A N   1 
ATOM   2407  C  CA  . ALA A 1  315 ? -24.624 2.801   127.311 1.00 37.24  ? 413  ALA A CA  1 
ATOM   2408  C  C   . ALA A 1  315 ? -26.100 3.195   127.269 1.00 35.27  ? 413  ALA A C   1 
ATOM   2409  O  O   . ALA A 1  315 ? -26.751 3.302   128.309 1.00 34.08  ? 413  ALA A O   1 
ATOM   2410  C  CB  . ALA A 1  315 ? -23.750 4.043   127.217 1.00 25.76  ? 413  ALA A CB  1 
ATOM   2411  N  N   . SER A 1  316 ? -26.623 3.406   126.065 1.00 35.70  ? 414  SER A N   1 
ATOM   2412  C  CA  . SER A 1  316 ? -27.973 3.936   125.900 1.00 37.09  ? 414  SER A CA  1 
ATOM   2413  C  C   . SER A 1  316 ? -29.019 2.849   125.668 1.00 32.51  ? 414  SER A C   1 
ATOM   2414  O  O   . SER A 1  316 ? -30.171 3.149   125.358 1.00 31.20  ? 414  SER A O   1 
ATOM   2415  C  CB  . SER A 1  316 ? -28.007 4.934   124.740 1.00 41.25  ? 414  SER A CB  1 
ATOM   2416  O  OG  . SER A 1  316 ? -27.762 4.287   123.503 1.00 43.06  ? 414  SER A OG  1 
ATOM   2417  N  N   . ALA A 1  317 ? -28.617 1.591   125.819 1.00 31.64  ? 415  ALA A N   1 
ATOM   2418  C  CA  . ALA A 1  317 ? -29.534 0.467   125.653 1.00 33.28  ? 415  ALA A CA  1 
ATOM   2419  C  C   . ALA A 1  317 ? -30.648 0.497   126.699 1.00 37.94  ? 415  ALA A C   1 
ATOM   2420  O  O   . ALA A 1  317 ? -30.388 0.656   127.891 1.00 41.54  ? 415  ALA A O   1 
ATOM   2421  C  CB  . ALA A 1  317 ? -28.775 -0.848  125.724 1.00 30.06  ? 415  ALA A CB  1 
ATOM   2422  N  N   . SER A 1  318 ? -31.888 0.342   126.244 1.00 36.96  ? 416  SER A N   1 
ATOM   2423  C  CA  . SER A 1  318 ? -33.041 0.407   127.136 1.00 36.72  ? 416  SER A CA  1 
ATOM   2424  C  C   . SER A 1  318 ? -34.036 -0.725  126.877 1.00 34.71  ? 416  SER A C   1 
ATOM   2425  O  O   . SER A 1  318 ? -34.655 -1.241  127.807 1.00 33.05  ? 416  SER A O   1 
ATOM   2426  C  CB  . SER A 1  318 ? -33.741 1.762   126.996 1.00 36.20  ? 416  SER A CB  1 
ATOM   2427  O  OG  . SER A 1  318 ? -34.308 1.913   125.706 1.00 34.96  ? 416  SER A OG  1 
ATOM   2428  N  N   . GLN A 1  319 ? -34.183 -1.107  125.612 1.00 34.39  ? 417  GLN A N   1 
ATOM   2429  C  CA  . GLN A 1  319 ? -35.086 -2.190  125.232 1.00 32.76  ? 417  GLN A CA  1 
ATOM   2430  C  C   . GLN A 1  319 ? -34.638 -3.530  125.808 1.00 31.09  ? 417  GLN A C   1 
ATOM   2431  O  O   . GLN A 1  319 ? -33.611 -4.074  125.405 1.00 32.16  ? 417  GLN A O   1 
ATOM   2432  C  CB  . GLN A 1  319 ? -35.179 -2.288  123.706 1.00 35.94  ? 417  GLN A CB  1 
ATOM   2433  C  CG  . GLN A 1  319 ? -36.104 -3.381  123.198 1.00 41.14  ? 417  GLN A CG  1 
ATOM   2434  C  CD  . GLN A 1  319 ? -37.563 -2.985  123.259 1.00 51.09  ? 417  GLN A CD  1 
ATOM   2435  O  OE1 . GLN A 1  319 ? -38.303 -3.425  124.140 1.00 54.58  ? 417  GLN A OE1 1 
ATOM   2436  N  NE2 . GLN A 1  319 ? -37.987 -2.152  122.316 1.00 54.34  ? 417  GLN A NE2 1 
ATOM   2437  N  N   . GLU A 1  320 ? -35.414 -4.062  126.749 1.00 29.63  ? 418  GLU A N   1 
ATOM   2438  C  CA  . GLU A 1  320 ? -35.083 -5.342  127.367 1.00 30.83  ? 418  GLU A CA  1 
ATOM   2439  C  C   . GLU A 1  320 ? -35.495 -6.505  126.472 1.00 30.29  ? 418  GLU A C   1 
ATOM   2440  O  O   . GLU A 1  320 ? -36.514 -6.443  125.783 1.00 26.65  ? 418  GLU A O   1 
ATOM   2441  C  CB  . GLU A 1  320 ? -35.751 -5.469  128.741 1.00 34.62  ? 418  GLU A CB  1 
ATOM   2442  C  CG  . GLU A 1  320 ? -35.474 -6.792  129.450 1.00 38.11  ? 418  GLU A CG  1 
ATOM   2443  C  CD  . GLU A 1  320 ? -35.986 -6.823  130.875 1.00 43.15  ? 418  GLU A CD  1 
ATOM   2444  O  OE1 . GLU A 1  320 ? -36.782 -5.936  131.246 1.00 45.71  ? 418  GLU A OE1 1 
ATOM   2445  O  OE2 . GLU A 1  320 ? -35.598 -7.745  131.623 1.00 44.48  ? 418  GLU A OE2 1 
ATOM   2446  N  N   . VAL A 1  321 ? -34.697 -7.567  126.487 1.00 32.46  ? 419  VAL A N   1 
ATOM   2447  C  CA  . VAL A 1  321 ? -35.033 -8.782  125.761 1.00 28.69  ? 419  VAL A CA  1 
ATOM   2448  C  C   . VAL A 1  321 ? -35.558 -9.834  126.730 1.00 29.02  ? 419  VAL A C   1 
ATOM   2449  O  O   . VAL A 1  321 ? -34.880 -10.205 127.688 1.00 31.16  ? 419  VAL A O   1 
ATOM   2450  C  CB  . VAL A 1  321 ? -33.822 -9.337  124.993 1.00 27.30  ? 419  VAL A CB  1 
ATOM   2451  C  CG1 . VAL A 1  321 ? -34.157 -10.690 124.394 1.00 24.41  ? 419  VAL A CG1 1 
ATOM   2452  C  CG2 . VAL A 1  321 ? -33.397 -8.361  123.907 1.00 19.46  ? 419  VAL A CG2 1 
ATOM   2453  N  N   . THR A 1  322 ? -36.777 -10.301 126.481 1.00 30.49  ? 420  THR A N   1 
ATOM   2454  C  CA  . THR A 1  322 ? -37.421 -11.284 127.343 1.00 29.52  ? 420  THR A CA  1 
ATOM   2455  C  C   . THR A 1  322 ? -38.113 -12.343 126.497 1.00 31.65  ? 420  THR A C   1 
ATOM   2456  O  O   . THR A 1  322 ? -38.351 -12.140 125.307 1.00 31.51  ? 420  THR A O   1 
ATOM   2457  C  CB  . THR A 1  322 ? -38.459 -10.642 128.285 1.00 30.48  ? 420  THR A CB  1 
ATOM   2458  O  OG1 . THR A 1  322 ? -39.448 -9.951  127.512 1.00 32.67  ? 420  THR A OG1 1 
ATOM   2459  C  CG2 . THR A 1  322 ? -37.795 -9.664  129.246 1.00 31.53  ? 420  THR A CG2 1 
ATOM   2460  N  N   . GLY A 1  323 ? -38.433 -13.473 127.115 1.00 33.98  ? 421  GLY A N   1 
ATOM   2461  C  CA  . GLY A 1  323 ? -39.084 -14.561 126.412 1.00 34.24  ? 421  GLY A CA  1 
ATOM   2462  C  C   . GLY A 1  323 ? -38.316 -15.860 126.534 1.00 34.48  ? 421  GLY A C   1 
ATOM   2463  O  O   . GLY A 1  323 ? -37.220 -15.891 127.092 1.00 34.71  ? 421  GLY A O   1 
ATOM   2464  N  N   . PRO A 1  324 ? -38.887 -16.947 125.997 1.00 33.34  ? 422  PRO A N   1 
ATOM   2465  C  CA  . PRO A 1  324 ? -38.283 -18.279 126.115 1.00 32.53  ? 422  PRO A CA  1 
ATOM   2466  C  C   . PRO A 1  324 ? -37.043 -18.444 125.242 1.00 31.34  ? 422  PRO A C   1 
ATOM   2467  O  O   . PRO A 1  324 ? -36.868 -17.723 124.256 1.00 28.05  ? 422  PRO A O   1 
ATOM   2468  C  CB  . PRO A 1  324 ? -39.395 -19.220 125.646 1.00 30.96  ? 422  PRO A CB  1 
ATOM   2469  C  CG  . PRO A 1  324 ? -40.287 -18.388 124.803 1.00 29.99  ? 422  PRO A CG  1 
ATOM   2470  C  CD  . PRO A 1  324 ? -40.144 -16.958 125.229 1.00 32.29  ? 422  PRO A CD  1 
ATOM   2471  N  N   . LEU A 1  325 ? -36.183 -19.384 125.615 1.00 33.24  ? 423  LEU A N   1 
ATOM   2472  C  CA  . LEU A 1  325 ? -35.039 -19.749 124.792 1.00 32.35  ? 423  LEU A CA  1 
ATOM   2473  C  C   . LEU A 1  325 ? -35.383 -20.958 123.935 1.00 34.09  ? 423  LEU A C   1 
ATOM   2474  O  O   . LEU A 1  325 ? -36.059 -21.879 124.393 1.00 39.99  ? 423  LEU A O   1 
ATOM   2475  C  CB  . LEU A 1  325 ? -33.820 -20.047 125.665 1.00 33.95  ? 423  LEU A CB  1 
ATOM   2476  C  CG  . LEU A 1  325 ? -33.387 -18.931 126.616 1.00 35.36  ? 423  LEU A CG  1 
ATOM   2477  C  CD1 . LEU A 1  325 ? -32.133 -19.328 127.375 1.00 35.70  ? 423  LEU A CD1 1 
ATOM   2478  C  CD2 . LEU A 1  325 ? -33.164 -17.640 125.851 1.00 34.27  ? 423  LEU A CD2 1 
ATOM   2479  N  N   . ALA A 1  326 ? -34.922 -20.953 122.690 1.00 29.12  ? 424  ALA A N   1 
ATOM   2480  C  CA  . ALA A 1  326 ? -35.178 -22.068 121.789 1.00 26.40  ? 424  ALA A CA  1 
ATOM   2481  C  C   . ALA A 1  326 ? -34.056 -22.229 120.770 1.00 23.34  ? 424  ALA A C   1 
ATOM   2482  O  O   . ALA A 1  326 ? -33.258 -21.316 120.555 1.00 22.40  ? 424  ALA A O   1 
ATOM   2483  C  CB  . ALA A 1  326 ? -36.512 -21.884 121.084 1.00 25.67  ? 424  ALA A CB  1 
ATOM   2484  N  N   . SER A 1  327 ? -33.999 -23.402 120.150 1.00 22.26  ? 425  SER A N   1 
ATOM   2485  C  CA  . SER A 1  327 ? -32.955 -23.710 119.184 1.00 21.33  ? 425  SER A CA  1 
ATOM   2486  C  C   . SER A 1  327 ? -33.394 -24.835 118.255 1.00 23.44  ? 425  SER A C   1 
ATOM   2487  O  O   . SER A 1  327 ? -34.070 -25.774 118.676 1.00 25.81  ? 425  SER A O   1 
ATOM   2488  C  CB  . SER A 1  327 ? -31.656 -24.091 119.895 1.00 19.86  ? 425  SER A CB  1 
ATOM   2489  O  OG  . SER A 1  327 ? -31.806 -25.293 120.632 1.00 19.11  ? 425  SER A OG  1 
ATOM   2490  N  N   . ALA A 1  328 ? -33.005 -24.733 116.990 1.00 22.66  ? 426  ALA A N   1 
ATOM   2491  C  CA  . ALA A 1  328 ? -33.289 -25.776 116.014 1.00 22.19  ? 426  ALA A CA  1 
ATOM   2492  C  C   . ALA A 1  328 ? -32.087 -25.981 115.105 1.00 21.47  ? 426  ALA A C   1 
ATOM   2493  O  O   . ALA A 1  328 ? -31.462 -25.020 114.666 1.00 20.32  ? 426  ALA A O   1 
ATOM   2494  C  CB  . ALA A 1  328 ? -34.520 -25.426 115.198 1.00 20.85  ? 426  ALA A CB  1 
ATOM   2495  N  N   . HIS A 1  329 ? -31.759 -27.238 114.829 1.00 22.65  ? 427  HIS A N   1 
ATOM   2496  C  CA  . HIS A 1  329 ? -30.606 -27.551 113.995 1.00 23.28  ? 427  HIS A CA  1 
ATOM   2497  C  C   . HIS A 1  329 ? -30.935 -28.659 113.005 1.00 23.74  ? 427  HIS A C   1 
ATOM   2498  O  O   . HIS A 1  329 ? -31.789 -29.506 113.265 1.00 22.47  ? 427  HIS A O   1 
ATOM   2499  C  CB  . HIS A 1  329 ? -29.410 -27.948 114.866 1.00 20.50  ? 427  HIS A CB  1 
ATOM   2500  C  CG  . HIS A 1  329 ? -28.227 -28.439 114.091 1.00 19.14  ? 427  HIS A CG  1 
ATOM   2501  N  ND1 . HIS A 1  329 ? -28.132 -29.728 113.613 1.00 17.87  ? 427  HIS A ND1 1 
ATOM   2502  C  CD2 . HIS A 1  329 ? -27.096 -27.808 113.697 1.00 19.21  ? 427  HIS A CD2 1 
ATOM   2503  C  CE1 . HIS A 1  329 ? -26.990 -29.873 112.967 1.00 17.78  ? 427  HIS A CE1 1 
ATOM   2504  N  NE2 . HIS A 1  329 ? -26.342 -28.722 113.002 1.00 22.56  ? 427  HIS A NE2 1 
ATOM   2505  N  N   . GLN A 1  330 ? -30.241 -28.652 111.872 1.00 21.01  ? 428  GLN A N   1 
ATOM   2506  C  CA  . GLN A 1  330 ? -30.433 -29.673 110.857 1.00 23.76  ? 428  GLN A CA  1 
ATOM   2507  C  C   . GLN A 1  330 ? -29.181 -29.823 110.000 1.00 26.80  ? 428  GLN A C   1 
ATOM   2508  O  O   . GLN A 1  330 ? -28.540 -28.833 109.648 1.00 18.28  ? 428  GLN A O   1 
ATOM   2509  C  CB  . GLN A 1  330 ? -31.638 -29.321 109.985 1.00 29.46  ? 428  GLN A CB  1 
ATOM   2510  C  CG  . GLN A 1  330 ? -32.194 -30.475 109.179 1.00 35.88  ? 428  GLN A CG  1 
ATOM   2511  C  CD  . GLN A 1  330 ? -33.498 -30.120 108.494 1.00 37.91  ? 428  GLN A CD  1 
ATOM   2512  O  OE1 . GLN A 1  330 ? -33.730 -28.966 108.134 1.00 36.61  ? 428  GLN A OE1 1 
ATOM   2513  N  NE2 . GLN A 1  330 ? -34.364 -31.112 108.321 1.00 40.40  ? 428  GLN A NE2 1 
ATOM   2514  N  N   . TRP A 1  331 ? -28.829 -31.065 109.679 1.00 27.68  ? 429  TRP A N   1 
ATOM   2515  C  CA  . TRP A 1  331 ? -27.780 -31.330 108.700 1.00 21.52  ? 429  TRP A CA  1 
ATOM   2516  C  C   . TRP A 1  331 ? -28.388 -31.407 107.307 1.00 22.59  ? 429  TRP A C   1 
ATOM   2517  O  O   . TRP A 1  331 ? -29.422 -32.044 107.112 1.00 24.64  ? 429  TRP A O   1 
ATOM   2518  C  CB  . TRP A 1  331 ? -27.036 -32.628 109.021 1.00 18.58  ? 429  TRP A CB  1 
ATOM   2519  C  CG  . TRP A 1  331 ? -26.078 -32.528 110.167 1.00 18.84  ? 429  TRP A CG  1 
ATOM   2520  C  CD1 . TRP A 1  331 ? -25.127 -31.568 110.361 1.00 21.14  ? 429  TRP A CD1 1 
ATOM   2521  C  CD2 . TRP A 1  331 ? -25.939 -33.454 111.252 1.00 26.22  ? 429  TRP A CD2 1 
ATOM   2522  N  NE1 . TRP A 1  331 ? -24.426 -31.822 111.514 1.00 20.37  ? 429  TRP A NE1 1 
ATOM   2523  C  CE2 . TRP A 1  331 ? -24.903 -32.975 112.079 1.00 24.91  ? 429  TRP A CE2 1 
ATOM   2524  C  CE3 . TRP A 1  331 ? -26.599 -34.634 111.611 1.00 30.82  ? 429  TRP A CE3 1 
ATOM   2525  C  CZ2 . TRP A 1  331 ? -24.509 -33.637 113.241 1.00 31.47  ? 429  TRP A CZ2 1 
ATOM   2526  C  CZ3 . TRP A 1  331 ? -26.208 -35.289 112.765 1.00 33.05  ? 429  TRP A CZ3 1 
ATOM   2527  C  CH2 . TRP A 1  331 ? -25.173 -34.790 113.566 1.00 34.76  ? 429  TRP A CH2 1 
ATOM   2528  N  N   . VAL A 1  332 ? -27.747 -30.759 106.339 1.00 20.23  ? 430  VAL A N   1 
ATOM   2529  C  CA  . VAL A 1  332 ? -28.304 -30.672 104.994 1.00 19.34  ? 430  VAL A CA  1 
ATOM   2530  C  C   . VAL A 1  332 ? -27.276 -30.968 103.903 1.00 23.33  ? 430  VAL A C   1 
ATOM   2531  O  O   . VAL A 1  332 ? -26.187 -30.391 103.886 1.00 24.54  ? 430  VAL A O   1 
ATOM   2532  C  CB  . VAL A 1  332 ? -28.905 -29.275 104.726 1.00 15.85  ? 430  VAL A CB  1 
ATOM   2533  C  CG1 . VAL A 1  332 ? -29.444 -29.186 103.307 1.00 15.83  ? 430  VAL A CG1 1 
ATOM   2534  C  CG2 . VAL A 1  332 ? -29.992 -28.951 105.740 1.00 17.27  ? 430  VAL A CG2 1 
ATOM   2535  N  N   . ASP A 1  333 ? -27.632 -31.874 102.998 1.00 25.74  ? 431  ASP A N   1 
ATOM   2536  C  CA  . ASP A 1  333 ? -26.847 -32.119 101.795 1.00 24.69  ? 431  ASP A CA  1 
ATOM   2537  C  C   . ASP A 1  333 ? -27.114 -30.987 100.807 1.00 22.73  ? 431  ASP A C   1 
ATOM   2538  O  O   . ASP A 1  333 ? -28.096 -31.022 100.064 1.00 23.92  ? 431  ASP A O   1 
ATOM   2539  C  CB  . ASP A 1  333 ? -27.204 -33.473 101.179 1.00 29.76  ? 431  ASP A CB  1 
ATOM   2540  C  CG  . ASP A 1  333 ? -26.260 -33.881 100.060 1.00 33.71  ? 431  ASP A CG  1 
ATOM   2541  O  OD1 . ASP A 1  333 ? -25.447 -33.044 99.613  1.00 32.32  ? 431  ASP A OD1 1 
ATOM   2542  O  OD2 . ASP A 1  333 ? -26.346 -35.046 99.614  1.00 37.97  ? 431  ASP A OD2 1 
ATOM   2543  N  N   . MET A 1  334 ? -26.239 -29.987 100.801 1.00 18.47  ? 432  MET A N   1 
ATOM   2544  C  CA  . MET A 1  334 ? -26.433 -28.794 99.982  1.00 18.04  ? 432  MET A CA  1 
ATOM   2545  C  C   . MET A 1  334 ? -26.179 -29.039 98.497  1.00 20.10  ? 432  MET A C   1 
ATOM   2546  O  O   . MET A 1  334 ? -26.291 -28.121 97.685  1.00 23.26  ? 432  MET A O   1 
ATOM   2547  C  CB  . MET A 1  334 ? -25.533 -27.663 100.479 1.00 15.30  ? 432  MET A CB  1 
ATOM   2548  C  CG  . MET A 1  334 ? -26.031 -26.992 101.752 1.00 15.06  ? 432  MET A CG  1 
ATOM   2549  S  SD  . MET A 1  334 ? -27.617 -26.158 101.552 1.00 25.25  ? 432  MET A SD  1 
ATOM   2550  C  CE  . MET A 1  334 ? -27.218 -24.986 100.259 1.00 14.07  ? 432  MET A CE  1 
ATOM   2551  N  N   . THR A 1  335 ? -25.826 -30.268 98.141  1.00 17.24  ? 433  THR A N   1 
ATOM   2552  C  CA  . THR A 1  335 ? -25.594 -30.613 96.744  1.00 21.00  ? 433  THR A CA  1 
ATOM   2553  C  C   . THR A 1  335 ? -26.886 -31.045 96.059  1.00 25.63  ? 433  THR A C   1 
ATOM   2554  O  O   . THR A 1  335 ? -26.941 -31.157 94.835  1.00 32.36  ? 433  THR A O   1 
ATOM   2555  C  CB  . THR A 1  335 ? -24.552 -31.733 96.607  1.00 22.88  ? 433  THR A CB  1 
ATOM   2556  O  OG1 . THR A 1  335 ? -25.123 -32.973 97.040  1.00 24.78  ? 433  THR A OG1 1 
ATOM   2557  C  CG2 . THR A 1  335 ? -23.328 -31.419 97.446  1.00 18.37  ? 433  THR A CG2 1 
ATOM   2558  N  N   . ASP A 1  336 ? -27.922 -31.288 96.856  1.00 22.99  ? 434  ASP A N   1 
ATOM   2559  C  CA  . ASP A 1  336 ? -29.131 -31.930 96.357  1.00 23.07  ? 434  ASP A CA  1 
ATOM   2560  C  C   . ASP A 1  336 ? -30.399 -31.298 96.929  1.00 26.54  ? 434  ASP A C   1 
ATOM   2561  O  O   . ASP A 1  336 ? -31.371 -31.995 97.216  1.00 34.16  ? 434  ASP A O   1 
ATOM   2562  C  CB  . ASP A 1  336 ? -29.095 -33.423 96.687  1.00 29.37  ? 434  ASP A CB  1 
ATOM   2563  C  CG  . ASP A 1  336 ? -30.052 -34.232 95.841  1.00 37.48  ? 434  ASP A CG  1 
ATOM   2564  O  OD1 . ASP A 1  336 ? -30.158 -33.950 94.629  1.00 41.99  ? 434  ASP A OD1 1 
ATOM   2565  O  OD2 . ASP A 1  336 ? -30.702 -35.147 96.389  1.00 41.13  ? 434  ASP A OD2 1 
ATOM   2566  N  N   . VAL A 1  337 ? -30.390 -29.980 97.096  1.00 21.34  ? 435  VAL A N   1 
ATOM   2567  C  CA  . VAL A 1  337 ? -31.557 -29.283 97.624  1.00 20.07  ? 435  VAL A CA  1 
ATOM   2568  C  C   . VAL A 1  337 ? -32.456 -28.754 96.509  1.00 26.06  ? 435  VAL A C   1 
ATOM   2569  O  O   . VAL A 1  337 ? -32.019 -27.971 95.664  1.00 26.51  ? 435  VAL A O   1 
ATOM   2570  C  CB  . VAL A 1  337 ? -31.153 -28.109 98.533  1.00 20.23  ? 435  VAL A CB  1 
ATOM   2571  C  CG1 . VAL A 1  337 ? -32.388 -27.370 99.026  1.00 17.49  ? 435  VAL A CG1 1 
ATOM   2572  C  CG2 . VAL A 1  337 ? -30.316 -28.604 99.703  1.00 22.05  ? 435  VAL A CG2 1 
ATOM   2573  N  N   . THR A 1  338 ? -33.713 -29.189 96.513  1.00 23.91  ? 436  THR A N   1 
ATOM   2574  C  CA  . THR A 1  338 ? -34.699 -28.688 95.563  1.00 21.00  ? 436  THR A CA  1 
ATOM   2575  C  C   . THR A 1  338 ? -35.257 -27.354 96.046  1.00 23.22  ? 436  THR A C   1 
ATOM   2576  O  O   . THR A 1  338 ? -35.895 -27.288 97.096  1.00 23.81  ? 436  THR A O   1 
ATOM   2577  C  CB  . THR A 1  338 ? -35.855 -29.685 95.363  1.00 22.49  ? 436  THR A CB  1 
ATOM   2578  O  OG1 . THR A 1  338 ? -35.339 -30.934 94.886  1.00 22.25  ? 436  THR A OG1 1 
ATOM   2579  C  CG2 . THR A 1  338 ? -36.865 -29.140 94.363  1.00 19.01  ? 436  THR A CG2 1 
ATOM   2580  N  N   . VAL A 1  339 ? -35.023 -26.296 95.278  1.00 26.78  ? 437  VAL A N   1 
ATOM   2581  C  CA  . VAL A 1  339 ? -35.436 -24.961 95.693  1.00 29.49  ? 437  VAL A CA  1 
ATOM   2582  C  C   . VAL A 1  339 ? -36.580 -24.476 94.804  1.00 31.95  ? 437  VAL A C   1 
ATOM   2583  O  O   . VAL A 1  339 ? -36.555 -24.637 93.582  1.00 34.95  ? 437  VAL A O   1 
ATOM   2584  C  CB  . VAL A 1  339 ? -34.247 -23.956 95.682  1.00 27.06  ? 437  VAL A CB  1 
ATOM   2585  C  CG1 . VAL A 1  339 ? -32.980 -24.644 96.158  1.00 27.53  ? 437  VAL A CG1 1 
ATOM   2586  C  CG2 . VAL A 1  339 ? -34.023 -23.342 94.310  1.00 29.40  ? 437  VAL A CG2 1 
ATOM   2587  N  N   . TRP A 1  340 ? -37.625 -23.949 95.432  1.00 31.20  ? 438  TRP A N   1 
ATOM   2588  C  CA  . TRP A 1  340 ? -38.778 -23.455 94.688  1.00 31.75  ? 438  TRP A CA  1 
ATOM   2589  C  C   . TRP A 1  340 ? -38.709 -21.956 94.421  1.00 34.18  ? 438  TRP A C   1 
ATOM   2590  O  O   . TRP A 1  340 ? -38.676 -21.143 95.341  1.00 36.92  ? 438  TRP A O   1 
ATOM   2591  C  CB  . TRP A 1  340 ? -40.070 -23.820 95.427  1.00 27.64  ? 438  TRP A CB  1 
ATOM   2592  C  CG  . TRP A 1  340 ? -40.314 -25.292 95.399  1.00 27.71  ? 438  TRP A CG  1 
ATOM   2593  C  CD1 . TRP A 1  340 ? -39.963 -26.204 96.353  1.00 27.35  ? 438  TRP A CD1 1 
ATOM   2594  C  CD2 . TRP A 1  340 ? -40.928 -26.034 94.341  1.00 24.91  ? 438  TRP A CD2 1 
ATOM   2595  N  NE1 . TRP A 1  340 ? -40.336 -27.468 95.959  1.00 24.79  ? 438  TRP A NE1 1 
ATOM   2596  C  CE2 . TRP A 1  340 ? -40.930 -27.390 94.727  1.00 23.32  ? 438  TRP A CE2 1 
ATOM   2597  C  CE3 . TRP A 1  340 ? -41.488 -25.682 93.108  1.00 19.75  ? 438  TRP A CE3 1 
ATOM   2598  C  CZ2 . TRP A 1  340 ? -41.467 -28.393 93.924  1.00 21.92  ? 438  TRP A CZ2 1 
ATOM   2599  C  CZ3 . TRP A 1  340 ? -42.017 -26.680 92.313  1.00 23.00  ? 438  TRP A CZ3 1 
ATOM   2600  C  CH2 . TRP A 1  340 ? -42.002 -28.018 92.724  1.00 22.47  ? 438  TRP A CH2 1 
ATOM   2601  N  N   . LEU A 1  341 ? -38.686 -21.615 93.137  1.00 35.04  ? 439  LEU A N   1 
ATOM   2602  C  CA  . LEU A 1  341 ? -38.667 -20.232 92.681  1.00 39.16  ? 439  LEU A CA  1 
ATOM   2603  C  C   . LEU A 1  341 ? -40.091 -19.749 92.428  1.00 46.50  ? 439  LEU A C   1 
ATOM   2604  O  O   . LEU A 1  341 ? -40.362 -18.549 92.370  1.00 51.58  ? 439  LEU A O   1 
ATOM   2605  C  CB  . LEU A 1  341 ? -37.810 -20.100 91.419  1.00 40.78  ? 439  LEU A CB  1 
ATOM   2606  C  CG  . LEU A 1  341 ? -36.481 -20.865 91.478  1.00 39.89  ? 439  LEU A CG  1 
ATOM   2607  C  CD1 . LEU A 1  341 ? -35.741 -20.800 90.150  1.00 38.88  ? 439  LEU A CD1 1 
ATOM   2608  C  CD2 . LEU A 1  341 ? -35.600 -20.350 92.611  1.00 40.10  ? 439  LEU A CD2 1 
ATOM   2609  N  N   . ASN A 1  342 ? -40.991 -20.714 92.279  1.00 48.83  ? 440  ASN A N   1 
ATOM   2610  C  CA  . ASN A 1  342 ? -42.403 -20.480 92.006  1.00 44.76  ? 440  ASN A CA  1 
ATOM   2611  C  C   . ASN A 1  342 ? -43.252 -21.321 92.936  1.00 46.75  ? 440  ASN A C   1 
ATOM   2612  O  O   . ASN A 1  342 ? -42.755 -21.919 93.892  1.00 50.91  ? 440  ASN A O   1 
ATOM   2613  C  CB  . ASN A 1  342 ? -42.781 -20.906 90.598  1.00 45.85  ? 440  ASN A CB  1 
ATOM   2614  C  CG  . ASN A 1  342 ? -42.680 -19.813 89.567  1.00 50.82  ? 440  ASN A CG  1 
ATOM   2615  O  OD1 . ASN A 1  342 ? -42.497 -18.629 89.858  1.00 50.33  ? 440  ASN A OD1 1 
ATOM   2616  N  ND2 . ASN A 1  342 ? -42.825 -20.245 88.318  1.00 61.32  ? 440  ASN A ND2 1 
ATOM   2617  N  N   . SER A 1  343 ? -44.547 -21.360 92.642  1.00 44.44  ? 441  SER A N   1 
ATOM   2618  C  CA  . SER A 1  343 ? -45.416 -22.423 93.126  1.00 38.36  ? 441  SER A CA  1 
ATOM   2619  C  C   . SER A 1  343 ? -45.309 -23.613 92.166  1.00 35.79  ? 441  SER A C   1 
ATOM   2620  O  O   . SER A 1  343 ? -45.489 -24.762 92.562  1.00 35.59  ? 441  SER A O   1 
ATOM   2621  C  CB  . SER A 1  343 ? -46.864 -21.941 93.237  1.00 38.16  ? 441  SER A CB  1 
ATOM   2622  O  OG  . SER A 1  343 ? -47.339 -21.467 91.991  1.00 39.65  ? 441  SER A OG  1 
ATOM   2623  N  N   . THR A 1  344 ? -45.023 -23.309 90.900  1.00 34.77  ? 442  THR A N   1 
ATOM   2624  C  CA  . THR A 1  344 ? -44.986 -24.304 89.826  1.00 37.54  ? 442  THR A CA  1 
ATOM   2625  C  C   . THR A 1  344 ? -43.580 -24.664 89.326  1.00 38.46  ? 442  THR A C   1 
ATOM   2626  O  O   . THR A 1  344 ? -43.406 -25.629 88.581  1.00 42.63  ? 442  THR A O   1 
ATOM   2627  C  CB  . THR A 1  344 ? -45.810 -23.824 88.614  1.00 38.48  ? 442  THR A CB  1 
ATOM   2628  O  OG1 . THR A 1  344 ? -45.106 -22.769 87.946  1.00 35.58  ? 442  THR A OG1 1 
ATOM   2629  C  CG2 . THR A 1  344 ? -47.166 -23.309 89.067  1.00 41.98  ? 442  THR A CG2 1 
ATOM   2630  N  N   . HIS A 1  345 ? -42.588 -23.878 89.727  1.00 37.13  ? 443  HIS A N   1 
ATOM   2631  C  CA  . HIS A 1  345 ? -41.231 -23.975 89.188  1.00 41.47  ? 443  HIS A CA  1 
ATOM   2632  C  C   . HIS A 1  345 ? -40.154 -24.151 90.249  1.00 40.57  ? 443  HIS A C   1 
ATOM   2633  O  O   . HIS A 1  345 ? -40.105 -23.417 91.236  1.00 40.19  ? 443  HIS A O   1 
ATOM   2634  C  CB  . HIS A 1  345 ? -40.904 -22.741 88.347  1.00 47.90  ? 443  HIS A CB  1 
ATOM   2635  C  CG  . HIS A 1  345 ? -39.483 -22.682 87.886  1.00 55.93  ? 443  HIS A CG  1 
ATOM   2636  N  ND1 . HIS A 1  345 ? -39.026 -23.341 86.765  1.00 57.90  ? 443  HIS A ND1 1 
ATOM   2637  C  CD2 . HIS A 1  345 ? -38.413 -22.032 88.402  1.00 57.69  ? 443  HIS A CD2 1 
ATOM   2638  C  CE1 . HIS A 1  345 ? -37.736 -23.100 86.613  1.00 56.38  ? 443  HIS A CE1 1 
ATOM   2639  N  NE2 . HIS A 1  345 ? -37.339 -22.309 87.593  1.00 56.15  ? 443  HIS A NE2 1 
ATOM   2640  N  N   . ALA A 1  346 ? -39.283 -25.129 90.026  1.00 37.37  ? 444  ALA A N   1 
ATOM   2641  C  CA  . ALA A 1  346 ? -38.201 -25.419 90.953  1.00 30.09  ? 444  ALA A CA  1 
ATOM   2642  C  C   . ALA A 1  346 ? -36.892 -25.622 90.211  1.00 28.11  ? 444  ALA A C   1 
ATOM   2643  O  O   . ALA A 1  346 ? -36.876 -25.912 89.017  1.00 30.10  ? 444  ALA A O   1 
ATOM   2644  C  CB  . ALA A 1  346 ? -38.521 -26.649 91.782  1.00 27.24  ? 444  ALA A CB  1 
ATOM   2645  N  N   . SER A 1  347 ? -35.793 -25.465 90.935  1.00 26.24  ? 445  SER A N   1 
ATOM   2646  C  CA  . SER A 1  347 ? -34.479 -25.784 90.405  1.00 26.10  ? 445  SER A CA  1 
ATOM   2647  C  C   . SER A 1  347 ? -33.712 -26.576 91.453  1.00 27.14  ? 445  SER A C   1 
ATOM   2648  O  O   . SER A 1  347 ? -34.312 -27.206 92.324  1.00 23.95  ? 445  SER A O   1 
ATOM   2649  C  CB  . SER A 1  347 ? -33.720 -24.519 90.009  1.00 24.72  ? 445  SER A CB  1 
ATOM   2650  O  OG  . SER A 1  347 ? -32.499 -24.841 89.364  1.00 21.12  ? 445  SER A OG  1 
ATOM   2651  N  N   . LYS A 1  348 ? -32.388 -26.538 91.376  1.00 27.40  ? 446  LYS A N   1 
ATOM   2652  C  CA  . LYS A 1  348 ? -31.570 -27.422 92.191  1.00 25.61  ? 446  LYS A CA  1 
ATOM   2653  C  C   . LYS A 1  348 ? -30.226 -26.805 92.546  1.00 27.75  ? 446  LYS A C   1 
ATOM   2654  O  O   . LYS A 1  348 ? -29.640 -26.065 91.756  1.00 27.88  ? 446  LYS A O   1 
ATOM   2655  C  CB  . LYS A 1  348 ? -31.359 -28.750 91.456  1.00 27.19  ? 446  LYS A CB  1 
ATOM   2656  C  CG  . LYS A 1  348 ? -30.786 -29.873 92.300  1.00 28.70  ? 446  LYS A CG  1 
ATOM   2657  C  CD  . LYS A 1  348 ? -30.515 -31.105 91.449  1.00 30.68  ? 446  LYS A CD  1 
ATOM   2658  C  CE  . LYS A 1  348 ? -29.140 -31.685 91.730  1.00 36.00  ? 446  LYS A CE  1 
ATOM   2659  N  NZ  . LYS A 1  348 ? -28.052 -30.771 91.278  1.00 39.91  ? 446  LYS A NZ  1 
ATOM   2660  N  N   . THR A 1  349 ? -29.744 -27.115 93.744  1.00 27.90  ? 447  THR A N   1 
ATOM   2661  C  CA  . THR A 1  349 ? -28.392 -26.750 94.132  1.00 20.75  ? 447  THR A CA  1 
ATOM   2662  C  C   . THR A 1  349 ? -27.433 -27.771 93.535  1.00 22.19  ? 447  THR A C   1 
ATOM   2663  O  O   . THR A 1  349 ? -27.852 -28.837 93.084  1.00 23.13  ? 447  THR A O   1 
ATOM   2664  C  CB  . THR A 1  349 ? -28.228 -26.691 95.657  1.00 17.77  ? 447  THR A CB  1 
ATOM   2665  O  OG1 . THR A 1  349 ? -28.775 -27.879 96.244  1.00 22.13  ? 447  THR A OG1 1 
ATOM   2666  C  CG2 . THR A 1  349 ? -28.949 -25.481 96.223  1.00 15.75  ? 447  THR A CG2 1 
ATOM   2667  N  N   . CYS A 1  350 ? -26.145 -27.453 93.536  1.00 22.81  ? 448  CYS A N   1 
ATOM   2668  C  CA  . CYS A 1  350 ? -25.186 -28.246 92.781  1.00 23.75  ? 448  CYS A CA  1 
ATOM   2669  C  C   . CYS A 1  350 ? -24.125 -28.865 93.673  1.00 28.78  ? 448  CYS A C   1 
ATOM   2670  O  O   . CYS A 1  350 ? -23.982 -28.494 94.839  1.00 31.55  ? 448  CYS A O   1 
ATOM   2671  C  CB  . CYS A 1  350 ? -24.513 -27.376 91.721  1.00 21.63  ? 448  CYS A CB  1 
ATOM   2672  S  SG  . CYS A 1  350 ? -25.639 -26.266 90.852  1.00 26.72  ? 448  CYS A SG  1 
ATOM   2673  N  N   . LYS A 1  351 ? -23.382 -29.816 93.118  1.00 30.17  ? 449  LYS A N   1 
ATOM   2674  C  CA  . LYS A 1  351 ? -22.167 -30.288 93.759  1.00 30.50  ? 449  LYS A CA  1 
ATOM   2675  C  C   . LYS A 1  351 ? -21.175 -29.129 93.732  1.00 27.24  ? 449  LYS A C   1 
ATOM   2676  O  O   . LYS A 1  351 ? -21.083 -28.419 92.730  1.00 25.86  ? 449  LYS A O   1 
ATOM   2677  C  CB  . LYS A 1  351 ? -21.613 -31.524 93.055  1.00 34.57  ? 449  LYS A CB  1 
ATOM   2678  C  CG  . LYS A 1  351 ? -22.368 -32.801 93.389  1.00 38.69  ? 449  LYS A CG  1 
ATOM   2679  C  CD  . LYS A 1  351 ? -21.910 -33.961 92.527  1.00 46.25  ? 449  LYS A CD  1 
ATOM   2680  C  CE  . LYS A 1  351 ? -22.549 -35.264 92.978  1.00 53.83  ? 449  LYS A CE  1 
ATOM   2681  N  NZ  . LYS A 1  351 ? -21.727 -36.447 92.603  1.00 59.85  ? 449  LYS A NZ  1 
ATOM   2682  N  N   . PRO A 1  352 ? -20.437 -28.929 94.834  1.00 24.60  ? 450  PRO A N   1 
ATOM   2683  C  CA  . PRO A 1  352 ? -19.618 -27.723 95.018  1.00 25.19  ? 450  PRO A CA  1 
ATOM   2684  C  C   . PRO A 1  352 ? -18.575 -27.499 93.921  1.00 25.80  ? 450  PRO A C   1 
ATOM   2685  O  O   . PRO A 1  352 ? -17.889 -28.430 93.500  1.00 25.61  ? 450  PRO A O   1 
ATOM   2686  C  CB  . PRO A 1  352 ? -18.939 -27.956 96.375  1.00 20.97  ? 450  PRO A CB  1 
ATOM   2687  C  CG  . PRO A 1  352 ? -19.123 -29.403 96.682  1.00 20.40  ? 450  PRO A CG  1 
ATOM   2688  C  CD  . PRO A 1  352 ? -20.376 -29.826 95.999  1.00 20.24  ? 450  PRO A CD  1 
ATOM   2689  N  N   . ALA A 1  353 ? -18.480 -26.256 93.456  1.00 24.68  ? 451  ALA A N   1 
ATOM   2690  C  CA  . ALA A 1  353 ? -17.510 -25.879 92.433  1.00 26.93  ? 451  ALA A CA  1 
ATOM   2691  C  C   . ALA A 1  353 ? -17.134 -24.403 92.542  1.00 22.77  ? 451  ALA A C   1 
ATOM   2692  O  O   . ALA A 1  353 ? -17.983 -23.558 92.828  1.00 22.51  ? 451  ALA A O   1 
ATOM   2693  C  CB  . ALA A 1  353 ? -18.056 -26.185 91.047  1.00 18.67  ? 451  ALA A CB  1 
ATOM   2694  N  N   . LEU A 1  354 ? -15.859 -24.102 92.307  1.00 21.02  ? 452  LEU A N   1 
ATOM   2695  C  CA  . LEU A 1  354 ? -15.377 -22.725 92.319  1.00 23.69  ? 452  LEU A CA  1 
ATOM   2696  C  C   . LEU A 1  354 ? -15.217 -22.176 90.906  1.00 23.59  ? 452  LEU A C   1 
ATOM   2697  O  O   . LEU A 1  354 ? -14.735 -22.869 90.011  1.00 23.46  ? 452  LEU A O   1 
ATOM   2698  C  CB  . LEU A 1  354 ? -14.047 -22.625 93.074  1.00 25.14  ? 452  LEU A CB  1 
ATOM   2699  C  CG  . LEU A 1  354 ? -14.087 -22.950 94.567  1.00 16.64  ? 452  LEU A CG  1 
ATOM   2700  C  CD1 . LEU A 1  354 ? -12.687 -23.154 95.110  1.00 16.97  ? 452  LEU A CD1 1 
ATOM   2701  C  CD2 . LEU A 1  354 ? -14.798 -21.840 95.326  1.00 15.75  ? 452  LEU A CD2 1 
ATOM   2702  N  N   . GLY A 1  355 ? -15.626 -20.926 90.715  1.00 22.31  ? 453  GLY A N   1 
ATOM   2703  C  CA  . GLY A 1  355 ? -15.549 -20.285 89.415  1.00 23.45  ? 453  GLY A CA  1 
ATOM   2704  C  C   . GLY A 1  355 ? -14.186 -19.697 89.104  1.00 24.51  ? 453  GLY A C   1 
ATOM   2705  O  O   . GLY A 1  355 ? -13.340 -19.576 89.990  1.00 23.67  ? 453  GLY A O   1 
ATOM   2706  N  N   . TYR A 1  356 ? -13.976 -19.350 87.836  1.00 25.24  ? 454  TYR A N   1 
ATOM   2707  C  CA  . TYR A 1  356 ? -12.750 -18.695 87.383  1.00 26.50  ? 454  TYR A CA  1 
ATOM   2708  C  C   . TYR A 1  356 ? -12.342 -17.511 88.253  1.00 26.60  ? 454  TYR A C   1 
ATOM   2709  O  O   . TYR A 1  356 ? -11.173 -17.365 88.612  1.00 25.34  ? 454  TYR A O   1 
ATOM   2710  C  CB  . TYR A 1  356 ? -12.906 -18.220 85.935  1.00 28.78  ? 454  TYR A CB  1 
ATOM   2711  C  CG  . TYR A 1  356 ? -12.465 -19.218 84.888  1.00 35.91  ? 454  TYR A CG  1 
ATOM   2712  C  CD1 . TYR A 1  356 ? -12.959 -20.515 84.876  1.00 38.00  ? 454  TYR A CD1 1 
ATOM   2713  C  CD2 . TYR A 1  356 ? -11.554 -18.854 83.903  1.00 39.13  ? 454  TYR A CD2 1 
ATOM   2714  C  CE1 . TYR A 1  356 ? -12.553 -21.424 83.911  1.00 41.81  ? 454  TYR A CE1 1 
ATOM   2715  C  CE2 . TYR A 1  356 ? -11.143 -19.752 82.938  1.00 42.02  ? 454  TYR A CE2 1 
ATOM   2716  C  CZ  . TYR A 1  356 ? -11.645 -21.036 82.946  1.00 46.44  ? 454  TYR A CZ  1 
ATOM   2717  O  OH  . TYR A 1  356 ? -11.234 -21.930 81.982  1.00 52.40  ? 454  TYR A OH  1 
ATOM   2718  N  N   . SER A 1  357 ? -13.315 -16.671 88.590  1.00 18.22  ? 455  SER A N   1 
ATOM   2719  C  CA  . SER A 1  357 ? -13.048 -15.424 89.300  1.00 17.70  ? 455  SER A CA  1 
ATOM   2720  C  C   . SER A 1  357 ? -12.617 -15.620 90.751  1.00 19.03  ? 455  SER A C   1 
ATOM   2721  O  O   . SER A 1  357 ? -12.206 -14.666 91.409  1.00 21.16  ? 455  SER A O   1 
ATOM   2722  C  CB  . SER A 1  357 ? -14.276 -14.517 89.243  1.00 17.39  ? 455  SER A CB  1 
ATOM   2723  O  OG  . SER A 1  357 ? -14.364 -13.874 87.984  1.00 18.17  ? 455  SER A OG  1 
ATOM   2724  N  N   . PHE A 1  358 ? -12.727 -16.846 91.256  1.00 16.84  ? 456  PHE A N   1 
ATOM   2725  C  CA  . PHE A 1  358 ? -12.210 -17.161 92.584  1.00 17.49  ? 456  PHE A CA  1 
ATOM   2726  C  C   . PHE A 1  358 ? -10.706 -16.908 92.639  1.00 20.23  ? 456  PHE A C   1 
ATOM   2727  O  O   . PHE A 1  358 ? -10.183 -16.422 93.641  1.00 23.99  ? 456  PHE A O   1 
ATOM   2728  C  CB  . PHE A 1  358 ? -12.517 -18.614 92.962  1.00 16.41  ? 456  PHE A CB  1 
ATOM   2729  C  CG  . PHE A 1  358 ? -11.731 -19.114 94.144  1.00 19.16  ? 456  PHE A CG  1 
ATOM   2730  C  CD1 . PHE A 1  358 ? -12.162 -18.861 95.434  1.00 15.58  ? 456  PHE A CD1 1 
ATOM   2731  C  CD2 . PHE A 1  358 ? -10.569 -19.850 93.963  1.00 19.17  ? 456  PHE A CD2 1 
ATOM   2732  C  CE1 . PHE A 1  358 ? -11.444 -19.320 96.524  1.00 15.58  ? 456  PHE A CE1 1 
ATOM   2733  C  CE2 . PHE A 1  358 ? -9.846  -20.311 95.049  1.00 18.12  ? 456  PHE A CE2 1 
ATOM   2734  C  CZ  . PHE A 1  358 ? -10.285 -20.046 96.332  1.00 17.27  ? 456  PHE A CZ  1 
ATOM   2735  N  N   . ALA A 1  359 ? -10.018 -17.243 91.552  1.00 17.61  ? 457  ALA A N   1 
ATOM   2736  C  CA  . ALA A 1  359 ? -8.572  -17.071 91.464  1.00 18.15  ? 457  ALA A CA  1 
ATOM   2737  C  C   . ALA A 1  359 ? -8.179  -15.604 91.314  1.00 18.13  ? 457  ALA A C   1 
ATOM   2738  O  O   . ALA A 1  359 ? -6.997  -15.266 91.355  1.00 22.75  ? 457  ALA A O   1 
ATOM   2739  C  CB  . ALA A 1  359 ? -8.016  -17.882 90.302  1.00 19.16  ? 457  ALA A CB  1 
ATOM   2740  N  N   . ALA A 1  360 ? -9.171  -14.739 91.132  1.00 18.48  ? 458  ALA A N   1 
ATOM   2741  C  CA  . ALA A 1  360 ? -8.919  -13.319 90.911  1.00 19.57  ? 458  ALA A CA  1 
ATOM   2742  C  C   . ALA A 1  360 ? -8.777  -12.554 92.220  1.00 18.37  ? 458  ALA A C   1 
ATOM   2743  O  O   . ALA A 1  360 ? -8.264  -11.438 92.239  1.00 20.40  ? 458  ALA A O   1 
ATOM   2744  C  CB  . ALA A 1  360 ? -10.029 -12.713 90.068  1.00 23.93  ? 458  ALA A CB  1 
ATOM   2745  N  N   . GLY A 1  361 ? -9.238  -13.154 93.311  1.00 22.82  ? 459  GLY A N   1 
ATOM   2746  C  CA  . GLY A 1  361 ? -9.232  -12.490 94.601  1.00 22.50  ? 459  GLY A CA  1 
ATOM   2747  C  C   . GLY A 1  361 ? -10.143 -11.277 94.612  1.00 23.42  ? 459  GLY A C   1 
ATOM   2748  O  O   . GLY A 1  361 ? -11.093 -11.198 93.831  1.00 25.35  ? 459  GLY A O   1 
ATOM   2749  N  N   . THR A 1  362 ? -9.850  -10.328 95.497  1.00 21.99  ? 460  THR A N   1 
ATOM   2750  C  CA  . THR A 1  362 ? -10.638 -9.105  95.606  1.00 18.65  ? 460  THR A CA  1 
ATOM   2751  C  C   . THR A 1  362 ? -9.740  -7.880  95.658  1.00 18.48  ? 460  THR A C   1 
ATOM   2752  O  O   . THR A 1  362 ? -8.521  -7.986  95.533  1.00 21.22  ? 460  THR A O   1 
ATOM   2753  C  CB  . THR A 1  362 ? -11.526 -9.095  96.868  1.00 18.17  ? 460  THR A CB  1 
ATOM   2754  O  OG1 . THR A 1  362 ? -10.707 -8.921  98.033  1.00 22.81  ? 460  THR A OG1 1 
ATOM   2755  C  CG2 . THR A 1  362 ? -12.310 -10.387 96.993  1.00 14.25  ? 460  THR A CG2 1 
ATOM   2756  N  N   . ILE A 1  363 ? -10.353 -6.716  95.839  1.00 16.39  ? 461  ILE A N   1 
ATOM   2757  C  CA  . ILE A 1  363 ? -9.611  -5.474  96.008  1.00 18.28  ? 461  ILE A CA  1 
ATOM   2758  C  C   . ILE A 1  363 ? -9.003  -5.382  97.406  1.00 21.31  ? 461  ILE A C   1 
ATOM   2759  O  O   . ILE A 1  363 ? -8.243  -4.460  97.701  1.00 21.79  ? 461  ILE A O   1 
ATOM   2760  C  CB  . ILE A 1  363 ? -10.506 -4.250  95.754  1.00 19.17  ? 461  ILE A CB  1 
ATOM   2761  C  CG1 . ILE A 1  363 ? -11.669 -4.222  96.748  1.00 16.71  ? 461  ILE A CG1 1 
ATOM   2762  C  CG2 . ILE A 1  363 ? -11.023 -4.263  94.326  1.00 19.72  ? 461  ILE A CG2 1 
ATOM   2763  C  CD1 . ILE A 1  363 ? -12.626 -3.068  96.529  1.00 15.96  ? 461  ILE A CD1 1 
ATOM   2764  N  N   . ASP A 1  364 ? -9.353  -6.338  98.263  1.00 15.29  ? 462  ASP A N   1 
ATOM   2765  C  CA  . ASP A 1  364 ? -8.784  -6.423  99.605  1.00 15.99  ? 462  ASP A CA  1 
ATOM   2766  C  C   . ASP A 1  364 ? -7.594  -7.373  99.609  1.00 17.40  ? 462  ASP A C   1 
ATOM   2767  O  O   . ASP A 1  364 ? -6.893  -7.509  100.612 1.00 18.38  ? 462  ASP A O   1 
ATOM   2768  C  CB  . ASP A 1  364 ? -9.831  -6.897  100.617 1.00 15.70  ? 462  ASP A CB  1 
ATOM   2769  C  CG  . ASP A 1  364 ? -11.002 -5.943  100.738 1.00 23.06  ? 462  ASP A CG  1 
ATOM   2770  O  OD1 . ASP A 1  364 ? -10.779 -4.713  100.731 1.00 24.60  ? 462  ASP A OD1 1 
ATOM   2771  O  OD2 . ASP A 1  364 ? -12.148 -6.425  100.844 1.00 24.05  ? 462  ASP A OD2 1 
ATOM   2772  N  N   . GLY A 1  365 ? -7.375  -8.025  98.472  1.00 16.98  ? 463  GLY A N   1 
ATOM   2773  C  CA  . GLY A 1  365 ? -6.311  -9.000  98.330  1.00 16.78  ? 463  GLY A CA  1 
ATOM   2774  C  C   . GLY A 1  365 ? -6.404  -9.667  96.973  1.00 16.26  ? 463  GLY A C   1 
ATOM   2775  O  O   . GLY A 1  365 ? -7.227  -10.555 96.759  1.00 22.32  ? 463  GLY A O   1 
ATOM   2776  N  N   . VAL A 1  366 ? -5.552  -9.230  96.053  1.00 23.90  ? 464  VAL A N   1 
ATOM   2777  C  CA  . VAL A 1  366 ? -5.621  -9.671  94.668  1.00 24.19  ? 464  VAL A CA  1 
ATOM   2778  C  C   . VAL A 1  366 ? -4.889  -10.993 94.466  1.00 24.51  ? 464  VAL A C   1 
ATOM   2779  O  O   . VAL A 1  366 ? -3.924  -11.293 95.169  1.00 29.23  ? 464  VAL A O   1 
ATOM   2780  C  CB  . VAL A 1  366 ? -5.023  -8.611  93.721  1.00 27.05  ? 464  VAL A CB  1 
ATOM   2781  C  CG1 . VAL A 1  366 ? -5.510  -8.824  92.299  1.00 31.29  ? 464  VAL A CG1 1 
ATOM   2782  C  CG2 . VAL A 1  366 ? -5.390  -7.219  94.196  1.00 26.33  ? 464  VAL A CG2 1 
ATOM   2783  N  N   . GLY A 1  367 ? -5.358  -11.784 93.507  1.00 27.66  ? 465  GLY A N   1 
ATOM   2784  C  CA  . GLY A 1  367 ? -4.678  -13.008 93.125  1.00 28.72  ? 465  GLY A CA  1 
ATOM   2785  C  C   . GLY A 1  367 ? -3.429  -12.713 92.317  1.00 27.80  ? 465  GLY A C   1 
ATOM   2786  O  O   . GLY A 1  367 ? -3.279  -11.626 91.761  1.00 28.23  ? 465  GLY A O   1 
ATOM   2787  N  N   . GLY A 1  368 ? -2.526  -13.686 92.258  1.00 25.95  ? 466  GLY A N   1 
ATOM   2788  C  CA  . GLY A 1  368 ? -1.258  -13.520 91.569  1.00 25.82  ? 466  GLY A CA  1 
ATOM   2789  C  C   . GLY A 1  368 ? -1.264  -13.914 90.103  1.00 29.29  ? 466  GLY A C   1 
ATOM   2790  O  O   . GLY A 1  368 ? -0.309  -13.634 89.379  1.00 32.96  ? 466  GLY A O   1 
ATOM   2791  N  N   . LEU A 1  369 ? -2.330  -14.576 89.665  1.00 29.15  ? 467  LEU A N   1 
ATOM   2792  C  CA  . LEU A 1  369 ? -2.333  -15.247 88.367  1.00 32.74  ? 467  LEU A CA  1 
ATOM   2793  C  C   . LEU A 1  369 ? -3.069  -14.481 87.269  1.00 35.64  ? 467  LEU A C   1 
ATOM   2794  O  O   . LEU A 1  369 ? -3.477  -15.073 86.267  1.00 39.72  ? 467  LEU A O   1 
ATOM   2795  C  CB  . LEU A 1  369 ? -2.947  -16.640 88.505  1.00 34.26  ? 467  LEU A CB  1 
ATOM   2796  C  CG  . LEU A 1  369 ? -2.193  -17.583 89.444  1.00 36.19  ? 467  LEU A CG  1 
ATOM   2797  C  CD1 . LEU A 1  369 ? -2.942  -18.893 89.617  1.00 39.47  ? 467  LEU A CD1 1 
ATOM   2798  C  CD2 . LEU A 1  369 ? -0.786  -17.820 88.929  1.00 34.40  ? 467  LEU A CD2 1 
ATOM   2799  N  N   . ASN A 1  370 ? -3.244  -13.177 87.468  1.00 34.88  ? 468  ASN A N   1 
ATOM   2800  C  CA  . ASN A 1  370 ? -3.816  -12.286 86.458  1.00 37.85  ? 468  ASN A CA  1 
ATOM   2801  C  C   . ASN A 1  370 ? -5.276  -12.584 86.106  1.00 32.77  ? 468  ASN A C   1 
ATOM   2802  O  O   . ASN A 1  370 ? -5.767  -12.143 85.066  1.00 32.25  ? 468  ASN A O   1 
ATOM   2803  C  CB  . ASN A 1  370 ? -2.967  -12.322 85.181  1.00 43.49  ? 468  ASN A CB  1 
ATOM   2804  C  CG  . ASN A 1  370 ? -2.615  -10.939 84.675  1.00 50.52  ? 468  ASN A CG  1 
ATOM   2805  O  OD1 . ASN A 1  370 ? -2.564  -9.978  85.443  1.00 53.93  ? 468  ASN A OD1 1 
ATOM   2806  N  ND2 . ASN A 1  370 ? -2.363  -10.832 83.376  1.00 55.44  ? 468  ASN A ND2 1 
ATOM   2807  N  N   . PHE A 1  371 ? -5.967  -13.335 86.960  1.00 29.47  ? 469  PHE A N   1 
ATOM   2808  C  CA  . PHE A 1  371 ? -7.404  -13.542 86.790  1.00 28.09  ? 469  PHE A CA  1 
ATOM   2809  C  C   . PHE A 1  371 ? -8.175  -12.264 87.098  1.00 27.52  ? 469  PHE A C   1 
ATOM   2810  O  O   . PHE A 1  371 ? -7.782  -11.491 87.970  1.00 32.26  ? 469  PHE A O   1 
ATOM   2811  C  CB  . PHE A 1  371 ? -7.903  -14.678 87.686  1.00 26.41  ? 469  PHE A CB  1 
ATOM   2812  C  CG  . PHE A 1  371 ? -7.661  -16.049 87.126  1.00 26.10  ? 469  PHE A CG  1 
ATOM   2813  C  CD1 . PHE A 1  371 ? -6.393  -16.606 87.141  1.00 29.80  ? 469  PHE A CD1 1 
ATOM   2814  C  CD2 . PHE A 1  371 ? -8.705  -16.784 86.592  1.00 27.10  ? 469  PHE A CD2 1 
ATOM   2815  C  CE1 . PHE A 1  371 ? -6.172  -17.872 86.629  1.00 33.19  ? 469  PHE A CE1 1 
ATOM   2816  C  CE2 . PHE A 1  371 ? -8.492  -18.048 86.079  1.00 32.55  ? 469  PHE A CE2 1 
ATOM   2817  C  CZ  . PHE A 1  371 ? -7.225  -18.593 86.098  1.00 35.21  ? 469  PHE A CZ  1 
ATOM   2818  N  N   . THR A 1  372 ? -9.272  -12.043 86.382  1.00 24.55  ? 470  THR A N   1 
ATOM   2819  C  CA  . THR A 1  372 ? -10.119 -10.881 86.637  1.00 24.25  ? 470  THR A CA  1 
ATOM   2820  C  C   . THR A 1  372 ? -11.495 -11.306 87.139  1.00 23.75  ? 470  THR A C   1 
ATOM   2821  O  O   . THR A 1  372 ? -12.011 -12.355 86.752  1.00 26.44  ? 470  THR A O   1 
ATOM   2822  C  CB  . THR A 1  372 ? -10.292 -10.011 85.381  1.00 27.54  ? 470  THR A CB  1 
ATOM   2823  O  OG1 . THR A 1  372 ? -10.844 -10.799 84.321  1.00 28.88  ? 470  THR A OG1 1 
ATOM   2824  C  CG2 . THR A 1  372 ? -8.955  -9.436  84.942  1.00 32.66  ? 470  THR A CG2 1 
ATOM   2825  N  N   . GLN A 1  373 ? -12.088 -10.486 87.999  1.00 22.35  ? 471  GLN A N   1 
ATOM   2826  C  CA  . GLN A 1  373 ? -13.442 -10.730 88.476  1.00 21.80  ? 471  GLN A CA  1 
ATOM   2827  C  C   . GLN A 1  373 ? -14.454 -10.508 87.356  1.00 25.27  ? 471  GLN A C   1 
ATOM   2828  O  O   . GLN A 1  373 ? -14.237 -9.682  86.469  1.00 26.83  ? 471  GLN A O   1 
ATOM   2829  C  CB  . GLN A 1  373 ? -13.770 -9.829  89.667  1.00 21.24  ? 471  GLN A CB  1 
ATOM   2830  C  CG  . GLN A 1  373 ? -13.006 -10.164 90.936  1.00 19.06  ? 471  GLN A CG  1 
ATOM   2831  C  CD  . GLN A 1  373 ? -13.532 -9.412  92.144  1.00 20.05  ? 471  GLN A CD  1 
ATOM   2832  O  OE1 . GLN A 1  373 ? -14.669 -9.617  92.570  1.00 20.81  ? 471  GLN A OE1 1 
ATOM   2833  N  NE2 . GLN A 1  373 ? -12.706 -8.536  92.701  1.00 19.32  ? 471  GLN A NE2 1 
ATOM   2834  N  N   . GLY A 1  374 ? -15.557 -11.248 87.397  1.00 25.37  ? 472  GLY A N   1 
ATOM   2835  C  CA  . GLY A 1  374 ? -16.618 -11.076 86.420  1.00 24.61  ? 472  GLY A CA  1 
ATOM   2836  C  C   . GLY A 1  374 ? -16.519 -12.001 85.221  1.00 28.43  ? 472  GLY A C   1 
ATOM   2837  O  O   . GLY A 1  374 ? -17.120 -11.742 84.179  1.00 37.41  ? 472  GLY A O   1 
ATOM   2838  N  N   . LYS A 1  375 ? -15.764 -13.085 85.365  1.00 28.08  ? 473  LYS A N   1 
ATOM   2839  C  CA  . LYS A 1  375 ? -15.606 -14.057 84.287  1.00 30.58  ? 473  LYS A CA  1 
ATOM   2840  C  C   . LYS A 1  375 ? -16.817 -14.978 84.182  1.00 30.82  ? 473  LYS A C   1 
ATOM   2841  O  O   . LYS A 1  375 ? -17.070 -15.790 85.072  1.00 30.97  ? 473  LYS A O   1 
ATOM   2842  C  CB  . LYS A 1  375 ? -14.341 -14.892 84.500  1.00 31.72  ? 473  LYS A CB  1 
ATOM   2843  C  CG  . LYS A 1  375 ? -13.104 -14.375 83.782  1.00 37.42  ? 473  LYS A CG  1 
ATOM   2844  C  CD  . LYS A 1  375 ? -13.019 -14.941 82.373  1.00 44.33  ? 473  LYS A CD  1 
ATOM   2845  C  CE  . LYS A 1  375 ? -11.603 -14.851 81.822  1.00 51.34  ? 473  LYS A CE  1 
ATOM   2846  N  NZ  . LYS A 1  375 ? -11.455 -15.591 80.536  1.00 53.45  ? 473  LYS A NZ  1 
ATOM   2847  N  N   . THR A 1  376 ? -17.565 -14.842 83.092  1.00 33.00  ? 474  THR A N   1 
ATOM   2848  C  CA  . THR A 1  376 ? -18.734 -15.681 82.856  1.00 35.22  ? 474  THR A CA  1 
ATOM   2849  C  C   . THR A 1  376 ? -18.428 -16.711 81.775  1.00 43.02  ? 474  THR A C   1 
ATOM   2850  O  O   . THR A 1  376 ? -19.296 -17.484 81.371  1.00 43.95  ? 474  THR A O   1 
ATOM   2851  C  CB  . THR A 1  376 ? -19.961 -14.847 82.439  1.00 31.71  ? 474  THR A CB  1 
ATOM   2852  O  OG1 . THR A 1  376 ? -19.691 -14.179 81.201  1.00 36.09  ? 474  THR A OG1 1 
ATOM   2853  C  CG2 . THR A 1  376 ? -20.298 -13.818 83.508  1.00 26.90  ? 474  THR A CG2 1 
ATOM   2854  N  N   . GLU A 1  377 ? -17.180 -16.714 81.317  1.00 47.29  ? 475  GLU A N   1 
ATOM   2855  C  CA  . GLU A 1  377 ? -16.741 -17.632 80.274  1.00 51.38  ? 475  GLU A CA  1 
ATOM   2856  C  C   . GLU A 1  377 ? -15.389 -18.228 80.628  1.00 54.17  ? 475  GLU A C   1 
ATOM   2857  O  O   . GLU A 1  377 ? -14.536 -17.558 81.209  1.00 55.78  ? 475  GLU A O   1 
ATOM   2858  C  CB  . GLU A 1  377 ? -16.638 -16.922 78.922  1.00 55.52  ? 475  GLU A CB  1 
ATOM   2859  C  CG  . GLU A 1  377 ? -17.847 -16.093 78.526  1.00 62.21  ? 475  GLU A CG  1 
ATOM   2860  C  CD  . GLU A 1  377 ? -17.555 -15.181 77.351  1.00 70.19  ? 475  GLU A CD  1 
ATOM   2861  O  OE1 . GLU A 1  377 ? -16.552 -14.437 77.409  1.00 71.31  ? 475  GLU A OE1 1 
ATOM   2862  O  OE2 . GLU A 1  377 ? -18.320 -15.213 76.364  1.00 74.71  ? 475  GLU A OE2 1 
ATOM   2863  N  N   . GLY A 1  378 ? -15.196 -19.493 80.276  1.00 55.96  ? 476  GLY A N   1 
ATOM   2864  C  CA  . GLY A 1  378 ? -13.912 -20.133 80.474  1.00 56.30  ? 476  GLY A CA  1 
ATOM   2865  C  C   . GLY A 1  378 ? -13.037 -19.908 79.257  1.00 58.89  ? 476  GLY A C   1 
ATOM   2866  O  O   . GLY A 1  378 ? -13.460 -19.286 78.283  1.00 62.05  ? 476  GLY A O   1 
ATOM   2867  N  N   . ASP A 1  379 ? -11.812 -20.413 79.312  1.00 58.13  ? 477  ASP A N   1 
ATOM   2868  C  CA  . ASP A 1  379 ? -10.935 -20.388 78.154  1.00 60.13  ? 477  ASP A CA  1 
ATOM   2869  C  C   . ASP A 1  379 ? -10.303 -21.765 77.962  1.00 59.61  ? 477  ASP A C   1 
ATOM   2870  O  O   . ASP A 1  379 ? -10.171 -22.521 78.923  1.00 56.24  ? 477  ASP A O   1 
ATOM   2871  C  CB  . ASP A 1  379 ? -9.872  -19.279 78.294  1.00 61.88  ? 477  ASP A CB  1 
ATOM   2872  C  CG  . ASP A 1  379 ? -9.049  -19.383 79.574  1.00 62.07  ? 477  ASP A CG  1 
ATOM   2873  O  OD1 . ASP A 1  379 ? -8.731  -20.505 80.018  1.00 64.49  ? 477  ASP A OD1 1 
ATOM   2874  O  OD2 . ASP A 1  379 ? -8.716  -18.320 80.138  1.00 60.46  ? 477  ASP A OD2 1 
ATOM   2875  N  N   . PRO A 1  380 ? -9.942  -22.104 76.713  1.00 59.54  ? 478  PRO A N   1 
ATOM   2876  C  CA  . PRO A 1  380 ? -9.413  -23.440 76.421  1.00 55.13  ? 478  PRO A CA  1 
ATOM   2877  C  C   . PRO A 1  380 ? -8.132  -23.720 77.191  1.00 48.91  ? 478  PRO A C   1 
ATOM   2878  O  O   . PRO A 1  380 ? -7.826  -24.873 77.489  1.00 47.26  ? 478  PRO A O   1 
ATOM   2879  C  CB  . PRO A 1  380 ? -9.150  -23.394 74.912  1.00 59.02  ? 478  PRO A CB  1 
ATOM   2880  C  CG  . PRO A 1  380 ? -10.049 -22.323 74.405  1.00 61.17  ? 478  PRO A CG  1 
ATOM   2881  C  CD  . PRO A 1  380 ? -10.081 -21.293 75.490  1.00 61.31  ? 478  PRO A CD  1 
ATOM   2882  N  N   . PHE A 1  381 ? -7.402  -22.660 77.516  1.00 47.68  ? 479  PHE A N   1 
ATOM   2883  C  CA  . PHE A 1  381 ? -6.137  -22.781 78.220  1.00 53.32  ? 479  PHE A CA  1 
ATOM   2884  C  C   . PHE A 1  381 ? -6.301  -23.375 79.622  1.00 53.45  ? 479  PHE A C   1 
ATOM   2885  O  O   . PHE A 1  381 ? -5.744  -24.431 79.921  1.00 53.94  ? 479  PHE A O   1 
ATOM   2886  C  CB  . PHE A 1  381 ? -5.464  -21.411 78.305  1.00 61.03  ? 479  PHE A CB  1 
ATOM   2887  C  CG  . PHE A 1  381 ? -4.135  -21.437 78.983  1.00 69.67  ? 479  PHE A CG  1 
ATOM   2888  C  CD1 . PHE A 1  381 ? -3.006  -21.855 78.300  1.00 76.01  ? 479  PHE A CD1 1 
ATOM   2889  C  CD2 . PHE A 1  381 ? -4.011  -21.047 80.302  1.00 68.69  ? 479  PHE A CD2 1 
ATOM   2890  C  CE1 . PHE A 1  381 ? -1.776  -21.882 78.921  1.00 77.86  ? 479  PHE A CE1 1 
ATOM   2891  C  CE2 . PHE A 1  381 ? -2.789  -21.074 80.926  1.00 69.51  ? 479  PHE A CE2 1 
ATOM   2892  C  CZ  . PHE A 1  381 ? -1.667  -21.490 80.237  1.00 74.26  ? 479  PHE A CZ  1 
ATOM   2893  N  N   . TRP A 1  382 ? -7.067  -22.703 80.477  1.00 52.80  ? 480  TRP A N   1 
ATOM   2894  C  CA  . TRP A 1  382 ? -7.257  -23.167 81.852  1.00 52.02  ? 480  TRP A CA  1 
ATOM   2895  C  C   . TRP A 1  382 ? -8.196  -24.365 81.959  1.00 44.75  ? 480  TRP A C   1 
ATOM   2896  O  O   . TRP A 1  382 ? -8.048  -25.190 82.862  1.00 41.73  ? 480  TRP A O   1 
ATOM   2897  C  CB  . TRP A 1  382 ? -7.763  -22.027 82.740  1.00 58.17  ? 480  TRP A CB  1 
ATOM   2898  C  CG  . TRP A 1  382 ? -6.653  -21.249 83.370  1.00 64.48  ? 480  TRP A CG  1 
ATOM   2899  C  CD1 . TRP A 1  382 ? -6.200  -20.014 83.009  1.00 66.74  ? 480  TRP A CD1 1 
ATOM   2900  C  CD2 . TRP A 1  382 ? -5.853  -21.660 84.485  1.00 65.78  ? 480  TRP A CD2 1 
ATOM   2901  N  NE1 . TRP A 1  382 ? -5.163  -19.633 83.828  1.00 68.34  ? 480  TRP A NE1 1 
ATOM   2902  C  CE2 . TRP A 1  382 ? -4.932  -20.627 84.743  1.00 67.94  ? 480  TRP A CE2 1 
ATOM   2903  C  CE3 . TRP A 1  382 ? -5.826  -22.804 85.289  1.00 62.94  ? 480  TRP A CE3 1 
ATOM   2904  C  CZ2 . TRP A 1  382 ? -3.995  -20.701 85.773  1.00 66.22  ? 480  TRP A CZ2 1 
ATOM   2905  C  CZ3 . TRP A 1  382 ? -4.896  -22.877 86.309  1.00 61.34  ? 480  TRP A CZ3 1 
ATOM   2906  C  CH2 . TRP A 1  382 ? -3.993  -21.833 86.542  1.00 63.55  ? 480  TRP A CH2 1 
ATOM   2907  N  N   . ASP A 1  383 ? -9.160  -24.456 81.048  1.00 40.74  ? 481  ASP A N   1 
ATOM   2908  C  CA  . ASP A 1  383 ? -10.019 -25.635 80.970  1.00 39.39  ? 481  ASP A CA  1 
ATOM   2909  C  C   . ASP A 1  383 ? -9.170  -26.882 80.745  1.00 38.15  ? 481  ASP A C   1 
ATOM   2910  O  O   . ASP A 1  383 ? -9.445  -27.942 81.308  1.00 31.41  ? 481  ASP A O   1 
ATOM   2911  C  CB  . ASP A 1  383 ? -11.060 -25.485 79.858  1.00 42.11  ? 481  ASP A CB  1 
ATOM   2912  C  CG  . ASP A 1  383 ? -12.216 -24.582 80.255  1.00 42.13  ? 481  ASP A CG  1 
ATOM   2913  O  OD1 . ASP A 1  383 ? -12.621 -24.612 81.436  1.00 38.69  ? 481  ASP A OD1 1 
ATOM   2914  O  OD2 . ASP A 1  383 ? -12.727 -23.850 79.383  1.00 45.14  ? 481  ASP A OD2 1 
ATOM   2915  N  N   . THR A 1  384 ? -8.135  -26.742 79.920  1.00 43.98  ? 482  THR A N   1 
ATOM   2916  C  CA  . THR A 1  384 ? -7.204  -27.834 79.652  1.00 48.13  ? 482  THR A CA  1 
ATOM   2917  C  C   . THR A 1  384 ? -6.469  -28.258 80.922  1.00 51.02  ? 482  THR A C   1 
ATOM   2918  O  O   . THR A 1  384 ? -6.457  -29.438 81.275  1.00 50.86  ? 482  THR A O   1 
ATOM   2919  C  CB  . THR A 1  384 ? -6.168  -27.447 78.585  1.00 46.49  ? 482  THR A CB  1 
ATOM   2920  O  OG1 . THR A 1  384 ? -6.836  -27.101 77.366  1.00 45.60  ? 482  THR A OG1 1 
ATOM   2921  C  CG2 . THR A 1  384 ? -5.226  -28.603 78.327  1.00 46.40  ? 482  THR A CG2 1 
ATOM   2922  N  N   . ILE A 1  385 ? -5.840  -27.290 81.586  1.00 52.12  ? 483  ILE A N   1 
ATOM   2923  C  CA  . ILE A 1  385 ? -5.116  -27.536 82.830  1.00 54.49  ? 483  ILE A CA  1 
ATOM   2924  C  C   . ILE A 1  385 ? -6.008  -28.214 83.869  1.00 55.64  ? 483  ILE A C   1 
ATOM   2925  O  O   . ILE A 1  385 ? -5.594  -29.167 84.532  1.00 56.68  ? 483  ILE A O   1 
ATOM   2926  C  CB  . ILE A 1  385 ? -4.551  -26.224 83.421  1.00 51.83  ? 483  ILE A CB  1 
ATOM   2927  C  CG1 . ILE A 1  385 ? -3.581  -25.570 82.438  1.00 54.99  ? 483  ILE A CG1 1 
ATOM   2928  C  CG2 . ILE A 1  385 ? -3.852  -26.488 84.744  1.00 47.09  ? 483  ILE A CG2 1 
ATOM   2929  C  CD1 . ILE A 1  385 ? -3.221  -24.142 82.792  1.00 54.74  ? 483  ILE A CD1 1 
ATOM   2930  N  N   . ARG A 1  386 ? -7.236  -27.720 83.994  1.00 52.57  ? 484  ARG A N   1 
ATOM   2931  C  CA  . ARG A 1  386 ? -8.211  -28.280 84.925  1.00 48.15  ? 484  ARG A CA  1 
ATOM   2932  C  C   . ARG A 1  386 ? -8.531  -29.738 84.600  1.00 50.68  ? 484  ARG A C   1 
ATOM   2933  O  O   . ARG A 1  386 ? -8.580  -30.587 85.491  1.00 53.66  ? 484  ARG A O   1 
ATOM   2934  C  CB  . ARG A 1  386 ? -9.495  -27.451 84.908  1.00 45.06  ? 484  ARG A CB  1 
ATOM   2935  C  CG  . ARG A 1  386 ? -10.696 -28.141 85.535  1.00 43.57  ? 484  ARG A CG  1 
ATOM   2936  C  CD  . ARG A 1  386 ? -11.993 -27.458 85.139  1.00 41.24  ? 484  ARG A CD  1 
ATOM   2937  N  NE  . ARG A 1  386 ? -12.287 -27.634 83.719  1.00 43.31  ? 484  ARG A NE  1 
ATOM   2938  C  CZ  . ARG A 1  386 ? -13.356 -27.132 83.107  1.00 44.52  ? 484  ARG A CZ  1 
ATOM   2939  N  NH1 . ARG A 1  386 ? -14.238 -26.415 83.791  1.00 50.07  ? 484  ARG A NH1 1 
ATOM   2940  N  NH2 . ARG A 1  386 ? -13.542 -27.343 81.812  1.00 38.72  ? 484  ARG A NH2 1 
ATOM   2941  N  N   . ASP A 1  387 ? -8.743  -30.020 83.318  1.00 49.82  ? 485  ASP A N   1 
ATOM   2942  C  CA  . ASP A 1  387 ? -9.032  -31.376 82.865  1.00 51.34  ? 485  ASP A CA  1 
ATOM   2943  C  C   . ASP A 1  387 ? -7.857  -32.326 83.088  1.00 54.39  ? 485  ASP A C   1 
ATOM   2944  O  O   . ASP A 1  387 ? -8.027  -33.415 83.636  1.00 53.36  ? 485  ASP A O   1 
ATOM   2945  C  CB  . ASP A 1  387 ? -9.416  -31.373 81.384  1.00 53.65  ? 485  ASP A CB  1 
ATOM   2946  C  CG  . ASP A 1  387 ? -10.749 -30.696 81.126  1.00 54.54  ? 485  ASP A CG  1 
ATOM   2947  O  OD1 . ASP A 1  387 ? -11.547 -30.561 82.076  1.00 55.67  ? 485  ASP A OD1 1 
ATOM   2948  O  OD2 . ASP A 1  387 ? -11.001 -30.304 79.967  1.00 55.11  ? 485  ASP A OD2 1 
ATOM   2949  N  N   . GLN A 1  388 ? -6.670  -31.909 82.658  1.00 60.91  ? 486  GLN A N   1 
ATOM   2950  C  CA  . GLN A 1  388 ? -5.485  -32.762 82.713  1.00 68.70  ? 486  GLN A CA  1 
ATOM   2951  C  C   . GLN A 1  388 ? -5.064  -33.116 84.137  1.00 68.48  ? 486  GLN A C   1 
ATOM   2952  O  O   . GLN A 1  388 ? -4.630  -34.238 84.400  1.00 69.04  ? 486  GLN A O   1 
ATOM   2953  C  CB  . GLN A 1  388 ? -4.314  -32.093 81.985  1.00 72.32  ? 486  GLN A CB  1 
ATOM   2954  C  CG  . GLN A 1  388 ? -4.503  -31.949 80.482  1.00 76.23  ? 486  GLN A CG  1 
ATOM   2955  C  CD  . GLN A 1  388 ? -4.628  -33.288 79.777  1.00 79.70  ? 486  GLN A CD  1 
ATOM   2956  O  OE1 . GLN A 1  388 ? -3.992  -34.270 80.164  1.00 81.06  ? 486  GLN A OE1 1 
ATOM   2957  N  NE2 . GLN A 1  388 ? -5.449  -33.334 78.733  1.00 80.12  ? 486  GLN A NE2 1 
ATOM   2958  N  N   . ILE A 1  389 ? -5.198  -32.163 85.054  1.00 66.52  ? 487  ILE A N   1 
ATOM   2959  C  CA  . ILE A 1  389 ? -4.697  -32.348 86.412  1.00 64.99  ? 487  ILE A CA  1 
ATOM   2960  C  C   . ILE A 1  389 ? -5.751  -32.906 87.365  1.00 64.01  ? 487  ILE A C   1 
ATOM   2961  O  O   . ILE A 1  389 ? -5.513  -33.903 88.047  1.00 65.69  ? 487  ILE A O   1 
ATOM   2962  C  CB  . ILE A 1  389 ? -4.157  -31.024 86.989  1.00 63.49  ? 487  ILE A CB  1 
ATOM   2963  C  CG1 . ILE A 1  389 ? -2.964  -30.533 86.166  1.00 67.33  ? 487  ILE A CG1 1 
ATOM   2964  C  CG2 . ILE A 1  389 ? -3.761  -31.199 88.447  1.00 60.43  ? 487  ILE A CG2 1 
ATOM   2965  C  CD1 . ILE A 1  389 ? -2.330  -29.267 86.703  1.00 67.23  ? 487  ILE A CD1 1 
ATOM   2966  N  N   . LEU A 1  390 ? -6.914  -32.265 87.413  1.00 62.65  ? 488  LEU A N   1 
ATOM   2967  C  CA  . LEU A 1  390 ? -7.947  -32.646 88.372  1.00 63.81  ? 488  LEU A CA  1 
ATOM   2968  C  C   . LEU A 1  390 ? -8.980  -33.594 87.773  1.00 67.70  ? 488  LEU A C   1 
ATOM   2969  O  O   . LEU A 1  390 ? -9.504  -34.469 88.462  1.00 70.73  ? 488  LEU A O   1 
ATOM   2970  C  CB  . LEU A 1  390 ? -8.642  -31.401 88.919  1.00 62.14  ? 488  LEU A CB  1 
ATOM   2971  C  CG  . LEU A 1  390 ? -7.717  -30.405 89.618  1.00 60.69  ? 488  LEU A CG  1 
ATOM   2972  C  CD1 . LEU A 1  390 ? -8.487  -29.164 90.019  1.00 59.73  ? 488  LEU A CD1 1 
ATOM   2973  C  CD2 . LEU A 1  390 ? -7.047  -31.044 90.824  1.00 58.35  ? 488  LEU A CD2 1 
ATOM   2974  N  N   . GLY A 1  391 ? -9.270  -33.412 86.490  1.00 68.39  ? 489  GLY A N   1 
ATOM   2975  C  CA  . GLY A 1  391 ? -10.292 -34.192 85.818  1.00 66.41  ? 489  GLY A CA  1 
ATOM   2976  C  C   . GLY A 1  391 ? -11.256 -33.289 85.077  1.00 63.80  ? 489  GLY A C   1 
ATOM   2977  O  O   . GLY A 1  391 ? -11.275 -32.080 85.299  1.00 65.53  ? 489  GLY A O   1 
ATOM   2978  N  N   . LYS A 1  392 ? -12.056 -33.869 84.190  1.00 60.60  ? 490  LYS A N   1 
ATOM   2979  C  CA  . LYS A 1  392 ? -13.020 -33.083 83.430  1.00 58.99  ? 490  LYS A CA  1 
ATOM   2980  C  C   . LYS A 1  392 ? -14.387 -33.083 84.101  1.00 56.03  ? 490  LYS A C   1 
ATOM   2981  O  O   . LYS A 1  392 ? -14.979 -34.141 84.308  1.00 61.34  ? 490  LYS A O   1 
ATOM   2982  C  CB  . LYS A 1  392 ? -13.139 -33.607 81.999  1.00 62.55  ? 490  LYS A CB  1 
ATOM   2983  C  CG  . LYS A 1  392 ? -13.993 -32.725 81.099  1.00 65.82  ? 490  LYS A CG  1 
ATOM   2984  C  CD  . LYS A 1  392 ? -13.963 -33.199 79.655  1.00 68.79  ? 490  LYS A CD  1 
ATOM   2985  C  CE  . LYS A 1  392 ? -14.761 -32.266 78.757  1.00 66.40  ? 490  LYS A CE  1 
ATOM   2986  N  NZ  . LYS A 1  392 ? -14.665 -32.658 77.325  1.00 65.94  ? 490  LYS A NZ  1 
ATOM   2987  N  N   . PRO A 1  393 ? -14.883 -31.887 84.454  1.00 50.42  ? 491  PRO A N   1 
ATOM   2988  C  CA  . PRO A 1  393 ? -16.210 -31.709 85.055  1.00 47.03  ? 491  PRO A CA  1 
ATOM   2989  C  C   . PRO A 1  393 ? -17.319 -32.318 84.202  1.00 45.94  ? 491  PRO A C   1 
ATOM   2990  O  O   . PRO A 1  393 ? -17.298 -32.172 82.980  1.00 47.63  ? 491  PRO A O   1 
ATOM   2991  C  CB  . PRO A 1  393 ? -16.364 -30.187 85.135  1.00 45.00  ? 491  PRO A CB  1 
ATOM   2992  C  CG  . PRO A 1  393 ? -14.979 -29.658 85.130  1.00 47.52  ? 491  PRO A CG  1 
ATOM   2993  C  CD  . PRO A 1  393 ? -14.157 -30.612 84.318  1.00 51.13  ? 491  PRO A CD  1 
ATOM   2994  N  N   . SER A 1  394 ? -18.260 -33.006 84.842  1.00 41.83  ? 492  SER A N   1 
ATOM   2995  C  CA  . SER A 1  394 ? -19.411 -33.568 84.143  1.00 41.43  ? 492  SER A CA  1 
ATOM   2996  C  C   . SER A 1  394 ? -20.245 -32.471 83.488  1.00 41.51  ? 492  SER A C   1 
ATOM   2997  O  O   . SER A 1  394 ? -20.115 -31.295 83.824  1.00 37.69  ? 492  SER A O   1 
ATOM   2998  C  CB  . SER A 1  394 ? -20.275 -34.384 85.107  1.00 39.95  ? 492  SER A CB  1 
ATOM   2999  O  OG  . SER A 1  394 ? -20.833 -33.557 86.112  1.00 38.76  ? 492  SER A OG  1 
ATOM   3000  N  N   . GLU A 1  395 ? -21.107 -32.860 82.556  1.00 46.07  ? 493  GLU A N   1 
ATOM   3001  C  CA  . GLU A 1  395 ? -21.943 -31.889 81.867  1.00 50.40  ? 493  GLU A CA  1 
ATOM   3002  C  C   . GLU A 1  395 ? -23.058 -31.400 82.786  1.00 48.44  ? 493  GLU A C   1 
ATOM   3003  O  O   . GLU A 1  395 ? -23.554 -30.283 82.635  1.00 48.43  ? 493  GLU A O   1 
ATOM   3004  C  CB  . GLU A 1  395 ? -22.528 -32.492 80.588  1.00 55.46  ? 493  GLU A CB  1 
ATOM   3005  C  CG  . GLU A 1  395 ? -22.746 -31.484 79.467  1.00 59.97  ? 493  GLU A CG  1 
ATOM   3006  C  CD  . GLU A 1  395 ? -21.442 -30.958 78.887  1.00 64.97  ? 493  GLU A CD  1 
ATOM   3007  O  OE1 . GLU A 1  395 ? -20.393 -31.612 79.076  1.00 63.78  ? 493  GLU A OE1 1 
ATOM   3008  O  OE2 . GLU A 1  395 ? -21.466 -29.890 78.240  1.00 68.55  ? 493  GLU A OE2 1 
ATOM   3009  N  N   . GLU A 1  396 ? -23.439 -32.239 83.744  1.00 48.09  ? 494  GLU A N   1 
ATOM   3010  C  CA  . GLU A 1  396 ? -24.455 -31.877 84.728  1.00 48.59  ? 494  GLU A CA  1 
ATOM   3011  C  C   . GLU A 1  396 ? -23.989 -30.735 85.625  1.00 41.40  ? 494  GLU A C   1 
ATOM   3012  O  O   . GLU A 1  396 ? -24.737 -29.790 85.873  1.00 41.01  ? 494  GLU A O   1 
ATOM   3013  C  CB  . GLU A 1  396 ? -24.845 -33.086 85.585  1.00 57.90  ? 494  GLU A CB  1 
ATOM   3014  C  CG  . GLU A 1  396 ? -25.703 -34.124 84.870  1.00 68.55  ? 494  GLU A CG  1 
ATOM   3015  C  CD  . GLU A 1  396 ? -24.890 -35.131 84.074  1.00 77.44  ? 494  GLU A CD  1 
ATOM   3016  O  OE1 . GLU A 1  396 ? -23.671 -34.918 83.896  1.00 78.64  ? 494  GLU A OE1 1 
ATOM   3017  O  OE2 . GLU A 1  396 ? -25.476 -36.138 83.623  1.00 80.78  ? 494  GLU A OE2 1 
ATOM   3018  N  N   . ILE A 1  397 ? -22.755 -30.826 86.111  1.00 35.66  ? 495  ILE A N   1 
ATOM   3019  C  CA  . ILE A 1  397 ? -22.242 -29.845 87.061  1.00 32.76  ? 495  ILE A CA  1 
ATOM   3020  C  C   . ILE A 1  397 ? -21.951 -28.514 86.366  1.00 34.87  ? 495  ILE A C   1 
ATOM   3021  O  O   . ILE A 1  397 ? -22.052 -27.454 86.984  1.00 33.61  ? 495  ILE A O   1 
ATOM   3022  C  CB  . ILE A 1  397 ? -20.974 -30.364 87.788  1.00 31.51  ? 495  ILE A CB  1 
ATOM   3023  C  CG1 . ILE A 1  397 ? -20.685 -29.526 89.035  1.00 34.81  ? 495  ILE A CG1 1 
ATOM   3024  C  CG2 . ILE A 1  397 ? -19.766 -30.382 86.865  1.00 32.29  ? 495  ILE A CG2 1 
ATOM   3025  C  CD1 . ILE A 1  397 ? -19.596 -30.103 89.915  1.00 37.28  ? 495  ILE A CD1 1 
ATOM   3026  N  N   . LYS A 1  398 ? -21.608 -28.568 85.081  1.00 36.47  ? 496  LYS A N   1 
ATOM   3027  C  CA  . LYS A 1  398 ? -21.382 -27.357 84.300  1.00 35.93  ? 496  LYS A CA  1 
ATOM   3028  C  C   . LYS A 1  398 ? -22.691 -26.617 84.062  1.00 33.31  ? 496  LYS A C   1 
ATOM   3029  O  O   . LYS A 1  398 ? -22.756 -25.394 84.168  1.00 33.42  ? 496  LYS A O   1 
ATOM   3030  C  CB  . LYS A 1  398 ? -20.730 -27.687 82.955  1.00 41.37  ? 496  LYS A CB  1 
ATOM   3031  C  CG  . LYS A 1  398 ? -19.301 -28.191 83.034  1.00 42.72  ? 496  LYS A CG  1 
ATOM   3032  C  CD  . LYS A 1  398 ? -18.836 -28.672 81.666  1.00 48.57  ? 496  LYS A CD  1 
ATOM   3033  C  CE  . LYS A 1  398 ? -17.400 -29.165 81.697  1.00 54.17  ? 496  LYS A CE  1 
ATOM   3034  N  NZ  . LYS A 1  398 ? -16.984 -29.714 80.377  1.00 57.55  ? 496  LYS A NZ  1 
ATOM   3035  N  N   . GLU A 1  399 ? -23.734 -27.376 83.744  1.00 36.34  ? 497  GLU A N   1 
ATOM   3036  C  CA  . GLU A 1  399 ? -25.035 -26.803 83.429  1.00 39.61  ? 497  GLU A CA  1 
ATOM   3037  C  C   . GLU A 1  399 ? -25.695 -26.255 84.690  1.00 34.01  ? 497  GLU A C   1 
ATOM   3038  O  O   . GLU A 1  399 ? -26.387 -25.236 84.654  1.00 32.25  ? 497  GLU A O   1 
ATOM   3039  C  CB  . GLU A 1  399 ? -25.933 -27.853 82.773  1.00 43.14  ? 497  GLU A CB  1 
ATOM   3040  C  CG  . GLU A 1  399 ? -27.200 -27.294 82.148  1.00 48.37  ? 497  GLU A CG  1 
ATOM   3041  C  CD  . GLU A 1  399 ? -26.910 -26.378 80.973  1.00 53.18  ? 497  GLU A CD  1 
ATOM   3042  O  OE1 . GLU A 1  399 ? -25.973 -26.677 80.202  1.00 53.07  ? 497  GLU A OE1 1 
ATOM   3043  O  OE2 . GLU A 1  399 ? -27.620 -25.361 80.818  1.00 55.48  ? 497  GLU A OE2 1 
ATOM   3044  N  N   . CYS A 1  400 ? -25.472 -26.945 85.804  1.00 29.56  ? 498  CYS A N   1 
ATOM   3045  C  CA  . CYS A 1  400 ? -26.043 -26.561 87.090  1.00 25.12  ? 498  CYS A CA  1 
ATOM   3046  C  C   . CYS A 1  400 ? -25.451 -25.254 87.614  1.00 25.22  ? 498  CYS A C   1 
ATOM   3047  O  O   . CYS A 1  400 ? -26.126 -24.487 88.298  1.00 25.90  ? 498  CYS A O   1 
ATOM   3048  C  CB  . CYS A 1  400 ? -25.830 -27.683 88.113  1.00 22.38  ? 498  CYS A CB  1 
ATOM   3049  S  SG  . CYS A 1  400 ? -26.737 -27.493 89.664  1.00 52.57  ? 498  CYS A SG  1 
ATOM   3050  N  N   . HIS A 1  401 ? -24.187 -25.004 87.287  1.00 28.66  ? 499  HIS A N   1 
ATOM   3051  C  CA  . HIS A 1  401 ? -23.465 -23.859 87.835  1.00 25.71  ? 499  HIS A CA  1 
ATOM   3052  C  C   . HIS A 1  401 ? -23.537 -22.607 86.963  1.00 23.79  ? 499  HIS A C   1 
ATOM   3053  O  O   . HIS A 1  401 ? -23.120 -21.535 87.394  1.00 19.54  ? 499  HIS A O   1 
ATOM   3054  C  CB  . HIS A 1  401 ? -21.999 -24.228 88.070  1.00 23.91  ? 499  HIS A CB  1 
ATOM   3055  C  CG  . HIS A 1  401 ? -21.749 -24.892 89.388  1.00 18.48  ? 499  HIS A CG  1 
ATOM   3056  N  ND1 . HIS A 1  401 ? -21.509 -24.182 90.544  1.00 17.55  ? 499  HIS A ND1 1 
ATOM   3057  C  CD2 . HIS A 1  401 ? -21.713 -26.201 89.736  1.00 18.84  ? 499  HIS A CD2 1 
ATOM   3058  C  CE1 . HIS A 1  401 ? -21.330 -25.023 91.546  1.00 17.37  ? 499  HIS A CE1 1 
ATOM   3059  N  NE2 . HIS A 1  401 ? -21.450 -26.254 91.083  1.00 18.15  ? 499  HIS A NE2 1 
ATOM   3060  N  N   . LYS A 1  402 ? -24.063 -22.747 85.749  1.00 24.72  ? 500  LYS A N   1 
ATOM   3061  C  CA  . LYS A 1  402 ? -24.148 -21.636 84.799  1.00 28.37  ? 500  LYS A CA  1 
ATOM   3062  C  C   . LYS A 1  402 ? -24.785 -20.394 85.425  1.00 28.85  ? 500  LYS A C   1 
ATOM   3063  O  O   . LYS A 1  402 ? -25.726 -20.508 86.212  1.00 32.13  ? 500  LYS A O   1 
ATOM   3064  C  CB  . LYS A 1  402 ? -24.945 -22.063 83.564  1.00 35.63  ? 500  LYS A CB  1 
ATOM   3065  C  CG  . LYS A 1  402 ? -24.157 -22.924 82.588  1.00 43.32  ? 500  LYS A CG  1 
ATOM   3066  C  CD  . LYS A 1  402 ? -24.889 -23.091 81.266  1.00 46.56  ? 500  LYS A CD  1 
ATOM   3067  C  CE  . LYS A 1  402 ? -24.105 -23.986 80.317  1.00 46.41  ? 500  LYS A CE  1 
ATOM   3068  N  NZ  . LYS A 1  402 ? -22.664 -23.615 80.254  1.00 44.38  ? 500  LYS A NZ  1 
ATOM   3069  N  N   . PRO A 1  403 ? -24.284 -19.199 85.069  1.00 28.25  ? 501  PRO A N   1 
ATOM   3070  C  CA  . PRO A 1  403 ? -23.221 -18.947 84.090  1.00 26.67  ? 501  PRO A CA  1 
ATOM   3071  C  C   . PRO A 1  403 ? -21.803 -19.005 84.665  1.00 27.04  ? 501  PRO A C   1 
ATOM   3072  O  O   . PRO A 1  403 ? -20.885 -18.474 84.040  1.00 27.45  ? 501  PRO A O   1 
ATOM   3073  C  CB  . PRO A 1  403 ? -23.535 -17.531 83.612  1.00 25.17  ? 501  PRO A CB  1 
ATOM   3074  C  CG  . PRO A 1  403 ? -24.100 -16.872 84.822  1.00 23.21  ? 501  PRO A CG  1 
ATOM   3075  C  CD  . PRO A 1  403 ? -24.863 -17.941 85.575  1.00 25.37  ? 501  PRO A CD  1 
ATOM   3076  N  N   . LYS A 1  404 ? -21.624 -19.627 85.825  1.00 19.38  ? 502  LYS A N   1 
ATOM   3077  C  CA  . LYS A 1  404 ? -20.294 -19.756 86.411  1.00 19.06  ? 502  LYS A CA  1 
ATOM   3078  C  C   . LYS A 1  404 ? -19.434 -20.733 85.619  1.00 24.59  ? 502  LYS A C   1 
ATOM   3079  O  O   . LYS A 1  404 ? -19.804 -21.894 85.454  1.00 24.05  ? 502  LYS A O   1 
ATOM   3080  C  CB  . LYS A 1  404 ? -20.376 -20.218 87.867  1.00 18.12  ? 502  LYS A CB  1 
ATOM   3081  C  CG  . LYS A 1  404 ? -19.023 -20.563 88.469  1.00 20.63  ? 502  LYS A CG  1 
ATOM   3082  C  CD  . LYS A 1  404 ? -19.150 -21.497 89.663  1.00 20.47  ? 502  LYS A CD  1 
ATOM   3083  C  CE  . LYS A 1  404 ? -19.777 -20.807 90.860  1.00 18.24  ? 502  LYS A CE  1 
ATOM   3084  N  NZ  . LYS A 1  404 ? -20.012 -21.762 91.981  1.00 16.13  ? 502  LYS A NZ  1 
ATOM   3085  N  N   . PRO A 1  405 ? -18.275 -20.266 85.133  1.00 23.83  ? 503  PRO A N   1 
ATOM   3086  C  CA  . PRO A 1  405 ? -17.300 -21.153 84.495  1.00 21.25  ? 503  PRO A CA  1 
ATOM   3087  C  C   . PRO A 1  405 ? -16.451 -21.855 85.550  1.00 22.13  ? 503  PRO A C   1 
ATOM   3088  O  O   . PRO A 1  405 ? -15.782 -21.192 86.342  1.00 21.67  ? 503  PRO A O   1 
ATOM   3089  C  CB  . PRO A 1  405 ? -16.463 -20.201 83.643  1.00 21.85  ? 503  PRO A CB  1 
ATOM   3090  C  CG  . PRO A 1  405 ? -16.542 -18.895 84.356  1.00 20.97  ? 503  PRO A CG  1 
ATOM   3091  C  CD  . PRO A 1  405 ? -17.847 -18.857 85.111  1.00 20.16  ? 503  PRO A CD  1 
ATOM   3092  N  N   . ILE A 1  406 ? -16.481 -23.182 85.564  1.00 24.08  ? 504  ILE A N   1 
ATOM   3093  C  CA  . ILE A 1  406 ? -15.853 -23.937 86.640  1.00 23.70  ? 504  ILE A CA  1 
ATOM   3094  C  C   . ILE A 1  406 ? -14.332 -23.959 86.531  1.00 26.04  ? 504  ILE A C   1 
ATOM   3095  O  O   . ILE A 1  406 ? -13.773 -24.355 85.507  1.00 26.10  ? 504  ILE A O   1 
ATOM   3096  C  CB  . ILE A 1  406 ? -16.373 -25.386 86.677  1.00 25.96  ? 504  ILE A CB  1 
ATOM   3097  C  CG1 . ILE A 1  406 ? -17.847 -25.404 87.093  1.00 25.10  ? 504  ILE A CG1 1 
ATOM   3098  C  CG2 . ILE A 1  406 ? -15.536 -26.232 87.627  1.00 21.29  ? 504  ILE A CG2 1 
ATOM   3099  C  CD1 . ILE A 1  406 ? -18.441 -26.791 87.195  1.00 21.20  ? 504  ILE A CD1 1 
ATOM   3100  N  N   . LEU A 1  407 ? -13.674 -23.527 87.603  1.00 25.44  ? 505  LEU A N   1 
ATOM   3101  C  CA  . LEU A 1  407 ? -12.225 -23.606 87.713  1.00 23.98  ? 505  LEU A CA  1 
ATOM   3102  C  C   . LEU A 1  407 ? -11.847 -24.841 88.520  1.00 24.95  ? 505  LEU A C   1 
ATOM   3103  O  O   . LEU A 1  407 ? -10.968 -25.608 88.131  1.00 24.56  ? 505  LEU A O   1 
ATOM   3104  C  CB  . LEU A 1  407 ? -11.659 -22.347 88.372  1.00 22.53  ? 505  LEU A CB  1 
ATOM   3105  C  CG  . LEU A 1  407 ? -10.135 -22.249 88.486  1.00 25.87  ? 505  LEU A CG  1 
ATOM   3106  C  CD1 . LEU A 1  407 ? -9.489  -22.149 87.112  1.00 29.11  ? 505  LEU A CD1 1 
ATOM   3107  C  CD2 . LEU A 1  407 ? -9.732  -21.073 89.364  1.00 19.92  ? 505  LEU A CD2 1 
ATOM   3108  N  N   . LEU A 1  408 ? -12.525 -25.026 89.649  1.00 24.96  ? 506  LEU A N   1 
ATOM   3109  C  CA  . LEU A 1  408 ? -12.323 -26.199 90.489  1.00 28.33  ? 506  LEU A CA  1 
ATOM   3110  C  C   . LEU A 1  408 ? -13.660 -26.881 90.758  1.00 33.16  ? 506  LEU A C   1 
ATOM   3111  O  O   . LEU A 1  408 ? -14.525 -26.313 91.424  1.00 35.17  ? 506  LEU A O   1 
ATOM   3112  C  CB  . LEU A 1  408 ? -11.656 -25.812 91.812  1.00 28.81  ? 506  LEU A CB  1 
ATOM   3113  C  CG  . LEU A 1  408 ? -10.334 -25.040 91.758  1.00 32.54  ? 506  LEU A CG  1 
ATOM   3114  C  CD1 . LEU A 1  408 ? -9.918  -24.585 93.148  1.00 30.87  ? 506  LEU A CD1 1 
ATOM   3115  C  CD2 . LEU A 1  408 ? -9.241  -25.875 91.123  1.00 34.94  ? 506  LEU A CD2 1 
ATOM   3116  N  N   . HIS A 1  409 ? -13.830 -28.097 90.248  1.00 33.94  ? 507  HIS A N   1 
ATOM   3117  C  CA  . HIS A 1  409 ? -15.058 -28.844 90.489  1.00 38.97  ? 507  HIS A CA  1 
ATOM   3118  C  C   . HIS A 1  409 ? -14.865 -29.736 91.711  1.00 43.88  ? 507  HIS A C   1 
ATOM   3119  O  O   . HIS A 1  409 ? -14.835 -30.965 91.615  1.00 42.88  ? 507  HIS A O   1 
ATOM   3120  C  CB  . HIS A 1  409 ? -15.461 -29.669 89.262  1.00 42.78  ? 507  HIS A CB  1 
ATOM   3121  C  CG  . HIS A 1  409 ? -14.388 -30.587 88.762  1.00 45.95  ? 507  HIS A CG  1 
ATOM   3122  N  ND1 . HIS A 1  409 ? -13.185 -30.131 88.267  1.00 47.99  ? 507  HIS A ND1 1 
ATOM   3123  C  CD2 . HIS A 1  409 ? -14.342 -31.937 88.675  1.00 48.34  ? 507  HIS A CD2 1 
ATOM   3124  C  CE1 . HIS A 1  409 ? -12.442 -31.161 87.904  1.00 52.11  ? 507  HIS A CE1 1 
ATOM   3125  N  NE2 . HIS A 1  409 ? -13.122 -32.269 88.139  1.00 53.33  ? 507  HIS A NE2 1 
ATOM   3126  N  N   . THR A 1  410 ? -14.729 -29.089 92.863  1.00 51.07  ? 508  THR A N   1 
ATOM   3127  C  CA  . THR A 1  410 ? -14.415 -29.758 94.120  1.00 57.33  ? 508  THR A CA  1 
ATOM   3128  C  C   . THR A 1  410 ? -15.444 -30.821 94.506  1.00 59.57  ? 508  THR A C   1 
ATOM   3129  O  O   . THR A 1  410 ? -15.121 -31.773 95.215  1.00 60.26  ? 508  THR A O   1 
ATOM   3130  C  CB  . THR A 1  410 ? -14.296 -28.734 95.263  1.00 56.75  ? 508  THR A CB  1 
ATOM   3131  O  OG1 . THR A 1  410 ? -15.508 -27.975 95.358  1.00 56.05  ? 508  THR A OG1 1 
ATOM   3132  C  CG2 . THR A 1  410 ? -13.137 -27.789 94.998  1.00 54.83  ? 508  THR A CG2 1 
ATOM   3133  N  N   . GLY A 1  411 ? -16.678 -30.657 94.035  1.00 59.17  ? 509  GLY A N   1 
ATOM   3134  C  CA  . GLY A 1  411 ? -17.741 -31.602 94.327  1.00 58.70  ? 509  GLY A CA  1 
ATOM   3135  C  C   . GLY A 1  411 ? -17.505 -32.971 93.723  1.00 63.23  ? 509  GLY A C   1 
ATOM   3136  O  O   . GLY A 1  411 ? -18.102 -33.960 94.148  1.00 67.44  ? 509  GLY A O   1 
ATOM   3137  N  N   . GLU A 1  412 ? -16.631 -33.025 92.724  1.00 62.77  ? 510  GLU A N   1 
ATOM   3138  C  CA  . GLU A 1  412 ? -16.293 -34.282 92.075  1.00 62.68  ? 510  GLU A CA  1 
ATOM   3139  C  C   . GLU A 1  412 ? -14.806 -34.576 92.236  1.00 61.23  ? 510  GLU A C   1 
ATOM   3140  O  O   . GLU A 1  412 ? -14.202 -35.267 91.416  1.00 63.71  ? 510  GLU A O   1 
ATOM   3141  C  CB  . GLU A 1  412 ? -16.686 -34.249 90.598  1.00 63.60  ? 510  GLU A CB  1 
ATOM   3142  C  CG  . GLU A 1  412 ? -18.179 -34.065 90.378  1.00 63.23  ? 510  GLU A CG  1 
ATOM   3143  C  CD  . GLU A 1  412 ? -18.543 -33.910 88.917  1.00 66.73  ? 510  GLU A CD  1 
ATOM   3144  O  OE1 . GLU A 1  412 ? -17.621 -33.786 88.083  1.00 69.67  ? 510  GLU A OE1 1 
ATOM   3145  O  OE2 . GLU A 1  412 ? -19.752 -33.913 88.602  1.00 66.21  ? 510  GLU A OE2 1 
ATOM   3146  N  N   . LEU A 1  413 ? -14.226 -34.035 93.304  1.00 58.41  ? 511  LEU A N   1 
ATOM   3147  C  CA  . LEU A 1  413 ? -12.833 -34.293 93.650  1.00 58.34  ? 511  LEU A CA  1 
ATOM   3148  C  C   . LEU A 1  413 ? -12.752 -34.734 95.108  1.00 56.09  ? 511  LEU A C   1 
ATOM   3149  O  O   . LEU A 1  413 ? -13.010 -33.947 96.018  1.00 52.77  ? 511  LEU A O   1 
ATOM   3150  C  CB  . LEU A 1  413 ? -11.972 -33.049 93.418  1.00 58.48  ? 511  LEU A CB  1 
ATOM   3151  C  CG  . LEU A 1  413 ? -11.897 -32.515 91.986  1.00 57.01  ? 511  LEU A CG  1 
ATOM   3152  C  CD1 . LEU A 1  413 ? -11.207 -31.157 91.949  1.00 55.47  ? 511  LEU A CD1 1 
ATOM   3153  C  CD2 . LEU A 1  413 ? -11.189 -33.508 91.080  1.00 55.20  ? 511  LEU A CD2 1 
ATOM   3154  N  N   . SER A 1  414 ? -12.400 -35.996 95.323  1.00 59.14  ? 512  SER A N   1 
ATOM   3155  C  CA  . SER A 1  414 ? -12.481 -36.592 96.652  1.00 61.87  ? 512  SER A CA  1 
ATOM   3156  C  C   . SER A 1  414 ? -11.195 -37.299 97.071  1.00 65.39  ? 512  SER A C   1 
ATOM   3157  O  O   . SER A 1  414 ? -11.201 -38.099 98.008  1.00 67.39  ? 512  SER A O   1 
ATOM   3158  C  CB  . SER A 1  414 ? -13.651 -37.578 96.714  1.00 63.51  ? 512  SER A CB  1 
ATOM   3159  O  OG  . SER A 1  414 ? -13.551 -38.552 95.689  1.00 65.26  ? 512  SER A OG  1 
ATOM   3160  N  N   . LYS A 1  415 ? -10.096 -37.010 96.381  1.00 65.51  ? 513  LYS A N   1 
ATOM   3161  C  CA  . LYS A 1  415 ? -8.827  -37.653 96.695  1.00 69.03  ? 513  LYS A CA  1 
ATOM   3162  C  C   . LYS A 1  415 ? -7.816  -36.634 97.204  1.00 69.55  ? 513  LYS A C   1 
ATOM   3163  O  O   . LYS A 1  415 ? -7.600  -35.609 96.562  1.00 72.63  ? 513  LYS A O   1 
ATOM   3164  C  CB  . LYS A 1  415 ? -8.274  -38.367 95.459  1.00 73.93  ? 513  LYS A CB  1 
ATOM   3165  C  CG  . LYS A 1  415 ? -9.160  -39.497 94.964  1.00 77.72  ? 513  LYS A CG  1 
ATOM   3166  C  CD  . LYS A 1  415 ? -8.956  -40.773 95.759  1.00 79.03  ? 513  LYS A CD  1 
ATOM   3167  C  CE  . LYS A 1  415 ? -10.003 -41.811 95.391  1.00 78.96  ? 513  LYS A CE  1 
ATOM   3168  N  NZ  . LYS A 1  415 ? -9.810  -43.083 96.140  1.00 81.21  ? 513  LYS A NZ  1 
ATOM   3169  N  N   . PRO A 1  416 ? -7.181  -36.913 98.356  1.00 67.32  ? 514  PRO A N   1 
ATOM   3170  C  CA  . PRO A 1  416 ? -7.373  -38.088 99.216  1.00 68.21  ? 514  PRO A CA  1 
ATOM   3171  C  C   . PRO A 1  416 ? -8.689  -38.045 99.992  1.00 68.95  ? 514  PRO A C   1 
ATOM   3172  O  O   . PRO A 1  416 ? -9.268  -39.092 100.284 1.00 72.29  ? 514  PRO A O   1 
ATOM   3173  C  CB  . PRO A 1  416 ? -6.179  -38.020 100.170 1.00 67.95  ? 514  PRO A CB  1 
ATOM   3174  C  CG  . PRO A 1  416 ? -5.853  -36.574 100.248 1.00 66.20  ? 514  PRO A CG  1 
ATOM   3175  C  CD  . PRO A 1  416 ? -6.141  -36.011 98.885  1.00 65.43  ? 514  PRO A CD  1 
ATOM   3176  N  N   . HIS A 1  417 ? -9.145  -36.840 100.317 1.00 65.58  ? 515  HIS A N   1 
ATOM   3177  C  CA  . HIS A 1  417 ? -10.434 -36.643 100.968 1.00 63.73  ? 515  HIS A CA  1 
ATOM   3178  C  C   . HIS A 1  417 ? -11.249 -35.648 100.148 1.00 58.62  ? 515  HIS A C   1 
ATOM   3179  O  O   . HIS A 1  417 ? -10.682 -34.936 99.318  1.00 52.91  ? 515  HIS A O   1 
ATOM   3180  C  CB  . HIS A 1  417 ? -10.248 -36.136 102.402 1.00 66.30  ? 515  HIS A CB  1 
ATOM   3181  C  CG  . HIS A 1  417 ? -9.517  -37.091 103.293 1.00 69.14  ? 515  HIS A CG  1 
ATOM   3182  N  ND1 . HIS A 1  417 ? -10.112 -38.212 103.829 1.00 70.61  ? 515  HIS A ND1 1 
ATOM   3183  C  CD2 . HIS A 1  417 ? -8.243  -37.084 103.752 1.00 71.46  ? 515  HIS A CD2 1 
ATOM   3184  C  CE1 . HIS A 1  417 ? -9.233  -38.860 104.573 1.00 73.05  ? 515  HIS A CE1 1 
ATOM   3185  N  NE2 . HIS A 1  417 ? -8.092  -38.196 104.544 1.00 74.27  ? 515  HIS A NE2 1 
ATOM   3186  N  N   . PRO A 1  418 ? -12.581 -35.619 100.351 1.00 60.04  ? 516  PRO A N   1 
ATOM   3187  C  CA  . PRO A 1  418 ? -13.434 -34.612 99.707  1.00 57.77  ? 516  PRO A CA  1 
ATOM   3188  C  C   . PRO A 1  418 ? -12.869 -33.198 99.830  1.00 57.79  ? 516  PRO A C   1 
ATOM   3189  O  O   . PRO A 1  418 ? -12.473 -32.780 100.918 1.00 56.82  ? 516  PRO A O   1 
ATOM   3190  C  CB  . PRO A 1  418 ? -14.752 -34.742 100.469 1.00 53.70  ? 516  PRO A CB  1 
ATOM   3191  C  CG  . PRO A 1  418 ? -14.807 -36.179 100.849 1.00 55.99  ? 516  PRO A CG  1 
ATOM   3192  C  CD  . PRO A 1  418 ? -13.380 -36.636 101.059 1.00 59.12  ? 516  PRO A CD  1 
ATOM   3193  N  N   . TRP A 1  419 ? -12.828 -32.479 98.713  1.00 57.04  ? 517  TRP A N   1 
ATOM   3194  C  CA  . TRP A 1  419 ? -12.212 -31.160 98.669  1.00 54.33  ? 517  TRP A CA  1 
ATOM   3195  C  C   . TRP A 1  419 ? -13.107 -30.108 99.325  1.00 51.87  ? 517  TRP A C   1 
ATOM   3196  O  O   . TRP A 1  419 ? -12.628 -29.244 100.058 1.00 52.73  ? 517  TRP A O   1 
ATOM   3197  C  CB  . TRP A 1  419 ? -11.886 -30.774 97.225  1.00 54.84  ? 517  TRP A CB  1 
ATOM   3198  C  CG  . TRP A 1  419 ? -10.670 -31.478 96.684  1.00 56.93  ? 517  TRP A CG  1 
ATOM   3199  C  CD1 . TRP A 1  419 ? -10.329 -32.787 96.871  1.00 57.49  ? 517  TRP A CD1 1 
ATOM   3200  C  CD2 . TRP A 1  419 ? -9.623  -30.903 95.890  1.00 57.89  ? 517  TRP A CD2 1 
ATOM   3201  N  NE1 . TRP A 1  419 ? -9.145  -33.066 96.234  1.00 58.71  ? 517  TRP A NE1 1 
ATOM   3202  C  CE2 . TRP A 1  419 ? -8.690  -31.926 95.626  1.00 58.55  ? 517  TRP A CE2 1 
ATOM   3203  C  CE3 . TRP A 1  419 ? -9.387  -29.625 95.373  1.00 55.58  ? 517  TRP A CE3 1 
ATOM   3204  C  CZ2 . TRP A 1  419 ? -7.539  -31.710 94.868  1.00 56.31  ? 517  TRP A CZ2 1 
ATOM   3205  C  CZ3 . TRP A 1  419 ? -8.244  -29.413 94.621  1.00 53.76  ? 517  TRP A CZ3 1 
ATOM   3206  C  CH2 . TRP A 1  419 ? -7.335  -30.450 94.376  1.00 54.14  ? 517  TRP A CH2 1 
ATOM   3207  N  N   . HIS A 1  420 ? -14.407 -30.188 99.060  1.00 50.00  ? 518  HIS A N   1 
ATOM   3208  C  CA  . HIS A 1  420 ? -15.383 -29.306 99.695  1.00 47.15  ? 518  HIS A CA  1 
ATOM   3209  C  C   . HIS A 1  420 ? -16.451 -30.120 100.423 1.00 44.28  ? 518  HIS A C   1 
ATOM   3210  O  O   . HIS A 1  420 ? -16.682 -31.280 100.086 1.00 47.56  ? 518  HIS A O   1 
ATOM   3211  C  CB  . HIS A 1  420 ? -16.026 -28.382 98.657  1.00 49.71  ? 518  HIS A CB  1 
ATOM   3212  C  CG  . HIS A 1  420 ? -15.338 -27.059 98.519  1.00 55.50  ? 518  HIS A CG  1 
ATOM   3213  N  ND1 . HIS A 1  420 ? -15.545 -26.219 97.447  1.00 55.62  ? 518  HIS A ND1 1 
ATOM   3214  C  CD2 . HIS A 1  420 ? -14.456 -26.425 99.328  1.00 58.82  ? 518  HIS A CD2 1 
ATOM   3215  C  CE1 . HIS A 1  420 ? -14.817 -25.127 97.598  1.00 57.72  ? 518  HIS A CE1 1 
ATOM   3216  N  NE2 . HIS A 1  420 ? -14.146 -25.227 98.731  1.00 59.14  ? 518  HIS A NE2 1 
ATOM   3217  N  N   . PRO A 1  421 ? -17.087 -29.527 101.446 1.00 38.40  ? 519  PRO A N   1 
ATOM   3218  C  CA  . PRO A 1  421 ? -18.139 -30.249 102.173 1.00 37.39  ? 519  PRO A CA  1 
ATOM   3219  C  C   . PRO A 1  421 ? -19.435 -30.385 101.376 1.00 36.97  ? 519  PRO A C   1 
ATOM   3220  O  O   . PRO A 1  421 ? -19.771 -29.513 100.572 1.00 31.40  ? 519  PRO A O   1 
ATOM   3221  C  CB  . PRO A 1  421 ? -18.362 -29.388 103.421 1.00 31.31  ? 519  PRO A CB  1 
ATOM   3222  C  CG  . PRO A 1  421 ? -17.907 -28.033 103.033 1.00 33.05  ? 519  PRO A CG  1 
ATOM   3223  C  CD  . PRO A 1  421 ? -16.790 -28.218 102.052 1.00 35.11  ? 519  PRO A CD  1 
ATOM   3224  N  N   . ASP A 1  422 ? -20.146 -31.485 101.599 1.00 37.03  ? 520  ASP A N   1 
ATOM   3225  C  CA  . ASP A 1  422 ? -21.483 -31.663 101.051 1.00 35.79  ? 520  ASP A CA  1 
ATOM   3226  C  C   . ASP A 1  422 ? -22.513 -31.464 102.155 1.00 29.39  ? 520  ASP A C   1 
ATOM   3227  O  O   . ASP A 1  422 ? -23.591 -30.917 101.924 1.00 26.40  ? 520  ASP A O   1 
ATOM   3228  C  CB  . ASP A 1  422 ? -21.643 -33.048 100.420 1.00 42.04  ? 520  ASP A CB  1 
ATOM   3229  C  CG  . ASP A 1  422 ? -20.802 -33.225 99.171  1.00 44.53  ? 520  ASP A CG  1 
ATOM   3230  O  OD1 . ASP A 1  422 ? -20.311 -32.209 98.636  1.00 45.73  ? 520  ASP A OD1 1 
ATOM   3231  O  OD2 . ASP A 1  422 ? -20.645 -34.380 98.720  1.00 45.45  ? 520  ASP A OD2 1 
ATOM   3232  N  N   . ILE A 1  423 ? -22.165 -31.915 103.357 1.00 27.65  ? 521  ILE A N   1 
ATOM   3233  C  CA  . ILE A 1  423 ? -23.047 -31.806 104.514 1.00 26.82  ? 521  ILE A CA  1 
ATOM   3234  C  C   . ILE A 1  423 ? -22.798 -30.499 105.258 1.00 23.77  ? 521  ILE A C   1 
ATOM   3235  O  O   . ILE A 1  423 ? -21.693 -30.244 105.736 1.00 23.88  ? 521  ILE A O   1 
ATOM   3236  C  CB  . ILE A 1  423 ? -22.863 -32.983 105.491 1.00 28.44  ? 521  ILE A CB  1 
ATOM   3237  C  CG1 . ILE A 1  423 ? -22.942 -34.323 104.751 1.00 30.57  ? 521  ILE A CG1 1 
ATOM   3238  C  CG2 . ILE A 1  423 ? -23.895 -32.911 106.607 1.00 21.72  ? 521  ILE A CG2 1 
ATOM   3239  C  CD1 . ILE A 1  423 ? -24.149 -34.465 103.853 1.00 31.06  ? 521  ILE A CD1 1 
ATOM   3240  N  N   . VAL A 1  424 ? -23.837 -29.676 105.354 1.00 23.27  ? 522  VAL A N   1 
ATOM   3241  C  CA  . VAL A 1  424 ? -23.722 -28.350 105.947 1.00 23.09  ? 522  VAL A CA  1 
ATOM   3242  C  C   . VAL A 1  424 ? -24.698 -28.171 107.109 1.00 20.51  ? 522  VAL A C   1 
ATOM   3243  O  O   . VAL A 1  424 ? -25.820 -28.673 107.069 1.00 25.74  ? 522  VAL A O   1 
ATOM   3244  C  CB  . VAL A 1  424 ? -23.969 -27.251 104.886 1.00 25.20  ? 522  VAL A CB  1 
ATOM   3245  C  CG1 . VAL A 1  424 ? -23.773 -25.872 105.476 1.00 24.93  ? 522  VAL A CG1 1 
ATOM   3246  C  CG2 . VAL A 1  424 ? -23.047 -27.450 103.693 1.00 26.04  ? 522  VAL A CG2 1 
ATOM   3247  N  N   . ASP A 1  425 ? -24.254 -27.474 108.151 1.00 17.73  ? 523  ASP A N   1 
ATOM   3248  C  CA  . ASP A 1  425 ? -25.112 -27.156 109.287 1.00 18.76  ? 523  ASP A CA  1 
ATOM   3249  C  C   . ASP A 1  425 ? -25.993 -25.943 109.008 1.00 18.74  ? 523  ASP A C   1 
ATOM   3250  O  O   . ASP A 1  425 ? -25.514 -24.914 108.532 1.00 18.48  ? 523  ASP A O   1 
ATOM   3251  C  CB  . ASP A 1  425 ? -24.278 -26.889 110.542 1.00 26.28  ? 523  ASP A CB  1 
ATOM   3252  C  CG  . ASP A 1  425 ? -23.475 -28.092 110.979 1.00 33.84  ? 523  ASP A CG  1 
ATOM   3253  O  OD1 . ASP A 1  425 ? -24.028 -28.949 111.701 1.00 32.81  ? 523  ASP A OD1 1 
ATOM   3254  O  OD2 . ASP A 1  425 ? -22.285 -28.177 110.605 1.00 40.09  ? 523  ASP A OD2 1 
ATOM   3255  N  N   . VAL A 1  426 ? -27.282 -26.071 109.301 1.00 19.89  ? 524  VAL A N   1 
ATOM   3256  C  CA  . VAL A 1  426 ? -28.158 -24.910 109.382 1.00 23.46  ? 524  VAL A CA  1 
ATOM   3257  C  C   . VAL A 1  426 ? -28.808 -24.900 110.761 1.00 14.42  ? 524  VAL A C   1 
ATOM   3258  O  O   . VAL A 1  426 ? -29.270 -25.932 111.246 1.00 15.02  ? 524  VAL A O   1 
ATOM   3259  C  CB  . VAL A 1  426 ? -29.235 -24.895 108.263 1.00 18.04  ? 524  VAL A CB  1 
ATOM   3260  C  CG1 . VAL A 1  426 ? -28.586 -24.709 106.898 1.00 16.38  ? 524  VAL A CG1 1 
ATOM   3261  C  CG2 . VAL A 1  426 ? -30.091 -26.154 108.297 1.00 18.00  ? 524  VAL A CG2 1 
ATOM   3262  N  N   . GLN A 1  427 ? -28.811 -23.742 111.413 1.00 14.11  ? 525  GLN A N   1 
ATOM   3263  C  CA  . GLN A 1  427 ? -29.362 -23.667 112.757 1.00 19.04  ? 525  GLN A CA  1 
ATOM   3264  C  C   . GLN A 1  427 ? -29.773 -22.256 113.157 1.00 19.77  ? 525  GLN A C   1 
ATOM   3265  O  O   . GLN A 1  427 ? -29.199 -21.266 112.701 1.00 13.67  ? 525  GLN A O   1 
ATOM   3266  C  CB  . GLN A 1  427 ? -28.362 -24.232 113.775 1.00 17.69  ? 525  GLN A CB  1 
ATOM   3267  C  CG  . GLN A 1  427 ? -27.681 -23.202 114.657 1.00 14.96  ? 525  GLN A CG  1 
ATOM   3268  C  CD  . GLN A 1  427 ? -26.607 -23.815 115.534 1.00 16.22  ? 525  GLN A CD  1 
ATOM   3269  O  OE1 . GLN A 1  427 ? -25.427 -23.804 115.189 1.00 18.78  ? 525  GLN A OE1 1 
ATOM   3270  N  NE2 . GLN A 1  427 ? -27.014 -24.353 116.678 1.00 16.34  ? 525  GLN A NE2 1 
ATOM   3271  N  N   . ILE A 1  428 ? -30.795 -22.185 114.005 1.00 14.51  ? 526  ILE A N   1 
ATOM   3272  C  CA  . ILE A 1  428 ? -31.249 -20.926 114.572 1.00 14.39  ? 526  ILE A CA  1 
ATOM   3273  C  C   . ILE A 1  428 ? -31.319 -21.051 116.088 1.00 17.14  ? 526  ILE A C   1 
ATOM   3274  O  O   . ILE A 1  428 ? -31.784 -22.060 116.614 1.00 15.64  ? 526  ILE A O   1 
ATOM   3275  C  CB  . ILE A 1  428 ? -32.632 -20.515 114.028 1.00 16.23  ? 526  ILE A CB  1 
ATOM   3276  C  CG1 . ILE A 1  428 ? -32.599 -20.380 112.504 1.00 16.43  ? 526  ILE A CG1 1 
ATOM   3277  C  CG2 . ILE A 1  428 ? -33.100 -19.213 114.668 1.00 14.30  ? 526  ILE A CG2 1 
ATOM   3278  C  CD1 . ILE A 1  428 ? -33.948 -20.058 111.897 1.00 13.92  ? 526  ILE A CD1 1 
ATOM   3279  N  N   . ILE A 1  429 ? -30.845 -20.025 116.785 1.00 25.21  ? 527  ILE A N   1 
ATOM   3280  C  CA  . ILE A 1  429 ? -30.998 -19.942 118.230 1.00 30.28  ? 527  ILE A CA  1 
ATOM   3281  C  C   . ILE A 1  429 ? -31.752 -18.665 118.569 1.00 28.01  ? 527  ILE A C   1 
ATOM   3282  O  O   . ILE A 1  429 ? -31.397 -17.585 118.101 1.00 27.32  ? 527  ILE A O   1 
ATOM   3283  C  CB  . ILE A 1  429 ? -29.635 -19.966 118.953 1.00 33.98  ? 527  ILE A CB  1 
ATOM   3284  C  CG1 . ILE A 1  429 ? -29.076 -21.389 118.982 1.00 38.26  ? 527  ILE A CG1 1 
ATOM   3285  C  CG2 . ILE A 1  429 ? -29.761 -19.423 120.367 1.00 32.69  ? 527  ILE A CG2 1 
ATOM   3286  C  CD1 . ILE A 1  429 ? -27.758 -21.513 119.712 1.00 41.99  ? 527  ILE A CD1 1 
ATOM   3287  N  N   . THR A 1  430 ? -32.804 -18.787 119.369 1.00 27.26  ? 528  THR A N   1 
ATOM   3288  C  CA  . THR A 1  430 ? -33.593 -17.620 119.737 1.00 22.50  ? 528  THR A CA  1 
ATOM   3289  C  C   . THR A 1  430 ? -33.461 -17.277 121.216 1.00 21.80  ? 528  THR A C   1 
ATOM   3290  O  O   . THR A 1  430 ? -33.653 -18.130 122.083 1.00 19.55  ? 528  THR A O   1 
ATOM   3291  C  CB  . THR A 1  430 ? -35.085 -17.819 119.409 1.00 20.70  ? 528  THR A CB  1 
ATOM   3292  O  OG1 . THR A 1  430 ? -35.609 -18.909 120.178 1.00 26.13  ? 528  THR A OG1 1 
ATOM   3293  C  CG2 . THR A 1  430 ? -35.278 -18.105 117.926 1.00 20.17  ? 528  THR A CG2 1 
ATOM   3294  N  N   . LEU A 1  431 ? -33.116 -16.024 121.492 1.00 25.83  ? 529  LEU A N   1 
ATOM   3295  C  CA  . LEU A 1  431 ? -33.188 -15.489 122.844 1.00 32.45  ? 529  LEU A CA  1 
ATOM   3296  C  C   . LEU A 1  431 ? -34.346 -14.507 122.894 1.00 34.73  ? 529  LEU A C   1 
ATOM   3297  O  O   . LEU A 1  431 ? -34.173 -13.322 122.616 1.00 38.39  ? 529  LEU A O   1 
ATOM   3298  C  CB  . LEU A 1  431 ? -31.885 -14.798 123.264 1.00 38.98  ? 529  LEU A CB  1 
ATOM   3299  C  CG  . LEU A 1  431 ? -30.520 -15.451 123.016 1.00 49.18  ? 529  LEU A CG  1 
ATOM   3300  C  CD1 . LEU A 1  431 ? -30.544 -16.934 123.369 1.00 52.60  ? 529  LEU A CD1 1 
ATOM   3301  C  CD2 . LEU A 1  431 ? -30.029 -15.230 121.591 1.00 52.77  ? 529  LEU A CD2 1 
ATOM   3302  N  N   . GLY A 1  432 ? -35.527 -15.007 123.240 1.00 30.43  ? 530  GLY A N   1 
ATOM   3303  C  CA  . GLY A 1  432 ? -36.720 -14.185 123.264 1.00 23.38  ? 530  GLY A CA  1 
ATOM   3304  C  C   . GLY A 1  432 ? -37.070 -13.666 121.882 1.00 21.46  ? 530  GLY A C   1 
ATOM   3305  O  O   . GLY A 1  432 ? -37.368 -14.441 120.975 1.00 23.42  ? 530  GLY A O   1 
ATOM   3306  N  N   . SER A 1  433 ? -37.014 -12.350 121.718 1.00 25.84  ? 531  SER A N   1 
ATOM   3307  C  CA  . SER A 1  433 ? -37.364 -11.719 120.451 1.00 28.00  ? 531  SER A CA  1 
ATOM   3308  C  C   . SER A 1  433 ? -36.166 -11.617 119.510 1.00 26.94  ? 531  SER A C   1 
ATOM   3309  O  O   . SER A 1  433 ? -36.278 -11.078 118.408 1.00 26.24  ? 531  SER A O   1 
ATOM   3310  C  CB  . SER A 1  433 ? -37.953 -10.328 120.695 1.00 32.59  ? 531  SER A CB  1 
ATOM   3311  O  OG  . SER A 1  433 ? -37.169 -9.599  121.626 1.00 36.34  ? 531  SER A OG  1 
ATOM   3312  N  N   . LEU A 1  434 ? -35.022 -12.133 119.948 1.00 22.07  ? 532  LEU A N   1 
ATOM   3313  C  CA  . LEU A 1  434 ? -33.815 -12.112 119.128 1.00 19.70  ? 532  LEU A CA  1 
ATOM   3314  C  C   . LEU A 1  434 ? -33.543 -13.482 118.519 1.00 19.48  ? 532  LEU A C   1 
ATOM   3315  O  O   . LEU A 1  434 ? -33.418 -14.474 119.234 1.00 17.45  ? 532  LEU A O   1 
ATOM   3316  C  CB  . LEU A 1  434 ? -32.608 -11.664 119.953 1.00 20.71  ? 532  LEU A CB  1 
ATOM   3317  C  CG  . LEU A 1  434 ? -31.254 -11.815 119.252 1.00 22.61  ? 532  LEU A CG  1 
ATOM   3318  C  CD1 . LEU A 1  434 ? -31.149 -10.870 118.061 1.00 21.56  ? 532  LEU A CD1 1 
ATOM   3319  C  CD2 . LEU A 1  434 ? -30.103 -11.594 120.223 1.00 19.66  ? 532  LEU A CD2 1 
ATOM   3320  N  N   . ALA A 1  435 ? -33.442 -13.530 117.196 1.00 19.73  ? 533  ALA A N   1 
ATOM   3321  C  CA  . ALA A 1  435 ? -33.137 -14.774 116.503 1.00 18.15  ? 533  ALA A CA  1 
ATOM   3322  C  C   . ALA A 1  435 ? -31.761 -14.706 115.855 1.00 22.56  ? 533  ALA A C   1 
ATOM   3323  O  O   . ALA A 1  435 ? -31.436 -13.741 115.163 1.00 30.76  ? 533  ALA A O   1 
ATOM   3324  C  CB  . ALA A 1  435 ? -34.201 -15.078 115.461 1.00 17.20  ? 533  ALA A CB  1 
ATOM   3325  N  N   . ILE A 1  436 ? -30.954 -15.734 116.087 1.00 19.88  ? 534  ILE A N   1 
ATOM   3326  C  CA  . ILE A 1  436 ? -29.612 -15.788 115.527 1.00 18.03  ? 534  ILE A CA  1 
ATOM   3327  C  C   . ILE A 1  436 ? -29.505 -16.918 114.514 1.00 21.66  ? 534  ILE A C   1 
ATOM   3328  O  O   . ILE A 1  436 ? -29.615 -18.090 114.871 1.00 23.66  ? 534  ILE A O   1 
ATOM   3329  C  CB  . ILE A 1  436 ? -28.545 -15.994 116.619 1.00 18.13  ? 534  ILE A CB  1 
ATOM   3330  C  CG1 . ILE A 1  436 ? -28.563 -14.841 117.622 1.00 15.10  ? 534  ILE A CG1 1 
ATOM   3331  C  CG2 . ILE A 1  436 ? -27.165 -16.151 115.992 1.00 16.83  ? 534  ILE A CG2 1 
ATOM   3332  C  CD1 . ILE A 1  436 ? -27.691 -15.086 118.830 1.00 15.05  ? 534  ILE A CD1 1 
ATOM   3333  N  N   . THR A 1  437 ? -29.307 -16.565 113.249 1.00 12.92  ? 535  THR A N   1 
ATOM   3334  C  CA  . THR A 1  437 ? -29.134 -17.568 112.208 1.00 15.22  ? 535  THR A CA  1 
ATOM   3335  C  C   . THR A 1  437 ? -27.650 -17.859 111.992 1.00 17.10  ? 535  THR A C   1 
ATOM   3336  O  O   . THR A 1  437 ? -26.886 -16.980 111.591 1.00 16.06  ? 535  THR A O   1 
ATOM   3337  C  CB  . THR A 1  437 ? -29.772 -17.125 110.883 1.00 14.21  ? 535  THR A CB  1 
ATOM   3338  O  OG1 . THR A 1  437 ? -29.171 -15.901 110.446 1.00 12.59  ? 535  THR A OG1 1 
ATOM   3339  C  CG2 . THR A 1  437 ? -31.269 -16.917 111.057 1.00 19.03  ? 535  THR A CG2 1 
ATOM   3340  N  N   . ALA A 1  438 ? -27.248 -19.095 112.271 1.00 16.21  ? 536  ALA A N   1 
ATOM   3341  C  CA  . ALA A 1  438 ? -25.864 -19.513 112.091 1.00 12.94  ? 536  ALA A CA  1 
ATOM   3342  C  C   . ALA A 1  438 ? -25.574 -19.785 110.619 1.00 26.45  ? 536  ALA A C   1 
ATOM   3343  O  O   . ALA A 1  438 ? -25.910 -20.848 110.095 1.00 22.13  ? 536  ALA A O   1 
ATOM   3344  C  CB  . ALA A 1  438 ? -25.567 -20.746 112.929 1.00 13.53  ? 536  ALA A CB  1 
ATOM   3345  N  N   . ILE A 1  439 ? -24.950 -18.815 109.958 1.00 23.91  ? 537  ILE A N   1 
ATOM   3346  C  CA  . ILE A 1  439 ? -24.626 -18.939 108.541 1.00 20.53  ? 537  ILE A CA  1 
ATOM   3347  C  C   . ILE A 1  439 ? -23.256 -19.592 108.367 1.00 18.83  ? 537  ILE A C   1 
ATOM   3348  O  O   . ILE A 1  439 ? -22.277 -19.175 108.987 1.00 17.12  ? 537  ILE A O   1 
ATOM   3349  C  CB  . ILE A 1  439 ? -24.658 -17.565 107.829 1.00 19.04  ? 537  ILE A CB  1 
ATOM   3350  C  CG1 . ILE A 1  439 ? -26.038 -17.310 107.217 1.00 16.85  ? 537  ILE A CG1 1 
ATOM   3351  C  CG2 . ILE A 1  439 ? -23.600 -17.488 106.739 1.00 18.91  ? 537  ILE A CG2 1 
ATOM   3352  C  CD1 . ILE A 1  439 ? -27.179 -17.311 108.212 1.00 17.11  ? 537  ILE A CD1 1 
ATOM   3353  N  N   . PRO A 1  440 ? -23.195 -20.640 107.533 1.00 19.59  ? 538  PRO A N   1 
ATOM   3354  C  CA  . PRO A 1  440 ? -21.987 -21.437 107.303 1.00 18.45  ? 538  PRO A CA  1 
ATOM   3355  C  C   . PRO A 1  440 ? -21.080 -20.850 106.230 1.00 16.55  ? 538  PRO A C   1 
ATOM   3356  O  O   . PRO A 1  440 ? -20.594 -21.583 105.369 1.00 17.94  ? 538  PRO A O   1 
ATOM   3357  C  CB  . PRO A 1  440 ? -22.552 -22.776 106.842 1.00 20.16  ? 538  PRO A CB  1 
ATOM   3358  C  CG  . PRO A 1  440 ? -23.786 -22.382 106.087 1.00 18.53  ? 538  PRO A CG  1 
ATOM   3359  C  CD  . PRO A 1  440 ? -24.359 -21.195 106.818 1.00 18.49  ? 538  PRO A CD  1 
ATOM   3360  N  N   . GLY A 1  441 ? -20.850 -19.545 106.281 1.00 16.47  ? 539  GLY A N   1 
ATOM   3361  C  CA  . GLY A 1  441 ? -20.054 -18.891 105.263 1.00 13.82  ? 539  GLY A CA  1 
ATOM   3362  C  C   . GLY A 1  441 ? -20.203 -17.386 105.275 1.00 14.08  ? 539  GLY A C   1 
ATOM   3363  O  O   . GLY A 1  441 ? -20.403 -16.776 106.324 1.00 13.37  ? 539  GLY A O   1 
ATOM   3364  N  N   . GLU A 1  442 ? -20.096 -16.785 104.096 1.00 15.17  ? 540  GLU A N   1 
ATOM   3365  C  CA  . GLU A 1  442 ? -20.098 -15.335 103.974 1.00 15.44  ? 540  GLU A CA  1 
ATOM   3366  C  C   . GLU A 1  442 ? -21.249 -14.841 103.102 1.00 14.44  ? 540  GLU A C   1 
ATOM   3367  O  O   . GLU A 1  442 ? -21.155 -14.836 101.874 1.00 15.66  ? 540  GLU A O   1 
ATOM   3368  C  CB  . GLU A 1  442 ? -18.761 -14.855 103.408 1.00 21.81  ? 540  GLU A CB  1 
ATOM   3369  C  CG  . GLU A 1  442 ? -17.553 -15.465 104.102 1.00 23.97  ? 540  GLU A CG  1 
ATOM   3370  C  CD  . GLU A 1  442 ? -16.253 -14.797 103.711 1.00 25.80  ? 540  GLU A CD  1 
ATOM   3371  O  OE1 . GLU A 1  442 ? -16.230 -13.551 103.620 1.00 24.06  ? 540  GLU A OE1 1 
ATOM   3372  O  OE2 . GLU A 1  442 ? -15.255 -15.517 103.495 1.00 25.53  ? 540  GLU A OE2 1 
ATOM   3373  N  N   . PHE A 1  443 ? -22.336 -14.433 103.746 1.00 11.38  ? 541  PHE A N   1 
ATOM   3374  C  CA  . PHE A 1  443 ? -23.469 -13.842 103.047 1.00 11.39  ? 541  PHE A CA  1 
ATOM   3375  C  C   . PHE A 1  443 ? -23.132 -12.427 102.590 1.00 15.06  ? 541  PHE A C   1 
ATOM   3376  O  O   . PHE A 1  443 ? -22.555 -11.648 103.347 1.00 16.79  ? 541  PHE A O   1 
ATOM   3377  C  CB  . PHE A 1  443 ? -24.707 -13.820 103.946 1.00 11.33  ? 541  PHE A CB  1 
ATOM   3378  C  CG  . PHE A 1  443 ? -25.576 -15.038 103.818 1.00 13.65  ? 541  PHE A CG  1 
ATOM   3379  C  CD1 . PHE A 1  443 ? -25.021 -16.305 103.813 1.00 14.02  ? 541  PHE A CD1 1 
ATOM   3380  C  CD2 . PHE A 1  443 ? -26.953 -14.914 103.723 1.00 11.46  ? 541  PHE A CD2 1 
ATOM   3381  C  CE1 . PHE A 1  443 ? -25.820 -17.428 103.703 1.00 16.14  ? 541  PHE A CE1 1 
ATOM   3382  C  CE2 . PHE A 1  443 ? -27.758 -16.033 103.614 1.00 13.21  ? 541  PHE A CE2 1 
ATOM   3383  C  CZ  . PHE A 1  443 ? -27.191 -17.292 103.604 1.00 14.99  ? 541  PHE A CZ  1 
ATOM   3384  N  N   . THR A 1  444 ? -23.479 -12.095 101.351 1.00 11.67  ? 542  THR A N   1 
ATOM   3385  C  CA  . THR A 1  444 ? -23.347 -10.720 100.887 1.00 17.74  ? 542  THR A CA  1 
ATOM   3386  C  C   . THR A 1  444 ? -24.400 -9.849  101.562 1.00 19.81  ? 542  THR A C   1 
ATOM   3387  O  O   . THR A 1  444 ? -25.252 -10.348 102.300 1.00 22.72  ? 542  THR A O   1 
ATOM   3388  C  CB  . THR A 1  444 ? -23.482 -10.607 99.357  1.00 20.18  ? 542  THR A CB  1 
ATOM   3389  O  OG1 . THR A 1  444 ? -24.761 -11.104 98.944  1.00 21.51  ? 542  THR A OG1 1 
ATOM   3390  C  CG2 . THR A 1  444 ? -22.381 -11.395 98.668  1.00 18.15  ? 542  THR A CG2 1 
ATOM   3391  N  N   . THR A 1  445 ? -24.330 -8.546  101.314 1.00 18.54  ? 543  THR A N   1 
ATOM   3392  C  CA  . THR A 1  445 ? -25.251 -7.593  101.920 1.00 21.53  ? 543  THR A CA  1 
ATOM   3393  C  C   . THR A 1  445 ? -26.719 -7.936  101.645 1.00 20.48  ? 543  THR A C   1 
ATOM   3394  O  O   . THR A 1  445 ? -27.508 -8.090  102.576 1.00 23.45  ? 543  THR A O   1 
ATOM   3395  C  CB  . THR A 1  445 ? -24.963 -6.161  101.435 1.00 25.66  ? 543  THR A CB  1 
ATOM   3396  O  OG1 . THR A 1  445 ? -23.636 -5.786  101.822 1.00 28.82  ? 543  THR A OG1 1 
ATOM   3397  C  CG2 . THR A 1  445 ? -25.953 -5.184  102.042 1.00 23.16  ? 543  THR A CG2 1 
ATOM   3398  N  N   . MET A 1  446 ? -27.081 -8.057  100.371 1.00 16.93  ? 544  MET A N   1 
ATOM   3399  C  CA  . MET A 1  446 ? -28.470 -8.316  100.003 1.00 21.70  ? 544  MET A CA  1 
ATOM   3400  C  C   . MET A 1  446 ? -28.910 -9.734  100.368 1.00 23.54  ? 544  MET A C   1 
ATOM   3401  O  O   . MET A 1  446 ? -30.084 -9.969  100.660 1.00 25.76  ? 544  MET A O   1 
ATOM   3402  C  CB  . MET A 1  446 ? -28.683 -8.073  98.507  1.00 24.03  ? 544  MET A CB  1 
ATOM   3403  C  CG  . MET A 1  446 ? -30.145 -7.952  98.116  1.00 23.21  ? 544  MET A CG  1 
ATOM   3404  S  SD  . MET A 1  446 ? -30.924 -6.506  98.858  1.00 24.56  ? 544  MET A SD  1 
ATOM   3405  C  CE  . MET A 1  446 ? -30.631 -5.268  97.599  1.00 15.23  ? 544  MET A CE  1 
ATOM   3406  N  N   . SER A 1  447 ? -27.968 -10.673 100.353 1.00 21.87  ? 545  SER A N   1 
ATOM   3407  C  CA  . SER A 1  447 ? -28.248 -12.050 100.753 1.00 20.31  ? 545  SER A CA  1 
ATOM   3408  C  C   . SER A 1  447 ? -28.707 -12.112 102.205 1.00 19.33  ? 545  SER A C   1 
ATOM   3409  O  O   . SER A 1  447 ? -29.670 -12.806 102.533 1.00 19.14  ? 545  SER A O   1 
ATOM   3410  C  CB  . SER A 1  447 ? -27.018 -12.936 100.553 1.00 23.02  ? 545  SER A CB  1 
ATOM   3411  O  OG  . SER A 1  447 ? -26.698 -13.062 99.179  1.00 29.30  ? 545  SER A OG  1 
ATOM   3412  N  N   . GLY A 1  448 ? -28.010 -11.382 103.070 1.00 18.24  ? 546  GLY A N   1 
ATOM   3413  C  CA  . GLY A 1  448 ? -28.349 -11.339 104.481 1.00 19.90  ? 546  GLY A CA  1 
ATOM   3414  C  C   . GLY A 1  448 ? -29.667 -10.628 104.719 1.00 20.99  ? 546  GLY A C   1 
ATOM   3415  O  O   . GLY A 1  448 ? -30.456 -11.035 105.572 1.00 15.34  ? 546  GLY A O   1 
ATOM   3416  N  N   . ARG A 1  449 ? -29.903 -9.565  103.955 1.00 20.87  ? 547  ARG A N   1 
ATOM   3417  C  CA  . ARG A 1  449 ? -31.159 -8.828  104.022 1.00 18.94  ? 547  ARG A CA  1 
ATOM   3418  C  C   . ARG A 1  449 ? -32.345 -9.731  103.700 1.00 22.63  ? 547  ARG A C   1 
ATOM   3419  O  O   . ARG A 1  449 ? -33.346 -9.732  104.417 1.00 25.49  ? 547  ARG A O   1 
ATOM   3420  C  CB  . ARG A 1  449 ? -31.134 -7.632  103.067 1.00 15.30  ? 547  ARG A CB  1 
ATOM   3421  C  CG  . ARG A 1  449 ? -30.248 -6.492  103.539 1.00 15.92  ? 547  ARG A CG  1 
ATOM   3422  C  CD  . ARG A 1  449 ? -30.018 -5.453  102.456 1.00 13.73  ? 547  ARG A CD  1 
ATOM   3423  N  NE  . ARG A 1  449 ? -29.151 -4.378  102.929 1.00 13.89  ? 547  ARG A NE  1 
ATOM   3424  C  CZ  . ARG A 1  449 ? -28.799 -3.321  102.203 1.00 20.80  ? 547  ARG A CZ  1 
ATOM   3425  N  NH1 . ARG A 1  449 ? -29.241 -3.190  100.960 1.00 21.74  ? 547  ARG A NH1 1 
ATOM   3426  N  NH2 . ARG A 1  449 ? -28.005 -2.395  102.722 1.00 16.38  ? 547  ARG A NH2 1 
ATOM   3427  N  N   . ARG A 1  450 ? -32.223 -10.505 102.626 1.00 21.61  ? 548  ARG A N   1 
ATOM   3428  C  CA  . ARG A 1  450 ? -33.300 -11.391 102.200 1.00 22.51  ? 548  ARG A CA  1 
ATOM   3429  C  C   . ARG A 1  450 ? -33.601 -12.471 103.235 1.00 21.01  ? 548  ARG A C   1 
ATOM   3430  O  O   . ARG A 1  450 ? -34.761 -12.706 103.567 1.00 24.21  ? 548  ARG A O   1 
ATOM   3431  C  CB  . ARG A 1  450 ? -32.961 -12.042 100.857 1.00 24.70  ? 548  ARG A CB  1 
ATOM   3432  C  CG  . ARG A 1  450 ? -33.024 -11.092 99.676  1.00 13.48  ? 548  ARG A CG  1 
ATOM   3433  C  CD  . ARG A 1  450 ? -32.896 -11.834 98.359  1.00 18.22  ? 548  ARG A CD  1 
ATOM   3434  N  NE  . ARG A 1  450 ? -32.775 -10.915 97.230  1.00 18.05  ? 548  ARG A NE  1 
ATOM   3435  C  CZ  . ARG A 1  450 ? -32.541 -11.294 95.977  1.00 19.74  ? 548  ARG A CZ  1 
ATOM   3436  N  NH1 . ARG A 1  450 ? -32.405 -12.581 95.682  1.00 19.38  ? 548  ARG A NH1 1 
ATOM   3437  N  NH2 . ARG A 1  450 ? -32.448 -10.385 95.017  1.00 15.15  ? 548  ARG A NH2 1 
ATOM   3438  N  N   . LEU A 1  451 ? -32.558 -13.117 103.750 1.00 14.70  ? 549  LEU A N   1 
ATOM   3439  C  CA  . LEU A 1  451 ? -32.743 -14.206 104.704 1.00 14.04  ? 549  LEU A CA  1 
ATOM   3440  C  C   . LEU A 1  451 ? -33.280 -13.698 106.039 1.00 16.73  ? 549  LEU A C   1 
ATOM   3441  O  O   . LEU A 1  451 ? -34.160 -14.320 106.632 1.00 20.78  ? 549  LEU A O   1 
ATOM   3442  C  CB  . LEU A 1  451 ? -31.433 -14.966 104.918 1.00 16.15  ? 549  LEU A CB  1 
ATOM   3443  C  CG  . LEU A 1  451 ? -31.550 -16.266 105.721 1.00 16.08  ? 549  LEU A CG  1 
ATOM   3444  C  CD1 . LEU A 1  451 ? -30.728 -17.373 105.078 1.00 11.96  ? 549  LEU A CD1 1 
ATOM   3445  C  CD2 . LEU A 1  451 ? -31.130 -16.061 107.170 1.00 15.14  ? 549  LEU A CD2 1 
ATOM   3446  N  N   . ARG A 1  452 ? -32.749 -12.569 106.501 1.00 12.35  ? 550  ARG A N   1 
ATOM   3447  C  CA  . ARG A 1  452 ? -33.214 -11.934 107.733 1.00 15.94  ? 550  ARG A CA  1 
ATOM   3448  C  C   . ARG A 1  452 ? -34.718 -11.700 107.699 1.00 15.62  ? 550  ARG A C   1 
ATOM   3449  O  O   . ARG A 1  452 ? -35.451 -12.144 108.582 1.00 17.18  ? 550  ARG A O   1 
ATOM   3450  C  CB  . ARG A 1  452 ? -32.502 -10.600 107.959 1.00 15.39  ? 550  ARG A CB  1 
ATOM   3451  C  CG  . ARG A 1  452 ? -31.224 -10.689 108.766 1.00 15.97  ? 550  ARG A CG  1 
ATOM   3452  C  CD  . ARG A 1  452 ? -30.780 -9.307  109.226 1.00 21.84  ? 550  ARG A CD  1 
ATOM   3453  N  NE  . ARG A 1  452 ? -30.646 -8.355  108.127 1.00 25.19  ? 550  ARG A NE  1 
ATOM   3454  C  CZ  . ARG A 1  452 ? -29.482 -7.951  107.628 1.00 25.03  ? 550  ARG A CZ  1 
ATOM   3455  N  NH1 . ARG A 1  452 ? -28.348 -8.416  108.132 1.00 28.18  ? 550  ARG A NH1 1 
ATOM   3456  N  NH2 . ARG A 1  452 ? -29.450 -7.080  106.629 1.00 25.25  ? 550  ARG A NH2 1 
ATOM   3457  N  N   . GLU A 1  453 ? -35.161 -10.981 106.673 1.00 17.56  ? 551  GLU A N   1 
ATOM   3458  C  CA  . GLU A 1  453 ? -36.558 -10.596 106.529 1.00 19.79  ? 551  GLU A CA  1 
ATOM   3459  C  C   . GLU A 1  453 ? -37.474 -11.794 106.271 1.00 18.88  ? 551  GLU A C   1 
ATOM   3460  O  O   . GLU A 1  453 ? -38.611 -11.823 106.741 1.00 15.51  ? 551  GLU A O   1 
ATOM   3461  C  CB  . GLU A 1  453 ? -36.690 -9.570  105.405 1.00 22.96  ? 551  GLU A CB  1 
ATOM   3462  C  CG  . GLU A 1  453 ? -35.953 -8.271  105.698 1.00 29.05  ? 551  GLU A CG  1 
ATOM   3463  C  CD  . GLU A 1  453 ? -35.759 -7.407  104.468 1.00 31.85  ? 551  GLU A CD  1 
ATOM   3464  O  OE1 . GLU A 1  453 ? -36.416 -7.676  103.442 1.00 37.54  ? 551  GLU A OE1 1 
ATOM   3465  O  OE2 . GLU A 1  453 ? -34.943 -6.463  104.530 1.00 26.42  ? 551  GLU A OE2 1 
ATOM   3466  N  N   . ALA A 1  454 ? -36.977 -12.781 105.531 1.00 18.52  ? 552  ALA A N   1 
ATOM   3467  C  CA  . ALA A 1  454 ? -37.752 -13.988 105.254 1.00 20.55  ? 552  ALA A CA  1 
ATOM   3468  C  C   . ALA A 1  454 ? -37.960 -14.807 106.523 1.00 19.35  ? 552  ALA A C   1 
ATOM   3469  O  O   . ALA A 1  454 ? -39.051 -15.319 106.771 1.00 19.56  ? 552  ALA A O   1 
ATOM   3470  C  CB  . ALA A 1  454 ? -37.071 -14.829 104.186 1.00 13.48  ? 552  ALA A CB  1 
ATOM   3471  N  N   . VAL A 1  455 ? -36.904 -14.925 107.322 1.00 19.40  ? 553  VAL A N   1 
ATOM   3472  C  CA  . VAL A 1  455 ? -36.975 -15.658 108.581 1.00 22.13  ? 553  VAL A CA  1 
ATOM   3473  C  C   . VAL A 1  455 ? -37.861 -14.905 109.572 1.00 19.67  ? 553  VAL A C   1 
ATOM   3474  O  O   . VAL A 1  455 ? -38.654 -15.512 110.296 1.00 18.96  ? 553  VAL A O   1 
ATOM   3475  C  CB  . VAL A 1  455 ? -35.567 -15.888 109.180 1.00 13.13  ? 553  VAL A CB  1 
ATOM   3476  C  CG1 . VAL A 1  455 ? -35.653 -16.310 110.638 1.00 13.40  ? 553  VAL A CG1 1 
ATOM   3477  C  CG2 . VAL A 1  455 ? -34.817 -16.932 108.372 1.00 12.88  ? 553  VAL A CG2 1 
ATOM   3478  N  N   . GLN A 1  456 ? -37.735 -13.580 109.584 1.00 16.60  ? 554  GLN A N   1 
ATOM   3479  C  CA  . GLN A 1  456 ? -38.597 -12.728 110.400 1.00 15.90  ? 554  GLN A CA  1 
ATOM   3480  C  C   . GLN A 1  456 ? -40.068 -12.911 110.035 1.00 17.74  ? 554  GLN A C   1 
ATOM   3481  O  O   . GLN A 1  456 ? -40.925 -13.036 110.911 1.00 15.66  ? 554  GLN A O   1 
ATOM   3482  C  CB  . GLN A 1  456 ? -38.206 -11.257 110.250 1.00 14.50  ? 554  GLN A CB  1 
ATOM   3483  C  CG  . GLN A 1  456 ? -39.088 -10.310 111.056 1.00 21.98  ? 554  GLN A CG  1 
ATOM   3484  C  CD  . GLN A 1  456 ? -38.654 -8.862  110.946 1.00 33.63  ? 554  GLN A CD  1 
ATOM   3485  O  OE1 . GLN A 1  456 ? -38.323 -8.382  109.863 1.00 38.88  ? 554  GLN A OE1 1 
ATOM   3486  N  NE2 . GLN A 1  456 ? -38.663 -8.154  112.070 1.00 37.45  ? 554  GLN A NE2 1 
ATOM   3487  N  N   . ALA A 1  457 ? -40.350 -12.907 108.736 1.00 16.63  ? 555  ALA A N   1 
ATOM   3488  C  CA  . ALA A 1  457 ? -41.709 -13.081 108.236 1.00 18.90  ? 555  ALA A CA  1 
ATOM   3489  C  C   . ALA A 1  457 ? -42.301 -14.426 108.657 1.00 21.72  ? 555  ALA A C   1 
ATOM   3490  O  O   . ALA A 1  457 ? -43.476 -14.506 109.016 1.00 24.13  ? 555  ALA A O   1 
ATOM   3491  C  CB  . ALA A 1  457 ? -41.731 -12.943 106.720 1.00 15.42  ? 555  ALA A CB  1 
ATOM   3492  N  N   . GLU A 1  458 ? -41.486 -15.477 108.605 1.00 24.14  ? 556  GLU A N   1 
ATOM   3493  C  CA  . GLU A 1  458 ? -41.919 -16.810 109.016 1.00 24.13  ? 556  GLU A CA  1 
ATOM   3494  C  C   . GLU A 1  458 ? -42.348 -16.839 110.477 1.00 24.41  ? 556  GLU A C   1 
ATOM   3495  O  O   . GLU A 1  458 ? -43.421 -17.351 110.805 1.00 24.96  ? 556  GLU A O   1 
ATOM   3496  C  CB  . GLU A 1  458 ? -40.809 -17.835 108.784 1.00 21.99  ? 556  GLU A CB  1 
ATOM   3497  C  CG  . GLU A 1  458 ? -40.968 -18.627 107.503 1.00 24.64  ? 556  GLU A CG  1 
ATOM   3498  C  CD  . GLU A 1  458 ? -42.098 -19.634 107.566 1.00 28.17  ? 556  GLU A CD  1 
ATOM   3499  O  OE1 . GLU A 1  458 ? -42.469 -20.059 108.682 1.00 30.95  ? 556  GLU A OE1 1 
ATOM   3500  O  OE2 . GLU A 1  458 ? -42.614 -20.005 106.493 1.00 27.90  ? 556  GLU A OE2 1 
ATOM   3501  N  N   . PHE A 1  459 ? -41.496 -16.302 111.347 1.00 21.73  ? 557  PHE A N   1 
ATOM   3502  C  CA  . PHE A 1  459 ? -41.807 -16.186 112.767 1.00 19.93  ? 557  PHE A CA  1 
ATOM   3503  C  C   . PHE A 1  459 ? -43.128 -15.454 112.974 1.00 17.50  ? 557  PHE A C   1 
ATOM   3504  O  O   . PHE A 1  459 ? -43.933 -15.833 113.823 1.00 19.55  ? 557  PHE A O   1 
ATOM   3505  C  CB  . PHE A 1  459 ? -40.688 -15.458 113.513 1.00 18.70  ? 557  PHE A CB  1 
ATOM   3506  C  CG  . PHE A 1  459 ? -39.530 -16.340 113.892 1.00 15.50  ? 557  PHE A CG  1 
ATOM   3507  C  CD1 . PHE A 1  459 ? -39.712 -17.414 114.747 1.00 15.84  ? 557  PHE A CD1 1 
ATOM   3508  C  CD2 . PHE A 1  459 ? -38.256 -16.078 113.415 1.00 14.85  ? 557  PHE A CD2 1 
ATOM   3509  C  CE1 . PHE A 1  459 ? -38.648 -18.223 115.107 1.00 20.05  ? 557  PHE A CE1 1 
ATOM   3510  C  CE2 . PHE A 1  459 ? -37.187 -16.882 113.772 1.00 16.48  ? 557  PHE A CE2 1 
ATOM   3511  C  CZ  . PHE A 1  459 ? -37.384 -17.956 114.618 1.00 18.29  ? 557  PHE A CZ  1 
ATOM   3512  N  N   . ALA A 1  460 ? -43.339 -14.404 112.188 1.00 17.30  ? 558  ALA A N   1 
ATOM   3513  C  CA  . ALA A 1  460 ? -44.546 -13.592 112.285 1.00 17.55  ? 558  ALA A CA  1 
ATOM   3514  C  C   . ALA A 1  460 ? -45.782 -14.397 111.894 1.00 18.85  ? 558  ALA A C   1 
ATOM   3515  O  O   . ALA A 1  460 ? -46.812 -14.340 112.566 1.00 22.09  ? 558  ALA A O   1 
ATOM   3516  C  CB  . ALA A 1  460 ? -44.419 -12.354 111.410 1.00 19.27  ? 558  ALA A CB  1 
ATOM   3517  N  N   . SER A 1  461 ? -45.665 -15.149 110.804 1.00 17.48  ? 559  SER A N   1 
ATOM   3518  C  CA  . SER A 1  461 ? -46.745 -16.007 110.327 1.00 24.63  ? 559  SER A CA  1 
ATOM   3519  C  C   . SER A 1  461 ? -47.174 -17.050 111.356 1.00 25.51  ? 559  SER A C   1 
ATOM   3520  O  O   . SER A 1  461 ? -48.285 -17.573 111.288 1.00 29.42  ? 559  SER A O   1 
ATOM   3521  C  CB  . SER A 1  461 ? -46.329 -16.713 109.032 1.00 24.26  ? 559  SER A CB  1 
ATOM   3522  O  OG  . SER A 1  461 ? -46.214 -15.796 107.960 1.00 28.59  ? 559  SER A OG  1 
ATOM   3523  N  N   . HIS A 1  462 ? -46.295 -17.353 112.306 1.00 23.82  ? 560  HIS A N   1 
ATOM   3524  C  CA  . HIS A 1  462 ? -46.583 -18.391 113.288 1.00 19.73  ? 560  HIS A CA  1 
ATOM   3525  C  C   . HIS A 1  462 ? -46.542 -17.886 114.729 1.00 21.06  ? 560  HIS A C   1 
ATOM   3526  O  O   . HIS A 1  462 ? -46.198 -18.629 115.647 1.00 25.00  ? 560  HIS A O   1 
ATOM   3527  C  CB  . HIS A 1  462 ? -45.613 -19.558 113.107 1.00 18.26  ? 560  HIS A CB  1 
ATOM   3528  C  CG  . HIS A 1  462 ? -45.752 -20.252 111.788 1.00 22.50  ? 560  HIS A CG  1 
ATOM   3529  N  ND1 . HIS A 1  462 ? -46.742 -21.177 111.535 1.00 24.30  ? 560  HIS A ND1 1 
ATOM   3530  C  CD2 . HIS A 1  462 ? -45.033 -20.147 110.645 1.00 22.51  ? 560  HIS A CD2 1 
ATOM   3531  C  CE1 . HIS A 1  462 ? -46.623 -21.617 110.294 1.00 24.69  ? 560  HIS A CE1 1 
ATOM   3532  N  NE2 . HIS A 1  462 ? -45.595 -21.008 109.733 1.00 25.27  ? 560  HIS A NE2 1 
ATOM   3533  N  N   . GLY A 1  463 ? -46.906 -16.623 114.922 1.00 19.12  ? 561  GLY A N   1 
ATOM   3534  C  CA  . GLY A 1  463 ? -47.196 -16.109 116.249 1.00 24.64  ? 561  GLY A CA  1 
ATOM   3535  C  C   . GLY A 1  463 ? -46.058 -15.441 116.991 1.00 27.74  ? 561  GLY A C   1 
ATOM   3536  O  O   . GLY A 1  463 ? -46.268 -14.865 118.057 1.00 33.06  ? 561  GLY A O   1 
ATOM   3537  N  N   . MET A 1  464 ? -44.853 -15.512 116.440 1.00 25.62  ? 562  MET A N   1 
ATOM   3538  C  CA  . MET A 1  464 ? -43.713 -14.854 117.066 1.00 24.68  ? 562  MET A CA  1 
ATOM   3539  C  C   . MET A 1  464 ? -43.450 -13.502 116.411 1.00 29.14  ? 562  MET A C   1 
ATOM   3540  O  O   . MET A 1  464 ? -42.717 -13.402 115.428 1.00 30.06  ? 562  MET A O   1 
ATOM   3541  C  CB  . MET A 1  464 ? -42.477 -15.748 117.000 1.00 21.64  ? 562  MET A CB  1 
ATOM   3542  C  CG  . MET A 1  464 ? -42.483 -16.849 118.056 1.00 20.18  ? 562  MET A CG  1 
ATOM   3543  S  SD  . MET A 1  464 ? -41.128 -18.026 117.899 1.00 23.78  ? 562  MET A SD  1 
ATOM   3544  C  CE  . MET A 1  464 ? -39.728 -16.989 118.313 1.00 17.31  ? 562  MET A CE  1 
ATOM   3545  N  N   . GLN A 1  465 ? -44.057 -12.466 116.980 1.00 34.29  ? 563  GLN A N   1 
ATOM   3546  C  CA  . GLN A 1  465 ? -44.055 -11.127 116.398 1.00 34.25  ? 563  GLN A CA  1 
ATOM   3547  C  C   . GLN A 1  465 ? -42.792 -10.329 116.716 1.00 28.62  ? 563  GLN A C   1 
ATOM   3548  O  O   . GLN A 1  465 ? -42.121 -10.577 117.721 1.00 24.85  ? 563  GLN A O   1 
ATOM   3549  C  CB  . GLN A 1  465 ? -45.276 -10.344 116.883 1.00 34.65  ? 563  GLN A CB  1 
ATOM   3550  C  CG  . GLN A 1  465 ? -46.322 -10.061 115.819 1.00 34.68  ? 563  GLN A CG  1 
ATOM   3551  C  CD  . GLN A 1  465 ? -46.689 -11.280 115.006 1.00 33.83  ? 563  GLN A CD  1 
ATOM   3552  O  OE1 . GLN A 1  465 ? -47.189 -12.269 115.537 1.00 33.68  ? 563  GLN A OE1 1 
ATOM   3553  N  NE2 . GLN A 1  465 ? -46.455 -11.208 113.701 1.00 34.80  ? 563  GLN A NE2 1 
ATOM   3554  N  N   . ASN A 1  466 ? -42.489 -9.370  115.842 1.00 28.13  ? 564  ASN A N   1 
ATOM   3555  C  CA  . ASN A 1  466 ? -41.406 -8.407  116.031 1.00 32.93  ? 564  ASN A CA  1 
ATOM   3556  C  C   . ASN A 1  466 ? -40.069 -9.046  116.395 1.00 32.34  ? 564  ASN A C   1 
ATOM   3557  O  O   . ASN A 1  466 ? -39.409 -8.636  117.349 1.00 29.40  ? 564  ASN A O   1 
ATOM   3558  C  CB  . ASN A 1  466 ? -41.796 -7.384  117.101 1.00 39.91  ? 564  ASN A CB  1 
ATOM   3559  C  CG  . ASN A 1  466 ? -42.964 -6.513  116.675 1.00 48.24  ? 564  ASN A CG  1 
ATOM   3560  O  OD1 . ASN A 1  466 ? -43.357 -6.506  115.507 1.00 51.63  ? 564  ASN A OD1 1 
ATOM   3561  N  ND2 . ASN A 1  466 ? -43.517 -5.760  117.620 1.00 50.05  ? 564  ASN A ND2 1 
ATOM   3562  N  N   . MET A 1  467 ? -39.676 -10.055 115.626 1.00 31.85  ? 565  MET A N   1 
ATOM   3563  C  CA  . MET A 1  467 ? -38.407 -10.728 115.852 1.00 29.91  ? 565  MET A CA  1 
ATOM   3564  C  C   . MET A 1  467 ? -37.250 -9.948  115.245 1.00 31.47  ? 565  MET A C   1 
ATOM   3565  O  O   . MET A 1  467 ? -37.311 -9.534  114.089 1.00 33.76  ? 565  MET A O   1 
ATOM   3566  C  CB  . MET A 1  467 ? -38.437 -12.143 115.274 1.00 26.48  ? 565  MET A CB  1 
ATOM   3567  C  CG  . MET A 1  467 ? -39.409 -13.074 115.969 1.00 27.20  ? 565  MET A CG  1 
ATOM   3568  S  SD  . MET A 1  467 ? -38.898 -13.453 117.654 1.00 33.22  ? 565  MET A SD  1 
ATOM   3569  C  CE  . MET A 1  467 ? -37.312 -14.233 117.353 1.00 16.02  ? 565  MET A CE  1 
ATOM   3570  N  N   . THR A 1  468 ? -36.203 -9.740  116.035 1.00 24.39  ? 566  THR A N   1 
ATOM   3571  C  CA  . THR A 1  468 ? -34.954 -9.220  115.501 1.00 22.71  ? 566  THR A CA  1 
ATOM   3572  C  C   . THR A 1  468 ? -34.081 -10.389 115.064 1.00 21.36  ? 566  THR A C   1 
ATOM   3573  O  O   . THR A 1  468 ? -33.680 -11.218 115.881 1.00 19.84  ? 566  THR A O   1 
ATOM   3574  C  CB  . THR A 1  468 ? -34.195 -8.356  116.523 1.00 25.03  ? 566  THR A CB  1 
ATOM   3575  O  OG1 . THR A 1  468 ? -34.950 -7.173  116.808 1.00 25.77  ? 566  THR A OG1 1 
ATOM   3576  C  CG2 . THR A 1  468 ? -32.839 -7.954  115.966 1.00 15.09  ? 566  THR A CG2 1 
ATOM   3577  N  N   . VAL A 1  469 ? -33.800 -10.459 113.769 1.00 19.62  ? 567  VAL A N   1 
ATOM   3578  C  CA  . VAL A 1  469 ? -33.005 -11.551 113.228 1.00 20.25  ? 567  VAL A CA  1 
ATOM   3579  C  C   . VAL A 1  469 ? -31.630 -11.033 112.826 1.00 18.38  ? 567  VAL A C   1 
ATOM   3580  O  O   . VAL A 1  469 ? -31.521 -10.025 112.133 1.00 21.01  ? 567  VAL A O   1 
ATOM   3581  C  CB  . VAL A 1  469 ? -33.692 -12.201 112.009 1.00 17.35  ? 567  VAL A CB  1 
ATOM   3582  C  CG1 . VAL A 1  469 ? -32.917 -13.430 111.551 1.00 15.18  ? 567  VAL A CG1 1 
ATOM   3583  C  CG2 . VAL A 1  469 ? -35.128 -12.570 112.344 1.00 15.76  ? 567  VAL A CG2 1 
ATOM   3584  N  N   . VAL A 1  470 ? -30.579 -11.708 113.278 1.00 14.50  ? 568  VAL A N   1 
ATOM   3585  C  CA  . VAL A 1  470 ? -29.223 -11.330 112.895 1.00 19.06  ? 568  VAL A CA  1 
ATOM   3586  C  C   . VAL A 1  470 ? -28.557 -12.440 112.097 1.00 20.04  ? 568  VAL A C   1 
ATOM   3587  O  O   . VAL A 1  470 ? -28.806 -13.624 112.324 1.00 20.24  ? 568  VAL A O   1 
ATOM   3588  C  CB  . VAL A 1  470 ? -28.342 -10.989 114.124 1.00 14.70  ? 568  VAL A CB  1 
ATOM   3589  C  CG1 . VAL A 1  470 ? -28.864 -9.754  114.829 1.00 13.57  ? 568  VAL A CG1 1 
ATOM   3590  C  CG2 . VAL A 1  470 ? -28.268 -12.164 115.082 1.00 14.73  ? 568  VAL A CG2 1 
ATOM   3591  N  N   . ILE A 1  471 ? -27.716 -12.046 111.149 1.00 21.14  ? 569  ILE A N   1 
ATOM   3592  C  CA  . ILE A 1  471 ? -26.895 -12.996 110.418 1.00 19.46  ? 569  ILE A CA  1 
ATOM   3593  C  C   . ILE A 1  471 ? -25.604 -13.237 111.188 1.00 17.90  ? 569  ILE A C   1 
ATOM   3594  O  O   . ILE A 1  471 ? -24.850 -12.302 111.449 1.00 18.42  ? 569  ILE A O   1 
ATOM   3595  C  CB  . ILE A 1  471 ? -26.569 -12.490 108.998 1.00 21.21  ? 569  ILE A CB  1 
ATOM   3596  C  CG1 . ILE A 1  471 ? -27.855 -12.258 108.199 1.00 18.60  ? 569  ILE A CG1 1 
ATOM   3597  C  CG2 . ILE A 1  471 ? -25.637 -13.458 108.280 1.00 11.47  ? 569  ILE A CG2 1 
ATOM   3598  C  CD1 . ILE A 1  471 ? -28.525 -13.527 107.736 1.00 21.94  ? 569  ILE A CD1 1 
ATOM   3599  N  N   . SER A 1  472 ? -25.356 -14.485 111.568 1.00 12.08  ? 570  SER A N   1 
ATOM   3600  C  CA  . SER A 1  472 ? -24.096 -14.833 112.213 1.00 20.75  ? 570  SER A CA  1 
ATOM   3601  C  C   . SER A 1  472 ? -23.202 -15.545 111.209 1.00 20.78  ? 570  SER A C   1 
ATOM   3602  O  O   . SER A 1  472 ? -23.514 -16.648 110.762 1.00 21.52  ? 570  SER A O   1 
ATOM   3603  C  CB  . SER A 1  472 ? -24.334 -15.707 113.444 1.00 20.45  ? 570  SER A CB  1 
ATOM   3604  O  OG  . SER A 1  472 ? -23.110 -16.147 114.000 1.00 22.80  ? 570  SER A OG  1 
ATOM   3605  N  N   . GLY A 1  473 ? -22.089 -14.910 110.855 1.00 19.45  ? 571  GLY A N   1 
ATOM   3606  C  CA  . GLY A 1  473 ? -21.268 -15.393 109.761 1.00 17.77  ? 571  GLY A CA  1 
ATOM   3607  C  C   . GLY A 1  473 ? -20.200 -16.394 110.147 1.00 19.59  ? 571  GLY A C   1 
ATOM   3608  O  O   . GLY A 1  473 ? -19.751 -16.435 111.295 1.00 19.37  ? 571  GLY A O   1 
ATOM   3609  N  N   . LEU A 1  474 ? -19.797 -17.203 109.168 1.00 20.22  ? 572  LEU A N   1 
ATOM   3610  C  CA  . LEU A 1  474 ? -18.701 -18.152 109.328 1.00 17.66  ? 572  LEU A CA  1 
ATOM   3611  C  C   . LEU A 1  474 ? -18.928 -19.069 110.518 1.00 17.11  ? 572  LEU A C   1 
ATOM   3612  O  O   . LEU A 1  474 ? -18.089 -19.177 111.412 1.00 17.43  ? 572  LEU A O   1 
ATOM   3613  C  CB  . LEU A 1  474 ? -17.383 -17.400 109.460 1.00 16.83  ? 572  LEU A CB  1 
ATOM   3614  C  CG  . LEU A 1  474 ? -17.148 -16.562 108.205 1.00 15.20  ? 572  LEU A CG  1 
ATOM   3615  C  CD1 . LEU A 1  474 ? -17.086 -15.092 108.550 1.00 12.29  ? 572  LEU A CD1 1 
ATOM   3616  C  CD2 . LEU A 1  474 ? -15.888 -17.009 107.496 1.00 15.00  ? 572  LEU A CD2 1 
ATOM   3617  N  N   . CYS A 1  475 ? -20.082 -19.724 110.516 1.00 17.12  ? 573  CYS A N   1 
ATOM   3618  C  CA  . CYS A 1  475 ? -20.471 -20.596 111.608 1.00 14.83  ? 573  CYS A CA  1 
ATOM   3619  C  C   . CYS A 1  475 ? -20.303 -22.062 111.236 1.00 18.72  ? 573  CYS A C   1 
ATOM   3620  O  O   . CYS A 1  475 ? -20.529 -22.452 110.090 1.00 19.81  ? 573  CYS A O   1 
ATOM   3621  C  CB  . CYS A 1  475 ? -21.920 -20.325 112.019 1.00 14.05  ? 573  CYS A CB  1 
ATOM   3622  S  SG  . CYS A 1  475 ? -22.180 -18.726 112.812 1.00 21.28  ? 573  CYS A SG  1 
ATOM   3623  N  N   . ASN A 1  476 ? -19.867 -22.857 112.208 1.00 21.36  ? 574  ASN A N   1 
ATOM   3624  C  CA  . ASN A 1  476 ? -19.989 -24.312 112.155 1.00 21.02  ? 574  ASN A CA  1 
ATOM   3625  C  C   . ASN A 1  476 ? -19.178 -25.016 111.063 1.00 18.37  ? 574  ASN A C   1 
ATOM   3626  O  O   . ASN A 1  476 ? -18.520 -26.023 111.324 1.00 21.51  ? 574  ASN A O   1 
ATOM   3627  C  CB  . ASN A 1  476 ? -21.467 -24.679 112.003 1.00 22.16  ? 574  ASN A CB  1 
ATOM   3628  C  CG  . ASN A 1  476 ? -22.328 -24.071 113.091 1.00 24.62  ? 574  ASN A CG  1 
ATOM   3629  O  OD1 . ASN A 1  476 ? -21.862 -23.836 114.206 1.00 27.72  ? 574  ASN A OD1 1 
ATOM   3630  N  ND2 . ASN A 1  476 ? -23.590 -23.811 112.774 1.00 27.55  ? 574  ASN A ND2 1 
ATOM   3631  N  N   . VAL A 1  477 ? -19.233 -24.491 109.844 1.00 15.21  ? 575  VAL A N   1 
ATOM   3632  C  CA  . VAL A 1  477 ? -18.553 -25.101 108.709 1.00 17.34  ? 575  VAL A CA  1 
ATOM   3633  C  C   . VAL A 1  477 ? -18.408 -24.061 107.601 1.00 15.91  ? 575  VAL A C   1 
ATOM   3634  O  O   . VAL A 1  477 ? -19.307 -23.253 107.380 1.00 21.02  ? 575  VAL A O   1 
ATOM   3635  C  CB  . VAL A 1  477 ? -19.321 -26.350 108.194 1.00 15.49  ? 575  VAL A CB  1 
ATOM   3636  C  CG1 . VAL A 1  477 ? -20.767 -26.003 107.864 1.00 14.96  ? 575  VAL A CG1 1 
ATOM   3637  C  CG2 . VAL A 1  477 ? -18.621 -26.969 106.993 1.00 15.82  ? 575  VAL A CG2 1 
ATOM   3638  N  N   . TYR A 1  478 ? -17.271 -24.065 106.913 1.00 14.64  ? 576  TYR A N   1 
ATOM   3639  C  CA  . TYR A 1  478 ? -17.018 -23.044 105.906 1.00 16.18  ? 576  TYR A CA  1 
ATOM   3640  C  C   . TYR A 1  478 ? -17.372 -23.526 104.504 1.00 16.96  ? 576  TYR A C   1 
ATOM   3641  O  O   . TYR A 1  478 ? -16.861 -24.542 104.030 1.00 16.71  ? 576  TYR A O   1 
ATOM   3642  C  CB  . TYR A 1  478 ? -15.558 -22.590 105.951 1.00 14.36  ? 576  TYR A CB  1 
ATOM   3643  C  CG  . TYR A 1  478 ? -15.277 -21.405 105.057 1.00 13.92  ? 576  TYR A CG  1 
ATOM   3644  C  CD1 . TYR A 1  478 ? -15.851 -20.167 105.312 1.00 14.51  ? 576  TYR A CD1 1 
ATOM   3645  C  CD2 . TYR A 1  478 ? -14.443 -21.523 103.956 1.00 14.19  ? 576  TYR A CD2 1 
ATOM   3646  C  CE1 . TYR A 1  478 ? -15.600 -19.081 104.498 1.00 16.11  ? 576  TYR A CE1 1 
ATOM   3647  C  CE2 . TYR A 1  478 ? -14.186 -20.442 103.134 1.00 13.90  ? 576  TYR A CE2 1 
ATOM   3648  C  CZ  . TYR A 1  478 ? -14.764 -19.223 103.411 1.00 13.36  ? 576  TYR A CZ  1 
ATOM   3649  O  OH  . TYR A 1  478 ? -14.515 -18.142 102.597 1.00 14.99  ? 576  TYR A OH  1 
ATOM   3650  N  N   . THR A 1  479 ? -18.255 -22.778 103.851 1.00 15.44  ? 577  THR A N   1 
ATOM   3651  C  CA  . THR A 1  479 ? -18.722 -23.107 102.511 1.00 17.11  ? 577  THR A CA  1 
ATOM   3652  C  C   . THR A 1  479 ? -18.563 -21.897 101.598 1.00 20.78  ? 577  THR A C   1 
ATOM   3653  O  O   . THR A 1  479 ? -19.284 -21.750 100.609 1.00 26.10  ? 577  THR A O   1 
ATOM   3654  C  CB  . THR A 1  479 ? -20.191 -23.564 102.520 1.00 17.89  ? 577  THR A CB  1 
ATOM   3655  O  OG1 . THR A 1  479 ? -21.024 -22.494 102.984 1.00 16.67  ? 577  THR A OG1 1 
ATOM   3656  C  CG2 . THR A 1  479 ? -20.367 -24.766 103.437 1.00 14.16  ? 577  THR A CG2 1 
ATOM   3657  N  N   . HIS A 1  480 ? -17.621 -21.031 101.966 1.00 18.04  ? 578  HIS A N   1 
ATOM   3658  C  CA  . HIS A 1  480 ? -17.293 -19.817 101.221 1.00 16.99  ? 578  HIS A CA  1 
ATOM   3659  C  C   . HIS A 1  480 ? -18.451 -18.823 101.203 1.00 15.89  ? 578  HIS A C   1 
ATOM   3660  O  O   . HIS A 1  480 ? -19.106 -18.609 102.221 1.00 18.01  ? 578  HIS A O   1 
ATOM   3661  C  CB  . HIS A 1  480 ? -16.853 -20.162 99.796  1.00 20.40  ? 578  HIS A CB  1 
ATOM   3662  C  CG  . HIS A 1  480 ? -15.569 -20.930 99.734  1.00 25.39  ? 578  HIS A CG  1 
ATOM   3663  N  ND1 . HIS A 1  480 ? -14.377 -20.358 99.345  1.00 27.91  ? 578  HIS A ND1 1 
ATOM   3664  C  CD2 . HIS A 1  480 ? -15.290 -22.225 100.016 1.00 24.71  ? 578  HIS A CD2 1 
ATOM   3665  C  CE1 . HIS A 1  480 ? -13.419 -21.267 99.389  1.00 23.95  ? 578  HIS A CE1 1 
ATOM   3666  N  NE2 . HIS A 1  480 ? -13.947 -22.408 99.793  1.00 22.64  ? 578  HIS A NE2 1 
ATOM   3667  N  N   . TYR A 1  481 ? -18.701 -18.220 100.046 1.00 17.62  ? 579  TYR A N   1 
ATOM   3668  C  CA  . TYR A 1  481 ? -19.604 -17.074 99.964  1.00 16.43  ? 579  TYR A CA  1 
ATOM   3669  C  C   . TYR A 1  481 ? -20.999 -17.455 99.481  1.00 21.38  ? 579  TYR A C   1 
ATOM   3670  O  O   . TYR A 1  481 ? -21.187 -18.477 98.820  1.00 24.27  ? 579  TYR A O   1 
ATOM   3671  C  CB  . TYR A 1  481 ? -19.022 -16.006 99.035  1.00 14.71  ? 579  TYR A CB  1 
ATOM   3672  C  CG  . TYR A 1  481 ? -17.795 -15.306 99.577  1.00 19.80  ? 579  TYR A CG  1 
ATOM   3673  C  CD1 . TYR A 1  481 ? -16.563 -15.948 99.614  1.00 18.16  ? 579  TYR A CD1 1 
ATOM   3674  C  CD2 . TYR A 1  481 ? -17.866 -14.000 100.044 1.00 18.42  ? 579  TYR A CD2 1 
ATOM   3675  C  CE1 . TYR A 1  481 ? -15.441 -15.312 100.107 1.00 17.34  ? 579  TYR A CE1 1 
ATOM   3676  C  CE2 . TYR A 1  481 ? -16.749 -13.356 100.537 1.00 17.26  ? 579  TYR A CE2 1 
ATOM   3677  C  CZ  . TYR A 1  481 ? -15.538 -14.016 100.566 1.00 16.50  ? 579  TYR A CZ  1 
ATOM   3678  O  OH  . TYR A 1  481 ? -14.423 -13.378 101.057 1.00 17.08  ? 579  TYR A OH  1 
ATOM   3679  N  N   . ILE A 1  482 ? -21.975 -16.619 99.819  1.00 19.60  ? 580  ILE A N   1 
ATOM   3680  C  CA  . ILE A 1  482 ? -23.341 -16.794 99.343  1.00 14.09  ? 580  ILE A CA  1 
ATOM   3681  C  C   . ILE A 1  482 ? -23.863 -15.490 98.752  1.00 16.79  ? 580  ILE A C   1 
ATOM   3682  O  O   . ILE A 1  482 ? -23.991 -14.482 99.448  1.00 17.25  ? 580  ILE A O   1 
ATOM   3683  C  CB  . ILE A 1  482 ? -24.294 -17.267 100.461 1.00 14.05  ? 580  ILE A CB  1 
ATOM   3684  C  CG1 . ILE A 1  482 ? -23.915 -18.671 100.947 1.00 15.43  ? 580  ILE A CG1 1 
ATOM   3685  C  CG2 . ILE A 1  482 ? -25.725 -17.280 99.961  1.00 17.58  ? 580  ILE A CG2 1 
ATOM   3686  C  CD1 . ILE A 1  482 ? -22.890 -18.701 102.072 1.00 13.22  ? 580  ILE A CD1 1 
ATOM   3687  N  N   . THR A 1  483 ? -24.160 -15.519 97.458  1.00 18.84  ? 581  THR A N   1 
ATOM   3688  C  CA  . THR A 1  483 ? -24.664 -14.345 96.761  1.00 15.98  ? 581  THR A CA  1 
ATOM   3689  C  C   . THR A 1  483 ? -26.127 -14.534 96.379  1.00 16.81  ? 581  THR A C   1 
ATOM   3690  O  O   . THR A 1  483 ? -26.649 -15.651 96.420  1.00 14.53  ? 581  THR A O   1 
ATOM   3691  C  CB  . THR A 1  483 ? -23.846 -14.051 95.488  1.00 17.29  ? 581  THR A CB  1 
ATOM   3692  O  OG1 . THR A 1  483 ? -23.846 -15.205 94.636  1.00 17.17  ? 581  THR A OG1 1 
ATOM   3693  C  CG2 . THR A 1  483 ? -22.412 -13.689 95.842  1.00 14.63  ? 581  THR A CG2 1 
ATOM   3694  N  N   . THR A 1  484 ? -26.793 -13.442 96.021  1.00 13.24  ? 582  THR A N   1 
ATOM   3695  C  CA  . THR A 1  484 ? -28.144 -13.536 95.485  1.00 17.74  ? 582  THR A CA  1 
ATOM   3696  C  C   . THR A 1  484 ? -28.063 -14.083 94.067  1.00 14.82  ? 582  THR A C   1 
ATOM   3697  O  O   . THR A 1  484 ? -27.007 -14.020 93.437  1.00 14.37  ? 582  THR A O   1 
ATOM   3698  C  CB  . THR A 1  484 ? -28.869 -12.174 95.471  1.00 20.16  ? 582  THR A CB  1 
ATOM   3699  O  OG1 . THR A 1  484 ? -28.269 -11.318 94.491  1.00 19.20  ? 582  THR A OG1 1 
ATOM   3700  C  CG2 . THR A 1  484 ? -28.805 -11.512 96.839  1.00 24.96  ? 582  THR A CG2 1 
ATOM   3701  N  N   . TYR A 1  485 ? -29.175 -14.613 93.570  1.00 16.06  ? 583  TYR A N   1 
ATOM   3702  C  CA  . TYR A 1  485 ? -29.244 -15.119 92.202  1.00 19.06  ? 583  TYR A CA  1 
ATOM   3703  C  C   . TYR A 1  485 ? -28.766 -14.087 91.182  1.00 20.50  ? 583  TYR A C   1 
ATOM   3704  O  O   . TYR A 1  485 ? -28.039 -14.415 90.247  1.00 26.01  ? 583  TYR A O   1 
ATOM   3705  C  CB  . TYR A 1  485 ? -30.671 -15.556 91.868  1.00 15.70  ? 583  TYR A CB  1 
ATOM   3706  C  CG  . TYR A 1  485 ? -30.834 -16.032 90.444  1.00 16.57  ? 583  TYR A CG  1 
ATOM   3707  C  CD1 . TYR A 1  485 ? -30.541 -17.340 90.092  1.00 16.75  ? 583  TYR A CD1 1 
ATOM   3708  C  CD2 . TYR A 1  485 ? -31.290 -15.171 89.453  1.00 17.32  ? 583  TYR A CD2 1 
ATOM   3709  C  CE1 . TYR A 1  485 ? -30.687 -17.777 88.790  1.00 17.98  ? 583  TYR A CE1 1 
ATOM   3710  C  CE2 . TYR A 1  485 ? -31.440 -15.597 88.151  1.00 18.23  ? 583  TYR A CE2 1 
ATOM   3711  C  CZ  . TYR A 1  485 ? -31.138 -16.901 87.824  1.00 18.39  ? 583  TYR A CZ  1 
ATOM   3712  O  OH  . TYR A 1  485 ? -31.287 -17.327 86.525  1.00 20.60  ? 583  TYR A OH  1 
ATOM   3713  N  N   . GLU A 1  486 ? -29.181 -12.841 91.375  1.00 21.05  ? 584  GLU A N   1 
ATOM   3714  C  CA  . GLU A 1  486 ? -28.823 -11.757 90.470  1.00 23.20  ? 584  GLU A CA  1 
ATOM   3715  C  C   . GLU A 1  486 ? -27.335 -11.425 90.547  1.00 22.70  ? 584  GLU A C   1 
ATOM   3716  O  O   . GLU A 1  486 ? -26.691 -11.195 89.524  1.00 21.93  ? 584  GLU A O   1 
ATOM   3717  C  CB  . GLU A 1  486 ? -29.670 -10.518 90.772  1.00 24.52  ? 584  GLU A CB  1 
ATOM   3718  C  CG  . GLU A 1  486 ? -31.163 -10.724 90.540  1.00 22.00  ? 584  GLU A CG  1 
ATOM   3719  C  CD  . GLU A 1  486 ? -31.873 -11.363 91.722  1.00 22.58  ? 584  GLU A CD  1 
ATOM   3720  O  OE1 . GLU A 1  486 ? -31.189 -11.822 92.661  1.00 19.59  ? 584  GLU A OE1 1 
ATOM   3721  O  OE2 . GLU A 1  486 ? -33.121 -11.416 91.706  1.00 26.58  ? 584  GLU A OE2 1 
ATOM   3722  N  N   . GLU A 1  487 ? -26.797 -11.402 91.763  1.00 24.40  ? 585  GLU A N   1 
ATOM   3723  C  CA  . GLU A 1  487 ? -25.372 -11.161 91.977  1.00 24.10  ? 585  GLU A CA  1 
ATOM   3724  C  C   . GLU A 1  487 ? -24.518 -12.277 91.383  1.00 25.93  ? 585  GLU A C   1 
ATOM   3725  O  O   . GLU A 1  487 ? -23.416 -12.036 90.889  1.00 28.83  ? 585  GLU A O   1 
ATOM   3726  C  CB  . GLU A 1  487 ? -25.070 -11.020 93.471  1.00 20.71  ? 585  GLU A CB  1 
ATOM   3727  C  CG  . GLU A 1  487 ? -25.518 -9.704  94.079  1.00 18.13  ? 585  GLU A CG  1 
ATOM   3728  C  CD  . GLU A 1  487 ? -25.559 -9.748  95.593  1.00 19.31  ? 585  GLU A CD  1 
ATOM   3729  O  OE1 . GLU A 1  487 ? -24.971 -10.681 96.179  1.00 19.06  ? 585  GLU A OE1 1 
ATOM   3730  O  OE2 . GLU A 1  487 ? -26.172 -8.844  96.197  1.00 23.00  ? 585  GLU A OE2 1 
ATOM   3731  N  N   . TYR A 1  488 ? -25.041 -13.498 91.440  1.00 23.44  ? 586  TYR A N   1 
ATOM   3732  C  CA  . TYR A 1  488 ? -24.341 -14.685 90.960  1.00 20.58  ? 586  TYR A CA  1 
ATOM   3733  C  C   . TYR A 1  488 ? -24.065 -14.598 89.461  1.00 21.00  ? 586  TYR A C   1 
ATOM   3734  O  O   . TYR A 1  488 ? -23.069 -15.133 88.970  1.00 21.85  ? 586  TYR A O   1 
ATOM   3735  C  CB  . TYR A 1  488 ? -25.165 -15.933 91.284  1.00 17.18  ? 586  TYR A CB  1 
ATOM   3736  C  CG  . TYR A 1  488 ? -24.533 -17.252 90.894  1.00 16.01  ? 586  TYR A CG  1 
ATOM   3737  C  CD1 . TYR A 1  488 ? -24.717 -17.785 89.625  1.00 16.44  ? 586  TYR A CD1 1 
ATOM   3738  C  CD2 . TYR A 1  488 ? -23.772 -17.975 91.805  1.00 17.64  ? 586  TYR A CD2 1 
ATOM   3739  C  CE1 . TYR A 1  488 ? -24.150 -18.992 89.269  1.00 16.81  ? 586  TYR A CE1 1 
ATOM   3740  C  CE2 . TYR A 1  488 ? -23.201 -19.185 91.458  1.00 15.56  ? 586  TYR A CE2 1 
ATOM   3741  C  CZ  . TYR A 1  488 ? -23.394 -19.688 90.188  1.00 16.37  ? 586  TYR A CZ  1 
ATOM   3742  O  OH  . TYR A 1  488 ? -22.831 -20.893 89.837  1.00 16.85  ? 586  TYR A OH  1 
ATOM   3743  N  N   . GLN A 1  489 ? -24.956 -13.922 88.742  1.00 20.06  ? 587  GLN A N   1 
ATOM   3744  C  CA  . GLN A 1  489 ? -24.849 -13.786 87.293  1.00 17.96  ? 587  GLN A CA  1 
ATOM   3745  C  C   . GLN A 1  489 ? -23.585 -13.041 86.871  1.00 18.49  ? 587  GLN A C   1 
ATOM   3746  O  O   . GLN A 1  489 ? -22.971 -13.376 85.859  1.00 21.94  ? 587  GLN A O   1 
ATOM   3747  C  CB  . GLN A 1  489 ? -26.082 -13.070 86.738  1.00 18.55  ? 587  GLN A CB  1 
ATOM   3748  C  CG  . GLN A 1  489 ? -27.404 -13.744 87.080  1.00 18.97  ? 587  GLN A CG  1 
ATOM   3749  C  CD  . GLN A 1  489 ? -27.423 -15.211 86.698  1.00 20.14  ? 587  GLN A CD  1 
ATOM   3750  O  OE1 . GLN A 1  489 ? -27.172 -15.566 85.547  1.00 23.39  ? 587  GLN A OE1 1 
ATOM   3751  N  NE2 . GLN A 1  489 ? -27.724 -16.072 87.664  1.00 17.91  ? 587  GLN A NE2 1 
ATOM   3752  N  N   . ALA A 1  490 ? -23.198 -12.037 87.653  1.00 17.77  ? 588  ALA A N   1 
ATOM   3753  C  CA  . ALA A 1  490 ? -22.062 -11.185 87.308  1.00 21.12  ? 588  ALA A CA  1 
ATOM   3754  C  C   . ALA A 1  490 ? -20.730 -11.912 87.482  1.00 20.47  ? 588  ALA A C   1 
ATOM   3755  O  O   . ALA A 1  490 ? -19.730 -11.543 86.867  1.00 18.41  ? 588  ALA A O   1 
ATOM   3756  C  CB  . ALA A 1  490 ? -22.084 -9.915  88.145  1.00 17.71  ? 588  ALA A CB  1 
ATOM   3757  N  N   . GLN A 1  491 ? -20.730 -12.934 88.334  1.00 19.13  ? 589  GLN A N   1 
ATOM   3758  C  CA  . GLN A 1  491 ? -19.570 -13.800 88.547  1.00 20.61  ? 589  GLN A CA  1 
ATOM   3759  C  C   . GLN A 1  491 ? -18.321 -13.074 89.030  1.00 24.08  ? 589  GLN A C   1 
ATOM   3760  O  O   . GLN A 1  491 ? -17.214 -13.384 88.596  1.00 30.67  ? 589  GLN A O   1 
ATOM   3761  C  CB  . GLN A 1  491 ? -19.240 -14.574 87.268  1.00 17.98  ? 589  GLN A CB  1 
ATOM   3762  C  CG  . GLN A 1  491 ? -20.040 -15.847 87.123  1.00 18.54  ? 589  GLN A CG  1 
ATOM   3763  C  CD  . GLN A 1  491 ? -19.903 -16.746 88.337  1.00 21.77  ? 589  GLN A CD  1 
ATOM   3764  O  OE1 . GLN A 1  491 ? -18.822 -17.260 88.626  1.00 21.35  ? 589  GLN A OE1 1 
ATOM   3765  N  NE2 . GLN A 1  491 ? -21.000 -16.932 89.061  1.00 25.95  ? 589  GLN A NE2 1 
ATOM   3766  N  N   . ARG A 1  492 ? -18.495 -12.114 89.931  1.00 24.72  ? 590  ARG A N   1 
ATOM   3767  C  CA  . ARG A 1  492 ? -17.357 -11.557 90.648  1.00 23.86  ? 590  ARG A CA  1 
ATOM   3768  C  C   . ARG A 1  492 ? -16.906 -12.556 91.710  1.00 22.64  ? 590  ARG A C   1 
ATOM   3769  O  O   . ARG A 1  492 ? -17.507 -13.622 91.846  1.00 20.47  ? 590  ARG A O   1 
ATOM   3770  C  CB  . ARG A 1  492 ? -17.704 -10.202 91.265  1.00 21.63  ? 590  ARG A CB  1 
ATOM   3771  C  CG  . ARG A 1  492 ? -17.791 -9.084  90.237  1.00 22.95  ? 590  ARG A CG  1 
ATOM   3772  C  CD  . ARG A 1  492 ? -18.036 -7.730  90.880  1.00 21.55  ? 590  ARG A CD  1 
ATOM   3773  N  NE  . ARG A 1  492 ? -16.961 -7.332  91.781  1.00 20.46  ? 590  ARG A NE  1 
ATOM   3774  C  CZ  . ARG A 1  492 ? -15.817 -6.784  91.386  1.00 17.30  ? 590  ARG A CZ  1 
ATOM   3775  N  NH1 . ARG A 1  492 ? -15.592 -6.574  90.098  1.00 17.53  ? 590  ARG A NH1 1 
ATOM   3776  N  NH2 . ARG A 1  492 ? -14.898 -6.450  92.280  1.00 16.91  ? 590  ARG A NH2 1 
ATOM   3777  N  N   . TYR A 1  493 ? -15.849 -12.215 92.444  1.00 21.71  ? 591  TYR A N   1 
ATOM   3778  C  CA  . TYR A 1  493 ? -15.220 -13.140 93.389  1.00 18.35  ? 591  TYR A CA  1 
ATOM   3779  C  C   . TYR A 1  493 ? -16.205 -13.874 94.299  1.00 18.25  ? 591  TYR A C   1 
ATOM   3780  O  O   . TYR A 1  493 ? -16.140 -15.096 94.428  1.00 14.35  ? 591  TYR A O   1 
ATOM   3781  C  CB  . TYR A 1  493 ? -14.198 -12.401 94.256  1.00 14.73  ? 591  TYR A CB  1 
ATOM   3782  C  CG  . TYR A 1  493 ? -13.562 -13.285 95.306  1.00 18.04  ? 591  TYR A CG  1 
ATOM   3783  C  CD1 . TYR A 1  493 ? -12.480 -14.097 94.994  1.00 18.66  ? 591  TYR A CD1 1 
ATOM   3784  C  CD2 . TYR A 1  493 ? -14.052 -13.317 96.606  1.00 13.88  ? 591  TYR A CD2 1 
ATOM   3785  C  CE1 . TYR A 1  493 ? -11.900 -14.910 95.949  1.00 18.10  ? 591  TYR A CE1 1 
ATOM   3786  C  CE2 . TYR A 1  493 ? -13.479 -14.124 97.564  1.00 13.76  ? 591  TYR A CE2 1 
ATOM   3787  C  CZ  . TYR A 1  493 ? -12.404 -14.918 97.231  1.00 14.22  ? 591  TYR A CZ  1 
ATOM   3788  O  OH  . TYR A 1  493 ? -11.834 -15.721 98.187  1.00 14.22  ? 591  TYR A OH  1 
ATOM   3789  N  N   . GLU A 1  494 ? -17.104 -13.129 94.933  1.00 19.86  ? 592  GLU A N   1 
ATOM   3790  C  CA  . GLU A 1  494 ? -18.065 -13.722 95.857  1.00 18.41  ? 592  GLU A CA  1 
ATOM   3791  C  C   . GLU A 1  494 ? -19.025 -14.652 95.125  1.00 16.39  ? 592  GLU A C   1 
ATOM   3792  O  O   . GLU A 1  494 ? -19.404 -15.701 95.643  1.00 13.44  ? 592  GLU A O   1 
ATOM   3793  C  CB  . GLU A 1  494 ? -18.855 -12.638 96.596  1.00 19.06  ? 592  GLU A CB  1 
ATOM   3794  C  CG  . GLU A 1  494 ? -18.005 -11.650 97.378  1.00 12.97  ? 592  GLU A CG  1 
ATOM   3795  C  CD  . GLU A 1  494 ? -17.556 -10.475 96.536  1.00 17.94  ? 592  GLU A CD  1 
ATOM   3796  O  OE1 . GLU A 1  494 ? -17.857 -10.460 95.324  1.00 18.53  ? 592  GLU A OE1 1 
ATOM   3797  O  OE2 . GLU A 1  494 ? -16.912 -9.560  97.089  1.00 20.42  ? 592  GLU A OE2 1 
ATOM   3798  N  N   . ALA A 1  495 ? -19.411 -14.258 93.916  1.00 14.08  ? 593  ALA A N   1 
ATOM   3799  C  CA  . ALA A 1  495 ? -20.326 -15.049 93.102  1.00 14.41  ? 593  ALA A CA  1 
ATOM   3800  C  C   . ALA A 1  495 ? -19.649 -16.318 92.600  1.00 21.05  ? 593  ALA A C   1 
ATOM   3801  O  O   . ALA A 1  495 ? -20.274 -17.376 92.521  1.00 25.12  ? 593  ALA A O   1 
ATOM   3802  C  CB  . ALA A 1  495 ? -20.841 -14.225 91.939  1.00 14.95  ? 593  ALA A CB  1 
ATOM   3803  N  N   . ALA A 1  496 ? -18.370 -16.205 92.257  1.00 17.85  ? 594  ALA A N   1 
ATOM   3804  C  CA  . ALA A 1  496 ? -17.592 -17.356 91.819  1.00 15.57  ? 594  ALA A CA  1 
ATOM   3805  C  C   . ALA A 1  496 ? -17.305 -18.276 92.999  1.00 15.19  ? 594  ALA A C   1 
ATOM   3806  O  O   . ALA A 1  496 ? -16.984 -19.451 92.822  1.00 16.05  ? 594  ALA A O   1 
ATOM   3807  C  CB  . ALA A 1  496 ? -16.299 -16.909 91.163  1.00 16.08  ? 594  ALA A CB  1 
ATOM   3808  N  N   . SER A 1  497 ? -17.415 -17.723 94.203  1.00 16.79  ? 595  SER A N   1 
ATOM   3809  C  CA  . SER A 1  497 ? -17.177 -18.476 95.427  1.00 18.19  ? 595  SER A CA  1 
ATOM   3810  C  C   . SER A 1  497 ? -18.488 -18.937 96.058  1.00 20.27  ? 595  SER A C   1 
ATOM   3811  O  O   . SER A 1  497 ? -18.522 -19.324 97.225  1.00 22.69  ? 595  SER A O   1 
ATOM   3812  C  CB  . SER A 1  497 ? -16.383 -17.633 96.425  1.00 19.80  ? 595  SER A CB  1 
ATOM   3813  O  OG  . SER A 1  497 ? -15.136 -17.236 95.878  1.00 20.26  ? 595  SER A OG  1 
ATOM   3814  N  N   . THR A 1  498 ? -19.567 -18.882 95.284  1.00 17.20  ? 596  THR A N   1 
ATOM   3815  C  CA  . THR A 1  498 ? -20.844 -19.442 95.706  1.00 15.40  ? 596  THR A CA  1 
ATOM   3816  C  C   . THR A 1  498 ? -20.903 -20.888 95.223  1.00 16.91  ? 596  THR A C   1 
ATOM   3817  O  O   . THR A 1  498 ? -21.337 -21.164 94.104  1.00 18.81  ? 596  THR A O   1 
ATOM   3818  C  CB  . THR A 1  498 ? -22.031 -18.632 95.157  1.00 17.56  ? 596  THR A CB  1 
ATOM   3819  O  OG1 . THR A 1  498 ? -21.895 -17.263 95.556  1.00 19.86  ? 596  THR A OG1 1 
ATOM   3820  C  CG2 . THR A 1  498 ? -23.347 -19.178 95.686  1.00 17.80  ? 596  THR A CG2 1 
ATOM   3821  N  N   . ILE A 1  499 ? -20.461 -21.806 96.075  1.00 14.36  ? 597  ILE A N   1 
ATOM   3822  C  CA  . ILE A 1  499 ? -20.071 -23.140 95.629  1.00 20.00  ? 597  ILE A CA  1 
ATOM   3823  C  C   . ILE A 1  499 ? -21.219 -24.087 95.282  1.00 18.91  ? 597  ILE A C   1 
ATOM   3824  O  O   . ILE A 1  499 ? -21.022 -25.032 94.523  1.00 21.77  ? 597  ILE A O   1 
ATOM   3825  C  CB  . ILE A 1  499 ? -19.183 -23.829 96.690  1.00 21.34  ? 597  ILE A CB  1 
ATOM   3826  C  CG1 . ILE A 1  499 ? -19.963 -24.078 97.981  1.00 18.00  ? 597  ILE A CG1 1 
ATOM   3827  C  CG2 . ILE A 1  499 ? -17.946 -22.990 96.973  1.00 21.41  ? 597  ILE A CG2 1 
ATOM   3828  C  CD1 . ILE A 1  499 ? -19.159 -24.798 99.045  1.00 15.91  ? 597  ILE A CD1 1 
ATOM   3829  N  N   . TYR A 1  500 ? -22.414 -23.847 95.807  1.00 16.75  ? 598  TYR A N   1 
ATOM   3830  C  CA  . TYR A 1  500 ? -23.522 -24.751 95.508  1.00 17.80  ? 598  TYR A CA  1 
ATOM   3831  C  C   . TYR A 1  500 ? -24.415 -24.234 94.383  1.00 20.58  ? 598  TYR A C   1 
ATOM   3832  O  O   . TYR A 1  500 ? -25.547 -24.688 94.219  1.00 18.27  ? 598  TYR A O   1 
ATOM   3833  C  CB  . TYR A 1  500 ? -24.347 -25.020 96.769  1.00 17.02  ? 598  TYR A CB  1 
ATOM   3834  C  CG  . TYR A 1  500 ? -23.525 -25.610 97.891  1.00 18.28  ? 598  TYR A CG  1 
ATOM   3835  C  CD1 . TYR A 1  500 ? -23.020 -26.902 97.798  1.00 20.11  ? 598  TYR A CD1 1 
ATOM   3836  C  CD2 . TYR A 1  500 ? -23.254 -24.882 99.042  1.00 18.23  ? 598  TYR A CD2 1 
ATOM   3837  C  CE1 . TYR A 1  500 ? -22.263 -27.451 98.815  1.00 22.17  ? 598  TYR A CE1 1 
ATOM   3838  C  CE2 . TYR A 1  500 ? -22.498 -25.425 100.068 1.00 22.26  ? 598  TYR A CE2 1 
ATOM   3839  C  CZ  . TYR A 1  500 ? -22.004 -26.709 99.948  1.00 23.51  ? 598  TYR A CZ  1 
ATOM   3840  O  OH  . TYR A 1  500 ? -21.250 -27.258 100.961 1.00 24.21  ? 598  TYR A OH  1 
ATOM   3841  N  N   . GLY A 1  501 ? -23.892 -23.300 93.595  1.00 15.54  ? 599  GLY A N   1 
ATOM   3842  C  CA  . GLY A 1  501 ? -24.602 -22.813 92.428  1.00 21.52  ? 599  GLY A CA  1 
ATOM   3843  C  C   . GLY A 1  501 ? -25.445 -21.575 92.670  1.00 18.61  ? 599  GLY A C   1 
ATOM   3844  O  O   . GLY A 1  501 ? -25.450 -21.025 93.773  1.00 14.79  ? 599  GLY A O   1 
ATOM   3845  N  N   . PRO A 1  502 ? -26.174 -21.136 91.632  1.00 15.89  ? 600  PRO A N   1 
ATOM   3846  C  CA  . PRO A 1  502 ? -26.971 -19.902 91.626  1.00 19.40  ? 600  PRO A CA  1 
ATOM   3847  C  C   . PRO A 1  502 ? -28.137 -19.901 92.612  1.00 18.73  ? 600  PRO A C   1 
ATOM   3848  O  O   . PRO A 1  502 ? -28.644 -18.830 92.939  1.00 22.27  ? 600  PRO A O   1 
ATOM   3849  C  CB  . PRO A 1  502 ? -27.491 -19.827 90.187  1.00 19.36  ? 600  PRO A CB  1 
ATOM   3850  C  CG  . PRO A 1  502 ? -27.430 -21.223 89.682  1.00 22.49  ? 600  PRO A CG  1 
ATOM   3851  C  CD  . PRO A 1  502 ? -26.236 -21.836 90.338  1.00 16.79  ? 600  PRO A CD  1 
ATOM   3852  N  N   . HIS A 1  503 ? -28.556 -21.075 93.072  1.00 18.01  ? 601  HIS A N   1 
ATOM   3853  C  CA  . HIS A 1  503 ? -29.721 -21.171 93.945  1.00 18.34  ? 601  HIS A CA  1 
ATOM   3854  C  C   . HIS A 1  503 ? -29.337 -21.454 95.393  1.00 20.56  ? 601  HIS A C   1 
ATOM   3855  O  O   . HIS A 1  503 ? -30.178 -21.857 96.199  1.00 18.80  ? 601  HIS A O   1 
ATOM   3856  C  CB  . HIS A 1  503 ? -30.673 -22.250 93.431  1.00 19.57  ? 601  HIS A CB  1 
ATOM   3857  C  CG  . HIS A 1  503 ? -31.137 -22.021 92.027  1.00 22.72  ? 601  HIS A CG  1 
ATOM   3858  N  ND1 . HIS A 1  503 ? -31.906 -20.934 91.668  1.00 20.93  ? 601  HIS A ND1 1 
ATOM   3859  C  CD2 . HIS A 1  503 ? -30.923 -22.722 90.889  1.00 20.41  ? 601  HIS A CD2 1 
ATOM   3860  C  CE1 . HIS A 1  503 ? -32.159 -20.985 90.373  1.00 20.27  ? 601  HIS A CE1 1 
ATOM   3861  N  NE2 . HIS A 1  503 ? -31.572 -22.060 89.876  1.00 22.12  ? 601  HIS A NE2 1 
ATOM   3862  N  N   . THR A 1  504 ? -28.070 -21.220 95.720  1.00 14.15  ? 602  THR A N   1 
ATOM   3863  C  CA  . THR A 1  504 ? -27.562 -21.452 97.068  1.00 22.54  ? 602  THR A CA  1 
ATOM   3864  C  C   . THR A 1  504 ? -28.307 -20.616 98.107  1.00 24.87  ? 602  THR A C   1 
ATOM   3865  O  O   . THR A 1  504 ? -28.657 -21.111 99.179  1.00 22.54  ? 602  THR A O   1 
ATOM   3866  C  CB  . THR A 1  504 ? -26.057 -21.137 97.158  1.00 18.75  ? 602  THR A CB  1 
ATOM   3867  O  OG1 . THR A 1  504 ? -25.347 -21.900 96.175  1.00 18.39  ? 602  THR A OG1 1 
ATOM   3868  C  CG2 . THR A 1  504 ? -25.518 -21.466 98.541  1.00 17.16  ? 602  THR A CG2 1 
ATOM   3869  N  N   . LEU A 1  505 ? -28.556 -19.351 97.779  1.00 13.12  ? 603  LEU A N   1 
ATOM   3870  C  CA  . LEU A 1  505 ? -29.258 -18.451 98.688  1.00 20.16  ? 603  LEU A CA  1 
ATOM   3871  C  C   . LEU A 1  505 ? -30.711 -18.874 98.872  1.00 20.44  ? 603  LEU A C   1 
ATOM   3872  O  O   . LEU A 1  505 ? -31.205 -18.945 99.997  1.00 23.43  ? 603  LEU A O   1 
ATOM   3873  C  CB  . LEU A 1  505 ? -29.201 -17.009 98.185  1.00 19.00  ? 603  LEU A CB  1 
ATOM   3874  C  CG  . LEU A 1  505 ? -29.994 -16.022 99.044  1.00 19.53  ? 603  LEU A CG  1 
ATOM   3875  C  CD1 . LEU A 1  505 ? -29.529 -16.072 100.495 1.00 17.16  ? 603  LEU A CD1 1 
ATOM   3876  C  CD2 . LEU A 1  505 ? -29.896 -14.608 98.496  1.00 20.22  ? 603  LEU A CD2 1 
ATOM   3877  N  N   . SER A 1  506 ? -31.390 -19.139 97.761  1.00 21.35  ? 604  SER A N   1 
ATOM   3878  C  CA  . SER A 1  506 ? -32.785 -19.565 97.791  1.00 20.35  ? 604  SER A CA  1 
ATOM   3879  C  C   . SER A 1  506 ? -32.963 -20.845 98.603  1.00 18.36  ? 604  SER A C   1 
ATOM   3880  O  O   . SER A 1  506 ? -33.993 -21.041 99.246  1.00 15.90  ? 604  SER A O   1 
ATOM   3881  C  CB  . SER A 1  506 ? -33.311 -19.770 96.369  1.00 22.12  ? 604  SER A CB  1 
ATOM   3882  O  OG  . SER A 1  506 ? -33.489 -18.528 95.714  1.00 27.32  ? 604  SER A OG  1 
ATOM   3883  N  N   . ALA A 1  507 ? -31.956 -21.713 98.569  1.00 20.05  ? 605  ALA A N   1 
ATOM   3884  C  CA  . ALA A 1  507 ? -31.982 -22.937 99.360  1.00 20.67  ? 605  ALA A CA  1 
ATOM   3885  C  C   . ALA A 1  507 ? -31.914 -22.626 100.851 1.00 19.34  ? 605  ALA A C   1 
ATOM   3886  O  O   . ALA A 1  507 ? -32.692 -23.162 101.638 1.00 20.35  ? 605  ALA A O   1 
ATOM   3887  C  CB  . ALA A 1  507 ? -30.837 -23.855 98.959  1.00 14.18  ? 605  ALA A CB  1 
ATOM   3888  N  N   . TYR A 1  508 ? -30.991 -21.747 101.228 1.00 16.94  ? 606  TYR A N   1 
ATOM   3889  C  CA  . TYR A 1  508 ? -30.807 -21.382 102.630 1.00 19.40  ? 606  TYR A CA  1 
ATOM   3890  C  C   . TYR A 1  508 ? -32.033 -20.675 103.199 1.00 19.22  ? 606  TYR A C   1 
ATOM   3891  O  O   . TYR A 1  508 ? -32.465 -20.973 104.311 1.00 18.91  ? 606  TYR A O   1 
ATOM   3892  C  CB  . TYR A 1  508 ? -29.572 -20.493 102.795 1.00 12.45  ? 606  TYR A CB  1 
ATOM   3893  C  CG  . TYR A 1  508 ? -28.266 -21.255 102.783 1.00 12.52  ? 606  TYR A CG  1 
ATOM   3894  C  CD1 . TYR A 1  508 ? -28.130 -22.452 103.474 1.00 19.50  ? 606  TYR A CD1 1 
ATOM   3895  C  CD2 . TYR A 1  508 ? -27.168 -20.777 102.079 1.00 15.05  ? 606  TYR A CD2 1 
ATOM   3896  C  CE1 . TYR A 1  508 ? -26.935 -23.154 103.464 1.00 17.71  ? 606  TYR A CE1 1 
ATOM   3897  C  CE2 . TYR A 1  508 ? -25.969 -21.471 102.063 1.00 14.67  ? 606  TYR A CE2 1 
ATOM   3898  C  CZ  . TYR A 1  508 ? -25.858 -22.657 102.757 1.00 13.96  ? 606  TYR A CZ  1 
ATOM   3899  O  OH  . TYR A 1  508 ? -24.670 -23.348 102.744 1.00 15.46  ? 606  TYR A OH  1 
ATOM   3900  N  N   . ILE A 1  509 ? -32.593 -19.746 102.429 1.00 19.83  ? 607  ILE A N   1 
ATOM   3901  C  CA  . ILE A 1  509 ? -33.797 -19.035 102.844 1.00 15.43  ? 607  ILE A CA  1 
ATOM   3902  C  C   . ILE A 1  509 ? -34.915 -20.032 103.116 1.00 16.80  ? 607  ILE A C   1 
ATOM   3903  O  O   . ILE A 1  509 ? -35.600 -19.954 104.133 1.00 16.37  ? 607  ILE A O   1 
ATOM   3904  C  CB  . ILE A 1  509 ? -34.249 -18.020 101.780 1.00 15.49  ? 607  ILE A CB  1 
ATOM   3905  C  CG1 . ILE A 1  509 ? -33.220 -16.895 101.654 1.00 16.01  ? 607  ILE A CG1 1 
ATOM   3906  C  CG2 . ILE A 1  509 ? -35.614 -17.454 102.129 1.00 13.28  ? 607  ILE A CG2 1 
ATOM   3907  C  CD1 . ILE A 1  509 ? -33.546 -15.877 100.580 1.00 17.01  ? 607  ILE A CD1 1 
ATOM   3908  N  N   . GLN A 1  510 ? -35.063 -20.986 102.206 1.00 16.97  ? 608  GLN A N   1 
ATOM   3909  C  CA  . GLN A 1  510 ? -36.028 -22.067 102.352 1.00 17.39  ? 608  GLN A CA  1 
ATOM   3910  C  C   . GLN A 1  510 ? -35.746 -22.903 103.601 1.00 22.44  ? 608  GLN A C   1 
ATOM   3911  O  O   . GLN A 1  510 ? -36.648 -23.178 104.392 1.00 23.53  ? 608  GLN A O   1 
ATOM   3912  C  CB  . GLN A 1  510 ? -36.001 -22.949 101.107 1.00 15.51  ? 608  GLN A CB  1 
ATOM   3913  C  CG  . GLN A 1  510 ? -36.901 -24.160 101.165 1.00 20.72  ? 608  GLN A CG  1 
ATOM   3914  C  CD  . GLN A 1  510 ? -36.770 -25.014 99.924  1.00 29.64  ? 608  GLN A CD  1 
ATOM   3915  O  OE1 . GLN A 1  510 ? -37.198 -24.621 98.837  1.00 31.29  ? 608  GLN A OE1 1 
ATOM   3916  N  NE2 . GLN A 1  510 ? -36.167 -26.189 100.075 1.00 29.52  ? 608  GLN A NE2 1 
ATOM   3917  N  N   . LEU A 1  511 ? -34.487 -23.299 103.767 1.00 18.80  ? 609  LEU A N   1 
ATOM   3918  C  CA  . LEU A 1  511 ? -34.068 -24.125 104.896 1.00 15.86  ? 609  LEU A CA  1 
ATOM   3919  C  C   . LEU A 1  511 ? -34.223 -23.408 106.235 1.00 17.86  ? 609  LEU A C   1 
ATOM   3920  O  O   . LEU A 1  511 ? -34.698 -23.994 107.208 1.00 20.49  ? 609  LEU A O   1 
ATOM   3921  C  CB  . LEU A 1  511 ? -32.614 -24.568 104.715 1.00 15.81  ? 609  LEU A CB  1 
ATOM   3922  C  CG  . LEU A 1  511 ? -32.340 -25.603 103.622 1.00 16.76  ? 609  LEU A CG  1 
ATOM   3923  C  CD1 . LEU A 1  511 ? -30.844 -25.776 103.418 1.00 17.15  ? 609  LEU A CD1 1 
ATOM   3924  C  CD2 . LEU A 1  511 ? -32.993 -26.933 103.959 1.00 14.97  ? 609  LEU A CD2 1 
ATOM   3925  N  N   . PHE A 1  512 ? -33.817 -22.142 106.284 1.00 19.68  ? 610  PHE A N   1 
ATOM   3926  C  CA  . PHE A 1  512 ? -33.880 -21.372 107.524 1.00 17.82  ? 610  PHE A CA  1 
ATOM   3927  C  C   . PHE A 1  512 ? -35.304 -20.943 107.867 1.00 17.79  ? 610  PHE A C   1 
ATOM   3928  O  O   . PHE A 1  512 ? -35.649 -20.835 109.044 1.00 19.53  ? 610  PHE A O   1 
ATOM   3929  C  CB  . PHE A 1  512 ? -32.965 -20.147 107.446 1.00 16.98  ? 610  PHE A CB  1 
ATOM   3930  C  CG  . PHE A 1  512 ? -31.527 -20.448 107.761 1.00 12.68  ? 610  PHE A CG  1 
ATOM   3931  C  CD1 . PHE A 1  512 ? -31.080 -20.450 109.071 1.00 16.37  ? 610  PHE A CD1 1 
ATOM   3932  C  CD2 . PHE A 1  512 ? -30.624 -20.731 106.752 1.00 12.55  ? 610  PHE A CD2 1 
ATOM   3933  C  CE1 . PHE A 1  512 ? -29.757 -20.728 109.366 1.00 17.00  ? 610  PHE A CE1 1 
ATOM   3934  C  CE2 . PHE A 1  512 ? -29.302 -21.010 107.040 1.00 12.66  ? 610  PHE A CE2 1 
ATOM   3935  C  CZ  . PHE A 1  512 ? -28.868 -21.007 108.348 1.00 12.61  ? 610  PHE A CZ  1 
ATOM   3936  N  N   . ARG A 1  513 ? -36.122 -20.687 106.848 1.00 18.60  ? 611  ARG A N   1 
ATOM   3937  C  CA  . ARG A 1  513 ? -37.545 -20.442 107.070 1.00 19.04  ? 611  ARG A CA  1 
ATOM   3938  C  C   . ARG A 1  513 ? -38.159 -21.627 107.803 1.00 22.54  ? 611  ARG A C   1 
ATOM   3939  O  O   . ARG A 1  513 ? -38.912 -21.458 108.760 1.00 27.94  ? 611  ARG A O   1 
ATOM   3940  C  CB  . ARG A 1  513 ? -38.288 -20.195 105.753 1.00 15.71  ? 611  ARG A CB  1 
ATOM   3941  C  CG  . ARG A 1  513 ? -38.251 -18.745 105.283 1.00 17.82  ? 611  ARG A CG  1 
ATOM   3942  C  CD  . ARG A 1  513 ? -38.891 -18.562 103.914 1.00 21.54  ? 611  ARG A CD  1 
ATOM   3943  N  NE  . ARG A 1  513 ? -40.347 -18.693 103.958 1.00 30.83  ? 611  ARG A NE  1 
ATOM   3944  C  CZ  . ARG A 1  513 ? -41.017 -19.799 103.651 1.00 39.71  ? 611  ARG A CZ  1 
ATOM   3945  N  NH1 . ARG A 1  513 ? -40.368 -20.891 103.273 1.00 43.99  ? 611  ARG A NH1 1 
ATOM   3946  N  NH2 . ARG A 1  513 ? -42.341 -19.813 103.724 1.00 40.49  ? 611  ARG A NH2 1 
ATOM   3947  N  N   . ASN A 1  514 ? -37.824 -22.827 107.338 1.00 19.85  ? 612  ASN A N   1 
ATOM   3948  C  CA  . ASN A 1  514 ? -38.331 -24.061 107.924 1.00 19.34  ? 612  ASN A CA  1 
ATOM   3949  C  C   . ASN A 1  514 ? -37.912 -24.220 109.381 1.00 20.96  ? 612  ASN A C   1 
ATOM   3950  O  O   . ASN A 1  514 ? -38.715 -24.604 110.232 1.00 21.00  ? 612  ASN A O   1 
ATOM   3951  C  CB  . ASN A 1  514 ? -37.857 -25.266 107.108 1.00 18.86  ? 612  ASN A CB  1 
ATOM   3952  C  CG  . ASN A 1  514 ? -38.544 -26.552 107.515 1.00 28.20  ? 612  ASN A CG  1 
ATOM   3953  O  OD1 . ASN A 1  514 ? -39.755 -26.580 107.737 1.00 36.85  ? 612  ASN A OD1 1 
ATOM   3954  N  ND2 . ASN A 1  514 ? -37.772 -27.627 107.617 1.00 29.27  ? 612  ASN A ND2 1 
ATOM   3955  N  N   . LEU A 1  515 ? -36.644 -23.934 109.655 1.00 21.29  ? 613  LEU A N   1 
ATOM   3956  C  CA  . LEU A 1  515 ? -36.125 -23.959 111.017 1.00 21.33  ? 613  LEU A CA  1 
ATOM   3957  C  C   . LEU A 1  515 ? -36.915 -23.023 111.929 1.00 20.03  ? 613  LEU A C   1 
ATOM   3958  O  O   . LEU A 1  515 ? -37.309 -23.405 113.030 1.00 22.23  ? 613  LEU A O   1 
ATOM   3959  C  CB  . LEU A 1  515 ? -34.642 -23.588 111.027 1.00 23.28  ? 613  LEU A CB  1 
ATOM   3960  C  CG  . LEU A 1  515 ? -33.646 -24.750 111.010 1.00 22.06  ? 613  LEU A CG  1 
ATOM   3961  C  CD1 . LEU A 1  515 ? -34.033 -25.803 109.984 1.00 25.59  ? 613  LEU A CD1 1 
ATOM   3962  C  CD2 . LEU A 1  515 ? -32.253 -24.229 110.729 1.00 19.69  ? 613  LEU A CD2 1 
ATOM   3963  N  N   . ALA A 1  516 ? -37.143 -21.801 111.458 1.00 18.81  ? 614  ALA A N   1 
ATOM   3964  C  CA  . ALA A 1  516 ? -37.912 -20.809 112.202 1.00 17.05  ? 614  ALA A CA  1 
ATOM   3965  C  C   . ALA A 1  516 ? -39.333 -21.295 112.471 1.00 20.76  ? 614  ALA A C   1 
ATOM   3966  O  O   . ALA A 1  516 ? -39.867 -21.112 113.565 1.00 24.24  ? 614  ALA A O   1 
ATOM   3967  C  CB  . ALA A 1  516 ? -37.941 -19.489 111.448 1.00 14.53  ? 614  ALA A CB  1 
ATOM   3968  N  N   . LYS A 1  517 ? -39.933 -21.918 111.462 1.00 22.94  ? 615  LYS A N   1 
ATOM   3969  C  CA  . LYS A 1  517 ? -41.282 -22.459 111.571 1.00 18.96  ? 615  LYS A CA  1 
ATOM   3970  C  C   . LYS A 1  517 ? -41.359 -23.557 112.625 1.00 17.73  ? 615  LYS A C   1 
ATOM   3971  O  O   . LYS A 1  517 ? -42.316 -23.622 113.393 1.00 19.85  ? 615  LYS A O   1 
ATOM   3972  C  CB  . LYS A 1  517 ? -41.745 -22.993 110.213 1.00 21.69  ? 615  LYS A CB  1 
ATOM   3973  C  CG  . LYS A 1  517 ? -43.137 -23.602 110.208 1.00 26.75  ? 615  LYS A CG  1 
ATOM   3974  C  CD  . LYS A 1  517 ? -43.409 -24.308 108.887 1.00 28.82  ? 615  LYS A CD  1 
ATOM   3975  C  CE  . LYS A 1  517 ? -44.823 -24.856 108.827 1.00 32.04  ? 615  LYS A CE  1 
ATOM   3976  N  NZ  . LYS A 1  517 ? -45.086 -25.574 107.546 1.00 32.62  ? 615  LYS A NZ  1 
ATOM   3977  N  N   . ALA A 1  518 ? -40.341 -24.411 112.662 1.00 18.71  ? 616  ALA A N   1 
ATOM   3978  C  CA  . ALA A 1  518 ? -40.283 -25.494 113.639 1.00 19.86  ? 616  ALA A CA  1 
ATOM   3979  C  C   . ALA A 1  518 ? -40.184 -24.954 115.063 1.00 20.83  ? 616  ALA A C   1 
ATOM   3980  O  O   . ALA A 1  518 ? -40.749 -25.526 115.995 1.00 19.34  ? 616  ALA A O   1 
ATOM   3981  C  CB  . ALA A 1  518 ? -39.112 -26.412 113.340 1.00 20.63  ? 616  ALA A CB  1 
ATOM   3982  N  N   . ILE A 1  519 ? -39.469 -23.845 115.223 1.00 19.73  ? 617  ILE A N   1 
ATOM   3983  C  CA  . ILE A 1  519 ? -39.298 -23.226 116.531 1.00 21.49  ? 617  ILE A CA  1 
ATOM   3984  C  C   . ILE A 1  519 ? -40.594 -22.577 117.005 1.00 24.97  ? 617  ILE A C   1 
ATOM   3985  O  O   . ILE A 1  519 ? -41.009 -22.761 118.151 1.00 24.54  ? 617  ILE A O   1 
ATOM   3986  C  CB  . ILE A 1  519 ? -38.175 -22.166 116.507 1.00 20.05  ? 617  ILE A CB  1 
ATOM   3987  C  CG1 . ILE A 1  519 ? -36.817 -22.828 116.266 1.00 17.56  ? 617  ILE A CG1 1 
ATOM   3988  C  CG2 . ILE A 1  519 ? -38.152 -21.369 117.804 1.00 17.26  ? 617  ILE A CG2 1 
ATOM   3989  C  CD1 . ILE A 1  519 ? -35.666 -21.847 116.155 1.00 16.01  ? 617  ILE A CD1 1 
ATOM   3990  N  N   . ALA A 1  520 ? -41.233 -21.828 116.111 1.00 25.98  ? 618  ALA A N   1 
ATOM   3991  C  CA  . ALA A 1  520 ? -42.461 -21.105 116.434 1.00 21.56  ? 618  ALA A CA  1 
ATOM   3992  C  C   . ALA A 1  520 ? -43.638 -22.042 116.704 1.00 22.23  ? 618  ALA A C   1 
ATOM   3993  O  O   . ALA A 1  520 ? -44.436 -21.800 117.609 1.00 22.73  ? 618  ALA A O   1 
ATOM   3994  C  CB  . ALA A 1  520 ? -42.805 -20.138 115.314 1.00 18.79  ? 618  ALA A CB  1 
ATOM   3995  N  N   . THR A 1  521 ? -43.748 -23.103 115.912 1.00 23.01  ? 619  THR A N   1 
ATOM   3996  C  CA  . THR A 1  521 ? -44.838 -24.062 116.064 1.00 22.45  ? 619  THR A CA  1 
ATOM   3997  C  C   . THR A 1  521 ? -44.523 -25.131 117.105 1.00 21.92  ? 619  THR A C   1 
ATOM   3998  O  O   . THR A 1  521 ? -45.338 -26.021 117.347 1.00 23.95  ? 619  THR A O   1 
ATOM   3999  C  CB  . THR A 1  521 ? -45.168 -24.762 114.731 1.00 21.41  ? 619  THR A CB  1 
ATOM   4000  O  OG1 . THR A 1  521 ? -44.027 -25.507 114.284 1.00 19.27  ? 619  THR A OG1 1 
ATOM   4001  C  CG2 . THR A 1  521 ? -45.554 -23.741 113.670 1.00 18.97  ? 619  THR A CG2 1 
ATOM   4002  N  N   . ASP A 1  522 ? -43.334 -25.043 117.696 1.00 23.35  ? 620  ASP A N   1 
ATOM   4003  C  CA  . ASP A 1  522 ? -42.888 -25.975 118.730 1.00 25.22  ? 620  ASP A CA  1 
ATOM   4004  C  C   . ASP A 1  522 ? -42.838 -27.416 118.214 1.00 26.60  ? 620  ASP A C   1 
ATOM   4005  O  O   . ASP A 1  522 ? -43.245 -28.350 118.905 1.00 22.03  ? 620  ASP A O   1 
ATOM   4006  C  CB  . ASP A 1  522 ? -43.792 -25.875 119.964 1.00 29.67  ? 620  ASP A CB  1 
ATOM   4007  C  CG  . ASP A 1  522 ? -43.062 -26.204 121.250 1.00 42.10  ? 620  ASP A CG  1 
ATOM   4008  O  OD1 . ASP A 1  522 ? -42.847 -27.404 121.529 1.00 45.32  ? 620  ASP A OD1 1 
ATOM   4009  O  OD2 . ASP A 1  522 ? -42.699 -25.260 121.983 1.00 49.43  ? 620  ASP A OD2 1 
ATOM   4010  N  N   . THR A 1  523 ? -42.351 -27.585 116.988 1.00 25.21  ? 621  THR A N   1 
ATOM   4011  C  CA  . THR A 1  523 ? -42.234 -28.909 116.381 1.00 27.26  ? 621  THR A CA  1 
ATOM   4012  C  C   . THR A 1  523 ? -40.823 -29.181 115.857 1.00 30.31  ? 621  THR A C   1 
ATOM   4013  O  O   . THR A 1  523 ? -40.659 -29.824 114.820 1.00 34.62  ? 621  THR A O   1 
ATOM   4014  C  CB  . THR A 1  523 ? -43.230 -29.088 115.214 1.00 26.29  ? 621  THR A CB  1 
ATOM   4015  O  OG1 . THR A 1  523 ? -42.900 -28.180 114.155 1.00 27.59  ? 621  THR A OG1 1 
ATOM   4016  C  CG2 . THR A 1  523 ? -44.658 -28.832 115.675 1.00 23.74  ? 621  THR A CG2 1 
ATOM   4017  N  N   . VAL A 1  524 ? -39.811 -28.691 116.568 1.00 28.13  ? 622  VAL A N   1 
ATOM   4018  C  CA  . VAL A 1  524 ? -38.422 -28.875 116.146 1.00 30.97  ? 622  VAL A CA  1 
ATOM   4019  C  C   . VAL A 1  524 ? -38.042 -30.357 116.171 1.00 34.53  ? 622  VAL A C   1 
ATOM   4020  O  O   . VAL A 1  524 ? -37.157 -30.792 115.432 1.00 38.74  ? 622  VAL A O   1 
ATOM   4021  C  CB  . VAL A 1  524 ? -37.437 -28.049 117.020 1.00 26.80  ? 622  VAL A CB  1 
ATOM   4022  C  CG1 . VAL A 1  524 ? -38.175 -26.931 117.743 1.00 26.59  ? 622  VAL A CG1 1 
ATOM   4023  C  CG2 . VAL A 1  524 ? -36.687 -28.931 118.011 1.00 27.14  ? 622  VAL A CG2 1 
ATOM   4024  N  N   . ALA A 1  525 ? -38.707 -31.123 117.032 1.00 31.30  ? 623  ALA A N   1 
ATOM   4025  C  CA  . ALA A 1  525 ? -38.481 -32.561 117.121 1.00 30.74  ? 623  ALA A CA  1 
ATOM   4026  C  C   . ALA A 1  525 ? -38.952 -33.264 115.853 1.00 33.38  ? 623  ALA A C   1 
ATOM   4027  O  O   . ALA A 1  525 ? -38.524 -34.379 115.553 1.00 34.37  ? 623  ALA A O   1 
ATOM   4028  C  CB  . ALA A 1  525 ? -39.182 -33.136 118.339 1.00 29.95  ? 623  ALA A CB  1 
ATOM   4029  N  N   . ASN A 1  526 ? -39.847 -32.611 115.117 1.00 34.33  ? 624  ASN A N   1 
ATOM   4030  C  CA  . ASN A 1  526 ? -40.381 -33.184 113.888 1.00 34.61  ? 624  ASN A CA  1 
ATOM   4031  C  C   . ASN A 1  526 ? -39.430 -32.959 112.715 1.00 26.93  ? 624  ASN A C   1 
ATOM   4032  O  O   . ASN A 1  526 ? -39.609 -33.531 111.639 1.00 24.62  ? 624  ASN A O   1 
ATOM   4033  C  CB  . ASN A 1  526 ? -41.760 -32.597 113.577 1.00 40.21  ? 624  ASN A CB  1 
ATOM   4034  C  CG  . ASN A 1  526 ? -42.508 -33.393 112.520 1.00 45.38  ? 624  ASN A CG  1 
ATOM   4035  O  OD1 . ASN A 1  526 ? -42.798 -34.575 112.706 1.00 46.43  ? 624  ASN A OD1 1 
ATOM   4036  N  ND2 . ASN A 1  526 ? -42.821 -32.747 111.401 1.00 46.39  ? 624  ASN A ND2 1 
ATOM   4037  N  N   . LEU A 1  527 ? -38.415 -32.127 112.931 1.00 23.67  ? 625  LEU A N   1 
ATOM   4038  C  CA  . LEU A 1  527 ? -37.367 -31.932 111.933 1.00 21.04  ? 625  LEU A CA  1 
ATOM   4039  C  C   . LEU A 1  527 ? -36.524 -33.191 111.791 1.00 26.01  ? 625  LEU A C   1 
ATOM   4040  O  O   . LEU A 1  527 ? -36.148 -33.812 112.785 1.00 29.31  ? 625  LEU A O   1 
ATOM   4041  C  CB  . LEU A 1  527 ? -36.467 -30.750 112.304 1.00 18.70  ? 625  LEU A CB  1 
ATOM   4042  C  CG  . LEU A 1  527 ? -37.012 -29.327 112.180 1.00 20.81  ? 625  LEU A CG  1 
ATOM   4043  C  CD1 . LEU A 1  527 ? -36.091 -28.348 112.890 1.00 17.49  ? 625  LEU A CD1 1 
ATOM   4044  C  CD2 . LEU A 1  527 ? -37.179 -28.940 110.720 1.00 17.39  ? 625  LEU A CD2 1 
ATOM   4045  N  N   . SER A 1  528 ? -36.230 -33.565 110.552 1.00 29.54  ? 626  SER A N   1 
ATOM   4046  C  CA  . SER A 1  528 ? -35.339 -34.686 110.284 1.00 33.92  ? 626  SER A CA  1 
ATOM   4047  C  C   . SER A 1  528 ? -33.899 -34.312 110.625 1.00 37.29  ? 626  SER A C   1 
ATOM   4048  O  O   . SER A 1  528 ? -33.449 -33.211 110.304 1.00 36.44  ? 626  SER A O   1 
ATOM   4049  C  CB  . SER A 1  528 ? -35.450 -35.122 108.822 1.00 34.91  ? 626  SER A CB  1 
ATOM   4050  O  OG  . SER A 1  528 ? -35.120 -34.057 107.949 1.00 35.92  ? 626  SER A OG  1 
ATOM   4051  N  N   . ARG A 1  529 ? -33.194 -35.220 111.296 1.00 37.89  ? 627  ARG A N   1 
ATOM   4052  C  CA  . ARG A 1  529 ? -31.802 -34.998 111.681 1.00 35.10  ? 627  ARG A CA  1 
ATOM   4053  C  C   . ARG A 1  529 ? -30.915 -34.565 110.517 1.00 30.58  ? 627  ARG A C   1 
ATOM   4054  O  O   . ARG A 1  529 ? -30.061 -33.688 110.662 1.00 24.20  ? 627  ARG A O   1 
ATOM   4055  C  CB  . ARG A 1  529 ? -31.212 -36.270 112.300 1.00 39.47  ? 627  ARG A CB  1 
ATOM   4056  C  CG  . ARG A 1  529 ? -29.779 -36.098 112.784 1.00 48.71  ? 627  ARG A CG  1 
ATOM   4057  C  CD  . ARG A 1  529 ? -29.110 -37.434 113.072 1.00 59.13  ? 627  ARG A CD  1 
ATOM   4058  N  NE  . ARG A 1  529 ? -29.098 -37.770 114.491 1.00 67.38  ? 627  ARG A NE  1 
ATOM   4059  C  CZ  . ARG A 1  529 ? -28.276 -38.664 115.032 1.00 73.21  ? 627  ARG A CZ  1 
ATOM   4060  N  NH1 . ARG A 1  529 ? -27.398 -39.304 114.271 1.00 74.38  ? 627  ARG A NH1 1 
ATOM   4061  N  NH2 . ARG A 1  529 ? -28.327 -38.914 116.334 1.00 75.57  ? 627  ARG A NH2 1 
ATOM   4062  N  N   . GLY A 1  530 ? -31.134 -35.177 109.359 1.00 29.72  ? 628  GLY A N   1 
ATOM   4063  C  CA  . GLY A 1  530 ? -30.278 -34.950 108.213 1.00 24.82  ? 628  GLY A CA  1 
ATOM   4064  C  C   . GLY A 1  530 ? -29.071 -35.870 108.256 1.00 24.23  ? 628  GLY A C   1 
ATOM   4065  O  O   . GLY A 1  530 ? -28.764 -36.447 109.300 1.00 21.63  ? 628  GLY A O   1 
ATOM   4066  N  N   . PRO A 1  531 ? -28.378 -36.014 107.118 1.00 24.79  ? 629  PRO A N   1 
ATOM   4067  C  CA  . PRO A 1  531 ? -27.211 -36.896 107.004 1.00 25.32  ? 629  PRO A CA  1 
ATOM   4068  C  C   . PRO A 1  531 ? -26.050 -36.440 107.883 1.00 27.98  ? 629  PRO A C   1 
ATOM   4069  O  O   . PRO A 1  531 ? -25.687 -35.268 107.861 1.00 29.78  ? 629  PRO A O   1 
ATOM   4070  C  CB  . PRO A 1  531 ? -26.843 -36.796 105.522 1.00 25.78  ? 629  PRO A CB  1 
ATOM   4071  C  CG  . PRO A 1  531 ? -27.364 -35.462 105.100 1.00 24.90  ? 629  PRO A CG  1 
ATOM   4072  C  CD  . PRO A 1  531 ? -28.629 -35.264 105.876 1.00 24.51  ? 629  PRO A CD  1 
ATOM   4073  N  N   . GLU A 1  532 ? -25.477 -37.365 108.644 1.00 34.93  ? 630  GLU A N   1 
ATOM   4074  C  CA  . GLU A 1  532 ? -24.360 -37.042 109.523 1.00 42.99  ? 630  GLU A CA  1 
ATOM   4075  C  C   . GLU A 1  532 ? -23.080 -36.782 108.731 1.00 43.15  ? 630  GLU A C   1 
ATOM   4076  O  O   . GLU A 1  532 ? -22.742 -37.543 107.825 1.00 43.28  ? 630  GLU A O   1 
ATOM   4077  C  CB  . GLU A 1  532 ? -24.141 -38.171 110.532 1.00 49.22  ? 630  GLU A CB  1 
ATOM   4078  C  CG  . GLU A 1  532 ? -22.979 -37.951 111.480 1.00 54.53  ? 630  GLU A CG  1 
ATOM   4079  C  CD  . GLU A 1  532 ? -22.959 -38.958 112.610 1.00 62.73  ? 630  GLU A CD  1 
ATOM   4080  O  OE1 . GLU A 1  532 ? -24.032 -39.516 112.925 1.00 62.33  ? 630  GLU A OE1 1 
ATOM   4081  O  OE2 . GLU A 1  532 ? -21.872 -39.197 113.177 1.00 67.42  ? 630  GLU A OE2 1 
ATOM   4082  N  N   . PRO A 1  533 ? -22.365 -35.697 109.072 1.00 42.60  ? 631  PRO A N   1 
ATOM   4083  C  CA  . PRO A 1  533 ? -21.094 -35.361 108.420 1.00 43.40  ? 631  PRO A CA  1 
ATOM   4084  C  C   . PRO A 1  533 ? -19.959 -36.284 108.867 1.00 46.08  ? 631  PRO A C   1 
ATOM   4085  O  O   . PRO A 1  533 ? -20.015 -36.833 109.969 1.00 40.07  ? 631  PRO A O   1 
ATOM   4086  C  CB  . PRO A 1  533 ? -20.842 -33.918 108.869 1.00 39.41  ? 631  PRO A CB  1 
ATOM   4087  C  CG  . PRO A 1  533 ? -21.569 -33.789 110.159 1.00 37.57  ? 631  PRO A CG  1 
ATOM   4088  C  CD  . PRO A 1  533 ? -22.774 -34.678 110.054 1.00 38.11  ? 631  PRO A CD  1 
ATOM   4089  N  N   . PRO A 1  534 ? -18.929 -36.447 108.021 1.00 56.02  ? 632  PRO A N   1 
ATOM   4090  C  CA  . PRO A 1  534 ? -17.837 -37.386 108.302 1.00 62.12  ? 632  PRO A CA  1 
ATOM   4091  C  C   . PRO A 1  534 ? -16.729 -36.795 109.168 1.00 68.22  ? 632  PRO A C   1 
ATOM   4092  O  O   . PRO A 1  534 ? -16.581 -35.574 109.242 1.00 67.45  ? 632  PRO A O   1 
ATOM   4093  C  CB  . PRO A 1  534 ? -17.306 -37.713 106.908 1.00 59.51  ? 632  PRO A CB  1 
ATOM   4094  C  CG  . PRO A 1  534 ? -17.534 -36.457 106.134 1.00 56.52  ? 632  PRO A CG  1 
ATOM   4095  C  CD  . PRO A 1  534 ? -18.778 -35.810 106.699 1.00 55.87  ? 632  PRO A CD  1 
ATOM   4096  N  N   . PHE A 1  535 ? -15.960 -37.664 109.817 1.00 73.80  ? 633  PHE A N   1 
ATOM   4097  C  CA  . PHE A 1  535 ? -14.783 -37.238 110.566 1.00 75.89  ? 633  PHE A CA  1 
ATOM   4098  C  C   . PHE A 1  535 ? -13.536 -37.972 110.086 1.00 76.39  ? 633  PHE A C   1 
ATOM   4099  O  O   . PHE A 1  535 ? -13.239 -39.081 110.533 1.00 76.71  ? 633  PHE A O   1 
ATOM   4100  C  CB  . PHE A 1  535 ? -14.983 -37.464 112.066 1.00 79.03  ? 633  PHE A CB  1 
ATOM   4101  C  CG  . PHE A 1  535 ? -14.019 -36.694 112.928 1.00 81.37  ? 633  PHE A CG  1 
ATOM   4102  C  CD1 . PHE A 1  535 ? -14.278 -35.378 113.277 1.00 80.75  ? 633  PHE A CD1 1 
ATOM   4103  C  CD2 . PHE A 1  535 ? -12.852 -37.285 113.384 1.00 83.11  ? 633  PHE A CD2 1 
ATOM   4104  C  CE1 . PHE A 1  535 ? -13.392 -34.667 114.067 1.00 80.62  ? 633  PHE A CE1 1 
ATOM   4105  C  CE2 . PHE A 1  535 ? -11.962 -36.579 114.173 1.00 82.67  ? 633  PHE A CE2 1 
ATOM   4106  C  CZ  . PHE A 1  535 ? -12.233 -35.269 114.515 1.00 81.38  ? 633  PHE A CZ  1 
ATOM   4107  N  N   . PHE A 1  536 ? -12.816 -37.340 109.166 1.00 76.24  ? 634  PHE A N   1 
ATOM   4108  C  CA  . PHE A 1  536 ? -11.619 -37.919 108.564 1.00 78.20  ? 634  PHE A CA  1 
ATOM   4109  C  C   . PHE A 1  536 ? -10.500 -38.035 109.594 1.00 77.75  ? 634  PHE A C   1 
ATOM   4110  O  O   . PHE A 1  536 ? -10.299 -37.121 110.393 1.00 80.02  ? 634  PHE A O   1 
ATOM   4111  C  CB  . PHE A 1  536 ? -11.156 -37.069 107.377 1.00 80.07  ? 634  PHE A CB  1 
ATOM   4112  C  CG  . PHE A 1  536 ? -12.240 -36.783 106.374 1.00 81.77  ? 634  PHE A CG  1 
ATOM   4113  C  CD1 . PHE A 1  536 ? -13.131 -37.771 105.989 1.00 83.47  ? 634  PHE A CD1 1 
ATOM   4114  C  CD2 . PHE A 1  536 ? -12.368 -35.519 105.820 1.00 78.82  ? 634  PHE A CD2 1 
ATOM   4115  C  CE1 . PHE A 1  536 ? -14.128 -37.505 105.068 1.00 81.64  ? 634  PHE A CE1 1 
ATOM   4116  C  CE2 . PHE A 1  536 ? -13.362 -35.246 104.899 1.00 76.76  ? 634  PHE A CE2 1 
ATOM   4117  C  CZ  . PHE A 1  536 ? -14.243 -36.240 104.523 1.00 78.66  ? 634  PHE A CZ  1 
ATOM   4118  N  N   . LYS A 1  537 ? -9.769  -39.147 109.578 1.00 88.38  ? 635  LYS A N   1 
ATOM   4119  C  CA  . LYS A 1  537 ? -8.729  -39.364 110.577 1.00 85.96  ? 635  LYS A CA  1 
ATOM   4120  C  C   . LYS A 1  537 ? -7.466  -38.615 110.167 1.00 84.10  ? 635  LYS A C   1 
ATOM   4121  O  O   . LYS A 1  537 ? -6.922  -37.830 110.943 1.00 81.38  ? 635  LYS A O   1 
ATOM   4122  C  CB  . LYS A 1  537 ? -8.405  -40.853 110.738 1.00 86.34  ? 635  LYS A CB  1 
ATOM   4123  C  CG  . LYS A 1  537 ? -9.536  -41.734 111.234 1.00 88.63  ? 635  LYS A CG  1 
ATOM   4124  C  CD  . LYS A 1  537 ? -9.020  -43.153 111.406 1.00 90.77  ? 635  LYS A CD  1 
ATOM   4125  C  CE  . LYS A 1  537 ? -10.143 -44.165 111.499 1.00 92.42  ? 635  LYS A CE  1 
ATOM   4126  N  NZ  . LYS A 1  537 ? -9.614  -45.558 111.479 1.00 93.85  ? 635  LYS A NZ  1 
ATOM   4127  N  N   . GLN A 1  538 ? -7.010  -38.855 108.942 1.00 85.89  ? 636  GLN A N   1 
ATOM   4128  C  CA  . GLN A 1  538 ? -5.786  -38.238 108.440 1.00 86.95  ? 636  GLN A CA  1 
ATOM   4129  C  C   . GLN A 1  538 ? -6.132  -37.130 107.456 1.00 85.79  ? 636  GLN A C   1 
ATOM   4130  O  O   . GLN A 1  538 ? -5.506  -36.075 107.457 1.00 82.98  ? 636  GLN A O   1 
ATOM   4131  C  CB  . GLN A 1  538 ? -4.876  -39.279 107.782 1.00 88.81  ? 636  GLN A CB  1 
ATOM   4132  C  CG  . GLN A 1  538 ? -4.499  -40.450 108.694 1.00 91.51  ? 636  GLN A CG  1 
ATOM   4133  C  CD  . GLN A 1  538 ? -5.472  -41.622 108.574 1.00 94.54  ? 636  GLN A CD  1 
ATOM   4134  O  OE1 . GLN A 1  538 ? -6.355  -41.619 107.716 1.00 95.23  ? 636  GLN A OE1 1 
ATOM   4135  N  NE2 . GLN A 1  538 ? -5.322  -42.618 109.445 1.00 94.90  ? 636  GLN A NE2 1 
ATOM   4136  N  N   . ILE A 1  544 ? 7.701   -30.146 108.505 1.00 70.08  ? 642  ILE A N   1 
ATOM   4137  C  CA  . ILE A 1  544 ? 8.872   -29.491 109.073 1.00 69.68  ? 642  ILE A CA  1 
ATOM   4138  C  C   . ILE A 1  544 ? 9.640   -30.431 109.999 1.00 71.85  ? 642  ILE A C   1 
ATOM   4139  O  O   . ILE A 1  544 ? 9.112   -30.876 111.017 1.00 73.99  ? 642  ILE A O   1 
ATOM   4140  C  CB  . ILE A 1  544 ? 8.484   -28.218 109.852 1.00 67.19  ? 642  ILE A CB  1 
ATOM   4141  C  CG1 . ILE A 1  544 ? 7.767   -27.227 108.932 1.00 64.18  ? 642  ILE A CG1 1 
ATOM   4142  C  CG2 . ILE A 1  544 ? 9.715   -27.578 110.479 1.00 67.92  ? 642  ILE A CG2 1 
ATOM   4143  C  CD1 . ILE A 1  544 ? 7.333   -25.951 109.624 1.00 61.20  ? 642  ILE A CD1 1 
ATOM   4144  N  N   . PRO A 1  545 ? 10.896  -30.740 109.638 1.00 70.53  ? 643  PRO A N   1 
ATOM   4145  C  CA  . PRO A 1  545 ? 11.777  -31.594 110.445 1.00 69.09  ? 643  PRO A CA  1 
ATOM   4146  C  C   . PRO A 1  545 ? 12.105  -30.963 111.797 1.00 63.25  ? 643  PRO A C   1 
ATOM   4147  O  O   . PRO A 1  545 ? 12.176  -29.737 111.900 1.00 57.49  ? 643  PRO A O   1 
ATOM   4148  C  CB  . PRO A 1  545 ? 13.041  -31.727 109.586 1.00 69.78  ? 643  PRO A CB  1 
ATOM   4149  C  CG  . PRO A 1  545 ? 12.983  -30.605 108.612 1.00 69.51  ? 643  PRO A CG  1 
ATOM   4150  C  CD  . PRO A 1  545 ? 11.539  -30.290 108.392 1.00 69.87  ? 643  PRO A CD  1 
ATOM   4151  N  N   . SER A 1  546 ? 12.286  -31.793 112.820 1.00 62.01  ? 644  SER A N   1 
ATOM   4152  C  CA  . SER A 1  546 ? 12.548  -31.304 114.169 1.00 58.97  ? 644  SER A CA  1 
ATOM   4153  C  C   . SER A 1  546 ? 13.913  -30.626 114.247 1.00 51.92  ? 644  SER A C   1 
ATOM   4154  O  O   . SER A 1  546 ? 14.898  -31.125 113.705 1.00 52.03  ? 644  SER A O   1 
ATOM   4155  C  CB  . SER A 1  546 ? 12.469  -32.454 115.177 1.00 63.99  ? 644  SER A CB  1 
ATOM   4156  O  OG  . SER A 1  546 ? 12.750  -32.003 116.493 1.00 66.61  ? 644  SER A OG  1 
ATOM   4157  N  N   . ILE A 1  547 ? 13.965  -29.488 114.932 1.00 43.95  ? 645  ILE A N   1 
ATOM   4158  C  CA  . ILE A 1  547 ? 15.208  -28.737 115.083 1.00 40.78  ? 645  ILE A CA  1 
ATOM   4159  C  C   . ILE A 1  547 ? 15.498  -28.382 116.538 1.00 37.89  ? 645  ILE A C   1 
ATOM   4160  O  O   . ILE A 1  547 ? 14.634  -27.867 117.247 1.00 35.81  ? 645  ILE A O   1 
ATOM   4161  C  CB  . ILE A 1  547 ? 15.178  -27.437 114.250 1.00 34.87  ? 645  ILE A CB  1 
ATOM   4162  C  CG1 . ILE A 1  547 ? 15.035  -27.760 112.759 1.00 32.22  ? 645  ILE A CG1 1 
ATOM   4163  C  CG2 . ILE A 1  547 ? 16.427  -26.606 114.496 1.00 29.88  ? 645  ILE A CG2 1 
ATOM   4164  C  CD1 . ILE A 1  547 ? 15.050  -26.543 111.864 1.00 31.73  ? 645  ILE A CD1 1 
ATOM   4165  N  N   . VAL A 1  548 ? 16.724  -28.656 116.975 1.00 34.80  ? 646  VAL A N   1 
ATOM   4166  C  CA  . VAL A 1  548 ? 17.164  -28.271 118.309 1.00 34.79  ? 646  VAL A CA  1 
ATOM   4167  C  C   . VAL A 1  548 ? 17.633  -26.822 118.299 1.00 32.72  ? 646  VAL A C   1 
ATOM   4168  O  O   . VAL A 1  548 ? 18.530  -26.458 117.539 1.00 35.74  ? 646  VAL A O   1 
ATOM   4169  C  CB  . VAL A 1  548 ? 18.303  -29.177 118.817 1.00 37.17  ? 646  VAL A CB  1 
ATOM   4170  C  CG1 . VAL A 1  548 ? 18.936  -28.592 120.073 1.00 35.85  ? 646  VAL A CG1 1 
ATOM   4171  C  CG2 . VAL A 1  548 ? 17.786  -30.585 119.078 1.00 37.33  ? 646  VAL A CG2 1 
ATOM   4172  N  N   . ASP A 1  549 ? 17.019  -25.997 119.141 1.00 30.55  ? 647  ASP A N   1 
ATOM   4173  C  CA  . ASP A 1  549 ? 17.383  -24.587 119.233 1.00 28.46  ? 647  ASP A CA  1 
ATOM   4174  C  C   . ASP A 1  549 ? 18.790  -24.421 119.797 1.00 28.35  ? 647  ASP A C   1 
ATOM   4175  O  O   . ASP A 1  549 ? 19.227  -25.201 120.645 1.00 25.58  ? 647  ASP A O   1 
ATOM   4176  C  CB  . ASP A 1  549 ? 16.375  -23.824 120.097 1.00 29.65  ? 647  ASP A CB  1 
ATOM   4177  C  CG  . ASP A 1  549 ? 14.961  -23.896 119.549 1.00 28.83  ? 647  ASP A CG  1 
ATOM   4178  O  OD1 . ASP A 1  549 ? 14.624  -23.092 118.652 1.00 25.95  ? 647  ASP A OD1 1 
ATOM   4179  O  OD2 . ASP A 1  549 ? 14.184  -24.750 120.024 1.00 28.24  ? 647  ASP A OD2 1 
ATOM   4180  N  N   . ARG A 1  550 ? 19.499  -23.404 119.321 1.00 28.79  ? 648  ARG A N   1 
ATOM   4181  C  CA  . ARG A 1  550 ? 20.857  -23.143 119.781 1.00 30.48  ? 648  ARG A CA  1 
ATOM   4182  C  C   . ARG A 1  550 ? 21.031  -21.691 120.207 1.00 32.16  ? 648  ARG A C   1 
ATOM   4183  O  O   . ARG A 1  550 ? 20.403  -20.788 119.652 1.00 31.88  ? 648  ARG A O   1 
ATOM   4184  C  CB  . ARG A 1  550 ? 21.876  -23.477 118.688 1.00 28.69  ? 648  ARG A CB  1 
ATOM   4185  C  CG  . ARG A 1  550 ? 21.766  -24.881 118.120 1.00 32.57  ? 648  ARG A CG  1 
ATOM   4186  C  CD  . ARG A 1  550 ? 22.228  -25.939 119.105 1.00 38.03  ? 648  ARG A CD  1 
ATOM   4187  N  NE  . ARG A 1  550 ? 22.151  -27.273 118.514 1.00 45.04  ? 648  ARG A NE  1 
ATOM   4188  C  CZ  . ARG A 1  550 ? 22.401  -28.402 119.168 1.00 46.77  ? 648  ARG A CZ  1 
ATOM   4189  N  NH1 . ARG A 1  550 ? 22.747  -28.368 120.448 1.00 45.51  ? 648  ARG A NH1 1 
ATOM   4190  N  NH2 . ARG A 1  550 ? 22.305  -29.566 118.540 1.00 46.19  ? 648  ARG A NH2 1 
ATOM   4191  N  N   . ALA A 1  551 ? 21.877  -21.479 121.209 1.00 28.53  ? 649  ALA A N   1 
ATOM   4192  C  CA  . ALA A 1  551 ? 22.291  -20.138 121.592 1.00 24.40  ? 649  ALA A CA  1 
ATOM   4193  C  C   . ALA A 1  551 ? 23.686  -19.866 121.039 1.00 25.47  ? 649  ALA A C   1 
ATOM   4194  O  O   . ALA A 1  551 ? 24.466  -20.799 120.848 1.00 22.45  ? 649  ALA A O   1 
ATOM   4195  C  CB  . ALA A 1  551 ? 22.271  -19.983 123.102 1.00 23.90  ? 649  ALA A CB  1 
ATOM   4196  N  N   . PRO A 1  552 ? 24.006  -18.588 120.775 1.00 26.06  ? 650  PRO A N   1 
ATOM   4197  C  CA  . PRO A 1  552 ? 25.361  -18.230 120.346 1.00 24.62  ? 650  PRO A CA  1 
ATOM   4198  C  C   . PRO A 1  552 ? 26.404  -18.675 121.364 1.00 29.45  ? 650  PRO A C   1 
ATOM   4199  O  O   . PRO A 1  552 ? 26.087  -18.782 122.549 1.00 33.88  ? 650  PRO A O   1 
ATOM   4200  C  CB  . PRO A 1  552 ? 25.302  -16.705 120.244 1.00 20.97  ? 650  PRO A CB  1 
ATOM   4201  C  CG  . PRO A 1  552 ? 23.872  -16.412 119.965 1.00 20.51  ? 650  PRO A CG  1 
ATOM   4202  C  CD  . PRO A 1  552 ? 23.104  -17.424 120.760 1.00 26.78  ? 650  PRO A CD  1 
ATOM   4203  N  N   . LYS A 1  553 ? 27.623  -18.937 120.901 1.00 29.88  ? 651  LYS A N   1 
ATOM   4204  C  CA  . LYS A 1  553 ? 28.688  -19.425 121.770 1.00 27.91  ? 651  LYS A CA  1 
ATOM   4205  C  C   . LYS A 1  553 ? 28.954  -18.474 122.932 1.00 28.81  ? 651  LYS A C   1 
ATOM   4206  O  O   . LYS A 1  553 ? 29.145  -17.274 122.736 1.00 28.83  ? 651  LYS A O   1 
ATOM   4207  C  CB  . LYS A 1  553 ? 29.972  -19.640 120.970 1.00 26.01  ? 651  LYS A CB  1 
ATOM   4208  C  CG  . LYS A 1  553 ? 31.127  -20.182 121.794 1.00 27.77  ? 651  LYS A CG  1 
ATOM   4209  C  CD  . LYS A 1  553 ? 32.080  -21.001 120.944 1.00 31.89  ? 651  LYS A CD  1 
ATOM   4210  C  CE  . LYS A 1  553 ? 33.245  -21.523 121.773 1.00 33.63  ? 651  LYS A CE  1 
ATOM   4211  N  NZ  . LYS A 1  553 ? 32.785  -22.465 122.835 1.00 35.96  ? 651  LYS A NZ  1 
ATOM   4212  N  N   . GLY A 1  554 ? 28.954  -19.022 124.144 1.00 29.75  ? 652  GLY A N   1 
ATOM   4213  C  CA  . GLY A 1  554 ? 29.177  -18.241 125.345 1.00 29.18  ? 652  GLY A CA  1 
ATOM   4214  C  C   . GLY A 1  554 ? 27.928  -17.535 125.834 1.00 31.78  ? 652  GLY A C   1 
ATOM   4215  O  O   . GLY A 1  554 ? 27.969  -16.787 126.809 1.00 34.58  ? 652  GLY A O   1 
ATOM   4216  N  N   . ARG A 1  555 ? 26.811  -17.772 125.154 1.00 32.18  ? 653  ARG A N   1 
ATOM   4217  C  CA  . ARG A 1  555 ? 25.543  -17.159 125.531 1.00 31.62  ? 653  ARG A CA  1 
ATOM   4218  C  C   . ARG A 1  555 ? 24.492  -18.227 125.825 1.00 28.89  ? 653  ARG A C   1 
ATOM   4219  O  O   . ARG A 1  555 ? 24.737  -19.419 125.646 1.00 27.88  ? 653  ARG A O   1 
ATOM   4220  C  CB  . ARG A 1  555 ? 25.053  -16.219 124.427 1.00 35.16  ? 653  ARG A CB  1 
ATOM   4221  C  CG  . ARG A 1  555 ? 25.955  -15.015 124.188 1.00 41.35  ? 653  ARG A CG  1 
ATOM   4222  C  CD  . ARG A 1  555 ? 25.630  -13.863 125.126 1.00 46.90  ? 653  ARG A CD  1 
ATOM   4223  N  NE  . ARG A 1  555 ? 25.249  -12.656 124.396 1.00 53.15  ? 653  ARG A NE  1 
ATOM   4224  C  CZ  . ARG A 1  555 ? 26.114  -11.800 123.860 1.00 56.84  ? 653  ARG A CZ  1 
ATOM   4225  N  NH1 . ARG A 1  555 ? 27.418  -12.016 123.967 1.00 59.62  ? 653  ARG A NH1 1 
ATOM   4226  N  NH2 . ARG A 1  555 ? 25.674  -10.728 123.213 1.00 55.66  ? 653  ARG A NH2 1 
ATOM   4227  N  N   . THR A 1  556 ? 23.322  -17.793 126.279 1.00 28.66  ? 654  THR A N   1 
ATOM   4228  C  CA  . THR A 1  556 ? 22.211  -18.704 126.512 1.00 29.09  ? 654  THR A CA  1 
ATOM   4229  C  C   . THR A 1  556 ? 20.895  -18.028 126.144 1.00 29.06  ? 654  THR A C   1 
ATOM   4230  O  O   . THR A 1  556 ? 20.845  -16.810 125.983 1.00 29.59  ? 654  THR A O   1 
ATOM   4231  C  CB  . THR A 1  556 ? 22.154  -19.175 127.973 1.00 31.01  ? 654  THR A CB  1 
ATOM   4232  O  OG1 . THR A 1  556 ? 21.172  -20.211 128.105 1.00 31.50  ? 654  THR A OG1 1 
ATOM   4233  C  CG2 . THR A 1  556 ? 21.798  -18.017 128.892 1.00 22.23  ? 654  THR A CG2 1 
ATOM   4234  N  N   . PHE A 1  557 ? 19.832  -18.820 126.026 1.00 26.41  ? 655  PHE A N   1 
ATOM   4235  C  CA  . PHE A 1  557 ? 18.531  -18.303 125.609 1.00 21.07  ? 655  PHE A CA  1 
ATOM   4236  C  C   . PHE A 1  557 ? 18.013  -17.235 126.564 1.00 23.50  ? 655  PHE A C   1 
ATOM   4237  O  O   . PHE A 1  557 ? 17.989  -17.430 127.778 1.00 32.11  ? 655  PHE A O   1 
ATOM   4238  C  CB  . PHE A 1  557 ? 17.514  -19.439 125.494 1.00 21.41  ? 655  PHE A CB  1 
ATOM   4239  C  CG  . PHE A 1  557 ? 17.917  -20.513 124.528 1.00 21.74  ? 655  PHE A CG  1 
ATOM   4240  C  CD1 . PHE A 1  557 ? 17.837  -20.299 123.162 1.00 26.66  ? 655  PHE A CD1 1 
ATOM   4241  C  CD2 . PHE A 1  557 ? 18.386  -21.733 124.984 1.00 22.43  ? 655  PHE A CD2 1 
ATOM   4242  C  CE1 . PHE A 1  557 ? 18.214  -21.285 122.269 1.00 24.80  ? 655  PHE A CE1 1 
ATOM   4243  C  CE2 . PHE A 1  557 ? 18.763  -22.721 124.098 1.00 22.82  ? 655  PHE A CE2 1 
ATOM   4244  C  CZ  . PHE A 1  557 ? 18.678  -22.497 122.739 1.00 25.41  ? 655  PHE A CZ  1 
ATOM   4245  N  N   . GLY A 1  558 ? 17.610  -16.100 126.002 1.00 22.21  ? 656  GLY A N   1 
ATOM   4246  C  CA  . GLY A 1  558 ? 17.087  -14.996 126.784 1.00 23.05  ? 656  GLY A CA  1 
ATOM   4247  C  C   . GLY A 1  558 ? 18.074  -13.856 126.945 1.00 26.45  ? 656  GLY A C   1 
ATOM   4248  O  O   . GLY A 1  558 ? 17.696  -12.753 127.343 1.00 27.97  ? 656  GLY A O   1 
ATOM   4249  N  N   . ASP A 1  559 ? 19.341  -14.118 126.635 1.00 26.80  ? 657  ASP A N   1 
ATOM   4250  C  CA  . ASP A 1  559 ? 20.367  -13.082 126.695 1.00 24.83  ? 657  ASP A CA  1 
ATOM   4251  C  C   . ASP A 1  559 ? 20.092  -11.987 125.672 1.00 25.75  ? 657  ASP A C   1 
ATOM   4252  O  O   . ASP A 1  559 ? 19.623  -12.254 124.566 1.00 26.70  ? 657  ASP A O   1 
ATOM   4253  C  CB  . ASP A 1  559 ? 21.756  -13.679 126.470 1.00 27.33  ? 657  ASP A CB  1 
ATOM   4254  C  CG  . ASP A 1  559 ? 22.231  -14.508 127.646 1.00 33.74  ? 657  ASP A CG  1 
ATOM   4255  O  OD1 . ASP A 1  559 ? 21.561  -14.482 128.699 1.00 35.75  ? 657  ASP A OD1 1 
ATOM   4256  O  OD2 . ASP A 1  559 ? 23.275  -15.184 127.518 1.00 35.44  ? 657  ASP A OD2 1 
ATOM   4257  N  N   . VAL A 1  560 ? 20.370  -10.747 126.053 1.00 26.31  ? 658  VAL A N   1 
ATOM   4258  C  CA  . VAL A 1  560 ? 20.142  -9.614  125.170 1.00 24.92  ? 658  VAL A CA  1 
ATOM   4259  C  C   . VAL A 1  560 ? 21.277  -9.440  124.162 1.00 29.78  ? 658  VAL A C   1 
ATOM   4260  O  O   . VAL A 1  560 ? 22.436  -9.282  124.544 1.00 33.93  ? 658  VAL A O   1 
ATOM   4261  C  CB  . VAL A 1  560 ? 19.978  -8.313  125.974 1.00 22.12  ? 658  VAL A CB  1 
ATOM   4262  C  CG1 . VAL A 1  560 ? 19.810  -7.131  125.037 1.00 19.38  ? 658  VAL A CG1 1 
ATOM   4263  C  CG2 . VAL A 1  560 ? 18.791  -8.425  126.920 1.00 19.05  ? 658  VAL A CG2 1 
ATOM   4264  N  N   . LEU A 1  561 ? 20.940  -9.472  122.876 1.00 30.29  ? 659  LEU A N   1 
ATOM   4265  C  CA  . LEU A 1  561 ? 21.914  -9.194  121.822 1.00 29.79  ? 659  LEU A CA  1 
ATOM   4266  C  C   . LEU A 1  561 ? 21.915  -7.707  121.492 1.00 24.65  ? 659  LEU A C   1 
ATOM   4267  O  O   . LEU A 1  561 ? 22.959  -7.129  121.196 1.00 19.71  ? 659  LEU A O   1 
ATOM   4268  C  CB  . LEU A 1  561 ? 21.633  -10.015 120.554 1.00 29.46  ? 659  LEU A CB  1 
ATOM   4269  C  CG  . LEU A 1  561 ? 21.869  -11.533 120.466 1.00 30.26  ? 659  LEU A CG  1 
ATOM   4270  C  CD1 . LEU A 1  561 ? 21.784  -12.259 121.803 1.00 34.34  ? 659  LEU A CD1 1 
ATOM   4271  C  CD2 . LEU A 1  561 ? 20.904  -12.159 119.464 1.00 29.05  ? 659  LEU A CD2 1 
ATOM   4272  N  N   . GLN A 1  562 ? 20.737  -7.094  121.545 1.00 28.30  ? 660  GLN A N   1 
ATOM   4273  C  CA  . GLN A 1  562 ? 20.609  -5.659  121.319 1.00 30.98  ? 660  GLN A CA  1 
ATOM   4274  C  C   . GLN A 1  562 ? 19.647  -5.025  122.321 1.00 30.61  ? 660  GLN A C   1 
ATOM   4275  O  O   . GLN A 1  562 ? 18.436  -5.231  122.243 1.00 35.99  ? 660  GLN A O   1 
ATOM   4276  C  CB  . GLN A 1  562 ? 20.140  -5.384  119.891 1.00 34.35  ? 660  GLN A CB  1 
ATOM   4277  C  CG  . GLN A 1  562 ? 19.997  -3.910  119.560 1.00 40.70  ? 660  GLN A CG  1 
ATOM   4278  C  CD  . GLN A 1  562 ? 19.566  -3.681  118.126 1.00 45.88  ? 660  GLN A CD  1 
ATOM   4279  O  OE1 . GLN A 1  562 ? 18.614  -2.946  117.861 1.00 46.84  ? 660  GLN A OE1 1 
ATOM   4280  N  NE2 . GLN A 1  562 ? 20.269  -4.310  117.190 1.00 44.43  ? 660  GLN A NE2 1 
ATOM   4281  N  N   . PRO A 1  563 ? 20.189  -4.243  123.265 1.00 24.70  ? 661  PRO A N   1 
ATOM   4282  C  CA  . PRO A 1  563 ? 19.375  -3.557  124.273 1.00 21.82  ? 661  PRO A CA  1 
ATOM   4283  C  C   . PRO A 1  563 ? 18.673  -2.332  123.698 1.00 21.74  ? 661  PRO A C   1 
ATOM   4284  O  O   . PRO A 1  563 ? 19.022  -1.879  122.607 1.00 25.92  ? 661  PRO A O   1 
ATOM   4285  C  CB  . PRO A 1  563 ? 20.403  -3.154  125.331 1.00 21.71  ? 661  PRO A CB  1 
ATOM   4286  C  CG  . PRO A 1  563 ? 21.663  -2.965  124.556 1.00 19.90  ? 661  PRO A CG  1 
ATOM   4287  C  CD  . PRO A 1  563 ? 21.629  -3.986  123.447 1.00 21.78  ? 661  PRO A CD  1 
ATOM   4288  N  N   . ALA A 1  564 ? 17.698  -1.803  124.429 1.00 18.70  ? 662  ALA A N   1 
ATOM   4289  C  CA  . ALA A 1  564 ? 17.009  -0.587  124.014 1.00 20.88  ? 662  ALA A CA  1 
ATOM   4290  C  C   . ALA A 1  564 ? 17.911  0.625   124.197 1.00 22.61  ? 662  ALA A C   1 
ATOM   4291  O  O   . ALA A 1  564 ? 18.907  0.561   124.917 1.00 19.06  ? 662  ALA A O   1 
ATOM   4292  C  CB  . ALA A 1  564 ? 15.717  -0.410  124.796 1.00 18.62  ? 662  ALA A CB  1 
ATOM   4293  N  N   . LYS A 1  565 ? 17.568  1.724   123.531 1.00 27.63  ? 663  LYS A N   1 
ATOM   4294  C  CA  . LYS A 1  565 ? 18.250  2.993   123.751 1.00 26.61  ? 663  LYS A CA  1 
ATOM   4295  C  C   . LYS A 1  565 ? 18.127  3.389   125.217 1.00 29.31  ? 663  LYS A C   1 
ATOM   4296  O  O   . LYS A 1  565 ? 17.173  2.991   125.887 1.00 36.62  ? 663  LYS A O   1 
ATOM   4297  C  CB  . LYS A 1  565 ? 17.656  4.087   122.861 1.00 28.76  ? 663  LYS A CB  1 
ATOM   4298  C  CG  . LYS A 1  565 ? 17.762  3.831   121.370 1.00 29.49  ? 663  LYS A CG  1 
ATOM   4299  C  CD  . LYS A 1  565 ? 17.164  4.990   120.590 1.00 31.32  ? 663  LYS A CD  1 
ATOM   4300  C  CE  . LYS A 1  565 ? 17.177  4.727   119.094 1.00 36.56  ? 663  LYS A CE  1 
ATOM   4301  N  NZ  . LYS A 1  565 ? 18.554  4.498   118.575 1.00 40.64  ? 663  LYS A NZ  1 
ATOM   4302  N  N   . PRO A 1  566 ? 19.088  4.176   125.723 1.00 28.72  ? 664  PRO A N   1 
ATOM   4303  C  CA  . PRO A 1  566 ? 19.015  4.609   127.123 1.00 32.70  ? 664  PRO A CA  1 
ATOM   4304  C  C   . PRO A 1  566 ? 17.789  5.474   127.396 1.00 32.16  ? 664  PRO A C   1 
ATOM   4305  O  O   . PRO A 1  566 ? 17.240  5.429   128.497 1.00 34.45  ? 664  PRO A O   1 
ATOM   4306  C  CB  . PRO A 1  566 ? 20.306  5.416   127.315 1.00 21.00  ? 664  PRO A CB  1 
ATOM   4307  C  CG  . PRO A 1  566 ? 21.217  4.959   126.227 1.00 24.47  ? 664  PRO A CG  1 
ATOM   4308  C  CD  . PRO A 1  566 ? 20.335  4.608   125.070 1.00 25.88  ? 664  PRO A CD  1 
ATOM   4309  N  N   . GLU A 1  567 ? 17.362  6.242   126.399 1.00 28.32  ? 665  GLU A N   1 
ATOM   4310  C  CA  . GLU A 1  567 ? 16.251  7.171   126.575 1.00 24.30  ? 665  GLU A CA  1 
ATOM   4311  C  C   . GLU A 1  567 ? 15.321  7.186   125.369 1.00 22.58  ? 665  GLU A C   1 
ATOM   4312  O  O   . GLU A 1  567 ? 15.766  7.077   124.226 1.00 23.20  ? 665  GLU A O   1 
ATOM   4313  C  CB  . GLU A 1  567 ? 16.770  8.589   126.827 1.00 25.79  ? 665  GLU A CB  1 
ATOM   4314  C  CG  . GLU A 1  567 ? 17.604  8.755   128.085 1.00 24.00  ? 665  GLU A CG  1 
ATOM   4315  C  CD  . GLU A 1  567 ? 18.203  10.142  128.197 1.00 26.62  ? 665  GLU A CD  1 
ATOM   4316  O  OE1 . GLU A 1  567 ? 18.002  10.949  127.266 1.00 25.50  ? 665  GLU A OE1 1 
ATOM   4317  O  OE2 . GLU A 1  567 ? 18.874  10.425  129.212 1.00 29.18  ? 665  GLU A OE2 1 
ATOM   4318  N  N   . TYR A 1  568 ? 14.027  7.326   125.636 1.00 24.88  ? 666  TYR A N   1 
ATOM   4319  C  CA  . TYR A 1  568 ? 13.030  7.452   124.581 1.00 20.64  ? 666  TYR A CA  1 
ATOM   4320  C  C   . TYR A 1  568 ? 12.046  8.572   124.892 1.00 21.51  ? 666  TYR A C   1 
ATOM   4321  O  O   . TYR A 1  568 ? 11.749  8.846   126.054 1.00 22.14  ? 666  TYR A O   1 
ATOM   4322  C  CB  . TYR A 1  568 ? 12.257  6.144   124.398 1.00 21.19  ? 666  TYR A CB  1 
ATOM   4323  C  CG  . TYR A 1  568 ? 13.055  4.987   123.838 1.00 26.63  ? 666  TYR A CG  1 
ATOM   4324  C  CD1 . TYR A 1  568 ? 13.098  4.747   122.470 1.00 19.42  ? 666  TYR A CD1 1 
ATOM   4325  C  CD2 . TYR A 1  568 ? 13.742  4.119   124.678 1.00 25.78  ? 666  TYR A CD2 1 
ATOM   4326  C  CE1 . TYR A 1  568 ? 13.815  3.686   121.953 1.00 19.05  ? 666  TYR A CE1 1 
ATOM   4327  C  CE2 . TYR A 1  568 ? 14.463  3.053   124.170 1.00 22.12  ? 666  TYR A CE2 1 
ATOM   4328  C  CZ  . TYR A 1  568 ? 14.495  2.841   122.806 1.00 22.02  ? 666  TYR A CZ  1 
ATOM   4329  O  OH  . TYR A 1  568 ? 15.212  1.782   122.296 1.00 21.85  ? 666  TYR A OH  1 
ATOM   4330  N  N   . ARG A 1  569 ? 11.535  9.212   123.848 1.00 23.40  ? 667  ARG A N   1 
ATOM   4331  C  CA  . ARG A 1  569 ? 10.402  10.112  123.993 1.00 27.13  ? 667  ARG A CA  1 
ATOM   4332  C  C   . ARG A 1  569 ? 9.159   9.365   123.530 1.00 27.75  ? 667  ARG A C   1 
ATOM   4333  O  O   . ARG A 1  569 ? 9.256   8.453   122.708 1.00 26.50  ? 667  ARG A O   1 
ATOM   4334  C  CB  . ARG A 1  569 ? 10.599  11.405  123.198 1.00 33.15  ? 667  ARG A CB  1 
ATOM   4335  C  CG  . ARG A 1  569 ? 10.505  11.242  121.692 1.00 40.59  ? 667  ARG A CG  1 
ATOM   4336  C  CD  . ARG A 1  569 ? 10.347  12.588  121.003 1.00 49.77  ? 667  ARG A CD  1 
ATOM   4337  N  NE  . ARG A 1  569 ? 11.521  13.439  121.175 1.00 57.15  ? 667  ARG A NE  1 
ATOM   4338  C  CZ  . ARG A 1  569 ? 11.566  14.723  120.838 1.00 62.10  ? 667  ARG A CZ  1 
ATOM   4339  N  NH1 . ARG A 1  569 ? 10.498  15.311  120.315 1.00 62.93  ? 667  ARG A NH1 1 
ATOM   4340  N  NH2 . ARG A 1  569 ? 12.677  15.423  121.028 1.00 63.36  ? 667  ARG A NH2 1 
ATOM   4341  N  N   . VAL A 1  570 ? 8.001   9.730   124.071 1.00 28.44  ? 668  VAL A N   1 
ATOM   4342  C  CA  . VAL A 1  570 ? 6.752   9.087   123.677 1.00 27.02  ? 668  VAL A CA  1 
ATOM   4343  C  C   . VAL A 1  570 ? 6.520   9.240   122.176 1.00 26.18  ? 668  VAL A C   1 
ATOM   4344  O  O   . VAL A 1  570 ? 6.856   10.266  121.585 1.00 28.98  ? 668  VAL A O   1 
ATOM   4345  C  CB  . VAL A 1  570 ? 5.545   9.656   124.453 1.00 24.27  ? 668  VAL A CB  1 
ATOM   4346  C  CG1 . VAL A 1  570 ? 5.709   9.401   125.944 1.00 23.67  ? 668  VAL A CG1 1 
ATOM   4347  C  CG2 . VAL A 1  570 ? 5.374   11.140  124.174 1.00 24.93  ? 668  VAL A CG2 1 
ATOM   4348  N  N   . GLY A 1  571 ? 5.976   8.196   121.561 1.00 22.50  ? 669  GLY A N   1 
ATOM   4349  C  CA  . GLY A 1  571 ? 5.778   8.180   120.126 1.00 21.25  ? 669  GLY A CA  1 
ATOM   4350  C  C   . GLY A 1  571 ? 6.806   7.324   119.415 1.00 22.92  ? 669  GLY A C   1 
ATOM   4351  O  O   . GLY A 1  571 ? 6.556   6.820   118.322 1.00 26.94  ? 669  GLY A O   1 
ATOM   4352  N  N   . GLU A 1  572 ? 7.967   7.152   120.038 1.00 22.07  ? 670  GLU A N   1 
ATOM   4353  C  CA  . GLU A 1  572 ? 9.032   6.357   119.440 1.00 21.89  ? 670  GLU A CA  1 
ATOM   4354  C  C   . GLU A 1  572 ? 8.850   4.874   119.727 1.00 23.44  ? 670  GLU A C   1 
ATOM   4355  O  O   . GLU A 1  572 ? 7.934   4.478   120.446 1.00 29.11  ? 670  GLU A O   1 
ATOM   4356  C  CB  . GLU A 1  572 ? 10.399  6.822   119.943 1.00 21.46  ? 670  GLU A CB  1 
ATOM   4357  C  CG  . GLU A 1  572 ? 10.710  8.268   119.620 1.00 25.26  ? 670  GLU A CG  1 
ATOM   4358  C  CD  . GLU A 1  572 ? 12.089  8.686   120.088 1.00 32.67  ? 670  GLU A CD  1 
ATOM   4359  O  OE1 . GLU A 1  572 ? 12.560  8.153   121.116 1.00 33.40  ? 670  GLU A OE1 1 
ATOM   4360  O  OE2 . GLU A 1  572 ? 12.701  9.551   119.427 1.00 36.93  ? 670  GLU A OE2 1 
ATOM   4361  N  N   . VAL A 1  573 ? 9.734   4.060   119.164 1.00 19.23  ? 671  VAL A N   1 
ATOM   4362  C  CA  . VAL A 1  573 ? 9.620   2.613   119.272 1.00 18.84  ? 671  VAL A CA  1 
ATOM   4363  C  C   . VAL A 1  573 ? 10.847  2.017   119.950 1.00 20.52  ? 671  VAL A C   1 
ATOM   4364  O  O   . VAL A 1  573 ? 11.957  2.086   119.420 1.00 22.24  ? 671  VAL A O   1 
ATOM   4365  C  CB  . VAL A 1  573 ? 9.441   1.962   117.889 1.00 23.78  ? 671  VAL A CB  1 
ATOM   4366  C  CG1 . VAL A 1  573 ? 9.402   0.448   118.016 1.00 26.19  ? 671  VAL A CG1 1 
ATOM   4367  C  CG2 . VAL A 1  573 ? 8.179   2.479   117.222 1.00 19.89  ? 671  VAL A CG2 1 
ATOM   4368  N  N   . ALA A 1  574 ? 10.646  1.438   121.128 1.00 19.42  ? 672  ALA A N   1 
ATOM   4369  C  CA  . ALA A 1  574 ? 11.728  0.765   121.833 1.00 21.85  ? 672  ALA A CA  1 
ATOM   4370  C  C   . ALA A 1  574 ? 11.855  -0.669  121.337 1.00 24.93  ? 672  ALA A C   1 
ATOM   4371  O  O   . ALA A 1  574 ? 10.871  -1.404  121.276 1.00 27.44  ? 672  ALA A O   1 
ATOM   4372  C  CB  . ALA A 1  574 ? 11.488  0.796   123.332 1.00 18.62  ? 672  ALA A CB  1 
ATOM   4373  N  N   . GLU A 1  575 ? 13.074  -1.067  120.990 1.00 27.90  ? 673  GLU A N   1 
ATOM   4374  C  CA  . GLU A 1  575 ? 13.304  -2.381  120.404 1.00 27.78  ? 673  GLU A CA  1 
ATOM   4375  C  C   . GLU A 1  575 ? 14.411  -3.131  121.131 1.00 27.81  ? 673  GLU A C   1 
ATOM   4376  O  O   . GLU A 1  575 ? 15.512  -2.612  121.312 1.00 34.08  ? 673  GLU A O   1 
ATOM   4377  C  CB  . GLU A 1  575 ? 13.649  -2.247  118.919 1.00 31.70  ? 673  GLU A CB  1 
ATOM   4378  C  CG  . GLU A 1  575 ? 13.997  -3.559  118.241 1.00 37.37  ? 673  GLU A CG  1 
ATOM   4379  C  CD  . GLU A 1  575 ? 14.251  -3.398  116.755 1.00 44.64  ? 673  GLU A CD  1 
ATOM   4380  O  OE1 . GLU A 1  575 ? 13.406  -2.786  116.070 1.00 52.36  ? 673  GLU A OE1 1 
ATOM   4381  O  OE2 . GLU A 1  575 ? 15.296  -3.881  116.270 1.00 41.88  ? 673  GLU A OE2 1 
ATOM   4382  N  N   . VAL A 1  576 ? 14.109  -4.355  121.549 1.00 23.47  ? 674  VAL A N   1 
ATOM   4383  C  CA  . VAL A 1  576 ? 15.089  -5.203  122.214 1.00 22.43  ? 674  VAL A CA  1 
ATOM   4384  C  C   . VAL A 1  576 ? 15.171  -6.562  121.529 1.00 24.56  ? 674  VAL A C   1 
ATOM   4385  O  O   . VAL A 1  576 ? 14.149  -7.182  121.240 1.00 27.66  ? 674  VAL A O   1 
ATOM   4386  C  CB  . VAL A 1  576 ? 14.747  -5.403  123.706 1.00 21.11  ? 674  VAL A CB  1 
ATOM   4387  C  CG1 . VAL A 1  576 ? 15.786  -6.281  124.380 1.00 18.19  ? 674  VAL A CG1 1 
ATOM   4388  C  CG2 . VAL A 1  576 ? 14.642  -4.061  124.414 1.00 18.17  ? 674  VAL A CG2 1 
ATOM   4389  N  N   . ILE A 1  577 ? 16.392  -7.023  121.277 1.00 21.29  ? 675  ILE A N   1 
ATOM   4390  C  CA  . ILE A 1  577 ? 16.601  -8.294  120.600 1.00 20.61  ? 675  ILE A CA  1 
ATOM   4391  C  C   . ILE A 1  577 ? 17.242  -9.315  121.532 1.00 23.08  ? 675  ILE A C   1 
ATOM   4392  O  O   . ILE A 1  577 ? 18.288  -9.061  122.129 1.00 18.24  ? 675  ILE A O   1 
ATOM   4393  C  CB  . ILE A 1  577 ? 17.485  -8.128  119.348 1.00 21.72  ? 675  ILE A CB  1 
ATOM   4394  C  CG1 . ILE A 1  577 ? 16.884  -7.084  118.405 1.00 21.63  ? 675  ILE A CG1 1 
ATOM   4395  C  CG2 . ILE A 1  577 ? 17.654  -9.459  118.632 1.00 19.37  ? 675  ILE A CG2 1 
ATOM   4396  C  CD1 . ILE A 1  577 ? 17.681  -6.879  117.136 1.00 17.74  ? 675  ILE A CD1 1 
ATOM   4397  N  N   . PHE A 1  578 ? 16.599  -10.472 121.649 1.00 20.86  ? 676  PHE A N   1 
ATOM   4398  C  CA  . PHE A 1  578 ? 17.081  -11.554 122.495 1.00 23.80  ? 676  PHE A CA  1 
ATOM   4399  C  C   . PHE A 1  578 ? 17.536  -12.721 121.634 1.00 24.27  ? 676  PHE A C   1 
ATOM   4400  O  O   . PHE A 1  578 ? 17.086  -12.870 120.496 1.00 21.60  ? 676  PHE A O   1 
ATOM   4401  C  CB  . PHE A 1  578 ? 15.988  -12.043 123.451 1.00 28.71  ? 676  PHE A CB  1 
ATOM   4402  C  CG  . PHE A 1  578 ? 15.360  -10.962 124.288 1.00 26.05  ? 676  PHE A CG  1 
ATOM   4403  C  CD1 . PHE A 1  578 ? 14.295  -10.219 123.803 1.00 23.98  ? 676  PHE A CD1 1 
ATOM   4404  C  CD2 . PHE A 1  578 ? 15.805  -10.723 125.578 1.00 23.20  ? 676  PHE A CD2 1 
ATOM   4405  C  CE1 . PHE A 1  578 ? 13.705  -9.235  124.577 1.00 18.38  ? 676  PHE A CE1 1 
ATOM   4406  C  CE2 . PHE A 1  578 ? 15.218  -9.743  126.360 1.00 23.07  ? 676  PHE A CE2 1 
ATOM   4407  C  CZ  . PHE A 1  578 ? 14.166  -8.999  125.859 1.00 24.59  ? 676  PHE A CZ  1 
ATOM   4408  N  N   . VAL A 1  579 ? 18.425  -13.553 122.166 1.00 24.65  ? 677  VAL A N   1 
ATOM   4409  C  CA  . VAL A 1  579 ? 18.663  -14.844 121.542 1.00 26.20  ? 677  VAL A CA  1 
ATOM   4410  C  C   . VAL A 1  579 ? 17.424  -15.670 121.838 1.00 26.49  ? 677  VAL A C   1 
ATOM   4411  O  O   . VAL A 1  579 ? 17.018  -15.804 122.993 1.00 29.32  ? 677  VAL A O   1 
ATOM   4412  C  CB  . VAL A 1  579 ? 19.934  -15.549 122.070 1.00 26.76  ? 677  VAL A CB  1 
ATOM   4413  C  CG1 . VAL A 1  579 ? 20.260  -15.079 123.463 1.00 27.52  ? 677  VAL A CG1 1 
ATOM   4414  C  CG2 . VAL A 1  579 ? 19.765  -17.067 122.044 1.00 22.70  ? 677  VAL A CG2 1 
ATOM   4415  N  N   . GLY A 1  580 ? 16.813  -16.214 120.796 1.00 25.49  ? 678  GLY A N   1 
ATOM   4416  C  CA  . GLY A 1  580 ? 15.521  -16.844 120.955 1.00 23.44  ? 678  GLY A CA  1 
ATOM   4417  C  C   . GLY A 1  580 ? 15.489  -18.302 120.563 1.00 26.30  ? 678  GLY A C   1 
ATOM   4418  O  O   . GLY A 1  580 ? 16.469  -18.855 120.065 1.00 30.32  ? 678  GLY A O   1 
ATOM   4419  N  N   . ALA A 1  581 ? 14.343  -18.922 120.807 1.00 23.36  ? 679  ALA A N   1 
ATOM   4420  C  CA  . ALA A 1  581 ? 14.070  -20.262 120.326 1.00 23.68  ? 679  ALA A CA  1 
ATOM   4421  C  C   . ALA A 1  581 ? 12.765  -20.225 119.547 1.00 27.54  ? 679  ALA A C   1 
ATOM   4422  O  O   . ALA A 1  581 ? 12.093  -19.194 119.510 1.00 20.56  ? 679  ALA A O   1 
ATOM   4423  C  CB  . ALA A 1  581 ? 13.996  -21.245 121.477 1.00 23.16  ? 679  ALA A CB  1 
ATOM   4424  N  N   . ASN A 1  582 ? 12.406  -21.341 118.926 1.00 30.33  ? 680  ASN A N   1 
ATOM   4425  C  CA  . ASN A 1  582 ? 11.200  -21.386 118.113 1.00 29.71  ? 680  ASN A CA  1 
ATOM   4426  C  C   . ASN A 1  582 ? 9.957   -21.191 118.973 1.00 28.06  ? 680  ASN A C   1 
ATOM   4427  O  O   . ASN A 1  582 ? 9.729   -21.943 119.920 1.00 30.94  ? 680  ASN A O   1 
ATOM   4428  C  CB  . ASN A 1  582 ? 11.116  -22.708 117.351 1.00 30.29  ? 680  ASN A CB  1 
ATOM   4429  C  CG  . ASN A 1  582 ? 10.186  -22.633 116.157 1.00 28.65  ? 680  ASN A CG  1 
ATOM   4430  O  OD1 . ASN A 1  582 ? 9.096   -22.066 116.237 1.00 29.44  ? 680  ASN A OD1 1 
ATOM   4431  N  ND2 . ASN A 1  582 ? 10.614  -23.205 115.039 1.00 27.42  ? 680  ASN A ND2 1 
ATOM   4432  N  N   . PRO A 1  583 ? 9.155   -20.166 118.648 1.00 26.00  ? 681  PRO A N   1 
ATOM   4433  C  CA  . PRO A 1  583 ? 7.907   -19.849 119.351 1.00 23.42  ? 681  PRO A CA  1 
ATOM   4434  C  C   . PRO A 1  583 ? 6.943   -21.030 119.435 1.00 25.54  ? 681  PRO A C   1 
ATOM   4435  O  O   . PRO A 1  583 ? 6.112   -21.068 120.341 1.00 27.89  ? 681  PRO A O   1 
ATOM   4436  C  CB  . PRO A 1  583 ? 7.309   -18.722 118.506 1.00 23.85  ? 681  PRO A CB  1 
ATOM   4437  C  CG  . PRO A 1  583 ? 8.484   -18.067 117.879 1.00 20.45  ? 681  PRO A CG  1 
ATOM   4438  C  CD  . PRO A 1  583 ? 9.465   -19.172 117.606 1.00 20.76  ? 681  PRO A CD  1 
ATOM   4439  N  N   . LYS A 1  584 ? 7.053   -21.979 118.509 1.00 25.50  ? 682  LYS A N   1 
ATOM   4440  C  CA  . LYS A 1  584 ? 6.146   -23.121 118.489 1.00 26.98  ? 682  LYS A CA  1 
ATOM   4441  C  C   . LYS A 1  584 ? 6.444   -24.100 119.621 1.00 27.77  ? 682  LYS A C   1 
ATOM   4442  O  O   . LYS A 1  584 ? 5.649   -24.998 119.899 1.00 27.44  ? 682  LYS A O   1 
ATOM   4443  C  CB  . LYS A 1  584 ? 6.213   -23.840 117.140 1.00 29.59  ? 682  LYS A CB  1 
ATOM   4444  C  CG  . LYS A 1  584 ? 7.420   -24.742 116.960 1.00 30.12  ? 682  LYS A CG  1 
ATOM   4445  C  CD  . LYS A 1  584 ? 7.485   -25.269 115.537 1.00 30.82  ? 682  LYS A CD  1 
ATOM   4446  C  CE  . LYS A 1  584 ? 8.638   -26.238 115.350 1.00 34.93  ? 682  LYS A CE  1 
ATOM   4447  N  NZ  . LYS A 1  584 ? 8.731   -26.706 113.938 1.00 38.18  ? 682  LYS A NZ  1 
ATOM   4448  N  N   . ASN A 1  585 ? 7.594   -23.932 120.267 1.00 25.26  ? 683  ASN A N   1 
ATOM   4449  C  CA  . ASN A 1  585 ? 7.914   -24.725 121.446 1.00 25.48  ? 683  ASN A CA  1 
ATOM   4450  C  C   . ASN A 1  585 ? 7.043   -24.312 122.628 1.00 31.53  ? 683  ASN A C   1 
ATOM   4451  O  O   . ASN A 1  585 ? 6.835   -25.086 123.560 1.00 38.92  ? 683  ASN A O   1 
ATOM   4452  C  CB  . ASN A 1  585 ? 9.391   -24.577 121.816 1.00 23.58  ? 683  ASN A CB  1 
ATOM   4453  C  CG  . ASN A 1  585 ? 10.320  -25.078 120.729 1.00 27.72  ? 683  ASN A CG  1 
ATOM   4454  O  OD1 . ASN A 1  585 ? 9.975   -25.982 119.967 1.00 31.78  ? 683  ASN A OD1 1 
ATOM   4455  N  ND2 . ASN A 1  585 ? 11.512  -24.493 120.654 1.00 27.08  ? 683  ASN A ND2 1 
ATOM   4456  N  N   . SER A 1  586 ? 6.536   -23.083 122.579 1.00 34.52  ? 684  SER A N   1 
ATOM   4457  C  CA  . SER A 1  586 ? 5.747   -22.525 123.672 1.00 41.99  ? 684  SER A CA  1 
ATOM   4458  C  C   . SER A 1  586 ? 4.261   -22.814 123.499 1.00 51.27  ? 684  SER A C   1 
ATOM   4459  O  O   . SER A 1  586 ? 3.428   -22.331 124.267 1.00 53.45  ? 684  SER A O   1 
ATOM   4460  C  CB  . SER A 1  586 ? 5.973   -21.014 123.774 1.00 37.59  ? 684  SER A CB  1 
ATOM   4461  O  OG  . SER A 1  586 ? 7.314   -20.721 124.127 1.00 35.12  ? 684  SER A OG  1 
ATOM   4462  N  N   . VAL A 1  587 ? 3.934   -23.601 122.481 1.00 55.83  ? 685  VAL A N   1 
ATOM   4463  C  CA  . VAL A 1  587 ? 2.548   -23.936 122.189 1.00 63.94  ? 685  VAL A CA  1 
ATOM   4464  C  C   . VAL A 1  587 ? 2.163   -25.288 122.782 1.00 68.44  ? 685  VAL A C   1 
ATOM   4465  O  O   . VAL A 1  587 ? 1.911   -25.402 123.980 1.00 70.61  ? 685  VAL A O   1 
ATOM   4466  C  CB  . VAL A 1  587 ? 2.293   -23.944 120.673 1.00 66.83  ? 685  VAL A CB  1 
ATOM   4467  C  CG1 . VAL A 1  587 ? 0.847   -24.294 120.382 1.00 69.63  ? 685  VAL A CG1 1 
ATOM   4468  C  CG2 . VAL A 1  587 ? 2.638   -22.590 120.085 1.00 65.29  ? 685  VAL A CG2 1 
ATOM   4469  N  N   . GLN A 1  590 ? 0.822   -25.146 129.030 1.00 88.99  ? 688  GLN A N   1 
ATOM   4470  C  CA  . GLN A 1  590 ? -0.136  -24.162 128.540 1.00 87.06  ? 688  GLN A CA  1 
ATOM   4471  C  C   . GLN A 1  590 ? -0.268  -22.988 129.500 1.00 85.73  ? 688  GLN A C   1 
ATOM   4472  O  O   . GLN A 1  590 ? -1.365  -22.480 129.737 1.00 87.29  ? 688  GLN A O   1 
ATOM   4473  C  CB  . GLN A 1  590 ? -1.500  -24.813 128.306 1.00 87.30  ? 688  GLN A CB  1 
ATOM   4474  C  CG  . GLN A 1  590 ? -1.531  -25.747 127.109 1.00 87.08  ? 688  GLN A CG  1 
ATOM   4475  C  CD  . GLN A 1  590 ? -2.611  -26.802 127.217 1.00 88.17  ? 688  GLN A CD  1 
ATOM   4476  O  OE1 . GLN A 1  590 ? -3.286  -26.913 128.240 1.00 89.34  ? 688  GLN A OE1 1 
ATOM   4477  N  NE2 . GLN A 1  590 ? -2.777  -27.588 126.160 1.00 88.50  ? 688  GLN A NE2 1 
ATOM   4478  N  N   . THR A 1  591 ? 0.860   -22.569 130.062 1.00 82.12  ? 689  THR A N   1 
ATOM   4479  C  CA  . THR A 1  591 ? 0.873   -21.479 131.025 1.00 79.36  ? 689  THR A CA  1 
ATOM   4480  C  C   . THR A 1  591 ? 1.630   -20.323 130.390 1.00 77.21  ? 689  THR A C   1 
ATOM   4481  O  O   . THR A 1  591 ? 2.049   -19.379 131.065 1.00 77.81  ? 689  THR A O   1 
ATOM   4482  C  CB  . THR A 1  591 ? 1.538   -21.885 132.350 1.00 77.76  ? 689  THR A CB  1 
ATOM   4483  O  OG1 . THR A 1  591 ? 2.769   -22.567 132.080 1.00 77.88  ? 689  THR A OG1 1 
ATOM   4484  C  CG2 . THR A 1  591 ? 0.620   -22.794 133.151 1.00 76.88  ? 689  THR A CG2 1 
ATOM   4485  N  N   . HIS A 1  592 ? 1.803   -20.422 129.076 1.00 70.73  ? 690  HIS A N   1 
ATOM   4486  C  CA  . HIS A 1  592 ? 2.463   -19.391 128.290 1.00 59.15  ? 690  HIS A CA  1 
ATOM   4487  C  C   . HIS A 1  592 ? 1.453   -18.377 127.767 1.00 51.95  ? 690  HIS A C   1 
ATOM   4488  O  O   . HIS A 1  592 ? 1.067   -18.425 126.599 1.00 56.77  ? 690  HIS A O   1 
ATOM   4489  C  CB  . HIS A 1  592 ? 3.223   -20.022 127.126 1.00 56.84  ? 690  HIS A CB  1 
ATOM   4490  C  CG  . HIS A 1  592 ? 4.263   -19.128 126.531 1.00 55.96  ? 690  HIS A CG  1 
ATOM   4491  N  ND1 . HIS A 1  592 ? 5.503   -18.948 127.105 1.00 57.59  ? 690  HIS A ND1 1 
ATOM   4492  C  CD2 . HIS A 1  592 ? 4.248   -18.359 125.417 1.00 53.65  ? 690  HIS A CD2 1 
ATOM   4493  C  CE1 . HIS A 1  592 ? 6.208   -18.110 126.368 1.00 54.87  ? 690  HIS A CE1 1 
ATOM   4494  N  NE2 . HIS A 1  592 ? 5.470   -17.737 125.338 1.00 52.98  ? 690  HIS A NE2 1 
ATOM   4495  N  N   . GLN A 1  593 ? 1.024   -17.462 128.628 1.00 39.86  ? 691  GLN A N   1 
ATOM   4496  C  CA  . GLN A 1  593 ? 0.034   -16.470 128.232 1.00 31.15  ? 691  GLN A CA  1 
ATOM   4497  C  C   . GLN A 1  593 ? 0.644   -15.370 127.364 1.00 26.82  ? 691  GLN A C   1 
ATOM   4498  O  O   . GLN A 1  593 ? -0.050  -14.768 126.545 1.00 29.22  ? 691  GLN A O   1 
ATOM   4499  C  CB  . GLN A 1  593 ? -0.650  -15.873 129.463 1.00 33.54  ? 691  GLN A CB  1 
ATOM   4500  C  CG  . GLN A 1  593 ? -1.369  -16.914 130.313 1.00 40.70  ? 691  GLN A CG  1 
ATOM   4501  C  CD  . GLN A 1  593 ? -2.276  -16.299 131.362 1.00 45.67  ? 691  GLN A CD  1 
ATOM   4502  O  OE1 . GLN A 1  593 ? -2.271  -15.087 131.572 1.00 49.36  ? 691  GLN A OE1 1 
ATOM   4503  N  NE2 . GLN A 1  593 ? -3.061  -17.137 132.027 1.00 46.44  ? 691  GLN A NE2 1 
ATOM   4504  N  N   . THR A 1  594 ? 1.938   -15.113 127.531 1.00 19.39  ? 692  THR A N   1 
ATOM   4505  C  CA  . THR A 1  594 ? 2.593   -14.052 126.769 1.00 19.35  ? 692  THR A CA  1 
ATOM   4506  C  C   . THR A 1  594 ? 4.061   -14.349 126.454 1.00 23.36  ? 692  THR A C   1 
ATOM   4507  O  O   . THR A 1  594 ? 4.764   -14.997 127.232 1.00 25.06  ? 692  THR A O   1 
ATOM   4508  C  CB  . THR A 1  594 ? 2.507   -12.697 127.511 1.00 15.61  ? 692  THR A CB  1 
ATOM   4509  O  OG1 . THR A 1  594 ? 3.020   -11.654 126.673 1.00 15.00  ? 692  THR A OG1 1 
ATOM   4510  C  CG2 . THR A 1  594 ? 3.300   -12.735 128.810 1.00 15.64  ? 692  THR A CG2 1 
ATOM   4511  N  N   . PHE A 1  595 ? 4.505   -13.882 125.290 1.00 21.92  ? 693  PHE A N   1 
ATOM   4512  C  CA  . PHE A 1  595 ? 5.905   -13.993 124.895 1.00 21.22  ? 693  PHE A CA  1 
ATOM   4513  C  C   . PHE A 1  595 ? 6.731   -12.851 125.468 1.00 23.62  ? 693  PHE A C   1 
ATOM   4514  O  O   . PHE A 1  595 ? 7.954   -12.947 125.571 1.00 23.99  ? 693  PHE A O   1 
ATOM   4515  C  CB  . PHE A 1  595 ? 6.038   -14.006 123.369 1.00 20.61  ? 693  PHE A CB  1 
ATOM   4516  C  CG  . PHE A 1  595 ? 5.782   -15.348 122.746 1.00 24.01  ? 693  PHE A CG  1 
ATOM   4517  C  CD1 . PHE A 1  595 ? 6.776   -16.313 122.715 1.00 25.31  ? 693  PHE A CD1 1 
ATOM   4518  C  CD2 . PHE A 1  595 ? 4.551   -15.642 122.181 1.00 25.18  ? 693  PHE A CD2 1 
ATOM   4519  C  CE1 . PHE A 1  595 ? 6.546   -17.549 122.138 1.00 27.28  ? 693  PHE A CE1 1 
ATOM   4520  C  CE2 . PHE A 1  595 ? 4.315   -16.875 121.604 1.00 27.04  ? 693  PHE A CE2 1 
ATOM   4521  C  CZ  . PHE A 1  595 ? 5.315   -17.829 121.582 1.00 27.06  ? 693  PHE A CZ  1 
ATOM   4522  N  N   . LEU A 1  596 ? 6.056   -11.770 125.842 1.00 24.43  ? 694  LEU A N   1 
ATOM   4523  C  CA  . LEU A 1  596 ? 6.744   -10.561 126.267 1.00 24.74  ? 694  LEU A CA  1 
ATOM   4524  C  C   . LEU A 1  596 ? 5.938   -9.775  127.288 1.00 25.49  ? 694  LEU A C   1 
ATOM   4525  O  O   . LEU A 1  596 ? 4.711   -9.860  127.328 1.00 28.92  ? 694  LEU A O   1 
ATOM   4526  C  CB  . LEU A 1  596 ? 7.051   -9.667  125.059 1.00 25.15  ? 694  LEU A CB  1 
ATOM   4527  C  CG  . LEU A 1  596 ? 5.865   -8.946  124.404 1.00 22.19  ? 694  LEU A CG  1 
ATOM   4528  C  CD1 . LEU A 1  596 ? 5.745   -7.501  124.879 1.00 20.33  ? 694  LEU A CD1 1 
ATOM   4529  C  CD2 . LEU A 1  596 ? 5.965   -8.998  122.890 1.00 22.74  ? 694  LEU A CD2 1 
ATOM   4530  N  N   . THR A 1  597 ? 6.642   -9.010  128.113 1.00 20.87  ? 695  THR A N   1 
ATOM   4531  C  CA  . THR A 1  597 ? 6.009   -8.000  128.947 1.00 21.64  ? 695  THR A CA  1 
ATOM   4532  C  C   . THR A 1  597 ? 6.784   -6.694  128.867 1.00 22.82  ? 695  THR A C   1 
ATOM   4533  O  O   . THR A 1  597 ? 8.007   -6.694  128.735 1.00 20.91  ? 695  THR A O   1 
ATOM   4534  C  CB  . THR A 1  597 ? 5.916   -8.431  130.424 1.00 20.68  ? 695  THR A CB  1 
ATOM   4535  O  OG1 . THR A 1  597 ? 7.221   -8.765  130.909 1.00 23.46  ? 695  THR A OG1 1 
ATOM   4536  C  CG2 . THR A 1  597 ? 4.992   -9.630  130.587 1.00 19.64  ? 695  THR A CG2 1 
ATOM   4537  N  N   . VAL A 1  598 ? 6.065   -5.581  128.948 1.00 23.15  ? 696  VAL A N   1 
ATOM   4538  C  CA  . VAL A 1  598 ? 6.698   -4.295  129.185 1.00 20.04  ? 696  VAL A CA  1 
ATOM   4539  C  C   . VAL A 1  598 ? 6.393   -3.915  130.622 1.00 22.48  ? 696  VAL A C   1 
ATOM   4540  O  O   . VAL A 1  598 ? 5.232   -3.897  131.030 1.00 21.29  ? 696  VAL A O   1 
ATOM   4541  C  CB  . VAL A 1  598 ? 6.200   -3.206  128.219 1.00 16.45  ? 696  VAL A CB  1 
ATOM   4542  C  CG1 . VAL A 1  598 ? 6.918   -1.890  128.483 1.00 16.87  ? 696  VAL A CG1 1 
ATOM   4543  C  CG2 . VAL A 1  598 ? 6.396   -3.650  126.774 1.00 13.87  ? 696  VAL A CG2 1 
ATOM   4544  N  N   . GLU A 1  599 ? 7.435   -3.622  131.391 1.00 24.34  ? 697  GLU A N   1 
ATOM   4545  C  CA  . GLU A 1  599 ? 7.274   -3.418  132.822 1.00 21.87  ? 697  GLU A CA  1 
ATOM   4546  C  C   . GLU A 1  599 ? 7.803   -2.063  133.267 1.00 23.34  ? 697  GLU A C   1 
ATOM   4547  O  O   . GLU A 1  599 ? 8.851   -1.609  132.809 1.00 25.02  ? 697  GLU A O   1 
ATOM   4548  C  CB  . GLU A 1  599 ? 7.972   -4.538  133.594 1.00 21.25  ? 697  GLU A CB  1 
ATOM   4549  C  CG  . GLU A 1  599 ? 7.493   -5.932  133.211 1.00 23.28  ? 697  GLU A CG  1 
ATOM   4550  C  CD  . GLU A 1  599 ? 8.128   -7.026  134.044 1.00 26.94  ? 697  GLU A CD  1 
ATOM   4551  O  OE1 . GLU A 1  599 ? 8.956   -6.706  134.923 1.00 25.61  ? 697  GLU A OE1 1 
ATOM   4552  O  OE2 . GLU A 1  599 ? 7.796   -8.209  133.820 1.00 29.43  ? 697  GLU A OE2 1 
ATOM   4553  N  N   . LYS A 1  600 ? 7.064   -1.424  134.168 1.00 24.80  ? 698  LYS A N   1 
ATOM   4554  C  CA  . LYS A 1  600 ? 7.431   -0.112  134.682 1.00 25.93  ? 698  LYS A CA  1 
ATOM   4555  C  C   . LYS A 1  600 ? 7.917   -0.207  136.122 1.00 27.83  ? 698  LYS A C   1 
ATOM   4556  O  O   . LYS A 1  600 ? 7.309   -0.889  136.947 1.00 26.51  ? 698  LYS A O   1 
ATOM   4557  C  CB  . LYS A 1  600 ? 6.240   0.845   134.592 1.00 25.19  ? 698  LYS A CB  1 
ATOM   4558  C  CG  . LYS A 1  600 ? 6.545   2.271   135.014 1.00 30.47  ? 698  LYS A CG  1 
ATOM   4559  C  CD  . LYS A 1  600 ? 5.339   3.174   134.804 1.00 33.84  ? 698  LYS A CD  1 
ATOM   4560  C  CE  . LYS A 1  600 ? 5.692   4.637   135.035 1.00 39.22  ? 698  LYS A CE  1 
ATOM   4561  N  NZ  . LYS A 1  600 ? 6.116   4.902   136.439 1.00 41.81  ? 698  LYS A NZ  1 
ATOM   4562  N  N   . TYR A 1  601 ? 9.017   0.477   136.417 1.00 28.62  ? 699  TYR A N   1 
ATOM   4563  C  CA  . TYR A 1  601 ? 9.557   0.499   137.770 1.00 24.59  ? 699  TYR A CA  1 
ATOM   4564  C  C   . TYR A 1  601 ? 8.840   1.541   138.619 1.00 23.61  ? 699  TYR A C   1 
ATOM   4565  O  O   . TYR A 1  601 ? 8.734   2.704   138.230 1.00 20.74  ? 699  TYR A O   1 
ATOM   4566  C  CB  . TYR A 1  601 ? 11.060  0.782   137.750 1.00 22.83  ? 699  TYR A CB  1 
ATOM   4567  C  CG  . TYR A 1  601 ? 11.691  0.793   139.124 1.00 25.35  ? 699  TYR A CG  1 
ATOM   4568  C  CD1 . TYR A 1  601 ? 11.839  -0.381  139.852 1.00 27.98  ? 699  TYR A CD1 1 
ATOM   4569  C  CD2 . TYR A 1  601 ? 12.139  1.978   139.694 1.00 25.38  ? 699  TYR A CD2 1 
ATOM   4570  C  CE1 . TYR A 1  601 ? 12.415  -0.375  141.110 1.00 27.28  ? 699  TYR A CE1 1 
ATOM   4571  C  CE2 . TYR A 1  601 ? 12.715  1.995   140.950 1.00 27.03  ? 699  TYR A CE2 1 
ATOM   4572  C  CZ  . TYR A 1  601 ? 12.850  0.815   141.654 1.00 29.23  ? 699  TYR A CZ  1 
ATOM   4573  O  OH  . TYR A 1  601 ? 13.424  0.832   142.906 1.00 33.53  ? 699  TYR A OH  1 
ATOM   4574  N  N   . GLU A 1  602 ? 8.351   1.121   139.780 1.00 25.09  ? 700  GLU A N   1 
ATOM   4575  C  CA  . GLU A 1  602 ? 7.727   2.045   140.714 1.00 27.39  ? 700  GLU A CA  1 
ATOM   4576  C  C   . GLU A 1  602 ? 8.657   2.267   141.898 1.00 26.12  ? 700  GLU A C   1 
ATOM   4577  O  O   . GLU A 1  602 ? 8.845   1.379   142.727 1.00 30.49  ? 700  GLU A O   1 
ATOM   4578  C  CB  . GLU A 1  602 ? 6.369   1.521   141.181 1.00 36.28  ? 700  GLU A CB  1 
ATOM   4579  C  CG  . GLU A 1  602 ? 5.677   2.428   142.185 1.00 47.19  ? 700  GLU A CG  1 
ATOM   4580  C  CD  . GLU A 1  602 ? 5.552   3.857   141.690 1.00 56.14  ? 700  GLU A CD  1 
ATOM   4581  O  OE1 . GLU A 1  602 ? 5.202   4.052   140.506 1.00 59.25  ? 700  GLU A OE1 1 
ATOM   4582  O  OE2 . GLU A 1  602 ? 5.808   4.787   142.485 1.00 58.26  ? 700  GLU A OE2 1 
ATOM   4583  N  N   . ALA A 1  603 ? 9.226   3.465   141.971 1.00 22.73  ? 701  ALA A N   1 
ATOM   4584  C  CA  . ALA A 1  603 ? 10.259  3.777   142.952 1.00 20.25  ? 701  ALA A CA  1 
ATOM   4585  C  C   . ALA A 1  603 ? 9.761   3.689   144.391 1.00 21.11  ? 701  ALA A C   1 
ATOM   4586  O  O   . ALA A 1  603 ? 10.487  3.235   145.273 1.00 25.65  ? 701  ALA A O   1 
ATOM   4587  C  CB  . ALA A 1  603 ? 10.832  5.160   142.678 1.00 17.56  ? 701  ALA A CB  1 
ATOM   4588  N  N   . THR A 1  604 ? 8.530   4.130   144.626 1.00 23.58  ? 702  THR A N   1 
ATOM   4589  C  CA  . THR A 1  604 ? 7.958   4.120   145.968 1.00 29.34  ? 702  THR A CA  1 
ATOM   4590  C  C   . THR A 1  604 ? 7.949   2.715   146.569 1.00 30.48  ? 702  THR A C   1 
ATOM   4591  O  O   . THR A 1  604 ? 8.348   2.522   147.716 1.00 36.00  ? 702  THR A O   1 
ATOM   4592  C  CB  . THR A 1  604 ? 6.527   4.685   145.974 1.00 32.54  ? 702  THR A CB  1 
ATOM   4593  O  OG1 . THR A 1  604 ? 5.701   3.916   145.090 1.00 37.05  ? 702  THR A OG1 1 
ATOM   4594  C  CG2 . THR A 1  604 ? 6.530   6.138   145.519 1.00 30.75  ? 702  THR A CG2 1 
ATOM   4595  N  N   . SER A 1  605 ? 7.492   1.739   145.791 1.00 26.08  ? 703  SER A N   1 
ATOM   4596  C  CA  . SER A 1  605 ? 7.434   0.357   146.255 1.00 23.54  ? 703  SER A CA  1 
ATOM   4597  C  C   . SER A 1  605 ? 8.681   -0.435  145.864 1.00 28.90  ? 703  SER A C   1 
ATOM   4598  O  O   . SER A 1  605 ? 8.834   -1.590  146.263 1.00 34.82  ? 703  SER A O   1 
ATOM   4599  C  CB  . SER A 1  605 ? 6.187   -0.337  145.705 1.00 20.28  ? 703  SER A CB  1 
ATOM   4600  O  OG  . SER A 1  605 ? 6.103   -0.192  144.298 1.00 21.88  ? 703  SER A OG  1 
ATOM   4601  N  N   . THR A 1  606 ? 9.565   0.197   145.094 1.00 27.63  ? 704  THR A N   1 
ATOM   4602  C  CA  . THR A 1  606 ? 10.758  -0.456  144.545 1.00 27.77  ? 704  THR A CA  1 
ATOM   4603  C  C   . THR A 1  606 ? 10.428  -1.808  143.919 1.00 28.96  ? 704  THR A C   1 
ATOM   4604  O  O   . THR A 1  606 ? 10.978  -2.834  144.316 1.00 30.54  ? 704  THR A O   1 
ATOM   4605  C  CB  . THR A 1  606 ? 11.856  -0.659  145.615 1.00 31.98  ? 704  THR A CB  1 
ATOM   4606  O  OG1 . THR A 1  606 ? 11.361  -1.491  146.672 1.00 38.09  ? 704  THR A OG1 1 
ATOM   4607  C  CG2 . THR A 1  606 ? 12.302  0.677   146.186 1.00 30.46  ? 704  THR A CG2 1 
ATOM   4608  N  N   . SER A 1  607 ? 9.531   -1.801  142.939 1.00 27.09  ? 705  SER A N   1 
ATOM   4609  C  CA  . SER A 1  607 ? 9.099   -3.037  142.298 1.00 28.26  ? 705  SER A CA  1 
ATOM   4610  C  C   . SER A 1  607 ? 8.704   -2.793  140.849 1.00 33.02  ? 705  SER A C   1 
ATOM   4611  O  O   . SER A 1  607 ? 8.400   -1.664  140.460 1.00 33.76  ? 705  SER A O   1 
ATOM   4612  C  CB  . SER A 1  607 ? 7.930   -3.659  143.064 1.00 25.32  ? 705  SER A CB  1 
ATOM   4613  O  OG  . SER A 1  607 ? 6.813   -2.789  143.080 1.00 25.35  ? 705  SER A OG  1 
ATOM   4614  N  N   . TRP A 1  608 ? 8.714   -3.858  140.053 1.00 31.52  ? 706  TRP A N   1 
ATOM   4615  C  CA  . TRP A 1  608 ? 8.329   -3.767  138.650 1.00 26.01  ? 706  TRP A CA  1 
ATOM   4616  C  C   . TRP A 1  608 ? 6.877   -4.178  138.440 1.00 27.19  ? 706  TRP A C   1 
ATOM   4617  O  O   . TRP A 1  608 ? 6.418   -5.184  138.982 1.00 25.64  ? 706  TRP A O   1 
ATOM   4618  C  CB  . TRP A 1  608 ? 9.249   -4.633  137.789 1.00 22.35  ? 706  TRP A CB  1 
ATOM   4619  C  CG  . TRP A 1  608 ? 10.663  -4.142  137.744 1.00 22.87  ? 706  TRP A CG  1 
ATOM   4620  C  CD1 . TRP A 1  608 ? 11.687  -4.519  138.563 1.00 19.86  ? 706  TRP A CD1 1 
ATOM   4621  C  CD2 . TRP A 1  608 ? 11.209  -3.174  136.840 1.00 22.98  ? 706  TRP A CD2 1 
ATOM   4622  N  NE1 . TRP A 1  608 ? 12.838  -3.853  138.220 1.00 18.56  ? 706  TRP A NE1 1 
ATOM   4623  C  CE2 . TRP A 1  608 ? 12.570  -3.020  137.165 1.00 20.96  ? 706  TRP A CE2 1 
ATOM   4624  C  CE3 . TRP A 1  608 ? 10.679  -2.426  135.784 1.00 26.72  ? 706  TRP A CE3 1 
ATOM   4625  C  CZ2 . TRP A 1  608 ? 13.408  -2.149  136.474 1.00 24.65  ? 706  TRP A CZ2 1 
ATOM   4626  C  CZ3 . TRP A 1  608 ? 11.512  -1.561  135.101 1.00 27.88  ? 706  TRP A CZ3 1 
ATOM   4627  C  CH2 . TRP A 1  608 ? 12.861  -1.430  135.448 1.00 25.75  ? 706  TRP A CH2 1 
ATOM   4628  N  N   . GLN A 1  609 ? 6.161   -3.391  137.645 1.00 29.48  ? 707  GLN A N   1 
ATOM   4629  C  CA  . GLN A 1  609 ? 4.752   -3.646  137.379 1.00 31.50  ? 707  GLN A CA  1 
ATOM   4630  C  C   . GLN A 1  609 ? 4.501   -3.802  135.882 1.00 29.08  ? 707  GLN A C   1 
ATOM   4631  O  O   . GLN A 1  609 ? 4.867   -2.932  135.091 1.00 27.12  ? 707  GLN A O   1 
ATOM   4632  C  CB  . GLN A 1  609 ? 3.899   -2.514  137.949 1.00 37.97  ? 707  GLN A CB  1 
ATOM   4633  C  CG  . GLN A 1  609 ? 3.932   -2.433  139.467 1.00 47.70  ? 707  GLN A CG  1 
ATOM   4634  C  CD  . GLN A 1  609 ? 3.465   -1.090  139.986 1.00 60.11  ? 707  GLN A CD  1 
ATOM   4635  O  OE1 . GLN A 1  609 ? 2.935   -0.272  139.234 1.00 65.26  ? 707  GLN A OE1 1 
ATOM   4636  N  NE2 . GLN A 1  609 ? 3.666   -0.851  141.278 1.00 64.21  ? 707  GLN A NE2 1 
ATOM   4637  N  N   . ILE A 1  610 ? 3.879   -4.911  135.495 1.00 26.02  ? 708  ILE A N   1 
ATOM   4638  C  CA  . ILE A 1  610 ? 3.607   -5.180  134.086 1.00 25.94  ? 708  ILE A CA  1 
ATOM   4639  C  C   . ILE A 1  610 ? 2.603   -4.177  133.524 1.00 21.69  ? 708  ILE A C   1 
ATOM   4640  O  O   . ILE A 1  610 ? 1.514   -4.008  134.067 1.00 20.26  ? 708  ILE A O   1 
ATOM   4641  C  CB  . ILE A 1  610 ? 3.073   -6.611  133.871 1.00 25.74  ? 708  ILE A CB  1 
ATOM   4642  C  CG1 . ILE A 1  610 ? 4.078   -7.641  134.390 1.00 23.34  ? 708  ILE A CG1 1 
ATOM   4643  C  CG2 . ILE A 1  610 ? 2.783   -6.857  132.400 1.00 24.01  ? 708  ILE A CG2 1 
ATOM   4644  C  CD1 . ILE A 1  610 ? 3.485   -9.015  134.603 1.00 21.70  ? 708  ILE A CD1 1 
ATOM   4645  N  N   . VAL A 1  611 ? 2.982   -3.511  132.438 1.00 22.11  ? 709  VAL A N   1 
ATOM   4646  C  CA  . VAL A 1  611 ? 2.124   -2.516  131.803 1.00 21.41  ? 709  VAL A CA  1 
ATOM   4647  C  C   . VAL A 1  611 ? 1.624   -3.016  130.447 1.00 19.16  ? 709  VAL A C   1 
ATOM   4648  O  O   . VAL A 1  611 ? 0.505   -2.710  130.034 1.00 19.34  ? 709  VAL A O   1 
ATOM   4649  C  CB  . VAL A 1  611 ? 2.873   -1.171  131.624 1.00 22.06  ? 709  VAL A CB  1 
ATOM   4650  C  CG1 . VAL A 1  611 ? 2.042   -0.173  130.825 1.00 27.05  ? 709  VAL A CG1 1 
ATOM   4651  C  CG2 . VAL A 1  611 ? 3.246   -0.593  132.980 1.00 16.36  ? 709  VAL A CG2 1 
ATOM   4652  N  N   . CYS A 1  612 ? 2.444   -3.815  129.771 1.00 17.50  ? 710  CYS A N   1 
ATOM   4653  C  CA  . CYS A 1  612 ? 2.045   -4.413  128.503 1.00 16.61  ? 710  CYS A CA  1 
ATOM   4654  C  C   . CYS A 1  612 ? 2.352   -5.906  128.449 1.00 20.28  ? 710  CYS A C   1 
ATOM   4655  O  O   . CYS A 1  612 ? 3.219   -6.401  129.167 1.00 20.18  ? 710  CYS A O   1 
ATOM   4656  C  CB  . CYS A 1  612 ? 2.742   -3.709  127.335 1.00 16.56  ? 710  CYS A CB  1 
ATOM   4657  S  SG  . CYS A 1  612 ? 2.422   -1.936  127.184 1.00 25.30  ? 710  CYS A SG  1 
ATOM   4658  N  N   . ASN A 1  613 ? 1.627   -6.611  127.587 1.00 14.22  ? 711  ASN A N   1 
ATOM   4659  C  CA  . ASN A 1  613 ? 1.947   -7.989  127.236 1.00 14.32  ? 711  ASN A CA  1 
ATOM   4660  C  C   . ASN A 1  613 ? 1.887   -8.122  125.720 1.00 16.97  ? 711  ASN A C   1 
ATOM   4661  O  O   . ASN A 1  613 ? 1.734   -7.119  125.023 1.00 15.94  ? 711  ASN A O   1 
ATOM   4662  C  CB  . ASN A 1  613 ? 0.993   -8.977  127.916 1.00 21.22  ? 711  ASN A CB  1 
ATOM   4663  C  CG  . ASN A 1  613 ? -0.472  -8.664  127.651 1.00 22.92  ? 711  ASN A CG  1 
ATOM   4664  O  OD1 . ASN A 1  613 ? -0.807  -7.906  126.740 1.00 26.16  ? 711  ASN A OD1 1 
ATOM   4665  N  ND2 . ASN A 1  613 ? -1.353  -9.259  128.446 1.00 22.25  ? 711  ASN A ND2 1 
ATOM   4666  N  N   . ASP A 1  614 ? 1.997   -9.340  125.199 1.00 16.39  ? 712  ASP A N   1 
ATOM   4667  C  CA  . ASP A 1  614 ? 2.000   -9.507  123.749 1.00 18.86  ? 712  ASP A CA  1 
ATOM   4668  C  C   . ASP A 1  614 ? 0.607   -9.288  123.147 1.00 24.30  ? 712  ASP A C   1 
ATOM   4669  O  O   . ASP A 1  614 ? 0.456   -9.205  121.929 1.00 29.56  ? 712  ASP A O   1 
ATOM   4670  C  CB  . ASP A 1  614 ? 2.544   -10.888 123.357 1.00 16.50  ? 712  ASP A CB  1 
ATOM   4671  C  CG  . ASP A 1  614 ? 1.708   -12.039 123.898 1.00 18.95  ? 712  ASP A CG  1 
ATOM   4672  O  OD1 . ASP A 1  614 ? 0.619   -11.805 124.464 1.00 18.99  ? 712  ASP A OD1 1 
ATOM   4673  O  OD2 . ASP A 1  614 ? 2.146   -13.199 123.741 1.00 21.14  ? 712  ASP A OD2 1 
ATOM   4674  N  N   . ALA A 1  615 ? -0.405  -9.192  124.006 1.00 18.68  ? 713  ALA A N   1 
ATOM   4675  C  CA  . ALA A 1  615 ? -1.768  -8.925  123.556 1.00 18.58  ? 713  ALA A CA  1 
ATOM   4676  C  C   . ALA A 1  615 ? -2.001  -7.434  123.326 1.00 15.53  ? 713  ALA A C   1 
ATOM   4677  O  O   . ALA A 1  615 ? -2.870  -7.047  122.547 1.00 15.92  ? 713  ALA A O   1 
ATOM   4678  C  CB  . ALA A 1  615 ? -2.772  -9.467  124.558 1.00 21.35  ? 713  ALA A CB  1 
ATOM   4679  N  N   . SER A 1  616 ? -1.223  -6.601  124.011 1.00 15.22  ? 714  SER A N   1 
ATOM   4680  C  CA  . SER A 1  616 ? -1.272  -5.159  123.797 1.00 16.80  ? 714  SER A CA  1 
ATOM   4681  C  C   . SER A 1  616 ? -0.958  -4.817  122.347 1.00 15.12  ? 714  SER A C   1 
ATOM   4682  O  O   . SER A 1  616 ? 0.058   -5.243  121.809 1.00 14.82  ? 714  SER A O   1 
ATOM   4683  C  CB  . SER A 1  616 ? -0.289  -4.439  124.726 1.00 16.18  ? 714  SER A CB  1 
ATOM   4684  O  OG  . SER A 1  616 ? -0.518  -4.775  126.081 1.00 19.24  ? 714  SER A OG  1 
ATOM   4685  N  N   . TRP A 1  617 ? -1.820  -4.027  121.719 1.00 23.02  ? 715  TRP A N   1 
ATOM   4686  C  CA  . TRP A 1  617 ? -1.619  -3.652  120.325 1.00 24.51  ? 715  TRP A CA  1 
ATOM   4687  C  C   . TRP A 1  617 ? -0.427  -2.714  120.169 1.00 23.22  ? 715  TRP A C   1 
ATOM   4688  O  O   . TRP A 1  617 ? 0.042   -2.474  119.058 1.00 19.34  ? 715  TRP A O   1 
ATOM   4689  C  CB  . TRP A 1  617 ? -2.885  -3.005  119.758 1.00 23.84  ? 715  TRP A CB  1 
ATOM   4690  C  CG  . TRP A 1  617 ? -3.960  -3.998  119.436 1.00 24.65  ? 715  TRP A CG  1 
ATOM   4691  C  CD1 . TRP A 1  617 ? -4.732  -4.687  120.324 1.00 25.07  ? 715  TRP A CD1 1 
ATOM   4692  C  CD2 . TRP A 1  617 ? -4.383  -4.411  118.131 1.00 26.50  ? 715  TRP A CD2 1 
ATOM   4693  N  NE1 . TRP A 1  617 ? -5.609  -5.506  119.654 1.00 25.71  ? 715  TRP A NE1 1 
ATOM   4694  C  CE2 . TRP A 1  617 ? -5.416  -5.354  118.306 1.00 26.54  ? 715  TRP A CE2 1 
ATOM   4695  C  CE3 . TRP A 1  617 ? -3.990  -4.074  116.832 1.00 27.53  ? 715  TRP A CE3 1 
ATOM   4696  C  CZ2 . TRP A 1  617 ? -6.061  -5.963  117.231 1.00 25.87  ? 715  TRP A CZ2 1 
ATOM   4697  C  CZ3 . TRP A 1  617 ? -4.630  -4.682  115.767 1.00 27.31  ? 715  TRP A CZ3 1 
ATOM   4698  C  CH2 . TRP A 1  617 ? -5.654  -5.616  115.972 1.00 26.24  ? 715  TRP A CH2 1 
ATOM   4699  N  N   . GLU A 1  618 ? 0.057   -2.193  121.293 1.00 26.73  ? 716  GLU A N   1 
ATOM   4700  C  CA  . GLU A 1  618 ? 1.210   -1.300  121.307 1.00 31.08  ? 716  GLU A CA  1 
ATOM   4701  C  C   . GLU A 1  618 ? 2.527   -2.061  121.170 1.00 26.52  ? 716  GLU A C   1 
ATOM   4702  O  O   . GLU A 1  618 ? 3.541   -1.493  120.766 1.00 27.48  ? 716  GLU A O   1 
ATOM   4703  C  CB  . GLU A 1  618 ? 1.218   -0.483  122.600 1.00 37.38  ? 716  GLU A CB  1 
ATOM   4704  C  CG  . GLU A 1  618 ? -0.164  -0.274  123.194 1.00 45.14  ? 716  GLU A CG  1 
ATOM   4705  C  CD  . GLU A 1  618 ? -0.118  0.018   124.678 1.00 56.38  ? 716  GLU A CD  1 
ATOM   4706  O  OE1 . GLU A 1  618 ? 0.917   0.532   125.152 1.00 61.26  ? 716  GLU A OE1 1 
ATOM   4707  O  OE2 . GLU A 1  618 ? -1.112  -0.278  125.373 1.00 61.02  ? 716  GLU A OE2 1 
ATOM   4708  N  N   . THR A 1  619 ? 2.507   -3.343  121.518 1.00 18.27  ? 717  THR A N   1 
ATOM   4709  C  CA  . THR A 1  619 ? 3.708   -4.169  121.460 1.00 15.73  ? 717  THR A CA  1 
ATOM   4710  C  C   . THR A 1  619 ? 3.697   -5.115  120.264 1.00 17.56  ? 717  THR A C   1 
ATOM   4711  O  O   . THR A 1  619 ? 2.638   -5.532  119.797 1.00 18.47  ? 717  THR A O   1 
ATOM   4712  C  CB  . THR A 1  619 ? 3.894   -4.997  122.750 1.00 16.18  ? 717  THR A CB  1 
ATOM   4713  O  OG1 . THR A 1  619 ? 2.789   -5.893  122.916 1.00 14.89  ? 717  THR A OG1 1 
ATOM   4714  C  CG2 . THR A 1  619 ? 3.985   -4.084  123.960 1.00 13.75  ? 717  THR A CG2 1 
ATOM   4715  N  N   . ARG A 1  620 ? 4.886   -5.436  119.766 1.00 18.76  ? 718  ARG A N   1 
ATOM   4716  C  CA  . ARG A 1  620 ? 5.035   -6.393  118.679 1.00 20.87  ? 718  ARG A CA  1 
ATOM   4717  C  C   . ARG A 1  620 ? 6.141   -7.394  118.996 1.00 23.13  ? 718  ARG A C   1 
ATOM   4718  O  O   . ARG A 1  620 ? 7.141   -7.049  119.625 1.00 24.89  ? 718  ARG A O   1 
ATOM   4719  C  CB  . ARG A 1  620 ? 5.327   -5.667  117.363 1.00 21.13  ? 718  ARG A CB  1 
ATOM   4720  C  CG  . ARG A 1  620 ? 4.220   -4.718  116.935 1.00 22.62  ? 718  ARG A CG  1 
ATOM   4721  C  CD  . ARG A 1  620 ? 4.533   -4.027  115.622 1.00 22.60  ? 718  ARG A CD  1 
ATOM   4722  N  NE  . ARG A 1  620 ? 3.665   -2.871  115.418 1.00 24.93  ? 718  ARG A NE  1 
ATOM   4723  C  CZ  . ARG A 1  620 ? 3.737   -2.051  114.375 1.00 27.47  ? 718  ARG A CZ  1 
ATOM   4724  N  NH1 . ARG A 1  620 ? 4.641   -2.255  113.427 1.00 27.06  ? 718  ARG A NH1 1 
ATOM   4725  N  NH2 . ARG A 1  620 ? 2.903   -1.024  114.280 1.00 27.17  ? 718  ARG A NH2 1 
ATOM   4726  N  N   . PHE A 1  621 ? 5.951   -8.636  118.561 1.00 20.10  ? 719  PHE A N   1 
ATOM   4727  C  CA  . PHE A 1  621 ? 6.930   -9.692  118.794 1.00 17.10  ? 719  PHE A CA  1 
ATOM   4728  C  C   . PHE A 1  621 ? 7.318   -10.362 117.481 1.00 20.12  ? 719  PHE A C   1 
ATOM   4729  O  O   . PHE A 1  621 ? 6.503   -11.050 116.873 1.00 20.02  ? 719  PHE A O   1 
ATOM   4730  C  CB  . PHE A 1  621 ? 6.379   -10.726 119.780 1.00 18.62  ? 719  PHE A CB  1 
ATOM   4731  C  CG  . PHE A 1  621 ? 7.266   -11.927 119.964 1.00 23.23  ? 719  PHE A CG  1 
ATOM   4732  C  CD1 . PHE A 1  621 ? 8.386   -11.860 120.778 1.00 23.15  ? 719  PHE A CD1 1 
ATOM   4733  C  CD2 . PHE A 1  621 ? 6.970   -13.127 119.338 1.00 21.80  ? 719  PHE A CD2 1 
ATOM   4734  C  CE1 . PHE A 1  621 ? 9.201   -12.963 120.952 1.00 22.94  ? 719  PHE A CE1 1 
ATOM   4735  C  CE2 . PHE A 1  621 ? 7.781   -14.233 119.509 1.00 24.38  ? 719  PHE A CE2 1 
ATOM   4736  C  CZ  . PHE A 1  621 ? 8.898   -14.151 120.317 1.00 23.06  ? 719  PHE A CZ  1 
ATOM   4737  N  N   . TYR A 1  622 ? 8.556   -10.150 117.043 1.00 24.07  ? 720  TYR A N   1 
ATOM   4738  C  CA  . TYR A 1  622 ? 9.054   -10.773 115.818 1.00 25.44  ? 720  TYR A CA  1 
ATOM   4739  C  C   . TYR A 1  622 ? 10.022  -11.913 116.108 1.00 23.50  ? 720  TYR A C   1 
ATOM   4740  O  O   . TYR A 1  622 ? 10.850  -11.823 117.013 1.00 21.74  ? 720  TYR A O   1 
ATOM   4741  C  CB  . TYR A 1  622 ? 9.750   -9.741  114.927 1.00 28.82  ? 720  TYR A CB  1 
ATOM   4742  C  CG  . TYR A 1  622 ? 8.847   -8.661  114.380 1.00 33.27  ? 720  TYR A CG  1 
ATOM   4743  C  CD1 . TYR A 1  622 ? 8.546   -7.533  115.133 1.00 33.96  ? 720  TYR A CD1 1 
ATOM   4744  C  CD2 . TYR A 1  622 ? 8.310   -8.759  113.103 1.00 36.16  ? 720  TYR A CD2 1 
ATOM   4745  C  CE1 . TYR A 1  622 ? 7.728   -6.539  114.634 1.00 38.44  ? 720  TYR A CE1 1 
ATOM   4746  C  CE2 . TYR A 1  622 ? 7.492   -7.768  112.594 1.00 38.48  ? 720  TYR A CE2 1 
ATOM   4747  C  CZ  . TYR A 1  622 ? 7.202   -6.661  113.365 1.00 40.87  ? 720  TYR A CZ  1 
ATOM   4748  O  OH  . TYR A 1  622 ? 6.387   -5.671  112.864 1.00 43.36  ? 720  TYR A OH  1 
ATOM   4749  N  N   . TRP A 1  623 ? 9.927   -12.978 115.320 1.00 25.97  ? 721  TRP A N   1 
ATOM   4750  C  CA  . TRP A 1  623 ? 10.868  -14.085 115.424 1.00 27.93  ? 721  TRP A CA  1 
ATOM   4751  C  C   . TRP A 1  623 ? 11.581  -14.302 114.094 1.00 27.46  ? 721  TRP A C   1 
ATOM   4752  O  O   . TRP A 1  623 ? 10.940  -14.416 113.049 1.00 27.63  ? 721  TRP A O   1 
ATOM   4753  C  CB  . TRP A 1  623 ? 10.152  -15.365 115.853 1.00 16.67  ? 721  TRP A CB  1 
ATOM   4754  C  CG  . TRP A 1  623 ? 11.065  -16.544 115.989 1.00 18.64  ? 721  TRP A CG  1 
ATOM   4755  C  CD1 . TRP A 1  623 ? 11.929  -16.795 117.015 1.00 17.43  ? 721  TRP A CD1 1 
ATOM   4756  C  CD2 . TRP A 1  623 ? 11.211  -17.631 115.066 1.00 17.98  ? 721  TRP A CD2 1 
ATOM   4757  N  NE1 . TRP A 1  623 ? 12.598  -17.974 116.793 1.00 21.38  ? 721  TRP A NE1 1 
ATOM   4758  C  CE2 . TRP A 1  623 ? 12.177  -18.507 115.603 1.00 20.24  ? 721  TRP A CE2 1 
ATOM   4759  C  CE3 . TRP A 1  623 ? 10.616  -17.951 113.841 1.00 18.25  ? 721  TRP A CE3 1 
ATOM   4760  C  CZ2 . TRP A 1  623 ? 12.563  -19.681 114.956 1.00 19.40  ? 721  TRP A CZ2 1 
ATOM   4761  C  CZ3 . TRP A 1  623 ? 11.002  -19.117 113.199 1.00 21.95  ? 721  TRP A CZ3 1 
ATOM   4762  C  CH2 . TRP A 1  623 ? 11.967  -19.968 113.759 1.00 19.62  ? 721  TRP A CH2 1 
ATOM   4763  N  N   . HIS A 1  624 ? 12.907  -14.354 114.135 1.00 26.16  ? 722  HIS A N   1 
ATOM   4764  C  CA  . HIS A 1  624 ? 13.690  -14.559 112.924 1.00 29.26  ? 722  HIS A CA  1 
ATOM   4765  C  C   . HIS A 1  624 ? 14.583  -15.791 113.042 1.00 29.96  ? 722  HIS A C   1 
ATOM   4766  O  O   . HIS A 1  624 ? 15.366  -15.916 113.985 1.00 32.23  ? 722  HIS A O   1 
ATOM   4767  C  CB  . HIS A 1  624 ? 14.532  -13.322 112.612 1.00 34.84  ? 722  HIS A CB  1 
ATOM   4768  C  CG  . HIS A 1  624 ? 15.175  -13.359 111.261 1.00 45.94  ? 722  HIS A CG  1 
ATOM   4769  N  ND1 . HIS A 1  624 ? 16.489  -13.731 111.071 1.00 50.42  ? 722  HIS A ND1 1 
ATOM   4770  C  CD2 . HIS A 1  624 ? 14.682  -13.083 110.031 1.00 48.26  ? 722  HIS A CD2 1 
ATOM   4771  C  CE1 . HIS A 1  624 ? 16.779  -13.676 109.784 1.00 49.63  ? 722  HIS A CE1 1 
ATOM   4772  N  NE2 . HIS A 1  624 ? 15.700  -13.285 109.130 1.00 50.74  ? 722  HIS A NE2 1 
ATOM   4773  N  N   . LYS A 1  625 ? 14.456  -16.701 112.083 1.00 29.50  ? 723  LYS A N   1 
ATOM   4774  C  CA  . LYS A 1  625 ? 15.219  -17.944 112.097 1.00 27.50  ? 723  LYS A CA  1 
ATOM   4775  C  C   . LYS A 1  625 ? 16.626  -17.744 111.542 1.00 26.29  ? 723  LYS A C   1 
ATOM   4776  O  O   . LYS A 1  625 ? 16.816  -17.053 110.541 1.00 20.80  ? 723  LYS A O   1 
ATOM   4777  C  CB  . LYS A 1  625 ? 14.491  -19.027 111.297 1.00 28.22  ? 723  LYS A CB  1 
ATOM   4778  C  CG  . LYS A 1  625 ? 15.110  -20.409 111.428 1.00 30.46  ? 723  LYS A CG  1 
ATOM   4779  C  CD  . LYS A 1  625 ? 14.369  -21.438 110.592 1.00 34.89  ? 723  LYS A CD  1 
ATOM   4780  C  CE  . LYS A 1  625 ? 15.124  -22.759 110.559 1.00 45.97  ? 723  LYS A CE  1 
ATOM   4781  N  NZ  . LYS A 1  625 ? 14.363  -23.827 109.853 1.00 49.89  ? 723  LYS A NZ  1 
ATOM   4782  N  N   . GLY A 1  626 ? 17.606  -18.356 112.199 1.00 25.33  ? 724  GLY A N   1 
ATOM   4783  C  CA  . GLY A 1  626 ? 18.989  -18.275 111.767 1.00 22.78  ? 724  GLY A CA  1 
ATOM   4784  C  C   . GLY A 1  626 ? 19.541  -19.625 111.356 1.00 27.22  ? 724  GLY A C   1 
ATOM   4785  O  O   . GLY A 1  626 ? 18.784  -20.546 111.048 1.00 29.80  ? 724  GLY A O   1 
ATOM   4786  N  N   . LEU A 1  627 ? 20.865  -19.743 111.350 1.00 27.66  ? 725  LEU A N   1 
ATOM   4787  C  CA  . LEU A 1  627 ? 21.522  -20.967 110.901 1.00 26.35  ? 725  LEU A CA  1 
ATOM   4788  C  C   . LEU A 1  627 ? 21.678  -22.000 112.010 1.00 21.37  ? 725  LEU A C   1 
ATOM   4789  O  O   . LEU A 1  627 ? 22.106  -21.676 113.118 1.00 27.67  ? 725  LEU A O   1 
ATOM   4790  C  CB  . LEU A 1  627 ? 22.897  -20.644 110.310 1.00 23.51  ? 725  LEU A CB  1 
ATOM   4791  C  CG  . LEU A 1  627 ? 22.915  -19.681 109.124 1.00 22.80  ? 725  LEU A CG  1 
ATOM   4792  C  CD1 . LEU A 1  627 ? 24.342  -19.420 108.669 1.00 21.34  ? 725  LEU A CD1 1 
ATOM   4793  C  CD2 . LEU A 1  627 ? 22.070  -20.228 107.982 1.00 21.84  ? 725  LEU A CD2 1 
ATOM   4794  N  N   . LEU A 1  628 ? 21.324  -23.242 111.689 1.00 22.11  ? 726  LEU A N   1 
ATOM   4795  C  CA  . LEU A 1  628 ? 21.568  -24.396 112.553 1.00 23.69  ? 726  LEU A CA  1 
ATOM   4796  C  C   . LEU A 1  628 ? 21.032  -24.238 113.973 1.00 28.99  ? 726  LEU A C   1 
ATOM   4797  O  O   . LEU A 1  628 ? 21.743  -24.509 114.939 1.00 36.90  ? 726  LEU A O   1 
ATOM   4798  C  CB  . LEU A 1  628 ? 23.069  -24.694 112.610 1.00 23.14  ? 726  LEU A CB  1 
ATOM   4799  C  CG  . LEU A 1  628 ? 23.756  -25.004 111.279 1.00 24.26  ? 726  LEU A CG  1 
ATOM   4800  C  CD1 . LEU A 1  628 ? 25.220  -25.344 111.501 1.00 24.20  ? 726  LEU A CD1 1 
ATOM   4801  C  CD2 . LEU A 1  628 ? 23.042  -26.138 110.560 1.00 24.52  ? 726  LEU A CD2 1 
ATOM   4802  N  N   . GLY A 1  629 ? 19.783  -23.801 114.099 1.00 21.78  ? 727  GLY A N   1 
ATOM   4803  C  CA  . GLY A 1  629 ? 19.152  -23.715 115.403 1.00 21.81  ? 727  GLY A CA  1 
ATOM   4804  C  C   . GLY A 1  629 ? 19.255  -22.348 116.051 1.00 26.11  ? 727  GLY A C   1 
ATOM   4805  O  O   . GLY A 1  629 ? 18.668  -22.109 117.105 1.00 28.58  ? 727  GLY A O   1 
ATOM   4806  N  N   . LEU A 1  630 ? 20.013  -21.450 115.432 1.00 20.23  ? 728  LEU A N   1 
ATOM   4807  C  CA  . LEU A 1  630 ? 20.121  -20.083 115.923 1.00 28.62  ? 728  LEU A CA  1 
ATOM   4808  C  C   . LEU A 1  630 ? 18.856  -19.303 115.589 1.00 27.66  ? 728  LEU A C   1 
ATOM   4809  O  O   . LEU A 1  630 ? 18.236  -19.539 114.553 1.00 26.31  ? 728  LEU A O   1 
ATOM   4810  C  CB  . LEU A 1  630 ? 21.344  -19.388 115.323 1.00 25.18  ? 728  LEU A CB  1 
ATOM   4811  C  CG  . LEU A 1  630 ? 22.655  -19.540 116.095 1.00 24.75  ? 728  LEU A CG  1 
ATOM   4812  C  CD1 . LEU A 1  630 ? 23.761  -18.766 115.406 1.00 20.97  ? 728  LEU A CD1 1 
ATOM   4813  C  CD2 . LEU A 1  630 ? 22.496  -19.083 117.538 1.00 28.24  ? 728  LEU A CD2 1 
ATOM   4814  N  N   . SER A 1  631 ? 18.476  -18.376 116.464 1.00 27.37  ? 729  SER A N   1 
ATOM   4815  C  CA  . SER A 1  631 ? 17.283  -17.564 116.241 1.00 23.63  ? 729  SER A CA  1 
ATOM   4816  C  C   . SER A 1  631 ? 17.201  -16.347 117.155 1.00 17.66  ? 729  SER A C   1 
ATOM   4817  O  O   . SER A 1  631 ? 17.617  -16.394 118.311 1.00 21.05  ? 729  SER A O   1 
ATOM   4818  C  CB  . SER A 1  631 ? 16.026  -18.414 116.429 1.00 26.95  ? 729  SER A CB  1 
ATOM   4819  O  OG  . SER A 1  631 ? 14.872  -17.596 116.473 1.00 35.59  ? 729  SER A OG  1 
ATOM   4820  N  N   . ASN A 1  632 ? 16.639  -15.262 116.632 1.00 17.42  ? 730  ASN A N   1 
ATOM   4821  C  CA  . ASN A 1  632 ? 16.431  -14.059 117.424 1.00 20.58  ? 730  ASN A CA  1 
ATOM   4822  C  C   . ASN A 1  632 ? 14.958  -13.843 117.725 1.00 21.88  ? 730  ASN A C   1 
ATOM   4823  O  O   . ASN A 1  632 ? 14.091  -14.192 116.923 1.00 22.51  ? 730  ASN A O   1 
ATOM   4824  C  CB  . ASN A 1  632 ? 16.967  -12.825 116.707 1.00 24.60  ? 730  ASN A CB  1 
ATOM   4825  C  CG  . ASN A 1  632 ? 18.469  -12.830 116.566 1.00 32.37  ? 730  ASN A CG  1 
ATOM   4826  O  OD1 . ASN A 1  632 ? 19.146  -13.790 116.932 1.00 30.49  ? 730  ASN A OD1 1 
ATOM   4827  N  ND2 . ASN A 1  632 ? 19.000  -11.734 116.038 1.00 40.78  ? 730  ASN A ND2 1 
ATOM   4828  N  N   . ALA A 1  633 ? 14.685  -13.251 118.881 1.00 24.06  ? 731  ALA A N   1 
ATOM   4829  C  CA  . ALA A 1  633 ? 13.336  -12.842 119.236 1.00 21.70  ? 731  ALA A CA  1 
ATOM   4830  C  C   . ALA A 1  633 ? 13.328  -11.345 119.499 1.00 22.92  ? 731  ALA A C   1 
ATOM   4831  O  O   . ALA A 1  633 ? 13.939  -10.872 120.458 1.00 19.33  ? 731  ALA A O   1 
ATOM   4832  C  CB  . ALA A 1  633 ? 12.838  -13.608 120.446 1.00 19.18  ? 731  ALA A CB  1 
ATOM   4833  N  N   . THR A 1  634 ? 12.645  -10.604 118.634 1.00 24.04  ? 732  THR A N   1 
ATOM   4834  C  CA  . THR A 1  634 ? 12.600  -9.154  118.743 1.00 21.14  ? 732  THR A CA  1 
ATOM   4835  C  C   . THR A 1  634 ? 11.287  -8.674  119.348 1.00 22.83  ? 732  THR A C   1 
ATOM   4836  O  O   . THR A 1  634 ? 10.209  -8.993  118.849 1.00 21.36  ? 732  THR A O   1 
ATOM   4837  C  CB  . THR A 1  634 ? 12.793  -8.487  117.369 1.00 19.33  ? 732  THR A CB  1 
ATOM   4838  O  OG1 . THR A 1  634 ? 14.022  -8.940  116.786 1.00 20.85  ? 732  THR A OG1 1 
ATOM   4839  C  CG2 . THR A 1  634 ? 12.831  -6.974  117.510 1.00 18.98  ? 732  THR A CG2 1 
ATOM   4840  N  N   . VAL A 1  635 ? 11.388  -7.911  120.431 1.00 21.15  ? 733  VAL A N   1 
ATOM   4841  C  CA  . VAL A 1  635 ? 10.218  -7.278  121.025 1.00 19.08  ? 733  VAL A CA  1 
ATOM   4842  C  C   . VAL A 1  635 ? 10.249  -5.782  120.760 1.00 18.46  ? 733  VAL A C   1 
ATOM   4843  O  O   . VAL A 1  635 ? 11.219  -5.107  121.101 1.00 17.83  ? 733  VAL A O   1 
ATOM   4844  C  CB  . VAL A 1  635 ? 10.134  -7.519  122.542 1.00 22.46  ? 733  VAL A CB  1 
ATOM   4845  C  CG1 . VAL A 1  635 ? 8.930   -6.793  123.120 1.00 16.90  ? 733  VAL A CG1 1 
ATOM   4846  C  CG2 . VAL A 1  635 ? 10.057  -9.007  122.840 1.00 21.99  ? 733  VAL A CG2 1 
ATOM   4847  N  N   . GLU A 1  636 ? 9.190   -5.271  120.142 1.00 21.94  ? 734  GLU A N   1 
ATOM   4848  C  CA  . GLU A 1  636 ? 9.071   -3.843  119.886 1.00 20.64  ? 734  GLU A CA  1 
ATOM   4849  C  C   . GLU A 1  636 ? 7.980   -3.223  120.744 1.00 24.36  ? 734  GLU A C   1 
ATOM   4850  O  O   . GLU A 1  636 ? 6.862   -3.734  120.803 1.00 29.16  ? 734  GLU A O   1 
ATOM   4851  C  CB  . GLU A 1  636 ? 8.777   -3.580  118.409 1.00 30.01  ? 734  GLU A CB  1 
ATOM   4852  C  CG  . GLU A 1  636 ? 9.915   -3.928  117.470 1.00 38.35  ? 734  GLU A CG  1 
ATOM   4853  C  CD  . GLU A 1  636 ? 9.569   -3.653  116.021 1.00 43.77  ? 734  GLU A CD  1 
ATOM   4854  O  OE1 . GLU A 1  636 ? 10.366  -4.028  115.137 1.00 44.93  ? 734  GLU A OE1 1 
ATOM   4855  O  OE2 . GLU A 1  636 ? 8.502   -3.054  115.768 1.00 45.69  ? 734  GLU A OE2 1 
ATOM   4856  N  N   . TRP A 1  637 ? 8.307   -2.122  121.412 1.00 21.82  ? 735  TRP A N   1 
ATOM   4857  C  CA  . TRP A 1  637 ? 7.305   -1.370  122.153 1.00 21.30  ? 735  TRP A CA  1 
ATOM   4858  C  C   . TRP A 1  637 ? 7.071   -0.021  121.491 1.00 24.63  ? 735  TRP A C   1 
ATOM   4859  O  O   . TRP A 1  637 ? 7.879   0.897   121.630 1.00 25.23  ? 735  TRP A O   1 
ATOM   4860  C  CB  . TRP A 1  637 ? 7.725   -1.166  123.610 1.00 21.49  ? 735  TRP A CB  1 
ATOM   4861  C  CG  . TRP A 1  637 ? 6.700   -0.417  124.418 1.00 22.78  ? 735  TRP A CG  1 
ATOM   4862  C  CD1 . TRP A 1  637 ? 5.346   -0.429  124.237 1.00 24.40  ? 735  TRP A CD1 1 
ATOM   4863  C  CD2 . TRP A 1  637 ? 6.948   0.467   125.520 1.00 24.47  ? 735  TRP A CD2 1 
ATOM   4864  N  NE1 . TRP A 1  637 ? 4.736   0.384   125.162 1.00 19.60  ? 735  TRP A NE1 1 
ATOM   4865  C  CE2 . TRP A 1  637 ? 5.696   0.946   125.960 1.00 26.20  ? 735  TRP A CE2 1 
ATOM   4866  C  CE3 . TRP A 1  637 ? 8.104   0.897   126.177 1.00 18.39  ? 735  TRP A CE3 1 
ATOM   4867  C  CZ2 . TRP A 1  637 ? 5.571   1.833   127.029 1.00 24.45  ? 735  TRP A CZ2 1 
ATOM   4868  C  CZ3 . TRP A 1  637 ? 7.977   1.776   127.238 1.00 22.13  ? 735  TRP A CZ3 1 
ATOM   4869  C  CH2 . TRP A 1  637 ? 6.720   2.235   127.653 1.00 22.78  ? 735  TRP A CH2 1 
ATOM   4870  N  N   . HIS A 1  638 ? 5.956   0.093   120.779 1.00 26.17  ? 736  HIS A N   1 
ATOM   4871  C  CA  . HIS A 1  638 ? 5.574   1.351   120.160 1.00 24.57  ? 736  HIS A CA  1 
ATOM   4872  C  C   . HIS A 1  638 ? 4.974   2.251   121.228 1.00 26.02  ? 736  HIS A C   1 
ATOM   4873  O  O   . HIS A 1  638 ? 3.777   2.190   121.505 1.00 25.51  ? 736  HIS A O   1 
ATOM   4874  C  CB  . HIS A 1  638 ? 4.583   1.121   119.018 1.00 26.35  ? 736  HIS A CB  1 
ATOM   4875  C  CG  . HIS A 1  638 ? 5.164   0.376   117.857 1.00 28.30  ? 736  HIS A CG  1 
ATOM   4876  N  ND1 . HIS A 1  638 ? 5.295   0.935   116.604 1.00 29.10  ? 736  HIS A ND1 1 
ATOM   4877  C  CD2 . HIS A 1  638 ? 5.661   -0.880  117.762 1.00 24.88  ? 736  HIS A CD2 1 
ATOM   4878  C  CE1 . HIS A 1  638 ? 5.842   0.054   115.786 1.00 25.56  ? 736  HIS A CE1 1 
ATOM   4879  N  NE2 . HIS A 1  638 ? 6.075   -1.056  116.464 1.00 23.30  ? 736  HIS A NE2 1 
ATOM   4880  N  N   . ILE A 1  639 ? 5.826   3.072   121.836 1.00 28.01  ? 737  ILE A N   1 
ATOM   4881  C  CA  . ILE A 1  639 ? 5.437   3.899   122.970 1.00 28.62  ? 737  ILE A CA  1 
ATOM   4882  C  C   . ILE A 1  639 ? 4.335   4.877   122.589 1.00 31.33  ? 737  ILE A C   1 
ATOM   4883  O  O   . ILE A 1  639 ? 4.530   5.739   121.734 1.00 35.58  ? 737  ILE A O   1 
ATOM   4884  C  CB  . ILE A 1  639 ? 6.644   4.682   123.529 1.00 28.98  ? 737  ILE A CB  1 
ATOM   4885  C  CG1 . ILE A 1  639 ? 7.789   3.725   123.865 1.00 28.55  ? 737  ILE A CG1 1 
ATOM   4886  C  CG2 . ILE A 1  639 ? 6.245   5.484   124.755 1.00 24.48  ? 737  ILE A CG2 1 
ATOM   4887  C  CD1 . ILE A 1  639 ? 9.143   4.394   123.949 1.00 28.10  ? 737  ILE A CD1 1 
ATOM   4888  N  N   . PRO A 1  640 ? 3.163   4.739   123.224 1.00 29.93  ? 738  PRO A N   1 
ATOM   4889  C  CA  . PRO A 1  640 ? 2.032   5.625   122.934 1.00 32.72  ? 738  PRO A CA  1 
ATOM   4890  C  C   . PRO A 1  640 ? 2.259   7.027   123.486 1.00 36.74  ? 738  PRO A C   1 
ATOM   4891  O  O   . PRO A 1  640 ? 3.035   7.199   124.426 1.00 31.01  ? 738  PRO A O   1 
ATOM   4892  C  CB  . PRO A 1  640 ? 0.855   4.940   123.633 1.00 30.91  ? 738  PRO A CB  1 
ATOM   4893  C  CG  . PRO A 1  640 ? 1.472   4.139   124.721 1.00 30.05  ? 738  PRO A CG  1 
ATOM   4894  C  CD  . PRO A 1  640 ? 2.838   3.730   124.247 1.00 28.16  ? 738  PRO A CD  1 
ATOM   4895  N  N   . ASP A 1  641 ? 1.596   8.017   122.896 1.00 43.61  ? 739  ASP A N   1 
ATOM   4896  C  CA  . ASP A 1  641 ? 1.703   9.396   123.358 1.00 45.27  ? 739  ASP A CA  1 
ATOM   4897  C  C   . ASP A 1  641 ? 1.164   9.556   124.777 1.00 40.65  ? 739  ASP A C   1 
ATOM   4898  O  O   . ASP A 1  641 ? 1.589   10.444  125.516 1.00 38.00  ? 739  ASP A O   1 
ATOM   4899  C  CB  . ASP A 1  641 ? 0.961   10.333  122.403 1.00 49.73  ? 739  ASP A CB  1 
ATOM   4900  C  CG  . ASP A 1  641 ? 1.496   10.263  120.985 1.00 51.64  ? 739  ASP A CG  1 
ATOM   4901  O  OD1 . ASP A 1  641 ? 2.645   9.808   120.803 1.00 47.68  ? 739  ASP A OD1 1 
ATOM   4902  O  OD2 . ASP A 1  641 ? 0.766   10.661  120.053 1.00 57.67  ? 739  ASP A OD2 1 
ATOM   4903  N  N   . THR A 1  642 ? 0.222   8.694   125.147 1.00 39.73  ? 740  THR A N   1 
ATOM   4904  C  CA  . THR A 1  642 ? -0.403  8.742   126.465 1.00 37.93  ? 740  THR A CA  1 
ATOM   4905  C  C   . THR A 1  642 ? 0.454   8.078   127.539 1.00 33.62  ? 740  THR A C   1 
ATOM   4906  O  O   . THR A 1  642 ? 0.167   8.200   128.730 1.00 33.54  ? 740  THR A O   1 
ATOM   4907  C  CB  . THR A 1  642 ? -1.787  8.071   126.454 1.00 43.90  ? 740  THR A CB  1 
ATOM   4908  O  OG1 . THR A 1  642 ? -1.651  6.699   126.061 1.00 47.28  ? 740  THR A OG1 1 
ATOM   4909  C  CG2 . THR A 1  642 ? -2.718  8.784   125.485 1.00 46.45  ? 740  THR A CG2 1 
ATOM   4910  N  N   . ALA A 1  643 ? 1.496   7.369   127.112 1.00 32.35  ? 741  ALA A N   1 
ATOM   4911  C  CA  . ALA A 1  643 ? 2.366   6.648   128.037 1.00 33.27  ? 741  ALA A CA  1 
ATOM   4912  C  C   . ALA A 1  643 ? 3.028   7.601   129.020 1.00 37.47  ? 741  ALA A C   1 
ATOM   4913  O  O   . ALA A 1  643 ? 3.435   8.703   128.656 1.00 41.53  ? 741  ALA A O   1 
ATOM   4914  C  CB  . ALA A 1  643 ? 3.419   5.860   127.278 1.00 32.79  ? 741  ALA A CB  1 
ATOM   4915  N  N   . GLN A 1  644 ? 3.127   7.170   130.271 1.00 37.87  ? 742  GLN A N   1 
ATOM   4916  C  CA  . GLN A 1  644 ? 3.723   7.993   131.311 1.00 41.02  ? 742  GLN A CA  1 
ATOM   4917  C  C   . GLN A 1  644 ? 5.236   7.823   131.351 1.00 36.72  ? 742  GLN A C   1 
ATOM   4918  O  O   . GLN A 1  644 ? 5.740   6.709   131.211 1.00 36.02  ? 742  GLN A O   1 
ATOM   4919  C  CB  . GLN A 1  644 ? 3.126   7.629   132.669 1.00 48.80  ? 742  GLN A CB  1 
ATOM   4920  C  CG  . GLN A 1  644 ? 1.640   7.304   132.618 1.00 60.37  ? 742  GLN A CG  1 
ATOM   4921  C  CD  . GLN A 1  644 ? 1.265   6.155   133.536 1.00 67.89  ? 742  GLN A CD  1 
ATOM   4922  O  OE1 . GLN A 1  644 ? 2.100   5.312   133.870 1.00 68.79  ? 742  GLN A OE1 1 
ATOM   4923  N  NE2 . GLN A 1  644 ? 0.009   6.128   133.967 1.00 71.55  ? 742  GLN A NE2 1 
ATOM   4924  N  N   . PRO A 1  645 ? 5.967   8.932   131.535 1.00 33.83  ? 743  PRO A N   1 
ATOM   4925  C  CA  . PRO A 1  645 ? 7.424   8.876   131.686 1.00 33.67  ? 743  PRO A CA  1 
ATOM   4926  C  C   . PRO A 1  645 ? 7.821   8.011   132.878 1.00 35.48  ? 743  PRO A C   1 
ATOM   4927  O  O   . PRO A 1  645 ? 7.046   7.886   133.826 1.00 36.72  ? 743  PRO A O   1 
ATOM   4928  C  CB  . PRO A 1  645 ? 7.813   10.340  131.907 1.00 32.40  ? 743  PRO A CB  1 
ATOM   4929  C  CG  . PRO A 1  645 ? 6.718   11.117  131.265 1.00 33.02  ? 743  PRO A CG  1 
ATOM   4930  C  CD  . PRO A 1  645 ? 5.469   10.317  131.489 1.00 32.53  ? 743  PRO A CD  1 
ATOM   4931  N  N   . GLY A 1  646 ? 9.010   7.424   132.830 1.00 35.46  ? 744  GLY A N   1 
ATOM   4932  C  CA  . GLY A 1  646 ? 9.441   6.534   133.889 1.00 34.24  ? 744  GLY A CA  1 
ATOM   4933  C  C   . GLY A 1  646 ? 10.532  5.588   133.440 1.00 31.54  ? 744  GLY A C   1 
ATOM   4934  O  O   . GLY A 1  646 ? 11.010  5.665   132.311 1.00 31.44  ? 744  GLY A O   1 
ATOM   4935  N  N   . ILE A 1  647 ? 10.916  4.679   134.328 1.00 29.14  ? 745  ILE A N   1 
ATOM   4936  C  CA  . ILE A 1  647 ? 11.917  3.678   134.002 1.00 25.83  ? 745  ILE A CA  1 
ATOM   4937  C  C   . ILE A 1  647 ? 11.223  2.377   133.613 1.00 23.18  ? 745  ILE A C   1 
ATOM   4938  O  O   . ILE A 1  647 ? 10.361  1.876   134.336 1.00 19.34  ? 745  ILE A O   1 
ATOM   4939  C  CB  . ILE A 1  647 ? 12.882  3.438   135.181 1.00 26.97  ? 745  ILE A CB  1 
ATOM   4940  C  CG1 . ILE A 1  647 ? 13.728  4.688   135.433 1.00 28.38  ? 745  ILE A CG1 1 
ATOM   4941  C  CG2 . ILE A 1  647 ? 13.775  2.237   134.912 1.00 24.95  ? 745  ILE A CG2 1 
ATOM   4942  C  CD1 . ILE A 1  647 ? 14.530  4.640   136.714 1.00 28.53  ? 745  ILE A CD1 1 
ATOM   4943  N  N   . TYR A 1  648 ? 11.596  1.847   132.453 1.00 22.34  ? 746  TYR A N   1 
ATOM   4944  C  CA  . TYR A 1  648 ? 10.940  0.672   131.895 1.00 19.99  ? 746  TYR A CA  1 
ATOM   4945  C  C   . TYR A 1  648 ? 11.934  -0.430  131.555 1.00 21.09  ? 746  TYR A C   1 
ATOM   4946  O  O   . TYR A 1  648 ? 13.134  -0.187  131.431 1.00 23.65  ? 746  TYR A O   1 
ATOM   4947  C  CB  . TYR A 1  648 ? 10.152  1.049   130.639 1.00 18.90  ? 746  TYR A CB  1 
ATOM   4948  C  CG  . TYR A 1  648 ? 8.925   1.892   130.899 1.00 21.96  ? 746  TYR A CG  1 
ATOM   4949  C  CD1 . TYR A 1  648 ? 9.009   3.276   130.960 1.00 22.50  ? 746  TYR A CD1 1 
ATOM   4950  C  CD2 . TYR A 1  648 ? 7.678   1.303   131.064 1.00 18.80  ? 746  TYR A CD2 1 
ATOM   4951  C  CE1 . TYR A 1  648 ? 7.888   4.050   131.193 1.00 24.37  ? 746  TYR A CE1 1 
ATOM   4952  C  CE2 . TYR A 1  648 ? 6.552   2.067   131.294 1.00 19.49  ? 746  TYR A CE2 1 
ATOM   4953  C  CZ  . TYR A 1  648 ? 6.662   3.439   131.357 1.00 20.73  ? 746  TYR A CZ  1 
ATOM   4954  O  OH  . TYR A 1  648 ? 5.543   4.204   131.586 1.00 22.16  ? 746  TYR A OH  1 
ATOM   4955  N  N   . ARG A 1  649 ? 11.419  -1.643  131.400 1.00 16.98  ? 747  ARG A N   1 
ATOM   4956  C  CA  . ARG A 1  649 ? 12.219  -2.763  130.932 1.00 18.33  ? 747  ARG A CA  1 
ATOM   4957  C  C   . ARG A 1  649 ? 11.341  -3.713  130.132 1.00 20.12  ? 747  ARG A C   1 
ATOM   4958  O  O   . ARG A 1  649 ? 10.122  -3.749  130.310 1.00 19.02  ? 747  ARG A O   1 
ATOM   4959  C  CB  . ARG A 1  649 ? 12.869  -3.502  132.101 1.00 18.43  ? 747  ARG A CB  1 
ATOM   4960  C  CG  . ARG A 1  649 ? 11.889  -4.304  132.935 1.00 18.43  ? 747  ARG A CG  1 
ATOM   4961  C  CD  . ARG A 1  649 ? 12.583  -5.025  134.071 1.00 17.58  ? 747  ARG A CD  1 
ATOM   4962  N  NE  . ARG A 1  649 ? 11.662  -5.895  134.795 1.00 19.92  ? 747  ARG A NE  1 
ATOM   4963  C  CZ  . ARG A 1  649 ? 11.984  -6.586  135.884 1.00 20.47  ? 747  ARG A CZ  1 
ATOM   4964  N  NH1 . ARG A 1  649 ? 13.210  -6.513  136.379 1.00 20.47  ? 747  ARG A NH1 1 
ATOM   4965  N  NH2 . ARG A 1  649 ? 11.078  -7.351  136.478 1.00 22.20  ? 747  ARG A NH2 1 
ATOM   4966  N  N   . ILE A 1  650 ? 11.966  -4.485  129.254 1.00 20.18  ? 748  ILE A N   1 
ATOM   4967  C  CA  . ILE A 1  650 ? 11.236  -5.412  128.404 1.00 19.16  ? 748  ILE A CA  1 
ATOM   4968  C  C   . ILE A 1  650 ? 11.699  -6.836  128.668 1.00 18.34  ? 748  ILE A C   1 
ATOM   4969  O  O   . ILE A 1  650 ? 12.899  -7.108  128.698 1.00 16.35  ? 748  ILE A O   1 
ATOM   4970  C  CB  . ILE A 1  650 ? 11.422  -5.067  126.914 1.00 19.77  ? 748  ILE A CB  1 
ATOM   4971  C  CG1 . ILE A 1  650 ? 10.711  -3.753  126.581 1.00 18.87  ? 748  ILE A CG1 1 
ATOM   4972  C  CG2 . ILE A 1  650 ? 10.906  -6.190  126.036 1.00 16.31  ? 748  ILE A CG2 1 
ATOM   4973  C  CD1 . ILE A 1  650 ? 11.130  -3.149  125.262 1.00 20.72  ? 748  ILE A CD1 1 
ATOM   4974  N  N   . ARG A 1  651 ? 10.749  -7.745  128.867 1.00 16.42  ? 749  ARG A N   1 
ATOM   4975  C  CA  . ARG A 1  651 ? 11.101  -9.127  129.156 1.00 16.42  ? 749  ARG A CA  1 
ATOM   4976  C  C   . ARG A 1  651 ? 10.607  -10.069 128.068 1.00 19.27  ? 749  ARG A C   1 
ATOM   4977  O  O   . ARG A 1  651 ? 9.673   -9.758  127.331 1.00 22.12  ? 749  ARG A O   1 
ATOM   4978  C  CB  . ARG A 1  651 ? 10.553  -9.568  130.514 1.00 16.69  ? 749  ARG A CB  1 
ATOM   4979  C  CG  . ARG A 1  651 ? 11.062  -8.742  131.683 1.00 16.65  ? 749  ARG A CG  1 
ATOM   4980  C  CD  . ARG A 1  651 ? 10.733  -9.408  133.002 1.00 16.96  ? 749  ARG A CD  1 
ATOM   4981  N  NE  . ARG A 1  651 ? 11.554  -10.603 133.181 1.00 17.98  ? 749  ARG A NE  1 
ATOM   4982  C  CZ  . ARG A 1  651 ? 11.265  -11.606 134.002 1.00 17.31  ? 749  ARG A CZ  1 
ATOM   4983  N  NH1 . ARG A 1  651 ? 10.162  -11.576 134.736 1.00 17.65  ? 749  ARG A NH1 1 
ATOM   4984  N  NH2 . ARG A 1  651 ? 12.085  -12.644 134.085 1.00 17.40  ? 749  ARG A NH2 1 
ATOM   4985  N  N   . TYR A 1  652 ? 11.255  -11.223 127.974 1.00 20.46  ? 750  TYR A N   1 
ATOM   4986  C  CA  . TYR A 1  652 ? 10.957  -12.195 126.935 1.00 19.92  ? 750  TYR A CA  1 
ATOM   4987  C  C   . TYR A 1  652 ? 10.792  -13.578 127.547 1.00 20.38  ? 750  TYR A C   1 
ATOM   4988  O  O   . TYR A 1  652 ? 11.597  -14.005 128.374 1.00 20.87  ? 750  TYR A O   1 
ATOM   4989  C  CB  . TYR A 1  652 ? 12.065  -12.191 125.878 1.00 18.99  ? 750  TYR A CB  1 
ATOM   4990  C  CG  . TYR A 1  652 ? 12.059  -13.368 124.928 1.00 18.84  ? 750  TYR A CG  1 
ATOM   4991  C  CD1 . TYR A 1  652 ? 10.905  -13.745 124.251 1.00 19.93  ? 750  TYR A CD1 1 
ATOM   4992  C  CD2 . TYR A 1  652 ? 13.220  -14.095 124.695 1.00 20.36  ? 750  TYR A CD2 1 
ATOM   4993  C  CE1 . TYR A 1  652 ? 10.907  -14.822 123.378 1.00 20.37  ? 750  TYR A CE1 1 
ATOM   4994  C  CE2 . TYR A 1  652 ? 13.232  -15.169 123.825 1.00 23.32  ? 750  TYR A CE2 1 
ATOM   4995  C  CZ  . TYR A 1  652 ? 12.074  -15.530 123.171 1.00 20.93  ? 750  TYR A CZ  1 
ATOM   4996  O  OH  . TYR A 1  652 ? 12.092  -16.599 122.304 1.00 18.21  ? 750  TYR A OH  1 
ATOM   4997  N  N   . PHE A 1  653 ? 9.736   -14.270 127.137 1.00 23.43  ? 751  PHE A N   1 
ATOM   4998  C  CA  . PHE A 1  653 ? 9.423   -15.594 127.655 1.00 22.95  ? 751  PHE A CA  1 
ATOM   4999  C  C   . PHE A 1  653 ? 9.260   -16.570 126.499 1.00 24.52  ? 751  PHE A C   1 
ATOM   5000  O  O   . PHE A 1  653 ? 8.424   -16.366 125.620 1.00 30.51  ? 751  PHE A O   1 
ATOM   5001  C  CB  . PHE A 1  653 ? 8.148   -15.558 128.507 1.00 19.91  ? 751  PHE A CB  1 
ATOM   5002  C  CG  . PHE A 1  653 ? 8.154   -14.494 129.570 1.00 21.79  ? 751  PHE A CG  1 
ATOM   5003  C  CD1 . PHE A 1  653 ? 7.755   -13.197 129.279 1.00 24.11  ? 751  PHE A CD1 1 
ATOM   5004  C  CD2 . PHE A 1  653 ? 8.553   -14.791 130.863 1.00 19.88  ? 751  PHE A CD2 1 
ATOM   5005  C  CE1 . PHE A 1  653 ? 7.761   -12.216 130.256 1.00 17.66  ? 751  PHE A CE1 1 
ATOM   5006  C  CE2 . PHE A 1  653 ? 8.560   -13.816 131.844 1.00 17.96  ? 751  PHE A CE2 1 
ATOM   5007  C  CZ  . PHE A 1  653 ? 8.164   -12.527 131.540 1.00 17.75  ? 751  PHE A CZ  1 
ATOM   5008  N  N   . GLY A 1  654 ? 10.073  -17.621 126.493 1.00 21.18  ? 752  GLY A N   1 
ATOM   5009  C  CA  . GLY A 1  654 ? 10.041  -18.587 125.414 1.00 21.25  ? 752  GLY A CA  1 
ATOM   5010  C  C   . GLY A 1  654 ? 10.401  -19.984 125.871 1.00 27.07  ? 752  GLY A C   1 
ATOM   5011  O  O   . GLY A 1  654 ? 10.608  -20.226 127.059 1.00 34.82  ? 752  GLY A O   1 
ATOM   5012  N  N   . HIS A 1  655 ? 10.470  -20.907 124.919 1.00 25.54  ? 753  HIS A N   1 
ATOM   5013  C  CA  . HIS A 1  655 ? 10.821  -22.289 125.215 1.00 22.45  ? 753  HIS A CA  1 
ATOM   5014  C  C   . HIS A 1  655 ? 11.797  -22.836 124.182 1.00 23.44  ? 753  HIS A C   1 
ATOM   5015  O  O   . HIS A 1  655 ? 11.629  -22.618 122.983 1.00 20.28  ? 753  HIS A O   1 
ATOM   5016  C  CB  . HIS A 1  655 ? 9.569   -23.166 125.270 1.00 22.74  ? 753  HIS A CB  1 
ATOM   5017  C  CG  . HIS A 1  655 ? 8.687   -22.887 126.445 1.00 24.78  ? 753  HIS A CG  1 
ATOM   5018  N  ND1 . HIS A 1  655 ? 7.715   -21.910 126.434 1.00 26.08  ? 753  HIS A ND1 1 
ATOM   5019  C  CD2 . HIS A 1  655 ? 8.630   -23.459 127.671 1.00 24.51  ? 753  HIS A CD2 1 
ATOM   5020  C  CE1 . HIS A 1  655 ? 7.098   -21.891 127.601 1.00 26.25  ? 753  HIS A CE1 1 
ATOM   5021  N  NE2 . HIS A 1  655 ? 7.635   -22.821 128.371 1.00 25.60  ? 753  HIS A NE2 1 
ATOM   5022  N  N   . ASN A 1  656 ? 12.815  -23.549 124.653 1.00 24.47  ? 754  ASN A N   1 
ATOM   5023  C  CA  . ASN A 1  656 ? 13.796  -24.156 123.762 1.00 24.56  ? 754  ASN A CA  1 
ATOM   5024  C  C   . ASN A 1  656 ? 13.664  -25.674 123.718 1.00 26.53  ? 754  ASN A C   1 
ATOM   5025  O  O   . ASN A 1  656 ? 13.184  -26.293 124.668 1.00 27.66  ? 754  ASN A O   1 
ATOM   5026  C  CB  . ASN A 1  656 ? 15.213  -23.764 124.184 1.00 24.99  ? 754  ASN A CB  1 
ATOM   5027  C  CG  . ASN A 1  656 ? 15.589  -24.313 125.547 1.00 28.75  ? 754  ASN A CG  1 
ATOM   5028  O  OD1 . ASN A 1  656 ? 15.020  -23.921 126.565 1.00 30.66  ? 754  ASN A OD1 1 
ATOM   5029  N  ND2 . ASN A 1  656 ? 16.555  -25.224 125.572 1.00 30.06  ? 754  ASN A ND2 1 
ATOM   5030  N  N   . ARG A 1  657 ? 14.089  -26.269 122.608 1.00 29.45  ? 755  ARG A N   1 
ATOM   5031  C  CA  . ARG A 1  657 ? 13.978  -27.710 122.416 1.00 36.65  ? 755  ARG A CA  1 
ATOM   5032  C  C   . ARG A 1  657 ? 15.346  -28.387 122.467 1.00 42.05  ? 755  ARG A C   1 
ATOM   5033  O  O   . ARG A 1  657 ? 16.260  -28.010 121.735 1.00 42.39  ? 755  ARG A O   1 
ATOM   5034  C  CB  . ARG A 1  657 ? 13.300  -28.003 121.076 1.00 41.42  ? 755  ARG A CB  1 
ATOM   5035  C  CG  . ARG A 1  657 ? 12.988  -29.467 120.818 1.00 44.03  ? 755  ARG A CG  1 
ATOM   5036  C  CD  . ARG A 1  657 ? 12.328  -29.642 119.458 1.00 45.80  ? 755  ARG A CD  1 
ATOM   5037  N  NE  . ARG A 1  657 ? 12.178  -31.047 119.090 1.00 51.62  ? 755  ARG A NE  1 
ATOM   5038  C  CZ  . ARG A 1  657 ? 11.046  -31.733 119.197 1.00 55.36  ? 755  ARG A CZ  1 
ATOM   5039  N  NH1 . ARG A 1  657 ? 9.951   -31.146 119.658 1.00 56.57  ? 755  ARG A NH1 1 
ATOM   5040  N  NH2 . ARG A 1  657 ? 11.009  -33.008 118.837 1.00 56.66  ? 755  ARG A NH2 1 
ATOM   5041  N  N   . LYS A 1  658 ? 15.479  -29.389 123.332 1.00 46.03  ? 756  LYS A N   1 
ATOM   5042  C  CA  . LYS A 1  658 ? 16.720  -30.153 123.450 1.00 46.58  ? 756  LYS A CA  1 
ATOM   5043  C  C   . LYS A 1  658 ? 16.495  -31.640 123.200 1.00 50.59  ? 756  LYS A C   1 
ATOM   5044  O  O   . LYS A 1  658 ? 15.387  -32.147 123.378 1.00 50.92  ? 756  LYS A O   1 
ATOM   5045  C  CB  . LYS A 1  658 ? 17.358  -29.939 124.825 1.00 47.34  ? 756  LYS A CB  1 
ATOM   5046  C  CG  . LYS A 1  658 ? 17.960  -28.556 125.007 1.00 55.90  ? 756  LYS A CG  1 
ATOM   5047  C  CD  . LYS A 1  658 ? 18.668  -28.419 126.344 1.00 63.41  ? 756  LYS A CD  1 
ATOM   5048  C  CE  . LYS A 1  658 ? 19.373  -27.074 126.451 1.00 65.67  ? 756  LYS A CE  1 
ATOM   5049  N  NZ  . LYS A 1  658 ? 20.078  -26.902 127.754 1.00 66.75  ? 756  LYS A NZ  1 
ATOM   5050  N  N   . GLN A 1  659 ? 17.555  -32.334 122.793 1.00 54.58  ? 757  GLN A N   1 
ATOM   5051  C  CA  . GLN A 1  659 ? 17.500  -33.779 122.586 1.00 56.38  ? 757  GLN A CA  1 
ATOM   5052  C  C   . GLN A 1  659 ? 18.899  -34.385 122.553 1.00 58.33  ? 757  GLN A C   1 
ATOM   5053  O  O   . GLN A 1  659 ? 19.133  -35.461 123.106 1.00 60.89  ? 757  GLN A O   1 
ATOM   5054  C  CB  . GLN A 1  659 ? 16.759  -34.113 121.291 1.00 55.99  ? 757  GLN A CB  1 
ATOM   5055  C  CG  . GLN A 1  659 ? 16.602  -35.604 121.040 1.00 61.09  ? 757  GLN A CG  1 
ATOM   5056  C  CD  . GLN A 1  659 ? 15.463  -35.918 120.090 1.00 63.97  ? 757  GLN A CD  1 
ATOM   5057  O  OE1 . GLN A 1  659 ? 15.011  -35.053 119.339 1.00 64.82  ? 757  GLN A OE1 1 
ATOM   5058  N  NE2 . GLN A 1  659 ? 14.992  -37.160 120.119 1.00 63.12  ? 757  GLN A NE2 1 
ATOM   5059  N  N   . PRO A 1  664 ? 13.694  -38.130 125.840 1.00 72.08  ? 762  PRO A N   1 
ATOM   5060  C  CA  . PRO A 1  664 ? 14.336  -37.887 124.543 1.00 73.00  ? 762  PRO A CA  1 
ATOM   5061  C  C   . PRO A 1  664 ? 14.127  -36.453 124.054 1.00 72.40  ? 762  PRO A C   1 
ATOM   5062  O  O   . PRO A 1  664 ? 15.071  -35.664 124.060 1.00 73.42  ? 762  PRO A O   1 
ATOM   5063  C  CB  . PRO A 1  664 ? 13.649  -38.895 123.613 1.00 71.46  ? 762  PRO A CB  1 
ATOM   5064  C  CG  . PRO A 1  664 ? 12.363  -39.238 124.291 1.00 70.85  ? 762  PRO A CG  1 
ATOM   5065  C  CD  . PRO A 1  664 ? 12.645  -39.160 125.758 1.00 71.30  ? 762  PRO A CD  1 
ATOM   5066  N  N   . ALA A 1  665 ? 12.908  -36.129 123.636 1.00 69.17  ? 763  ALA A N   1 
ATOM   5067  C  CA  . ALA A 1  665 ? 12.573  -34.773 123.218 1.00 64.89  ? 763  ALA A CA  1 
ATOM   5068  C  C   . ALA A 1  665 ? 12.012  -33.985 124.397 1.00 60.02  ? 763  ALA A C   1 
ATOM   5069  O  O   . ALA A 1  665 ? 10.969  -34.335 124.948 1.00 58.48  ? 763  ALA A O   1 
ATOM   5070  C  CB  . ALA A 1  665 ? 11.580  -34.799 122.067 1.00 65.36  ? 763  ALA A CB  1 
ATOM   5071  N  N   . VAL A 1  666 ? 12.706  -32.919 124.782 1.00 56.99  ? 764  VAL A N   1 
ATOM   5072  C  CA  . VAL A 1  666 ? 12.345  -32.169 125.981 1.00 52.43  ? 764  VAL A CA  1 
ATOM   5073  C  C   . VAL A 1  666 ? 12.185  -30.676 125.693 1.00 47.04  ? 764  VAL A C   1 
ATOM   5074  O  O   . VAL A 1  666 ? 13.007  -30.074 125.002 1.00 47.78  ? 764  VAL A O   1 
ATOM   5075  C  CB  . VAL A 1  666 ? 13.402  -32.367 127.091 1.00 53.40  ? 764  VAL A CB  1 
ATOM   5076  C  CG1 . VAL A 1  666 ? 13.171  -31.404 128.240 1.00 53.48  ? 764  VAL A CG1 1 
ATOM   5077  C  CG2 . VAL A 1  666 ? 13.380  -33.803 127.591 1.00 55.61  ? 764  VAL A CG2 1 
ATOM   5078  N  N   . ILE A 1  667 ? 11.122  -30.084 126.231 1.00 42.77  ? 765  ILE A N   1 
ATOM   5079  C  CA  . ILE A 1  667 ? 10.885  -28.653 126.091 1.00 35.46  ? 765  ILE A CA  1 
ATOM   5080  C  C   . ILE A 1  667 ? 11.136  -27.950 127.421 1.00 33.45  ? 765  ILE A C   1 
ATOM   5081  O  O   . ILE A 1  667 ? 10.538  -28.302 128.438 1.00 36.37  ? 765  ILE A O   1 
ATOM   5082  C  CB  . ILE A 1  667 ? 9.442   -28.356 125.630 1.00 33.81  ? 765  ILE A CB  1 
ATOM   5083  C  CG1 . ILE A 1  667 ? 9.118   -29.109 124.337 1.00 24.79  ? 765  ILE A CG1 1 
ATOM   5084  C  CG2 . ILE A 1  667 ? 9.232   -26.858 125.458 1.00 29.06  ? 765  ILE A CG2 1 
ATOM   5085  C  CD1 . ILE A 1  667 ? 9.929   -28.656 123.145 1.00 37.62  ? 765  ILE A CD1 1 
ATOM   5086  N  N   . LEU A 1  668 ? 12.023  -26.960 127.414 1.00 31.81  ? 766  LEU A N   1 
ATOM   5087  C  CA  . LEU A 1  668 ? 12.356  -26.238 128.637 1.00 31.19  ? 766  LEU A CA  1 
ATOM   5088  C  C   . LEU A 1  668 ? 11.986  -24.766 128.533 1.00 30.85  ? 766  LEU A C   1 
ATOM   5089  O  O   . LEU A 1  668 ? 11.994  -24.192 127.447 1.00 32.08  ? 766  LEU A O   1 
ATOM   5090  C  CB  . LEU A 1  668 ? 13.847  -26.377 128.954 1.00 31.14  ? 766  LEU A CB  1 
ATOM   5091  C  CG  . LEU A 1  668 ? 14.390  -27.804 129.028 1.00 28.39  ? 766  LEU A CG  1 
ATOM   5092  C  CD1 . LEU A 1  668 ? 15.910  -27.803 128.982 1.00 26.96  ? 766  LEU A CD1 1 
ATOM   5093  C  CD2 . LEU A 1  668 ? 13.886  -28.491 130.288 1.00 26.03  ? 766  LEU A CD2 1 
ATOM   5094  N  N   . SER A 1  669 ? 11.678  -24.155 129.672 1.00 29.72  ? 767  SER A N   1 
ATOM   5095  C  CA  . SER A 1  669 ? 11.344  -22.738 129.707 1.00 26.87  ? 767  SER A CA  1 
ATOM   5096  C  C   . SER A 1  669 ? 12.567  -21.883 130.004 1.00 28.33  ? 767  SER A C   1 
ATOM   5097  O  O   . SER A 1  669 ? 13.516  -22.335 130.643 1.00 30.05  ? 767  SER A O   1 
ATOM   5098  C  CB  . SER A 1  669 ? 10.258  -22.470 130.749 1.00 26.11  ? 767  SER A CB  1 
ATOM   5099  O  OG  . SER A 1  669 ? 10.729  -22.756 132.054 1.00 29.84  ? 767  SER A OG  1 
ATOM   5100  N  N   . PHE A 1  670 ? 12.532  -20.639 129.541 1.00 27.97  ? 768  PHE A N   1 
ATOM   5101  C  CA  . PHE A 1  670 ? 13.577  -19.677 129.857 1.00 25.00  ? 768  PHE A CA  1 
ATOM   5102  C  C   . PHE A 1  670 ? 13.005  -18.269 129.822 1.00 25.33  ? 768  PHE A C   1 
ATOM   5103  O  O   . PHE A 1  670 ? 11.921  -18.042 129.286 1.00 25.11  ? 768  PHE A O   1 
ATOM   5104  C  CB  . PHE A 1  670 ? 14.760  -19.806 128.889 1.00 20.99  ? 768  PHE A CB  1 
ATOM   5105  C  CG  . PHE A 1  670 ? 14.429  -19.459 127.463 1.00 18.60  ? 768  PHE A CG  1 
ATOM   5106  C  CD1 . PHE A 1  670 ? 14.523  -18.150 127.010 1.00 24.23  ? 768  PHE A CD1 1 
ATOM   5107  C  CD2 . PHE A 1  670 ? 14.038  -20.442 126.571 1.00 19.03  ? 768  PHE A CD2 1 
ATOM   5108  C  CE1 . PHE A 1  670 ? 14.224  -17.829 125.697 1.00 17.83  ? 768  PHE A CE1 1 
ATOM   5109  C  CE2 . PHE A 1  670 ? 13.739  -20.127 125.256 1.00 25.36  ? 768  PHE A CE2 1 
ATOM   5110  C  CZ  . PHE A 1  670 ? 13.832  -18.817 124.820 1.00 18.24  ? 768  PHE A CZ  1 
ATOM   5111  N  N   . GLU A 1  671 ? 13.747  -17.323 130.383 1.00 27.84  ? 769  GLU A N   1 
ATOM   5112  C  CA  . GLU A 1  671 ? 13.312  -15.936 130.407 1.00 28.26  ? 769  GLU A CA  1 
ATOM   5113  C  C   . GLU A 1  671 ? 14.458  -15.006 130.039 1.00 26.54  ? 769  GLU A C   1 
ATOM   5114  O  O   . GLU A 1  671 ? 15.631  -15.346 130.203 1.00 28.26  ? 769  GLU A O   1 
ATOM   5115  C  CB  . GLU A 1  671 ? 12.768  -15.561 131.788 1.00 31.66  ? 769  GLU A CB  1 
ATOM   5116  C  CG  . GLU A 1  671 ? 11.529  -16.329 132.219 1.00 41.16  ? 769  GLU A CG  1 
ATOM   5117  C  CD  . GLU A 1  671 ? 11.080  -15.964 133.622 1.00 50.74  ? 769  GLU A CD  1 
ATOM   5118  O  OE1 . GLU A 1  671 ? 11.810  -15.216 134.307 1.00 57.37  ? 769  GLU A OE1 1 
ATOM   5119  O  OE2 . GLU A 1  671 ? 9.996   -16.423 134.041 1.00 49.84  ? 769  GLU A OE2 1 
ATOM   5120  N  N   . GLY A 1  672 ? 14.108  -13.829 129.540 1.00 23.92  ? 770  GLY A N   1 
ATOM   5121  C  CA  . GLY A 1  672 ? 15.091  -12.805 129.252 1.00 24.73  ? 770  GLY A CA  1 
ATOM   5122  C  C   . GLY A 1  672 ? 14.607  -11.474 129.780 1.00 24.37  ? 770  GLY A C   1 
ATOM   5123  O  O   . GLY A 1  672 ? 13.414  -11.186 129.747 1.00 25.00  ? 770  GLY A O   1 
ATOM   5124  N  N   . THR A 1  673 ? 15.532  -10.663 130.277 1.00 23.58  ? 771  THR A N   1 
ATOM   5125  C  CA  . THR A 1  673 ? 15.183  -9.353  130.802 1.00 22.85  ? 771  THR A CA  1 
ATOM   5126  C  C   . THR A 1  673 ? 16.156  -8.308  130.281 1.00 21.45  ? 771  THR A C   1 
ATOM   5127  O  O   . THR A 1  673 ? 17.364  -8.414  130.487 1.00 22.25  ? 771  THR A O   1 
ATOM   5128  C  CB  . THR A 1  673 ? 15.187  -9.337  132.340 1.00 26.11  ? 771  THR A CB  1 
ATOM   5129  O  OG1 . THR A 1  673 ? 14.274  -10.325 132.832 1.00 30.60  ? 771  THR A OG1 1 
ATOM   5130  C  CG2 . THR A 1  673 ? 14.778  -7.966  132.858 1.00 24.90  ? 771  THR A CG2 1 
ATOM   5131  N  N   . SER A 1  674 ? 15.624  -7.297  129.604 1.00 22.54  ? 772  SER A N   1 
ATOM   5132  C  CA  . SER A 1  674 ? 16.457  -6.243  129.046 1.00 24.48  ? 772  SER A CA  1 
ATOM   5133  C  C   . SER A 1  674 ? 16.905  -5.297  130.148 1.00 25.46  ? 772  SER A C   1 
ATOM   5134  O  O   . SER A 1  674 ? 16.217  -5.157  131.159 1.00 27.92  ? 772  SER A O   1 
ATOM   5135  C  CB  . SER A 1  674 ? 15.702  -5.466  127.967 1.00 22.96  ? 772  SER A CB  1 
ATOM   5136  O  OG  . SER A 1  674 ? 14.816  -4.523  128.547 1.00 21.61  ? 772  SER A OG  1 
ATOM   5137  N  N   . PRO A 1  675 ? 18.076  -4.667  129.970 1.00 21.81  ? 773  PRO A N   1 
ATOM   5138  C  CA  . PRO A 1  675 ? 18.501  -3.597  130.877 1.00 20.76  ? 773  PRO A CA  1 
ATOM   5139  C  C   . PRO A 1  675 ? 17.422  -2.529  130.998 1.00 20.07  ? 773  PRO A C   1 
ATOM   5140  O  O   . PRO A 1  675 ? 16.697  -2.293  130.032 1.00 22.29  ? 773  PRO A O   1 
ATOM   5141  C  CB  . PRO A 1  675 ? 19.751  -3.033  130.199 1.00 15.65  ? 773  PRO A CB  1 
ATOM   5142  C  CG  . PRO A 1  675 ? 20.281  -4.152  129.386 1.00 15.50  ? 773  PRO A CG  1 
ATOM   5143  C  CD  . PRO A 1  675 ? 19.110  -5.000  128.973 1.00 23.69  ? 773  PRO A CD  1 
ATOM   5144  N  N   . ALA A 1  676 ? 17.312  -1.896  132.159 1.00 20.44  ? 774  ALA A N   1 
ATOM   5145  C  CA  . ALA A 1  676 ? 16.311  -0.858  132.350 1.00 16.39  ? 774  ALA A CA  1 
ATOM   5146  C  C   . ALA A 1  676 ? 16.604  0.334   131.450 1.00 23.31  ? 774  ALA A C   1 
ATOM   5147  O  O   . ALA A 1  676 ? 17.761  0.691   131.231 1.00 27.88  ? 774  ALA A O   1 
ATOM   5148  C  CB  . ALA A 1  676 ? 16.261  -0.426  133.806 1.00 16.68  ? 774  ALA A CB  1 
ATOM   5149  N  N   . PHE A 1  677 ? 15.546  0.942   130.930 1.00 17.39  ? 775  PHE A N   1 
ATOM   5150  C  CA  . PHE A 1  677 ? 15.669  2.137   130.110 1.00 16.97  ? 775  PHE A CA  1 
ATOM   5151  C  C   . PHE A 1  677 ? 14.556  3.101   130.482 1.00 23.78  ? 775  PHE A C   1 
ATOM   5152  O  O   . PHE A 1  677 ? 13.687  2.772   131.289 1.00 23.65  ? 775  PHE A O   1 
ATOM   5153  C  CB  . PHE A 1  677 ? 15.628  1.798   128.618 1.00 17.81  ? 775  PHE A CB  1 
ATOM   5154  C  CG  . PHE A 1  677 ? 14.362  1.114   128.178 1.00 22.03  ? 775  PHE A CG  1 
ATOM   5155  C  CD1 . PHE A 1  677 ? 14.228  -0.261  128.282 1.00 21.20  ? 775  PHE A CD1 1 
ATOM   5156  C  CD2 . PHE A 1  677 ? 13.309  1.846   127.655 1.00 25.76  ? 775  PHE A CD2 1 
ATOM   5157  C  CE1 . PHE A 1  677 ? 13.068  -0.892  127.874 1.00 19.85  ? 775  PHE A CE1 1 
ATOM   5158  C  CE2 . PHE A 1  677 ? 12.145  1.220   127.247 1.00 26.36  ? 775  PHE A CE2 1 
ATOM   5159  C  CZ  . PHE A 1  677 ? 12.026  -0.150  127.358 1.00 23.39  ? 775  PHE A CZ  1 
ATOM   5160  N  N   . GLU A 1  678 ? 14.579  4.293   129.899 1.00 25.94  ? 776  GLU A N   1 
ATOM   5161  C  CA  . GLU A 1  678 ? 13.687  5.344   130.360 1.00 28.08  ? 776  GLU A CA  1 
ATOM   5162  C  C   . GLU A 1  678 ? 12.898  6.035   129.255 1.00 26.07  ? 776  GLU A C   1 
ATOM   5163  O  O   . GLU A 1  678 ? 13.381  6.218   128.136 1.00 25.84  ? 776  GLU A O   1 
ATOM   5164  C  CB  . GLU A 1  678 ? 14.488  6.388   131.145 1.00 29.15  ? 776  GLU A CB  1 
ATOM   5165  C  CG  . GLU A 1  678 ? 13.631  7.412   131.871 1.00 30.11  ? 776  GLU A CG  1 
ATOM   5166  C  CD  . GLU A 1  678 ? 14.435  8.298   132.793 1.00 34.75  ? 776  GLU A CD  1 
ATOM   5167  O  OE1 . GLU A 1  678 ? 15.679  8.280   132.697 1.00 37.84  ? 776  GLU A OE1 1 
ATOM   5168  O  OE2 . GLU A 1  678 ? 13.821  9.007   133.617 1.00 37.73  ? 776  GLU A OE2 1 
ATOM   5169  N  N   . VAL A 1  679 ? 11.675  6.420   129.600 1.00 24.11  ? 777  VAL A N   1 
ATOM   5170  C  CA  . VAL A 1  679 ? 10.837  7.235   128.740 1.00 26.92  ? 777  VAL A CA  1 
ATOM   5171  C  C   . VAL A 1  679 ? 10.892  8.611   129.381 1.00 26.70  ? 777  VAL A C   1 
ATOM   5172  O  O   . VAL A 1  679 ? 10.714  8.744   130.593 1.00 22.49  ? 777  VAL A O   1 
ATOM   5173  C  CB  . VAL A 1  679 ? 9.389   6.716   128.647 1.00 27.66  ? 777  VAL A CB  1 
ATOM   5174  C  CG1 . VAL A 1  679 ? 8.522   7.697   127.874 1.00 28.88  ? 777  VAL A CG1 1 
ATOM   5175  C  CG2 . VAL A 1  679 ? 9.359   5.342   127.997 1.00 22.98  ? 777  VAL A CG2 1 
ATOM   5176  N  N   . VAL A 1  680 ? 11.132  9.636   128.573 1.00 27.34  ? 778  VAL A N   1 
ATOM   5177  C  CA  . VAL A 1  680 ? 11.376  10.963  129.115 1.00 26.05  ? 778  VAL A CA  1 
ATOM   5178  C  C   . VAL A 1  680 ? 10.327  11.996  128.732 1.00 31.43  ? 778  VAL A C   1 
ATOM   5179  O  O   . VAL A 1  680 ? 9.594   11.837  127.755 1.00 36.70  ? 778  VAL A O   1 
ATOM   5180  C  CB  . VAL A 1  680 ? 12.753  11.484  128.664 1.00 26.82  ? 778  VAL A CB  1 
ATOM   5181  C  CG1 . VAL A 1  680 ? 13.830  10.476  129.020 1.00 21.07  ? 778  VAL A CG1 1 
ATOM   5182  C  CG2 . VAL A 1  680 ? 12.759  11.738  127.167 1.00 26.19  ? 778  VAL A CG2 1 
ATOM   5183  N  N   . THR A 1  681 ? 10.267  13.054  129.533 1.00 33.10  ? 779  THR A N   1 
ATOM   5184  C  CA  . THR A 1  681 ? 9.389   14.183  129.276 1.00 34.71  ? 779  THR A CA  1 
ATOM   5185  C  C   . THR A 1  681 ? 10.122  15.223  128.442 1.00 37.16  ? 779  THR A C   1 
ATOM   5186  O  O   . THR A 1  681 ? 11.265  15.571  128.738 1.00 33.53  ? 779  THR A O   1 
ATOM   5187  C  CB  . THR A 1  681 ? 8.908   14.833  130.588 1.00 36.44  ? 779  THR A CB  1 
ATOM   5188  O  OG1 . THR A 1  681 ? 8.448   13.820  131.491 1.00 37.64  ? 779  THR A OG1 1 
ATOM   5189  C  CG2 . THR A 1  681 ? 7.791   15.830  130.317 1.00 35.71  ? 779  THR A CG2 1 
ATOM   5190  N  N   . ILE A 1  682 ? 9.467   15.708  127.391 1.00 45.75  ? 780  ILE A N   1 
ATOM   5191  C  CA  . ILE A 1  682 ? 10.044  16.746  126.543 1.00 50.28  ? 780  ILE A CA  1 
ATOM   5192  C  C   . ILE A 1  682 ? 9.013   17.822  126.222 1.00 53.39  ? 780  ILE A C   1 
ATOM   5193  O  O   . ILE A 1  682 ? 7.839   17.692  126.570 1.00 54.69  ? 780  ILE A O   1 
ATOM   5194  C  CB  . ILE A 1  682 ? 10.597  16.168  125.227 1.00 49.00  ? 780  ILE A CB  1 
ATOM   5195  C  CG1 . ILE A 1  682 ? 11.724  15.173  125.510 1.00 50.41  ? 780  ILE A CG1 1 
ATOM   5196  C  CG2 . ILE A 1  682 ? 11.095  17.285  124.325 1.00 47.58  ? 780  ILE A CG2 1 
ATOM   5197  C  CD1 . ILE A 1  682 ? 12.309  14.537  124.272 1.00 51.65  ? 780  ILE A CD1 1 
ATOM   5198  N  N   . PHE B 1  1   ? -34.895 -1.759  142.526 1.00 66.61  ? 99   PHE B N   1 
ATOM   5199  C  CA  . PHE B 1  1   ? -34.501 -0.673  143.415 1.00 68.54  ? 99   PHE B CA  1 
ATOM   5200  C  C   . PHE B 1  1   ? -34.798 0.684   142.785 1.00 71.49  ? 99   PHE B C   1 
ATOM   5201  O  O   . PHE B 1  1   ? -34.314 0.993   141.696 1.00 74.56  ? 99   PHE B O   1 
ATOM   5202  C  CB  . PHE B 1  1   ? -33.017 -0.783  143.768 1.00 68.64  ? 99   PHE B CB  1 
ATOM   5203  C  CG  . PHE B 1  1   ? -32.534 0.292   144.699 1.00 66.97  ? 99   PHE B CG  1 
ATOM   5204  C  CD1 . PHE B 1  1   ? -33.074 0.421   145.968 1.00 68.80  ? 99   PHE B CD1 1 
ATOM   5205  C  CD2 . PHE B 1  1   ? -31.531 1.165   144.311 1.00 63.33  ? 99   PHE B CD2 1 
ATOM   5206  C  CE1 . PHE B 1  1   ? -32.631 1.407   146.828 1.00 67.28  ? 99   PHE B CE1 1 
ATOM   5207  C  CE2 . PHE B 1  1   ? -31.080 2.150   145.168 1.00 62.29  ? 99   PHE B CE2 1 
ATOM   5208  C  CZ  . PHE B 1  1   ? -31.631 2.272   146.428 1.00 63.99  ? 99   PHE B CZ  1 
ATOM   5209  N  N   . SER B 1  2   ? -35.596 1.492   143.478 1.00 70.00  ? 100  SER B N   1 
ATOM   5210  C  CA  . SER B 1  2   ? -36.019 2.786   142.952 1.00 66.76  ? 100  SER B CA  1 
ATOM   5211  C  C   . SER B 1  2   ? -35.348 3.951   143.674 1.00 58.33  ? 100  SER B C   1 
ATOM   5212  O  O   . SER B 1  2   ? -35.902 5.047   143.754 1.00 59.38  ? 100  SER B O   1 
ATOM   5213  C  CB  . SER B 1  2   ? -37.540 2.921   143.043 1.00 72.34  ? 100  SER B CB  1 
ATOM   5214  O  OG  . SER B 1  2   ? -37.992 2.732   144.372 1.00 74.28  ? 100  SER B OG  1 
ATOM   5215  N  N   . GLY B 1  3   ? -34.149 3.708   144.190 1.00 53.03  ? 101  GLY B N   1 
ATOM   5216  C  CA  . GLY B 1  3   ? -33.363 4.739   144.844 1.00 45.95  ? 101  GLY B CA  1 
ATOM   5217  C  C   . GLY B 1  3   ? -32.285 5.243   143.903 1.00 38.37  ? 101  GLY B C   1 
ATOM   5218  O  O   . GLY B 1  3   ? -32.272 4.882   142.727 1.00 38.34  ? 101  GLY B O   1 
ATOM   5219  N  N   . TYR B 1  4   ? -31.380 6.076   144.405 1.00 30.53  ? 102  TYR B N   1 
ATOM   5220  C  CA  . TYR B 1  4   ? -30.369 6.678   143.542 1.00 24.29  ? 102  TYR B CA  1 
ATOM   5221  C  C   . TYR B 1  4   ? -29.228 5.717   143.223 1.00 24.84  ? 102  TYR B C   1 
ATOM   5222  O  O   . TYR B 1  4   ? -28.959 4.776   143.970 1.00 28.07  ? 102  TYR B O   1 
ATOM   5223  C  CB  . TYR B 1  4   ? -29.768 7.930   144.185 1.00 23.05  ? 102  TYR B CB  1 
ATOM   5224  C  CG  . TYR B 1  4   ? -30.754 8.964   144.675 1.00 25.28  ? 102  TYR B CG  1 
ATOM   5225  C  CD1 . TYR B 1  4   ? -31.498 9.723   143.782 1.00 25.65  ? 102  TYR B CD1 1 
ATOM   5226  C  CD2 . TYR B 1  4   ? -30.902 9.217   146.032 1.00 24.22  ? 102  TYR B CD2 1 
ATOM   5227  C  CE1 . TYR B 1  4   ? -32.387 10.682  144.229 1.00 24.72  ? 102  TYR B CE1 1 
ATOM   5228  C  CE2 . TYR B 1  4   ? -31.784 10.175  146.489 1.00 23.22  ? 102  TYR B CE2 1 
ATOM   5229  C  CZ  . TYR B 1  4   ? -32.524 10.904  145.584 1.00 24.94  ? 102  TYR B CZ  1 
ATOM   5230  O  OH  . TYR B 1  4   ? -33.405 11.858  146.037 1.00 28.05  ? 102  TYR B OH  1 
ATOM   5231  N  N   . HIS B 1  5   ? -28.572 5.958   142.094 1.00 25.18  ? 103  HIS B N   1 
ATOM   5232  C  CA  . HIS B 1  5   ? -27.253 5.400   141.828 1.00 23.47  ? 103  HIS B CA  1 
ATOM   5233  C  C   . HIS B 1  5   ? -26.210 6.434   142.240 1.00 24.70  ? 103  HIS B C   1 
ATOM   5234  O  O   . HIS B 1  5   ? -26.311 7.599   141.858 1.00 22.25  ? 103  HIS B O   1 
ATOM   5235  C  CB  . HIS B 1  5   ? -27.097 5.028   140.354 1.00 28.86  ? 103  HIS B CB  1 
ATOM   5236  C  CG  . HIS B 1  5   ? -27.818 3.775   139.969 1.00 35.51  ? 103  HIS B CG  1 
ATOM   5237  N  ND1 . HIS B 1  5   ? -27.587 2.565   140.587 1.00 38.43  ? 103  HIS B ND1 1 
ATOM   5238  C  CD2 . HIS B 1  5   ? -28.769 3.544   139.033 1.00 38.18  ? 103  HIS B CD2 1 
ATOM   5239  C  CE1 . HIS B 1  5   ? -28.362 1.642   140.047 1.00 40.08  ? 103  HIS B CE1 1 
ATOM   5240  N  NE2 . HIS B 1  5   ? -29.089 2.210   139.102 1.00 40.57  ? 103  HIS B NE2 1 
ATOM   5241  N  N   . ILE B 1  6   ? -25.219 6.018   143.023 1.00 24.62  ? 104  ILE B N   1 
ATOM   5242  C  CA  . ILE B 1  6   ? -24.244 6.960   143.563 1.00 20.68  ? 104  ILE B CA  1 
ATOM   5243  C  C   . ILE B 1  6   ? -22.811 6.581   143.203 1.00 22.47  ? 104  ILE B C   1 
ATOM   5244  O  O   . ILE B 1  6   ? -22.400 5.433   143.366 1.00 25.04  ? 104  ILE B O   1 
ATOM   5245  C  CB  . ILE B 1  6   ? -24.351 7.064   145.098 1.00 22.22  ? 104  ILE B CB  1 
ATOM   5246  C  CG1 . ILE B 1  6   ? -25.789 7.371   145.518 1.00 20.40  ? 104  ILE B CG1 1 
ATOM   5247  C  CG2 . ILE B 1  6   ? -23.398 8.126   145.630 1.00 20.45  ? 104  ILE B CG2 1 
ATOM   5248  C  CD1 . ILE B 1  6   ? -25.994 7.376   147.016 1.00 20.10  ? 104  ILE B CD1 1 
ATOM   5249  N  N   . GLY B 1  7   ? -22.055 7.556   142.707 1.00 21.05  ? 105  GLY B N   1 
ATOM   5250  C  CA  . GLY B 1  7   ? -20.642 7.366   142.433 1.00 22.82  ? 105  GLY B CA  1 
ATOM   5251  C  C   . GLY B 1  7   ? -19.798 8.443   143.086 1.00 22.61  ? 105  GLY B C   1 
ATOM   5252  O  O   . GLY B 1  7   ? -20.219 9.596   143.184 1.00 20.89  ? 105  GLY B O   1 
ATOM   5253  N  N   . VAL B 1  8   ? -18.606 8.071   143.542 1.00 25.71  ? 106  VAL B N   1 
ATOM   5254  C  CA  . VAL B 1  8   ? -17.701 9.026   144.175 1.00 28.08  ? 106  VAL B CA  1 
ATOM   5255  C  C   . VAL B 1  8   ? -16.280 8.836   143.658 1.00 28.88  ? 106  VAL B C   1 
ATOM   5256  O  O   . VAL B 1  8   ? -15.894 7.737   143.255 1.00 31.68  ? 106  VAL B O   1 
ATOM   5257  C  CB  . VAL B 1  8   ? -17.695 8.898   145.718 1.00 27.77  ? 106  VAL B CB  1 
ATOM   5258  C  CG1 . VAL B 1  8   ? -19.089 9.130   146.287 1.00 28.35  ? 106  VAL B CG1 1 
ATOM   5259  C  CG2 . VAL B 1  8   ? -17.146 7.544   146.149 1.00 25.68  ? 106  VAL B CG2 1 
ATOM   5260  N  N   . GLY B 1  9   ? -15.504 9.915   143.659 1.00 25.33  ? 107  GLY B N   1 
ATOM   5261  C  CA  . GLY B 1  9   ? -14.131 9.850   143.197 1.00 25.65  ? 107  GLY B CA  1 
ATOM   5262  C  C   . GLY B 1  9   ? -13.259 10.981  143.704 1.00 23.79  ? 107  GLY B C   1 
ATOM   5263  O  O   . GLY B 1  9   ? -13.715 12.110  143.892 1.00 23.53  ? 107  GLY B O   1 
ATOM   5264  N  N   . ARG B 1  10  ? -11.987 10.668  143.914 1.00 19.28  ? 108  ARG B N   1 
ATOM   5265  C  CA  . ARG B 1  10  ? -11.007 11.651  144.346 1.00 16.25  ? 108  ARG B CA  1 
ATOM   5266  C  C   . ARG B 1  10  ? -9.758  11.547  143.485 1.00 20.64  ? 108  ARG B C   1 
ATOM   5267  O  O   . ARG B 1  10  ? -9.274  10.450  143.207 1.00 29.63  ? 108  ARG B O   1 
ATOM   5268  C  CB  . ARG B 1  10  ? -10.658 11.449  145.819 1.00 19.37  ? 108  ARG B CB  1 
ATOM   5269  C  CG  . ARG B 1  10  ? -9.614  12.414  146.356 1.00 22.25  ? 108  ARG B CG  1 
ATOM   5270  C  CD  . ARG B 1  10  ? -9.104  11.973  147.720 1.00 22.00  ? 108  ARG B CD  1 
ATOM   5271  N  NE  . ARG B 1  10  ? -8.607  10.600  147.700 1.00 21.29  ? 108  ARG B NE  1 
ATOM   5272  C  CZ  . ARG B 1  10  ? -9.268  9.556   148.189 1.00 18.68  ? 108  ARG B CZ  1 
ATOM   5273  N  NH1 . ARG B 1  10  ? -10.462 9.722   148.743 1.00 18.41  ? 108  ARG B NH1 1 
ATOM   5274  N  NH2 . ARG B 1  10  ? -8.737  8.344   148.121 1.00 17.26  ? 108  ARG B NH2 1 
ATOM   5275  N  N   . ALA B 1  11  ? -9.235  12.692  143.064 1.00 18.32  ? 109  ALA B N   1 
ATOM   5276  C  CA  . ALA B 1  11  ? -8.064  12.707  142.202 1.00 16.69  ? 109  ALA B CA  1 
ATOM   5277  C  C   . ALA B 1  11  ? -7.163  13.890  142.513 1.00 22.54  ? 109  ALA B C   1 
ATOM   5278  O  O   . ALA B 1  11  ? -7.636  14.975  142.855 1.00 22.69  ? 109  ALA B O   1 
ATOM   5279  C  CB  . ALA B 1  11  ? -8.482  12.731  140.742 1.00 17.38  ? 109  ALA B CB  1 
ATOM   5280  N  N   . ASP B 1  12  ? -5.859  13.661  142.397 1.00 20.71  ? 110  ASP B N   1 
ATOM   5281  C  CA  . ASP B 1  12  ? -4.855  14.696  142.606 1.00 16.43  ? 110  ASP B CA  1 
ATOM   5282  C  C   . ASP B 1  12  ? -4.986  15.796  141.558 1.00 16.66  ? 110  ASP B C   1 
ATOM   5283  O  O   . ASP B 1  12  ? -4.957  15.525  140.358 1.00 17.40  ? 110  ASP B O   1 
ATOM   5284  C  CB  . ASP B 1  12  ? -3.453  14.082  142.567 1.00 18.40  ? 110  ASP B CB  1 
ATOM   5285  C  CG  . ASP B 1  12  ? -2.362  15.084  142.890 1.00 20.68  ? 110  ASP B CG  1 
ATOM   5286  O  OD1 . ASP B 1  12  ? -2.657  16.101  143.550 1.00 21.67  ? 110  ASP B OD1 1 
ATOM   5287  O  OD2 . ASP B 1  12  ? -1.204  14.850  142.486 1.00 25.27  ? 110  ASP B OD2 1 
ATOM   5288  N  N   . CYS B 1  13  ? -5.148  17.033  142.013 1.00 19.71  ? 111  CYS B N   1 
ATOM   5289  C  CA  . CYS B 1  13  ? -5.211  18.175  141.107 1.00 22.12  ? 111  CYS B CA  1 
ATOM   5290  C  C   . CYS B 1  13  ? -4.195  19.232  141.524 1.00 25.99  ? 111  CYS B C   1 
ATOM   5291  O  O   . CYS B 1  13  ? -4.387  20.426  141.294 1.00 26.20  ? 111  CYS B O   1 
ATOM   5292  C  CB  . CYS B 1  13  ? -6.621  18.774  141.074 1.00 19.85  ? 111  CYS B CB  1 
ATOM   5293  S  SG  . CYS B 1  13  ? -7.133  19.588  142.602 1.00 31.92  ? 111  CYS B SG  1 
ATOM   5294  N  N   . THR B 1  14  ? -3.108  18.777  142.137 1.00 28.89  ? 112  THR B N   1 
ATOM   5295  C  CA  . THR B 1  14  ? -2.061  19.672  142.607 1.00 27.72  ? 112  THR B CA  1 
ATOM   5296  C  C   . THR B 1  14  ? -1.222  20.167  141.436 1.00 29.02  ? 112  THR B C   1 
ATOM   5297  O  O   . THR B 1  14  ? -0.738  19.372  140.631 1.00 29.26  ? 112  THR B O   1 
ATOM   5298  C  CB  . THR B 1  14  ? -1.139  18.978  143.632 1.00 23.17  ? 112  THR B CB  1 
ATOM   5299  O  OG1 . THR B 1  14  ? -1.929  18.381  144.667 1.00 19.34  ? 112  THR B OG1 1 
ATOM   5300  C  CG2 . THR B 1  14  ? -0.165  19.975  144.245 1.00 20.65  ? 112  THR B CG2 1 
ATOM   5301  N  N   . GLY B 1  15  ? -1.061  21.481  141.334 1.00 28.41  ? 113  GLY B N   1 
ATOM   5302  C  CA  . GLY B 1  15  ? -0.218  22.057  140.303 1.00 31.93  ? 113  GLY B CA  1 
ATOM   5303  C  C   . GLY B 1  15  ? 1.248   21.940  140.674 1.00 32.49  ? 113  GLY B C   1 
ATOM   5304  O  O   . GLY B 1  15  ? 1.637   21.063  141.447 1.00 32.75  ? 113  GLY B O   1 
ATOM   5305  N  N   . GLN B 1  16  ? 2.073   22.823  140.123 1.00 29.41  ? 114  GLN B N   1 
ATOM   5306  C  CA  . GLN B 1  16  ? 3.487   22.827  140.470 1.00 29.46  ? 114  GLN B CA  1 
ATOM   5307  C  C   . GLN B 1  16  ? 3.680   23.505  141.822 1.00 27.17  ? 114  GLN B C   1 
ATOM   5308  O  O   . GLN B 1  16  ? 2.929   24.412  142.185 1.00 21.92  ? 114  GLN B O   1 
ATOM   5309  C  CB  . GLN B 1  16  ? 4.310   23.519  139.381 1.00 27.87  ? 114  GLN B CB  1 
ATOM   5310  C  CG  . GLN B 1  16  ? 4.005   24.992  139.198 1.00 26.02  ? 114  GLN B CG  1 
ATOM   5311  C  CD  . GLN B 1  16  ? 4.753   25.592  138.027 1.00 26.45  ? 114  GLN B CD  1 
ATOM   5312  O  OE1 . GLN B 1  16  ? 4.387   25.382  136.871 1.00 30.48  ? 114  GLN B OE1 1 
ATOM   5313  N  NE2 . GLN B 1  16  ? 5.811   26.339  138.318 1.00 25.57  ? 114  GLN B NE2 1 
ATOM   5314  N  N   . VAL B 1  17  ? 4.683   23.053  142.569 1.00 23.87  ? 115  VAL B N   1 
ATOM   5315  C  CA  . VAL B 1  17  ? 4.892   23.529  143.931 1.00 19.95  ? 115  VAL B CA  1 
ATOM   5316  C  C   . VAL B 1  17  ? 6.141   24.402  144.046 1.00 20.56  ? 115  VAL B C   1 
ATOM   5317  O  O   . VAL B 1  17  ? 6.623   24.673  145.147 1.00 18.74  ? 115  VAL B O   1 
ATOM   5318  C  CB  . VAL B 1  17  ? 4.995   22.352  144.922 1.00 22.79  ? 115  VAL B CB  1 
ATOM   5319  C  CG1 . VAL B 1  17  ? 3.739   21.494  144.857 1.00 17.26  ? 115  VAL B CG1 1 
ATOM   5320  C  CG2 . VAL B 1  17  ? 6.233   21.518  144.640 1.00 20.60  ? 115  VAL B CG2 1 
ATOM   5321  N  N   . ALA B 1  18  ? 6.656   24.841  142.903 1.00 20.03  ? 116  ALA B N   1 
ATOM   5322  C  CA  . ALA B 1  18  ? 7.828   25.709  142.871 1.00 22.61  ? 116  ALA B CA  1 
ATOM   5323  C  C   . ALA B 1  18  ? 7.752   26.662  141.684 1.00 27.63  ? 116  ALA B C   1 
ATOM   5324  O  O   . ALA B 1  18  ? 7.051   26.389  140.708 1.00 32.09  ? 116  ALA B O   1 
ATOM   5325  C  CB  . ALA B 1  18  ? 9.102   24.883  142.809 1.00 22.65  ? 116  ALA B CB  1 
ATOM   5326  N  N   . ASP B 1  19  ? 8.480   27.773  141.779 1.00 25.90  ? 117  ASP B N   1 
ATOM   5327  C  CA  . ASP B 1  19  ? 8.542   28.777  140.718 1.00 23.31  ? 117  ASP B CA  1 
ATOM   5328  C  C   . ASP B 1  19  ? 7.158   29.275  140.323 1.00 25.13  ? 117  ASP B C   1 
ATOM   5329  O  O   . ASP B 1  19  ? 6.876   29.494  139.145 1.00 29.98  ? 117  ASP B O   1 
ATOM   5330  C  CB  . ASP B 1  19  ? 9.268   28.218  139.493 1.00 25.72  ? 117  ASP B CB  1 
ATOM   5331  C  CG  . ASP B 1  19  ? 10.775  28.317  139.619 1.00 30.26  ? 117  ASP B CG  1 
ATOM   5332  O  OD1 . ASP B 1  19  ? 11.259  28.645  140.725 1.00 28.68  ? 117  ASP B OD1 1 
ATOM   5333  O  OD2 . ASP B 1  19  ? 11.474  28.064  138.615 1.00 33.03  ? 117  ASP B OD2 1 
ATOM   5334  N  N   . ILE B 1  20  ? 6.303   29.456  141.323 1.00 25.89  ? 118  ILE B N   1 
ATOM   5335  C  CA  . ILE B 1  20  ? 4.933   29.899  141.106 1.00 21.22  ? 118  ILE B CA  1 
ATOM   5336  C  C   . ILE B 1  20  ? 4.393   30.492  142.404 1.00 20.96  ? 118  ILE B C   1 
ATOM   5337  O  O   . ILE B 1  20  ? 4.844   30.132  143.491 1.00 20.43  ? 118  ILE B O   1 
ATOM   5338  C  CB  . ILE B 1  20  ? 4.039   28.730  140.625 1.00 20.72  ? 118  ILE B CB  1 
ATOM   5339  C  CG1 . ILE B 1  20  ? 2.692   29.236  140.104 1.00 22.52  ? 118  ILE B CG1 1 
ATOM   5340  C  CG2 . ILE B 1  20  ? 3.846   27.702  141.732 1.00 22.07  ? 118  ILE B CG2 1 
ATOM   5341  C  CD1 . ILE B 1  20  ? 1.969   28.236  139.226 1.00 20.49  ? 118  ILE B CD1 1 
ATOM   5342  N  N   . ASN B 1  21  ? 3.443   31.414  142.293 1.00 25.39  ? 119  ASN B N   1 
ATOM   5343  C  CA  . ASN B 1  21  ? 2.848   32.033  143.473 1.00 30.68  ? 119  ASN B CA  1 
ATOM   5344  C  C   . ASN B 1  21  ? 1.638   31.265  143.985 1.00 32.69  ? 119  ASN B C   1 
ATOM   5345  O  O   . ASN B 1  21  ? 0.997   30.524  143.239 1.00 34.27  ? 119  ASN B O   1 
ATOM   5346  C  CB  . ASN B 1  21  ? 2.450   33.479  143.180 1.00 38.53  ? 119  ASN B CB  1 
ATOM   5347  C  CG  . ASN B 1  21  ? 3.647   34.391  143.014 1.00 48.58  ? 119  ASN B CG  1 
ATOM   5348  O  OD1 . ASN B 1  21  ? 4.669   34.223  143.682 1.00 52.38  ? 119  ASN B OD1 1 
ATOM   5349  N  ND2 . ASN B 1  21  ? 3.526   35.369  142.125 1.00 51.55  ? 119  ASN B ND2 1 
ATOM   5350  N  N   . LEU B 1  22  ? 1.335   31.447  145.265 1.00 33.43  ? 120  LEU B N   1 
ATOM   5351  C  CA  . LEU B 1  22  ? 0.131   30.882  145.859 1.00 32.13  ? 120  LEU B CA  1 
ATOM   5352  C  C   . LEU B 1  22  ? -1.038  31.855  145.698 1.00 34.03  ? 120  LEU B C   1 
ATOM   5353  O  O   . LEU B 1  22  ? -0.877  33.065  145.858 1.00 32.68  ? 120  LEU B O   1 
ATOM   5354  C  CB  . LEU B 1  22  ? 0.365   30.549  147.334 1.00 27.72  ? 120  LEU B CB  1 
ATOM   5355  C  CG  . LEU B 1  22  ? 1.473   29.527  147.617 1.00 24.98  ? 120  LEU B CG  1 
ATOM   5356  C  CD1 . LEU B 1  22  ? 1.642   29.302  149.114 1.00 15.38  ? 120  LEU B CD1 1 
ATOM   5357  C  CD2 . LEU B 1  22  ? 1.203   28.209  146.902 1.00 15.87  ? 120  LEU B CD2 1 
ATOM   5358  N  N   . MET B 1  23  ? -2.213  31.318  145.382 1.00 37.92  ? 121  MET B N   1 
ATOM   5359  C  CA  . MET B 1  23  ? -3.384  32.136  145.073 1.00 41.56  ? 121  MET B CA  1 
ATOM   5360  C  C   . MET B 1  23  ? -4.229  32.399  146.318 1.00 39.49  ? 121  MET B C   1 
ATOM   5361  O  O   . MET B 1  23  ? -4.484  31.490  147.107 1.00 36.30  ? 121  MET B O   1 
ATOM   5362  C  CB  . MET B 1  23  ? -4.233  31.442  144.001 1.00 43.56  ? 121  MET B CB  1 
ATOM   5363  C  CG  . MET B 1  23  ? -5.415  32.243  143.458 1.00 44.88  ? 121  MET B CG  1 
ATOM   5364  S  SD  . MET B 1  23  ? -4.983  33.472  142.207 1.00 64.28  ? 121  MET B SD  1 
ATOM   5365  C  CE  . MET B 1  23  ? -5.190  34.995  143.120 1.00 34.73  ? 121  MET B CE  1 
ATOM   5366  N  N   . GLY B 1  24  ? -4.660  33.645  146.489 1.00 41.27  ? 122  GLY B N   1 
ATOM   5367  C  CA  . GLY B 1  24  ? -5.566  33.989  147.570 1.00 38.77  ? 122  GLY B CA  1 
ATOM   5368  C  C   . GLY B 1  24  ? -5.253  35.289  148.292 1.00 36.86  ? 122  GLY B C   1 
ATOM   5369  O  O   . GLY B 1  24  ? -6.081  36.200  148.328 1.00 38.94  ? 122  GLY B O   1 
ATOM   5370  N  N   . TYR B 1  25  ? -4.059  35.376  148.871 1.00 32.07  ? 123  TYR B N   1 
ATOM   5371  C  CA  . TYR B 1  25  ? -3.682  36.536  149.677 1.00 31.38  ? 123  TYR B CA  1 
ATOM   5372  C  C   . TYR B 1  25  ? -3.227  37.729  148.840 1.00 33.42  ? 123  TYR B C   1 
ATOM   5373  O  O   . TYR B 1  25  ? -3.154  38.851  149.341 1.00 32.61  ? 123  TYR B O   1 
ATOM   5374  C  CB  . TYR B 1  25  ? -2.576  36.158  150.661 1.00 29.45  ? 123  TYR B CB  1 
ATOM   5375  C  CG  . TYR B 1  25  ? -3.021  35.232  151.768 1.00 26.64  ? 123  TYR B CG  1 
ATOM   5376  C  CD1 . TYR B 1  25  ? -3.926  35.654  152.735 1.00 21.63  ? 123  TYR B CD1 1 
ATOM   5377  C  CD2 . TYR B 1  25  ? -2.521  33.938  151.858 1.00 25.55  ? 123  TYR B CD2 1 
ATOM   5378  C  CE1 . TYR B 1  25  ? -4.328  34.809  153.752 1.00 16.14  ? 123  TYR B CE1 1 
ATOM   5379  C  CE2 . TYR B 1  25  ? -2.915  33.091  152.872 1.00 22.01  ? 123  TYR B CE2 1 
ATOM   5380  C  CZ  . TYR B 1  25  ? -3.819  33.529  153.815 1.00 18.67  ? 123  TYR B CZ  1 
ATOM   5381  O  OH  . TYR B 1  25  ? -4.209  32.681  154.825 1.00 21.60  ? 123  TYR B OH  1 
ATOM   5382  N  N   . GLY B 1  26  ? -2.926  37.482  147.569 1.00 35.34  ? 124  GLY B N   1 
ATOM   5383  C  CA  . GLY B 1  26  ? -2.398  38.506  146.684 1.00 36.74  ? 124  GLY B CA  1 
ATOM   5384  C  C   . GLY B 1  26  ? -1.133  39.176  147.185 1.00 42.67  ? 124  GLY B C   1 
ATOM   5385  O  O   . GLY B 1  26  ? -0.914  40.363  146.942 1.00 41.99  ? 124  GLY B O   1 
ATOM   5386  N  N   . LYS B 1  27  ? -0.295  38.418  147.885 1.00 50.52  ? 125  LYS B N   1 
ATOM   5387  C  CA  . LYS B 1  27  ? 0.987   38.935  148.348 1.00 53.62  ? 125  LYS B CA  1 
ATOM   5388  C  C   . LYS B 1  27  ? 2.058   38.756  147.283 1.00 55.42  ? 125  LYS B C   1 
ATOM   5389  O  O   . LYS B 1  27  ? 2.065   37.762  146.556 1.00 54.56  ? 125  LYS B O   1 
ATOM   5390  C  CB  . LYS B 1  27  ? 1.415   38.259  149.651 1.00 51.19  ? 125  LYS B CB  1 
ATOM   5391  C  CG  . LYS B 1  27  ? 0.513   38.580  150.830 1.00 53.40  ? 125  LYS B CG  1 
ATOM   5392  C  CD  . LYS B 1  27  ? 0.284   40.081  150.970 1.00 59.42  ? 125  LYS B CD  1 
ATOM   5393  C  CE  . LYS B 1  27  ? 1.559   40.820  151.357 1.00 61.65  ? 125  LYS B CE  1 
ATOM   5394  N  NZ  . LYS B 1  27  ? 1.331   42.289  151.467 1.00 63.34  ? 125  LYS B NZ  1 
ATOM   5395  N  N   . SER B 1  28  ? 2.959   39.728  147.198 1.00 59.34  ? 126  SER B N   1 
ATOM   5396  C  CA  . SER B 1  28  ? 3.971   39.761  146.149 1.00 59.93  ? 126  SER B CA  1 
ATOM   5397  C  C   . SER B 1  28  ? 4.932   38.577  146.229 1.00 54.19  ? 126  SER B C   1 
ATOM   5398  O  O   . SER B 1  28  ? 5.121   37.852  145.251 1.00 51.70  ? 126  SER B O   1 
ATOM   5399  C  CB  . SER B 1  28  ? 4.758   41.073  146.214 1.00 61.26  ? 126  SER B CB  1 
ATOM   5400  O  OG  . SER B 1  28  ? 5.575   41.236  145.068 1.00 64.07  ? 126  SER B OG  1 
ATOM   5401  N  N   . GLY B 1  29  ? 5.531   38.381  147.400 1.00 47.38  ? 127  GLY B N   1 
ATOM   5402  C  CA  . GLY B 1  29  ? 6.574   37.385  147.556 1.00 41.62  ? 127  GLY B CA  1 
ATOM   5403  C  C   . GLY B 1  29  ? 6.132   36.025  148.063 1.00 38.55  ? 127  GLY B C   1 
ATOM   5404  O  O   . GLY B 1  29  ? 6.971   35.211  148.446 1.00 40.03  ? 127  GLY B O   1 
ATOM   5405  N  N   . GLN B 1  30  ? 4.827   35.767  148.073 1.00 34.98  ? 128  GLN B N   1 
ATOM   5406  C  CA  . GLN B 1  30  ? 4.335   34.486  148.570 1.00 31.36  ? 128  GLN B CA  1 
ATOM   5407  C  C   . GLN B 1  30  ? 4.410   33.416  147.487 1.00 31.77  ? 128  GLN B C   1 
ATOM   5408  O  O   . GLN B 1  30  ? 3.389   32.993  146.946 1.00 28.92  ? 128  GLN B O   1 
ATOM   5409  C  CB  . GLN B 1  30  ? 2.900   34.601  149.084 1.00 30.26  ? 128  GLN B CB  1 
ATOM   5410  C  CG  . GLN B 1  30  ? 2.529   33.471  150.037 1.00 32.35  ? 128  GLN B CG  1 
ATOM   5411  C  CD  . GLN B 1  30  ? 1.033   33.307  150.221 1.00 33.44  ? 128  GLN B CD  1 
ATOM   5412  O  OE1 . GLN B 1  30  ? 0.234   33.936  149.527 1.00 35.95  ? 128  GLN B OE1 1 
ATOM   5413  N  NE2 . GLN B 1  30  ? 0.647   32.449  151.159 1.00 27.15  ? 128  GLN B NE2 1 
ATOM   5414  N  N   . ASN B 1  31  ? 5.626   32.982  147.175 1.00 34.04  ? 129  ASN B N   1 
ATOM   5415  C  CA  . ASN B 1  31  ? 5.830   31.933  146.186 1.00 32.02  ? 129  ASN B CA  1 
ATOM   5416  C  C   . ASN B 1  31  ? 5.817   30.548  146.821 1.00 28.85  ? 129  ASN B C   1 
ATOM   5417  O  O   . ASN B 1  31  ? 6.113   30.395  148.006 1.00 28.19  ? 129  ASN B O   1 
ATOM   5418  C  CB  . ASN B 1  31  ? 7.148   32.151  145.443 1.00 33.81  ? 129  ASN B CB  1 
ATOM   5419  C  CG  . ASN B 1  31  ? 8.356   32.010  146.348 1.00 35.50  ? 129  ASN B CG  1 
ATOM   5420  O  OD1 . ASN B 1  31  ? 8.314   32.374  147.524 1.00 34.82  ? 129  ASN B OD1 1 
ATOM   5421  N  ND2 . ASN B 1  31  ? 9.442   31.475  145.804 1.00 37.33  ? 129  ASN B ND2 1 
ATOM   5422  N  N   . ALA B 1  32  ? 5.477   29.539  146.027 1.00 27.14  ? 130  ALA B N   1 
ATOM   5423  C  CA  . ALA B 1  32  ? 5.493   28.166  146.507 1.00 23.39  ? 130  ALA B CA  1 
ATOM   5424  C  C   . ALA B 1  32  ? 6.929   27.667  146.577 1.00 24.58  ? 130  ALA B C   1 
ATOM   5425  O  O   . ALA B 1  32  ? 7.697   27.826  145.629 1.00 26.05  ? 130  ALA B O   1 
ATOM   5426  C  CB  . ALA B 1  32  ? 4.657   27.274  145.608 1.00 17.85  ? 130  ALA B CB  1 
ATOM   5427  N  N   . GLN B 1  33  ? 7.287   27.058  147.701 1.00 18.20  ? 131  GLN B N   1 
ATOM   5428  C  CA  . GLN B 1  33  ? 8.634   26.536  147.883 1.00 19.74  ? 131  GLN B CA  1 
ATOM   5429  C  C   . GLN B 1  33  ? 8.599   25.071  148.296 1.00 21.41  ? 131  GLN B C   1 
ATOM   5430  O  O   . GLN B 1  33  ? 9.585   24.536  148.804 1.00 20.04  ? 131  GLN B O   1 
ATOM   5431  C  CB  . GLN B 1  33  ? 9.393   27.366  148.922 1.00 22.06  ? 131  GLN B CB  1 
ATOM   5432  C  CG  . GLN B 1  33  ? 9.666   28.808  148.499 1.00 27.40  ? 131  GLN B CG  1 
ATOM   5433  C  CD  . GLN B 1  33  ? 10.122  29.692  149.654 1.00 25.78  ? 131  GLN B CD  1 
ATOM   5434  O  OE1 . GLN B 1  33  ? 10.562  29.205  150.696 1.00 25.84  ? 131  GLN B OE1 1 
ATOM   5435  N  NE2 . GLN B 1  33  ? 10.032  31.001  149.461 1.00 22.99  ? 131  GLN B NE2 1 
ATOM   5436  N  N   . GLY B 1  34  ? 7.462   24.424  148.057 1.00 22.20  ? 132  GLY B N   1 
ATOM   5437  C  CA  . GLY B 1  34  ? 7.283   23.031  148.422 1.00 19.47  ? 132  GLY B CA  1 
ATOM   5438  C  C   . GLY B 1  34  ? 5.846   22.657  148.735 1.00 20.29  ? 132  GLY B C   1 
ATOM   5439  O  O   . GLY B 1  34  ? 4.915   23.351  148.328 1.00 23.61  ? 132  GLY B O   1 
ATOM   5440  N  N   . ILE B 1  35  ? 5.661   21.556  149.459 1.00 19.17  ? 133  ILE B N   1 
ATOM   5441  C  CA  . ILE B 1  35  ? 4.324   21.020  149.693 1.00 18.48  ? 133  ILE B CA  1 
ATOM   5442  C  C   . ILE B 1  35  ? 4.140   20.490  151.118 1.00 18.84  ? 133  ILE B C   1 
ATOM   5443  O  O   . ILE B 1  35  ? 5.007   19.798  151.656 1.00 20.24  ? 133  ILE B O   1 
ATOM   5444  C  CB  . ILE B 1  35  ? 3.999   19.894  148.670 1.00 15.71  ? 133  ILE B CB  1 
ATOM   5445  C  CG1 . ILE B 1  35  ? 2.617   19.293  148.929 1.00 15.07  ? 133  ILE B CG1 1 
ATOM   5446  C  CG2 . ILE B 1  35  ? 5.069   18.811  148.686 1.00 16.31  ? 133  ILE B CG2 1 
ATOM   5447  C  CD1 . ILE B 1  35  ? 2.151   18.365  147.829 1.00 15.44  ? 133  ILE B CD1 1 
ATOM   5448  N  N   . LEU B 1  36  ? 3.010   20.841  151.730 1.00 17.35  ? 134  LEU B N   1 
ATOM   5449  C  CA  . LEU B 1  36  ? 2.638   20.317  153.041 1.00 18.23  ? 134  LEU B CA  1 
ATOM   5450  C  C   . LEU B 1  36  ? 1.645   19.168  152.889 1.00 24.13  ? 134  LEU B C   1 
ATOM   5451  O  O   . LEU B 1  36  ? 1.737   18.154  153.581 1.00 26.98  ? 134  LEU B O   1 
ATOM   5452  C  CB  . LEU B 1  36  ? 2.043   21.419  153.920 1.00 16.14  ? 134  LEU B CB  1 
ATOM   5453  C  CG  . LEU B 1  36  ? 1.373   20.966  155.222 1.00 17.37  ? 134  LEU B CG  1 
ATOM   5454  C  CD1 . LEU B 1  36  ? 2.355   20.221  156.114 1.00 12.84  ? 134  LEU B CD1 1 
ATOM   5455  C  CD2 . LEU B 1  36  ? 0.764   22.151  155.959 1.00 14.71  ? 134  LEU B CD2 1 
ATOM   5456  N  N   . THR B 1  37  ? 0.691   19.341  151.982 1.00 24.01  ? 135  THR B N   1 
ATOM   5457  C  CA  . THR B 1  37  ? -0.242  18.276  151.639 1.00 21.38  ? 135  THR B CA  1 
ATOM   5458  C  C   . THR B 1  37  ? -0.760  18.476  150.224 1.00 18.20  ? 135  THR B C   1 
ATOM   5459  O  O   . THR B 1  37  ? -0.651  19.563  149.659 1.00 20.03  ? 135  THR B O   1 
ATOM   5460  C  CB  . THR B 1  37  ? -1.434  18.208  152.613 1.00 20.76  ? 135  THR B CB  1 
ATOM   5461  O  OG1 . THR B 1  37  ? -2.196  17.022  152.353 1.00 20.25  ? 135  THR B OG1 1 
ATOM   5462  C  CG2 . THR B 1  37  ? -2.327  19.421  152.449 1.00 19.64  ? 135  THR B CG2 1 
ATOM   5463  N  N   . ARG B 1  38  ? -1.324  17.417  149.657 1.00 17.93  ? 136  ARG B N   1 
ATOM   5464  C  CA  . ARG B 1  38  ? -1.813  17.450  148.286 1.00 20.54  ? 136  ARG B CA  1 
ATOM   5465  C  C   . ARG B 1  38  ? -3.176  18.127  148.161 1.00 21.93  ? 136  ARG B C   1 
ATOM   5466  O  O   . ARG B 1  38  ? -3.919  18.245  149.136 1.00 23.95  ? 136  ARG B O   1 
ATOM   5467  C  CB  . ARG B 1  38  ? -1.887  16.029  147.724 1.00 21.37  ? 136  ARG B CB  1 
ATOM   5468  C  CG  . ARG B 1  38  ? -0.532  15.380  147.497 1.00 15.19  ? 136  ARG B CG  1 
ATOM   5469  C  CD  . ARG B 1  38  ? -0.053  15.616  146.078 1.00 15.89  ? 136  ARG B CD  1 
ATOM   5470  N  NE  . ARG B 1  38  ? 1.361   15.302  145.907 1.00 16.56  ? 136  ARG B NE  1 
ATOM   5471  C  CZ  . ARG B 1  38  ? 2.012   15.419  144.755 1.00 25.80  ? 136  ARG B CZ  1 
ATOM   5472  N  NH1 . ARG B 1  38  ? 1.373   15.847  143.674 1.00 27.24  ? 136  ARG B NH1 1 
ATOM   5473  N  NH2 . ARG B 1  38  ? 3.300   15.110  144.680 1.00 25.47  ? 136  ARG B NH2 1 
ATOM   5474  N  N   . LEU B 1  39  ? -3.486  18.579  146.950 1.00 21.07  ? 137  LEU B N   1 
ATOM   5475  C  CA  . LEU B 1  39  ? -4.792  19.152  146.646 1.00 17.09  ? 137  LEU B CA  1 
ATOM   5476  C  C   . LEU B 1  39  ? -5.586  18.180  145.779 1.00 17.59  ? 137  LEU B C   1 
ATOM   5477  O  O   . LEU B 1  39  ? -5.086  17.691  144.766 1.00 14.66  ? 137  LEU B O   1 
ATOM   5478  C  CB  . LEU B 1  39  ? -4.642  20.499  145.938 1.00 13.89  ? 137  LEU B CB  1 
ATOM   5479  C  CG  . LEU B 1  39  ? -3.667  21.487  146.579 1.00 22.18  ? 137  LEU B CG  1 
ATOM   5480  C  CD1 . LEU B 1  39  ? -3.550  22.752  145.746 1.00 14.17  ? 137  LEU B CD1 1 
ATOM   5481  C  CD2 . LEU B 1  39  ? -4.091  21.817  148.002 1.00 21.83  ? 137  LEU B CD2 1 
ATOM   5482  N  N   . TYR B 1  40  ? -6.826  17.908  146.171 1.00 20.27  ? 138  TYR B N   1 
ATOM   5483  C  CA  . TYR B 1  40  ? -7.644  16.934  145.457 1.00 20.90  ? 138  TYR B CA  1 
ATOM   5484  C  C   . TYR B 1  40  ? -8.913  17.533  144.866 1.00 24.21  ? 138  TYR B C   1 
ATOM   5485  O  O   . TYR B 1  40  ? -9.467  18.503  145.389 1.00 23.32  ? 138  TYR B O   1 
ATOM   5486  C  CB  . TYR B 1  40  ? -8.024  15.774  146.384 1.00 13.92  ? 138  TYR B CB  1 
ATOM   5487  C  CG  . TYR B 1  40  ? -6.849  15.115  147.070 1.00 21.17  ? 138  TYR B CG  1 
ATOM   5488  C  CD1 . TYR B 1  40  ? -6.106  14.133  146.428 1.00 14.63  ? 138  TYR B CD1 1 
ATOM   5489  C  CD2 . TYR B 1  40  ? -6.483  15.475  148.361 1.00 19.31  ? 138  TYR B CD2 1 
ATOM   5490  C  CE1 . TYR B 1  40  ? -5.032  13.527  147.052 1.00 14.77  ? 138  TYR B CE1 1 
ATOM   5491  C  CE2 . TYR B 1  40  ? -5.411  14.875  148.993 1.00 15.88  ? 138  TYR B CE2 1 
ATOM   5492  C  CZ  . TYR B 1  40  ? -4.689  13.902  148.335 1.00 21.17  ? 138  TYR B CZ  1 
ATOM   5493  O  OH  . TYR B 1  40  ? -3.619  13.303  148.961 1.00 24.51  ? 138  TYR B OH  1 
ATOM   5494  N  N   . SER B 1  41  ? -9.360  16.942  143.764 1.00 22.00  ? 139  SER B N   1 
ATOM   5495  C  CA  . SER B 1  41  ? -10.696 17.195  143.250 1.00 19.38  ? 139  SER B CA  1 
ATOM   5496  C  C   . SER B 1  41  ? -11.589 16.045  143.696 1.00 16.63  ? 139  SER B C   1 
ATOM   5497  O  O   . SER B 1  41  ? -11.248 14.879  143.508 1.00 17.91  ? 139  SER B O   1 
ATOM   5498  C  CB  . SER B 1  41  ? -10.687 17.323  141.727 1.00 24.36  ? 139  SER B CB  1 
ATOM   5499  O  OG  . SER B 1  41  ? -12.004 17.455  141.221 1.00 26.61  ? 139  SER B OG  1 
ATOM   5500  N  N   . ARG B 1  42  ? -12.733 16.368  144.284 1.00 17.65  ? 140  ARG B N   1 
ATOM   5501  C  CA  . ARG B 1  42  ? -13.606 15.328  144.808 1.00 21.46  ? 140  ARG B CA  1 
ATOM   5502  C  C   . ARG B 1  42  ? -15.000 15.427  144.196 1.00 20.64  ? 140  ARG B C   1 
ATOM   5503  O  O   . ARG B 1  42  ? -15.736 16.385  144.441 1.00 18.41  ? 140  ARG B O   1 
ATOM   5504  C  CB  . ARG B 1  42  ? -13.674 15.417  146.333 1.00 21.01  ? 140  ARG B CB  1 
ATOM   5505  C  CG  . ARG B 1  42  ? -12.439 14.862  147.039 1.00 19.14  ? 140  ARG B CG  1 
ATOM   5506  C  CD  . ARG B 1  42  ? -12.538 15.063  148.543 1.00 21.19  ? 140  ARG B CD  1 
ATOM   5507  N  NE  . ARG B 1  42  ? -11.373 14.559  149.267 1.00 19.07  ? 140  ARG B NE  1 
ATOM   5508  C  CZ  . ARG B 1  42  ? -10.378 15.324  149.707 1.00 20.94  ? 140  ARG B CZ  1 
ATOM   5509  N  NH1 . ARG B 1  42  ? -10.401 16.632  149.494 1.00 19.22  ? 140  ARG B NH1 1 
ATOM   5510  N  NH2 . ARG B 1  42  ? -9.361  14.781  150.362 1.00 12.80  ? 140  ARG B NH2 1 
ATOM   5511  N  N   . ALA B 1  43  ? -15.353 14.423  143.399 1.00 15.38  ? 141  ALA B N   1 
ATOM   5512  C  CA  . ALA B 1  43  ? -16.590 14.452  142.628 1.00 17.26  ? 141  ALA B CA  1 
ATOM   5513  C  C   . ALA B 1  43  ? -17.626 13.481  143.179 1.00 18.21  ? 141  ALA B C   1 
ATOM   5514  O  O   . ALA B 1  43  ? -17.291 12.390  143.641 1.00 16.21  ? 141  ALA B O   1 
ATOM   5515  C  CB  . ALA B 1  43  ? -16.305 14.142  141.164 1.00 18.01  ? 141  ALA B CB  1 
ATOM   5516  N  N   . PHE B 1  44  ? -18.888 13.896  143.131 1.00 18.96  ? 142  PHE B N   1 
ATOM   5517  C  CA  . PHE B 1  44  ? -19.994 13.063  143.586 1.00 21.74  ? 142  PHE B CA  1 
ATOM   5518  C  C   . PHE B 1  44  ? -21.092 13.019  142.528 1.00 22.89  ? 142  PHE B C   1 
ATOM   5519  O  O   . PHE B 1  44  ? -21.630 14.057  142.142 1.00 25.34  ? 142  PHE B O   1 
ATOM   5520  C  CB  . PHE B 1  44  ? -20.546 13.584  144.916 1.00 15.92  ? 142  PHE B CB  1 
ATOM   5521  C  CG  . PHE B 1  44  ? -19.513 13.678  146.005 1.00 24.66  ? 142  PHE B CG  1 
ATOM   5522  C  CD1 . PHE B 1  44  ? -18.691 14.792  146.109 1.00 23.63  ? 142  PHE B CD1 1 
ATOM   5523  C  CD2 . PHE B 1  44  ? -19.354 12.650  146.919 1.00 20.40  ? 142  PHE B CD2 1 
ATOM   5524  C  CE1 . PHE B 1  44  ? -17.738 14.879  147.109 1.00 14.21  ? 142  PHE B CE1 1 
ATOM   5525  C  CE2 . PHE B 1  44  ? -18.402 12.732  147.920 1.00 17.52  ? 142  PHE B CE2 1 
ATOM   5526  C  CZ  . PHE B 1  44  ? -17.593 13.847  148.014 1.00 14.26  ? 142  PHE B CZ  1 
ATOM   5527  N  N   . ILE B 1  45  ? -21.415 11.821  142.052 1.00 21.44  ? 143  ILE B N   1 
ATOM   5528  C  CA  . ILE B 1  45  ? -22.422 11.678  141.007 1.00 20.35  ? 143  ILE B CA  1 
ATOM   5529  C  C   . ILE B 1  45  ? -23.651 10.912  141.480 1.00 22.16  ? 143  ILE B C   1 
ATOM   5530  O  O   . ILE B 1  45  ? -23.560 9.758   141.899 1.00 19.52  ? 143  ILE B O   1 
ATOM   5531  C  CB  . ILE B 1  45  ? -21.856 10.967  139.763 1.00 22.04  ? 143  ILE B CB  1 
ATOM   5532  C  CG1 . ILE B 1  45  ? -20.585 11.667  139.279 1.00 23.62  ? 143  ILE B CG1 1 
ATOM   5533  C  CG2 . ILE B 1  45  ? -22.901 10.929  138.653 1.00 20.22  ? 143  ILE B CG2 1 
ATOM   5534  C  CD1 . ILE B 1  45  ? -20.082 11.165  137.946 1.00 22.28  ? 143  ILE B CD1 1 
ATOM   5535  N  N   . MET B 1  46  ? -24.800 11.575  141.409 1.00 23.44  ? 144  MET B N   1 
ATOM   5536  C  CA  . MET B 1  46  ? -26.083 10.949  141.699 1.00 20.80  ? 144  MET B CA  1 
ATOM   5537  C  C   . MET B 1  46  ? -26.868 10.790  140.403 1.00 23.59  ? 144  MET B C   1 
ATOM   5538  O  O   . MET B 1  46  ? -26.759 11.619  139.500 1.00 24.65  ? 144  MET B O   1 
ATOM   5539  C  CB  . MET B 1  46  ? -26.884 11.777  142.705 1.00 21.64  ? 144  MET B CB  1 
ATOM   5540  C  CG  . MET B 1  46  ? -26.416 11.657  144.147 1.00 18.84  ? 144  MET B CG  1 
ATOM   5541  S  SD  . MET B 1  46  ? -24.739 12.266  144.407 1.00 37.83  ? 144  MET B SD  1 
ATOM   5542  C  CE  . MET B 1  46  ? -24.870 13.933  143.766 1.00 29.10  ? 144  MET B CE  1 
ATOM   5543  N  N   . ALA B 1  47  ? -27.652 9.722   140.311 1.00 24.39  ? 145  ALA B N   1 
ATOM   5544  C  CA  . ALA B 1  47  ? -28.494 9.495   139.143 1.00 25.13  ? 145  ALA B CA  1 
ATOM   5545  C  C   . ALA B 1  47  ? -29.810 8.833   139.527 1.00 28.42  ? 145  ALA B C   1 
ATOM   5546  O  O   . ALA B 1  47  ? -29.906 8.164   140.558 1.00 31.47  ? 145  ALA B O   1 
ATOM   5547  C  CB  . ALA B 1  47  ? -27.760 8.649   138.116 1.00 23.28  ? 145  ALA B CB  1 
ATOM   5548  N  N   . GLU B 1  48  ? -30.827 9.030   138.694 1.00 30.97  ? 146  GLU B N   1 
ATOM   5549  C  CA  . GLU B 1  48  ? -32.098 8.338   138.875 1.00 36.55  ? 146  GLU B CA  1 
ATOM   5550  C  C   . GLU B 1  48  ? -31.869 6.839   138.685 1.00 40.43  ? 146  GLU B C   1 
ATOM   5551  O  O   . GLU B 1  48  ? -30.894 6.444   138.046 1.00 37.09  ? 146  GLU B O   1 
ATOM   5552  C  CB  . GLU B 1  48  ? -33.156 8.870   137.896 1.00 37.36  ? 146  GLU B CB  1 
ATOM   5553  C  CG  . GLU B 1  48  ? -33.431 10.373  138.004 1.00 37.68  ? 146  GLU B CG  1 
ATOM   5554  C  CD  . GLU B 1  48  ? -34.341 10.745  139.171 1.00 38.53  ? 146  GLU B CD  1 
ATOM   5555  O  OE1 . GLU B 1  48  ? -34.537 9.914   140.085 1.00 41.99  ? 146  GLU B OE1 1 
ATOM   5556  O  OE2 . GLU B 1  48  ? -34.871 11.878  139.170 1.00 34.02  ? 146  GLU B OE2 1 
ATOM   5557  N  N   . PRO B 1  49  ? -32.750 6.003   139.263 1.00 46.12  ? 147  PRO B N   1 
ATOM   5558  C  CA  . PRO B 1  49  ? -32.676 4.543   139.151 1.00 45.67  ? 147  PRO B CA  1 
ATOM   5559  C  C   . PRO B 1  49  ? -32.346 4.019   137.754 1.00 44.86  ? 147  PRO B C   1 
ATOM   5560  O  O   . PRO B 1  49  ? -31.578 3.060   137.641 1.00 45.58  ? 147  PRO B O   1 
ATOM   5561  C  CB  . PRO B 1  49  ? -34.077 4.105   139.565 1.00 46.28  ? 147  PRO B CB  1 
ATOM   5562  C  CG  . PRO B 1  49  ? -34.511 5.124   140.546 1.00 46.45  ? 147  PRO B CG  1 
ATOM   5563  C  CD  . PRO B 1  49  ? -33.804 6.415   140.209 1.00 46.26  ? 147  PRO B CD  1 
ATOM   5564  N  N   . ASP B 1  50  ? -32.903 4.643   136.719 1.00 44.00  ? 148  ASP B N   1 
ATOM   5565  C  CA  . ASP B 1  50  ? -32.680 4.207   135.344 1.00 46.43  ? 148  ASP B CA  1 
ATOM   5566  C  C   . ASP B 1  50  ? -31.370 4.737   134.768 1.00 45.98  ? 148  ASP B C   1 
ATOM   5567  O  O   . ASP B 1  50  ? -30.967 4.351   133.667 1.00 47.47  ? 148  ASP B O   1 
ATOM   5568  C  CB  . ASP B 1  50  ? -33.852 4.632   134.453 1.00 53.16  ? 148  ASP B CB  1 
ATOM   5569  C  CG  . ASP B 1  50  ? -33.992 6.144   134.343 1.00 58.34  ? 148  ASP B CG  1 
ATOM   5570  O  OD1 . ASP B 1  50  ? -33.462 6.856   135.218 1.00 61.05  ? 148  ASP B OD1 1 
ATOM   5571  O  OD2 . ASP B 1  50  ? -34.646 6.622   133.390 1.00 59.10  ? 148  ASP B OD2 1 
ATOM   5572  N  N   . GLY B 1  51  ? -30.706 5.617   135.513 1.00 42.72  ? 149  GLY B N   1 
ATOM   5573  C  CA  . GLY B 1  51  ? -29.441 6.182   135.076 1.00 37.14  ? 149  GLY B CA  1 
ATOM   5574  C  C   . GLY B 1  51  ? -29.575 7.548   134.430 1.00 37.60  ? 149  GLY B C   1 
ATOM   5575  O  O   . GLY B 1  51  ? -28.582 8.132   133.992 1.00 36.28  ? 149  GLY B O   1 
ATOM   5576  N  N   . SER B 1  52  ? -30.800 8.061   134.371 1.00 41.88  ? 150  SER B N   1 
ATOM   5577  C  CA  . SER B 1  52  ? -31.053 9.361   133.758 1.00 45.49  ? 150  SER B CA  1 
ATOM   5578  C  C   . SER B 1  52  ? -30.965 10.496  134.774 1.00 46.59  ? 150  SER B C   1 
ATOM   5579  O  O   . SER B 1  52  ? -30.897 10.256  135.979 1.00 44.87  ? 150  SER B O   1 
ATOM   5580  C  CB  . SER B 1  52  ? -32.426 9.376   133.087 1.00 45.96  ? 150  SER B CB  1 
ATOM   5581  O  OG  . SER B 1  52  ? -33.457 9.240   134.049 1.00 47.38  ? 150  SER B OG  1 
ATOM   5582  N  N   . ASN B 1  53  ? -30.967 11.729  134.268 1.00 48.92  ? 151  ASN B N   1 
ATOM   5583  C  CA  . ASN B 1  53  ? -30.983 12.934  135.099 1.00 51.26  ? 151  ASN B CA  1 
ATOM   5584  C  C   . ASN B 1  53  ? -29.864 12.961  136.130 1.00 43.01  ? 151  ASN B C   1 
ATOM   5585  O  O   . ASN B 1  53  ? -30.114 13.132  137.323 1.00 42.52  ? 151  ASN B O   1 
ATOM   5586  C  CB  . ASN B 1  53  ? -32.335 13.081  135.804 1.00 59.29  ? 151  ASN B CB  1 
ATOM   5587  C  CG  . ASN B 1  53  ? -33.463 13.409  134.844 1.00 68.34  ? 151  ASN B CG  1 
ATOM   5588  O  OD1 . ASN B 1  53  ? -34.061 14.482  134.916 1.00 67.69  ? 151  ASN B OD1 1 
ATOM   5589  N  ND2 . ASN B 1  53  ? -33.755 12.486  133.937 1.00 79.69  ? 151  ASN B ND2 1 
ATOM   5590  N  N   . ARG B 1  54  ? -28.632 12.784  135.670 1.00 36.52  ? 152  ARG B N   1 
ATOM   5591  C  CA  . ARG B 1  54  ? -27.496 12.755  136.578 1.00 31.99  ? 152  ARG B CA  1 
ATOM   5592  C  C   . ARG B 1  54  ? -27.119 14.151  137.050 1.00 32.72  ? 152  ARG B C   1 
ATOM   5593  O  O   . ARG B 1  54  ? -27.346 15.139  136.354 1.00 31.43  ? 152  ARG B O   1 
ATOM   5594  C  CB  . ARG B 1  54  ? -26.294 12.077  135.916 1.00 27.53  ? 152  ARG B CB  1 
ATOM   5595  C  CG  . ARG B 1  54  ? -26.642 10.779  135.223 1.00 30.96  ? 152  ARG B CG  1 
ATOM   5596  C  CD  . ARG B 1  54  ? -25.409 9.940   134.949 1.00 33.27  ? 152  ARG B CD  1 
ATOM   5597  N  NE  . ARG B 1  54  ? -25.769 8.621   134.438 1.00 37.29  ? 152  ARG B NE  1 
ATOM   5598  C  CZ  . ARG B 1  54  ? -24.929 7.595   134.356 1.00 43.61  ? 152  ARG B CZ  1 
ATOM   5599  N  NH1 . ARG B 1  54  ? -23.672 7.730   134.757 1.00 44.73  ? 152  ARG B NH1 1 
ATOM   5600  N  NH2 . ARG B 1  54  ? -25.348 6.431   133.876 1.00 45.63  ? 152  ARG B NH2 1 
ATOM   5601  N  N   . THR B 1  55  ? -26.540 14.218  138.243 1.00 32.38  ? 153  THR B N   1 
ATOM   5602  C  CA  . THR B 1  55  ? -26.039 15.471  138.788 1.00 31.94  ? 153  THR B CA  1 
ATOM   5603  C  C   . THR B 1  55  ? -24.625 15.272  139.321 1.00 29.34  ? 153  THR B C   1 
ATOM   5604  O  O   . THR B 1  55  ? -24.318 14.243  139.925 1.00 27.68  ? 153  THR B O   1 
ATOM   5605  C  CB  . THR B 1  55  ? -26.938 16.007  139.912 1.00 32.77  ? 153  THR B CB  1 
ATOM   5606  O  OG1 . THR B 1  55  ? -27.083 15.002  140.923 1.00 35.59  ? 153  THR B OG1 1 
ATOM   5607  C  CG2 . THR B 1  55  ? -28.313 16.376  139.370 1.00 31.80  ? 153  THR B CG2 1 
ATOM   5608  N  N   . VAL B 1  56  ? -23.767 16.259  139.090 1.00 25.22  ? 154  VAL B N   1 
ATOM   5609  C  CA  . VAL B 1  56  ? -22.392 16.200  139.562 1.00 21.87  ? 154  VAL B CA  1 
ATOM   5610  C  C   . VAL B 1  56  ? -22.053 17.377  140.462 1.00 18.12  ? 154  VAL B C   1 
ATOM   5611  O  O   . VAL B 1  56  ? -22.187 18.533  140.065 1.00 19.29  ? 154  VAL B O   1 
ATOM   5612  C  CB  . VAL B 1  56  ? -21.392 16.180  138.389 1.00 25.19  ? 154  VAL B CB  1 
ATOM   5613  C  CG1 . VAL B 1  56  ? -19.977 15.965  138.903 1.00 21.37  ? 154  VAL B CG1 1 
ATOM   5614  C  CG2 . VAL B 1  56  ? -21.767 15.103  137.385 1.00 29.40  ? 154  VAL B CG2 1 
ATOM   5615  N  N   . PHE B 1  57  ? -21.613 17.073  141.676 1.00 18.87  ? 155  PHE B N   1 
ATOM   5616  C  CA  . PHE B 1  57  ? -21.065 18.090  142.561 1.00 19.73  ? 155  PHE B CA  1 
ATOM   5617  C  C   . PHE B 1  57  ? -19.583 17.816  142.777 1.00 21.95  ? 155  PHE B C   1 
ATOM   5618  O  O   . PHE B 1  57  ? -19.195 16.717  143.181 1.00 20.51  ? 155  PHE B O   1 
ATOM   5619  C  CB  . PHE B 1  57  ? -21.806 18.118  143.898 1.00 15.34  ? 155  PHE B CB  1 
ATOM   5620  C  CG  . PHE B 1  57  ? -21.227 19.088  144.888 1.00 17.54  ? 155  PHE B CG  1 
ATOM   5621  C  CD1 . PHE B 1  57  ? -21.555 20.432  144.833 1.00 15.79  ? 155  PHE B CD1 1 
ATOM   5622  C  CD2 . PHE B 1  57  ? -20.347 18.657  145.870 1.00 17.34  ? 155  PHE B CD2 1 
ATOM   5623  C  CE1 . PHE B 1  57  ? -21.022 21.328  145.738 1.00 14.08  ? 155  PHE B CE1 1 
ATOM   5624  C  CE2 . PHE B 1  57  ? -19.809 19.547  146.779 1.00 18.46  ? 155  PHE B CE2 1 
ATOM   5625  C  CZ  . PHE B 1  57  ? -20.147 20.885  146.713 1.00 20.39  ? 155  PHE B CZ  1 
ATOM   5626  N  N   . VAL B 1  58  ? -18.752 18.812  142.496 1.00 15.13  ? 156  VAL B N   1 
ATOM   5627  C  CA  . VAL B 1  58  ? -17.314 18.648  142.647 1.00 22.18  ? 156  VAL B CA  1 
ATOM   5628  C  C   . VAL B 1  58  ? -16.736 19.682  143.603 1.00 18.62  ? 156  VAL B C   1 
ATOM   5629  O  O   . VAL B 1  58  ? -16.843 20.885  143.368 1.00 14.26  ? 156  VAL B O   1 
ATOM   5630  C  CB  . VAL B 1  58  ? -16.582 18.760  141.295 1.00 19.25  ? 156  VAL B CB  1 
ATOM   5631  C  CG1 . VAL B 1  58  ? -15.113 18.428  141.471 1.00 20.61  ? 156  VAL B CG1 1 
ATOM   5632  C  CG2 . VAL B 1  58  ? -17.207 17.833  140.270 1.00 16.12  ? 156  VAL B CG2 1 
ATOM   5633  N  N   . SER B 1  59  ? -16.133 19.203  144.686 1.00 14.64  ? 157  SER B N   1 
ATOM   5634  C  CA  . SER B 1  59  ? -15.436 20.074  145.621 1.00 15.76  ? 157  SER B CA  1 
ATOM   5635  C  C   . SER B 1  59  ? -13.942 19.989  145.343 1.00 18.78  ? 157  SER B C   1 
ATOM   5636  O  O   . SER B 1  59  ? -13.343 18.916  145.429 1.00 16.72  ? 157  SER B O   1 
ATOM   5637  C  CB  . SER B 1  59  ? -15.744 19.687  147.070 1.00 17.48  ? 157  SER B CB  1 
ATOM   5638  O  OG  . SER B 1  59  ? -15.195 20.630  147.976 1.00 18.36  ? 157  SER B OG  1 
ATOM   5639  N  N   . ILE B 1  60  ? -13.347 21.128  145.005 1.00 21.30  ? 158  ILE B N   1 
ATOM   5640  C  CA  . ILE B 1  60  ? -11.966 21.163  144.546 1.00 18.69  ? 158  ILE B CA  1 
ATOM   5641  C  C   . ILE B 1  60  ? -11.081 21.953  145.498 1.00 18.68  ? 158  ILE B C   1 
ATOM   5642  O  O   . ILE B 1  60  ? -11.385 23.099  145.831 1.00 17.04  ? 158  ILE B O   1 
ATOM   5643  C  CB  . ILE B 1  60  ? -11.864 21.784  143.141 1.00 14.12  ? 158  ILE B CB  1 
ATOM   5644  C  CG1 . ILE B 1  60  ? -12.936 21.199  142.219 1.00 17.32  ? 158  ILE B CG1 1 
ATOM   5645  C  CG2 . ILE B 1  60  ? -10.469 21.582  142.568 1.00 14.48  ? 158  ILE B CG2 1 
ATOM   5646  C  CD1 . ILE B 1  60  ? -13.249 22.063  141.016 1.00 15.11  ? 158  ILE B CD1 1 
ATOM   5647  N  N   . ASP B 1  61  ? -9.987  21.335  145.935 1.00 23.33  ? 159  ASP B N   1 
ATOM   5648  C  CA  . ASP B 1  61  ? -9.000  22.020  146.763 1.00 25.34  ? 159  ASP B CA  1 
ATOM   5649  C  C   . ASP B 1  61  ? -8.315  23.119  145.960 1.00 20.38  ? 159  ASP B C   1 
ATOM   5650  O  O   . ASP B 1  61  ? -7.228  22.930  145.415 1.00 17.41  ? 159  ASP B O   1 
ATOM   5651  C  CB  . ASP B 1  61  ? -7.974  21.029  147.309 1.00 29.35  ? 159  ASP B CB  1 
ATOM   5652  C  CG  . ASP B 1  61  ? -8.577  20.067  148.312 1.00 35.95  ? 159  ASP B CG  1 
ATOM   5653  O  OD1 . ASP B 1  61  ? -9.458  20.495  149.090 1.00 37.11  ? 159  ASP B OD1 1 
ATOM   5654  O  OD2 . ASP B 1  61  ? -8.177  18.884  148.323 1.00 39.17  ? 159  ASP B OD2 1 
ATOM   5655  N  N   . ILE B 1  62  ? -8.968  24.272  145.897 1.00 18.57  ? 160  ILE B N   1 
ATOM   5656  C  CA  . ILE B 1  62  ? -8.503  25.378  145.078 1.00 16.58  ? 160  ILE B CA  1 
ATOM   5657  C  C   . ILE B 1  62  ? -9.067  26.672  145.650 1.00 14.89  ? 160  ILE B C   1 
ATOM   5658  O  O   . ILE B 1  62  ? -10.096 26.657  146.328 1.00 18.00  ? 160  ILE B O   1 
ATOM   5659  C  CB  . ILE B 1  62  ? -8.935  25.192  143.599 1.00 19.21  ? 160  ILE B CB  1 
ATOM   5660  C  CG1 . ILE B 1  62  ? -8.121  26.083  142.661 1.00 21.25  ? 160  ILE B CG1 1 
ATOM   5661  C  CG2 . ILE B 1  62  ? -10.432 25.428  143.430 1.00 14.33  ? 160  ILE B CG2 1 
ATOM   5662  C  CD1 . ILE B 1  62  ? -8.416  25.832  141.200 1.00 17.87  ? 160  ILE B CD1 1 
ATOM   5663  N  N   . GLY B 1  63  ? -8.389  27.786  145.403 1.00 17.40  ? 161  GLY B N   1 
ATOM   5664  C  CA  . GLY B 1  63  ? -8.827  29.059  145.945 1.00 15.80  ? 161  GLY B CA  1 
ATOM   5665  C  C   . GLY B 1  63  ? -10.148 29.482  145.340 1.00 20.10  ? 161  GLY B C   1 
ATOM   5666  O  O   . GLY B 1  63  ? -11.074 29.876  146.050 1.00 19.44  ? 161  GLY B O   1 
ATOM   5667  N  N   . MET B 1  64  ? -10.238 29.378  144.017 1.00 26.02  ? 162  MET B N   1 
ATOM   5668  C  CA  . MET B 1  64  ? -11.441 29.755  143.281 1.00 21.52  ? 162  MET B CA  1 
ATOM   5669  C  C   . MET B 1  64  ? -11.585 28.872  142.051 1.00 27.10  ? 162  MET B C   1 
ATOM   5670  O  O   . MET B 1  64  ? -10.590 28.439  141.471 1.00 34.62  ? 162  MET B O   1 
ATOM   5671  C  CB  . MET B 1  64  ? -11.403 31.220  142.835 1.00 20.60  ? 162  MET B CB  1 
ATOM   5672  C  CG  . MET B 1  64  ? -11.112 32.249  143.912 1.00 25.54  ? 162  MET B CG  1 
ATOM   5673  S  SD  . MET B 1  64  ? -9.352  32.590  144.085 1.00 34.25  ? 162  MET B SD  1 
ATOM   5674  C  CE  . MET B 1  64  ? -9.393  33.988  145.205 1.00 39.17  ? 162  MET B CE  1 
ATOM   5675  N  N   . VAL B 1  65  ? -12.821 28.604  141.650 1.00 25.82  ? 163  VAL B N   1 
ATOM   5676  C  CA  . VAL B 1  65  ? -13.068 28.009  140.345 1.00 24.19  ? 163  VAL B CA  1 
ATOM   5677  C  C   . VAL B 1  65  ? -13.235 29.135  139.333 1.00 24.42  ? 163  VAL B C   1 
ATOM   5678  O  O   . VAL B 1  65  ? -14.073 30.017  139.511 1.00 26.32  ? 163  VAL B O   1 
ATOM   5679  C  CB  . VAL B 1  65  ? -14.316 27.105  140.340 1.00 23.86  ? 163  VAL B CB  1 
ATOM   5680  C  CG1 . VAL B 1  65  ? -14.628 26.648  138.924 1.00 18.68  ? 163  VAL B CG1 1 
ATOM   5681  C  CG2 . VAL B 1  65  ? -14.110 25.908  141.258 1.00 15.15  ? 163  VAL B CG2 1 
ATOM   5682  N  N   . SER B 1  66  ? -12.428 29.109  138.280 1.00 23.29  ? 164  SER B N   1 
ATOM   5683  C  CA  . SER B 1  66  ? -12.446 30.178  137.294 1.00 22.83  ? 164  SER B CA  1 
ATOM   5684  C  C   . SER B 1  66  ? -13.309 29.824  136.090 1.00 28.54  ? 164  SER B C   1 
ATOM   5685  O  O   . SER B 1  66  ? -13.561 28.649  135.819 1.00 28.83  ? 164  SER B O   1 
ATOM   5686  C  CB  . SER B 1  66  ? -11.023 30.506  136.837 1.00 23.41  ? 164  SER B CB  1 
ATOM   5687  O  OG  . SER B 1  66  ? -10.465 29.439  136.091 1.00 26.05  ? 164  SER B OG  1 
ATOM   5688  N  N   . GLN B 1  67  ? -13.765 30.855  135.385 1.00 29.45  ? 165  GLN B N   1 
ATOM   5689  C  CA  . GLN B 1  67  ? -14.539 30.693  134.161 1.00 30.98  ? 165  GLN B CA  1 
ATOM   5690  C  C   . GLN B 1  67  ? -13.817 29.813  133.150 1.00 32.71  ? 165  GLN B C   1 
ATOM   5691  O  O   . GLN B 1  67  ? -14.404 28.897  132.574 1.00 35.28  ? 165  GLN B O   1 
ATOM   5692  C  CB  . GLN B 1  67  ? -14.835 32.061  133.540 1.00 36.92  ? 165  GLN B CB  1 
ATOM   5693  C  CG  . GLN B 1  67  ? -15.794 32.020  132.364 1.00 45.35  ? 165  GLN B CG  1 
ATOM   5694  C  CD  . GLN B 1  67  ? -17.243 31.965  132.796 1.00 52.07  ? 165  GLN B CD  1 
ATOM   5695  O  OE1 . GLN B 1  67  ? -17.755 30.905  133.159 1.00 52.85  ? 165  GLN B OE1 1 
ATOM   5696  N  NE2 . GLN B 1  67  ? -17.915 33.112  132.762 1.00 51.78  ? 165  GLN B NE2 1 
ATOM   5697  N  N   . ARG B 1  68  ? -12.537 30.104  132.943 1.00 29.09  ? 166  ARG B N   1 
ATOM   5698  C  CA  . ARG B 1  68  ? -11.722 29.386  131.973 1.00 28.16  ? 166  ARG B CA  1 
ATOM   5699  C  C   . ARG B 1  68  ? -11.581 27.917  132.364 1.00 26.55  ? 166  ARG B C   1 
ATOM   5700  O  O   . ARG B 1  68  ? -11.584 27.033  131.509 1.00 28.49  ? 166  ARG B O   1 
ATOM   5701  C  CB  . ARG B 1  68  ? -10.346 30.042  131.849 1.00 31.82  ? 166  ARG B CB  1 
ATOM   5702  C  CG  . ARG B 1  68  ? -9.446  29.438  130.785 1.00 36.63  ? 166  ARG B CG  1 
ATOM   5703  C  CD  . ARG B 1  68  ? -8.142  30.211  130.681 1.00 42.67  ? 166  ARG B CD  1 
ATOM   5704  N  NE  . ARG B 1  68  ? -7.374  29.848  129.494 1.00 50.27  ? 166  ARG B NE  1 
ATOM   5705  C  CZ  . ARG B 1  68  ? -7.555  30.393  128.295 1.00 53.17  ? 166  ARG B CZ  1 
ATOM   5706  N  NH1 . ARG B 1  68  ? -8.474  31.335  128.123 1.00 50.58  ? 166  ARG B NH1 1 
ATOM   5707  N  NH2 . ARG B 1  68  ? -6.812  30.006  127.267 1.00 55.08  ? 166  ARG B NH2 1 
ATOM   5708  N  N   . LEU B 1  69  ? -11.455 27.669  133.664 1.00 25.18  ? 167  LEU B N   1 
ATOM   5709  C  CA  . LEU B 1  69  ? -11.336 26.311  134.183 1.00 24.24  ? 167  LEU B CA  1 
ATOM   5710  C  C   . LEU B 1  69  ? -12.603 25.502  133.928 1.00 26.99  ? 167  LEU B C   1 
ATOM   5711  O  O   . LEU B 1  69  ? -12.542 24.374  133.444 1.00 26.85  ? 167  LEU B O   1 
ATOM   5712  C  CB  . LEU B 1  69  ? -11.025 26.339  135.682 1.00 20.70  ? 167  LEU B CB  1 
ATOM   5713  C  CG  . LEU B 1  69  ? -10.609 25.017  136.328 1.00 20.27  ? 167  LEU B CG  1 
ATOM   5714  C  CD1 . LEU B 1  69  ? -9.235  24.600  135.840 1.00 21.35  ? 167  LEU B CD1 1 
ATOM   5715  C  CD2 . LEU B 1  69  ? -10.622 25.136  137.843 1.00 17.17  ? 167  LEU B CD2 1 
ATOM   5716  N  N   . ARG B 1  70  ? -13.749 26.090  134.255 1.00 30.49  ? 168  ARG B N   1 
ATOM   5717  C  CA  . ARG B 1  70  ? -15.037 25.420  134.096 1.00 27.59  ? 168  ARG B CA  1 
ATOM   5718  C  C   . ARG B 1  70  ? -15.351 25.099  132.639 1.00 28.85  ? 168  ARG B C   1 
ATOM   5719  O  O   . ARG B 1  70  ? -15.805 23.998  132.323 1.00 27.96  ? 168  ARG B O   1 
ATOM   5720  C  CB  . ARG B 1  70  ? -16.160 26.276  134.679 1.00 24.74  ? 168  ARG B CB  1 
ATOM   5721  C  CG  . ARG B 1  70  ? -17.553 25.806  134.286 1.00 25.79  ? 168  ARG B CG  1 
ATOM   5722  C  CD  . ARG B 1  70  ? -18.628 26.492  135.099 1.00 24.13  ? 168  ARG B CD  1 
ATOM   5723  N  NE  . ARG B 1  70  ? -19.965 26.225  134.579 1.00 29.24  ? 168  ARG B NE  1 
ATOM   5724  C  CZ  . ARG B 1  70  ? -20.758 25.247  135.006 1.00 26.44  ? 168  ARG B CZ  1 
ATOM   5725  N  NH1 . ARG B 1  70  ? -20.356 24.430  135.970 1.00 19.71  ? 168  ARG B NH1 1 
ATOM   5726  N  NH2 . ARG B 1  70  ? -21.956 25.087  134.466 1.00 28.72  ? 168  ARG B NH2 1 
ATOM   5727  N  N   . LEU B 1  71  ? -15.100 26.060  131.755 1.00 29.36  ? 169  LEU B N   1 
ATOM   5728  C  CA  . LEU B 1  71  ? -15.416 25.896  130.342 1.00 30.06  ? 169  LEU B CA  1 
ATOM   5729  C  C   . LEU B 1  71  ? -14.563 24.794  129.729 1.00 30.10  ? 169  LEU B C   1 
ATOM   5730  O  O   . LEU B 1  71  ? -15.046 23.994  128.928 1.00 30.92  ? 169  LEU B O   1 
ATOM   5731  C  CB  . LEU B 1  71  ? -15.218 27.211  129.589 1.00 33.48  ? 169  LEU B CB  1 
ATOM   5732  C  CG  . LEU B 1  71  ? -16.216 28.318  129.943 1.00 37.74  ? 169  LEU B CG  1 
ATOM   5733  C  CD1 . LEU B 1  71  ? -15.924 29.590  129.161 1.00 39.62  ? 169  LEU B CD1 1 
ATOM   5734  C  CD2 . LEU B 1  71  ? -17.644 27.848  129.703 1.00 37.16  ? 169  LEU B CD2 1 
ATOM   5735  N  N   . GLU B 1  72  ? -13.293 24.760  130.114 1.00 30.49  ? 170  GLU B N   1 
ATOM   5736  C  CA  . GLU B 1  72  ? -12.382 23.721  129.660 1.00 29.40  ? 170  GLU B CA  1 
ATOM   5737  C  C   . GLU B 1  72  ? -12.840 22.342  130.127 1.00 27.44  ? 170  GLU B C   1 
ATOM   5738  O  O   . GLU B 1  72  ? -12.905 21.401  129.337 1.00 28.86  ? 170  GLU B O   1 
ATOM   5739  C  CB  . GLU B 1  72  ? -10.964 24.005  130.156 1.00 29.68  ? 170  GLU B CB  1 
ATOM   5740  C  CG  . GLU B 1  72  ? -9.909  23.102  129.550 1.00 32.86  ? 170  GLU B CG  1 
ATOM   5741  C  CD  . GLU B 1  72  ? -9.884  23.173  128.038 1.00 41.31  ? 170  GLU B CD  1 
ATOM   5742  O  OE1 . GLU B 1  72  ? -10.092 24.276  127.487 1.00 43.94  ? 170  GLU B OE1 1 
ATOM   5743  O  OE2 . GLU B 1  72  ? -9.657  22.124  127.399 1.00 46.35  ? 170  GLU B OE2 1 
ATOM   5744  N  N   . VAL B 1  73  ? -13.155 22.231  131.414 1.00 22.72  ? 171  VAL B N   1 
ATOM   5745  C  CA  . VAL B 1  73  ? -13.652 20.982  131.983 1.00 23.43  ? 171  VAL B CA  1 
ATOM   5746  C  C   . VAL B 1  73  ? -14.933 20.502  131.300 1.00 27.00  ? 171  VAL B C   1 
ATOM   5747  O  O   . VAL B 1  73  ? -15.044 19.336  130.920 1.00 27.32  ? 171  VAL B O   1 
ATOM   5748  C  CB  . VAL B 1  73  ? -13.916 21.124  133.497 1.00 19.73  ? 171  VAL B CB  1 
ATOM   5749  C  CG1 . VAL B 1  73  ? -14.687 19.923  134.020 1.00 19.43  ? 171  VAL B CG1 1 
ATOM   5750  C  CG2 . VAL B 1  73  ? -12.608 21.285  134.249 1.00 23.63  ? 171  VAL B CG2 1 
ATOM   5751  N  N   . LEU B 1  74  ? -15.889 21.410  131.132 1.00 28.76  ? 172  LEU B N   1 
ATOM   5752  C  CA  . LEU B 1  74  ? -17.175 21.068  130.531 1.00 27.77  ? 172  LEU B CA  1 
ATOM   5753  C  C   . LEU B 1  74  ? -17.032 20.632  129.076 1.00 31.70  ? 172  LEU B C   1 
ATOM   5754  O  O   . LEU B 1  74  ? -17.751 19.747  128.609 1.00 28.89  ? 172  LEU B O   1 
ATOM   5755  C  CB  . LEU B 1  74  ? -18.137 22.253  130.622 1.00 24.87  ? 172  LEU B CB  1 
ATOM   5756  C  CG  . LEU B 1  74  ? -18.706 22.561  132.008 1.00 22.68  ? 172  LEU B CG  1 
ATOM   5757  C  CD1 . LEU B 1  74  ? -19.496 23.855  131.977 1.00 25.58  ? 172  LEU B CD1 1 
ATOM   5758  C  CD2 . LEU B 1  74  ? -19.566 21.413  132.511 1.00 21.45  ? 172  LEU B CD2 1 
ATOM   5759  N  N   . ASN B 1  75  ? -16.097 21.256  128.366 1.00 35.05  ? 173  ASN B N   1 
ATOM   5760  C  CA  . ASN B 1  75  ? -15.843 20.929  126.968 1.00 37.48  ? 173  ASN B CA  1 
ATOM   5761  C  C   . ASN B 1  75  ? -15.315 19.505  126.822 1.00 38.35  ? 173  ASN B C   1 
ATOM   5762  O  O   . ASN B 1  75  ? -15.744 18.759  125.941 1.00 40.00  ? 173  ASN B O   1 
ATOM   5763  C  CB  . ASN B 1  75  ? -14.853 21.928  126.363 1.00 41.65  ? 173  ASN B CB  1 
ATOM   5764  C  CG  . ASN B 1  75  ? -14.858 21.917  124.845 1.00 49.17  ? 173  ASN B CG  1 
ATOM   5765  O  OD1 . ASN B 1  75  ? -15.167 20.906  124.216 1.00 52.37  ? 173  ASN B OD1 1 
ATOM   5766  N  ND2 . ASN B 1  75  ? -14.510 23.051  124.249 1.00 52.48  ? 173  ASN B ND2 1 
ATOM   5767  N  N   . ARG B 1  76  ? -14.384 19.135  127.695 1.00 36.88  ? 174  ARG B N   1 
ATOM   5768  C  CA  . ARG B 1  76  ? -13.775 17.811  127.659 1.00 35.53  ? 174  ARG B CA  1 
ATOM   5769  C  C   . ARG B 1  76  ? -14.746 16.741  128.146 1.00 30.09  ? 174  ARG B C   1 
ATOM   5770  O  O   . ARG B 1  76  ? -14.699 15.598  127.693 1.00 31.24  ? 174  ARG B O   1 
ATOM   5771  C  CB  . ARG B 1  76  ? -12.493 17.796  128.492 1.00 39.77  ? 174  ARG B CB  1 
ATOM   5772  C  CG  . ARG B 1  76  ? -11.464 18.811  128.024 1.00 42.43  ? 174  ARG B CG  1 
ATOM   5773  C  CD  . ARG B 1  76  ? -10.137 18.661  128.742 1.00 43.16  ? 174  ARG B CD  1 
ATOM   5774  N  NE  . ARG B 1  76  ? -9.590  17.313  128.636 1.00 46.48  ? 174  ARG B NE  1 
ATOM   5775  C  CZ  . ARG B 1  76  ? -8.387  16.966  129.078 1.00 48.50  ? 174  ARG B CZ  1 
ATOM   5776  N  NH1 . ARG B 1  76  ? -7.606  17.872  129.650 1.00 44.49  ? 174  ARG B NH1 1 
ATOM   5777  N  NH2 . ARG B 1  76  ? -7.960  15.717  128.946 1.00 53.00  ? 174  ARG B NH2 1 
ATOM   5778  N  N   . LEU B 1  77  ? -15.625 17.116  129.071 1.00 29.24  ? 175  LEU B N   1 
ATOM   5779  C  CA  . LEU B 1  77  ? -16.693 16.225  129.512 1.00 27.72  ? 175  LEU B CA  1 
ATOM   5780  C  C   . LEU B 1  77  ? -17.621 15.895  128.353 1.00 31.98  ? 175  LEU B C   1 
ATOM   5781  O  O   . LEU B 1  77  ? -18.049 14.751  128.193 1.00 37.06  ? 175  LEU B O   1 
ATOM   5782  C  CB  . LEU B 1  77  ? -17.489 16.848  130.659 1.00 22.42  ? 175  LEU B CB  1 
ATOM   5783  C  CG  . LEU B 1  77  ? -16.840 16.844  132.043 1.00 22.64  ? 175  LEU B CG  1 
ATOM   5784  C  CD1 . LEU B 1  77  ? -17.735 17.558  133.045 1.00 20.55  ? 175  LEU B CD1 1 
ATOM   5785  C  CD2 . LEU B 1  77  ? -16.549 15.422  132.495 1.00 21.36  ? 175  LEU B CD2 1 
ATOM   5786  N  N   . GLN B 1  78  ? -17.923 16.906  127.544 1.00 32.78  ? 176  GLN B N   1 
ATOM   5787  C  CA  . GLN B 1  78  ? -18.778 16.733  126.376 1.00 36.58  ? 176  GLN B CA  1 
ATOM   5788  C  C   . GLN B 1  78  ? -18.127 15.799  125.363 1.00 36.66  ? 176  GLN B C   1 
ATOM   5789  O  O   . GLN B 1  78  ? -18.783 14.928  124.797 1.00 35.66  ? 176  GLN B O   1 
ATOM   5790  C  CB  . GLN B 1  78  ? -19.082 18.086  125.730 1.00 39.75  ? 176  GLN B CB  1 
ATOM   5791  C  CG  . GLN B 1  78  ? -20.082 18.016  124.588 1.00 44.84  ? 176  GLN B CG  1 
ATOM   5792  C  CD  . GLN B 1  78  ? -20.194 19.323  123.833 1.00 49.44  ? 176  GLN B CD  1 
ATOM   5793  O  OE1 . GLN B 1  78  ? -19.217 20.060  123.696 1.00 54.23  ? 176  GLN B OE1 1 
ATOM   5794  N  NE2 . GLN B 1  78  ? -21.393 19.626  123.348 1.00 47.92  ? 176  GLN B NE2 1 
ATOM   5795  N  N   . SER B 1  79  ? -16.835 15.999  125.129 1.00 37.02  ? 177  SER B N   1 
ATOM   5796  C  CA  . SER B 1  79  ? -16.077 15.152  124.218 1.00 40.10  ? 177  SER B CA  1 
ATOM   5797  C  C   . SER B 1  79  ? -16.153 13.677  124.607 1.00 40.48  ? 177  SER B C   1 
ATOM   5798  O  O   . SER B 1  79  ? -16.305 12.808  123.750 1.00 44.66  ? 177  SER B O   1 
ATOM   5799  C  CB  . SER B 1  79  ? -14.617 15.601  124.164 1.00 43.03  ? 177  SER B CB  1 
ATOM   5800  O  OG  . SER B 1  79  ? -14.513 16.916  123.650 1.00 48.14  ? 177  SER B OG  1 
ATOM   5801  N  N   . LYS B 1  80  ? -16.054 13.404  125.905 1.00 37.83  ? 178  LYS B N   1 
ATOM   5802  C  CA  . LYS B 1  80  ? -15.996 12.031  126.396 1.00 36.97  ? 178  LYS B CA  1 
ATOM   5803  C  C   . LYS B 1  80  ? -17.367 11.442  126.738 1.00 36.78  ? 178  LYS B C   1 
ATOM   5804  O  O   . LYS B 1  80  ? -17.596 10.249  126.541 1.00 38.64  ? 178  LYS B O   1 
ATOM   5805  C  CB  . LYS B 1  80  ? -15.082 11.957  127.623 1.00 35.76  ? 178  LYS B CB  1 
ATOM   5806  C  CG  . LYS B 1  80  ? -14.887 10.556  128.175 1.00 39.76  ? 178  LYS B CG  1 
ATOM   5807  C  CD  . LYS B 1  80  ? -13.730 10.508  129.161 1.00 41.40  ? 178  LYS B CD  1 
ATOM   5808  C  CE  . LYS B 1  80  ? -13.254 9.080   129.377 1.00 42.75  ? 178  LYS B CE  1 
ATOM   5809  N  NZ  . LYS B 1  80  ? -11.977 9.026   130.135 1.00 41.51  ? 178  LYS B NZ  1 
ATOM   5810  N  N   . TYR B 1  81  ? -18.277 12.272  127.239 1.00 34.45  ? 179  TYR B N   1 
ATOM   5811  C  CA  . TYR B 1  81  ? -19.558 11.773  127.743 1.00 32.38  ? 179  TYR B CA  1 
ATOM   5812  C  C   . TYR B 1  81  ? -20.763 12.297  126.964 1.00 35.11  ? 179  TYR B C   1 
ATOM   5813  O  O   . TYR B 1  81  ? -21.894 11.873  127.204 1.00 38.81  ? 179  TYR B O   1 
ATOM   5814  C  CB  . TYR B 1  81  ? -19.720 12.126  129.223 1.00 31.90  ? 179  TYR B CB  1 
ATOM   5815  C  CG  . TYR B 1  81  ? -18.698 11.476  130.128 1.00 32.49  ? 179  TYR B CG  1 
ATOM   5816  C  CD1 . TYR B 1  81  ? -18.787 10.128  130.451 1.00 30.24  ? 179  TYR B CD1 1 
ATOM   5817  C  CD2 . TYR B 1  81  ? -17.647 12.211  130.664 1.00 31.48  ? 179  TYR B CD2 1 
ATOM   5818  C  CE1 . TYR B 1  81  ? -17.857 9.529   131.279 1.00 31.01  ? 179  TYR B CE1 1 
ATOM   5819  C  CE2 . TYR B 1  81  ? -16.712 11.621  131.493 1.00 27.78  ? 179  TYR B CE2 1 
ATOM   5820  C  CZ  . TYR B 1  81  ? -16.821 10.280  131.798 1.00 30.09  ? 179  TYR B CZ  1 
ATOM   5821  O  OH  . TYR B 1  81  ? -15.894 9.688   132.623 1.00 30.98  ? 179  TYR B OH  1 
ATOM   5822  N  N   . GLY B 1  82  ? -20.522 13.213  126.032 1.00 32.55  ? 180  GLY B N   1 
ATOM   5823  C  CA  . GLY B 1  82  ? -21.591 13.784  125.234 1.00 31.68  ? 180  GLY B CA  1 
ATOM   5824  C  C   . GLY B 1  82  ? -22.509 14.690  126.032 1.00 33.92  ? 180  GLY B C   1 
ATOM   5825  O  O   . GLY B 1  82  ? -22.074 15.698  126.589 1.00 31.17  ? 180  GLY B O   1 
ATOM   5826  N  N   . SER B 1  83  ? -23.787 14.330  126.080 1.00 34.96  ? 181  SER B N   1 
ATOM   5827  C  CA  . SER B 1  83  ? -24.798 15.142  126.748 1.00 31.70  ? 181  SER B CA  1 
ATOM   5828  C  C   . SER B 1  83  ? -25.035 14.690  128.185 1.00 30.67  ? 181  SER B C   1 
ATOM   5829  O  O   . SER B 1  83  ? -25.916 15.209  128.866 1.00 34.20  ? 181  SER B O   1 
ATOM   5830  C  CB  . SER B 1  83  ? -26.114 15.104  125.967 1.00 36.46  ? 181  SER B CB  1 
ATOM   5831  O  OG  . SER B 1  83  ? -26.609 13.781  125.865 1.00 39.63  ? 181  SER B OG  1 
ATOM   5832  N  N   . LEU B 1  84  ? -24.256 13.711  128.636 1.00 28.24  ? 182  LEU B N   1 
ATOM   5833  C  CA  . LEU B 1  84  ? -24.445 13.127  129.960 1.00 29.28  ? 182  LEU B CA  1 
ATOM   5834  C  C   . LEU B 1  84  ? -24.210 14.141  131.081 1.00 29.72  ? 182  LEU B C   1 
ATOM   5835  O  O   . LEU B 1  84  ? -25.033 14.278  131.986 1.00 33.83  ? 182  LEU B O   1 
ATOM   5836  C  CB  . LEU B 1  84  ? -23.520 11.924  130.139 1.00 31.88  ? 182  LEU B CB  1 
ATOM   5837  C  CG  . LEU B 1  84  ? -23.821 11.024  131.337 1.00 32.56  ? 182  LEU B CG  1 
ATOM   5838  C  CD1 . LEU B 1  84  ? -25.266 10.555  131.291 1.00 31.44  ? 182  LEU B CD1 1 
ATOM   5839  C  CD2 . LEU B 1  84  ? -22.872 9.838   131.364 1.00 31.71  ? 182  LEU B CD2 1 
ATOM   5840  N  N   . TYR B 1  85  ? -23.087 14.848  131.016 1.00 28.96  ? 183  TYR B N   1 
ATOM   5841  C  CA  . TYR B 1  85  ? -22.747 15.842  132.029 1.00 29.27  ? 183  TYR B CA  1 
ATOM   5842  C  C   . TYR B 1  85  ? -22.599 17.209  131.378 1.00 28.99  ? 183  TYR B C   1 
ATOM   5843  O  O   . TYR B 1  85  ? -21.635 17.463  130.657 1.00 29.92  ? 183  TYR B O   1 
ATOM   5844  C  CB  . TYR B 1  85  ? -21.466 15.456  132.768 1.00 29.82  ? 183  TYR B CB  1 
ATOM   5845  C  CG  . TYR B 1  85  ? -21.489 14.049  133.320 1.00 31.03  ? 183  TYR B CG  1 
ATOM   5846  C  CD1 . TYR B 1  85  ? -22.432 13.673  134.265 1.00 29.57  ? 183  TYR B CD1 1 
ATOM   5847  C  CD2 . TYR B 1  85  ? -20.570 13.098  132.895 1.00 31.08  ? 183  TYR B CD2 1 
ATOM   5848  C  CE1 . TYR B 1  85  ? -22.461 12.391  134.775 1.00 28.22  ? 183  TYR B CE1 1 
ATOM   5849  C  CE2 . TYR B 1  85  ? -20.591 11.810  133.400 1.00 28.42  ? 183  TYR B CE2 1 
ATOM   5850  C  CZ  . TYR B 1  85  ? -21.539 11.463  134.339 1.00 27.45  ? 183  TYR B CZ  1 
ATOM   5851  O  OH  . TYR B 1  85  ? -21.568 10.184  134.847 1.00 26.51  ? 183  TYR B OH  1 
ATOM   5852  N  N   . ARG B 1  86  ? -23.558 18.089  131.648 1.00 27.83  ? 184  ARG B N   1 
ATOM   5853  C  CA  . ARG B 1  86  ? -23.647 19.369  130.958 1.00 28.29  ? 184  ARG B CA  1 
ATOM   5854  C  C   . ARG B 1  86  ? -23.380 20.540  131.895 1.00 30.46  ? 184  ARG B C   1 
ATOM   5855  O  O   . ARG B 1  86  ? -23.080 20.352  133.075 1.00 33.83  ? 184  ARG B O   1 
ATOM   5856  C  CB  . ARG B 1  86  ? -25.030 19.518  130.324 1.00 31.30  ? 184  ARG B CB  1 
ATOM   5857  C  CG  . ARG B 1  86  ? -25.484 18.291  129.552 1.00 30.25  ? 184  ARG B CG  1 
ATOM   5858  C  CD  . ARG B 1  86  ? -26.982 18.317  129.279 1.00 29.22  ? 184  ARG B CD  1 
ATOM   5859  N  NE  . ARG B 1  86  ? -27.764 18.327  130.513 1.00 27.23  ? 184  ARG B NE  1 
ATOM   5860  C  CZ  . ARG B 1  86  ? -28.081 17.238  131.208 1.00 28.75  ? 184  ARG B CZ  1 
ATOM   5861  N  NH1 . ARG B 1  86  ? -27.681 16.045  130.791 1.00 24.55  ? 184  ARG B NH1 1 
ATOM   5862  N  NH2 . ARG B 1  86  ? -28.796 17.342  132.321 1.00 26.89  ? 184  ARG B NH2 1 
ATOM   5863  N  N   . ARG B 1  87  ? -23.496 21.753  131.365 1.00 26.30  ? 185  ARG B N   1 
ATOM   5864  C  CA  . ARG B 1  87  ? -23.301 22.961  132.158 1.00 26.23  ? 185  ARG B CA  1 
ATOM   5865  C  C   . ARG B 1  87  ? -24.351 23.111  133.258 1.00 27.54  ? 185  ARG B C   1 
ATOM   5866  O  O   . ARG B 1  87  ? -24.107 23.779  134.262 1.00 29.24  ? 185  ARG B O   1 
ATOM   5867  C  CB  . ARG B 1  87  ? -23.309 24.199  131.255 1.00 28.56  ? 185  ARG B CB  1 
ATOM   5868  C  CG  . ARG B 1  87  ? -24.671 24.549  130.679 1.00 31.66  ? 185  ARG B CG  1 
ATOM   5869  C  CD  . ARG B 1  87  ? -24.618 25.850  129.897 1.00 36.14  ? 185  ARG B CD  1 
ATOM   5870  N  NE  . ARG B 1  87  ? -25.613 25.885  128.831 1.00 43.03  ? 185  ARG B NE  1 
ATOM   5871  C  CZ  . ARG B 1  87  ? -25.390 25.456  127.592 1.00 52.17  ? 185  ARG B CZ  1 
ATOM   5872  N  NH1 . ARG B 1  87  ? -24.205 24.959  127.264 1.00 51.31  ? 185  ARG B NH1 1 
ATOM   5873  N  NH2 . ARG B 1  87  ? -26.352 25.525  126.681 1.00 57.45  ? 185  ARG B NH2 1 
ATOM   5874  N  N   . ASP B 1  88  ? -25.512 22.488  133.071 1.00 25.75  ? 186  ASP B N   1 
ATOM   5875  C  CA  . ASP B 1  88  ? -26.626 22.680  133.995 1.00 27.24  ? 186  ASP B CA  1 
ATOM   5876  C  C   . ASP B 1  88  ? -26.609 21.702  135.172 1.00 26.27  ? 186  ASP B C   1 
ATOM   5877  O  O   . ASP B 1  88  ? -27.073 22.033  136.264 1.00 27.74  ? 186  ASP B O   1 
ATOM   5878  C  CB  . ASP B 1  88  ? -27.964 22.576  133.252 1.00 29.22  ? 186  ASP B CB  1 
ATOM   5879  C  CG  . ASP B 1  88  ? -28.171 21.224  132.596 1.00 33.10  ? 186  ASP B CG  1 
ATOM   5880  O  OD1 . ASP B 1  88  ? -27.613 21.002  131.500 1.00 39.90  ? 186  ASP B OD1 1 
ATOM   5881  O  OD2 . ASP B 1  88  ? -28.900 20.386  133.169 1.00 26.77  ? 186  ASP B OD2 1 
ATOM   5882  N  N   . ASN B 1  89  ? -26.077 20.503  134.959 1.00 24.05  ? 187  ASN B N   1 
ATOM   5883  C  CA  . ASN B 1  89  ? -26.080 19.488  136.008 1.00 23.39  ? 187  ASN B CA  1 
ATOM   5884  C  C   . ASN B 1  89  ? -24.691 19.216  136.584 1.00 25.33  ? 187  ASN B C   1 
ATOM   5885  O  O   . ASN B 1  89  ? -24.472 18.190  137.226 1.00 25.53  ? 187  ASN B O   1 
ATOM   5886  C  CB  . ASN B 1  89  ? -26.683 18.185  135.480 1.00 20.75  ? 187  ASN B CB  1 
ATOM   5887  C  CG  . ASN B 1  89  ? -25.868 17.576  134.357 1.00 23.74  ? 187  ASN B CG  1 
ATOM   5888  O  OD1 . ASN B 1  89  ? -25.242 18.288  133.572 1.00 25.99  ? 187  ASN B OD1 1 
ATOM   5889  N  ND2 . ASN B 1  89  ? -25.873 16.252  134.273 1.00 21.63  ? 187  ASN B ND2 1 
ATOM   5890  N  N   . VAL B 1  90  ? -23.756 20.133  136.352 1.00 26.31  ? 188  VAL B N   1 
ATOM   5891  C  CA  . VAL B 1  90  ? -22.417 20.021  136.924 1.00 22.31  ? 188  VAL B CA  1 
ATOM   5892  C  C   . VAL B 1  90  ? -22.023 21.278  137.694 1.00 21.59  ? 188  VAL B C   1 
ATOM   5893  O  O   . VAL B 1  90  ? -21.960 22.368  137.125 1.00 21.89  ? 188  VAL B O   1 
ATOM   5894  C  CB  . VAL B 1  90  ? -21.352 19.748  135.841 1.00 22.60  ? 188  VAL B CB  1 
ATOM   5895  C  CG1 . VAL B 1  90  ? -19.957 19.760  136.454 1.00 18.92  ? 188  VAL B CG1 1 
ATOM   5896  C  CG2 . VAL B 1  90  ? -21.622 18.423  135.145 1.00 23.44  ? 188  VAL B CG2 1 
ATOM   5897  N  N   . ILE B 1  91  ? -21.762 21.116  138.988 1.00 20.84  ? 189  ILE B N   1 
ATOM   5898  C  CA  . ILE B 1  91  ? -21.271 22.213  139.819 1.00 20.18  ? 189  ILE B CA  1 
ATOM   5899  C  C   . ILE B 1  91  ? -19.804 22.011  140.181 1.00 24.62  ? 189  ILE B C   1 
ATOM   5900  O  O   . ILE B 1  91  ? -19.429 20.972  140.725 1.00 26.98  ? 189  ILE B O   1 
ATOM   5901  C  CB  . ILE B 1  91  ? -22.088 22.358  141.120 1.00 20.75  ? 189  ILE B CB  1 
ATOM   5902  C  CG1 . ILE B 1  91  ? -23.528 22.770  140.811 1.00 20.23  ? 189  ILE B CG1 1 
ATOM   5903  C  CG2 . ILE B 1  91  ? -21.442 23.376  142.047 1.00 16.08  ? 189  ILE B CG2 1 
ATOM   5904  C  CD1 . ILE B 1  91  ? -24.444 22.714  142.011 1.00 19.71  ? 189  ILE B CD1 1 
ATOM   5905  N  N   . LEU B 1  92  ? -18.977 23.006  139.875 1.00 25.55  ? 190  LEU B N   1 
ATOM   5906  C  CA  . LEU B 1  92  ? -17.569 22.981  140.259 1.00 18.35  ? 190  LEU B CA  1 
ATOM   5907  C  C   . LEU B 1  92  ? -17.310 23.989  141.374 1.00 16.81  ? 190  LEU B C   1 
ATOM   5908  O  O   . LEU B 1  92  ? -17.382 25.198  141.153 1.00 16.63  ? 190  LEU B O   1 
ATOM   5909  C  CB  . LEU B 1  92  ? -16.676 23.283  139.055 1.00 18.56  ? 190  LEU B CB  1 
ATOM   5910  C  CG  . LEU B 1  92  ? -16.854 22.398  137.820 1.00 18.80  ? 190  LEU B CG  1 
ATOM   5911  C  CD1 . LEU B 1  92  ? -15.893 22.821  136.718 1.00 19.46  ? 190  LEU B CD1 1 
ATOM   5912  C  CD2 . LEU B 1  92  ? -16.652 20.935  138.181 1.00 16.78  ? 190  LEU B CD2 1 
ATOM   5913  N  N   . SER B 1  93  ? -17.006 23.489  142.568 1.00 14.53  ? 191  SER B N   1 
ATOM   5914  C  CA  . SER B 1  93  ? -16.855 24.352  143.737 1.00 15.49  ? 191  SER B CA  1 
ATOM   5915  C  C   . SER B 1  93  ? -15.449 24.301  144.333 1.00 16.91  ? 191  SER B C   1 
ATOM   5916  O  O   . SER B 1  93  ? -14.871 23.229  144.500 1.00 18.48  ? 191  SER B O   1 
ATOM   5917  C  CB  . SER B 1  93  ? -17.880 23.973  144.806 1.00 16.25  ? 191  SER B CB  1 
ATOM   5918  O  OG  . SER B 1  93  ? -17.695 24.736  145.986 1.00 18.77  ? 191  SER B OG  1 
ATOM   5919  N  N   . GLY B 1  94  ? -14.909 25.472  144.656 1.00 17.47  ? 192  GLY B N   1 
ATOM   5920  C  CA  . GLY B 1  94  ? -13.602 25.573  145.280 1.00 19.10  ? 192  GLY B CA  1 
ATOM   5921  C  C   . GLY B 1  94  ? -13.690 25.661  146.792 1.00 21.95  ? 192  GLY B C   1 
ATOM   5922  O  O   . GLY B 1  94  ? -14.546 26.361  147.329 1.00 23.18  ? 192  GLY B O   1 
ATOM   5923  N  N   . THR B 1  95  ? -12.798 24.954  147.480 1.00 16.30  ? 193  THR B N   1 
ATOM   5924  C  CA  . THR B 1  95  ? -12.775 24.959  148.939 1.00 15.73  ? 193  THR B CA  1 
ATOM   5925  C  C   . THR B 1  95  ? -12.325 26.304  149.503 1.00 18.79  ? 193  THR B C   1 
ATOM   5926  O  O   . THR B 1  95  ? -12.582 26.599  150.670 1.00 20.01  ? 193  THR B O   1 
ATOM   5927  C  CB  . THR B 1  95  ? -11.846 23.866  149.494 1.00 15.38  ? 193  THR B CB  1 
ATOM   5928  O  OG1 . THR B 1  95  ? -10.510 24.086  149.021 1.00 20.59  ? 193  THR B OG1 1 
ATOM   5929  C  CG2 . THR B 1  95  ? -12.318 22.492  149.052 1.00 22.38  ? 193  THR B CG2 1 
ATOM   5930  N  N   . HIS B 1  96  ? -11.627 27.080  148.672 1.00 17.18  ? 194  HIS B N   1 
ATOM   5931  C  CA  . HIS B 1  96  ? -11.136 28.428  148.988 1.00 21.89  ? 194  HIS B CA  1 
ATOM   5932  C  C   . HIS B 1  96  ? -9.872  28.412  149.845 1.00 17.44  ? 194  HIS B C   1 
ATOM   5933  O  O   . HIS B 1  96  ? -9.611  29.354  150.593 1.00 25.23  ? 194  HIS B O   1 
ATOM   5934  C  CB  . HIS B 1  96  ? -12.214 29.271  149.678 1.00 17.28  ? 194  HIS B CB  1 
ATOM   5935  C  CG  . HIS B 1  96  ? -11.997 30.746  149.555 1.00 19.84  ? 194  HIS B CG  1 
ATOM   5936  N  ND1 . HIS B 1  96  ? -11.491 31.331  148.415 1.00 18.95  ? 194  HIS B ND1 1 
ATOM   5937  C  CD2 . HIS B 1  96  ? -12.216 31.756  150.430 1.00 18.45  ? 194  HIS B CD2 1 
ATOM   5938  C  CE1 . HIS B 1  96  ? -11.409 32.638  148.592 1.00 19.59  ? 194  HIS B CE1 1 
ATOM   5939  N  NE2 . HIS B 1  96  ? -11.842 32.922  149.806 1.00 19.15  ? 194  HIS B NE2 1 
ATOM   5940  N  N   . THR B 1  97  ? -9.089  27.344  149.740 1.00 17.26  ? 195  THR B N   1 
ATOM   5941  C  CA  . THR B 1  97  ? -7.770  27.324  150.361 1.00 21.28  ? 195  THR B CA  1 
ATOM   5942  C  C   . THR B 1  97  ? -6.911  28.429  149.762 1.00 24.54  ? 195  THR B C   1 
ATOM   5943  O  O   . THR B 1  97  ? -6.944  28.668  148.556 1.00 28.31  ? 195  THR B O   1 
ATOM   5944  C  CB  . THR B 1  97  ? -7.061  25.965  150.186 1.00 21.56  ? 195  THR B CB  1 
ATOM   5945  O  OG1 . THR B 1  97  ? -5.705  26.076  150.636 1.00 17.51  ? 195  THR B OG1 1 
ATOM   5946  C  CG2 . THR B 1  97  ? -7.069  25.533  148.726 1.00 19.94  ? 195  THR B CG2 1 
ATOM   5947  N  N   . HIS B 1  98  ? -6.157  29.115  150.612 1.00 20.00  ? 196  HIS B N   1 
ATOM   5948  C  CA  . HIS B 1  98  ? -5.299  30.199  150.153 1.00 21.01  ? 196  HIS B CA  1 
ATOM   5949  C  C   . HIS B 1  98  ? -3.858  29.735  149.977 1.00 23.07  ? 196  HIS B C   1 
ATOM   5950  O  O   . HIS B 1  98  ? -2.935  30.550  149.952 1.00 20.67  ? 196  HIS B O   1 
ATOM   5951  C  CB  . HIS B 1  98  ? -5.357  31.374  151.128 1.00 19.77  ? 196  HIS B CB  1 
ATOM   5952  C  CG  . HIS B 1  98  ? -6.618  32.174  151.031 1.00 20.48  ? 196  HIS B CG  1 
ATOM   5953  N  ND1 . HIS B 1  98  ? -7.871  31.599  151.072 1.00 20.66  ? 196  HIS B ND1 1 
ATOM   5954  C  CD2 . HIS B 1  98  ? -6.821  33.506  150.900 1.00 21.49  ? 196  HIS B CD2 1 
ATOM   5955  C  CE1 . HIS B 1  98  ? -8.789  32.542  150.966 1.00 20.52  ? 196  HIS B CE1 1 
ATOM   5956  N  NE2 . HIS B 1  98  ? -8.179  33.709  150.862 1.00 20.20  ? 196  HIS B NE2 1 
ATOM   5957  N  N   . SER B 1  99  ? -3.671  28.425  149.851 1.00 22.72  ? 197  SER B N   1 
ATOM   5958  C  CA  . SER B 1  99  ? -2.333  27.857  149.720 1.00 25.32  ? 197  SER B CA  1 
ATOM   5959  C  C   . SER B 1  99  ? -2.196  26.963  148.493 1.00 21.52  ? 197  SER B C   1 
ATOM   5960  O  O   . SER B 1  99  ? -1.478  25.964  148.520 1.00 23.66  ? 197  SER B O   1 
ATOM   5961  C  CB  . SER B 1  99  ? -1.973  27.064  150.976 1.00 19.15  ? 197  SER B CB  1 
ATOM   5962  O  OG  . SER B 1  99  ? -1.956  27.900  152.119 1.00 19.11  ? 197  SER B OG  1 
ATOM   5963  N  N   . GLY B 1  100 ? -2.890  27.321  147.419 1.00 20.21  ? 198  GLY B N   1 
ATOM   5964  C  CA  . GLY B 1  100 ? -2.760  26.599  146.168 1.00 20.47  ? 198  GLY B CA  1 
ATOM   5965  C  C   . GLY B 1  100 ? -2.059  27.439  145.122 1.00 21.51  ? 198  GLY B C   1 
ATOM   5966  O  O   . GLY B 1  100 ? -2.109  28.666  145.181 1.00 22.77  ? 198  GLY B O   1 
ATOM   5967  N  N   . PRO B 1  101 ? -1.397  26.783  144.156 1.00 31.70  ? 199  PRO B N   1 
ATOM   5968  C  CA  . PRO B 1  101 ? -0.689  27.485  143.079 1.00 28.67  ? 199  PRO B CA  1 
ATOM   5969  C  C   . PRO B 1  101 ? -1.634  28.299  142.195 1.00 29.32  ? 199  PRO B C   1 
ATOM   5970  O  O   . PRO B 1  101 ? -2.737  27.848  141.885 1.00 30.36  ? 199  PRO B O   1 
ATOM   5971  C  CB  . PRO B 1  101 ? -0.035  26.347  142.287 1.00 25.77  ? 199  PRO B CB  1 
ATOM   5972  C  CG  . PRO B 1  101 ? -0.840  25.134  142.620 1.00 25.50  ? 199  PRO B CG  1 
ATOM   5973  C  CD  . PRO B 1  101 ? -1.271  25.320  144.040 1.00 21.46  ? 199  PRO B CD  1 
ATOM   5974  N  N   . ALA B 1  102 ? -1.193  29.487  141.793 1.00 34.10  ? 200  ALA B N   1 
ATOM   5975  C  CA  . ALA B 1  102 ? -2.014  30.391  140.993 1.00 37.99  ? 200  ALA B CA  1 
ATOM   5976  C  C   . ALA B 1  102 ? -1.818  30.173  139.497 1.00 41.60  ? 200  ALA B C   1 
ATOM   5977  O  O   . ALA B 1  102 ? -1.121  29.250  139.078 1.00 42.60  ? 200  ALA B O   1 
ATOM   5978  C  CB  . ALA B 1  102 ? -1.706  31.837  141.357 1.00 36.98  ? 200  ALA B CB  1 
ATOM   5979  N  N   . GLY B 1  103 ? -2.444  31.032  138.698 1.00 44.64  ? 201  GLY B N   1 
ATOM   5980  C  CA  . GLY B 1  103 ? -2.260  31.022  137.258 1.00 48.94  ? 201  GLY B CA  1 
ATOM   5981  C  C   . GLY B 1  103 ? -3.189  30.087  136.510 1.00 48.80  ? 201  GLY B C   1 
ATOM   5982  O  O   . GLY B 1  103 ? -2.743  29.268  135.706 1.00 47.94  ? 201  GLY B O   1 
ATOM   5983  N  N   . TYR B 1  104 ? -4.487  30.214  136.770 1.00 49.07  ? 202  TYR B N   1 
ATOM   5984  C  CA  . TYR B 1  104 ? -5.489  29.419  136.068 1.00 49.26  ? 202  TYR B CA  1 
ATOM   5985  C  C   . TYR B 1  104 ? -6.712  30.267  135.728 1.00 49.74  ? 202  TYR B C   1 
ATOM   5986  O  O   . TYR B 1  104 ? -7.822  29.749  135.589 1.00 46.18  ? 202  TYR B O   1 
ATOM   5987  C  CB  . TYR B 1  104 ? -5.898  28.199  136.898 1.00 46.64  ? 202  TYR B CB  1 
ATOM   5988  C  CG  . TYR B 1  104 ? -6.273  28.509  138.331 1.00 47.67  ? 202  TYR B CG  1 
ATOM   5989  C  CD1 . TYR B 1  104 ? -7.591  28.777  138.680 1.00 47.67  ? 202  TYR B CD1 1 
ATOM   5990  C  CD2 . TYR B 1  104 ? -5.313  28.525  139.335 1.00 49.41  ? 202  TYR B CD2 1 
ATOM   5991  C  CE1 . TYR B 1  104 ? -7.941  29.057  139.985 1.00 48.04  ? 202  TYR B CE1 1 
ATOM   5992  C  CE2 . TYR B 1  104 ? -5.654  28.804  140.646 1.00 49.35  ? 202  TYR B CE2 1 
ATOM   5993  C  CZ  . TYR B 1  104 ? -6.970  29.070  140.965 1.00 48.94  ? 202  TYR B CZ  1 
ATOM   5994  O  OH  . TYR B 1  104 ? -7.319  29.350  142.268 1.00 45.97  ? 202  TYR B OH  1 
ATOM   5995  N  N   . PHE B 1  105 ? -6.497  31.572  135.592 1.00 54.87  ? 203  PHE B N   1 
ATOM   5996  C  CA  . PHE B 1  105 ? -7.570  32.507  135.269 1.00 60.02  ? 203  PHE B CA  1 
ATOM   5997  C  C   . PHE B 1  105 ? -7.378  33.096  133.876 1.00 62.24  ? 203  PHE B C   1 
ATOM   5998  O  O   . PHE B 1  105 ? -6.266  33.107  133.347 1.00 64.25  ? 203  PHE B O   1 
ATOM   5999  C  CB  . PHE B 1  105 ? -7.633  33.636  136.297 1.00 62.58  ? 203  PHE B CB  1 
ATOM   6000  C  CG  . PHE B 1  105 ? -7.936  33.176  137.693 1.00 62.43  ? 203  PHE B CG  1 
ATOM   6001  C  CD1 . PHE B 1  105 ? -6.917  32.795  138.548 1.00 61.25  ? 203  PHE B CD1 1 
ATOM   6002  C  CD2 . PHE B 1  105 ? -9.239  33.157  138.162 1.00 64.96  ? 203  PHE B CD2 1 
ATOM   6003  C  CE1 . PHE B 1  105 ? -7.193  32.382  139.836 1.00 62.01  ? 203  PHE B CE1 1 
ATOM   6004  C  CE2 . PHE B 1  105 ? -9.524  32.745  139.450 1.00 64.44  ? 203  PHE B CE2 1 
ATOM   6005  C  CZ  . PHE B 1  105 ? -8.499  32.359  140.290 1.00 64.41  ? 203  PHE B CZ  1 
ATOM   6006  N  N   . GLN B 1  106 ? -8.461  33.589  133.284 1.00 63.06  ? 204  GLN B N   1 
ATOM   6007  C  CA  . GLN B 1  106 ? -8.381  34.244  131.982 1.00 62.46  ? 204  GLN B CA  1 
ATOM   6008  C  C   . GLN B 1  106 ? -8.601  35.755  132.084 1.00 64.13  ? 204  GLN B C   1 
ATOM   6009  O  O   . GLN B 1  106 ? -8.050  36.520  131.293 1.00 68.01  ? 204  GLN B O   1 
ATOM   6010  C  CB  . GLN B 1  106 ? -9.387  33.622  131.005 1.00 59.46  ? 204  GLN B CB  1 
ATOM   6011  C  CG  . GLN B 1  106 ? -10.841 33.993  131.254 1.00 56.35  ? 204  GLN B CG  1 
ATOM   6012  C  CD  . GLN B 1  106 ? -11.785 33.324  130.274 1.00 54.15  ? 204  GLN B CD  1 
ATOM   6013  O  OE1 . GLN B 1  106 ? -11.353 32.623  129.358 1.00 53.18  ? 204  GLN B OE1 1 
ATOM   6014  N  NE2 . GLN B 1  106 ? -13.081 33.536  130.463 1.00 53.61  ? 204  GLN B NE2 1 
ATOM   6015  N  N   . TYR B 1  107 ? -9.401  36.182  133.058 1.00 61.08  ? 205  TYR B N   1 
ATOM   6016  C  CA  . TYR B 1  107 ? -9.677  37.603  133.243 1.00 61.59  ? 205  TYR B CA  1 
ATOM   6017  C  C   . TYR B 1  107 ? -8.476  38.313  133.867 1.00 62.94  ? 205  TYR B C   1 
ATOM   6018  O  O   . TYR B 1  107 ? -7.829  37.781  134.769 1.00 63.04  ? 205  TYR B O   1 
ATOM   6019  C  CB  . TYR B 1  107 ? -10.935 37.801  134.092 1.00 59.95  ? 205  TYR B CB  1 
ATOM   6020  C  CG  . TYR B 1  107 ? -12.204 37.379  133.381 1.00 58.40  ? 205  TYR B CG  1 
ATOM   6021  C  CD1 . TYR B 1  107 ? -12.784 38.192  132.415 1.00 57.12  ? 205  TYR B CD1 1 
ATOM   6022  C  CD2 . TYR B 1  107 ? -12.816 36.165  133.668 1.00 56.15  ? 205  TYR B CD2 1 
ATOM   6023  C  CE1 . TYR B 1  107 ? -13.939 37.809  131.757 1.00 57.18  ? 205  TYR B CE1 1 
ATOM   6024  C  CE2 . TYR B 1  107 ? -13.972 35.774  133.016 1.00 55.69  ? 205  TYR B CE2 1 
ATOM   6025  C  CZ  . TYR B 1  107 ? -14.529 36.600  132.062 1.00 57.05  ? 205  TYR B CZ  1 
ATOM   6026  O  OH  . TYR B 1  107 ? -15.679 36.216  131.411 1.00 58.49  ? 205  TYR B OH  1 
ATOM   6027  N  N   . THR B 1  108 ? -8.204  39.522  133.384 1.00 63.41  ? 206  THR B N   1 
ATOM   6028  C  CA  . THR B 1  108 ? -6.934  40.210  133.619 1.00 63.81  ? 206  THR B CA  1 
ATOM   6029  C  C   . THR B 1  108 ? -6.579  40.441  135.091 1.00 65.53  ? 206  THR B C   1 
ATOM   6030  O  O   . THR B 1  108 ? -5.411  40.323  135.468 1.00 65.21  ? 206  THR B O   1 
ATOM   6031  C  CB  . THR B 1  108 ? -6.921  41.576  132.894 1.00 63.30  ? 206  THR B CB  1 
ATOM   6032  O  OG1 . THR B 1  108 ? -7.225  41.385  131.507 1.00 61.92  ? 206  THR B OG1 1 
ATOM   6033  C  CG2 . THR B 1  108 ? -5.560  42.245  133.016 1.00 64.27  ? 206  THR B CG2 1 
ATOM   6034  N  N   . VAL B 1  109 ? -7.572  40.767  135.915 1.00 67.94  ? 207  VAL B N   1 
ATOM   6035  C  CA  . VAL B 1  109 ? -7.333  41.041  137.334 1.00 68.50  ? 207  VAL B CA  1 
ATOM   6036  C  C   . VAL B 1  109 ? -6.615  39.894  138.041 1.00 64.99  ? 207  VAL B C   1 
ATOM   6037  O  O   . VAL B 1  109 ? -5.634  40.108  138.755 1.00 63.69  ? 207  VAL B O   1 
ATOM   6038  C  CB  . VAL B 1  109 ? -8.653  41.330  138.086 1.00 69.33  ? 207  VAL B CB  1 
ATOM   6039  C  CG1 . VAL B 1  109 ? -8.422  41.359  139.591 1.00 67.92  ? 207  VAL B CG1 1 
ATOM   6040  C  CG2 . VAL B 1  109 ? -9.252  42.636  137.617 1.00 70.66  ? 207  VAL B CG2 1 
ATOM   6041  N  N   . PHE B 1  110 ? -7.095  38.675  137.825 1.00 63.67  ? 208  PHE B N   1 
ATOM   6042  C  CA  . PHE B 1  110 ? -6.531  37.511  138.496 1.00 65.70  ? 208  PHE B CA  1 
ATOM   6043  C  C   . PHE B 1  110 ? -5.254  37.030  137.811 1.00 67.70  ? 208  PHE B C   1 
ATOM   6044  O  O   . PHE B 1  110 ? -4.463  36.299  138.406 1.00 68.95  ? 208  PHE B O   1 
ATOM   6045  C  CB  . PHE B 1  110 ? -7.557  36.383  138.558 1.00 65.33  ? 208  PHE B CB  1 
ATOM   6046  C  CG  . PHE B 1  110 ? -8.934  36.839  138.946 1.00 66.37  ? 208  PHE B CG  1 
ATOM   6047  C  CD1 . PHE B 1  110 ? -9.198  37.267  140.237 1.00 66.55  ? 208  PHE B CD1 1 
ATOM   6048  C  CD2 . PHE B 1  110 ? -9.964  36.845  138.019 1.00 66.81  ? 208  PHE B CD2 1 
ATOM   6049  C  CE1 . PHE B 1  110 ? -10.463 37.690  140.597 1.00 66.31  ? 208  PHE B CE1 1 
ATOM   6050  C  CE2 . PHE B 1  110 ? -11.233 37.267  138.373 1.00 65.98  ? 208  PHE B CE2 1 
ATOM   6051  C  CZ  . PHE B 1  110 ? -11.483 37.690  139.663 1.00 65.64  ? 208  PHE B CZ  1 
ATOM   6052  N  N   . VAL B 1  111 ? -5.058  37.440  136.561 1.00 67.35  ? 209  VAL B N   1 
ATOM   6053  C  CA  . VAL B 1  111 ? -3.836  37.110  135.836 1.00 65.35  ? 209  VAL B CA  1 
ATOM   6054  C  C   . VAL B 1  111 ? -2.694  37.983  136.347 1.00 70.26  ? 209  VAL B C   1 
ATOM   6055  O  O   . VAL B 1  111 ? -1.552  37.533  136.454 1.00 73.07  ? 209  VAL B O   1 
ATOM   6056  C  CB  . VAL B 1  111 ? -4.001  37.297  134.311 1.00 59.61  ? 209  VAL B CB  1 
ATOM   6057  C  CG1 . VAL B 1  111 ? -2.694  36.999  133.586 1.00 56.79  ? 209  VAL B CG1 1 
ATOM   6058  C  CG2 . VAL B 1  111 ? -5.115  36.409  133.784 1.00 57.44  ? 209  VAL B CG2 1 
ATOM   6059  N  N   . ILE B 1  112 ? -3.017  39.230  136.682 1.00 70.87  ? 210  ILE B N   1 
ATOM   6060  C  CA  . ILE B 1  112 ? -2.049  40.145  137.277 1.00 68.59  ? 210  ILE B CA  1 
ATOM   6061  C  C   . ILE B 1  112 ? -1.633  39.636  138.655 1.00 70.23  ? 210  ILE B C   1 
ATOM   6062  O  O   . ILE B 1  112 ? -0.445  39.603  138.984 1.00 73.27  ? 210  ILE B O   1 
ATOM   6063  C  CB  . ILE B 1  112 ? -2.618  41.575  137.400 1.00 61.04  ? 210  ILE B CB  1 
ATOM   6064  C  CG1 . ILE B 1  112 ? -2.754  42.217  136.019 1.00 57.92  ? 210  ILE B CG1 1 
ATOM   6065  C  CG2 . ILE B 1  112 ? -1.744  42.430  138.302 1.00 59.28  ? 210  ILE B CG2 1 
ATOM   6066  C  CD1 . ILE B 1  112 ? -3.485  43.542  136.034 1.00 56.56  ? 210  ILE B CD1 1 
ATOM   6067  N  N   . ALA B 1  113 ? -2.622  39.238  139.451 1.00 68.86  ? 211  ALA B N   1 
ATOM   6068  C  CA  . ALA B 1  113 ? -2.380  38.658  140.769 1.00 69.14  ? 211  ALA B CA  1 
ATOM   6069  C  C   . ALA B 1  113 ? -1.513  37.406  140.665 1.00 72.11  ? 211  ALA B C   1 
ATOM   6070  O  O   . ALA B 1  113 ? -0.559  37.234  141.422 1.00 75.38  ? 211  ALA B O   1 
ATOM   6071  C  CB  . ALA B 1  113 ? -3.700  38.335  141.457 1.00 65.76  ? 211  ALA B CB  1 
ATOM   6072  N  N   . SER B 1  114 ? -1.857  36.536  139.721 1.00 70.99  ? 212  SER B N   1 
ATOM   6073  C  CA  . SER B 1  114 ? -1.113  35.301  139.494 1.00 68.87  ? 212  SER B CA  1 
ATOM   6074  C  C   . SER B 1  114 ? 0.255   35.562  138.866 1.00 68.34  ? 212  SER B C   1 
ATOM   6075  O  O   . SER B 1  114 ? 1.094   34.662  138.804 1.00 69.82  ? 212  SER B O   1 
ATOM   6076  C  CB  . SER B 1  114 ? -1.918  34.351  138.604 1.00 67.58  ? 212  SER B CB  1 
ATOM   6077  O  OG  . SER B 1  114 ? -3.172  34.042  139.187 1.00 65.65  ? 212  SER B OG  1 
ATOM   6078  N  N   . GLU B 1  115 ? 0.456   36.790  138.392 1.00 67.40  ? 213  GLU B N   1 
ATOM   6079  C  CA  . GLU B 1  115 ? 1.671   37.186  137.680 1.00 66.03  ? 213  GLU B CA  1 
ATOM   6080  C  C   . GLU B 1  115 ? 1.866   36.352  136.418 1.00 61.82  ? 213  GLU B C   1 
ATOM   6081  O  O   . GLU B 1  115 ? 2.992   36.029  136.042 1.00 59.23  ? 213  GLU B O   1 
ATOM   6082  C  CB  . GLU B 1  115 ? 2.904   37.075  138.583 1.00 66.84  ? 213  GLU B CB  1 
ATOM   6083  C  CG  . GLU B 1  115 ? 2.906   38.033  139.764 1.00 68.85  ? 213  GLU B CG  1 
ATOM   6084  C  CD  . GLU B 1  115 ? 4.199   37.974  140.559 1.00 71.91  ? 213  GLU B CD  1 
ATOM   6085  O  OE1 . GLU B 1  115 ? 4.290   38.657  141.600 1.00 75.13  ? 213  GLU B OE1 1 
ATOM   6086  O  OE2 . GLU B 1  115 ? 5.124   37.244  140.143 1.00 69.61  ? 213  GLU B OE2 1 
ATOM   6087  N  N   . GLY B 1  116 ? 0.759   36.005  135.770 1.00 60.03  ? 214  GLY B N   1 
ATOM   6088  C  CA  . GLY B 1  116 ? 0.807   35.274  134.520 1.00 58.01  ? 214  GLY B CA  1 
ATOM   6089  C  C   . GLY B 1  116 ? -0.113  34.069  134.518 1.00 55.31  ? 214  GLY B C   1 
ATOM   6090  O  O   . GLY B 1  116 ? -0.897  33.867  135.445 1.00 52.08  ? 214  GLY B O   1 
ATOM   6091  N  N   . PHE B 1  117 ? -0.008  33.262  133.468 1.00 54.87  ? 215  PHE B N   1 
ATOM   6092  C  CA  . PHE B 1  117 ? -0.813  32.054  133.342 1.00 47.74  ? 215  PHE B CA  1 
ATOM   6093  C  C   . PHE B 1  117 ? 0.091   30.831  133.246 1.00 43.51  ? 215  PHE B C   1 
ATOM   6094  O  O   . PHE B 1  117 ? 1.013   30.792  132.432 1.00 45.39  ? 215  PHE B O   1 
ATOM   6095  C  CB  . PHE B 1  117 ? -1.734  32.145  132.120 1.00 45.24  ? 215  PHE B CB  1 
ATOM   6096  C  CG  . PHE B 1  117 ? -2.526  30.894  131.859 1.00 40.74  ? 215  PHE B CG  1 
ATOM   6097  C  CD1 . PHE B 1  117 ? -3.715  30.660  132.529 1.00 39.65  ? 215  PHE B CD1 1 
ATOM   6098  C  CD2 . PHE B 1  117 ? -2.094  29.964  130.927 1.00 36.48  ? 215  PHE B CD2 1 
ATOM   6099  C  CE1 . PHE B 1  117 ? -4.449  29.514  132.288 1.00 36.70  ? 215  PHE B CE1 1 
ATOM   6100  C  CE2 . PHE B 1  117 ? -2.824  28.818  130.680 1.00 34.01  ? 215  PHE B CE2 1 
ATOM   6101  C  CZ  . PHE B 1  117 ? -4.004  28.592  131.361 1.00 34.31  ? 215  PHE B CZ  1 
ATOM   6102  N  N   . SER B 1  118 ? -0.177  29.837  134.085 1.00 37.76  ? 216  SER B N   1 
ATOM   6103  C  CA  . SER B 1  118 ? 0.622   28.621  134.107 1.00 33.26  ? 216  SER B CA  1 
ATOM   6104  C  C   . SER B 1  118 ? -0.135  27.467  133.459 1.00 34.25  ? 216  SER B C   1 
ATOM   6105  O  O   . SER B 1  118 ? -1.018  26.873  134.078 1.00 39.49  ? 216  SER B O   1 
ATOM   6106  C  CB  . SER B 1  118 ? 1.004   28.269  135.547 1.00 34.14  ? 216  SER B CB  1 
ATOM   6107  O  OG  . SER B 1  118 ? 1.712   27.045  135.611 1.00 40.45  ? 216  SER B OG  1 
ATOM   6108  N  N   . ASN B 1  119 ? 0.215   27.157  132.212 1.00 32.30  ? 217  ASN B N   1 
ATOM   6109  C  CA  . ASN B 1  119 ? -0.440  26.080  131.476 1.00 35.19  ? 217  ASN B CA  1 
ATOM   6110  C  C   . ASN B 1  119 ? -0.306  24.739  132.192 1.00 33.88  ? 217  ASN B C   1 
ATOM   6111  O  O   . ASN B 1  119 ? -1.274  23.990  132.291 1.00 34.02  ? 217  ASN B O   1 
ATOM   6112  C  CB  . ASN B 1  119 ? 0.121   25.978  130.054 1.00 41.16  ? 217  ASN B CB  1 
ATOM   6113  C  CG  . ASN B 1  119 ? -0.789  25.193  129.121 1.00 48.65  ? 217  ASN B CG  1 
ATOM   6114  O  OD1 . ASN B 1  119 ? -2.005  25.166  129.304 1.00 42.17  ? 217  ASN B OD1 1 
ATOM   6115  N  ND2 . ASN B 1  119 ? -0.203  24.554  128.112 1.00 65.08  ? 217  ASN B ND2 1 
ATOM   6116  N  N   . GLN B 1  120 ? 0.891   24.450  132.694 1.00 34.65  ? 218  GLN B N   1 
ATOM   6117  C  CA  . GLN B 1  120 ? 1.146   23.221  133.445 1.00 41.05  ? 218  GLN B CA  1 
ATOM   6118  C  C   . GLN B 1  120 ? 0.166   23.053  134.600 1.00 39.87  ? 218  GLN B C   1 
ATOM   6119  O  O   . GLN B 1  120 ? -0.539  22.047  134.688 1.00 39.21  ? 218  GLN B O   1 
ATOM   6120  C  CB  . GLN B 1  120 ? 2.578   23.203  133.980 1.00 49.79  ? 218  GLN B CB  1 
ATOM   6121  C  CG  . GLN B 1  120 ? 3.610   22.685  132.995 1.00 62.01  ? 218  GLN B CG  1 
ATOM   6122  C  CD  . GLN B 1  120 ? 4.951   22.410  133.650 1.00 71.22  ? 218  GLN B CD  1 
ATOM   6123  O  OE1 . GLN B 1  120 ? 5.134   22.652  134.844 1.00 73.47  ? 218  GLN B OE1 1 
ATOM   6124  N  NE2 . GLN B 1  120 ? 5.896   21.894  132.871 1.00 73.82  ? 218  GLN B NE2 1 
ATOM   6125  N  N   . THR B 1  121 ? 0.147   24.039  135.491 1.00 37.53  ? 219  THR B N   1 
ATOM   6126  C  CA  . THR B 1  121 ? -0.752  24.044  136.639 1.00 35.01  ? 219  THR B CA  1 
ATOM   6127  C  C   . THR B 1  121 ? -2.216  23.944  136.209 1.00 34.25  ? 219  THR B C   1 
ATOM   6128  O  O   . THR B 1  121 ? -2.990  23.176  136.781 1.00 33.70  ? 219  THR B O   1 
ATOM   6129  C  CB  . THR B 1  121 ? -0.552  25.312  137.485 1.00 32.32  ? 219  THR B CB  1 
ATOM   6130  O  OG1 . THR B 1  121 ? 0.738   25.269  138.106 1.00 35.86  ? 219  THR B OG1 1 
ATOM   6131  C  CG2 . THR B 1  121 ? -1.624  25.423  138.558 1.00 27.03  ? 219  THR B CG2 1 
ATOM   6132  N  N   . PHE B 1  122 ? -2.584  24.723  135.197 1.00 33.16  ? 220  PHE B N   1 
ATOM   6133  C  CA  . PHE B 1  122 ? -3.949  24.728  134.685 1.00 30.73  ? 220  PHE B CA  1 
ATOM   6134  C  C   . PHE B 1  122 ? -4.371  23.351  134.171 1.00 32.92  ? 220  PHE B C   1 
ATOM   6135  O  O   . PHE B 1  122 ? -5.452  22.865  134.499 1.00 32.72  ? 220  PHE B O   1 
ATOM   6136  C  CB  . PHE B 1  122 ? -4.095  25.769  133.573 1.00 28.78  ? 220  PHE B CB  1 
ATOM   6137  C  CG  . PHE B 1  122 ? -5.464  25.811  132.958 1.00 28.62  ? 220  PHE B CG  1 
ATOM   6138  C  CD1 . PHE B 1  122 ? -6.502  26.472  133.595 1.00 28.53  ? 220  PHE B CD1 1 
ATOM   6139  C  CD2 . PHE B 1  122 ? -5.712  25.199  131.741 1.00 26.12  ? 220  PHE B CD2 1 
ATOM   6140  C  CE1 . PHE B 1  122 ? -7.763  26.517  133.032 1.00 25.30  ? 220  PHE B CE1 1 
ATOM   6141  C  CE2 . PHE B 1  122 ? -6.971  25.240  131.174 1.00 26.80  ? 220  PHE B CE2 1 
ATOM   6142  C  CZ  . PHE B 1  122 ? -7.998  25.900  131.820 1.00 25.70  ? 220  PHE B CZ  1 
ATOM   6143  N  N   . GLN B 1  123 ? -3.513  22.726  133.372 1.00 34.24  ? 221  GLN B N   1 
ATOM   6144  C  CA  . GLN B 1  123 ? -3.834  21.432  132.779 1.00 35.74  ? 221  GLN B CA  1 
ATOM   6145  C  C   . GLN B 1  123 ? -3.938  20.344  133.841 1.00 40.90  ? 221  GLN B C   1 
ATOM   6146  O  O   . GLN B 1  123 ? -4.805  19.475  133.763 1.00 42.21  ? 221  GLN B O   1 
ATOM   6147  C  CB  . GLN B 1  123 ? -2.790  21.041  131.730 1.00 33.45  ? 221  GLN B CB  1 
ATOM   6148  C  CG  . GLN B 1  123 ? -2.758  21.948  130.510 1.00 36.19  ? 221  GLN B CG  1 
ATOM   6149  C  CD  . GLN B 1  123 ? -4.060  21.938  129.734 1.00 39.08  ? 221  GLN B CD  1 
ATOM   6150  O  OE1 . GLN B 1  123 ? -4.787  20.944  129.725 1.00 38.68  ? 221  GLN B OE1 1 
ATOM   6151  N  NE2 . GLN B 1  123 ? -4.365  23.053  129.081 1.00 41.58  ? 221  GLN B NE2 1 
ATOM   6152  N  N   . HIS B 1  124 ? -3.048  20.395  134.828 1.00 43.81  ? 222  HIS B N   1 
ATOM   6153  C  CA  . HIS B 1  124 ? -3.047  19.418  135.910 1.00 43.12  ? 222  HIS B CA  1 
ATOM   6154  C  C   . HIS B 1  124 ? -4.347  19.506  136.701 1.00 37.32  ? 222  HIS B C   1 
ATOM   6155  O  O   . HIS B 1  124 ? -4.892  18.490  137.130 1.00 35.02  ? 222  HIS B O   1 
ATOM   6156  C  CB  . HIS B 1  124 ? -1.843  19.634  136.829 1.00 50.31  ? 222  HIS B CB  1 
ATOM   6157  C  CG  . HIS B 1  124 ? -1.513  18.451  137.685 1.00 60.44  ? 222  HIS B CG  1 
ATOM   6158  N  ND1 . HIS B 1  124 ? -2.478  17.656  138.266 1.00 64.66  ? 222  HIS B ND1 1 
ATOM   6159  C  CD2 . HIS B 1  124 ? -0.321  17.924  138.053 1.00 64.66  ? 222  HIS B CD2 1 
ATOM   6160  C  CE1 . HIS B 1  124 ? -1.895  16.694  138.960 1.00 66.06  ? 222  HIS B CE1 1 
ATOM   6161  N  NE2 . HIS B 1  124 ? -0.587  16.835  138.847 1.00 66.64  ? 222  HIS B NE2 1 
ATOM   6162  N  N   . MET B 1  125 ? -4.838  20.728  136.882 1.00 35.70  ? 223  MET B N   1 
ATOM   6163  C  CA  . MET B 1  125 ? -6.111  20.959  137.554 1.00 34.23  ? 223  MET B CA  1 
ATOM   6164  C  C   . MET B 1  125 ? -7.258  20.354  136.759 1.00 30.10  ? 223  MET B C   1 
ATOM   6165  O  O   . MET B 1  125 ? -8.137  19.703  137.319 1.00 32.93  ? 223  MET B O   1 
ATOM   6166  C  CB  . MET B 1  125 ? -6.350  22.455  137.756 1.00 38.07  ? 223  MET B CB  1 
ATOM   6167  C  CG  . MET B 1  125 ? -5.743  23.010  139.029 1.00 40.60  ? 223  MET B CG  1 
ATOM   6168  S  SD  . MET B 1  125 ? -5.676  24.811  139.027 1.00 73.72  ? 223  MET B SD  1 
ATOM   6169  C  CE  . MET B 1  125 ? -4.722  25.121  140.510 1.00 52.08  ? 223  MET B CE  1 
ATOM   6170  N  N   . VAL B 1  126 ? -7.242  20.579  135.449 1.00 25.02  ? 224  VAL B N   1 
ATOM   6171  C  CA  . VAL B 1  126 ? -8.296  20.093  134.569 1.00 26.31  ? 224  VAL B CA  1 
ATOM   6172  C  C   . VAL B 1  126 ? -8.358  18.570  134.563 1.00 30.82  ? 224  VAL B C   1 
ATOM   6173  O  O   . VAL B 1  126 ? -9.429  17.986  134.740 1.00 30.25  ? 224  VAL B O   1 
ATOM   6174  C  CB  . VAL B 1  126 ? -8.101  20.599  133.124 1.00 26.93  ? 224  VAL B CB  1 
ATOM   6175  C  CG1 . VAL B 1  126 ? -9.074  19.913  132.180 1.00 26.07  ? 224  VAL B CG1 1 
ATOM   6176  C  CG2 . VAL B 1  126 ? -8.262  22.110  133.062 1.00 23.63  ? 224  VAL B CG2 1 
ATOM   6177  N  N   . THR B 1  127 ? -7.208  17.928  134.376 1.00 32.05  ? 225  THR B N   1 
ATOM   6178  C  CA  . THR B 1  127 ? -7.156  16.470  134.339 1.00 29.31  ? 225  THR B CA  1 
ATOM   6179  C  C   . THR B 1  127 ? -7.527  15.874  135.691 1.00 24.92  ? 225  THR B C   1 
ATOM   6180  O  O   . THR B 1  127 ? -8.139  14.809  135.761 1.00 24.42  ? 225  THR B O   1 
ATOM   6181  C  CB  . THR B 1  127 ? -5.760  15.956  133.933 1.00 29.69  ? 225  THR B CB  1 
ATOM   6182  O  OG1 . THR B 1  127 ? -4.803  16.309  134.939 1.00 36.24  ? 225  THR B OG1 1 
ATOM   6183  C  CG2 . THR B 1  127 ? -5.336  16.549  132.599 1.00 26.18  ? 225  THR B CG2 1 
ATOM   6184  N  N   . GLY B 1  128 ? -7.164  16.572  136.762 1.00 20.77  ? 226  GLY B N   1 
ATOM   6185  C  CA  . GLY B 1  128 ? -7.501  16.135  138.104 1.00 19.93  ? 226  GLY B CA  1 
ATOM   6186  C  C   . GLY B 1  128 ? -8.998  16.142  138.335 1.00 25.95  ? 226  GLY B C   1 
ATOM   6187  O  O   . GLY B 1  128 ? -9.559  15.184  138.865 1.00 31.29  ? 226  GLY B O   1 
ATOM   6188  N  N   . ILE B 1  129 ? -9.644  17.232  137.935 1.00 25.33  ? 227  ILE B N   1 
ATOM   6189  C  CA  . ILE B 1  129 ? -11.091 17.357  138.055 1.00 25.89  ? 227  ILE B CA  1 
ATOM   6190  C  C   . ILE B 1  129 ? -11.802 16.311  137.199 1.00 27.35  ? 227  ILE B C   1 
ATOM   6191  O  O   . ILE B 1  129 ? -12.764 15.683  137.640 1.00 26.33  ? 227  ILE B O   1 
ATOM   6192  C  CB  . ILE B 1  129 ? -11.564 18.767  137.653 1.00 24.92  ? 227  ILE B CB  1 
ATOM   6193  C  CG1 . ILE B 1  129 ? -11.039 19.804  138.648 1.00 19.75  ? 227  ILE B CG1 1 
ATOM   6194  C  CG2 . ILE B 1  129 ? -13.084 18.826  137.575 1.00 23.35  ? 227  ILE B CG2 1 
ATOM   6195  C  CD1 . ILE B 1  129 ? -11.110 21.226  138.142 1.00 19.92  ? 227  ILE B CD1 1 
ATOM   6196  N  N   . LEU B 1  130 ? -11.317 16.121  135.976 1.00 29.57  ? 228  LEU B N   1 
ATOM   6197  C  CA  . LEU B 1  130 ? -11.902 15.140  135.068 1.00 26.90  ? 228  LEU B CA  1 
ATOM   6198  C  C   . LEU B 1  130 ? -11.712 13.706  135.555 1.00 29.46  ? 228  LEU B C   1 
ATOM   6199  O  O   . LEU B 1  130 ? -12.624 12.887  135.449 1.00 33.84  ? 228  LEU B O   1 
ATOM   6200  C  CB  . LEU B 1  130 ? -11.304 15.285  133.669 1.00 23.23  ? 228  LEU B CB  1 
ATOM   6201  C  CG  . LEU B 1  130 ? -11.634 16.572  132.914 1.00 25.70  ? 228  LEU B CG  1 
ATOM   6202  C  CD1 . LEU B 1  130 ? -10.848 16.623  131.620 1.00 24.15  ? 228  LEU B CD1 1 
ATOM   6203  C  CD2 . LEU B 1  130 ? -13.125 16.681  132.648 1.00 23.69  ? 228  LEU B CD2 1 
ATOM   6204  N  N   . LYS B 1  131 ? -10.533 13.407  136.095 1.00 26.53  ? 229  LYS B N   1 
ATOM   6205  C  CA  . LYS B 1  131 ? -10.236 12.057  136.566 1.00 25.88  ? 229  LYS B CA  1 
ATOM   6206  C  C   . LYS B 1  131 ? -11.136 11.681  137.736 1.00 22.96  ? 229  LYS B C   1 
ATOM   6207  O  O   . LYS B 1  131 ? -11.634 10.558  137.808 1.00 20.70  ? 229  LYS B O   1 
ATOM   6208  C  CB  . LYS B 1  131 ? -8.765  11.922  136.967 1.00 28.91  ? 229  LYS B CB  1 
ATOM   6209  C  CG  . LYS B 1  131 ? -8.388  10.519  137.432 1.00 32.29  ? 229  LYS B CG  1 
ATOM   6210  C  CD  . LYS B 1  131 ? -6.912  10.410  137.776 1.00 36.92  ? 229  LYS B CD  1 
ATOM   6211  C  CE  . LYS B 1  131 ? -6.555  9.001   138.232 1.00 38.57  ? 229  LYS B CE  1 
ATOM   6212  N  NZ  . LYS B 1  131 ? -5.192  8.927   138.830 1.00 39.77  ? 229  LYS B NZ  1 
ATOM   6213  N  N   . SER B 1  132 ? -11.345 12.628  138.647 1.00 23.68  ? 230  SER B N   1 
ATOM   6214  C  CA  . SER B 1  132 ? -12.209 12.403  139.800 1.00 24.27  ? 230  SER B CA  1 
ATOM   6215  C  C   . SER B 1  132 ? -13.626 12.083  139.338 1.00 25.72  ? 230  SER B C   1 
ATOM   6216  O  O   . SER B 1  132 ? -14.293 11.218  139.904 1.00 25.95  ? 230  SER B O   1 
ATOM   6217  C  CB  . SER B 1  132 ? -12.212 13.622  140.723 1.00 23.61  ? 230  SER B CB  1 
ATOM   6218  O  OG  . SER B 1  132 ? -12.760 14.754  140.073 1.00 17.52  ? 230  SER B OG  1 
ATOM   6219  N  N   . ILE B 1  133 ? -14.076 12.789  138.306 1.00 25.82  ? 231  ILE B N   1 
ATOM   6220  C  CA  . ILE B 1  133 ? -15.389 12.546  137.723 1.00 26.01  ? 231  ILE B CA  1 
ATOM   6221  C  C   . ILE B 1  133 ? -15.434 11.172  137.053 1.00 27.09  ? 231  ILE B C   1 
ATOM   6222  O  O   . ILE B 1  133 ? -16.413 10.440  137.196 1.00 28.94  ? 231  ILE B O   1 
ATOM   6223  C  CB  . ILE B 1  133 ? -15.763 13.645  136.702 1.00 24.93  ? 231  ILE B CB  1 
ATOM   6224  C  CG1 . ILE B 1  133 ? -15.985 14.979  137.420 1.00 23.70  ? 231  ILE B CG1 1 
ATOM   6225  C  CG2 . ILE B 1  133 ? -17.004 13.253  135.912 1.00 22.11  ? 231  ILE B CG2 1 
ATOM   6226  C  CD1 . ILE B 1  133 ? -16.203 16.151  136.484 1.00 18.86  ? 231  ILE B CD1 1 
ATOM   6227  N  N   . ASP B 1  134 ? -14.367 10.820  136.338 1.00 28.80  ? 232  ASP B N   1 
ATOM   6228  C  CA  . ASP B 1  134 ? -14.285 9.523   135.665 1.00 30.98  ? 232  ASP B CA  1 
ATOM   6229  C  C   . ASP B 1  134 ? -14.318 8.370   136.663 1.00 27.12  ? 232  ASP B C   1 
ATOM   6230  O  O   . ASP B 1  134 ? -14.917 7.329   136.395 1.00 26.12  ? 232  ASP B O   1 
ATOM   6231  C  CB  . ASP B 1  134 ? -13.016 9.427   134.810 1.00 38.50  ? 232  ASP B CB  1 
ATOM   6232  C  CG  . ASP B 1  134 ? -12.989 10.446  133.688 1.00 47.87  ? 232  ASP B CG  1 
ATOM   6233  O  OD1 . ASP B 1  134 ? -14.068 10.954  133.319 1.00 48.53  ? 232  ASP B OD1 1 
ATOM   6234  O  OD2 . ASP B 1  134 ? -11.887 10.736  133.175 1.00 51.61  ? 232  ASP B OD2 1 
ATOM   6235  N  N   . ILE B 1  135 ? -13.668 8.559   137.808 1.00 24.26  ? 233  ILE B N   1 
ATOM   6236  C  CA  . ILE B 1  135 ? -13.668 7.548   138.860 1.00 19.91  ? 233  ILE B CA  1 
ATOM   6237  C  C   . ILE B 1  135 ? -15.081 7.346   139.393 1.00 23.41  ? 233  ILE B C   1 
ATOM   6238  O  O   . ILE B 1  135 ? -15.557 6.216   139.507 1.00 26.69  ? 233  ILE B O   1 
ATOM   6239  C  CB  . ILE B 1  135 ? -12.734 7.932   140.028 1.00 19.25  ? 233  ILE B CB  1 
ATOM   6240  C  CG1 . ILE B 1  135 ? -11.273 7.932   139.576 1.00 23.01  ? 233  ILE B CG1 1 
ATOM   6241  C  CG2 . ILE B 1  135 ? -12.913 6.975   141.192 1.00 17.21  ? 233  ILE B CG2 1 
ATOM   6242  C  CD1 . ILE B 1  135 ? -10.323 8.552   140.585 1.00 17.91  ? 233  ILE B CD1 1 
ATOM   6243  N  N   . ALA B 1  136 ? -15.749 8.453   139.705 1.00 20.67  ? 234  ALA B N   1 
ATOM   6244  C  CA  . ALA B 1  136 ? -17.121 8.420   140.197 1.00 22.30  ? 234  ALA B CA  1 
ATOM   6245  C  C   . ALA B 1  136 ? -18.064 7.815   139.164 1.00 25.57  ? 234  ALA B C   1 
ATOM   6246  O  O   . ALA B 1  136 ? -18.958 7.042   139.504 1.00 25.46  ? 234  ALA B O   1 
ATOM   6247  C  CB  . ALA B 1  136 ? -17.579 9.820   140.573 1.00 23.94  ? 234  ALA B CB  1 
ATOM   6248  N  N   . HIS B 1  137 ? -17.851 8.175   137.902 1.00 28.39  ? 235  HIS B N   1 
ATOM   6249  C  CA  . HIS B 1  137 ? -18.668 7.683   136.800 1.00 27.60  ? 235  HIS B CA  1 
ATOM   6250  C  C   . HIS B 1  137 ? -18.588 6.166   136.644 1.00 29.91  ? 235  HIS B C   1 
ATOM   6251  O  O   . HIS B 1  137 ? -19.606 5.500   136.460 1.00 33.62  ? 235  HIS B O   1 
ATOM   6252  C  CB  . HIS B 1  137 ? -18.250 8.363   135.492 1.00 27.83  ? 235  HIS B CB  1 
ATOM   6253  C  CG  . HIS B 1  137 ? -18.926 7.811   134.275 1.00 28.07  ? 235  HIS B CG  1 
ATOM   6254  N  ND1 . HIS B 1  137 ? -20.099 8.332   133.774 1.00 24.97  ? 235  HIS B ND1 1 
ATOM   6255  C  CD2 . HIS B 1  137 ? -18.584 6.791   133.453 1.00 20.28  ? 235  HIS B CD2 1 
ATOM   6256  C  CE1 . HIS B 1  137 ? -20.455 7.652   132.698 1.00 21.61  ? 235  HIS B CE1 1 
ATOM   6257  N  NE2 . HIS B 1  137 ? -19.553 6.712   132.482 1.00 25.02  ? 235  HIS B NE2 1 
ATOM   6258  N  N   . THR B 1  138 ? -17.376 5.624   136.720 1.00 25.95  ? 236  THR B N   1 
ATOM   6259  C  CA  . THR B 1  138 ? -17.165 4.202   136.473 1.00 24.45  ? 236  THR B CA  1 
ATOM   6260  C  C   . THR B 1  138 ? -17.330 3.360   137.734 1.00 25.06  ? 236  THR B C   1 
ATOM   6261  O  O   . THR B 1  138 ? -17.168 2.140   137.699 1.00 29.77  ? 236  THR B O   1 
ATOM   6262  C  CB  . THR B 1  138 ? -15.766 3.939   135.882 1.00 26.78  ? 236  THR B CB  1 
ATOM   6263  O  OG1 . THR B 1  138 ? -14.765 4.406   136.793 1.00 30.51  ? 236  THR B OG1 1 
ATOM   6264  C  CG2 . THR B 1  138 ? -15.605 4.657   134.551 1.00 20.41  ? 236  THR B CG2 1 
ATOM   6265  N  N   . ASN B 1  139 ? -17.680 4.007   138.841 1.00 22.53  ? 237  ASN B N   1 
ATOM   6266  C  CA  . ASN B 1  139 ? -17.855 3.314   140.113 1.00 24.40  ? 237  ASN B CA  1 
ATOM   6267  C  C   . ASN B 1  139 ? -19.193 3.645   140.761 1.00 25.24  ? 237  ASN B C   1 
ATOM   6268  O  O   . ASN B 1  139 ? -19.276 3.790   141.981 1.00 27.49  ? 237  ASN B O   1 
ATOM   6269  C  CB  . ASN B 1  139 ? -16.729 3.672   141.092 1.00 27.65  ? 237  ASN B CB  1 
ATOM   6270  C  CG  . ASN B 1  139 ? -15.386 3.085   140.697 1.00 28.69  ? 237  ASN B CG  1 
ATOM   6271  O  OD1 . ASN B 1  139 ? -15.207 2.589   139.588 1.00 32.23  ? 237  ASN B OD1 1 
ATOM   6272  N  ND2 . ASN B 1  139 ? -14.428 3.148   141.613 1.00 26.47  ? 237  ASN B ND2 1 
ATOM   6273  N  N   . MET B 1  140 ? -20.239 3.767   139.951 1.00 28.61  ? 238  MET B N   1 
ATOM   6274  C  CA  . MET B 1  140 ? -21.562 4.065   140.489 1.00 28.24  ? 238  MET B CA  1 
ATOM   6275  C  C   . MET B 1  140 ? -22.206 2.813   141.064 1.00 31.08  ? 238  MET B C   1 
ATOM   6276  O  O   . MET B 1  140 ? -22.018 1.709   140.553 1.00 30.99  ? 238  MET B O   1 
ATOM   6277  C  CB  . MET B 1  140 ? -22.466 4.680   139.420 1.00 27.65  ? 238  MET B CB  1 
ATOM   6278  C  CG  . MET B 1  140 ? -21.927 5.964   138.826 1.00 25.12  ? 238  MET B CG  1 
ATOM   6279  S  SD  . MET B 1  140 ? -23.147 6.787   137.799 1.00 44.20  ? 238  MET B SD  1 
ATOM   6280  C  CE  . MET B 1  140 ? -24.355 7.255   139.036 1.00 22.62  ? 238  MET B CE  1 
ATOM   6281  N  N   . LYS B 1  141 ? -22.977 3.002   142.129 1.00 32.63  ? 239  LYS B N   1 
ATOM   6282  C  CA  . LYS B 1  141 ? -23.569 1.894   142.860 1.00 32.72  ? 239  LYS B CA  1 
ATOM   6283  C  C   . LYS B 1  141 ? -24.977 2.255   143.306 1.00 32.69  ? 239  LYS B C   1 
ATOM   6284  O  O   . LYS B 1  141 ? -25.267 3.425   143.560 1.00 29.90  ? 239  LYS B O   1 
ATOM   6285  C  CB  . LYS B 1  141 ? -22.723 1.547   144.088 1.00 37.57  ? 239  LYS B CB  1 
ATOM   6286  C  CG  . LYS B 1  141 ? -21.293 1.127   143.799 1.00 45.98  ? 239  LYS B CG  1 
ATOM   6287  C  CD  . LYS B 1  141 ? -20.505 1.003   145.095 1.00 53.78  ? 239  LYS B CD  1 
ATOM   6288  C  CE  . LYS B 1  141 ? -19.113 0.443   144.862 1.00 60.23  ? 239  LYS B CE  1 
ATOM   6289  N  NZ  . LYS B 1  141 ? -18.383 0.256   146.148 1.00 63.84  ? 239  LYS B NZ  1 
ATOM   6290  N  N   . PRO B 1  142 ? -25.863 1.254   143.397 1.00 32.19  ? 240  PRO B N   1 
ATOM   6291  C  CA  . PRO B 1  142 ? -27.163 1.491   144.028 1.00 29.65  ? 240  PRO B CA  1 
ATOM   6292  C  C   . PRO B 1  142 ? -26.953 1.848   145.494 1.00 29.79  ? 240  PRO B C   1 
ATOM   6293  O  O   . PRO B 1  142 ? -26.197 1.160   146.181 1.00 29.59  ? 240  PRO B O   1 
ATOM   6294  C  CB  . PRO B 1  142 ? -27.887 0.149   143.876 1.00 25.92  ? 240  PRO B CB  1 
ATOM   6295  C  CG  . PRO B 1  142 ? -27.188 -0.539  142.748 1.00 27.39  ? 240  PRO B CG  1 
ATOM   6296  C  CD  . PRO B 1  142 ? -25.757 -0.104  142.839 1.00 30.14  ? 240  PRO B CD  1 
ATOM   6297  N  N   . GLY B 1  143 ? -27.593 2.910   145.968 1.00 29.72  ? 241  GLY B N   1 
ATOM   6298  C  CA  . GLY B 1  143 ? -27.383 3.340   147.336 1.00 30.16  ? 241  GLY B CA  1 
ATOM   6299  C  C   . GLY B 1  143 ? -28.401 4.329   147.859 1.00 31.44  ? 241  GLY B C   1 
ATOM   6300  O  O   . GLY B 1  143 ? -29.406 4.617   147.210 1.00 34.86  ? 241  GLY B O   1 
ATOM   6301  N  N   . LYS B 1  144 ? -28.130 4.850   149.050 1.00 28.72  ? 242  LYS B N   1 
ATOM   6302  C  CA  . LYS B 1  144 ? -29.021 5.796   149.703 1.00 27.00  ? 242  LYS B CA  1 
ATOM   6303  C  C   . LYS B 1  144 ? -28.271 7.055   150.121 1.00 25.57  ? 242  LYS B C   1 
ATOM   6304  O  O   . LYS B 1  144 ? -27.049 7.043   150.264 1.00 23.81  ? 242  LYS B O   1 
ATOM   6305  C  CB  . LYS B 1  144 ? -29.673 5.154   150.930 1.00 27.63  ? 242  LYS B CB  1 
ATOM   6306  C  CG  . LYS B 1  144 ? -30.541 3.939   150.638 1.00 32.03  ? 242  LYS B CG  1 
ATOM   6307  C  CD  . LYS B 1  144 ? -31.067 3.341   151.936 1.00 36.22  ? 242  LYS B CD  1 
ATOM   6308  C  CE  . LYS B 1  144 ? -32.043 2.204   151.688 1.00 40.66  ? 242  LYS B CE  1 
ATOM   6309  N  NZ  . LYS B 1  144 ? -33.377 2.696   151.247 1.00 45.46  ? 242  LYS B NZ  1 
ATOM   6310  N  N   . ILE B 1  145 ? -29.011 8.141   150.315 1.00 23.50  ? 243  ILE B N   1 
ATOM   6311  C  CA  . ILE B 1  145 ? -28.428 9.383   150.801 1.00 18.89  ? 243  ILE B CA  1 
ATOM   6312  C  C   . ILE B 1  145 ? -29.103 9.807   152.099 1.00 23.69  ? 243  ILE B C   1 
ATOM   6313  O  O   . ILE B 1  145 ? -30.329 9.836   152.189 1.00 29.45  ? 243  ILE B O   1 
ATOM   6314  C  CB  . ILE B 1  145 ? -28.552 10.519  149.770 1.00 20.53  ? 243  ILE B CB  1 
ATOM   6315  C  CG1 . ILE B 1  145 ? -27.881 10.131  148.455 1.00 24.43  ? 243  ILE B CG1 1 
ATOM   6316  C  CG2 . ILE B 1  145 ? -27.927 11.788  150.305 1.00 16.80  ? 243  ILE B CG2 1 
ATOM   6317  C  CD1 . ILE B 1  145 ? -28.096 11.139  147.352 1.00 26.17  ? 243  ILE B CD1 1 
ATOM   6318  N  N   . PHE B 1  146 ? -28.298 10.136  153.102 1.00 25.26  ? 244  PHE B N   1 
ATOM   6319  C  CA  . PHE B 1  146 ? -28.822 10.610  154.374 1.00 22.08  ? 244  PHE B CA  1 
ATOM   6320  C  C   . PHE B 1  146 ? -28.272 11.999  154.670 1.00 25.37  ? 244  PHE B C   1 
ATOM   6321  O  O   . PHE B 1  146 ? -27.217 12.374  154.161 1.00 25.27  ? 244  PHE B O   1 
ATOM   6322  C  CB  . PHE B 1  146 ? -28.472 9.633   155.496 1.00 21.62  ? 244  PHE B CB  1 
ATOM   6323  C  CG  . PHE B 1  146 ? -29.076 8.268   155.316 1.00 21.95  ? 244  PHE B CG  1 
ATOM   6324  C  CD1 . PHE B 1  146 ? -30.326 7.975   155.838 1.00 19.36  ? 244  PHE B CD1 1 
ATOM   6325  C  CD2 . PHE B 1  146 ? -28.399 7.281   154.619 1.00 19.04  ? 244  PHE B CD2 1 
ATOM   6326  C  CE1 . PHE B 1  146 ? -30.889 6.723   155.670 1.00 20.25  ? 244  PHE B CE1 1 
ATOM   6327  C  CE2 . PHE B 1  146 ? -28.955 6.027   154.449 1.00 20.53  ? 244  PHE B CE2 1 
ATOM   6328  C  CZ  . PHE B 1  146 ? -30.202 5.748   154.976 1.00 20.53  ? 244  PHE B CZ  1 
ATOM   6329  N  N   . ILE B 1  147 ? -28.988 12.760  155.490 1.00 27.62  ? 245  ILE B N   1 
ATOM   6330  C  CA  . ILE B 1  147 ? -28.586 14.128  155.793 1.00 24.90  ? 245  ILE B CA  1 
ATOM   6331  C  C   . ILE B 1  147 ? -28.694 14.416  157.290 1.00 23.05  ? 245  ILE B C   1 
ATOM   6332  O  O   . ILE B 1  147 ? -29.579 13.903  157.978 1.00 25.34  ? 245  ILE B O   1 
ATOM   6333  C  CB  . ILE B 1  147 ? -29.438 15.152  154.994 1.00 26.49  ? 245  ILE B CB  1 
ATOM   6334  C  CG1 . ILE B 1  147 ? -28.858 16.564  155.115 1.00 27.94  ? 245  ILE B CG1 1 
ATOM   6335  C  CG2 . ILE B 1  147 ? -30.899 15.119  155.433 1.00 22.58  ? 245  ILE B CG2 1 
ATOM   6336  C  CD1 . ILE B 1  147 ? -29.498 17.567  154.180 1.00 25.16  ? 245  ILE B CD1 1 
ATOM   6337  N  N   . ASN B 1  148 ? -27.768 15.219  157.797 1.00 21.09  ? 246  ASN B N   1 
ATOM   6338  C  CA  . ASN B 1  148 ? -27.765 15.585  159.204 1.00 21.03  ? 246  ASN B CA  1 
ATOM   6339  C  C   . ASN B 1  148 ? -27.225 16.997  159.394 1.00 19.09  ? 246  ASN B C   1 
ATOM   6340  O  O   . ASN B 1  148 ? -26.426 17.480  158.591 1.00 17.62  ? 246  ASN B O   1 
ATOM   6341  C  CB  . ASN B 1  148 ? -26.936 14.590  160.018 1.00 20.23  ? 246  ASN B CB  1 
ATOM   6342  C  CG  . ASN B 1  148 ? -27.358 14.531  161.473 1.00 19.99  ? 246  ASN B CG  1 
ATOM   6343  O  OD1 . ASN B 1  148 ? -28.147 15.355  161.939 1.00 17.46  ? 246  ASN B OD1 1 
ATOM   6344  N  ND2 . ASN B 1  148 ? -26.831 13.554  162.201 1.00 20.40  ? 246  ASN B ND2 1 
ATOM   6345  N  N   . LYS B 1  149 ? -27.666 17.654  160.460 1.00 20.99  ? 247  LYS B N   1 
ATOM   6346  C  CA  . LYS B 1  149 ? -27.258 19.025  160.738 1.00 19.67  ? 247  LYS B CA  1 
ATOM   6347  C  C   . LYS B 1  149 ? -26.880 19.177  162.206 1.00 21.01  ? 247  LYS B C   1 
ATOM   6348  O  O   . LYS B 1  149 ? -27.473 18.542  163.080 1.00 20.61  ? 247  LYS B O   1 
ATOM   6349  C  CB  . LYS B 1  149 ? -28.372 20.012  160.372 1.00 19.15  ? 247  LYS B CB  1 
ATOM   6350  C  CG  . LYS B 1  149 ? -29.080 19.701  159.060 1.00 25.07  ? 247  LYS B CG  1 
ATOM   6351  C  CD  . LYS B 1  149 ? -30.164 20.718  158.735 1.00 32.23  ? 247  LYS B CD  1 
ATOM   6352  C  CE  . LYS B 1  149 ? -31.074 20.206  157.625 1.00 33.68  ? 247  LYS B CE  1 
ATOM   6353  N  NZ  . LYS B 1  149 ? -32.157 21.174  157.295 1.00 32.88  ? 247  LYS B NZ  1 
ATOM   6354  N  N   . GLY B 1  150 ? -25.888 20.022  162.470 1.00 23.15  ? 248  GLY B N   1 
ATOM   6355  C  CA  . GLY B 1  150 ? -25.457 20.295  163.828 1.00 14.48  ? 248  GLY B CA  1 
ATOM   6356  C  C   . GLY B 1  150 ? -24.540 21.498  163.878 1.00 19.13  ? 248  GLY B C   1 
ATOM   6357  O  O   . GLY B 1  150 ? -23.953 21.879  162.866 1.00 21.96  ? 248  GLY B O   1 
ATOM   6358  N  N   . ASN B 1  151 ? -24.410 22.096  165.058 1.00 19.27  ? 249  ASN B N   1 
ATOM   6359  C  CA  . ASN B 1  151 ? -23.567 23.273  165.230 1.00 21.62  ? 249  ASN B CA  1 
ATOM   6360  C  C   . ASN B 1  151 ? -22.114 22.927  165.535 1.00 25.16  ? 249  ASN B C   1 
ATOM   6361  O  O   . ASN B 1  151 ? -21.827 21.922  166.184 1.00 24.93  ? 249  ASN B O   1 
ATOM   6362  C  CB  . ASN B 1  151 ? -24.124 24.165  166.340 1.00 23.62  ? 249  ASN B CB  1 
ATOM   6363  C  CG  . ASN B 1  151 ? -25.405 24.863  165.938 1.00 29.53  ? 249  ASN B CG  1 
ATOM   6364  O  OD1 . ASN B 1  151 ? -25.691 25.028  164.752 1.00 30.71  ? 249  ASN B OD1 1 
ATOM   6365  N  ND2 . ASN B 1  151 ? -26.187 25.279  166.927 1.00 34.79  ? 249  ASN B ND2 1 
ATOM   6366  N  N   . VAL B 1  152 ? -21.205 23.768  165.050 1.00 29.04  ? 250  VAL B N   1 
ATOM   6367  C  CA  . VAL B 1  152 ? -19.785 23.640  165.357 1.00 26.39  ? 250  VAL B CA  1 
ATOM   6368  C  C   . VAL B 1  152 ? -19.318 24.856  166.152 1.00 27.06  ? 250  VAL B C   1 
ATOM   6369  O  O   . VAL B 1  152 ? -19.354 25.985  165.658 1.00 28.82  ? 250  VAL B O   1 
ATOM   6370  C  CB  . VAL B 1  152 ? -18.937 23.501  164.077 1.00 22.75  ? 250  VAL B CB  1 
ATOM   6371  C  CG1 . VAL B 1  152 ? -17.476 23.271  164.427 1.00 20.80  ? 250  VAL B CG1 1 
ATOM   6372  C  CG2 . VAL B 1  152 ? -19.470 22.369  163.211 1.00 22.65  ? 250  VAL B CG2 1 
ATOM   6373  N  N   . ASP B 1  153 ? -18.869 24.621  167.381 1.00 24.59  ? 251  ASP B N   1 
ATOM   6374  C  CA  . ASP B 1  153 ? -18.533 25.712  168.292 1.00 24.07  ? 251  ASP B CA  1 
ATOM   6375  C  C   . ASP B 1  153 ? -17.044 26.051  168.301 1.00 21.79  ? 251  ASP B C   1 
ATOM   6376  O  O   . ASP B 1  153 ? -16.195 25.174  168.151 1.00 18.50  ? 251  ASP B O   1 
ATOM   6377  C  CB  . ASP B 1  153 ? -18.984 25.368  169.713 1.00 30.38  ? 251  ASP B CB  1 
ATOM   6378  C  CG  . ASP B 1  153 ? -20.485 25.490  169.896 1.00 36.46  ? 251  ASP B CG  1 
ATOM   6379  O  OD1 . ASP B 1  153 ? -21.091 26.392  169.280 1.00 38.81  ? 251  ASP B OD1 1 
ATOM   6380  O  OD2 . ASP B 1  153 ? -21.058 24.683  170.658 1.00 38.07  ? 251  ASP B OD2 1 
ATOM   6381  N  N   . GLY B 1  154 ? -16.743 27.338  168.460 1.00 22.76  ? 252  GLY B N   1 
ATOM   6382  C  CA  . GLY B 1  154 ? -15.393 27.795  168.743 1.00 23.31  ? 252  GLY B CA  1 
ATOM   6383  C  C   . GLY B 1  154 ? -14.368 27.729  167.624 1.00 22.50  ? 252  GLY B C   1 
ATOM   6384  O  O   . GLY B 1  154 ? -13.167 27.704  167.888 1.00 24.28  ? 252  GLY B O   1 
ATOM   6385  N  N   . VAL B 1  155 ? -14.824 27.706  166.377 1.00 22.37  ? 253  VAL B N   1 
ATOM   6386  C  CA  . VAL B 1  155 ? -13.904 27.635  165.248 1.00 19.11  ? 253  VAL B CA  1 
ATOM   6387  C  C   . VAL B 1  155 ? -14.024 28.832  164.315 1.00 19.52  ? 253  VAL B C   1 
ATOM   6388  O  O   . VAL B 1  155 ? -13.328 28.907  163.303 1.00 20.84  ? 253  VAL B O   1 
ATOM   6389  C  CB  . VAL B 1  155 ? -14.127 26.356  164.421 1.00 19.88  ? 253  VAL B CB  1 
ATOM   6390  C  CG1 . VAL B 1  155 ? -13.878 25.126  165.272 1.00 19.01  ? 253  VAL B CG1 1 
ATOM   6391  C  CG2 . VAL B 1  155 ? -15.535 26.339  163.844 1.00 19.56  ? 253  VAL B CG2 1 
ATOM   6392  N  N   . GLN B 1  156 ? -14.889 29.780  164.656 1.00 20.85  ? 254  GLN B N   1 
ATOM   6393  C  CA  . GLN B 1  156 ? -15.125 30.904  163.761 1.00 25.38  ? 254  GLN B CA  1 
ATOM   6394  C  C   . GLN B 1  156 ? -15.454 32.214  164.469 1.00 25.55  ? 254  GLN B C   1 
ATOM   6395  O  O   . GLN B 1  156 ? -16.104 32.228  165.514 1.00 27.55  ? 254  GLN B O   1 
ATOM   6396  C  CB  . GLN B 1  156 ? -16.252 30.551  162.788 1.00 28.39  ? 254  GLN B CB  1 
ATOM   6397  C  CG  . GLN B 1  156 ? -17.440 29.858  163.435 1.00 34.19  ? 254  GLN B CG  1 
ATOM   6398  C  CD  . GLN B 1  156 ? -18.557 29.569  162.450 1.00 29.74  ? 254  GLN B CD  1 
ATOM   6399  O  OE1 . GLN B 1  156 ? -19.735 29.620  162.798 1.00 33.66  ? 254  GLN B OE1 1 
ATOM   6400  N  NE2 . GLN B 1  156 ? -18.190 29.260  161.212 1.00 22.73  ? 254  GLN B NE2 1 
ATOM   6401  N  N   . ILE B 1  157 ? -14.984 33.315  163.888 1.00 22.73  ? 255  ILE B N   1 
ATOM   6402  C  CA  . ILE B 1  157 ? -15.409 34.650  164.292 1.00 22.76  ? 255  ILE B CA  1 
ATOM   6403  C  C   . ILE B 1  157 ? -15.812 35.435  163.051 1.00 20.42  ? 255  ILE B C   1 
ATOM   6404  O  O   . ILE B 1  157 ? -15.430 35.078  161.936 1.00 18.04  ? 255  ILE B O   1 
ATOM   6405  C  CB  . ILE B 1  157 ? -14.301 35.425  165.040 1.00 21.82  ? 255  ILE B CB  1 
ATOM   6406  C  CG1 . ILE B 1  157 ? -13.098 35.669  164.128 1.00 19.60  ? 255  ILE B CG1 1 
ATOM   6407  C  CG2 . ILE B 1  157 ? -13.902 34.701  166.319 1.00 23.42  ? 255  ILE B CG2 1 
ATOM   6408  C  CD1 . ILE B 1  157 ? -12.070 36.607  164.720 1.00 21.69  ? 255  ILE B CD1 1 
ATOM   6409  N  N   . ASN B 1  158 ? -16.579 36.503  163.244 1.00 19.05  ? 256  ASN B N   1 
ATOM   6410  C  CA  . ASN B 1  158 ? -16.916 37.399  162.145 1.00 16.47  ? 256  ASN B CA  1 
ATOM   6411  C  C   . ASN B 1  158 ? -15.833 38.462  162.012 1.00 18.66  ? 256  ASN B C   1 
ATOM   6412  O  O   . ASN B 1  158 ? -15.553 39.192  162.963 1.00 23.85  ? 256  ASN B O   1 
ATOM   6413  C  CB  . ASN B 1  158 ? -18.285 38.044  162.368 1.00 20.27  ? 256  ASN B CB  1 
ATOM   6414  C  CG  . ASN B 1  158 ? -18.846 38.683  161.107 1.00 23.59  ? 256  ASN B CG  1 
ATOM   6415  O  OD1 . ASN B 1  158 ? -18.170 39.462  160.436 1.00 24.01  ? 256  ASN B OD1 1 
ATOM   6416  N  ND2 . ASN B 1  158 ? -20.094 38.359  160.785 1.00 22.45  ? 256  ASN B ND2 1 
ATOM   6417  N  N   . ARG B 1  159 ? -15.222 38.548  160.835 1.00 14.65  ? 257  ARG B N   1 
ATOM   6418  C  CA  . ARG B 1  159 ? -14.093 39.451  160.636 1.00 14.24  ? 257  ARG B CA  1 
ATOM   6419  C  C   . ARG B 1  159 ? -14.561 40.841  160.215 1.00 14.47  ? 257  ARG B C   1 
ATOM   6420  O  O   . ARG B 1  159 ? -13.751 41.732  159.959 1.00 13.54  ? 257  ARG B O   1 
ATOM   6421  C  CB  . ARG B 1  159 ? -13.124 38.874  159.603 1.00 14.58  ? 257  ARG B CB  1 
ATOM   6422  C  CG  . ARG B 1  159 ? -13.664 38.808  158.189 1.00 16.54  ? 257  ARG B CG  1 
ATOM   6423  C  CD  . ARG B 1  159 ? -12.665 38.129  157.269 1.00 16.93  ? 257  ARG B CD  1 
ATOM   6424  N  NE  . ARG B 1  159 ? -13.070 38.189  155.869 1.00 19.35  ? 257  ARG B NE  1 
ATOM   6425  C  CZ  . ARG B 1  159 ? -12.387 37.638  154.871 1.00 19.17  ? 257  ARG B CZ  1 
ATOM   6426  N  NH1 . ARG B 1  159 ? -11.262 36.979  155.120 1.00 16.24  ? 257  ARG B NH1 1 
ATOM   6427  N  NH2 . ARG B 1  159 ? -12.829 37.744  153.626 1.00 16.98  ? 257  ARG B NH2 1 
ATOM   6428  N  N   . SER B 1  160 ? -15.876 41.014  160.148 1.00 14.34  ? 258  SER B N   1 
ATOM   6429  C  CA  . SER B 1  160 ? -16.476 42.328  159.946 1.00 17.43  ? 258  SER B CA  1 
ATOM   6430  C  C   . SER B 1  160 ? -17.742 42.450  160.791 1.00 23.73  ? 258  SER B C   1 
ATOM   6431  O  O   . SER B 1  160 ? -18.836 42.614  160.252 1.00 28.86  ? 258  SER B O   1 
ATOM   6432  C  CB  . SER B 1  160 ? -16.793 42.560  158.468 1.00 15.13  ? 258  SER B CB  1 
ATOM   6433  O  OG  . SER B 1  160 ? -15.606 42.695  157.708 1.00 13.54  ? 258  SER B OG  1 
ATOM   6434  N  N   . PRO B 1  161 ? -17.592 42.373  162.125 1.00 25.53  ? 259  PRO B N   1 
ATOM   6435  C  CA  . PRO B 1  161 ? -18.740 42.272  163.036 1.00 27.10  ? 259  PRO B CA  1 
ATOM   6436  C  C   . PRO B 1  161 ? -19.613 43.524  163.085 1.00 27.09  ? 259  PRO B C   1 
ATOM   6437  O  O   . PRO B 1  161 ? -20.824 43.412  163.278 1.00 29.65  ? 259  PRO B O   1 
ATOM   6438  C  CB  . PRO B 1  161 ? -18.082 42.027  164.396 1.00 24.60  ? 259  PRO B CB  1 
ATOM   6439  C  CG  . PRO B 1  161 ? -16.744 42.662  164.279 1.00 23.59  ? 259  PRO B CG  1 
ATOM   6440  C  CD  . PRO B 1  161 ? -16.316 42.455  162.858 1.00 22.81  ? 259  PRO B CD  1 
ATOM   6441  N  N   . TYR B 1  162 ? -19.007 44.695  162.920 1.00 23.17  ? 260  TYR B N   1 
ATOM   6442  C  CA  . TYR B 1  162 ? -19.752 45.946  162.987 1.00 21.91  ? 260  TYR B CA  1 
ATOM   6443  C  C   . TYR B 1  162 ? -20.615 46.128  161.740 1.00 21.21  ? 260  TYR B C   1 
ATOM   6444  O  O   . TYR B 1  162 ? -21.664 46.769  161.790 1.00 23.98  ? 260  TYR B O   1 
ATOM   6445  C  CB  . TYR B 1  162 ? -18.798 47.132  163.157 1.00 23.39  ? 260  TYR B CB  1 
ATOM   6446  C  CG  . TYR B 1  162 ? -18.007 47.097  164.449 1.00 28.30  ? 260  TYR B CG  1 
ATOM   6447  C  CD1 . TYR B 1  162 ? -18.581 47.488  165.654 1.00 28.77  ? 260  TYR B CD1 1 
ATOM   6448  C  CD2 . TYR B 1  162 ? -16.685 46.668  164.463 1.00 31.64  ? 260  TYR B CD2 1 
ATOM   6449  C  CE1 . TYR B 1  162 ? -17.857 47.454  166.836 1.00 31.71  ? 260  TYR B CE1 1 
ATOM   6450  C  CE2 . TYR B 1  162 ? -15.955 46.631  165.639 1.00 32.84  ? 260  TYR B CE2 1 
ATOM   6451  C  CZ  . TYR B 1  162 ? -16.545 47.025  166.821 1.00 33.55  ? 260  TYR B CZ  1 
ATOM   6452  O  OH  . TYR B 1  162 ? -15.817 46.988  167.990 1.00 30.88  ? 260  TYR B OH  1 
ATOM   6453  N  N   . SER B 1  163 ? -20.173 45.553  160.625 1.00 20.12  ? 261  SER B N   1 
ATOM   6454  C  CA  . SER B 1  163 ? -20.948 45.583  159.388 1.00 17.66  ? 261  SER B CA  1 
ATOM   6455  C  C   . SER B 1  163 ? -22.154 44.652  159.488 1.00 21.56  ? 261  SER B C   1 
ATOM   6456  O  O   . SER B 1  163 ? -23.222 44.946  158.952 1.00 21.88  ? 261  SER B O   1 
ATOM   6457  C  CB  . SER B 1  163 ? -20.071 45.197  158.190 1.00 14.51  ? 261  SER B CB  1 
ATOM   6458  O  OG  . SER B 1  163 ? -19.032 46.137  157.983 1.00 17.85  ? 261  SER B OG  1 
ATOM   6459  N  N   . TYR B 1  164 ? -21.975 43.532  160.182 1.00 17.59  ? 262  TYR B N   1 
ATOM   6460  C  CA  . TYR B 1  164 ? -23.073 42.611  160.444 1.00 17.16  ? 262  TYR B CA  1 
ATOM   6461  C  C   . TYR B 1  164 ? -24.169 43.318  161.237 1.00 19.53  ? 262  TYR B C   1 
ATOM   6462  O  O   . TYR B 1  164 ? -25.358 43.098  161.011 1.00 22.71  ? 262  TYR B O   1 
ATOM   6463  C  CB  . TYR B 1  164 ? -22.577 41.375  161.202 1.00 18.54  ? 262  TYR B CB  1 
ATOM   6464  C  CG  . TYR B 1  164 ? -23.672 40.406  161.589 1.00 15.64  ? 262  TYR B CG  1 
ATOM   6465  C  CD1 . TYR B 1  164 ? -24.114 39.437  160.698 1.00 16.50  ? 262  TYR B CD1 1 
ATOM   6466  C  CD2 . TYR B 1  164 ? -24.263 40.460  162.844 1.00 16.27  ? 262  TYR B CD2 1 
ATOM   6467  C  CE1 . TYR B 1  164 ? -25.115 38.550  161.046 1.00 18.21  ? 262  TYR B CE1 1 
ATOM   6468  C  CE2 . TYR B 1  164 ? -25.264 39.580  163.201 1.00 21.85  ? 262  TYR B CE2 1 
ATOM   6469  C  CZ  . TYR B 1  164 ? -25.688 38.626  162.299 1.00 23.06  ? 262  TYR B CZ  1 
ATOM   6470  O  OH  . TYR B 1  164 ? -26.686 37.748  162.657 1.00 20.92  ? 262  TYR B OH  1 
ATOM   6471  N  N   . LEU B 1  165 ? -23.753 44.180  162.158 1.00 18.86  ? 263  LEU B N   1 
ATOM   6472  C  CA  . LEU B 1  165 ? -24.682 44.900  163.020 1.00 19.81  ? 263  LEU B CA  1 
ATOM   6473  C  C   . LEU B 1  165 ? -25.488 45.948  162.255 1.00 23.98  ? 263  LEU B C   1 
ATOM   6474  O  O   . LEU B 1  165 ? -26.488 46.456  162.761 1.00 25.39  ? 263  LEU B O   1 
ATOM   6475  C  CB  . LEU B 1  165 ? -23.930 45.563  164.177 1.00 16.56  ? 263  LEU B CB  1 
ATOM   6476  C  CG  . LEU B 1  165 ? -23.323 44.613  165.213 1.00 16.03  ? 263  LEU B CG  1 
ATOM   6477  C  CD1 . LEU B 1  165 ? -22.439 45.370  166.189 1.00 16.50  ? 263  LEU B CD1 1 
ATOM   6478  C  CD2 . LEU B 1  165 ? -24.413 43.848  165.951 1.00 16.12  ? 263  LEU B CD2 1 
ATOM   6479  N  N   . GLN B 1  166 ? -25.049 46.275  161.043 1.00 25.77  ? 264  GLN B N   1 
ATOM   6480  C  CA  . GLN B 1  166 ? -25.770 47.229  160.204 1.00 22.55  ? 264  GLN B CA  1 
ATOM   6481  C  C   . GLN B 1  166 ? -27.071 46.627  159.683 1.00 24.64  ? 264  GLN B C   1 
ATOM   6482  O  O   . GLN B 1  166 ? -27.980 47.347  159.272 1.00 31.42  ? 264  GLN B O   1 
ATOM   6483  C  CB  . GLN B 1  166 ? -24.897 47.690  159.037 1.00 22.04  ? 264  GLN B CB  1 
ATOM   6484  C  CG  . GLN B 1  166 ? -23.658 48.461  159.462 1.00 27.31  ? 264  GLN B CG  1 
ATOM   6485  C  CD  . GLN B 1  166 ? -23.989 49.672  160.311 1.00 28.09  ? 264  GLN B CD  1 
ATOM   6486  O  OE1 . GLN B 1  166 ? -24.725 50.561  159.885 1.00 28.29  ? 264  GLN B OE1 1 
ATOM   6487  N  NE2 . GLN B 1  166 ? -23.442 49.713  161.521 1.00 30.04  ? 264  GLN B NE2 1 
ATOM   6488  N  N   . ASN B 1  167 ? -27.147 45.301  159.692 1.00 21.33  ? 265  ASN B N   1 
ATOM   6489  C  CA  . ASN B 1  167 ? -28.364 44.600  159.307 1.00 18.55  ? 265  ASN B CA  1 
ATOM   6490  C  C   . ASN B 1  167 ? -29.469 44.895  160.315 1.00 19.31  ? 265  ASN B C   1 
ATOM   6491  O  O   . ASN B 1  167 ? -29.181 45.174  161.480 1.00 19.06  ? 265  ASN B O   1 
ATOM   6492  C  CB  . ASN B 1  167 ? -28.105 43.096  159.204 1.00 17.36  ? 265  ASN B CB  1 
ATOM   6493  C  CG  . ASN B 1  167 ? -27.157 42.749  158.076 1.00 19.03  ? 265  ASN B CG  1 
ATOM   6494  O  OD1 . ASN B 1  167 ? -27.338 43.190  156.941 1.00 19.64  ? 265  ASN B OD1 1 
ATOM   6495  N  ND2 . ASN B 1  167 ? -26.134 41.962  158.383 1.00 17.12  ? 265  ASN B ND2 1 
ATOM   6496  N  N   . PRO B 1  168 ? -30.737 44.850  159.868 1.00 20.99  ? 266  PRO B N   1 
ATOM   6497  C  CA  . PRO B 1  168 ? -31.870 45.171  160.746 1.00 20.91  ? 266  PRO B CA  1 
ATOM   6498  C  C   . PRO B 1  168 ? -31.878 44.352  162.033 1.00 23.79  ? 266  PRO B C   1 
ATOM   6499  O  O   . PRO B 1  168 ? -31.635 43.145  162.003 1.00 23.50  ? 266  PRO B O   1 
ATOM   6500  C  CB  . PRO B 1  168 ? -33.086 44.834  159.879 1.00 20.28  ? 266  PRO B CB  1 
ATOM   6501  C  CG  . PRO B 1  168 ? -32.605 45.040  158.485 1.00 18.80  ? 266  PRO B CG  1 
ATOM   6502  C  CD  . PRO B 1  168 ? -31.178 44.570  158.490 1.00 19.20  ? 266  PRO B CD  1 
ATOM   6503  N  N   . GLN B 1  169 ? -32.143 45.023  163.149 1.00 29.09  ? 267  GLN B N   1 
ATOM   6504  C  CA  . GLN B 1  169 ? -32.173 44.386  164.461 1.00 35.57  ? 267  GLN B CA  1 
ATOM   6505  C  C   . GLN B 1  169 ? -33.149 43.213  164.497 1.00 33.62  ? 267  GLN B C   1 
ATOM   6506  O  O   . GLN B 1  169 ? -32.834 42.153  165.038 1.00 35.45  ? 267  GLN B O   1 
ATOM   6507  C  CB  . GLN B 1  169 ? -32.525 45.412  165.542 1.00 42.99  ? 267  GLN B CB  1 
ATOM   6508  C  CG  . GLN B 1  169 ? -33.071 44.807  166.822 1.00 51.63  ? 267  GLN B CG  1 
ATOM   6509  C  CD  . GLN B 1  169 ? -33.262 45.844  167.909 1.00 61.21  ? 267  GLN B CD  1 
ATOM   6510  O  OE1 . GLN B 1  169 ? -33.838 46.907  167.675 1.00 65.52  ? 267  GLN B OE1 1 
ATOM   6511  N  NE2 . GLN B 1  169 ? -32.773 45.544  169.106 1.00 63.14  ? 267  GLN B NE2 1 
ATOM   6512  N  N   . SER B 1  170 ? -34.331 43.412  163.921 1.00 31.88  ? 268  SER B N   1 
ATOM   6513  C  CA  . SER B 1  170 ? -35.359 42.375  163.901 1.00 31.80  ? 268  SER B CA  1 
ATOM   6514  C  C   . SER B 1  170 ? -34.875 41.127  163.166 1.00 30.74  ? 268  SER B C   1 
ATOM   6515  O  O   . SER B 1  170 ? -35.213 40.004  163.543 1.00 33.32  ? 268  SER B O   1 
ATOM   6516  C  CB  . SER B 1  170 ? -36.642 42.903  163.254 1.00 28.65  ? 268  SER B CB  1 
ATOM   6517  O  OG  . SER B 1  170 ? -36.392 43.395  161.948 1.00 29.93  ? 268  SER B OG  1 
ATOM   6518  N  N   . GLU B 1  171 ? -34.082 41.331  162.119 1.00 25.18  ? 269  GLU B N   1 
ATOM   6519  C  CA  . GLU B 1  171 ? -33.482 40.221  161.388 1.00 25.69  ? 269  GLU B CA  1 
ATOM   6520  C  C   . GLU B 1  171 ? -32.412 39.539  162.232 1.00 25.99  ? 269  GLU B C   1 
ATOM   6521  O  O   . GLU B 1  171 ? -32.384 38.313  162.349 1.00 28.02  ? 269  GLU B O   1 
ATOM   6522  C  CB  . GLU B 1  171 ? -32.877 40.694  160.067 1.00 22.99  ? 269  GLU B CB  1 
ATOM   6523  C  CG  . GLU B 1  171 ? -32.283 39.568  159.231 1.00 17.42  ? 269  GLU B CG  1 
ATOM   6524  C  CD  . GLU B 1  171 ? -31.565 40.069  157.993 1.00 20.47  ? 269  GLU B CD  1 
ATOM   6525  O  OE1 . GLU B 1  171 ? -30.768 41.022  158.113 1.00 19.55  ? 269  GLU B OE1 1 
ATOM   6526  O  OE2 . GLU B 1  171 ? -31.802 39.514  156.899 1.00 24.47  ? 269  GLU B OE2 1 
ATOM   6527  N  N   . ARG B 1  172 ? -31.529 40.347  162.814 1.00 23.49  ? 270  ARG B N   1 
ATOM   6528  C  CA  . ARG B 1  172 ? -30.435 39.842  163.638 1.00 23.35  ? 270  ARG B CA  1 
ATOM   6529  C  C   . ARG B 1  172 ? -30.946 39.079  164.857 1.00 28.47  ? 270  ARG B C   1 
ATOM   6530  O  O   . ARG B 1  172 ? -30.280 38.167  165.350 1.00 29.84  ? 270  ARG B O   1 
ATOM   6531  C  CB  . ARG B 1  172 ? -29.524 40.994  164.074 1.00 20.48  ? 270  ARG B CB  1 
ATOM   6532  C  CG  . ARG B 1  172 ? -28.545 41.436  162.995 1.00 22.58  ? 270  ARG B CG  1 
ATOM   6533  C  CD  . ARG B 1  172 ? -27.637 42.573  163.449 1.00 26.81  ? 270  ARG B CD  1 
ATOM   6534  N  NE  . ARG B 1  172 ? -27.908 43.019  164.813 1.00 29.69  ? 270  ARG B NE  1 
ATOM   6535  C  CZ  . ARG B 1  172 ? -28.396 44.215  165.127 1.00 27.35  ? 270  ARG B CZ  1 
ATOM   6536  N  NH1 . ARG B 1  172 ? -28.670 45.094  164.173 1.00 20.95  ? 270  ARG B NH1 1 
ATOM   6537  N  NH2 . ARG B 1  172 ? -28.608 44.535  166.396 1.00 30.21  ? 270  ARG B NH2 1 
ATOM   6538  N  N   . ALA B 1  173 ? -32.128 39.455  165.337 1.00 27.15  ? 271  ALA B N   1 
ATOM   6539  C  CA  . ALA B 1  173 ? -32.740 38.800  166.491 1.00 27.29  ? 271  ALA B CA  1 
ATOM   6540  C  C   . ALA B 1  173 ? -33.158 37.366  166.175 1.00 23.58  ? 271  ALA B C   1 
ATOM   6541  O  O   . ALA B 1  173 ? -33.356 36.554  167.080 1.00 24.34  ? 271  ALA B O   1 
ATOM   6542  C  CB  . ALA B 1  173 ? -33.939 39.603  166.978 1.00 27.66  ? 271  ALA B CB  1 
ATOM   6543  N  N   . ARG B 1  174 ? -33.283 37.059  164.888 1.00 20.07  ? 272  ARG B N   1 
ATOM   6544  C  CA  . ARG B 1  174 ? -33.733 35.743  164.443 1.00 17.25  ? 272  ARG B CA  1 
ATOM   6545  C  C   . ARG B 1  174 ? -32.607 34.717  164.426 1.00 23.86  ? 272  ARG B C   1 
ATOM   6546  O  O   . ARG B 1  174 ? -32.835 33.538  164.154 1.00 26.81  ? 272  ARG B O   1 
ATOM   6547  C  CB  . ARG B 1  174 ? -34.348 35.850  163.046 1.00 16.15  ? 272  ARG B CB  1 
ATOM   6548  C  CG  . ARG B 1  174 ? -35.631 36.661  162.973 1.00 20.31  ? 272  ARG B CG  1 
ATOM   6549  C  CD  . ARG B 1  174 ? -35.979 37.021  161.533 1.00 21.39  ? 272  ARG B CD  1 
ATOM   6550  N  NE  . ARG B 1  174 ? -35.438 36.065  160.569 1.00 26.39  ? 272  ARG B NE  1 
ATOM   6551  C  CZ  . ARG B 1  174 ? -36.022 34.920  160.233 1.00 35.19  ? 272  ARG B CZ  1 
ATOM   6552  N  NH1 . ARG B 1  174 ? -37.173 34.570  160.788 1.00 43.58  ? 272  ARG B NH1 1 
ATOM   6553  N  NH2 . ARG B 1  174 ? -35.447 34.121  159.345 1.00 31.99  ? 272  ARG B NH2 1 
ATOM   6554  N  N   . TYR B 1  175 ? -31.391 35.170  164.714 1.00 26.63  ? 273  TYR B N   1 
ATOM   6555  C  CA  . TYR B 1  175 ? -30.231 34.285  164.734 1.00 26.23  ? 273  TYR B CA  1 
ATOM   6556  C  C   . TYR B 1  175 ? -29.476 34.416  166.054 1.00 27.13  ? 273  TYR B C   1 
ATOM   6557  O  O   . TYR B 1  175 ? -29.528 35.458  166.706 1.00 30.11  ? 273  TYR B O   1 
ATOM   6558  C  CB  . TYR B 1  175 ? -29.314 34.590  163.547 1.00 23.85  ? 273  TYR B CB  1 
ATOM   6559  C  CG  . TYR B 1  175 ? -30.039 34.583  162.219 1.00 19.39  ? 273  TYR B CG  1 
ATOM   6560  C  CD1 . TYR B 1  175 ? -30.228 33.401  161.515 1.00 14.19  ? 273  TYR B CD1 1 
ATOM   6561  C  CD2 . TYR B 1  175 ? -30.544 35.757  161.676 1.00 16.01  ? 273  TYR B CD2 1 
ATOM   6562  C  CE1 . TYR B 1  175 ? -30.896 33.390  160.305 1.00 14.73  ? 273  TYR B CE1 1 
ATOM   6563  C  CE2 . TYR B 1  175 ? -31.212 35.757  160.468 1.00 14.59  ? 273  TYR B CE2 1 
ATOM   6564  C  CZ  . TYR B 1  175 ? -31.385 34.573  159.786 1.00 19.60  ? 273  TYR B CZ  1 
ATOM   6565  O  OH  . TYR B 1  175 ? -32.051 34.571  158.582 1.00 14.50  ? 273  TYR B OH  1 
ATOM   6566  N  N   . SER B 1  176 ? -28.780 33.355  166.450 1.00 24.18  ? 274  SER B N   1 
ATOM   6567  C  CA  . SER B 1  176 ? -28.070 33.351  167.726 1.00 24.56  ? 274  SER B CA  1 
ATOM   6568  C  C   . SER B 1  176 ? -26.624 33.831  167.609 1.00 24.62  ? 274  SER B C   1 
ATOM   6569  O  O   . SER B 1  176 ? -25.988 34.130  168.618 1.00 29.33  ? 274  SER B O   1 
ATOM   6570  C  CB  . SER B 1  176 ? -28.102 31.952  168.346 1.00 24.96  ? 274  SER B CB  1 
ATOM   6571  O  OG  . SER B 1  176 ? -27.462 31.010  167.508 1.00 28.12  ? 274  SER B OG  1 
ATOM   6572  N  N   . SER B 1  177 ? -26.105 33.903  166.387 1.00 22.88  ? 275  SER B N   1 
ATOM   6573  C  CA  . SER B 1  177 ? -24.711 34.292  166.178 1.00 24.71  ? 275  SER B CA  1 
ATOM   6574  C  C   . SER B 1  177 ? -24.516 35.068  164.878 1.00 27.56  ? 275  SER B C   1 
ATOM   6575  O  O   . SER B 1  177 ? -25.406 35.107  164.027 1.00 31.31  ? 275  SER B O   1 
ATOM   6576  C  CB  . SER B 1  177 ? -23.805 33.059  166.174 1.00 24.89  ? 275  SER B CB  1 
ATOM   6577  O  OG  . SER B 1  177 ? -23.979 32.290  167.351 1.00 32.23  ? 275  SER B OG  1 
ATOM   6578  N  N   . ASN B 1  178 ? -23.345 35.681  164.730 1.00 22.03  ? 276  ASN B N   1 
ATOM   6579  C  CA  . ASN B 1  178 ? -23.022 36.427  163.520 1.00 20.58  ? 276  ASN B CA  1 
ATOM   6580  C  C   . ASN B 1  178 ? -22.250 35.576  162.514 1.00 20.72  ? 276  ASN B C   1 
ATOM   6581  O  O   . ASN B 1  178 ? -21.728 36.085  161.520 1.00 17.36  ? 276  ASN B O   1 
ATOM   6582  C  CB  . ASN B 1  178 ? -22.236 37.696  163.869 1.00 21.10  ? 276  ASN B CB  1 
ATOM   6583  C  CG  . ASN B 1  178 ? -20.976 37.410  164.667 1.00 22.73  ? 276  ASN B CG  1 
ATOM   6584  O  OD1 . ASN B 1  178 ? -20.616 36.256  164.896 1.00 28.43  ? 276  ASN B OD1 1 
ATOM   6585  N  ND2 . ASN B 1  178 ? -20.302 38.470  165.099 1.00 14.68  ? 276  ASN B ND2 1 
ATOM   6586  N  N   . THR B 1  179 ? -22.183 34.277  162.788 1.00 16.44  ? 277  THR B N   1 
ATOM   6587  C  CA  . THR B 1  179 ? -21.656 33.309  161.836 1.00 13.77  ? 277  THR B CA  1 
ATOM   6588  C  C   . THR B 1  179 ? -22.574 32.096  161.798 1.00 15.87  ? 277  THR B C   1 
ATOM   6589  O  O   . THR B 1  179 ? -23.223 31.772  162.792 1.00 14.24  ? 277  THR B O   1 
ATOM   6590  C  CB  . THR B 1  179 ? -20.223 32.848  162.189 1.00 14.60  ? 277  THR B CB  1 
ATOM   6591  O  OG1 . THR B 1  179 ? -20.213 32.262  163.496 1.00 20.02  ? 277  THR B OG1 1 
ATOM   6592  C  CG2 . THR B 1  179 ? -19.248 34.015  162.154 1.00 12.38  ? 277  THR B CG2 1 
ATOM   6593  N  N   . ASP B 1  180 ? -22.623 31.425  160.652 1.00 20.33  ? 278  ASP B N   1 
ATOM   6594  C  CA  . ASP B 1  180 ? -23.430 30.221  160.519 1.00 20.10  ? 278  ASP B CA  1 
ATOM   6595  C  C   . ASP B 1  180 ? -22.696 29.018  161.094 1.00 19.10  ? 278  ASP B C   1 
ATOM   6596  O  O   . ASP B 1  180 ? -21.843 28.422  160.438 1.00 12.06  ? 278  ASP B O   1 
ATOM   6597  C  CB  . ASP B 1  180 ? -23.808 29.981  159.057 1.00 23.41  ? 278  ASP B CB  1 
ATOM   6598  C  CG  . ASP B 1  180 ? -24.974 30.845  158.611 1.00 26.57  ? 278  ASP B CG  1 
ATOM   6599  O  OD1 . ASP B 1  180 ? -25.736 31.314  159.484 1.00 26.20  ? 278  ASP B OD1 1 
ATOM   6600  O  OD2 . ASP B 1  180 ? -25.125 31.063  157.390 1.00 25.71  ? 278  ASP B OD2 1 
ATOM   6601  N  N   . LYS B 1  181 ? -23.039 28.670  162.329 1.00 17.99  ? 279  LYS B N   1 
ATOM   6602  C  CA  . LYS B 1  181 ? -22.393 27.570  163.034 1.00 18.03  ? 279  LYS B CA  1 
ATOM   6603  C  C   . LYS B 1  181 ? -22.862 26.201  162.549 1.00 18.55  ? 279  LYS B C   1 
ATOM   6604  O  O   . LYS B 1  181 ? -22.224 25.185  162.829 1.00 18.35  ? 279  LYS B O   1 
ATOM   6605  C  CB  . LYS B 1  181 ? -22.638 27.690  164.539 1.00 13.13  ? 279  LYS B CB  1 
ATOM   6606  C  CG  . LYS B 1  181 ? -21.992 28.901  165.188 1.00 13.20  ? 279  LYS B CG  1 
ATOM   6607  C  CD  . LYS B 1  181 ? -22.185 28.867  166.694 1.00 21.27  ? 279  LYS B CD  1 
ATOM   6608  C  CE  . LYS B 1  181 ? -21.429 29.990  167.380 1.00 29.96  ? 279  LYS B CE  1 
ATOM   6609  N  NZ  . LYS B 1  181 ? -21.596 29.937  168.858 1.00 37.89  ? 279  LYS B NZ  1 
ATOM   6610  N  N   . GLU B 1  182 ? -23.977 26.171  161.828 1.00 19.78  ? 280  GLU B N   1 
ATOM   6611  C  CA  . GLU B 1  182 ? -24.546 24.902  161.388 1.00 21.34  ? 280  GLU B CA  1 
ATOM   6612  C  C   . GLU B 1  182 ? -23.712 24.240  160.299 1.00 18.24  ? 280  GLU B C   1 
ATOM   6613  O  O   . GLU B 1  182 ? -23.424 24.842  159.267 1.00 15.01  ? 280  GLU B O   1 
ATOM   6614  C  CB  . GLU B 1  182 ? -25.978 25.095  160.886 1.00 23.43  ? 280  GLU B CB  1 
ATOM   6615  C  CG  . GLU B 1  182 ? -26.622 23.813  160.385 1.00 27.81  ? 280  GLU B CG  1 
ATOM   6616  C  CD  . GLU B 1  182 ? -28.098 23.976  160.087 1.00 33.68  ? 280  GLU B CD  1 
ATOM   6617  O  OE1 . GLU B 1  182 ? -28.435 24.566  159.038 1.00 35.44  ? 280  GLU B OE1 1 
ATOM   6618  O  OE2 . GLU B 1  182 ? -28.922 23.510  160.901 1.00 35.26  ? 280  GLU B OE2 1 
ATOM   6619  N  N   . MET B 1  183 ? -23.313 22.998  160.549 1.00 19.71  ? 281  MET B N   1 
ATOM   6620  C  CA  . MET B 1  183 ? -22.695 22.176  159.521 1.00 21.15  ? 281  MET B CA  1 
ATOM   6621  C  C   . MET B 1  183 ? -23.743 21.229  158.949 1.00 24.01  ? 281  MET B C   1 
ATOM   6622  O  O   . MET B 1  183 ? -24.546 20.663  159.689 1.00 22.91  ? 281  MET B O   1 
ATOM   6623  C  CB  . MET B 1  183 ? -21.510 21.390  160.089 1.00 20.36  ? 281  MET B CB  1 
ATOM   6624  C  CG  . MET B 1  183 ? -20.866 20.429  159.100 1.00 22.07  ? 281  MET B CG  1 
ATOM   6625  S  SD  . MET B 1  183 ? -19.555 19.428  159.836 1.00 23.07  ? 281  MET B SD  1 
ATOM   6626  C  CE  . MET B 1  183 ? -18.280 20.658  160.097 1.00 12.58  ? 281  MET B CE  1 
ATOM   6627  N  N   . ILE B 1  184 ? -23.736 21.054  157.633 1.00 26.12  ? 282  ILE B N   1 
ATOM   6628  C  CA  . ILE B 1  184 ? -24.657 20.120  157.002 1.00 22.68  ? 282  ILE B CA  1 
ATOM   6629  C  C   . ILE B 1  184 ? -23.884 19.010  156.304 1.00 22.84  ? 282  ILE B C   1 
ATOM   6630  O  O   . ILE B 1  184 ? -23.179 19.246  155.323 1.00 24.62  ? 282  ILE B O   1 
ATOM   6631  C  CB  . ILE B 1  184 ? -25.586 20.829  156.002 1.00 18.21  ? 282  ILE B CB  1 
ATOM   6632  C  CG1 . ILE B 1  184 ? -26.561 21.735  156.755 1.00 21.64  ? 282  ILE B CG1 1 
ATOM   6633  C  CG2 . ILE B 1  184 ? -26.355 19.814  155.175 1.00 17.54  ? 282  ILE B CG2 1 
ATOM   6634  C  CD1 . ILE B 1  184 ? -27.343 22.670  155.871 1.00 25.55  ? 282  ILE B CD1 1 
ATOM   6635  N  N   . VAL B 1  185 ? -24.012 17.799  156.837 1.00 20.78  ? 283  VAL B N   1 
ATOM   6636  C  CA  . VAL B 1  185 ? -23.318 16.638  156.299 1.00 21.47  ? 283  VAL B CA  1 
ATOM   6637  C  C   . VAL B 1  185 ? -24.245 15.811  155.417 1.00 20.98  ? 283  VAL B C   1 
ATOM   6638  O  O   . VAL B 1  185 ? -25.366 15.494  155.807 1.00 20.37  ? 283  VAL B O   1 
ATOM   6639  C  CB  . VAL B 1  185 ? -22.756 15.743  157.426 1.00 20.93  ? 283  VAL B CB  1 
ATOM   6640  C  CG1 . VAL B 1  185 ? -22.102 14.496  156.845 1.00 19.46  ? 283  VAL B CG1 1 
ATOM   6641  C  CG2 . VAL B 1  185 ? -21.762 16.517  158.275 1.00 17.92  ? 283  VAL B CG2 1 
ATOM   6642  N  N   . LEU B 1  186 ? -23.774 15.473  154.222 1.00 21.67  ? 284  LEU B N   1 
ATOM   6643  C  CA  . LEU B 1  186 ? -24.522 14.598  153.330 1.00 19.40  ? 284  LEU B CA  1 
ATOM   6644  C  C   . LEU B 1  186 ? -23.856 13.229  153.286 1.00 17.90  ? 284  LEU B C   1 
ATOM   6645  O  O   . LEU B 1  186 ? -22.734 13.095  152.804 1.00 14.81  ? 284  LEU B O   1 
ATOM   6646  C  CB  . LEU B 1  186 ? -24.612 15.197  151.927 1.00 21.77  ? 284  LEU B CB  1 
ATOM   6647  C  CG  . LEU B 1  186 ? -25.748 14.642  151.071 1.00 24.08  ? 284  LEU B CG  1 
ATOM   6648  C  CD1 . LEU B 1  186 ? -27.084 15.024  151.689 1.00 27.49  ? 284  LEU B CD1 1 
ATOM   6649  C  CD2 . LEU B 1  186 ? -25.650 15.129  149.634 1.00 22.05  ? 284  LEU B CD2 1 
ATOM   6650  N  N   . LYS B 1  187 ? -24.547 12.216  153.799 1.00 17.73  ? 285  LYS B N   1 
ATOM   6651  C  CA  . LYS B 1  187 ? -23.974 10.880  153.932 1.00 16.02  ? 285  LYS B CA  1 
ATOM   6652  C  C   . LYS B 1  187 ? -24.402 9.967   152.788 1.00 16.53  ? 285  LYS B C   1 
ATOM   6653  O  O   . LYS B 1  187 ? -25.576 9.922   152.421 1.00 30.37  ? 285  LYS B O   1 
ATOM   6654  C  CB  . LYS B 1  187 ? -24.376 10.272  155.277 1.00 20.04  ? 285  LYS B CB  1 
ATOM   6655  C  CG  . LYS B 1  187 ? -24.109 8.783   155.419 1.00 17.11  ? 285  LYS B CG  1 
ATOM   6656  C  CD  . LYS B 1  187 ? -24.351 8.337   156.852 1.00 17.50  ? 285  LYS B CD  1 
ATOM   6657  C  CE  . LYS B 1  187 ? -23.913 6.903   157.079 1.00 20.73  ? 285  LYS B CE  1 
ATOM   6658  N  NZ  . LYS B 1  187 ? -24.195 6.465   158.475 1.00 22.25  ? 285  LYS B NZ  1 
ATOM   6659  N  N   . MET B 1  188 ? -23.444 9.233   152.231 1.00 16.68  ? 286  MET B N   1 
ATOM   6660  C  CA  . MET B 1  188 ? -23.717 8.360   151.094 1.00 19.16  ? 286  MET B CA  1 
ATOM   6661  C  C   . MET B 1  188 ? -23.229 6.939   151.344 1.00 22.34  ? 286  MET B C   1 
ATOM   6662  O  O   . MET B 1  188 ? -22.046 6.712   151.599 1.00 28.56  ? 286  MET B O   1 
ATOM   6663  C  CB  . MET B 1  188 ? -23.070 8.925   149.829 1.00 19.93  ? 286  MET B CB  1 
ATOM   6664  C  CG  . MET B 1  188 ? -23.743 10.184  149.310 1.00 19.12  ? 286  MET B CG  1 
ATOM   6665  S  SD  . MET B 1  188 ? -22.673 11.157  148.241 1.00 33.77  ? 286  MET B SD  1 
ATOM   6666  C  CE  . MET B 1  188 ? -21.699 12.039  149.455 1.00 45.36  ? 286  MET B CE  1 
ATOM   6667  N  N   . VAL B 1  189 ? -24.155 5.986   151.280 1.00 23.51  ? 287  VAL B N   1 
ATOM   6668  C  CA  . VAL B 1  189 ? -23.840 4.576   151.486 1.00 28.35  ? 287  VAL B CA  1 
ATOM   6669  C  C   . VAL B 1  189 ? -24.440 3.714   150.379 1.00 32.60  ? 287  VAL B C   1 
ATOM   6670  O  O   . VAL B 1  189 ? -25.398 4.120   149.721 1.00 33.92  ? 287  VAL B O   1 
ATOM   6671  C  CB  . VAL B 1  189 ? -24.359 4.069   152.853 1.00 25.56  ? 287  VAL B CB  1 
ATOM   6672  C  CG1 . VAL B 1  189 ? -23.714 4.839   153.999 1.00 22.65  ? 287  VAL B CG1 1 
ATOM   6673  C  CG2 . VAL B 1  189 ? -25.878 4.160   152.918 1.00 20.78  ? 287  VAL B CG2 1 
ATOM   6674  N  N   . ASP B 1  190 ? -23.875 2.528   150.169 1.00 31.95  ? 288  ASP B N   1 
ATOM   6675  C  CA  . ASP B 1  190 ? -24.475 1.570   149.249 1.00 35.12  ? 288  ASP B CA  1 
ATOM   6676  C  C   . ASP B 1  190 ? -25.559 0.765   149.960 1.00 34.65  ? 288  ASP B C   1 
ATOM   6677  O  O   . ASP B 1  190 ? -25.805 0.963   151.149 1.00 33.09  ? 288  ASP B O   1 
ATOM   6678  C  CB  . ASP B 1  190 ? -23.412 0.641   148.637 1.00 39.10  ? 288  ASP B CB  1 
ATOM   6679  C  CG  . ASP B 1  190 ? -22.652 -0.170  149.678 1.00 41.04  ? 288  ASP B CG  1 
ATOM   6680  O  OD1 . ASP B 1  190 ? -23.024 -0.150  150.871 1.00 44.24  ? 288  ASP B OD1 1 
ATOM   6681  O  OD2 . ASP B 1  190 ? -21.674 -0.843  149.290 1.00 37.72  ? 288  ASP B OD2 1 
ATOM   6682  N  N   . LEU B 1  191 ? -26.210 -0.133  149.230 1.00 35.50  ? 289  LEU B N   1 
ATOM   6683  C  CA  . LEU B 1  191 ? -27.303 -0.915  149.794 1.00 34.46  ? 289  LEU B CA  1 
ATOM   6684  C  C   . LEU B 1  191 ? -26.808 -1.932  150.816 1.00 37.36  ? 289  LEU B C   1 
ATOM   6685  O  O   . LEU B 1  191 ? -27.579 -2.425  151.639 1.00 38.53  ? 289  LEU B O   1 
ATOM   6686  C  CB  . LEU B 1  191 ? -28.083 -1.621  148.686 1.00 32.87  ? 289  LEU B CB  1 
ATOM   6687  C  CG  . LEU B 1  191 ? -28.772 -0.668  147.710 1.00 32.31  ? 289  LEU B CG  1 
ATOM   6688  C  CD1 . LEU B 1  191 ? -29.598 -1.431  146.687 1.00 34.52  ? 289  LEU B CD1 1 
ATOM   6689  C  CD2 . LEU B 1  191 ? -29.629 0.321   148.479 1.00 29.82  ? 289  LEU B CD2 1 
ATOM   6690  N  N   . ASN B 1  192 ? -25.518 -2.241  150.762 1.00 41.53  ? 290  ASN B N   1 
ATOM   6691  C  CA  . ASN B 1  192 ? -24.909 -3.129  151.744 1.00 46.64  ? 290  ASN B CA  1 
ATOM   6692  C  C   . ASN B 1  192 ? -24.590 -2.406  153.049 1.00 42.45  ? 290  ASN B C   1 
ATOM   6693  O  O   . ASN B 1  192 ? -24.142 -3.021  154.014 1.00 41.92  ? 290  ASN B O   1 
ATOM   6694  C  CB  . ASN B 1  192 ? -23.641 -3.764  151.173 1.00 51.11  ? 290  ASN B CB  1 
ATOM   6695  C  CG  . ASN B 1  192 ? -23.940 -4.829  150.136 1.00 51.98  ? 290  ASN B CG  1 
ATOM   6696  O  OD1 . ASN B 1  192 ? -24.829 -5.660  150.321 1.00 50.23  ? 290  ASN B OD1 1 
ATOM   6697  N  ND2 . ASN B 1  192 ? -23.195 -4.811  149.035 1.00 53.09  ? 290  ASN B ND2 1 
ATOM   6698  N  N   . GLY B 1  193 ? -24.821 -1.097  153.070 1.00 36.17  ? 291  GLY B N   1 
ATOM   6699  C  CA  . GLY B 1  193 ? -24.634 -0.312  154.276 1.00 32.15  ? 291  GLY B CA  1 
ATOM   6700  C  C   . GLY B 1  193 ? -23.213 0.182   154.452 1.00 31.59  ? 291  GLY B C   1 
ATOM   6701  O  O   . GLY B 1  193 ? -22.891 0.809   155.459 1.00 33.33  ? 291  GLY B O   1 
ATOM   6702  N  N   . ASP B 1  194 ? -22.360 -0.096  153.472 1.00 28.16  ? 292  ASP B N   1 
ATOM   6703  C  CA  . ASP B 1  194 ? -20.968 0.334   153.542 1.00 31.82  ? 292  ASP B CA  1 
ATOM   6704  C  C   . ASP B 1  194 ? -20.839 1.806   153.161 1.00 32.71  ? 292  ASP B C   1 
ATOM   6705  O  O   . ASP B 1  194 ? -21.673 2.344   152.434 1.00 32.18  ? 292  ASP B O   1 
ATOM   6706  C  CB  . ASP B 1  194 ? -20.093 -0.522  152.623 1.00 38.35  ? 292  ASP B CB  1 
ATOM   6707  C  CG  . ASP B 1  194 ? -19.976 -1.955  153.098 1.00 46.92  ? 292  ASP B CG  1 
ATOM   6708  O  OD1 . ASP B 1  194 ? -20.113 -2.194  154.316 1.00 51.48  ? 292  ASP B OD1 1 
ATOM   6709  O  OD2 . ASP B 1  194 ? -19.743 -2.843  152.252 1.00 50.04  ? 292  ASP B OD2 1 
ATOM   6710  N  N   . ASP B 1  195 ? -19.786 2.449   153.653 1.00 30.04  ? 293  ASP B N   1 
ATOM   6711  C  CA  . ASP B 1  195 ? -19.619 3.886   153.478 1.00 28.04  ? 293  ASP B CA  1 
ATOM   6712  C  C   . ASP B 1  195 ? -19.037 4.211   152.106 1.00 28.81  ? 293  ASP B C   1 
ATOM   6713  O  O   . ASP B 1  195 ? -17.995 3.677   151.722 1.00 30.13  ? 293  ASP B O   1 
ATOM   6714  C  CB  . ASP B 1  195 ? -18.726 4.459   154.579 1.00 27.41  ? 293  ASP B CB  1 
ATOM   6715  C  CG  . ASP B 1  195 ? -19.311 4.267   155.966 1.00 27.17  ? 293  ASP B CG  1 
ATOM   6716  O  OD1 . ASP B 1  195 ? -20.528 4.482   156.134 1.00 32.04  ? 293  ASP B OD1 1 
ATOM   6717  O  OD2 . ASP B 1  195 ? -18.557 3.904   156.892 1.00 29.44  ? 293  ASP B OD2 1 
ATOM   6718  N  N   . LEU B 1  196 ? -19.704 5.096   151.373 1.00 28.81  ? 294  LEU B N   1 
ATOM   6719  C  CA  . LEU B 1  196 ? -19.220 5.515   150.063 1.00 28.39  ? 294  LEU B CA  1 
ATOM   6720  C  C   . LEU B 1  196 ? -18.510 6.861   150.137 1.00 27.76  ? 294  LEU B C   1 
ATOM   6721  O  O   . LEU B 1  196 ? -17.397 7.013   149.634 1.00 33.75  ? 294  LEU B O   1 
ATOM   6722  C  CB  . LEU B 1  196 ? -20.369 5.590   149.057 1.00 27.40  ? 294  LEU B CB  1 
ATOM   6723  C  CG  . LEU B 1  196 ? -21.103 4.286   148.748 1.00 31.89  ? 294  LEU B CG  1 
ATOM   6724  C  CD1 . LEU B 1  196 ? -22.206 4.522   147.725 1.00 31.82  ? 294  LEU B CD1 1 
ATOM   6725  C  CD2 . LEU B 1  196 ? -20.131 3.221   148.262 1.00 32.96  ? 294  LEU B CD2 1 
ATOM   6726  N  N   . GLY B 1  197 ? -19.161 7.836   150.760 1.00 20.58  ? 295  GLY B N   1 
ATOM   6727  C  CA  . GLY B 1  197 ? -18.590 9.163   150.866 1.00 19.21  ? 295  GLY B CA  1 
ATOM   6728  C  C   . GLY B 1  197 ? -19.437 10.133  151.660 1.00 18.17  ? 295  GLY B C   1 
ATOM   6729  O  O   . GLY B 1  197 ? -20.515 9.783   152.136 1.00 19.97  ? 295  GLY B O   1 
ATOM   6730  N  N   . LEU B 1  198 ? -18.941 11.358  151.813 1.00 20.76  ? 296  LEU B N   1 
ATOM   6731  C  CA  . LEU B 1  198 ? -19.701 12.409  152.476 1.00 22.27  ? 296  LEU B CA  1 
ATOM   6732  C  C   . LEU B 1  198 ? -19.354 13.789  151.929 1.00 20.48  ? 296  LEU B C   1 
ATOM   6733  O  O   . LEU B 1  198 ? -18.252 14.015  151.437 1.00 17.99  ? 296  LEU B O   1 
ATOM   6734  C  CB  . LEU B 1  198 ? -19.473 12.360  153.996 1.00 24.74  ? 296  LEU B CB  1 
ATOM   6735  C  CG  . LEU B 1  198 ? -18.173 12.868  154.638 1.00 30.89  ? 296  LEU B CG  1 
ATOM   6736  C  CD1 . LEU B 1  198 ? -18.174 14.379  154.888 1.00 29.64  ? 296  LEU B CD1 1 
ATOM   6737  C  CD2 . LEU B 1  198 ? -17.899 12.117  155.933 1.00 35.86  ? 296  LEU B CD2 1 
ATOM   6738  N  N   . ILE B 1  199 ? -20.310 14.706  152.030 1.00 22.86  ? 297  ILE B N   1 
ATOM   6739  C  CA  . ILE B 1  199 ? -20.071 16.113  151.735 1.00 18.54  ? 297  ILE B CA  1 
ATOM   6740  C  C   . ILE B 1  199 ? -20.417 16.929  152.971 1.00 17.27  ? 297  ILE B C   1 
ATOM   6741  O  O   . ILE B 1  199 ? -21.438 16.686  153.614 1.00 24.36  ? 297  ILE B O   1 
ATOM   6742  C  CB  . ILE B 1  199 ? -20.908 16.610  150.534 1.00 20.30  ? 297  ILE B CB  1 
ATOM   6743  C  CG1 . ILE B 1  199 ? -20.699 15.711  149.315 1.00 20.10  ? 297  ILE B CG1 1 
ATOM   6744  C  CG2 . ILE B 1  199 ? -20.561 18.050  150.196 1.00 12.87  ? 297  ILE B CG2 1 
ATOM   6745  C  CD1 . ILE B 1  199 ? -21.687 15.968  148.199 1.00 13.87  ? 297  ILE B CD1 1 
ATOM   6746  N  N   . SER B 1  200 ? -19.573 17.896  153.306 1.00 16.81  ? 298  SER B N   1 
ATOM   6747  C  CA  . SER B 1  200 ? -19.804 18.712  154.490 1.00 18.31  ? 298  SER B CA  1 
ATOM   6748  C  C   . SER B 1  200 ? -19.770 20.199  154.161 1.00 17.87  ? 298  SER B C   1 
ATOM   6749  O  O   . SER B 1  200 ? -18.710 20.758  153.877 1.00 20.92  ? 298  SER B O   1 
ATOM   6750  C  CB  . SER B 1  200 ? -18.769 18.388  155.569 1.00 23.78  ? 298  SER B CB  1 
ATOM   6751  O  OG  . SER B 1  200 ? -18.802 19.344  156.613 1.00 27.22  ? 298  SER B OG  1 
ATOM   6752  N  N   . TRP B 1  201 ? -20.940 20.831  154.182 1.00 16.33  ? 299  TRP B N   1 
ATOM   6753  C  CA  . TRP B 1  201 ? -21.040 22.274  153.991 1.00 13.21  ? 299  TRP B CA  1 
ATOM   6754  C  C   . TRP B 1  201 ? -20.865 22.994  155.321 1.00 13.47  ? 299  TRP B C   1 
ATOM   6755  O  O   . TRP B 1  201 ? -21.524 22.661  156.305 1.00 17.66  ? 299  TRP B O   1 
ATOM   6756  C  CB  . TRP B 1  201 ? -22.382 22.649  153.362 1.00 15.25  ? 299  TRP B CB  1 
ATOM   6757  C  CG  . TRP B 1  201 ? -22.461 22.377  151.893 1.00 17.63  ? 299  TRP B CG  1 
ATOM   6758  C  CD1 . TRP B 1  201 ? -22.042 23.194  150.885 1.00 19.37  ? 299  TRP B CD1 1 
ATOM   6759  C  CD2 . TRP B 1  201 ? -22.997 21.206  151.265 1.00 19.37  ? 299  TRP B CD2 1 
ATOM   6760  N  NE1 . TRP B 1  201 ? -22.283 22.605  149.667 1.00 19.55  ? 299  TRP B NE1 1 
ATOM   6761  C  CE2 . TRP B 1  201 ? -22.868 21.384  149.873 1.00 19.36  ? 299  TRP B CE2 1 
ATOM   6762  C  CE3 . TRP B 1  201 ? -23.572 20.025  151.744 1.00 16.93  ? 299  TRP B CE3 1 
ATOM   6763  C  CZ2 . TRP B 1  201 ? -23.294 20.425  148.956 1.00 18.33  ? 299  TRP B CZ2 1 
ATOM   6764  C  CZ3 . TRP B 1  201 ? -23.994 19.074  150.832 1.00 13.46  ? 299  TRP B CZ3 1 
ATOM   6765  C  CH2 . TRP B 1  201 ? -23.854 19.280  149.454 1.00 14.29  ? 299  TRP B CH2 1 
ATOM   6766  N  N   . PHE B 1  202 ? -19.969 23.974  155.347 1.00 13.22  ? 300  PHE B N   1 
ATOM   6767  C  CA  . PHE B 1  202 ? -19.690 24.730  156.561 1.00 11.55  ? 300  PHE B CA  1 
ATOM   6768  C  C   . PHE B 1  202 ? -18.947 26.017  156.223 1.00 19.79  ? 300  PHE B C   1 
ATOM   6769  O  O   . PHE B 1  202 ? -17.943 25.995  155.508 1.00 11.20  ? 300  PHE B O   1 
ATOM   6770  C  CB  . PHE B 1  202 ? -18.882 23.888  157.552 1.00 11.68  ? 300  PHE B CB  1 
ATOM   6771  C  CG  . PHE B 1  202 ? -18.608 24.582  158.854 1.00 15.11  ? 300  PHE B CG  1 
ATOM   6772  C  CD1 . PHE B 1  202 ? -19.623 24.777  159.778 1.00 14.57  ? 300  PHE B CD1 1 
ATOM   6773  C  CD2 . PHE B 1  202 ? -17.333 25.031  159.161 1.00 15.63  ? 300  PHE B CD2 1 
ATOM   6774  C  CE1 . PHE B 1  202 ? -19.375 25.416  160.977 1.00 12.63  ? 300  PHE B CE1 1 
ATOM   6775  C  CE2 . PHE B 1  202 ? -17.077 25.669  160.359 1.00 11.81  ? 300  PHE B CE2 1 
ATOM   6776  C  CZ  . PHE B 1  202 ? -18.098 25.861  161.268 1.00 12.03  ? 300  PHE B CZ  1 
ATOM   6777  N  N   . ALA B 1  203 ? -19.440 27.135  156.744 1.00 14.57  ? 301  ALA B N   1 
ATOM   6778  C  CA  . ALA B 1  203 ? -18.882 28.439  156.410 1.00 14.31  ? 301  ALA B CA  1 
ATOM   6779  C  C   . ALA B 1  203 ? -17.636 28.750  157.235 1.00 13.46  ? 301  ALA B C   1 
ATOM   6780  O  O   . ALA B 1  203 ? -17.718 28.940  158.447 1.00 11.36  ? 301  ALA B O   1 
ATOM   6781  C  CB  . ALA B 1  203 ? -19.926 29.524  156.607 1.00 11.31  ? 301  ALA B CB  1 
ATOM   6782  N  N   . ILE B 1  204 ? -16.489 28.799  156.562 1.00 11.09  ? 302  ILE B N   1 
ATOM   6783  C  CA  . ILE B 1  204 ? -15.227 29.179  157.192 1.00 20.87  ? 302  ILE B CA  1 
ATOM   6784  C  C   . ILE B 1  204 ? -14.155 29.437  156.135 1.00 15.28  ? 302  ILE B C   1 
ATOM   6785  O  O   . ILE B 1  204 ? -14.054 28.712  155.145 1.00 17.78  ? 302  ILE B O   1 
ATOM   6786  C  CB  . ILE B 1  204 ? -14.730 28.099  158.195 1.00 14.36  ? 302  ILE B CB  1 
ATOM   6787  C  CG1 . ILE B 1  204 ? -13.574 28.639  159.041 1.00 12.04  ? 302  ILE B CG1 1 
ATOM   6788  C  CG2 . ILE B 1  204 ? -14.324 26.810  157.484 1.00 11.25  ? 302  ILE B CG2 1 
ATOM   6789  C  CD1 . ILE B 1  204 ? -13.255 27.775  160.241 1.00 11.71  ? 302  ILE B CD1 1 
ATOM   6790  N  N   . HIS B 1  205 ? -13.377 30.496  156.331 1.00 14.66  ? 303  HIS B N   1 
ATOM   6791  C  CA  . HIS B 1  205 ? -12.240 30.778  155.458 1.00 14.17  ? 303  HIS B CA  1 
ATOM   6792  C  C   . HIS B 1  205 ? -11.092 29.819  155.733 1.00 17.92  ? 303  HIS B C   1 
ATOM   6793  O  O   . HIS B 1  205 ? -10.601 29.745  156.856 1.00 16.26  ? 303  HIS B O   1 
ATOM   6794  C  CB  . HIS B 1  205 ? -11.757 32.218  155.634 1.00 12.63  ? 303  HIS B CB  1 
ATOM   6795  C  CG  . HIS B 1  205 ? -12.215 33.146  154.554 1.00 13.33  ? 303  HIS B CG  1 
ATOM   6796  N  ND1 . HIS B 1  205 ? -13.465 33.727  154.551 1.00 12.99  ? 303  HIS B ND1 1 
ATOM   6797  C  CD2 . HIS B 1  205 ? -11.588 33.597  153.442 1.00 11.27  ? 303  HIS B CD2 1 
ATOM   6798  C  CE1 . HIS B 1  205 ? -13.588 34.496  153.484 1.00 12.88  ? 303  HIS B CE1 1 
ATOM   6799  N  NE2 . HIS B 1  205 ? -12.463 34.434  152.794 1.00 13.12  ? 303  HIS B NE2 1 
ATOM   6800  N  N   . PRO B 1  206 ? -10.663 29.069  154.709 1.00 18.20  ? 304  PRO B N   1 
ATOM   6801  C  CA  . PRO B 1  206 ? -9.464  28.245  154.883 1.00 18.13  ? 304  PRO B CA  1 
ATOM   6802  C  C   . PRO B 1  206 ? -8.207  29.099  154.794 1.00 20.25  ? 304  PRO B C   1 
ATOM   6803  O  O   . PRO B 1  206 ? -7.472  29.018  153.810 1.00 25.10  ? 304  PRO B O   1 
ATOM   6804  C  CB  . PRO B 1  206 ? -9.540  27.245  153.720 1.00 15.19  ? 304  PRO B CB  1 
ATOM   6805  C  CG  . PRO B 1  206 ? -10.909 27.417  153.122 1.00 13.76  ? 304  PRO B CG  1 
ATOM   6806  C  CD  . PRO B 1  206 ? -11.332 28.813  153.426 1.00 13.77  ? 304  PRO B CD  1 
ATOM   6807  N  N   . VAL B 1  207 ? -7.971  29.913  155.818 1.00 19.60  ? 305  VAL B N   1 
ATOM   6808  C  CA  . VAL B 1  207 ? -6.826  30.814  155.829 1.00 18.18  ? 305  VAL B CA  1 
ATOM   6809  C  C   . VAL B 1  207 ? -6.005  30.663  157.106 1.00 18.51  ? 305  VAL B C   1 
ATOM   6810  O  O   . VAL B 1  207 ? -5.233  31.553  157.466 1.00 20.45  ? 305  VAL B O   1 
ATOM   6811  C  CB  . VAL B 1  207 ? -7.263  32.285  155.679 1.00 15.84  ? 305  VAL B CB  1 
ATOM   6812  C  CG1 . VAL B 1  207 ? -7.893  32.516  154.316 1.00 15.33  ? 305  VAL B CG1 1 
ATOM   6813  C  CG2 . VAL B 1  207 ? -8.230  32.669  156.777 1.00 17.25  ? 305  VAL B CG2 1 
ATOM   6814  N  N   . SER B 1  208 ? -6.169  29.529  157.783 1.00 18.47  ? 306  SER B N   1 
ATOM   6815  C  CA  . SER B 1  208 ? -5.406  29.246  158.996 1.00 22.48  ? 306  SER B CA  1 
ATOM   6816  C  C   . SER B 1  208 ? -3.915  29.268  158.687 1.00 23.09  ? 306  SER B C   1 
ATOM   6817  O  O   . SER B 1  208 ? -3.101  29.644  159.528 1.00 23.86  ? 306  SER B O   1 
ATOM   6818  C  CB  . SER B 1  208 ? -5.812  27.900  159.594 1.00 23.20  ? 306  SER B CB  1 
ATOM   6819  O  OG  . SER B 1  208 ? -7.088  27.971  160.206 1.00 21.93  ? 306  SER B OG  1 
ATOM   6820  N  N   . MET B 1  209 ? -3.566  28.858  157.472 1.00 19.47  ? 307  MET B N   1 
ATOM   6821  C  CA  . MET B 1  209 ? -2.219  29.058  156.963 1.00 14.10  ? 307  MET B CA  1 
ATOM   6822  C  C   . MET B 1  209 ? -2.130  30.457  156.361 1.00 19.26  ? 307  MET B C   1 
ATOM   6823  O  O   . MET B 1  209 ? -2.730  30.731  155.320 1.00 21.34  ? 307  MET B O   1 
ATOM   6824  C  CB  . MET B 1  209 ? -1.862  27.999  155.919 1.00 12.94  ? 307  MET B CB  1 
ATOM   6825  C  CG  . MET B 1  209 ? -1.955  26.565  156.417 1.00 13.01  ? 307  MET B CG  1 
ATOM   6826  S  SD  . MET B 1  209 ? -0.648  26.118  157.578 1.00 25.90  ? 307  MET B SD  1 
ATOM   6827  C  CE  . MET B 1  209 ? 0.783   26.133  156.501 1.00 16.86  ? 307  MET B CE  1 
ATOM   6828  N  N   . ASN B 1  210 ? -1.388  31.345  157.016 1.00 19.48  ? 308  ASN B N   1 
ATOM   6829  C  CA  . ASN B 1  210 ? -1.363  32.745  156.610 1.00 23.34  ? 308  ASN B CA  1 
ATOM   6830  C  C   . ASN B 1  210 ? -0.462  32.981  155.400 1.00 23.60  ? 308  ASN B C   1 
ATOM   6831  O  O   . ASN B 1  210 ? 0.053   32.032  154.809 1.00 24.43  ? 308  ASN B O   1 
ATOM   6832  C  CB  . ASN B 1  210 ? -0.947  33.638  157.787 1.00 25.37  ? 308  ASN B CB  1 
ATOM   6833  C  CG  . ASN B 1  210 ? 0.472   33.378  158.282 1.00 30.34  ? 308  ASN B CG  1 
ATOM   6834  O  OD1 . ASN B 1  210 ? 1.326   32.851  157.571 1.00 28.05  ? 308  ASN B OD1 1 
ATOM   6835  N  ND2 . ASN B 1  210 ? 0.722   33.767  159.528 1.00 37.06  ? 308  ASN B ND2 1 
ATOM   6836  N  N   . ASN B 1  211 ? -0.279  34.246  155.030 1.00 23.51  ? 309  ASN B N   1 
ATOM   6837  C  CA  . ASN B 1  211 ? 0.439   34.582  153.803 1.00 23.16  ? 309  ASN B CA  1 
ATOM   6838  C  C   . ASN B 1  211 ? 1.962   34.534  153.938 1.00 22.16  ? 309  ASN B C   1 
ATOM   6839  O  O   . ASN B 1  211 ? 2.682   34.952  153.031 1.00 25.29  ? 309  ASN B O   1 
ATOM   6840  C  CB  . ASN B 1  211 ? 0.006   35.966  153.301 1.00 25.41  ? 309  ASN B CB  1 
ATOM   6841  C  CG  . ASN B 1  211 ? 0.273   37.069  154.308 1.00 29.39  ? 309  ASN B CG  1 
ATOM   6842  O  OD1 . ASN B 1  211 ? 0.920   36.853  155.329 1.00 35.37  ? 309  ASN B OD1 1 
ATOM   6843  N  ND2 . ASN B 1  211 ? -0.222  38.265  154.016 1.00 25.70  ? 309  ASN B ND2 1 
ATOM   6844  N  N   . SER B 1  212 ? 2.445   34.031  155.070 1.00 22.94  ? 310  SER B N   1 
ATOM   6845  C  CA  . SER B 1  212 ? 3.872   33.781  155.251 1.00 24.04  ? 310  SER B CA  1 
ATOM   6846  C  C   . SER B 1  212 ? 4.247   32.396  154.738 1.00 23.86  ? 310  SER B C   1 
ATOM   6847  O  O   . SER B 1  212 ? 5.425   32.065  154.614 1.00 30.53  ? 310  SER B O   1 
ATOM   6848  C  CB  . SER B 1  212 ? 4.269   33.917  156.721 1.00 26.83  ? 310  SER B CB  1 
ATOM   6849  O  OG  . SER B 1  212 ? 4.108   35.252  157.168 1.00 33.89  ? 310  SER B OG  1 
ATOM   6850  N  N   . ASN B 1  213 ? 3.233   31.591  154.441 1.00 18.62  ? 311  ASN B N   1 
ATOM   6851  C  CA  . ASN B 1  213 ? 3.444   30.207  154.041 1.00 18.81  ? 311  ASN B CA  1 
ATOM   6852  C  C   . ASN B 1  213 ? 3.899   30.077  152.595 1.00 20.52  ? 311  ASN B C   1 
ATOM   6853  O  O   . ASN B 1  213 ? 3.480   30.842  151.728 1.00 21.15  ? 311  ASN B O   1 
ATOM   6854  C  CB  . ASN B 1  213 ? 2.164   29.398  154.246 1.00 19.35  ? 311  ASN B CB  1 
ATOM   6855  C  CG  . ASN B 1  213 ? 2.223   28.035  153.591 1.00 23.67  ? 311  ASN B CG  1 
ATOM   6856  O  OD1 . ASN B 1  213 ? 2.995   27.170  154.004 1.00 21.88  ? 311  ASN B OD1 1 
ATOM   6857  N  ND2 . ASN B 1  213 ? 1.400   27.833  152.570 1.00 28.25  ? 311  ASN B ND2 1 
ATOM   6858  N  N   . HIS B 1  214 ? 4.763   29.101  152.347 1.00 23.39  ? 312  HIS B N   1 
ATOM   6859  C  CA  . HIS B 1  214 ? 5.255   28.834  151.006 1.00 22.62  ? 312  HIS B CA  1 
ATOM   6860  C  C   . HIS B 1  214 ? 4.991   27.379  150.633 1.00 18.17  ? 312  HIS B C   1 
ATOM   6861  O  O   . HIS B 1  214 ? 5.352   26.930  149.547 1.00 19.00  ? 312  HIS B O   1 
ATOM   6862  C  CB  . HIS B 1  214 ? 6.746   29.161  150.909 1.00 20.59  ? 312  HIS B CB  1 
ATOM   6863  C  CG  . HIS B 1  214 ? 7.065   30.592  151.211 1.00 21.51  ? 312  HIS B CG  1 
ATOM   6864  N  ND1 . HIS B 1  214 ? 6.871   31.606  150.298 1.00 22.01  ? 312  HIS B ND1 1 
ATOM   6865  C  CD2 . HIS B 1  214 ? 7.547   31.182  152.331 1.00 21.29  ? 312  HIS B CD2 1 
ATOM   6866  C  CE1 . HIS B 1  214 ? 7.229   32.757  150.838 1.00 21.79  ? 312  HIS B CE1 1 
ATOM   6867  N  NE2 . HIS B 1  214 ? 7.644   32.527  152.071 1.00 21.09  ? 312  HIS B NE2 1 
ATOM   6868  N  N   . LEU B 1  215 ? 4.354   26.654  151.547 1.00 15.53  ? 313  LEU B N   1 
ATOM   6869  C  CA  . LEU B 1  215 ? 4.026   25.248  151.335 1.00 18.23  ? 313  LEU B CA  1 
ATOM   6870  C  C   . LEU B 1  215 ? 2.609   25.070  150.813 1.00 19.89  ? 313  LEU B C   1 
ATOM   6871  O  O   . LEU B 1  215 ? 1.652   25.535  151.430 1.00 22.24  ? 313  LEU B O   1 
ATOM   6872  C  CB  . LEU B 1  215 ? 4.189   24.460  152.635 1.00 18.75  ? 313  LEU B CB  1 
ATOM   6873  C  CG  . LEU B 1  215 ? 5.518   23.765  152.921 1.00 20.05  ? 313  LEU B CG  1 
ATOM   6874  C  CD1 . LEU B 1  215 ? 6.690   24.600  152.438 1.00 21.95  ? 313  LEU B CD1 1 
ATOM   6875  C  CD2 . LEU B 1  215 ? 5.630   23.485  154.411 1.00 18.19  ? 313  LEU B CD2 1 
ATOM   6876  N  N   . VAL B 1  216 ? 2.479   24.388  149.679 1.00 19.44  ? 314  VAL B N   1 
ATOM   6877  C  CA  . VAL B 1  216 ? 1.170   24.052  149.126 1.00 15.96  ? 314  VAL B CA  1 
ATOM   6878  C  C   . VAL B 1  216 ? 0.392   23.167  150.095 1.00 13.57  ? 314  VAL B C   1 
ATOM   6879  O  O   . VAL B 1  216 ? 0.909   22.157  150.572 1.00 13.87  ? 314  VAL B O   1 
ATOM   6880  C  CB  . VAL B 1  216 ? 1.299   23.340  147.764 1.00 18.25  ? 314  VAL B CB  1 
ATOM   6881  C  CG1 . VAL B 1  216 ? -0.057  22.848  147.280 1.00 13.61  ? 314  VAL B CG1 1 
ATOM   6882  C  CG2 . VAL B 1  216 ? 1.933   24.270  146.735 1.00 14.13  ? 314  VAL B CG2 1 
ATOM   6883  N  N   . ASN B 1  217 ? -0.850  23.549  150.379 1.00 13.16  ? 315  ASN B N   1 
ATOM   6884  C  CA  . ASN B 1  217 ? -1.708  22.773  151.269 1.00 13.01  ? 315  ASN B CA  1 
ATOM   6885  C  C   . ASN B 1  217 ? -3.179  23.131  151.094 1.00 14.64  ? 315  ASN B C   1 
ATOM   6886  O  O   . ASN B 1  217 ? -3.517  24.105  150.421 1.00 17.15  ? 315  ASN B O   1 
ATOM   6887  C  CB  . ASN B 1  217 ? -1.290  22.970  152.732 1.00 13.15  ? 315  ASN B CB  1 
ATOM   6888  C  CG  . ASN B 1  217 ? -1.578  24.369  153.243 1.00 12.95  ? 315  ASN B CG  1 
ATOM   6889  O  OD1 . ASN B 1  217 ? -2.704  24.683  153.626 1.00 12.64  ? 315  ASN B OD1 1 
ATOM   6890  N  ND2 . ASN B 1  217 ? -0.556  25.218  153.254 1.00 13.18  ? 315  ASN B ND2 1 
ATOM   6891  N  N   . SER B 1  218 ? -4.051  22.335  151.706 1.00 12.96  ? 316  SER B N   1 
ATOM   6892  C  CA  . SER B 1  218 ? -5.491  22.518  151.566 1.00 13.91  ? 316  SER B CA  1 
ATOM   6893  C  C   . SER B 1  218 ? -6.119  23.159  152.803 1.00 16.96  ? 316  SER B C   1 
ATOM   6894  O  O   . SER B 1  218 ? -7.342  23.219  152.926 1.00 15.41  ? 316  SER B O   1 
ATOM   6895  C  CB  . SER B 1  218 ? -6.159  21.175  151.274 1.00 12.28  ? 316  SER B CB  1 
ATOM   6896  O  OG  . SER B 1  218 ? -5.670  20.166  152.140 1.00 17.30  ? 316  SER B OG  1 
ATOM   6897  N  N   . ASP B 1  219 ? -5.265  23.623  153.713 1.00 23.93  ? 317  ASP B N   1 
ATOM   6898  C  CA  . ASP B 1  219 ? -5.675  24.377  154.900 1.00 22.98  ? 317  ASP B CA  1 
ATOM   6899  C  C   . ASP B 1  219 ? -6.624  23.589  155.812 1.00 22.77  ? 317  ASP B C   1 
ATOM   6900  O  O   . ASP B 1  219 ? -6.654  22.359  155.775 1.00 22.92  ? 317  ASP B O   1 
ATOM   6901  C  CB  . ASP B 1  219 ? -6.314  25.706  154.485 1.00 18.10  ? 317  ASP B CB  1 
ATOM   6902  C  CG  . ASP B 1  219 ? -6.085  26.806  155.504 1.00 19.61  ? 317  ASP B CG  1 
ATOM   6903  O  OD1 . ASP B 1  219 ? -6.826  26.845  156.509 1.00 22.94  ? 317  ASP B OD1 1 
ATOM   6904  O  OD2 . ASP B 1  219 ? -5.162  27.626  155.304 1.00 14.32  ? 317  ASP B OD2 1 
ATOM   6905  N  N   . ASN B 1  220 ? -7.391  24.308  156.630 1.00 21.21  ? 318  ASN B N   1 
ATOM   6906  C  CA  . ASN B 1  220 ? -8.189  23.692  157.691 1.00 18.50  ? 318  ASN B CA  1 
ATOM   6907  C  C   . ASN B 1  220 ? -9.262  22.725  157.192 1.00 15.97  ? 318  ASN B C   1 
ATOM   6908  O  O   . ASN B 1  220 ? -9.387  21.616  157.713 1.00 19.16  ? 318  ASN B O   1 
ATOM   6909  C  CB  . ASN B 1  220 ? -8.839  24.773  158.561 1.00 18.45  ? 318  ASN B CB  1 
ATOM   6910  C  CG  . ASN B 1  220 ? -9.502  25.865  157.746 1.00 22.23  ? 318  ASN B CG  1 
ATOM   6911  O  OD1 . ASN B 1  220 ? -10.088 25.606  156.695 1.00 23.76  ? 318  ASN B OD1 1 
ATOM   6912  N  ND2 . ASN B 1  220 ? -9.422  27.098  158.235 1.00 11.72  ? 318  ASN B ND2 1 
ATOM   6913  N  N   . VAL B 1  221 ? -10.040 23.137  156.196 1.00 11.72  ? 319  VAL B N   1 
ATOM   6914  C  CA  . VAL B 1  221 ? -11.084 22.266  155.660 1.00 12.86  ? 319  VAL B CA  1 
ATOM   6915  C  C   . VAL B 1  221 ? -10.457 21.073  154.948 1.00 13.90  ? 319  VAL B C   1 
ATOM   6916  O  O   . VAL B 1  221 ? -11.040 19.989  154.901 1.00 13.68  ? 319  VAL B O   1 
ATOM   6917  C  CB  . VAL B 1  221 ? -12.024 23.017  154.690 1.00 11.44  ? 319  VAL B CB  1 
ATOM   6918  C  CG1 . VAL B 1  221 ? -12.776 24.119  155.420 1.00 11.32  ? 319  VAL B CG1 1 
ATOM   6919  C  CG2 . VAL B 1  221 ? -11.252 23.576  153.503 1.00 13.49  ? 319  VAL B CG2 1 
ATOM   6920  N  N   . GLY B 1  222 ? -9.260  21.279  154.409 1.00 12.66  ? 320  GLY B N   1 
ATOM   6921  C  CA  . GLY B 1  222 ? -8.510  20.209  153.783 1.00 12.19  ? 320  GLY B CA  1 
ATOM   6922  C  C   . GLY B 1  222 ? -8.049  19.202  154.813 1.00 12.54  ? 320  GLY B C   1 
ATOM   6923  O  O   . GLY B 1  222 ? -8.070  17.996  154.571 1.00 13.42  ? 320  GLY B O   1 
ATOM   6924  N  N   . TYR B 1  223 ? -7.626  19.700  155.969 1.00 12.61  ? 321  TYR B N   1 
ATOM   6925  C  CA  . TYR B 1  223 ? -7.181  18.830  157.048 1.00 18.07  ? 321  TYR B CA  1 
ATOM   6926  C  C   . TYR B 1  223 ? -8.353  18.039  157.616 1.00 18.62  ? 321  TYR B C   1 
ATOM   6927  O  O   . TYR B 1  223 ? -8.202  16.881  158.009 1.00 19.73  ? 321  TYR B O   1 
ATOM   6928  C  CB  . TYR B 1  223 ? -6.504  19.643  158.152 1.00 15.15  ? 321  TYR B CB  1 
ATOM   6929  C  CG  . TYR B 1  223 ? -5.978  18.801  159.291 1.00 17.65  ? 321  TYR B CG  1 
ATOM   6930  C  CD1 . TYR B 1  223 ? -4.960  17.878  159.085 1.00 20.28  ? 321  TYR B CD1 1 
ATOM   6931  C  CD2 . TYR B 1  223 ? -6.492  18.933  160.574 1.00 15.93  ? 321  TYR B CD2 1 
ATOM   6932  C  CE1 . TYR B 1  223 ? -4.474  17.105  160.124 1.00 16.38  ? 321  TYR B CE1 1 
ATOM   6933  C  CE2 . TYR B 1  223 ? -6.011  18.167  161.618 1.00 14.33  ? 321  TYR B CE2 1 
ATOM   6934  C  CZ  . TYR B 1  223 ? -5.003  17.255  161.388 1.00 16.44  ? 321  TYR B CZ  1 
ATOM   6935  O  OH  . TYR B 1  223 ? -4.525  16.491  162.428 1.00 19.81  ? 321  TYR B OH  1 
ATOM   6936  N  N   . ALA B 1  224 ? -9.523  18.670  157.647 1.00 12.82  ? 322  ALA B N   1 
ATOM   6937  C  CA  . ALA B 1  224 ? -10.733 18.019  158.133 1.00 13.03  ? 322  ALA B CA  1 
ATOM   6938  C  C   . ALA B 1  224 ? -11.127 16.875  157.205 1.00 15.04  ? 322  ALA B C   1 
ATOM   6939  O  O   . ALA B 1  224 ? -11.486 15.788  157.657 1.00 16.78  ? 322  ALA B O   1 
ATOM   6940  C  CB  . ALA B 1  224 ? -11.863 19.026  158.254 1.00 14.77  ? 322  ALA B CB  1 
ATOM   6941  N  N   . SER B 1  225 ? -11.056 17.134  155.904 1.00 14.50  ? 323  SER B N   1 
ATOM   6942  C  CA  . SER B 1  225 ? -11.285 16.107  154.896 1.00 13.06  ? 323  SER B CA  1 
ATOM   6943  C  C   . SER B 1  225 ? -10.259 14.987  155.024 1.00 16.66  ? 323  SER B C   1 
ATOM   6944  O  O   . SER B 1  225 ? -10.584 13.807  154.890 1.00 18.82  ? 323  SER B O   1 
ATOM   6945  C  CB  . SER B 1  225 ? -11.227 16.716  153.496 1.00 18.23  ? 323  SER B CB  1 
ATOM   6946  O  OG  . SER B 1  225 ? -12.174 17.762  153.363 1.00 28.15  ? 323  SER B OG  1 
ATOM   6947  N  N   . TYR B 1  226 ? -9.020  15.380  155.300 1.00 19.15  ? 324  TYR B N   1 
ATOM   6948  C  CA  . TYR B 1  226 ? -7.903  14.454  155.453 1.00 20.09  ? 324  TYR B CA  1 
ATOM   6949  C  C   . TYR B 1  226 ? -8.138  13.465  156.592 1.00 19.61  ? 324  TYR B C   1 
ATOM   6950  O  O   . TYR B 1  226 ? -7.920  12.263  156.433 1.00 20.29  ? 324  TYR B O   1 
ATOM   6951  C  CB  . TYR B 1  226 ? -6.611  15.249  155.682 1.00 23.51  ? 324  TYR B CB  1 
ATOM   6952  C  CG  . TYR B 1  226 ? -5.403  14.439  156.097 1.00 20.72  ? 324  TYR B CG  1 
ATOM   6953  C  CD1 . TYR B 1  226 ? -4.597  13.825  155.149 1.00 22.18  ? 324  TYR B CD1 1 
ATOM   6954  C  CD2 . TYR B 1  226 ? -5.049  14.319  157.435 1.00 22.63  ? 324  TYR B CD2 1 
ATOM   6955  C  CE1 . TYR B 1  226 ? -3.483  13.095  155.521 1.00 26.00  ? 324  TYR B CE1 1 
ATOM   6956  C  CE2 . TYR B 1  226 ? -3.938  13.591  157.818 1.00 25.57  ? 324  TYR B CE2 1 
ATOM   6957  C  CZ  . TYR B 1  226 ? -3.158  12.982  156.857 1.00 25.06  ? 324  TYR B CZ  1 
ATOM   6958  O  OH  . TYR B 1  226 ? -2.051  12.257  157.230 1.00 22.40  ? 324  TYR B OH  1 
ATOM   6959  N  N   . LEU B 1  227 ? -8.592  13.974  157.733 1.00 17.02  ? 325  LEU B N   1 
ATOM   6960  C  CA  . LEU B 1  227 ? -8.850  13.136  158.900 1.00 20.13  ? 325  LEU B CA  1 
ATOM   6961  C  C   . LEU B 1  227 ? -10.028 12.193  158.674 1.00 25.79  ? 325  LEU B C   1 
ATOM   6962  O  O   . LEU B 1  227 ? -9.980  11.026  159.065 1.00 32.07  ? 325  LEU B O   1 
ATOM   6963  C  CB  . LEU B 1  227 ? -9.106  13.998  160.136 1.00 20.44  ? 325  LEU B CB  1 
ATOM   6964  C  CG  . LEU B 1  227 ? -7.939  14.827  160.671 1.00 23.05  ? 325  LEU B CG  1 
ATOM   6965  C  CD1 . LEU B 1  227 ? -8.384  15.626  161.887 1.00 23.23  ? 325  LEU B CD1 1 
ATOM   6966  C  CD2 . LEU B 1  227 ? -6.746  13.943  161.010 1.00 15.33  ? 325  LEU B CD2 1 
ATOM   6967  N  N   . LEU B 1  228 ? -11.089 12.707  158.058 1.00 24.49  ? 326  LEU B N   1 
ATOM   6968  C  CA  . LEU B 1  228 ? -12.265 11.898  157.751 1.00 25.11  ? 326  LEU B CA  1 
ATOM   6969  C  C   . LEU B 1  228 ? -11.929 10.713  156.851 1.00 23.92  ? 326  LEU B C   1 
ATOM   6970  O  O   . LEU B 1  228 ? -12.369 9.590   157.100 1.00 26.93  ? 326  LEU B O   1 
ATOM   6971  C  CB  . LEU B 1  228 ? -13.351 12.751  157.090 1.00 23.47  ? 326  LEU B CB  1 
ATOM   6972  C  CG  . LEU B 1  228 ? -14.124 13.714  157.990 1.00 25.60  ? 326  LEU B CG  1 
ATOM   6973  C  CD1 . LEU B 1  228 ? -14.953 14.669  157.156 1.00 22.15  ? 326  LEU B CD1 1 
ATOM   6974  C  CD2 . LEU B 1  228 ? -15.013 12.932  158.940 1.00 32.94  ? 326  LEU B CD2 1 
ATOM   6975  N  N   . GLU B 1  229 ? -11.156 10.970  155.801 1.00 21.17  ? 327  GLU B N   1 
ATOM   6976  C  CA  . GLU B 1  229 ? -10.794 9.925   154.852 1.00 19.09  ? 327  GLU B CA  1 
ATOM   6977  C  C   . GLU B 1  229 ? -9.857  8.901   155.477 1.00 18.86  ? 327  GLU B C   1 
ATOM   6978  O  O   . GLU B 1  229 ? -10.013 7.701   155.268 1.00 24.59  ? 327  GLU B O   1 
ATOM   6979  C  CB  . GLU B 1  229 ? -10.154 10.530  153.601 1.00 20.46  ? 327  GLU B CB  1 
ATOM   6980  C  CG  . GLU B 1  229 ? -11.133 11.295  152.728 1.00 26.03  ? 327  GLU B CG  1 
ATOM   6981  C  CD  . GLU B 1  229 ? -10.498 11.824  151.460 1.00 29.84  ? 327  GLU B CD  1 
ATOM   6982  O  OE1 . GLU B 1  229 ? -11.229 12.028  150.468 1.00 27.74  ? 327  GLU B OE1 1 
ATOM   6983  O  OE2 . GLU B 1  229 ? -9.270  12.051  151.461 1.00 35.53  ? 327  GLU B OE2 1 
ATOM   6984  N  N   . GLN B 1  230 ? -8.891  9.375   156.253 1.00 16.17  ? 328  GLN B N   1 
ATOM   6985  C  CA  . GLN B 1  230 ? -7.926  8.481   156.878 1.00 22.61  ? 328  GLN B CA  1 
ATOM   6986  C  C   . GLN B 1  230 ? -8.576  7.581   157.922 1.00 31.63  ? 328  GLN B C   1 
ATOM   6987  O  O   . GLN B 1  230 ? -8.124  6.457   158.144 1.00 36.84  ? 328  GLN B O   1 
ATOM   6988  C  CB  . GLN B 1  230 ? -6.784  9.279   157.508 1.00 22.62  ? 328  GLN B CB  1 
ATOM   6989  C  CG  . GLN B 1  230 ? -5.790  9.810   156.494 1.00 26.44  ? 328  GLN B CG  1 
ATOM   6990  C  CD  . GLN B 1  230 ? -5.113  8.694   155.720 1.00 34.56  ? 328  GLN B CD  1 
ATOM   6991  O  OE1 . GLN B 1  230 ? -5.505  8.378   154.595 1.00 39.11  ? 328  GLN B OE1 1 
ATOM   6992  N  NE2 . GLN B 1  230 ? -4.097  8.086   156.322 1.00 36.47  ? 328  GLN B NE2 1 
ATOM   6993  N  N   . GLU B 1  231 ? -9.634  8.070   158.563 1.00 36.28  ? 329  GLU B N   1 
ATOM   6994  C  CA  . GLU B 1  231 ? -10.350 7.262   159.543 1.00 35.29  ? 329  GLU B CA  1 
ATOM   6995  C  C   . GLU B 1  231 ? -11.149 6.158   158.864 1.00 28.09  ? 329  GLU B C   1 
ATOM   6996  O  O   . GLU B 1  231 ? -11.154 5.015   159.315 1.00 28.63  ? 329  GLU B O   1 
ATOM   6997  C  CB  . GLU B 1  231 ? -11.281 8.124   160.396 1.00 38.79  ? 329  GLU B CB  1 
ATOM   6998  C  CG  . GLU B 1  231 ? -11.674 7.447   161.697 1.00 47.18  ? 329  GLU B CG  1 
ATOM   6999  C  CD  . GLU B 1  231 ? -12.954 7.995   162.285 1.00 56.07  ? 329  GLU B CD  1 
ATOM   7000  O  OE1 . GLU B 1  231 ? -13.690 8.702   161.564 1.00 62.15  ? 329  GLU B OE1 1 
ATOM   7001  O  OE2 . GLU B 1  231 ? -13.227 7.711   163.470 1.00 58.17  ? 329  GLU B OE2 1 
ATOM   7002  N  N   . LYS B 1  232 ? -11.835 6.511   157.783 1.00 23.54  ? 330  LYS B N   1 
ATOM   7003  C  CA  . LYS B 1  232 ? -12.637 5.543   157.044 1.00 21.63  ? 330  LYS B CA  1 
ATOM   7004  C  C   . LYS B 1  232 ? -11.785 4.606   156.196 1.00 26.33  ? 330  LYS B C   1 
ATOM   7005  O  O   . LYS B 1  232 ? -12.014 3.396   156.182 1.00 28.11  ? 330  LYS B O   1 
ATOM   7006  C  CB  . LYS B 1  232 ? -13.665 6.259   156.172 1.00 18.16  ? 330  LYS B CB  1 
ATOM   7007  C  CG  . LYS B 1  232 ? -14.802 6.846   156.980 1.00 23.39  ? 330  LYS B CG  1 
ATOM   7008  C  CD  . LYS B 1  232 ? -15.780 5.754   157.385 1.00 28.45  ? 330  LYS B CD  1 
ATOM   7009  C  CE  . LYS B 1  232 ? -16.406 6.045   158.732 1.00 33.38  ? 330  LYS B CE  1 
ATOM   7010  N  NZ  . LYS B 1  232 ? -16.986 7.415   158.790 1.00 34.82  ? 330  LYS B NZ  1 
ATOM   7011  N  N   . ASN B 1  233 ? -10.811 5.165   155.484 1.00 24.97  ? 331  ASN B N   1 
ATOM   7012  C  CA  . ASN B 1  233 ? -9.942  4.364   154.629 1.00 25.58  ? 331  ASN B CA  1 
ATOM   7013  C  C   . ASN B 1  233 ? -8.820  3.721   155.430 1.00 28.04  ? 331  ASN B C   1 
ATOM   7014  O  O   . ASN B 1  233 ? -7.641  3.960   155.170 1.00 30.27  ? 331  ASN B O   1 
ATOM   7015  C  CB  . ASN B 1  233 ? -9.360  5.211   153.497 1.00 23.61  ? 331  ASN B CB  1 
ATOM   7016  C  CG  . ASN B 1  233 ? -10.422 5.714   152.541 1.00 23.84  ? 331  ASN B CG  1 
ATOM   7017  O  OD1 . ASN B 1  233 ? -11.356 4.989   152.202 1.00 20.10  ? 331  ASN B OD1 1 
ATOM   7018  N  ND2 . ASN B 1  233 ? -10.285 6.960   152.100 1.00 16.81  ? 331  ASN B ND2 1 
ATOM   7019  N  N   . LYS B 1  234 ? -9.205  2.912   156.412 1.00 29.39  ? 332  LYS B N   1 
ATOM   7020  C  CA  . LYS B 1  234 ? -8.262  2.204   157.269 1.00 34.08  ? 332  LYS B CA  1 
ATOM   7021  C  C   . LYS B 1  234 ? -7.261  1.386   156.459 1.00 31.92  ? 332  LYS B C   1 
ATOM   7022  O  O   . LYS B 1  234 ? -7.645  0.612   155.583 1.00 34.03  ? 332  LYS B O   1 
ATOM   7023  C  CB  . LYS B 1  234 ? -9.022  1.287   158.229 1.00 41.02  ? 332  LYS B CB  1 
ATOM   7024  C  CG  . LYS B 1  234 ? -9.887  2.017   159.243 1.00 47.06  ? 332  LYS B CG  1 
ATOM   7025  C  CD  . LYS B 1  234 ? -10.649 1.035   160.121 1.00 52.04  ? 332  LYS B CD  1 
ATOM   7026  C  CE  . LYS B 1  234 ? -11.762 1.725   160.898 1.00 52.60  ? 332  LYS B CE  1 
ATOM   7027  N  NZ  . LYS B 1  234 ? -11.255 2.807   161.788 1.00 51.13  ? 332  LYS B NZ  1 
ATOM   7028  N  N   . GLY B 1  235 ? -5.977  1.559   156.756 1.00 29.37  ? 333  GLY B N   1 
ATOM   7029  C  CA  . GLY B 1  235 ? -4.936  0.815   156.071 1.00 29.71  ? 333  GLY B CA  1 
ATOM   7030  C  C   . GLY B 1  235 ? -4.440  1.472   154.795 1.00 30.12  ? 333  GLY B C   1 
ATOM   7031  O  O   . GLY B 1  235 ? -3.485  1.000   154.179 1.00 32.94  ? 333  GLY B O   1 
ATOM   7032  N  N   . TYR B 1  236 ? -5.087  2.561   154.395 1.00 29.90  ? 334  TYR B N   1 
ATOM   7033  C  CA  . TYR B 1  236 ? -4.699  3.278   153.183 1.00 32.88  ? 334  TYR B CA  1 
ATOM   7034  C  C   . TYR B 1  236 ? -3.851  4.512   153.480 1.00 36.79  ? 334  TYR B C   1 
ATOM   7035  O  O   . TYR B 1  236 ? -4.046  5.189   154.490 1.00 41.26  ? 334  TYR B O   1 
ATOM   7036  C  CB  . TYR B 1  236 ? -5.938  3.697   152.387 1.00 31.27  ? 334  TYR B CB  1 
ATOM   7037  C  CG  . TYR B 1  236 ? -6.652  2.562   151.691 1.00 30.72  ? 334  TYR B CG  1 
ATOM   7038  C  CD1 . TYR B 1  236 ? -7.654  1.847   152.336 1.00 31.39  ? 334  TYR B CD1 1 
ATOM   7039  C  CD2 . TYR B 1  236 ? -6.333  2.212   150.385 1.00 23.99  ? 334  TYR B CD2 1 
ATOM   7040  C  CE1 . TYR B 1  236 ? -8.314  0.811   151.702 1.00 27.65  ? 334  TYR B CE1 1 
ATOM   7041  C  CE2 . TYR B 1  236 ? -6.988  1.177   149.742 1.00 21.44  ? 334  TYR B CE2 1 
ATOM   7042  C  CZ  . TYR B 1  236 ? -7.978  0.481   150.406 1.00 26.22  ? 334  TYR B CZ  1 
ATOM   7043  O  OH  . TYR B 1  236 ? -8.634  -0.550  149.773 1.00 29.26  ? 334  TYR B OH  1 
ATOM   7044  N  N   . LEU B 1  237 ? -2.910  4.796   152.586 1.00 33.63  ? 335  LEU B N   1 
ATOM   7045  C  CA  . LEU B 1  237 ? -2.105  6.008   152.672 1.00 30.80  ? 335  LEU B CA  1 
ATOM   7046  C  C   . LEU B 1  237 ? -2.950  7.219   152.287 1.00 28.42  ? 335  LEU B C   1 
ATOM   7047  O  O   . LEU B 1  237 ? -3.948  7.073   151.583 1.00 29.29  ? 335  LEU B O   1 
ATOM   7048  C  CB  . LEU B 1  237 ? -0.879  5.901   151.763 1.00 28.08  ? 335  LEU B CB  1 
ATOM   7049  C  CG  . LEU B 1  237 ? 0.215   4.942   152.228 1.00 27.76  ? 335  LEU B CG  1 
ATOM   7050  C  CD1 . LEU B 1  237 ? 1.160   4.633   151.084 1.00 30.50  ? 335  LEU B CD1 1 
ATOM   7051  C  CD2 . LEU B 1  237 ? 0.969   5.534   153.407 1.00 27.72  ? 335  LEU B CD2 1 
ATOM   7052  N  N   . PRO B 1  238 ? -2.562  8.415   152.762 1.00 28.51  ? 336  PRO B N   1 
ATOM   7053  C  CA  . PRO B 1  238 ? -3.253  9.654   152.390 1.00 26.64  ? 336  PRO B CA  1 
ATOM   7054  C  C   . PRO B 1  238 ? -3.414  9.810   150.880 1.00 26.04  ? 336  PRO B C   1 
ATOM   7055  O  O   . PRO B 1  238 ? -2.465  9.577   150.133 1.00 25.29  ? 336  PRO B O   1 
ATOM   7056  C  CB  . PRO B 1  238 ? -2.339  10.738  152.961 1.00 23.96  ? 336  PRO B CB  1 
ATOM   7057  C  CG  . PRO B 1  238 ? -1.740  10.099  154.159 1.00 26.14  ? 336  PRO B CG  1 
ATOM   7058  C  CD  . PRO B 1  238 ? -1.509  8.662   153.765 1.00 28.43  ? 336  PRO B CD  1 
ATOM   7059  N  N   . GLY B 1  239 ? -4.612  10.188  150.448 1.00 22.76  ? 337  GLY B N   1 
ATOM   7060  C  CA  . GLY B 1  239 ? -4.904  10.339  149.035 1.00 19.14  ? 337  GLY B CA  1 
ATOM   7061  C  C   . GLY B 1  239 ? -5.380  9.055   148.386 1.00 21.52  ? 337  GLY B C   1 
ATOM   7062  O  O   . GLY B 1  239 ? -5.800  9.055   147.229 1.00 25.60  ? 337  GLY B O   1 
ATOM   7063  N  N   . GLN B 1  240 ? -5.318  7.958   149.134 1.00 21.16  ? 338  GLN B N   1 
ATOM   7064  C  CA  . GLN B 1  240 ? -5.792  6.668   148.644 1.00 22.37  ? 338  GLN B CA  1 
ATOM   7065  C  C   . GLN B 1  240 ? -6.947  6.159   149.499 1.00 22.33  ? 338  GLN B C   1 
ATOM   7066  O  O   . GLN B 1  240 ? -7.148  6.623   150.621 1.00 21.96  ? 338  GLN B O   1 
ATOM   7067  C  CB  . GLN B 1  240 ? -4.654  5.643   148.621 1.00 22.49  ? 338  GLN B CB  1 
ATOM   7068  C  CG  . GLN B 1  240 ? -3.506  5.998   147.684 1.00 25.14  ? 338  GLN B CG  1 
ATOM   7069  C  CD  . GLN B 1  240 ? -2.365  4.997   147.760 1.00 32.96  ? 338  GLN B CD  1 
ATOM   7070  O  OE1 . GLN B 1  240 ? -2.582  3.786   147.705 1.00 38.78  ? 338  GLN B OE1 1 
ATOM   7071  N  NE2 . GLN B 1  240 ? -1.141  5.499   147.879 1.00 31.16  ? 338  GLN B NE2 1 
ATOM   7072  N  N   . GLY B 1  241 ? -7.703  5.205   148.964 1.00 22.62  ? 339  GLY B N   1 
ATOM   7073  C  CA  . GLY B 1  241 ? -8.855  4.664   149.664 1.00 21.78  ? 339  GLY B CA  1 
ATOM   7074  C  C   . GLY B 1  241 ? -10.169 4.992   148.978 1.00 21.22  ? 339  GLY B C   1 
ATOM   7075  O  O   . GLY B 1  241 ? -10.315 6.062   148.388 1.00 19.85  ? 339  GLY B O   1 
ATOM   7076  N  N   . PRO B 1  242 ? -11.137 4.067   149.055 1.00 22.34  ? 340  PRO B N   1 
ATOM   7077  C  CA  . PRO B 1  242 ? -12.426 4.191   148.363 1.00 21.17  ? 340  PRO B CA  1 
ATOM   7078  C  C   . PRO B 1  242 ? -13.312 5.314   148.907 1.00 23.80  ? 340  PRO B C   1 
ATOM   7079  O  O   . PRO B 1  242 ? -13.971 5.994   148.122 1.00 30.28  ? 340  PRO B O   1 
ATOM   7080  C  CB  . PRO B 1  242 ? -13.077 2.825   148.597 1.00 19.24  ? 340  PRO B CB  1 
ATOM   7081  C  CG  . PRO B 1  242 ? -12.461 2.327   149.858 1.00 20.47  ? 340  PRO B CG  1 
ATOM   7082  C  CD  . PRO B 1  242 ? -11.046 2.818   149.832 1.00 24.16  ? 340  PRO B CD  1 
ATOM   7083  N  N   . PHE B 1  243 ? -13.334 5.498   150.223 1.00 17.55  ? 341  PHE B N   1 
ATOM   7084  C  CA  . PHE B 1  243 ? -14.167 6.527   150.840 1.00 16.97  ? 341  PHE B CA  1 
ATOM   7085  C  C   . PHE B 1  243 ? -13.683 7.926   150.467 1.00 23.46  ? 341  PHE B C   1 
ATOM   7086  O  O   . PHE B 1  243 ? -12.490 8.223   150.550 1.00 23.95  ? 341  PHE B O   1 
ATOM   7087  C  CB  . PHE B 1  243 ? -14.182 6.368   152.363 1.00 17.45  ? 341  PHE B CB  1 
ATOM   7088  C  CG  . PHE B 1  243 ? -15.166 7.266   153.060 1.00 18.04  ? 341  PHE B CG  1 
ATOM   7089  C  CD1 . PHE B 1  243 ? -16.494 6.895   153.180 1.00 18.35  ? 341  PHE B CD1 1 
ATOM   7090  C  CD2 . PHE B 1  243 ? -14.765 8.482   153.589 1.00 18.21  ? 341  PHE B CD2 1 
ATOM   7091  C  CE1 . PHE B 1  243 ? -17.402 7.717   153.820 1.00 18.54  ? 341  PHE B CE1 1 
ATOM   7092  C  CE2 . PHE B 1  243 ? -15.670 9.310   154.227 1.00 19.24  ? 341  PHE B CE2 1 
ATOM   7093  C  CZ  . PHE B 1  243 ? -16.989 8.928   154.341 1.00 18.05  ? 341  PHE B CZ  1 
ATOM   7094  N  N   . VAL B 1  244 ? -14.613 8.781   150.056 1.00 19.37  ? 342  VAL B N   1 
ATOM   7095  C  CA  . VAL B 1  244 ? -14.274 10.144  149.664 1.00 17.08  ? 342  VAL B CA  1 
ATOM   7096  C  C   . VAL B 1  244 ? -15.014 11.150  150.537 1.00 20.70  ? 342  VAL B C   1 
ATOM   7097  O  O   . VAL B 1  244 ? -16.239 11.145  150.596 1.00 22.70  ? 342  VAL B O   1 
ATOM   7098  C  CB  . VAL B 1  244 ? -14.612 10.402  148.185 1.00 15.23  ? 342  VAL B CB  1 
ATOM   7099  C  CG1 . VAL B 1  244 ? -14.307 11.845  147.817 1.00 14.64  ? 342  VAL B CG1 1 
ATOM   7100  C  CG2 . VAL B 1  244 ? -13.840 9.442   147.291 1.00 15.74  ? 342  VAL B CG2 1 
ATOM   7101  N  N   . ALA B 1  245 ? -14.267 12.023  151.203 1.00 22.40  ? 343  ALA B N   1 
ATOM   7102  C  CA  . ALA B 1  245 ? -14.869 12.987  152.115 1.00 21.20  ? 343  ALA B CA  1 
ATOM   7103  C  C   . ALA B 1  245 ? -14.470 14.408  151.743 1.00 25.81  ? 343  ALA B C   1 
ATOM   7104  O  O   . ALA B 1  245 ? -13.311 14.797  151.884 1.00 28.77  ? 343  ALA B O   1 
ATOM   7105  C  CB  . ALA B 1  245 ? -14.470 12.682  153.549 1.00 18.37  ? 343  ALA B CB  1 
ATOM   7106  N  N   . ALA B 1  246 ? -15.442 15.179  151.268 1.00 24.49  ? 344  ALA B N   1 
ATOM   7107  C  CA  . ALA B 1  246 ? -15.181 16.538  150.814 1.00 20.47  ? 344  ALA B CA  1 
ATOM   7108  C  C   . ALA B 1  246 ? -15.878 17.575  151.680 1.00 20.81  ? 344  ALA B C   1 
ATOM   7109  O  O   . ALA B 1  246 ? -17.086 17.508  151.895 1.00 23.98  ? 344  ALA B O   1 
ATOM   7110  C  CB  . ALA B 1  246 ? -15.612 16.698  149.366 1.00 20.44  ? 344  ALA B CB  1 
ATOM   7111  N  N   . PHE B 1  247 ? -15.107 18.534  152.177 1.00 18.32  ? 345  PHE B N   1 
ATOM   7112  C  CA  . PHE B 1  247 ? -15.684 19.724  152.778 1.00 14.51  ? 345  PHE B CA  1 
ATOM   7113  C  C   . PHE B 1  247 ? -15.992 20.725  151.680 1.00 18.41  ? 345  PHE B C   1 
ATOM   7114  O  O   . PHE B 1  247 ? -15.129 21.051  150.867 1.00 28.23  ? 345  PHE B O   1 
ATOM   7115  C  CB  . PHE B 1  247 ? -14.742 20.335  153.816 1.00 14.02  ? 345  PHE B CB  1 
ATOM   7116  C  CG  . PHE B 1  247 ? -15.000 19.863  155.215 1.00 19.80  ? 345  PHE B CG  1 
ATOM   7117  C  CD1 . PHE B 1  247 ? -14.709 18.562  155.587 1.00 22.38  ? 345  PHE B CD1 1 
ATOM   7118  C  CD2 . PHE B 1  247 ? -15.537 20.722  156.160 1.00 20.68  ? 345  PHE B CD2 1 
ATOM   7119  C  CE1 . PHE B 1  247 ? -14.950 18.126  156.875 1.00 25.66  ? 345  PHE B CE1 1 
ATOM   7120  C  CE2 . PHE B 1  247 ? -15.777 20.292  157.450 1.00 23.28  ? 345  PHE B CE2 1 
ATOM   7121  C  CZ  . PHE B 1  247 ? -15.484 18.993  157.808 1.00 23.91  ? 345  PHE B CZ  1 
ATOM   7122  N  N   . ALA B 1  248 ? -17.230 21.200  151.650 1.00 15.13  ? 346  ALA B N   1 
ATOM   7123  C  CA  . ALA B 1  248 ? -17.647 22.142  150.626 1.00 15.59  ? 346  ALA B CA  1 
ATOM   7124  C  C   . ALA B 1  248 ? -17.728 23.546  151.205 1.00 17.82  ? 346  ALA B C   1 
ATOM   7125  O  O   . ALA B 1  248 ? -18.227 23.739  152.314 1.00 19.62  ? 346  ALA B O   1 
ATOM   7126  C  CB  . ALA B 1  248 ? -18.984 21.728  150.033 1.00 18.73  ? 346  ALA B CB  1 
ATOM   7127  N  N   . SER B 1  249 ? -17.222 24.523  150.459 1.00 15.75  ? 347  SER B N   1 
ATOM   7128  C  CA  . SER B 1  249 ? -17.285 25.915  150.883 1.00 13.69  ? 347  SER B CA  1 
ATOM   7129  C  C   . SER B 1  249 ? -18.729 26.388  150.923 1.00 16.02  ? 347  SER B C   1 
ATOM   7130  O  O   . SER B 1  249 ? -19.578 25.884  150.187 1.00 18.31  ? 347  SER B O   1 
ATOM   7131  C  CB  . SER B 1  249 ? -16.466 26.803  149.946 1.00 15.74  ? 347  SER B CB  1 
ATOM   7132  O  OG  . SER B 1  249 ? -16.951 26.718  148.620 1.00 15.13  ? 347  SER B OG  1 
ATOM   7133  N  N   . SER B 1  250 ? -18.998 27.363  151.782 1.00 14.96  ? 348  SER B N   1 
ATOM   7134  C  CA  . SER B 1  250 ? -20.346 27.879  151.956 1.00 13.89  ? 348  SER B CA  1 
ATOM   7135  C  C   . SER B 1  250 ? -20.328 29.400  151.914 1.00 14.49  ? 348  SER B C   1 
ATOM   7136  O  O   . SER B 1  250 ? -19.544 29.994  151.173 1.00 12.76  ? 348  SER B O   1 
ATOM   7137  C  CB  . SER B 1  250 ? -20.945 27.385  153.273 1.00 19.64  ? 348  SER B CB  1 
ATOM   7138  O  OG  . SER B 1  250 ? -22.346 27.583  153.303 1.00 28.51  ? 348  SER B OG  1 
ATOM   7139  N  N   . ASN B 1  251 ? -21.189 30.031  152.704 1.00 15.94  ? 349  ASN B N   1 
ATOM   7140  C  CA  . ASN B 1  251 ? -21.168 31.484  152.816 1.00 20.94  ? 349  ASN B CA  1 
ATOM   7141  C  C   . ASN B 1  251 ? -20.115 31.935  153.831 1.00 19.19  ? 349  ASN B C   1 
ATOM   7142  O  O   . ASN B 1  251 ? -20.431 32.283  154.970 1.00 15.35  ? 349  ASN B O   1 
ATOM   7143  C  CB  . ASN B 1  251 ? -22.556 32.024  153.184 1.00 20.87  ? 349  ASN B CB  1 
ATOM   7144  C  CG  . ASN B 1  251 ? -23.144 31.355  154.410 1.00 23.08  ? 349  ASN B CG  1 
ATOM   7145  O  OD1 . ASN B 1  251 ? -22.923 30.168  154.653 1.00 25.54  ? 349  ASN B OD1 1 
ATOM   7146  N  ND2 . ASN B 1  251 ? -23.895 32.119  155.194 1.00 11.88  ? 349  ASN B ND2 1 
ATOM   7147  N  N   . LEU B 1  252 ? -18.859 31.935  153.395 1.00 15.27  ? 350  LEU B N   1 
ATOM   7148  C  CA  . LEU B 1  252 ? -17.733 32.186  154.284 1.00 15.69  ? 350  LEU B CA  1 
ATOM   7149  C  C   . LEU B 1  252 ? -17.229 33.628  154.238 1.00 19.46  ? 350  LEU B C   1 
ATOM   7150  O  O   . LEU B 1  252 ? -16.210 33.948  154.850 1.00 22.24  ? 350  LEU B O   1 
ATOM   7151  C  CB  . LEU B 1  252 ? -16.580 31.234  153.945 1.00 14.26  ? 350  LEU B CB  1 
ATOM   7152  C  CG  . LEU B 1  252 ? -16.287 30.912  152.470 1.00 15.06  ? 350  LEU B CG  1 
ATOM   7153  C  CD1 . LEU B 1  252 ? -16.007 32.152  151.626 1.00 11.02  ? 350  LEU B CD1 1 
ATOM   7154  C  CD2 . LEU B 1  252 ? -15.124 29.937  152.367 1.00 12.51  ? 350  LEU B CD2 1 
ATOM   7155  N  N   . GLY B 1  253 ? -17.955 34.485  153.526 1.00 17.53  ? 351  GLY B N   1 
ATOM   7156  C  CA  . GLY B 1  253 ? -17.494 35.824  153.192 1.00 17.14  ? 351  GLY B CA  1 
ATOM   7157  C  C   . GLY B 1  253 ? -16.875 36.642  154.310 1.00 17.98  ? 351  GLY B C   1 
ATOM   7158  O  O   . GLY B 1  253 ? -15.854 37.297  154.112 1.00 17.16  ? 351  GLY B O   1 
ATOM   7159  N  N   . ASP B 1  254 ? -17.486 36.599  155.488 1.00 19.22  ? 352  ASP B N   1 
ATOM   7160  C  CA  . ASP B 1  254 ? -17.002 37.375  156.624 1.00 18.61  ? 352  ASP B CA  1 
ATOM   7161  C  C   . ASP B 1  254 ? -16.640 36.480  157.806 1.00 18.78  ? 352  ASP B C   1 
ATOM   7162  O  O   . ASP B 1  254 ? -16.672 36.914  158.956 1.00 14.81  ? 352  ASP B O   1 
ATOM   7163  C  CB  . ASP B 1  254 ? -18.053 38.409  157.039 1.00 16.80  ? 352  ASP B CB  1 
ATOM   7164  C  CG  . ASP B 1  254 ? -19.406 37.783  157.330 1.00 20.55  ? 352  ASP B CG  1 
ATOM   7165  O  OD1 . ASP B 1  254 ? -19.645 36.641  156.883 1.00 18.69  ? 352  ASP B OD1 1 
ATOM   7166  O  OD2 . ASP B 1  254 ? -20.235 38.437  157.998 1.00 21.95  ? 352  ASP B OD2 1 
ATOM   7167  N  N   . VAL B 1  255 ? -16.284 35.232  157.514 1.00 11.63  ? 353  VAL B N   1 
ATOM   7168  C  CA  . VAL B 1  255 ? -16.010 34.251  158.558 1.00 16.88  ? 353  VAL B CA  1 
ATOM   7169  C  C   . VAL B 1  255 ? -14.535 33.845  158.595 1.00 21.65  ? 353  VAL B C   1 
ATOM   7170  O  O   . VAL B 1  255 ? -13.994 33.343  157.610 1.00 23.59  ? 353  VAL B O   1 
ATOM   7171  C  CB  . VAL B 1  255 ? -16.881 32.993  158.372 1.00 15.22  ? 353  VAL B CB  1 
ATOM   7172  C  CG1 . VAL B 1  255 ? -16.700 32.043  159.542 1.00 12.91  ? 353  VAL B CG1 1 
ATOM   7173  C  CG2 . VAL B 1  255 ? -18.346 33.383  158.223 1.00 15.08  ? 353  VAL B CG2 1 
ATOM   7174  N  N   . SER B 1  256 ? -13.894 34.064  159.740 1.00 21.97  ? 354  SER B N   1 
ATOM   7175  C  CA  . SER B 1  256 ? -12.475 33.760  159.913 1.00 16.84  ? 354  SER B CA  1 
ATOM   7176  C  C   . SER B 1  256 ? -12.239 32.610  160.892 1.00 19.31  ? 354  SER B C   1 
ATOM   7177  O  O   . SER B 1  256 ? -12.994 32.445  161.848 1.00 26.41  ? 354  SER B O   1 
ATOM   7178  C  CB  . SER B 1  256 ? -11.728 35.007  160.394 1.00 16.66  ? 354  SER B CB  1 
ATOM   7179  O  OG  . SER B 1  256 ? -10.383 34.704  160.720 1.00 17.16  ? 354  SER B OG  1 
ATOM   7180  N  N   . PRO B 1  257 ? -11.185 31.812  160.652 1.00 16.77  ? 355  PRO B N   1 
ATOM   7181  C  CA  . PRO B 1  257 ? -10.787 30.723  161.549 1.00 16.52  ? 355  PRO B CA  1 
ATOM   7182  C  C   . PRO B 1  257 ? -9.809  31.177  162.629 1.00 16.46  ? 355  PRO B C   1 
ATOM   7183  O  O   . PRO B 1  257 ? -9.435  30.389  163.499 1.00 12.90  ? 355  PRO B O   1 
ATOM   7184  C  CB  . PRO B 1  257 ? -10.111 29.737  160.603 1.00 12.05  ? 355  PRO B CB  1 
ATOM   7185  C  CG  . PRO B 1  257 ? -9.453  30.626  159.610 1.00 11.96  ? 355  PRO B CG  1 
ATOM   7186  C  CD  . PRO B 1  257 ? -10.405 31.787  159.402 1.00 11.87  ? 355  PRO B CD  1 
ATOM   7187  N  N   . ASN B 1  258 ? -9.404  32.440  162.568 1.00 16.64  ? 356  ASN B N   1 
ATOM   7188  C  CA  . ASN B 1  258 ? -8.421  32.977  163.501 1.00 17.84  ? 356  ASN B CA  1 
ATOM   7189  C  C   . ASN B 1  258 ? -9.123  33.525  164.737 1.00 18.97  ? 356  ASN B C   1 
ATOM   7190  O  O   . ASN B 1  258 ? -9.277  34.737  164.902 1.00 13.74  ? 356  ASN B O   1 
ATOM   7191  C  CB  . ASN B 1  258 ? -7.584  34.056  162.821 1.00 16.32  ? 356  ASN B CB  1 
ATOM   7192  C  CG  . ASN B 1  258 ? -6.807  33.519  161.632 1.00 17.01  ? 356  ASN B CG  1 
ATOM   7193  O  OD1 . ASN B 1  258 ? -6.256  32.418  161.683 1.00 16.14  ? 356  ASN B OD1 1 
ATOM   7194  N  ND2 . ASN B 1  258 ? -6.781  34.283  160.545 1.00 12.94  ? 356  ASN B ND2 1 
ATOM   7195  N  N   . ILE B 1  259 ? -9.532  32.611  165.612 1.00 17.50  ? 357  ILE B N   1 
ATOM   7196  C  CA  . ILE B 1  259 ? -10.507 32.908  166.655 1.00 18.15  ? 357  ILE B CA  1 
ATOM   7197  C  C   . ILE B 1  259 ? -9.978  33.735  167.825 1.00 21.40  ? 357  ILE B C   1 
ATOM   7198  O  O   . ILE B 1  259 ? -10.759 34.178  168.666 1.00 29.54  ? 357  ILE B O   1 
ATOM   7199  C  CB  . ILE B 1  259 ? -11.101 31.608  167.218 1.00 16.12  ? 357  ILE B CB  1 
ATOM   7200  C  CG1 . ILE B 1  259 ? -10.003 30.742  167.837 1.00 18.30  ? 357  ILE B CG1 1 
ATOM   7201  C  CG2 . ILE B 1  259 ? -11.833 30.847  166.125 1.00 13.46  ? 357  ILE B CG2 1 
ATOM   7202  C  CD1 . ILE B 1  259 ? -10.522 29.488  168.505 1.00 14.51  ? 357  ILE B CD1 1 
ATOM   7203  N  N   . LEU B 1  260 ? -8.668  33.946  167.892 1.00 18.49  ? 358  LEU B N   1 
ATOM   7204  C  CA  . LEU B 1  260 ? -8.116  34.814  168.929 1.00 20.03  ? 358  LEU B CA  1 
ATOM   7205  C  C   . LEU B 1  260 ? -8.461  36.274  168.659 1.00 21.06  ? 358  LEU B C   1 
ATOM   7206  O  O   . LEU B 1  260 ? -8.302  37.132  169.527 1.00 25.28  ? 358  LEU B O   1 
ATOM   7207  C  CB  . LEU B 1  260 ? -6.600  34.650  169.042 1.00 23.18  ? 358  LEU B CB  1 
ATOM   7208  C  CG  . LEU B 1  260 ? -6.072  33.309  169.550 1.00 21.74  ? 358  LEU B CG  1 
ATOM   7209  C  CD1 . LEU B 1  260 ? -4.572  33.400  169.779 1.00 17.28  ? 358  LEU B CD1 1 
ATOM   7210  C  CD2 . LEU B 1  260 ? -6.790  32.885  170.822 1.00 16.42  ? 358  LEU B CD2 1 
ATOM   7211  N  N   . GLY B 1  261 ? -8.939  36.548  167.450 1.00 21.15  ? 359  GLY B N   1 
ATOM   7212  C  CA  . GLY B 1  261 ? -9.372  37.883  167.088 1.00 19.92  ? 359  GLY B CA  1 
ATOM   7213  C  C   . GLY B 1  261 ? -8.242  38.786  166.635 1.00 19.95  ? 359  GLY B C   1 
ATOM   7214  O  O   . GLY B 1  261 ? -7.067  38.435  166.754 1.00 22.85  ? 359  GLY B O   1 
ATOM   7215  N  N   . PRO B 1  262 ? -8.596  39.970  166.118 1.00 21.74  ? 360  PRO B N   1 
ATOM   7216  C  CA  . PRO B 1  262 ? -7.633  40.931  165.573 1.00 23.07  ? 360  PRO B CA  1 
ATOM   7217  C  C   . PRO B 1  262 ? -6.854  41.667  166.660 1.00 26.81  ? 360  PRO B C   1 
ATOM   7218  O  O   . PRO B 1  262 ? -7.443  42.311  167.531 1.00 31.27  ? 360  PRO B O   1 
ATOM   7219  C  CB  . PRO B 1  262 ? -8.516  41.898  164.782 1.00 15.47  ? 360  PRO B CB  1 
ATOM   7220  C  CG  . PRO B 1  262 ? -9.835  41.841  165.463 1.00 15.44  ? 360  PRO B CG  1 
ATOM   7221  C  CD  . PRO B 1  262 ? -9.985  40.450  166.010 1.00 19.35  ? 360  PRO B CD  1 
ATOM   7222  N  N   . ARG B 1  263 ? -5.531  41.561  166.604 1.00 26.95  ? 361  ARG B N   1 
ATOM   7223  C  CA  . ARG B 1  263 ? -4.660  42.247  167.549 1.00 27.50  ? 361  ARG B CA  1 
ATOM   7224  C  C   . ARG B 1  263 ? -3.538  42.964  166.808 1.00 28.12  ? 361  ARG B C   1 
ATOM   7225  O  O   . ARG B 1  263 ? -3.113  42.522  165.741 1.00 29.55  ? 361  ARG B O   1 
ATOM   7226  C  CB  . ARG B 1  263 ? -4.072  41.255  168.557 1.00 28.93  ? 361  ARG B CB  1 
ATOM   7227  C  CG  . ARG B 1  263 ? -5.085  40.606  169.490 1.00 32.16  ? 361  ARG B CG  1 
ATOM   7228  C  CD  . ARG B 1  263 ? -5.309  41.451  170.733 1.00 38.29  ? 361  ARG B CD  1 
ATOM   7229  N  NE  . ARG B 1  263 ? -6.024  40.722  171.776 1.00 43.43  ? 361  ARG B NE  1 
ATOM   7230  C  CZ  . ARG B 1  263 ? -6.235  41.188  173.003 1.00 45.43  ? 361  ARG B CZ  1 
ATOM   7231  N  NH1 . ARG B 1  263 ? -5.783  42.386  173.348 1.00 44.46  ? 361  ARG B NH1 1 
ATOM   7232  N  NH2 . ARG B 1  263 ? -6.896  40.455  173.890 1.00 45.97  ? 361  ARG B NH2 1 
ATOM   7233  N  N   . CYS B 1  264 ? -3.066  44.073  167.368 1.00 23.65  ? 362  CYS B N   1 
ATOM   7234  C  CA  . CYS B 1  264 ? -1.915  44.762  166.803 1.00 25.06  ? 362  CYS B CA  1 
ATOM   7235  C  C   . CYS B 1  264 ? -0.659  43.982  167.171 1.00 26.67  ? 362  CYS B C   1 
ATOM   7236  O  O   . CYS B 1  264 ? -0.377  43.777  168.349 1.00 26.81  ? 362  CYS B O   1 
ATOM   7237  C  CB  . CYS B 1  264 ? -1.828  46.200  167.318 1.00 24.66  ? 362  CYS B CB  1 
ATOM   7238  S  SG  . CYS B 1  264 ? -3.280  47.210  166.961 1.00 28.17  ? 362  CYS B SG  1 
ATOM   7239  N  N   . ILE B 1  265 ? 0.098   43.557  166.166 1.00 26.38  ? 363  ILE B N   1 
ATOM   7240  C  CA  . ILE B 1  265 ? 1.258   42.702  166.398 1.00 28.98  ? 363  ILE B CA  1 
ATOM   7241  C  C   . ILE B 1  265 ? 2.338   43.385  167.239 1.00 28.77  ? 363  ILE B C   1 
ATOM   7242  O  O   . ILE B 1  265 ? 3.069   42.719  167.972 1.00 30.98  ? 363  ILE B O   1 
ATOM   7243  C  CB  . ILE B 1  265 ? 1.867   42.216  165.068 1.00 31.17  ? 363  ILE B CB  1 
ATOM   7244  C  CG1 . ILE B 1  265 ? 2.101   43.389  164.120 1.00 34.95  ? 363  ILE B CG1 1 
ATOM   7245  C  CG2 . ILE B 1  265 ? 0.948   41.201  164.407 1.00 28.11  ? 363  ILE B CG2 1 
ATOM   7246  C  CD1 . ILE B 1  265 ? 2.689   42.983  162.786 1.00 35.60  ? 363  ILE B CD1 1 
ATOM   7247  N  N   . ASN B 1  266 ? 2.434   44.707  167.141 1.00 26.83  ? 364  ASN B N   1 
ATOM   7248  C  CA  . ASN B 1  266 ? 3.466   45.447  167.864 1.00 30.56  ? 364  ASN B CA  1 
ATOM   7249  C  C   . ASN B 1  266 ? 3.143   45.684  169.337 1.00 30.88  ? 364  ASN B C   1 
ATOM   7250  O  O   . ASN B 1  266 ? 4.022   45.581  170.191 1.00 36.42  ? 364  ASN B O   1 
ATOM   7251  C  CB  . ASN B 1  266 ? 3.727   46.793  167.185 1.00 33.44  ? 364  ASN B CB  1 
ATOM   7252  C  CG  . ASN B 1  266 ? 2.451   47.556  166.889 1.00 34.88  ? 364  ASN B CG  1 
ATOM   7253  O  OD1 . ASN B 1  266 ? 1.365   47.158  167.310 1.00 40.07  ? 364  ASN B OD1 1 
ATOM   7254  N  ND2 . ASN B 1  266 ? 2.576   48.661  166.161 1.00 28.09  ? 364  ASN B ND2 1 
ATOM   7255  N  N   . THR B 1  267 ? 1.888   46.003  169.636 1.00 26.81  ? 365  THR B N   1 
ATOM   7256  C  CA  . THR B 1  267 ? 1.511   46.355  171.000 1.00 25.76  ? 365  THR B CA  1 
ATOM   7257  C  C   . THR B 1  267 ? 0.697   45.256  171.676 1.00 26.97  ? 365  THR B C   1 
ATOM   7258  O  O   . THR B 1  267 ? 0.611   45.204  172.904 1.00 29.10  ? 365  THR B O   1 
ATOM   7259  C  CB  . THR B 1  267 ? 0.702   47.666  171.037 1.00 29.88  ? 365  THR B CB  1 
ATOM   7260  O  OG1 . THR B 1  267 ? -0.585  47.457  170.443 1.00 26.91  ? 365  THR B OG1 1 
ATOM   7261  C  CG2 . THR B 1  267 ? 1.439   48.769  170.287 1.00 23.57  ? 365  THR B CG2 1 
ATOM   7262  N  N   . GLY B 1  268 ? 0.102   44.379  170.873 1.00 25.62  ? 366  GLY B N   1 
ATOM   7263  C  CA  . GLY B 1  268 ? -0.734  43.311  171.393 1.00 20.92  ? 366  GLY B CA  1 
ATOM   7264  C  C   . GLY B 1  268 ? -2.129  43.777  171.765 1.00 25.91  ? 366  GLY B C   1 
ATOM   7265  O  O   . GLY B 1  268 ? -2.943  43.001  172.263 1.00 22.94  ? 366  GLY B O   1 
ATOM   7266  N  N   . GLU B 1  269 ? -2.406  45.052  171.516 1.00 26.49  ? 367  GLU B N   1 
ATOM   7267  C  CA  . GLU B 1  269 ? -3.710  45.625  171.824 1.00 23.58  ? 367  GLU B CA  1 
ATOM   7268  C  C   . GLU B 1  269 ? -4.751  45.122  170.836 1.00 24.43  ? 367  GLU B C   1 
ATOM   7269  O  O   . GLU B 1  269 ? -4.416  44.696  169.731 1.00 26.61  ? 367  GLU B O   1 
ATOM   7270  C  CB  . GLU B 1  269 ? -3.653  47.152  171.795 1.00 25.02  ? 367  GLU B CB  1 
ATOM   7271  C  CG  . GLU B 1  269 ? -3.859  47.745  170.414 1.00 25.13  ? 367  GLU B CG  1 
ATOM   7272  C  CD  . GLU B 1  269 ? -3.455  49.199  170.335 1.00 28.37  ? 367  GLU B CD  1 
ATOM   7273  O  OE1 . GLU B 1  269 ? -4.327  50.046  170.046 1.00 28.84  ? 367  GLU B OE1 1 
ATOM   7274  O  OE2 . GLU B 1  269 ? -2.263  49.494  170.554 1.00 32.35  ? 367  GLU B OE2 1 
ATOM   7275  N  N   . SER B 1  270 ? -6.015  45.171  171.239 1.00 22.35  ? 368  SER B N   1 
ATOM   7276  C  CA  . SER B 1  270 ? -7.107  44.781  170.361 1.00 22.61  ? 368  SER B CA  1 
ATOM   7277  C  C   . SER B 1  270 ? -7.356  45.840  169.293 1.00 25.55  ? 368  SER B C   1 
ATOM   7278  O  O   . SER B 1  270 ? -7.473  47.026  169.602 1.00 26.39  ? 368  SER B O   1 
ATOM   7279  C  CB  . SER B 1  270 ? -8.383  44.543  171.170 1.00 25.85  ? 368  SER B CB  1 
ATOM   7280  O  OG  . SER B 1  270 ? -9.505  44.384  170.318 1.00 28.68  ? 368  SER B OG  1 
ATOM   7281  N  N   . CYS B 1  271 ? -7.416  45.413  168.036 1.00 25.54  ? 369  CYS B N   1 
ATOM   7282  C  CA  . CYS B 1  271 ? -7.795  46.309  166.951 1.00 23.95  ? 369  CYS B CA  1 
ATOM   7283  C  C   . CYS B 1  271 ? -9.135  45.873  166.371 1.00 26.02  ? 369  CYS B C   1 
ATOM   7284  O  O   . CYS B 1  271 ? -9.349  45.920  165.160 1.00 26.89  ? 369  CYS B O   1 
ATOM   7285  C  CB  . CYS B 1  271 ? -6.720  46.347  165.862 1.00 18.31  ? 369  CYS B CB  1 
ATOM   7286  S  SG  . CYS B 1  271 ? -6.312  44.745  165.143 1.00 31.30  ? 369  CYS B SG  1 
ATOM   7287  N  N   . ASP B 1  272 ? -10.033 45.444  167.252 1.00 26.03  ? 370  ASP B N   1 
ATOM   7288  C  CA  . ASP B 1  272 ? -11.387 45.081  166.858 1.00 28.42  ? 370  ASP B CA  1 
ATOM   7289  C  C   . ASP B 1  272 ? -12.232 46.345  166.705 1.00 29.92  ? 370  ASP B C   1 
ATOM   7290  O  O   . ASP B 1  272 ? -13.056 46.670  167.563 1.00 29.78  ? 370  ASP B O   1 
ATOM   7291  C  CB  . ASP B 1  272 ? -12.005 44.132  167.889 1.00 30.02  ? 370  ASP B CB  1 
ATOM   7292  C  CG  . ASP B 1  272 ? -13.402 43.675  167.510 1.00 32.47  ? 370  ASP B CG  1 
ATOM   7293  O  OD1 . ASP B 1  272 ? -13.777 43.803  166.325 1.00 34.94  ? 370  ASP B OD1 1 
ATOM   7294  O  OD2 . ASP B 1  272 ? -14.125 43.184  168.403 1.00 33.26  ? 370  ASP B OD2 1 
ATOM   7295  N  N   . ASN B 1  273 ? -12.013 47.059  165.606 1.00 28.86  ? 371  ASN B N   1 
ATOM   7296  C  CA  . ASN B 1  273 ? -12.732 48.294  165.332 1.00 28.25  ? 371  ASN B CA  1 
ATOM   7297  C  C   . ASN B 1  273 ? -13.207 48.358  163.884 1.00 25.76  ? 371  ASN B C   1 
ATOM   7298  O  O   . ASN B 1  273 ? -12.940 47.453  163.094 1.00 28.65  ? 371  ASN B O   1 
ATOM   7299  C  CB  . ASN B 1  273 ? -11.860 49.509  165.667 1.00 28.84  ? 371  ASN B CB  1 
ATOM   7300  C  CG  . ASN B 1  273 ? -10.445 49.383  165.130 1.00 26.01  ? 371  ASN B CG  1 
ATOM   7301  O  OD1 . ASN B 1  273 ? -10.220 49.411  163.922 1.00 26.50  ? 371  ASN B OD1 1 
ATOM   7302  N  ND2 . ASN B 1  273 ? -9.484  49.250  166.033 1.00 24.47  ? 371  ASN B ND2 1 
ATOM   7303  N  N   . ALA B 1  274 ? -13.914 49.430  163.543 1.00 23.50  ? 372  ALA B N   1 
ATOM   7304  C  CA  . ALA B 1  274 ? -14.540 49.552  162.232 1.00 22.60  ? 372  ALA B CA  1 
ATOM   7305  C  C   . ALA B 1  274 ? -13.526 49.638  161.098 1.00 23.30  ? 372  ALA B C   1 
ATOM   7306  O  O   . ALA B 1  274 ? -13.821 49.254  159.967 1.00 23.44  ? 372  ALA B O   1 
ATOM   7307  C  CB  . ALA B 1  274 ? -15.456 50.767  162.203 1.00 25.83  ? 372  ALA B CB  1 
ATOM   7308  N  N   . ASN B 1  275 ? -12.332 50.134  161.403 1.00 27.64  ? 373  ASN B N   1 
ATOM   7309  C  CA  . ASN B 1  275 ? -11.308 50.325  160.382 1.00 27.31  ? 373  ASN B CA  1 
ATOM   7310  C  C   . ASN B 1  275 ? -10.286 49.191  160.346 1.00 25.05  ? 373  ASN B C   1 
ATOM   7311  O  O   . ASN B 1  275 ? -9.483  49.106  159.414 1.00 16.86  ? 373  ASN B O   1 
ATOM   7312  C  CB  . ASN B 1  275 ? -10.588 51.657  160.595 1.00 35.31  ? 373  ASN B CB  1 
ATOM   7313  C  CG  . ASN B 1  275 ? -11.486 52.855  160.343 1.00 45.30  ? 373  ASN B CG  1 
ATOM   7314  O  OD1 . ASN B 1  275 ? -11.323 53.908  160.958 1.00 49.47  ? 373  ASN B OD1 1 
ATOM   7315  N  ND2 . ASN B 1  275 ? -12.446 52.695  159.439 1.00 48.63  ? 373  ASN B ND2 1 
ATOM   7316  N  N   . SER B 1  276 ? -10.328 48.327  161.359 1.00 23.29  ? 374  SER B N   1 
ATOM   7317  C  CA  . SER B 1  276 ? -9.314  47.292  161.564 1.00 21.41  ? 374  SER B CA  1 
ATOM   7318  C  C   . SER B 1  276 ? -7.912  47.884  161.472 1.00 21.96  ? 374  SER B C   1 
ATOM   7319  O  O   . SER B 1  276 ? -7.092  47.447  160.666 1.00 21.29  ? 374  SER B O   1 
ATOM   7320  C  CB  . SER B 1  276 ? -9.479  46.158  160.549 1.00 18.41  ? 374  SER B CB  1 
ATOM   7321  O  OG  . SER B 1  276 ? -10.684 45.449  160.771 1.00 20.40  ? 374  SER B OG  1 
ATOM   7322  N  N   . THR B 1  277 ? -7.645  48.882  162.306 1.00 23.47  ? 375  THR B N   1 
ATOM   7323  C  CA  . THR B 1  277 ? -6.397  49.619  162.220 1.00 25.60  ? 375  THR B CA  1 
ATOM   7324  C  C   . THR B 1  277 ? -5.749  49.794  163.587 1.00 26.61  ? 375  THR B C   1 
ATOM   7325  O  O   . THR B 1  277 ? -6.403  49.669  164.625 1.00 27.27  ? 375  THR B O   1 
ATOM   7326  C  CB  . THR B 1  277 ? -6.613  51.006  161.583 1.00 27.80  ? 375  THR B CB  1 
ATOM   7327  O  OG1 . THR B 1  277 ? -5.344  51.599  161.280 1.00 35.09  ? 375  THR B OG1 1 
ATOM   7328  C  CG2 . THR B 1  277 ? -7.376  51.913  162.533 1.00 24.07  ? 375  THR B CG2 1 
ATOM   7329  N  N   . CYS B 1  278 ? -4.451  50.070  163.573 1.00 25.33  ? 376  CYS B N   1 
ATOM   7330  C  CA  . CYS B 1  278 ? -3.694  50.269  164.800 1.00 24.47  ? 376  CYS B CA  1 
ATOM   7331  C  C   . CYS B 1  278 ? -3.141  51.688  164.868 1.00 26.03  ? 376  CYS B C   1 
ATOM   7332  O  O   . CYS B 1  278 ? -2.710  52.236  163.851 1.00 29.02  ? 376  CYS B O   1 
ATOM   7333  C  CB  . CYS B 1  278 ? -2.562  49.247  164.888 1.00 24.37  ? 376  CYS B CB  1 
ATOM   7334  S  SG  . CYS B 1  278 ? -3.141  47.536  164.964 1.00 37.77  ? 376  CYS B SG  1 
ATOM   7335  N  N   . PRO B 1  279 ? -3.157  52.289  166.068 1.00 26.32  ? 377  PRO B N   1 
ATOM   7336  C  CA  . PRO B 1  279 ? -2.650  53.646  166.303 1.00 26.24  ? 377  PRO B CA  1 
ATOM   7337  C  C   . PRO B 1  279 ? -1.193  53.805  165.871 1.00 28.41  ? 377  PRO B C   1 
ATOM   7338  O  O   . PRO B 1  279 ? -0.807  54.867  165.387 1.00 30.78  ? 377  PRO B O   1 
ATOM   7339  C  CB  . PRO B 1  279 ? -2.795  53.815  167.817 1.00 29.24  ? 377  PRO B CB  1 
ATOM   7340  C  CG  . PRO B 1  279 ? -3.916  52.906  168.182 1.00 30.15  ? 377  PRO B CG  1 
ATOM   7341  C  CD  . PRO B 1  279 ? -3.766  51.714  167.281 1.00 26.90  ? 377  PRO B CD  1 
ATOM   7342  N  N   . ILE B 1  280 ? -0.400  52.754  166.053 1.00 28.75  ? 378  ILE B N   1 
ATOM   7343  C  CA  . ILE B 1  280 ? 0.983   52.749  165.594 1.00 33.96  ? 378  ILE B CA  1 
ATOM   7344  C  C   . ILE B 1  280 ? 1.213   51.693  164.520 1.00 38.30  ? 378  ILE B C   1 
ATOM   7345  O  O   . ILE B 1  280 ? 1.186   50.495  164.799 1.00 45.89  ? 378  ILE B O   1 
ATOM   7346  C  CB  . ILE B 1  280 ? 1.963   52.491  166.752 1.00 37.74  ? 378  ILE B CB  1 
ATOM   7347  C  CG1 . ILE B 1  280 ? 1.786   53.538  167.851 1.00 42.97  ? 378  ILE B CG1 1 
ATOM   7348  C  CG2 . ILE B 1  280 ? 3.397   52.486  166.248 1.00 37.20  ? 378  ILE B CG2 1 
ATOM   7349  C  CD1 . ILE B 1  280 ? 2.632   53.273  169.072 1.00 46.15  ? 378  ILE B CD1 1 
ATOM   7350  N  N   . GLY B 1  281 ? 1.445   52.142  163.291 1.00 34.32  ? 379  GLY B N   1 
ATOM   7351  C  CA  . GLY B 1  281 ? 1.745   51.237  162.196 1.00 32.78  ? 379  GLY B CA  1 
ATOM   7352  C  C   . GLY B 1  281 ? 0.598   51.084  161.217 1.00 34.33  ? 379  GLY B C   1 
ATOM   7353  O  O   . GLY B 1  281 ? 0.781   50.606  160.098 1.00 37.49  ? 379  GLY B O   1 
ATOM   7354  N  N   . GLY B 1  282 ? -0.591  51.499  161.643 1.00 33.12  ? 380  GLY B N   1 
ATOM   7355  C  CA  . GLY B 1  282 ? -1.765  51.459  160.792 1.00 31.41  ? 380  GLY B CA  1 
ATOM   7356  C  C   . GLY B 1  282 ? -2.376  50.078  160.636 1.00 31.60  ? 380  GLY B C   1 
ATOM   7357  O  O   . GLY B 1  282 ? -2.175  49.205  161.480 1.00 27.79  ? 380  GLY B O   1 
ATOM   7358  N  N   . PRO B 1  283 ? -3.122  49.874  159.540 1.00 36.14  ? 381  PRO B N   1 
ATOM   7359  C  CA  . PRO B 1  283 ? -3.910  48.664  159.271 1.00 33.44  ? 381  PRO B CA  1 
ATOM   7360  C  C   . PRO B 1  283 ? -3.071  47.403  159.092 1.00 32.04  ? 381  PRO B C   1 
ATOM   7361  O  O   . PRO B 1  283 ? -3.517  46.317  159.463 1.00 34.83  ? 381  PRO B O   1 
ATOM   7362  C  CB  . PRO B 1  283 ? -4.639  49.006  157.968 1.00 34.11  ? 381  PRO B CB  1 
ATOM   7363  C  CG  . PRO B 1  283 ? -3.789  50.034  157.319 1.00 37.77  ? 381  PRO B CG  1 
ATOM   7364  C  CD  . PRO B 1  283 ? -3.209  50.844  158.435 1.00 39.14  ? 381  PRO B CD  1 
ATOM   7365  N  N   . SER B 1  284 ? -1.878  47.546  158.525 1.00 31.18  ? 382  SER B N   1 
ATOM   7366  C  CA  . SER B 1  284 ? -1.016  46.401  158.234 1.00 29.74  ? 382  SER B CA  1 
ATOM   7367  C  C   . SER B 1  284 ? -0.549  45.685  159.498 1.00 26.74  ? 382  SER B C   1 
ATOM   7368  O  O   . SER B 1  284 ? -0.068  44.553  159.440 1.00 27.52  ? 382  SER B O   1 
ATOM   7369  C  CB  . SER B 1  284 ? 0.198   46.848  157.418 1.00 32.98  ? 382  SER B CB  1 
ATOM   7370  O  OG  . SER B 1  284 ? 0.824   47.972  158.012 1.00 38.16  ? 382  SER B OG  1 
ATOM   7371  N  N   . MET B 1  285 ? -0.693  46.349  160.638 1.00 24.21  ? 383  MET B N   1 
ATOM   7372  C  CA  . MET B 1  285 ? -0.269  45.785  161.912 1.00 26.77  ? 383  MET B CA  1 
ATOM   7373  C  C   . MET B 1  285 ? -1.410  45.022  162.578 1.00 26.18  ? 383  MET B C   1 
ATOM   7374  O  O   . MET B 1  285 ? -1.201  44.283  163.540 1.00 28.71  ? 383  MET B O   1 
ATOM   7375  C  CB  . MET B 1  285 ? 0.243   46.890  162.833 1.00 29.65  ? 383  MET B CB  1 
ATOM   7376  C  CG  . MET B 1  285 ? 1.436   47.630  162.255 1.00 33.69  ? 383  MET B CG  1 
ATOM   7377  S  SD  . MET B 1  285 ? 2.900   46.598  162.072 1.00 39.95  ? 383  MET B SD  1 
ATOM   7378  C  CE  . MET B 1  285 ? 3.540   46.608  163.735 1.00 25.43  ? 383  MET B CE  1 
ATOM   7379  N  N   . CYS B 1  286 ? -2.619  45.215  162.059 1.00 21.38  ? 384  CYS B N   1 
ATOM   7380  C  CA  . CYS B 1  286 ? -3.819  44.609  162.620 1.00 16.90  ? 384  CYS B CA  1 
ATOM   7381  C  C   . CYS B 1  286 ? -4.077  43.237  161.997 1.00 19.30  ? 384  CYS B C   1 
ATOM   7382  O  O   . CYS B 1  286 ? -4.455  43.131  160.831 1.00 18.38  ? 384  CYS B O   1 
ATOM   7383  C  CB  . CYS B 1  286 ? -5.022  45.530  162.408 1.00 18.75  ? 384  CYS B CB  1 
ATOM   7384  S  SG  . CYS B 1  286 ? -6.565  44.949  163.138 1.00 27.26  ? 384  CYS B SG  1 
ATOM   7385  N  N   . ILE B 1  287 ? -3.861  42.188  162.782 1.00 17.76  ? 385  ILE B N   1 
ATOM   7386  C  CA  . ILE B 1  287 ? -3.927  40.820  162.280 1.00 17.39  ? 385  ILE B CA  1 
ATOM   7387  C  C   . ILE B 1  287 ? -4.580  39.890  163.305 1.00 19.37  ? 385  ILE B C   1 
ATOM   7388  O  O   . ILE B 1  287 ? -4.348  40.021  164.508 1.00 23.87  ? 385  ILE B O   1 
ATOM   7389  C  CB  . ILE B 1  287 ? -2.510  40.299  161.917 1.00 19.62  ? 385  ILE B CB  1 
ATOM   7390  C  CG1 . ILE B 1  287 ? -1.985  41.007  160.665 1.00 22.73  ? 385  ILE B CG1 1 
ATOM   7391  C  CG2 . ILE B 1  287 ? -2.503  38.789  161.709 1.00 15.19  ? 385  ILE B CG2 1 
ATOM   7392  C  CD1 . ILE B 1  287 ? -0.663  40.473  160.160 1.00 28.91  ? 385  ILE B CD1 1 
ATOM   7393  N  N   . ALA B 1  288 ? -5.408  38.965  162.826 1.00 17.63  ? 386  ALA B N   1 
ATOM   7394  C  CA  . ALA B 1  288 ? -6.026  37.968  163.692 1.00 19.76  ? 386  ALA B CA  1 
ATOM   7395  C  C   . ALA B 1  288 ? -5.266  36.646  163.627 1.00 21.40  ? 386  ALA B C   1 
ATOM   7396  O  O   . ALA B 1  288 ? -4.925  36.170  162.545 1.00 17.39  ? 386  ALA B O   1 
ATOM   7397  C  CB  . ALA B 1  288 ? -7.481  37.763  163.310 1.00 18.26  ? 386  ALA B CB  1 
ATOM   7398  N  N   . LYS B 1  289 ? -5.009  36.055  164.789 1.00 25.88  ? 387  LYS B N   1 
ATOM   7399  C  CA  . LYS B 1  289 ? -4.214  34.833  164.865 1.00 31.36  ? 387  LYS B CA  1 
ATOM   7400  C  C   . LYS B 1  289 ? -5.031  33.613  165.277 1.00 33.64  ? 387  LYS B C   1 
ATOM   7401  O  O   . LYS B 1  289 ? -6.096  33.736  165.882 1.00 37.50  ? 387  LYS B O   1 
ATOM   7402  C  CB  . LYS B 1  289 ? -3.043  35.024  165.831 1.00 34.19  ? 387  LYS B CB  1 
ATOM   7403  C  CG  . LYS B 1  289 ? -1.945  35.937  165.308 1.00 38.34  ? 387  LYS B CG  1 
ATOM   7404  C  CD  . LYS B 1  289 ? -0.773  35.974  166.275 1.00 44.17  ? 387  LYS B CD  1 
ATOM   7405  C  CE  . LYS B 1  289 ? 0.548   35.709  165.562 1.00 46.69  ? 387  LYS B CE  1 
ATOM   7406  N  NZ  . LYS B 1  289 ? 0.785   36.588  164.385 1.00 45.30  ? 387  LYS B NZ  1 
ATOM   7407  N  N   . GLY B 1  290 ? -4.517  32.434  164.942 1.00 29.96  ? 388  GLY B N   1 
ATOM   7408  C  CA  . GLY B 1  290 ? -5.169  31.183  165.282 1.00 25.80  ? 388  GLY B CA  1 
ATOM   7409  C  C   . GLY B 1  290 ? -4.871  30.709  166.690 1.00 26.20  ? 388  GLY B C   1 
ATOM   7410  O  O   . GLY B 1  290 ? -4.082  31.326  167.404 1.00 27.14  ? 388  GLY B O   1 
ATOM   7411  N  N   . PRO B 1  291 ? -5.494  29.591  167.092 1.00 26.20  ? 389  PRO B N   1 
ATOM   7412  C  CA  . PRO B 1  291 ? -5.423  29.060  168.458 1.00 22.43  ? 389  PRO B CA  1 
ATOM   7413  C  C   . PRO B 1  291 ? -4.129  28.313  168.786 1.00 25.05  ? 389  PRO B C   1 
ATOM   7414  O  O   . PRO B 1  291 ? -3.869  28.058  169.961 1.00 30.56  ? 389  PRO B O   1 
ATOM   7415  C  CB  . PRO B 1  291 ? -6.616  28.090  168.524 1.00 17.91  ? 389  PRO B CB  1 
ATOM   7416  C  CG  . PRO B 1  291 ? -7.363  28.254  167.225 1.00 17.87  ? 389  PRO B CG  1 
ATOM   7417  C  CD  . PRO B 1  291 ? -6.392  28.797  166.242 1.00 14.36  ? 389  PRO B CD  1 
ATOM   7418  N  N   . GLY B 1  292 ? -3.334  27.968  167.779 1.00 21.86  ? 390  GLY B N   1 
ATOM   7419  C  CA  . GLY B 1  292 ? -2.177  27.118  168.002 1.00 27.80  ? 390  GLY B CA  1 
ATOM   7420  C  C   . GLY B 1  292 ? -0.891  27.853  168.338 1.00 29.79  ? 390  GLY B C   1 
ATOM   7421  O  O   . GLY B 1  292 ? -0.870  29.079  168.442 1.00 30.69  ? 390  GLY B O   1 
ATOM   7422  N  N   . GLN B 1  293 ? 0.190   27.095  168.507 1.00 29.80  ? 391  GLN B N   1 
ATOM   7423  C  CA  . GLN B 1  293 ? 1.498   27.678  168.784 1.00 32.50  ? 391  GLN B CA  1 
ATOM   7424  C  C   . GLN B 1  293 ? 2.074   28.278  167.512 1.00 30.69  ? 391  GLN B C   1 
ATOM   7425  O  O   . GLN B 1  293 ? 2.891   29.197  167.555 1.00 33.79  ? 391  GLN B O   1 
ATOM   7426  C  CB  . GLN B 1  293 ? 2.455   26.640  169.366 1.00 37.95  ? 391  GLN B CB  1 
ATOM   7427  C  CG  . GLN B 1  293 ? 2.039   26.122  170.731 1.00 47.54  ? 391  GLN B CG  1 
ATOM   7428  C  CD  . GLN B 1  293 ? 2.018   27.218  171.783 1.00 58.28  ? 391  GLN B CD  1 
ATOM   7429  O  OE1 . GLN B 1  293 ? 3.032   27.868  172.040 1.00 63.43  ? 391  GLN B OE1 1 
ATOM   7430  N  NE2 . GLN B 1  293 ? 0.858   27.428  172.396 1.00 60.50  ? 391  GLN B NE2 1 
ATOM   7431  N  N   . ASP B 1  294 ? 1.653   27.734  166.376 1.00 28.26  ? 392  ASP B N   1 
ATOM   7432  C  CA  . ASP B 1  294 ? 1.987   28.317  165.087 1.00 25.53  ? 392  ASP B CA  1 
ATOM   7433  C  C   . ASP B 1  294 ? 0.824   28.121  164.124 1.00 22.10  ? 392  ASP B C   1 
ATOM   7434  O  O   . ASP B 1  294 ? -0.236  27.630  164.507 1.00 20.99  ? 392  ASP B O   1 
ATOM   7435  C  CB  . ASP B 1  294 ? 3.276   27.710  164.516 1.00 27.38  ? 392  ASP B CB  1 
ATOM   7436  C  CG  . ASP B 1  294 ? 3.246   26.190  164.459 1.00 33.18  ? 392  ASP B CG  1 
ATOM   7437  O  OD1 . ASP B 1  294 ? 2.146   25.601  164.425 1.00 33.00  ? 392  ASP B OD1 1 
ATOM   7438  O  OD2 . ASP B 1  294 ? 4.335   25.580  164.444 1.00 37.35  ? 392  ASP B OD2 1 
ATOM   7439  N  N   . MET B 1  295 ? 1.040   28.490  162.870 1.00 23.44  ? 393  MET B N   1 
ATOM   7440  C  CA  . MET B 1  295 ? 0.006   28.413  161.850 1.00 26.98  ? 393  MET B CA  1 
ATOM   7441  C  C   . MET B 1  295 ? -0.344  26.974  161.474 1.00 25.00  ? 393  MET B C   1 
ATOM   7442  O  O   . MET B 1  295 ? -1.495  26.677  161.156 1.00 22.96  ? 393  MET B O   1 
ATOM   7443  C  CB  . MET B 1  295 ? 0.458   29.206  160.625 1.00 31.82  ? 393  MET B CB  1 
ATOM   7444  C  CG  . MET B 1  295 ? 1.763   28.704  160.045 1.00 34.25  ? 393  MET B CG  1 
ATOM   7445  S  SD  . MET B 1  295 ? 2.403   29.786  158.765 1.00 40.89  ? 393  MET B SD  1 
ATOM   7446  C  CE  . MET B 1  295 ? 1.174   29.536  157.516 1.00 14.18  ? 393  MET B CE  1 
ATOM   7447  N  N   . PHE B 1  296 ? 0.644   26.085  161.519 1.00 20.88  ? 394  PHE B N   1 
ATOM   7448  C  CA  . PHE B 1  296 ? 0.405   24.668  161.277 1.00 16.78  ? 394  PHE B CA  1 
ATOM   7449  C  C   . PHE B 1  296 ? -0.519  24.099  162.348 1.00 17.71  ? 394  PHE B C   1 
ATOM   7450  O  O   . PHE B 1  296 ? -1.457  23.357  162.053 1.00 17.65  ? 394  PHE B O   1 
ATOM   7451  C  CB  . PHE B 1  296 ? 1.720   23.888  161.253 1.00 17.95  ? 394  PHE B CB  1 
ATOM   7452  C  CG  . PHE B 1  296 ? 2.671   24.333  160.181 1.00 24.16  ? 394  PHE B CG  1 
ATOM   7453  C  CD1 . PHE B 1  296 ? 2.602   23.785  158.911 1.00 21.17  ? 394  PHE B CD1 1 
ATOM   7454  C  CD2 . PHE B 1  296 ? 3.636   25.294  160.442 1.00 27.39  ? 394  PHE B CD2 1 
ATOM   7455  C  CE1 . PHE B 1  296 ? 3.473   24.187  157.921 1.00 21.98  ? 394  PHE B CE1 1 
ATOM   7456  C  CE2 . PHE B 1  296 ? 4.512   25.702  159.455 1.00 25.11  ? 394  PHE B CE2 1 
ATOM   7457  C  CZ  . PHE B 1  296 ? 4.430   25.148  158.192 1.00 22.90  ? 394  PHE B CZ  1 
ATOM   7458  N  N   . ASP B 1  297 ? -0.241  24.469  163.593 1.00 16.80  ? 395  ASP B N   1 
ATOM   7459  C  CA  . ASP B 1  297 ? -0.994  23.993  164.745 1.00 17.69  ? 395  ASP B CA  1 
ATOM   7460  C  C   . ASP B 1  297 ? -2.407  24.562  164.739 1.00 23.32  ? 395  ASP B C   1 
ATOM   7461  O  O   . ASP B 1  297 ? -3.373  23.855  165.028 1.00 25.61  ? 395  ASP B O   1 
ATOM   7462  C  CB  . ASP B 1  297 ? -0.270  24.367  166.040 1.00 22.43  ? 395  ASP B CB  1 
ATOM   7463  C  CG  . ASP B 1  297 ? -0.848  23.672  167.250 1.00 27.76  ? 395  ASP B CG  1 
ATOM   7464  O  OD1 . ASP B 1  297 ? -1.429  22.580  167.082 1.00 30.23  ? 395  ASP B OD1 1 
ATOM   7465  O  OD2 . ASP B 1  297 ? -0.713  24.207  168.372 1.00 29.65  ? 395  ASP B OD2 1 
ATOM   7466  N  N   . SER B 1  298 ? -2.514  25.847  164.415 1.00 22.57  ? 396  SER B N   1 
ATOM   7467  C  CA  . SER B 1  298 ? -3.808  26.506  164.281 1.00 20.49  ? 396  SER B CA  1 
ATOM   7468  C  C   . SER B 1  298 ? -4.668  25.802  163.234 1.00 21.02  ? 396  SER B C   1 
ATOM   7469  O  O   . SER B 1  298 ? -5.851  25.546  163.459 1.00 22.96  ? 396  SER B O   1 
ATOM   7470  C  CB  . SER B 1  298 ? -3.623  27.979  163.911 1.00 17.80  ? 396  SER B CB  1 
ATOM   7471  O  OG  . SER B 1  298 ? -3.039  28.698  164.982 1.00 20.54  ? 396  SER B OG  1 
ATOM   7472  N  N   . THR B 1  299 ? -4.058  25.498  162.091 1.00 19.59  ? 397  THR B N   1 
ATOM   7473  C  CA  . THR B 1  299 ? -4.735  24.809  160.998 1.00 18.67  ? 397  THR B CA  1 
ATOM   7474  C  C   . THR B 1  299 ? -5.296  23.459  161.430 1.00 21.05  ? 397  THR B C   1 
ATOM   7475  O  O   . THR B 1  299 ? -6.420  23.101  161.081 1.00 20.74  ? 397  THR B O   1 
ATOM   7476  C  CB  . THR B 1  299 ? -3.784  24.593  159.804 1.00 16.69  ? 397  THR B CB  1 
ATOM   7477  O  OG1 . THR B 1  299 ? -3.313  25.859  159.331 1.00 16.86  ? 397  THR B OG1 1 
ATOM   7478  C  CG2 . THR B 1  299 ? -4.496  23.873  158.670 1.00 17.45  ? 397  THR B CG2 1 
ATOM   7479  N  N   . GLN B 1  300 ? -4.514  22.717  162.203 1.00 23.53  ? 398  GLN B N   1 
ATOM   7480  C  CA  . GLN B 1  300 ? -4.921  21.381  162.616 1.00 19.42  ? 398  GLN B CA  1 
ATOM   7481  C  C   . GLN B 1  300 ? -5.971  21.424  163.721 1.00 15.32  ? 398  GLN B C   1 
ATOM   7482  O  O   . GLN B 1  300 ? -6.862  20.579  163.761 1.00 16.90  ? 398  GLN B O   1 
ATOM   7483  C  CB  . GLN B 1  300 ? -3.705  20.570  163.066 1.00 21.06  ? 398  GLN B CB  1 
ATOM   7484  C  CG  . GLN B 1  300 ? -2.751  20.241  161.930 1.00 23.09  ? 398  GLN B CG  1 
ATOM   7485  C  CD  . GLN B 1  300 ? -1.603  19.352  162.363 1.00 33.97  ? 398  GLN B CD  1 
ATOM   7486  O  OE1 . GLN B 1  300 ? -0.969  18.693  161.539 1.00 38.23  ? 398  GLN B OE1 1 
ATOM   7487  N  NE2 . GLN B 1  300 ? -1.327  19.331  163.662 1.00 37.41  ? 398  GLN B NE2 1 
ATOM   7488  N  N   . ILE B 1  301 ? -5.871  22.409  164.609 1.00 16.33  ? 399  ILE B N   1 
ATOM   7489  C  CA  . ILE B 1  301 ? -6.849  22.569  165.681 1.00 16.20  ? 399  ILE B CA  1 
ATOM   7490  C  C   . ILE B 1  301 ? -8.227  22.881  165.109 1.00 18.75  ? 399  ILE B C   1 
ATOM   7491  O  O   . ILE B 1  301 ? -9.224  22.268  165.492 1.00 20.18  ? 399  ILE B O   1 
ATOM   7492  C  CB  . ILE B 1  301 ? -6.438  23.680  166.665 1.00 16.61  ? 399  ILE B CB  1 
ATOM   7493  C  CG1 . ILE B 1  301 ? -5.257  23.219  167.522 1.00 15.51  ? 399  ILE B CG1 1 
ATOM   7494  C  CG2 . ILE B 1  301 ? -7.607  24.059  167.559 1.00 14.90  ? 399  ILE B CG2 1 
ATOM   7495  C  CD1 . ILE B 1  301 ? -4.585  24.334  168.293 1.00 15.87  ? 399  ILE B CD1 1 
ATOM   7496  N  N   . ILE B 1  302 ? -8.274  23.828  164.178 1.00 19.19  ? 400  ILE B N   1 
ATOM   7497  C  CA  . ILE B 1  302 ? -9.521  24.188  163.521 1.00 17.16  ? 400  ILE B CA  1 
ATOM   7498  C  C   . ILE B 1  302 ? -10.014 23.026  162.666 1.00 17.67  ? 400  ILE B C   1 
ATOM   7499  O  O   . ILE B 1  302 ? -11.194 22.676  162.695 1.00 23.13  ? 400  ILE B O   1 
ATOM   7500  C  CB  . ILE B 1  302 ? -9.359  25.446  162.642 1.00 19.78  ? 400  ILE B CB  1 
ATOM   7501  C  CG1 . ILE B 1  302 ? -8.983  26.653  163.501 1.00 23.01  ? 400  ILE B CG1 1 
ATOM   7502  C  CG2 . ILE B 1  302 ? -10.643 25.739  161.885 1.00 21.28  ? 400  ILE B CG2 1 
ATOM   7503  C  CD1 . ILE B 1  302 ? -10.009 26.988  164.562 1.00 23.20  ? 400  ILE B CD1 1 
ATOM   7504  N  N   . GLY B 1  303 ? -9.099  22.428  161.912 1.00 15.01  ? 401  GLY B N   1 
ATOM   7505  C  CA  . GLY B 1  303 ? -9.432  21.309  161.052 1.00 17.01  ? 401  GLY B CA  1 
ATOM   7506  C  C   . GLY B 1  303 ? -9.958  20.092  161.790 1.00 19.33  ? 401  GLY B C   1 
ATOM   7507  O  O   . GLY B 1  303 ? -10.895 19.441  161.328 1.00 23.74  ? 401  GLY B O   1 
ATOM   7508  N  N   . ARG B 1  304 ? -9.362  19.782  162.937 1.00 18.15  ? 402  ARG B N   1 
ATOM   7509  C  CA  . ARG B 1  304 ? -9.773  18.617  163.714 1.00 21.22  ? 402  ARG B CA  1 
ATOM   7510  C  C   . ARG B 1  304 ? -11.160 18.815  164.314 1.00 20.94  ? 402  ARG B C   1 
ATOM   7511  O  O   . ARG B 1  304 ? -11.973 17.890  164.347 1.00 18.78  ? 402  ARG B O   1 
ATOM   7512  C  CB  . ARG B 1  304 ? -8.761  18.317  164.820 1.00 21.35  ? 402  ARG B CB  1 
ATOM   7513  C  CG  . ARG B 1  304 ? -9.231  17.270  165.816 1.00 24.55  ? 402  ARG B CG  1 
ATOM   7514  C  CD  . ARG B 1  304 ? -8.082  16.751  166.655 1.00 27.36  ? 402  ARG B CD  1 
ATOM   7515  N  NE  . ARG B 1  304 ? -7.221  15.860  165.883 1.00 34.04  ? 402  ARG B NE  1 
ATOM   7516  C  CZ  . ARG B 1  304 ? -7.490  14.581  165.644 1.00 36.60  ? 402  ARG B CZ  1 
ATOM   7517  N  NH1 . ARG B 1  304 ? -8.600  14.034  166.121 1.00 36.07  ? 402  ARG B NH1 1 
ATOM   7518  N  NH2 . ARG B 1  304 ? -6.649  13.847  164.927 1.00 36.63  ? 402  ARG B NH2 1 
ATOM   7519  N  N   . ALA B 1  305 ? -11.419 20.028  164.792 1.00 20.69  ? 403  ALA B N   1 
ATOM   7520  C  CA  . ALA B 1  305 ? -12.708 20.362  165.380 1.00 21.87  ? 403  ALA B CA  1 
ATOM   7521  C  C   . ALA B 1  305 ? -13.837 20.170  164.370 1.00 26.22  ? 403  ALA B C   1 
ATOM   7522  O  O   . ALA B 1  305 ? -14.870 19.583  164.689 1.00 34.06  ? 403  ALA B O   1 
ATOM   7523  C  CB  . ALA B 1  305 ? -12.695 21.786  165.904 1.00 13.94  ? 403  ALA B CB  1 
ATOM   7524  N  N   . MET B 1  306 ? -13.631 20.656  163.150 1.00 23.54  ? 404  MET B N   1 
ATOM   7525  C  CA  . MET B 1  306 ? -14.616 20.483  162.088 1.00 22.71  ? 404  MET B CA  1 
ATOM   7526  C  C   . MET B 1  306 ? -14.775 19.011  161.733 1.00 26.56  ? 404  MET B C   1 
ATOM   7527  O  O   . MET B 1  306 ? -15.886 18.536  161.502 1.00 32.91  ? 404  MET B O   1 
ATOM   7528  C  CB  . MET B 1  306 ? -14.228 21.287  160.847 1.00 21.01  ? 404  MET B CB  1 
ATOM   7529  C  CG  . MET B 1  306 ? -14.295 22.794  161.039 1.00 20.78  ? 404  MET B CG  1 
ATOM   7530  S  SD  . MET B 1  306 ? -13.970 23.698  159.514 1.00 23.73  ? 404  MET B SD  1 
ATOM   7531  C  CE  . MET B 1  306 ? -12.266 23.236  159.209 1.00 11.96  ? 404  MET B CE  1 
ATOM   7532  N  N   . TYR B 1  307 ? -13.655 18.296  161.690 1.00 24.38  ? 405  TYR B N   1 
ATOM   7533  C  CA  . TYR B 1  307 ? -13.663 16.861  161.430 1.00 24.20  ? 405  TYR B CA  1 
ATOM   7534  C  C   . TYR B 1  307 ? -14.482 16.113  162.475 1.00 27.20  ? 405  TYR B C   1 
ATOM   7535  O  O   . TYR B 1  307 ? -15.233 15.194  162.147 1.00 28.52  ? 405  TYR B O   1 
ATOM   7536  C  CB  . TYR B 1  307 ? -12.232 16.315  161.398 1.00 21.97  ? 405  TYR B CB  1 
ATOM   7537  C  CG  . TYR B 1  307 ? -12.103 14.899  161.916 1.00 19.53  ? 405  TYR B CG  1 
ATOM   7538  C  CD1 . TYR B 1  307 ? -12.443 13.813  161.119 1.00 19.40  ? 405  TYR B CD1 1 
ATOM   7539  C  CD2 . TYR B 1  307 ? -11.636 14.647  163.201 1.00 17.00  ? 405  TYR B CD2 1 
ATOM   7540  C  CE1 . TYR B 1  307 ? -12.326 12.518  161.585 1.00 16.05  ? 405  TYR B CE1 1 
ATOM   7541  C  CE2 . TYR B 1  307 ? -11.517 13.355  163.677 1.00 15.67  ? 405  TYR B CE2 1 
ATOM   7542  C  CZ  . TYR B 1  307 ? -11.863 12.295  162.865 1.00 21.42  ? 405  TYR B CZ  1 
ATOM   7543  O  OH  . TYR B 1  307 ? -11.744 11.007  163.334 1.00 28.02  ? 405  TYR B OH  1 
ATOM   7544  N  N   . GLN B 1  308 ? -14.328 16.519  163.732 1.00 25.79  ? 406  GLN B N   1 
ATOM   7545  C  CA  . GLN B 1  308 ? -14.991 15.855  164.849 1.00 19.25  ? 406  GLN B CA  1 
ATOM   7546  C  C   . GLN B 1  308 ? -16.508 15.947  164.736 1.00 19.38  ? 406  GLN B C   1 
ATOM   7547  O  O   . GLN B 1  308 ? -17.210 14.954  164.923 1.00 21.90  ? 406  GLN B O   1 
ATOM   7548  C  CB  . GLN B 1  308 ? -14.526 16.456  166.176 1.00 18.40  ? 406  GLN B CB  1 
ATOM   7549  C  CG  . GLN B 1  308 ? -15.070 15.748  167.407 1.00 21.28  ? 406  GLN B CG  1 
ATOM   7550  C  CD  . GLN B 1  308 ? -14.725 14.272  167.435 1.00 25.19  ? 406  GLN B CD  1 
ATOM   7551  O  OE1 . GLN B 1  308 ? -13.615 13.875  167.085 1.00 29.12  ? 406  GLN B OE1 1 
ATOM   7552  N  NE2 . GLN B 1  308 ? -15.681 13.449  167.852 1.00 24.71  ? 406  GLN B NE2 1 
ATOM   7553  N  N   . ARG B 1  309 ? -17.013 17.136  164.425 1.00 22.24  ? 407  ARG B N   1 
ATOM   7554  C  CA  . ARG B 1  309 ? -18.450 17.325  164.260 1.00 25.31  ? 407  ARG B CA  1 
ATOM   7555  C  C   . ARG B 1  309 ? -18.964 16.651  162.992 1.00 26.70  ? 407  ARG B C   1 
ATOM   7556  O  O   . ARG B 1  309 ? -20.065 16.102  162.977 1.00 28.83  ? 407  ARG B O   1 
ATOM   7557  C  CB  . ARG B 1  309 ? -18.802 18.811  164.245 1.00 26.78  ? 407  ARG B CB  1 
ATOM   7558  C  CG  . ARG B 1  309 ? -18.712 19.467  165.610 1.00 33.04  ? 407  ARG B CG  1 
ATOM   7559  C  CD  . ARG B 1  309 ? -19.715 18.851  166.574 1.00 31.94  ? 407  ARG B CD  1 
ATOM   7560  N  NE  . ARG B 1  309 ? -21.090 19.193  166.226 1.00 29.63  ? 407  ARG B NE  1 
ATOM   7561  C  CZ  . ARG B 1  309 ? -22.115 18.353  166.318 1.00 32.33  ? 407  ARG B CZ  1 
ATOM   7562  N  NH1 . ARG B 1  309 ? -21.920 17.114  166.748 1.00 34.87  ? 407  ARG B NH1 1 
ATOM   7563  N  NH2 . ARG B 1  309 ? -23.335 18.749  165.980 1.00 29.88  ? 407  ARG B NH2 1 
ATOM   7564  N  N   . ALA B 1  310 ? -18.164 16.696  161.931 1.00 24.21  ? 408  ALA B N   1 
ATOM   7565  C  CA  . ALA B 1  310 ? -18.531 16.043  160.681 1.00 22.61  ? 408  ALA B CA  1 
ATOM   7566  C  C   . ALA B 1  310 ? -18.662 14.543  160.891 1.00 24.77  ? 408  ALA B C   1 
ATOM   7567  O  O   . ALA B 1  310 ? -19.559 13.905  160.342 1.00 27.76  ? 408  ALA B O   1 
ATOM   7568  C  CB  . ALA B 1  310 ? -17.504 16.340  159.599 1.00 20.78  ? 408  ALA B CB  1 
ATOM   7569  N  N   . LYS B 1  311 ? -17.763 13.989  161.697 1.00 21.20  ? 409  LYS B N   1 
ATOM   7570  C  CA  . LYS B 1  311 ? -17.776 12.565  162.005 1.00 19.35  ? 409  LYS B CA  1 
ATOM   7571  C  C   . LYS B 1  311 ? -18.991 12.186  162.849 1.00 21.01  ? 409  LYS B C   1 
ATOM   7572  O  O   . LYS B 1  311 ? -19.654 11.182  162.588 1.00 19.98  ? 409  LYS B O   1 
ATOM   7573  C  CB  . LYS B 1  311 ? -16.487 12.168  162.724 1.00 19.34  ? 409  LYS B CB  1 
ATOM   7574  C  CG  . LYS B 1  311 ? -16.340 10.677  162.955 1.00 23.29  ? 409  LYS B CG  1 
ATOM   7575  C  CD  . LYS B 1  311 ? -15.223 10.392  163.943 1.00 28.20  ? 409  LYS B CD  1 
ATOM   7576  C  CE  . LYS B 1  311 ? -15.604 9.273   164.897 1.00 33.00  ? 409  LYS B CE  1 
ATOM   7577  N  NZ  . LYS B 1  311 ? -14.570 9.073   165.950 1.00 35.53  ? 409  LYS B NZ  1 
ATOM   7578  N  N   . GLU B 1  312 ? -19.270 12.996  163.865 1.00 23.03  ? 410  GLU B N   1 
ATOM   7579  C  CA  . GLU B 1  312 ? -20.402 12.766  164.757 1.00 22.41  ? 410  GLU B CA  1 
ATOM   7580  C  C   . GLU B 1  312 ? -21.734 12.829  164.009 1.00 24.84  ? 410  GLU B C   1 
ATOM   7581  O  O   . GLU B 1  312 ? -22.600 11.974  164.193 1.00 16.81  ? 410  GLU B O   1 
ATOM   7582  C  CB  . GLU B 1  312 ? -20.387 13.782  165.901 1.00 19.08  ? 410  GLU B CB  1 
ATOM   7583  C  CG  . GLU B 1  312 ? -19.247 13.579  166.886 1.00 22.86  ? 410  GLU B CG  1 
ATOM   7584  C  CD  . GLU B 1  312 ? -19.039 14.775  167.797 1.00 30.16  ? 410  GLU B CD  1 
ATOM   7585  O  OE1 . GLU B 1  312 ? -19.817 15.747  167.693 1.00 33.86  ? 410  GLU B OE1 1 
ATOM   7586  O  OE2 . GLU B 1  312 ? -18.095 14.746  168.616 1.00 28.72  ? 410  GLU B OE2 1 
ATOM   7587  N  N   . LEU B 1  313 ? -21.892 13.848  163.170 1.00 24.88  ? 411  LEU B N   1 
ATOM   7588  C  CA  . LEU B 1  313 ? -23.110 14.014  162.383 1.00 24.30  ? 411  LEU B CA  1 
ATOM   7589  C  C   . LEU B 1  313 ? -23.274 12.898  161.355 1.00 23.89  ? 411  LEU B C   1 
ATOM   7590  O  O   . LEU B 1  313 ? -24.389 12.457  161.078 1.00 27.21  ? 411  LEU B O   1 
ATOM   7591  C  CB  . LEU B 1  313 ? -23.120 15.375  161.686 1.00 19.64  ? 411  LEU B CB  1 
ATOM   7592  C  CG  . LEU B 1  313 ? -23.251 16.591  162.604 1.00 16.08  ? 411  LEU B CG  1 
ATOM   7593  C  CD1 . LEU B 1  313 ? -22.953 17.877  161.847 1.00 15.17  ? 411  LEU B CD1 1 
ATOM   7594  C  CD2 . LEU B 1  313 ? -24.636 16.638  163.231 1.00 15.17  ? 411  LEU B CD2 1 
ATOM   7595  N  N   . TYR B 1  314 ? -22.158 12.453  160.786 1.00 23.59  ? 412  TYR B N   1 
ATOM   7596  C  CA  . TYR B 1  314 ? -22.169 11.360  159.818 1.00 24.13  ? 412  TYR B CA  1 
ATOM   7597  C  C   . TYR B 1  314 ? -22.671 10.069  160.451 1.00 27.77  ? 412  TYR B C   1 
ATOM   7598  O  O   . TYR B 1  314 ? -23.532 9.388   159.894 1.00 30.91  ? 412  TYR B O   1 
ATOM   7599  C  CB  . TYR B 1  314 ? -20.768 11.142  159.238 1.00 20.69  ? 412  TYR B CB  1 
ATOM   7600  C  CG  . TYR B 1  314 ? -20.693 10.070  158.169 1.00 23.20  ? 412  TYR B CG  1 
ATOM   7601  C  CD1 . TYR B 1  314 ? -20.839 10.391  156.826 1.00 20.44  ? 412  TYR B CD1 1 
ATOM   7602  C  CD2 . TYR B 1  314 ? -20.468 8.738   158.504 1.00 16.79  ? 412  TYR B CD2 1 
ATOM   7603  C  CE1 . TYR B 1  314 ? -20.765 9.419   155.846 1.00 17.36  ? 412  TYR B CE1 1 
ATOM   7604  C  CE2 . TYR B 1  314 ? -20.397 7.759   157.531 1.00 17.15  ? 412  TYR B CE2 1 
ATOM   7605  C  CZ  . TYR B 1  314 ? -20.547 8.105   156.203 1.00 22.06  ? 412  TYR B CZ  1 
ATOM   7606  O  OH  . TYR B 1  314 ? -20.477 7.138   155.228 1.00 21.80  ? 412  TYR B OH  1 
ATOM   7607  N  N   . ALA B 1  315 ? -22.118 9.743   161.614 1.00 25.14  ? 413  ALA B N   1 
ATOM   7608  C  CA  . ALA B 1  315 ? -22.463 8.519   162.330 1.00 23.98  ? 413  ALA B CA  1 
ATOM   7609  C  C   . ALA B 1  315 ? -23.941 8.459   162.700 1.00 24.96  ? 413  ALA B C   1 
ATOM   7610  O  O   . ALA B 1  315 ? -24.564 7.404   162.606 1.00 24.94  ? 413  ALA B O   1 
ATOM   7611  C  CB  . ALA B 1  315 ? -21.607 8.383   163.579 1.00 18.20  ? 413  ALA B CB  1 
ATOM   7612  N  N   . SER B 1  316 ? -24.493 9.590   163.129 1.00 25.41  ? 414  SER B N   1 
ATOM   7613  C  CA  . SER B 1  316 ? -25.857 9.619   163.645 1.00 23.05  ? 414  SER B CA  1 
ATOM   7614  C  C   . SER B 1  316 ? -26.887 10.061  162.609 1.00 23.69  ? 414  SER B C   1 
ATOM   7615  O  O   . SER B 1  316 ? -28.049 10.283  162.947 1.00 33.12  ? 414  SER B O   1 
ATOM   7616  C  CB  . SER B 1  316 ? -25.941 10.536  164.864 1.00 18.30  ? 414  SER B CB  1 
ATOM   7617  O  OG  . SER B 1  316 ? -25.715 11.884  164.499 1.00 17.63  ? 414  SER B OG  1 
ATOM   7618  N  N   . ALA B 1  317 ? -26.467 10.202  161.356 1.00 24.17  ? 415  ALA B N   1 
ATOM   7619  C  CA  . ALA B 1  317 ? -27.395 10.574  160.289 1.00 24.13  ? 415  ALA B CA  1 
ATOM   7620  C  C   . ALA B 1  317 ? -28.438 9.478   160.094 1.00 28.09  ? 415  ALA B C   1 
ATOM   7621  O  O   . ALA B 1  317 ? -28.096 8.303   159.971 1.00 32.15  ? 415  ALA B O   1 
ATOM   7622  C  CB  . ALA B 1  317 ? -26.645 10.835  158.993 1.00 18.45  ? 415  ALA B CB  1 
ATOM   7623  N  N   . SER B 1  318 ? -29.710 9.864   160.060 1.00 29.78  ? 416  SER B N   1 
ATOM   7624  C  CA  . SER B 1  318 ? -30.790 8.891   159.949 1.00 30.73  ? 416  SER B CA  1 
ATOM   7625  C  C   . SER B 1  318 ? -31.846 9.293   158.923 1.00 35.39  ? 416  SER B C   1 
ATOM   7626  O  O   . SER B 1  318 ? -32.422 8.437   158.251 1.00 38.29  ? 416  SER B O   1 
ATOM   7627  C  CB  . SER B 1  318 ? -31.448 8.683   161.314 1.00 31.17  ? 416  SER B CB  1 
ATOM   7628  O  OG  . SER B 1  318 ? -32.100 9.863   161.749 1.00 33.25  ? 416  SER B OG  1 
ATOM   7629  N  N   . GLN B 1  319 ? -32.111 10.591  158.823 1.00 36.22  ? 417  GLN B N   1 
ATOM   7630  C  CA  . GLN B 1  319 ? -33.084 11.098  157.859 1.00 34.03  ? 417  GLN B CA  1 
ATOM   7631  C  C   . GLN B 1  319 ? -32.618 10.870  156.427 1.00 28.31  ? 417  GLN B C   1 
ATOM   7632  O  O   . GLN B 1  319 ? -31.627 11.453  155.988 1.00 28.08  ? 417  GLN B O   1 
ATOM   7633  C  CB  . GLN B 1  319 ? -33.357 12.586  158.087 1.00 35.97  ? 417  GLN B CB  1 
ATOM   7634  C  CG  . GLN B 1  319 ? -34.379 13.162  157.122 1.00 44.26  ? 417  GLN B CG  1 
ATOM   7635  C  CD  . GLN B 1  319 ? -34.686 14.618  157.396 1.00 52.57  ? 417  GLN B CD  1 
ATOM   7636  O  OE1 . GLN B 1  319 ? -34.681 15.059  158.546 1.00 53.99  ? 417  GLN B OE1 1 
ATOM   7637  N  NE2 . GLN B 1  319 ? -34.951 15.375  156.338 1.00 55.05  ? 417  GLN B NE2 1 
ATOM   7638  N  N   . GLU B 1  320 ? -33.340 10.020  155.704 1.00 24.65  ? 418  GLU B N   1 
ATOM   7639  C  CA  . GLU B 1  320 ? -32.997 9.703   154.323 1.00 22.64  ? 418  GLU B CA  1 
ATOM   7640  C  C   . GLU B 1  320 ? -33.431 10.818  153.378 1.00 24.81  ? 418  GLU B C   1 
ATOM   7641  O  O   . GLU B 1  320 ? -34.451 11.474  153.597 1.00 24.74  ? 418  GLU B O   1 
ATOM   7642  C  CB  . GLU B 1  320 ? -33.642 8.379   153.899 1.00 25.43  ? 418  GLU B CB  1 
ATOM   7643  C  CG  . GLU B 1  320 ? -33.358 7.976   152.456 1.00 30.74  ? 418  GLU B CG  1 
ATOM   7644  C  CD  . GLU B 1  320 ? -33.862 6.590   152.116 1.00 35.37  ? 418  GLU B CD  1 
ATOM   7645  O  OE1 . GLU B 1  320 ? -34.661 6.034   152.898 1.00 34.81  ? 418  GLU B OE1 1 
ATOM   7646  O  OE2 . GLU B 1  320 ? -33.463 6.057   151.060 1.00 41.26  ? 418  GLU B OE2 1 
ATOM   7647  N  N   . VAL B 1  321 ? -32.643 11.029  152.329 1.00 24.98  ? 419  VAL B N   1 
ATOM   7648  C  CA  . VAL B 1  321 ? -32.982 11.989  151.292 1.00 26.24  ? 419  VAL B CA  1 
ATOM   7649  C  C   . VAL B 1  321 ? -33.534 11.257  150.077 1.00 32.45  ? 419  VAL B C   1 
ATOM   7650  O  O   . VAL B 1  321 ? -32.869 10.391  149.507 1.00 37.35  ? 419  VAL B O   1 
ATOM   7651  C  CB  . VAL B 1  321 ? -31.759 12.828  150.877 1.00 28.57  ? 419  VAL B CB  1 
ATOM   7652  C  CG1 . VAL B 1  321 ? -32.090 13.683  149.667 1.00 21.06  ? 419  VAL B CG1 1 
ATOM   7653  C  CG2 . VAL B 1  321 ? -31.289 13.693  152.041 1.00 23.24  ? 419  VAL B CG2 1 
ATOM   7654  N  N   . THR B 1  322 ? -34.757 11.604  149.689 1.00 33.81  ? 420  THR B N   1 
ATOM   7655  C  CA  . THR B 1  322 ? -35.422 10.958  148.564 1.00 30.88  ? 420  THR B CA  1 
ATOM   7656  C  C   . THR B 1  322 ? -36.125 11.991  147.692 1.00 30.18  ? 420  THR B C   1 
ATOM   7657  O  O   . THR B 1  322 ? -36.380 13.113  148.125 1.00 31.69  ? 420  THR B O   1 
ATOM   7658  C  CB  . THR B 1  322 ? -36.456 9.912   149.028 1.00 28.29  ? 420  THR B CB  1 
ATOM   7659  O  OG1 . THR B 1  322 ? -37.422 10.537  149.884 1.00 28.45  ? 420  THR B OG1 1 
ATOM   7660  C  CG2 . THR B 1  322 ? -35.780 8.774   149.781 1.00 25.83  ? 420  THR B CG2 1 
ATOM   7661  N  N   . GLY B 1  323 ? -36.448 11.600  146.465 1.00 28.20  ? 421  GLY B N   1 
ATOM   7662  C  CA  . GLY B 1  323 ? -37.097 12.492  145.525 1.00 28.92  ? 421  GLY B CA  1 
ATOM   7663  C  C   . GLY B 1  323 ? -36.324 12.605  144.227 1.00 30.46  ? 421  GLY B C   1 
ATOM   7664  O  O   . GLY B 1  323 ? -35.222 12.070  144.105 1.00 28.33  ? 421  GLY B O   1 
ATOM   7665  N  N   . PRO B 1  324 ? -36.890 13.326  143.250 1.00 30.83  ? 422  PRO B N   1 
ATOM   7666  C  CA  . PRO B 1  324 ? -36.275 13.431  141.922 1.00 31.71  ? 422  PRO B CA  1 
ATOM   7667  C  C   . PRO B 1  324 ? -35.025 14.303  141.912 1.00 31.76  ? 422  PRO B C   1 
ATOM   7668  O  O   . PRO B 1  324 ? -34.846 15.153  142.787 1.00 24.22  ? 422  PRO B O   1 
ATOM   7669  C  CB  . PRO B 1  324 ? -37.374 14.065  141.066 1.00 32.69  ? 422  PRO B CB  1 
ATOM   7670  C  CG  . PRO B 1  324 ? -38.269 14.761  142.024 1.00 30.87  ? 422  PRO B CG  1 
ATOM   7671  C  CD  . PRO B 1  324 ? -38.143 14.093  143.359 1.00 28.43  ? 422  PRO B CD  1 
ATOM   7672  N  N   . LEU B 1  325 ? -34.162 14.080  140.927 1.00 31.07  ? 423  LEU B N   1 
ATOM   7673  C  CA  . LEU B 1  325 ? -33.012 14.945  140.707 1.00 27.13  ? 423  LEU B CA  1 
ATOM   7674  C  C   . LEU B 1  325 ? -33.374 15.982  139.661 1.00 28.82  ? 423  LEU B C   1 
ATOM   7675  O  O   . LEU B 1  325 ? -34.059 15.676  138.684 1.00 38.40  ? 423  LEU B O   1 
ATOM   7676  C  CB  . LEU B 1  325 ? -31.794 14.137  140.260 1.00 26.84  ? 423  LEU B CB  1 
ATOM   7677  C  CG  . LEU B 1  325 ? -31.371 13.008  141.198 1.00 31.23  ? 423  LEU B CG  1 
ATOM   7678  C  CD1 . LEU B 1  325 ? -30.116 12.326  140.681 1.00 33.46  ? 423  LEU B CD1 1 
ATOM   7679  C  CD2 . LEU B 1  325 ? -31.153 13.540  142.603 1.00 31.31  ? 423  LEU B CD2 1 
ATOM   7680  N  N   . ALA B 1  326 ? -32.918 17.210  139.864 1.00 23.82  ? 424  ALA B N   1 
ATOM   7681  C  CA  . ALA B 1  326 ? -33.212 18.283  138.927 1.00 24.05  ? 424  ALA B CA  1 
ATOM   7682  C  C   . ALA B 1  326 ? -32.094 19.311  138.910 1.00 23.22  ? 424  ALA B C   1 
ATOM   7683  O  O   . ALA B 1  326 ? -31.267 19.362  139.819 1.00 22.40  ? 424  ALA B O   1 
ATOM   7684  C  CB  . ALA B 1  326 ? -34.537 18.943  139.275 1.00 24.28  ? 424  ALA B CB  1 
ATOM   7685  N  N   . SER B 1  327 ? -32.080 20.135  137.871 1.00 25.74  ? 425  SER B N   1 
ATOM   7686  C  CA  . SER B 1  327 ? -31.033 21.128  137.709 1.00 27.51  ? 425  SER B CA  1 
ATOM   7687  C  C   . SER B 1  327 ? -31.498 22.279  136.829 1.00 27.34  ? 425  SER B C   1 
ATOM   7688  O  O   . SER B 1  327 ? -32.232 22.081  135.861 1.00 32.61  ? 425  SER B O   1 
ATOM   7689  C  CB  . SER B 1  327 ? -29.777 20.487  137.114 1.00 32.80  ? 425  SER B CB  1 
ATOM   7690  O  OG  . SER B 1  327 ? -30.019 20.012  135.799 1.00 39.18  ? 425  SER B OG  1 
ATOM   7691  N  N   . ALA B 1  328 ? -31.069 23.486  137.182 1.00 22.62  ? 426  ALA B N   1 
ATOM   7692  C  CA  . ALA B 1  328 ? -31.362 24.673  136.392 1.00 25.01  ? 426  ALA B CA  1 
ATOM   7693  C  C   . ALA B 1  328 ? -30.132 25.567  136.347 1.00 25.60  ? 426  ALA B C   1 
ATOM   7694  O  O   . ALA B 1  328 ? -29.481 25.782  137.364 1.00 21.54  ? 426  ALA B O   1 
ATOM   7695  C  CB  . ALA B 1  328 ? -32.553 25.422  136.969 1.00 24.67  ? 426  ALA B CB  1 
ATOM   7696  N  N   . HIS B 1  329 ? -29.820 26.087  135.166 1.00 26.22  ? 427  HIS B N   1 
ATOM   7697  C  CA  . HIS B 1  329 ? -28.638 26.922  134.984 1.00 25.24  ? 427  HIS B CA  1 
ATOM   7698  C  C   . HIS B 1  329 ? -28.952 28.123  134.102 1.00 26.29  ? 427  HIS B C   1 
ATOM   7699  O  O   . HIS B 1  329 ? -29.847 28.069  133.260 1.00 23.76  ? 427  HIS B O   1 
ATOM   7700  C  CB  . HIS B 1  329 ? -27.494 26.098  134.378 1.00 23.96  ? 427  HIS B CB  1 
ATOM   7701  C  CG  . HIS B 1  329 ? -26.287 26.903  134.008 1.00 25.47  ? 427  HIS B CG  1 
ATOM   7702  N  ND1 . HIS B 1  329 ? -26.209 27.638  132.844 1.00 27.54  ? 427  HIS B ND1 1 
ATOM   7703  C  CD2 . HIS B 1  329 ? -25.106 27.084  134.645 1.00 28.04  ? 427  HIS B CD2 1 
ATOM   7704  C  CE1 . HIS B 1  329 ? -25.035 28.240  132.782 1.00 29.48  ? 427  HIS B CE1 1 
ATOM   7705  N  NE2 . HIS B 1  329 ? -24.346 27.920  133.862 1.00 29.88  ? 427  HIS B NE2 1 
ATOM   7706  N  N   . GLN B 1  330 ? -28.209 29.207  134.298 1.00 27.12  ? 428  GLN B N   1 
ATOM   7707  C  CA  . GLN B 1  330 ? -28.371 30.398  133.479 1.00 31.27  ? 428  GLN B CA  1 
ATOM   7708  C  C   . GLN B 1  330 ? -27.109 31.246  133.441 1.00 32.46  ? 428  GLN B C   1 
ATOM   7709  O  O   . GLN B 1  330 ? -26.426 31.414  134.451 1.00 30.45  ? 428  GLN B O   1 
ATOM   7710  C  CB  . GLN B 1  330 ? -29.533 31.248  133.992 1.00 31.98  ? 428  GLN B CB  1 
ATOM   7711  C  CG  . GLN B 1  330 ? -30.752 31.227  133.095 1.00 33.24  ? 428  GLN B CG  1 
ATOM   7712  C  CD  . GLN B 1  330 ? -31.678 32.396  133.346 1.00 35.47  ? 428  GLN B CD  1 
ATOM   7713  O  OE1 . GLN B 1  330 ? -31.519 33.132  134.319 1.00 35.12  ? 428  GLN B OE1 1 
ATOM   7714  N  NE2 . GLN B 1  330 ? -32.650 32.580  132.461 1.00 39.31  ? 428  GLN B NE2 1 
ATOM   7715  N  N   . TRP B 1  331 ? -26.798 31.769  132.261 1.00 34.15  ? 429  TRP B N   1 
ATOM   7716  C  CA  . TRP B 1  331 ? -25.767 32.788  132.139 1.00 31.93  ? 429  TRP B CA  1 
ATOM   7717  C  C   . TRP B 1  331 ? -26.431 34.146  132.314 1.00 30.89  ? 429  TRP B C   1 
ATOM   7718  O  O   . TRP B 1  331 ? -27.487 34.401  131.738 1.00 32.06  ? 429  TRP B O   1 
ATOM   7719  C  CB  . TRP B 1  331 ? -25.056 32.695  130.790 1.00 30.56  ? 429  TRP B CB  1 
ATOM   7720  C  CG  . TRP B 1  331 ? -24.086 31.560  130.690 1.00 32.20  ? 429  TRP B CG  1 
ATOM   7721  C  CD1 . TRP B 1  331 ? -23.101 31.242  131.579 1.00 33.46  ? 429  TRP B CD1 1 
ATOM   7722  C  CD2 . TRP B 1  331 ? -23.990 30.604  129.626 1.00 30.43  ? 429  TRP B CD2 1 
ATOM   7723  N  NE1 . TRP B 1  331 ? -22.406 30.140  131.142 1.00 32.62  ? 429  TRP B NE1 1 
ATOM   7724  C  CE2 . TRP B 1  331 ? -22.932 29.728  129.947 1.00 30.27  ? 429  TRP B CE2 1 
ATOM   7725  C  CE3 . TRP B 1  331 ? -24.699 30.400  128.439 1.00 30.03  ? 429  TRP B CE3 1 
ATOM   7726  C  CZ2 . TRP B 1  331 ? -22.564 28.669  129.120 1.00 28.68  ? 429  TRP B CZ2 1 
ATOM   7727  C  CZ3 . TRP B 1  331 ? -24.333 29.345  127.621 1.00 32.60  ? 429  TRP B CZ3 1 
ATOM   7728  C  CH2 . TRP B 1  331 ? -23.275 28.494  127.965 1.00 31.54  ? 429  TRP B CH2 1 
ATOM   7729  N  N   . VAL B 1  332 ? -25.817 35.013  133.111 1.00 29.82  ? 430  VAL B N   1 
ATOM   7730  C  CA  . VAL B 1  332 ? -26.431 36.293  133.444 1.00 31.66  ? 430  VAL B CA  1 
ATOM   7731  C  C   . VAL B 1  332 ? -25.445 37.446  133.319 1.00 31.91  ? 430  VAL B C   1 
ATOM   7732  O  O   . VAL B 1  332 ? -24.338 37.390  133.852 1.00 33.59  ? 430  VAL B O   1 
ATOM   7733  C  CB  . VAL B 1  332 ? -27.008 36.292  134.881 1.00 30.53  ? 430  VAL B CB  1 
ATOM   7734  C  CG1 . VAL B 1  332 ? -27.618 37.647  135.216 1.00 27.82  ? 430  VAL B CG1 1 
ATOM   7735  C  CG2 . VAL B 1  332 ? -28.038 35.185  135.052 1.00 29.23  ? 430  VAL B CG2 1 
ATOM   7736  N  N   . ASP B 1  333 ? -25.852 38.491  132.606 1.00 30.57  ? 431  ASP B N   1 
ATOM   7737  C  CA  . ASP B 1  333 ? -25.083 39.723  132.563 1.00 28.24  ? 431  ASP B CA  1 
ATOM   7738  C  C   . ASP B 1  333 ? -25.309 40.468  133.875 1.00 28.00  ? 431  ASP B C   1 
ATOM   7739  O  O   . ASP B 1  333 ? -26.282 41.208  134.018 1.00 33.30  ? 431  ASP B O   1 
ATOM   7740  C  CB  . ASP B 1  333 ? -25.499 40.579  131.365 1.00 32.07  ? 431  ASP B CB  1 
ATOM   7741  C  CG  . ASP B 1  333 ? -24.574 41.759  131.132 1.00 37.35  ? 431  ASP B CG  1 
ATOM   7742  O  OD1 . ASP B 1  333 ? -23.730 42.046  132.004 1.00 42.24  ? 431  ASP B OD1 1 
ATOM   7743  O  OD2 . ASP B 1  333 ? -24.694 42.407  130.070 1.00 37.50  ? 431  ASP B OD2 1 
ATOM   7744  N  N   . MET B 1  334 ? -24.400 40.278  134.828 1.00 23.95  ? 432  MET B N   1 
ATOM   7745  C  CA  . MET B 1  334 ? -24.549 40.849  136.164 1.00 23.97  ? 432  MET B CA  1 
ATOM   7746  C  C   . MET B 1  334 ? -24.298 42.352  136.165 1.00 25.10  ? 432  MET B C   1 
ATOM   7747  O  O   . MET B 1  334 ? -24.369 43.007  137.203 1.00 23.01  ? 432  MET B O   1 
ATOM   7748  C  CB  . MET B 1  334 ? -23.602 40.164  137.150 1.00 20.92  ? 432  MET B CB  1 
ATOM   7749  C  CG  . MET B 1  334 ? -24.057 38.788  137.590 1.00 20.47  ? 432  MET B CG  1 
ATOM   7750  S  SD  . MET B 1  334 ? -25.618 38.841  138.484 1.00 23.08  ? 432  MET B SD  1 
ATOM   7751  C  CE  . MET B 1  334 ? -25.190 39.927  139.841 1.00 22.59  ? 432  MET B CE  1 
ATOM   7752  N  N   . THR B 1  335 ? -23.995 42.887  134.990 1.00 29.15  ? 433  THR B N   1 
ATOM   7753  C  CA  . THR B 1  335 ? -23.763 44.310  134.815 1.00 30.45  ? 433  THR B CA  1 
ATOM   7754  C  C   . THR B 1  335 ? -25.084 45.035  134.535 1.00 32.93  ? 433  THR B C   1 
ATOM   7755  O  O   . THR B 1  335 ? -25.197 46.249  134.715 1.00 32.45  ? 433  THR B O   1 
ATOM   7756  C  CB  . THR B 1  335 ? -22.744 44.529  133.665 1.00 29.76  ? 433  THR B CB  1 
ATOM   7757  O  OG1 . THR B 1  335 ? -21.418 44.281  134.152 1.00 28.43  ? 433  THR B OG1 1 
ATOM   7758  C  CG2 . THR B 1  335 ? -22.815 45.927  133.083 1.00 34.97  ? 433  THR B CG2 1 
ATOM   7759  N  N   . ASP B 1  336 ? -26.111 44.267  134.184 1.00 33.23  ? 434  ASP B N   1 
ATOM   7760  C  CA  . ASP B 1  336 ? -27.340 44.841  133.642 1.00 33.65  ? 434  ASP B CA  1 
ATOM   7761  C  C   . ASP B 1  336 ? -28.600 44.179  134.195 1.00 32.81  ? 434  ASP B C   1 
ATOM   7762  O  O   . ASP B 1  336 ? -29.571 43.973  133.469 1.00 38.25  ? 434  ASP B O   1 
ATOM   7763  C  CB  . ASP B 1  336 ? -27.328 44.741  132.114 1.00 39.96  ? 434  ASP B CB  1 
ATOM   7764  C  CG  . ASP B 1  336 ? -28.318 45.684  131.458 1.00 47.78  ? 434  ASP B CG  1 
ATOM   7765  O  OD1 . ASP B 1  336 ? -28.443 46.837  131.925 1.00 51.10  ? 434  ASP B OD1 1 
ATOM   7766  O  OD2 . ASP B 1  336 ? -28.972 45.276  130.475 1.00 49.92  ? 434  ASP B OD2 1 
ATOM   7767  N  N   . VAL B 1  337 ? -28.578 43.839  135.478 1.00 27.68  ? 435  VAL B N   1 
ATOM   7768  C  CA  . VAL B 1  337 ? -29.735 43.222  136.115 1.00 24.10  ? 435  VAL B CA  1 
ATOM   7769  C  C   . VAL B 1  337 ? -30.619 44.268  136.786 1.00 27.81  ? 435  VAL B C   1 
ATOM   7770  O  O   . VAL B 1  337 ? -30.165 45.011  137.655 1.00 29.28  ? 435  VAL B O   1 
ATOM   7771  C  CB  . VAL B 1  337 ? -29.313 42.176  137.163 1.00 22.41  ? 435  VAL B CB  1 
ATOM   7772  C  CG1 . VAL B 1  337 ? -30.536 41.594  137.855 1.00 22.22  ? 435  VAL B CG1 1 
ATOM   7773  C  CG2 . VAL B 1  337 ? -28.477 41.078  136.517 1.00 22.30  ? 435  VAL B CG2 1 
ATOM   7774  N  N   . THR B 1  338 ? -31.882 44.322  136.373 1.00 24.03  ? 436  THR B N   1 
ATOM   7775  C  CA  . THR B 1  338 ? -32.856 45.211  136.994 1.00 24.23  ? 436  THR B CA  1 
ATOM   7776  C  C   . THR B 1  338 ? -33.384 44.584  138.278 1.00 24.76  ? 436  THR B C   1 
ATOM   7777  O  O   . THR B 1  338 ? -34.002 43.519  138.251 1.00 23.50  ? 436  THR B O   1 
ATOM   7778  C  CB  . THR B 1  338 ? -34.029 45.519  136.050 1.00 28.54  ? 436  THR B CB  1 
ATOM   7779  O  OG1 . THR B 1  338 ? -33.534 46.135  134.855 1.00 31.48  ? 436  THR B OG1 1 
ATOM   7780  C  CG2 . THR B 1  338 ? -35.025 46.452  136.722 1.00 27.35  ? 436  THR B CG2 1 
ATOM   7781  N  N   . VAL B 1  339 ? -33.144 45.249  139.403 1.00 25.13  ? 437  VAL B N   1 
ATOM   7782  C  CA  . VAL B 1  339 ? -33.502 44.691  140.699 1.00 24.79  ? 437  VAL B CA  1 
ATOM   7783  C  C   . VAL B 1  339 ? -34.661 45.440  141.350 1.00 26.27  ? 437  VAL B C   1 
ATOM   7784  O  O   . VAL B 1  339 ? -34.648 46.666  141.450 1.00 25.01  ? 437  VAL B O   1 
ATOM   7785  C  CB  . VAL B 1  339 ? -32.300 44.711  141.659 1.00 25.61  ? 437  VAL B CB  1 
ATOM   7786  C  CG1 . VAL B 1  339 ? -32.663 44.040  142.966 1.00 26.52  ? 437  VAL B CG1 1 
ATOM   7787  C  CG2 . VAL B 1  339 ? -31.102 44.032  141.019 1.00 27.03  ? 437  VAL B CG2 1 
ATOM   7788  N  N   . TRP B 1  340 ? -35.666 44.690  141.791 1.00 27.38  ? 438  TRP B N   1 
ATOM   7789  C  CA  . TRP B 1  340 ? -36.833 45.273  142.441 1.00 25.41  ? 438  TRP B CA  1 
ATOM   7790  C  C   . TRP B 1  340 ? -36.718 45.244  143.961 1.00 29.22  ? 438  TRP B C   1 
ATOM   7791  O  O   . TRP B 1  340 ? -36.607 44.177  144.564 1.00 31.93  ? 438  TRP B O   1 
ATOM   7792  C  CB  . TRP B 1  340 ? -38.101 44.549  141.976 1.00 23.58  ? 438  TRP B CB  1 
ATOM   7793  C  CG  . TRP B 1  340 ? -38.382 44.822  140.538 1.00 25.14  ? 438  TRP B CG  1 
ATOM   7794  C  CD1 . TRP B 1  340 ? -38.008 44.060  139.470 1.00 24.51  ? 438  TRP B CD1 1 
ATOM   7795  C  CD2 . TRP B 1  340 ? -39.066 45.959  140.000 1.00 28.42  ? 438  TRP B CD2 1 
ATOM   7796  N  NE1 . TRP B 1  340 ? -38.427 44.647  138.300 1.00 25.38  ? 438  TRP B NE1 1 
ATOM   7797  C  CE2 . TRP B 1  340 ? -39.079 45.815  138.599 1.00 31.01  ? 438  TRP B CE2 1 
ATOM   7798  C  CE3 . TRP B 1  340 ? -39.678 47.081  140.568 1.00 25.53  ? 438  TRP B CE3 1 
ATOM   7799  C  CZ2 . TRP B 1  340 ? -39.678 46.751  137.758 1.00 33.74  ? 438  TRP B CZ2 1 
ATOM   7800  C  CZ3 . TRP B 1  340 ? -40.268 48.011  139.731 1.00 26.44  ? 438  TRP B CZ3 1 
ATOM   7801  C  CH2 . TRP B 1  340 ? -40.265 47.839  138.342 1.00 27.03  ? 438  TRP B CH2 1 
ATOM   7802  N  N   . LEU B 1  341 ? -36.732 46.426  144.570 1.00 29.93  ? 439  LEU B N   1 
ATOM   7803  C  CA  . LEU B 1  341 ? -36.691 46.536  146.021 1.00 33.43  ? 439  LEU B CA  1 
ATOM   7804  C  C   . LEU B 1  341 ? -38.109 46.621  146.574 1.00 44.96  ? 439  LEU B C   1 
ATOM   7805  O  O   . LEU B 1  341 ? -38.364 46.288  147.729 1.00 50.69  ? 439  LEU B O   1 
ATOM   7806  C  CB  . LEU B 1  341 ? -35.879 47.762  146.443 1.00 35.33  ? 439  LEU B CB  1 
ATOM   7807  C  CG  . LEU B 1  341 ? -34.567 47.987  145.682 1.00 36.78  ? 439  LEU B CG  1 
ATOM   7808  C  CD1 . LEU B 1  341 ? -33.920 49.303  146.093 1.00 37.90  ? 439  LEU B CD1 1 
ATOM   7809  C  CD2 . LEU B 1  341 ? -33.604 46.824  145.884 1.00 32.85  ? 439  LEU B CD2 1 
ATOM   7810  N  N   . ASN B 1  342 ? -39.027 47.064  145.721 1.00 50.80  ? 440  ASN B N   1 
ATOM   7811  C  CA  . ASN B 1  342 ? -40.437 47.211  146.063 1.00 49.84  ? 440  ASN B CA  1 
ATOM   7812  C  C   . ASN B 1  342 ? -41.305 46.664  144.942 1.00 48.87  ? 440  ASN B C   1 
ATOM   7813  O  O   . ASN B 1  342 ? -40.812 46.019  144.014 1.00 51.57  ? 440  ASN B O   1 
ATOM   7814  C  CB  . ASN B 1  342 ? -40.808 48.673  146.325 1.00 52.04  ? 440  ASN B CB  1 
ATOM   7815  C  CG  . ASN B 1  342 ? -40.726 49.043  147.791 1.00 56.32  ? 440  ASN B CG  1 
ATOM   7816  O  OD1 . ASN B 1  342 ? -40.233 50.110  148.149 1.00 55.07  ? 440  ASN B OD1 1 
ATOM   7817  N  ND2 . ASN B 1  342 ? -41.227 48.163  148.649 1.00 61.69  ? 440  ASN B ND2 1 
ATOM   7818  N  N   . SER B 1  343 ? -42.603 46.929  145.025 1.00 43.97  ? 441  SER B N   1 
ATOM   7819  C  CA  . SER B 1  343 ? -43.479 46.790  143.871 1.00 40.19  ? 441  SER B CA  1 
ATOM   7820  C  C   . SER B 1  343 ? -43.369 48.039  143.000 1.00 39.67  ? 441  SER B C   1 
ATOM   7821  O  O   . SER B 1  343 ? -43.539 47.976  141.784 1.00 27.07  ? 441  SER B O   1 
ATOM   7822  C  CB  . SER B 1  343 ? -44.926 46.563  144.322 1.00 42.30  ? 441  SER B CB  1 
ATOM   7823  O  OG  . SER B 1  343 ? -45.374 47.618  145.152 1.00 44.74  ? 441  SER B OG  1 
ATOM   7824  N  N   . THR B 1  344 ? -43.073 49.169  143.635 1.00 36.67  ? 442  THR B N   1 
ATOM   7825  C  CA  . THR B 1  344 ? -43.019 50.451  142.942 1.00 40.62  ? 442  THR B CA  1 
ATOM   7826  C  C   . THR B 1  344 ? -41.599 50.980  142.739 1.00 44.21  ? 442  THR B C   1 
ATOM   7827  O  O   . THR B 1  344 ? -41.388 51.920  141.972 1.00 44.52  ? 442  THR B O   1 
ATOM   7828  C  CB  . THR B 1  344 ? -43.834 51.524  143.698 1.00 42.16  ? 442  THR B CB  1 
ATOM   7829  O  OG1 . THR B 1  344 ? -43.134 51.912  144.887 1.00 44.86  ? 442  THR B OG1 1 
ATOM   7830  C  CG2 . THR B 1  344 ? -45.198 50.978  144.077 1.00 41.13  ? 442  THR B CG2 1 
ATOM   7831  N  N   . HIS B 1  345 ? -40.628 50.371  143.411 1.00 47.19  ? 443  HIS B N   1 
ATOM   7832  C  CA  . HIS B 1  345 ? -39.284 50.937  143.470 1.00 45.29  ? 443  HIS B CA  1 
ATOM   7833  C  C   . HIS B 1  345 ? -38.249 49.915  142.997 1.00 36.82  ? 443  HIS B C   1 
ATOM   7834  O  O   . HIS B 1  345 ? -38.222 48.782  143.476 1.00 37.06  ? 443  HIS B O   1 
ATOM   7835  C  CB  . HIS B 1  345 ? -38.994 51.389  144.906 1.00 51.27  ? 443  HIS B CB  1 
ATOM   7836  C  CG  . HIS B 1  345 ? -37.652 52.019  145.098 1.00 59.53  ? 443  HIS B CG  1 
ATOM   7837  N  ND1 . HIS B 1  345 ? -37.422 53.358  144.866 1.00 63.66  ? 443  HIS B ND1 1 
ATOM   7838  C  CD2 . HIS B 1  345 ? -36.472 51.500  145.508 1.00 60.45  ? 443  HIS B CD2 1 
ATOM   7839  C  CE1 . HIS B 1  345 ? -36.158 53.637  145.128 1.00 61.80  ? 443  HIS B CE1 1 
ATOM   7840  N  NE2 . HIS B 1  345 ? -35.558 52.525  145.514 1.00 60.32  ? 443  HIS B NE2 1 
ATOM   7841  N  N   . ALA B 1  346 ? -37.398 50.317  142.057 1.00 30.66  ? 444  ALA B N   1 
ATOM   7842  C  CA  . ALA B 1  346 ? -36.387 49.416  141.504 1.00 26.55  ? 444  ALA B CA  1 
ATOM   7843  C  C   . ALA B 1  346 ? -35.024 50.081  141.363 1.00 28.30  ? 444  ALA B C   1 
ATOM   7844  O  O   . ALA B 1  346 ? -34.923 51.306  141.318 1.00 30.56  ? 444  ALA B O   1 
ATOM   7845  C  CB  . ALA B 1  346 ? -36.838 48.887  140.155 1.00 27.30  ? 444  ALA B CB  1 
ATOM   7846  N  N   . SER B 1  347 ? -33.977 49.264  141.289 1.00 27.15  ? 445  SER B N   1 
ATOM   7847  C  CA  . SER B 1  347 ? -32.641 49.767  140.996 1.00 26.04  ? 445  SER B CA  1 
ATOM   7848  C  C   . SER B 1  347 ? -31.923 48.893  139.971 1.00 27.32  ? 445  SER B C   1 
ATOM   7849  O  O   . SER B 1  347 ? -32.558 48.174  139.200 1.00 27.22  ? 445  SER B O   1 
ATOM   7850  C  CB  . SER B 1  347 ? -31.811 49.866  142.276 1.00 27.12  ? 445  SER B CB  1 
ATOM   7851  O  OG  . SER B 1  347 ? -30.567 50.491  142.018 1.00 23.32  ? 445  SER B OG  1 
ATOM   7852  N  N   . LYS B 1  348 ? -30.595 48.950  139.974 1.00 31.10  ? 446  LYS B N   1 
ATOM   7853  C  CA  . LYS B 1  348 ? -29.809 48.332  138.914 1.00 31.67  ? 446  LYS B CA  1 
ATOM   7854  C  C   . LYS B 1  348 ? -28.440 47.873  139.409 1.00 33.29  ? 446  LYS B C   1 
ATOM   7855  O  O   . LYS B 1  348 ? -27.840 48.508  140.278 1.00 38.27  ? 446  LYS B O   1 
ATOM   7856  C  CB  . LYS B 1  348 ? -29.645 49.320  137.756 1.00 33.15  ? 446  LYS B CB  1 
ATOM   7857  C  CG  . LYS B 1  348 ? -29.148 48.713  136.459 1.00 34.66  ? 446  LYS B CG  1 
ATOM   7858  C  CD  . LYS B 1  348 ? -28.904 49.790  135.415 1.00 34.09  ? 446  LYS B CD  1 
ATOM   7859  C  CE  . LYS B 1  348 ? -27.425 50.093  135.269 1.00 37.24  ? 446  LYS B CE  1 
ATOM   7860  N  NZ  . LYS B 1  348 ? -26.656 48.906  134.795 1.00 38.45  ? 446  LYS B NZ  1 
ATOM   7861  N  N   . THR B 1  349 ? -27.948 46.768  138.856 1.00 31.27  ? 447  THR B N   1 
ATOM   7862  C  CA  . THR B 1  349 ? -26.582 46.334  139.118 1.00 31.71  ? 447  THR B CA  1 
ATOM   7863  C  C   . THR B 1  349 ? -25.618 47.120  138.229 1.00 34.44  ? 447  THR B C   1 
ATOM   7864  O  O   . THR B 1  349 ? -26.040 47.786  137.281 1.00 29.15  ? 447  THR B O   1 
ATOM   7865  C  CB  . THR B 1  349 ? -26.405 44.820  138.882 1.00 30.48  ? 447  THR B CB  1 
ATOM   7866  O  OG1 . THR B 1  349 ? -26.953 44.460  137.608 1.00 32.19  ? 447  THR B OG1 1 
ATOM   7867  C  CG2 . THR B 1  349 ? -27.107 44.028  139.972 1.00 28.55  ? 447  THR B CG2 1 
ATOM   7868  N  N   . CYS B 1  350 ? -24.328 47.043  138.537 1.00 22.46  ? 448  CYS B N   1 
ATOM   7869  C  CA  . CYS B 1  350 ? -23.344 47.921  137.916 1.00 23.03  ? 448  CYS B CA  1 
ATOM   7870  C  C   . CYS B 1  350 ? -22.270 47.168  137.144 1.00 28.14  ? 448  CYS B C   1 
ATOM   7871  O  O   . CYS B 1  350 ? -22.145 45.949  137.256 1.00 27.38  ? 448  CYS B O   1 
ATOM   7872  C  CB  . CYS B 1  350 ? -22.675 48.789  138.981 1.00 22.86  ? 448  CYS B CB  1 
ATOM   7873  S  SG  . CYS B 1  350 ? -23.809 49.457  140.205 1.00 33.77  ? 448  CYS B SG  1 
ATOM   7874  N  N   . LYS B 1  351 ? -21.499 47.909  136.354 1.00 30.91  ? 449  LYS B N   1 
ATOM   7875  C  CA  . LYS B 1  351 ? -20.272 47.381  135.779 1.00 31.53  ? 449  LYS B CA  1 
ATOM   7876  C  C   . LYS B 1  351 ? -19.295 47.129  136.921 1.00 25.39  ? 449  LYS B C   1 
ATOM   7877  O  O   . LYS B 1  351 ? -19.205 47.936  137.846 1.00 26.04  ? 449  LYS B O   1 
ATOM   7878  C  CB  . LYS B 1  351 ? -19.671 48.348  134.757 1.00 37.66  ? 449  LYS B CB  1 
ATOM   7879  C  CG  . LYS B 1  351 ? -20.370 48.344  133.412 1.00 38.73  ? 449  LYS B CG  1 
ATOM   7880  C  CD  . LYS B 1  351 ? -19.854 49.439  132.499 1.00 44.60  ? 449  LYS B CD  1 
ATOM   7881  C  CE  . LYS B 1  351 ? -20.450 49.305  131.105 1.00 46.60  ? 449  LYS B CE  1 
ATOM   7882  N  NZ  . LYS B 1  351 ? -19.587 49.910  130.055 1.00 48.96  ? 449  LYS B NZ  1 
ATOM   7883  N  N   . PRO B 1  352 ? -18.568 46.001  136.870 1.00 23.65  ? 450  PRO B N   1 
ATOM   7884  C  CA  . PRO B 1  352 ? -17.746 45.572  138.009 1.00 25.19  ? 450  PRO B CA  1 
ATOM   7885  C  C   . PRO B 1  352 ? -16.689 46.601  138.406 1.00 32.12  ? 450  PRO B C   1 
ATOM   7886  O  O   . PRO B 1  352 ? -16.000 47.155  137.549 1.00 36.48  ? 450  PRO B O   1 
ATOM   7887  C  CB  . PRO B 1  352 ? -17.087 44.280  137.510 1.00 23.89  ? 450  PRO B CB  1 
ATOM   7888  C  CG  . PRO B 1  352 ? -17.274 44.273  136.029 1.00 26.65  ? 450  PRO B CG  1 
ATOM   7889  C  CD  . PRO B 1  352 ? -18.520 45.042  135.755 1.00 22.87  ? 450  PRO B CD  1 
ATOM   7890  N  N   . ALA B 1  353 ? -16.578 46.853  139.706 1.00 29.80  ? 451  ALA B N   1 
ATOM   7891  C  CA  . ALA B 1  353 ? -15.590 47.788  140.230 1.00 25.84  ? 451  ALA B CA  1 
ATOM   7892  C  C   . ALA B 1  353 ? -15.214 47.429  141.662 1.00 25.95  ? 451  ALA B C   1 
ATOM   7893  O  O   . ALA B 1  353 ? -16.064 47.017  142.450 1.00 24.63  ? 451  ALA B O   1 
ATOM   7894  C  CB  . ALA B 1  353 ? -16.115 49.211  140.160 1.00 29.02  ? 451  ALA B CB  1 
ATOM   7895  N  N   . LEU B 1  354 ? -13.937 47.594  141.988 1.00 26.44  ? 452  LEU B N   1 
ATOM   7896  C  CA  . LEU B 1  354 ? -13.447 47.346  143.338 1.00 27.98  ? 452  LEU B CA  1 
ATOM   7897  C  C   . LEU B 1  354 ? -13.274 48.652  144.106 1.00 31.89  ? 452  LEU B C   1 
ATOM   7898  O  O   . LEU B 1  354 ? -12.801 49.647  143.557 1.00 34.92  ? 452  LEU B O   1 
ATOM   7899  C  CB  . LEU B 1  354 ? -12.123 46.581  143.297 1.00 28.03  ? 452  LEU B CB  1 
ATOM   7900  C  CG  . LEU B 1  354 ? -12.179 45.170  142.708 1.00 27.14  ? 452  LEU B CG  1 
ATOM   7901  C  CD1 . LEU B 1  354 ? -10.782 44.660  142.401 1.00 26.12  ? 452  LEU B CD1 1 
ATOM   7902  C  CD2 . LEU B 1  354 ? -12.896 44.222  143.657 1.00 27.07  ? 452  LEU B CD2 1 
ATOM   7903  N  N   . GLY B 1  355 ? -13.663 48.644  145.377 1.00 31.64  ? 453  GLY B N   1 
ATOM   7904  C  CA  . GLY B 1  355 ? -13.563 49.829  146.209 1.00 31.35  ? 453  GLY B CA  1 
ATOM   7905  C  C   . GLY B 1  355 ? -12.178 50.019  146.793 1.00 33.19  ? 453  GLY B C   1 
ATOM   7906  O  O   . GLY B 1  355 ? -11.349 49.112  146.744 1.00 34.04  ? 453  GLY B O   1 
ATOM   7907  N  N   . TYR B 1  356 ? -11.930 51.211  147.330 1.00 33.93  ? 454  TYR B N   1 
ATOM   7908  C  CA  . TYR B 1  356 ? -10.673 51.535  148.002 1.00 33.70  ? 454  TYR B CA  1 
ATOM   7909  C  C   . TYR B 1  356 ? -10.255 50.469  149.011 1.00 28.28  ? 454  TYR B C   1 
ATOM   7910  O  O   . TYR B 1  356 ? -9.090  50.077  149.066 1.00 27.20  ? 454  TYR B O   1 
ATOM   7911  C  CB  . TYR B 1  356 ? -10.781 52.890  148.705 1.00 37.36  ? 454  TYR B CB  1 
ATOM   7912  C  CG  . TYR B 1  356 ? -10.367 54.069  147.853 1.00 44.11  ? 454  TYR B CG  1 
ATOM   7913  C  CD1 . TYR B 1  356 ? -10.923 54.277  146.598 1.00 45.83  ? 454  TYR B CD1 1 
ATOM   7914  C  CD2 . TYR B 1  356 ? -9.423  54.980  148.310 1.00 50.68  ? 454  TYR B CD2 1 
ATOM   7915  C  CE1 . TYR B 1  356 ? -10.548 55.358  145.820 1.00 46.28  ? 454  TYR B CE1 1 
ATOM   7916  C  CE2 . TYR B 1  356 ? -9.042  56.062  147.540 1.00 53.55  ? 454  TYR B CE2 1 
ATOM   7917  C  CZ  . TYR B 1  356 ? -9.607  56.246  146.296 1.00 50.05  ? 454  TYR B CZ  1 
ATOM   7918  O  OH  . TYR B 1  356 ? -9.228  57.323  145.529 1.00 49.48  ? 454  TYR B OH  1 
ATOM   7919  N  N   . SER B 1  357 ? -11.216 50.006  149.803 1.00 23.32  ? 455  SER B N   1 
ATOM   7920  C  CA  . SER B 1  357 ? -10.938 49.082  150.899 1.00 21.81  ? 455  SER B CA  1 
ATOM   7921  C  C   . SER B 1  357 ? -10.537 47.683  150.433 1.00 23.03  ? 455  SER B C   1 
ATOM   7922  O  O   . SER B 1  357 ? -10.109 46.861  151.242 1.00 26.15  ? 455  SER B O   1 
ATOM   7923  C  CB  . SER B 1  357 ? -12.147 48.990  151.828 1.00 19.67  ? 455  SER B CB  1 
ATOM   7924  O  OG  . SER B 1  357 ? -12.206 50.114  152.690 1.00 20.63  ? 455  SER B OG  1 
ATOM   7925  N  N   . PHE B 1  358 ? -10.681 47.407  149.140 1.00 21.14  ? 456  PHE B N   1 
ATOM   7926  C  CA  . PHE B 1  358 ? -10.196 46.148  148.581 1.00 19.33  ? 456  PHE B CA  1 
ATOM   7927  C  C   . PHE B 1  358 ? -8.688  46.017  148.783 1.00 26.19  ? 456  PHE B C   1 
ATOM   7928  O  O   . PHE B 1  358 ? -8.180  44.933  149.068 1.00 31.24  ? 456  PHE B O   1 
ATOM   7929  C  CB  . PHE B 1  358 ? -10.541 46.040  147.092 1.00 19.56  ? 456  PHE B CB  1 
ATOM   7930  C  CG  . PHE B 1  358 ? -9.781  44.961  146.369 1.00 19.43  ? 456  PHE B CG  1 
ATOM   7931  C  CD1 . PHE B 1  358 ? -10.217 43.648  146.404 1.00 18.77  ? 456  PHE B CD1 1 
ATOM   7932  C  CD2 . PHE B 1  358 ? -8.642  45.264  145.638 1.00 20.04  ? 456  PHE B CD2 1 
ATOM   7933  C  CE1 . PHE B 1  358 ? -9.522  42.653  145.738 1.00 18.71  ? 456  PHE B CE1 1 
ATOM   7934  C  CE2 . PHE B 1  358 ? -7.944  44.276  144.970 1.00 19.98  ? 456  PHE B CE2 1 
ATOM   7935  C  CZ  . PHE B 1  358 ? -8.385  42.968  145.020 1.00 19.31  ? 456  PHE B CZ  1 
ATOM   7936  N  N   . ALA B 1  359 ? -7.980  47.133  148.636 1.00 23.32  ? 457  ALA B N   1 
ATOM   7937  C  CA  . ALA B 1  359 ? -6.528  47.158  148.781 1.00 20.68  ? 457  ALA B CA  1 
ATOM   7938  C  C   . ALA B 1  359 ? -6.090  47.019  150.239 1.00 25.42  ? 457  ALA B C   1 
ATOM   7939  O  O   . ALA B 1  359 ? -4.901  46.885  150.527 1.00 20.67  ? 457  ALA B O   1 
ATOM   7940  C  CB  . ALA B 1  359 ? -5.964  48.441  148.184 1.00 21.68  ? 457  ALA B CB  1 
ATOM   7941  N  N   . ALA B 1  360 ? -7.051  47.054  151.156 1.00 23.31  ? 458  ALA B N   1 
ATOM   7942  C  CA  . ALA B 1  360 ? -6.747  46.990  152.580 1.00 23.79  ? 458  ALA B CA  1 
ATOM   7943  C  C   . ALA B 1  360 ? -6.620  45.554  153.070 1.00 23.61  ? 458  ALA B C   1 
ATOM   7944  O  O   . ALA B 1  360 ? -6.040  45.301  154.126 1.00 24.85  ? 458  ALA B O   1 
ATOM   7945  C  CB  . ALA B 1  360 ? -7.814  47.722  153.379 1.00 19.76  ? 458  ALA B CB  1 
ATOM   7946  N  N   . GLY B 1  361 ? -7.149  44.614  152.295 1.00 22.20  ? 459  GLY B N   1 
ATOM   7947  C  CA  . GLY B 1  361 ? -7.174  43.225  152.712 1.00 17.87  ? 459  GLY B CA  1 
ATOM   7948  C  C   . GLY B 1  361 ? -8.055  43.038  153.934 1.00 19.38  ? 459  GLY B C   1 
ATOM   7949  O  O   . GLY B 1  361 ? -8.986  43.813  154.163 1.00 17.49  ? 459  GLY B O   1 
ATOM   7950  N  N   . THR B 1  362 ? -7.770  42.001  154.714 1.00 18.87  ? 460  THR B N   1 
ATOM   7951  C  CA  . THR B 1  362 ? -8.522  41.715  155.930 1.00 16.81  ? 460  THR B CA  1 
ATOM   7952  C  C   . THR B 1  362 ? -7.579  41.428  157.088 1.00 23.60  ? 460  THR B C   1 
ATOM   7953  O  O   . THR B 1  362 ? -6.359  41.535  156.948 1.00 21.26  ? 460  THR B O   1 
ATOM   7954  C  CB  . THR B 1  362 ? -9.467  40.508  155.761 1.00 16.92  ? 460  THR B CB  1 
ATOM   7955  O  OG1 . THR B 1  362 ? -8.695  39.303  155.664 1.00 18.86  ? 460  THR B OG1 1 
ATOM   7956  C  CG2 . THR B 1  362 ? -10.313 40.652  154.513 1.00 15.94  ? 460  THR B CG2 1 
ATOM   7957  N  N   . ILE B 1  363 ? -8.148  41.067  158.234 1.00 24.01  ? 461  ILE B N   1 
ATOM   7958  C  CA  . ILE B 1  363 ? -7.353  40.683  159.394 1.00 20.17  ? 461  ILE B CA  1 
ATOM   7959  C  C   . ILE B 1  363 ? -6.764  39.282  159.237 1.00 21.71  ? 461  ILE B C   1 
ATOM   7960  O  O   . ILE B 1  363 ? -5.947  38.851  160.052 1.00 23.77  ? 461  ILE B O   1 
ATOM   7961  C  CB  . ILE B 1  363 ? -8.189  40.741  160.685 1.00 19.53  ? 461  ILE B CB  1 
ATOM   7962  C  CG1 . ILE B 1  363 ? -9.371  39.776  160.599 1.00 20.89  ? 461  ILE B CG1 1 
ATOM   7963  C  CG2 . ILE B 1  363 ? -8.674  42.160  160.939 1.00 20.64  ? 461  ILE B CG2 1 
ATOM   7964  C  CD1 . ILE B 1  363 ? -10.275 39.815  161.813 1.00 15.39  ? 461  ILE B CD1 1 
ATOM   7965  N  N   . ASP B 1  364 ? -7.179  38.579  158.186 1.00 19.33  ? 462  ASP B N   1 
ATOM   7966  C  CA  . ASP B 1  364 ? -6.632  37.263  157.871 1.00 16.93  ? 462  ASP B CA  1 
ATOM   7967  C  C   . ASP B 1  364 ? -5.500  37.386  156.858 1.00 19.35  ? 462  ASP B C   1 
ATOM   7968  O  O   . ASP B 1  364 ? -4.835  36.403  156.526 1.00 21.15  ? 462  ASP B O   1 
ATOM   7969  C  CB  . ASP B 1  364 ? -7.718  36.336  157.325 1.00 19.36  ? 462  ASP B CB  1 
ATOM   7970  C  CG  . ASP B 1  364 ? -8.826  36.085  158.323 1.00 22.62  ? 462  ASP B CG  1 
ATOM   7971  O  OD1 . ASP B 1  364 ? -8.523  35.919  159.524 1.00 23.75  ? 462  ASP B OD1 1 
ATOM   7972  O  OD2 . ASP B 1  364 ? -10.002 36.048  157.903 1.00 22.11  ? 462  ASP B OD2 1 
ATOM   7973  N  N   . GLY B 1  365 ? -5.296  38.603  156.367 1.00 19.99  ? 463  GLY B N   1 
ATOM   7974  C  CA  . GLY B 1  365 ? -4.289  38.875  155.359 1.00 16.65  ? 463  GLY B CA  1 
ATOM   7975  C  C   . GLY B 1  365 ? -4.399  40.315  154.902 1.00 18.43  ? 463  GLY B C   1 
ATOM   7976  O  O   . GLY B 1  365 ? -5.278  40.660  154.112 1.00 17.50  ? 463  GLY B O   1 
ATOM   7977  N  N   . VAL B 1  366 ? -3.503  41.157  155.403 1.00 20.11  ? 464  VAL B N   1 
ATOM   7978  C  CA  . VAL B 1  366 ? -3.586  42.592  155.168 1.00 21.94  ? 464  VAL B CA  1 
ATOM   7979  C  C   . VAL B 1  366 ? -2.964  42.994  153.836 1.00 21.12  ? 464  VAL B C   1 
ATOM   7980  O  O   . VAL B 1  366 ? -2.056  42.331  153.332 1.00 26.29  ? 464  VAL B O   1 
ATOM   7981  C  CB  . VAL B 1  366 ? -2.902  43.390  156.302 1.00 25.83  ? 464  VAL B CB  1 
ATOM   7982  C  CG1 . VAL B 1  366 ? -3.533  43.055  157.644 1.00 20.34  ? 464  VAL B CG1 1 
ATOM   7983  C  CG2 . VAL B 1  366 ? -1.405  43.108  156.333 1.00 30.78  ? 464  VAL B CG2 1 
ATOM   7984  N  N   . GLY B 1  367 ? -3.472  44.079  153.261 1.00 21.01  ? 465  GLY B N   1 
ATOM   7985  C  CA  . GLY B 1  367 ? -2.885  44.647  152.064 1.00 24.02  ? 465  GLY B CA  1 
ATOM   7986  C  C   . GLY B 1  367 ? -1.584  45.338  152.425 1.00 34.26  ? 465  GLY B C   1 
ATOM   7987  O  O   . GLY B 1  367 ? -1.344  45.658  153.589 1.00 39.19  ? 465  GLY B O   1 
ATOM   7988  N  N   . GLY B 1  368 ? -0.736  45.564  151.429 1.00 37.50  ? 466  GLY B N   1 
ATOM   7989  C  CA  . GLY B 1  368 ? 0.570   46.147  151.673 1.00 42.39  ? 466  GLY B CA  1 
ATOM   7990  C  C   . GLY B 1  368 ? 0.625   47.663  151.630 1.00 45.80  ? 466  GLY B C   1 
ATOM   7991  O  O   . GLY B 1  368 ? 1.616   48.258  152.044 1.00 44.12  ? 466  GLY B O   1 
ATOM   7992  N  N   . LEU B 1  369 ? -0.441  48.292  151.145 1.00 47.05  ? 467  LEU B N   1 
ATOM   7993  C  CA  . LEU B 1  369 ? -0.386  49.707  150.790 1.00 43.20  ? 467  LEU B CA  1 
ATOM   7994  C  C   . LEU B 1  369 ? -1.004  50.637  151.834 1.00 45.49  ? 467  LEU B C   1 
ATOM   7995  O  O   . LEU B 1  369 ? -1.367  51.770  151.516 1.00 51.96  ? 467  LEU B O   1 
ATOM   7996  C  CB  . LEU B 1  369 ? -1.083  49.931  149.449 1.00 40.81  ? 467  LEU B CB  1 
ATOM   7997  C  CG  . LEU B 1  369 ? -0.485  49.195  148.249 1.00 41.72  ? 467  LEU B CG  1 
ATOM   7998  C  CD1 . LEU B 1  369 ? -1.339  49.403  147.007 1.00 40.35  ? 467  LEU B CD1 1 
ATOM   7999  C  CD2 . LEU B 1  369 ? 0.948   49.636  148.012 1.00 48.20  ? 467  LEU B CD2 1 
ATOM   8000  N  N   . ASN B 1  370 ? -1.134  50.148  153.066 1.00 41.25  ? 468  ASN B N   1 
ATOM   8001  C  CA  . ASN B 1  370 ? -1.595  50.955  154.197 1.00 40.51  ? 468  ASN B CA  1 
ATOM   8002  C  C   . ASN B 1  370 ? -3.033  51.455  154.046 1.00 40.48  ? 468  ASN B C   1 
ATOM   8003  O  O   . ASN B 1  370 ? -3.448  52.389  154.735 1.00 39.59  ? 468  ASN B O   1 
ATOM   8004  C  CB  . ASN B 1  370 ? -0.656  52.143  154.428 1.00 47.16  ? 468  ASN B CB  1 
ATOM   8005  C  CG  . ASN B 1  370 ? -0.234  52.276  155.877 1.00 56.80  ? 468  ASN B CG  1 
ATOM   8006  O  OD1 . ASN B 1  370 ? -0.223  51.297  156.624 1.00 62.41  ? 468  ASN B OD1 1 
ATOM   8007  N  ND2 . ASN B 1  370 ? 0.126   53.490  156.280 1.00 57.22  ? 468  ASN B ND2 1 
ATOM   8008  N  N   . PHE B 1  371 ? -3.785  50.836  153.140 1.00 37.64  ? 469  PHE B N   1 
ATOM   8009  C  CA  . PHE B 1  371 ? -5.211  51.113  153.007 1.00 34.70  ? 469  PHE B CA  1 
ATOM   8010  C  C   . PHE B 1  371 ? -5.970  50.566  154.208 1.00 32.05  ? 469  PHE B C   1 
ATOM   8011  O  O   . PHE B 1  371 ? -5.593  49.539  154.769 1.00 31.06  ? 469  PHE B O   1 
ATOM   8012  C  CB  . PHE B 1  371 ? -5.766  50.504  151.718 1.00 38.16  ? 469  PHE B CB  1 
ATOM   8013  C  CG  . PHE B 1  371 ? -5.512  51.332  150.494 1.00 43.50  ? 469  PHE B CG  1 
ATOM   8014  C  CD1 . PHE B 1  371 ? -4.252  51.381  149.923 1.00 46.02  ? 469  PHE B CD1 1 
ATOM   8015  C  CD2 . PHE B 1  371 ? -6.538  52.053  149.904 1.00 45.52  ? 469  PHE B CD2 1 
ATOM   8016  C  CE1 . PHE B 1  371 ? -4.017  52.140  148.791 1.00 47.70  ? 469  PHE B CE1 1 
ATOM   8017  C  CE2 . PHE B 1  371 ? -6.310  52.812  148.773 1.00 47.46  ? 469  PHE B CE2 1 
ATOM   8018  C  CZ  . PHE B 1  371 ? -5.050  52.856  148.216 1.00 48.21  ? 469  PHE B CZ  1 
ATOM   8019  N  N   . THR B 1  372 ? -7.038  51.251  154.600 1.00 31.97  ? 470  THR B N   1 
ATOM   8020  C  CA  . THR B 1  372 ? -7.865  50.794  155.712 1.00 29.52  ? 470  THR B CA  1 
ATOM   8021  C  C   . THR B 1  372 ? -9.258  50.394  155.245 1.00 30.50  ? 470  THR B C   1 
ATOM   8022  O  O   . THR B 1  372 ? -9.794  50.963  154.296 1.00 34.40  ? 470  THR B O   1 
ATOM   8023  C  CB  . THR B 1  372 ? -8.008  51.873  156.799 1.00 27.36  ? 470  THR B CB  1 
ATOM   8024  O  OG1 . THR B 1  372 ? -8.566  53.061  156.225 1.00 27.96  ? 470  THR B OG1 1 
ATOM   8025  C  CG2 . THR B 1  372 ? -6.661  52.192  157.420 1.00 27.89  ? 470  THR B CG2 1 
ATOM   8026  N  N   . GLN B 1  373 ? -9.838  49.408  155.919 1.00 30.82  ? 471  GLN B N   1 
ATOM   8027  C  CA  . GLN B 1  373 ? -11.210 48.997  155.652 1.00 30.65  ? 471  GLN B CA  1 
ATOM   8028  C  C   . GLN B 1  373 ? -12.204 50.055  156.122 1.00 29.81  ? 471  GLN B C   1 
ATOM   8029  O  O   . GLN B 1  373 ? -11.955 50.764  157.096 1.00 30.00  ? 471  GLN B O   1 
ATOM   8030  C  CB  . GLN B 1  373 ? -11.509 47.661  156.331 1.00 26.86  ? 471  GLN B CB  1 
ATOM   8031  C  CG  . GLN B 1  373 ? -10.780 46.481  155.725 1.00 26.42  ? 471  GLN B CG  1 
ATOM   8032  C  CD  . GLN B 1  373 ? -11.271 45.159  156.276 1.00 29.99  ? 471  GLN B CD  1 
ATOM   8033  O  OE1 . GLN B 1  373 ? -12.425 44.778  156.075 1.00 29.17  ? 471  GLN B OE1 1 
ATOM   8034  N  NE2 . GLN B 1  373 ? -10.394 44.449  156.977 1.00 31.53  ? 471  GLN B NE2 1 
ATOM   8035  N  N   . GLY B 1  374 ? -13.332 50.157  155.427 1.00 29.51  ? 472  GLY B N   1 
ATOM   8036  C  CA  . GLY B 1  374 ? -14.385 51.072  155.827 1.00 31.78  ? 472  GLY B CA  1 
ATOM   8037  C  C   . GLY B 1  374 ? -14.295 52.433  155.167 1.00 33.34  ? 472  GLY B C   1 
ATOM   8038  O  O   . GLY B 1  374 ? -14.888 53.403  155.638 1.00 31.73  ? 472  GLY B O   1 
ATOM   8039  N  N   . LYS B 1  375 ? -13.548 52.509  154.073 1.00 36.92  ? 473  LYS B N   1 
ATOM   8040  C  CA  . LYS B 1  375 ? -13.403 53.759  153.342 1.00 38.96  ? 473  LYS B CA  1 
ATOM   8041  C  C   . LYS B 1  375 ? -14.607 54.019  152.449 1.00 33.62  ? 473  LYS B C   1 
ATOM   8042  O  O   . LYS B 1  375 ? -14.843 53.293  151.484 1.00 32.19  ? 473  LYS B O   1 
ATOM   8043  C  CB  . LYS B 1  375 ? -12.123 53.749  152.510 1.00 41.42  ? 473  LYS B CB  1 
ATOM   8044  C  CG  . LYS B 1  375 ? -10.941 54.365  153.226 1.00 47.77  ? 473  LYS B CG  1 
ATOM   8045  C  CD  . LYS B 1  375 ? -9.667  54.196  152.422 1.00 54.93  ? 473  LYS B CD  1 
ATOM   8046  C  CE  . LYS B 1  375 ? -8.468  54.730  153.186 1.00 60.85  ? 473  LYS B CE  1 
ATOM   8047  N  NZ  . LYS B 1  375 ? -7.184  54.401  152.508 1.00 63.21  ? 473  LYS B NZ  1 
ATOM   8048  N  N   . THR B 1  376 ? -15.370 55.056  152.779 1.00 30.31  ? 474  THR B N   1 
ATOM   8049  C  CA  . THR B 1  376 ? -16.540 55.416  151.992 1.00 33.58  ? 474  THR B CA  1 
ATOM   8050  C  C   . THR B 1  376 ? -16.275 56.657  151.146 1.00 41.44  ? 474  THR B C   1 
ATOM   8051  O  O   . THR B 1  376 ? -17.166 57.153  150.457 1.00 44.04  ? 474  THR B O   1 
ATOM   8052  C  CB  . THR B 1  376 ? -17.767 55.660  152.891 1.00 30.99  ? 474  THR B CB  1 
ATOM   8053  O  OG1 . THR B 1  376 ? -17.498 56.750  153.781 1.00 30.28  ? 474  THR B OG1 1 
ATOM   8054  C  CG2 . THR B 1  376 ? -18.085 54.418  153.707 1.00 21.71  ? 474  THR B CG2 1 
ATOM   8055  N  N   . GLU B 1  377 ? -15.042 57.152  151.207 1.00 46.87  ? 475  GLU B N   1 
ATOM   8056  C  CA  . GLU B 1  377 ? -14.636 58.334  150.452 1.00 51.02  ? 475  GLU B CA  1 
ATOM   8057  C  C   . GLU B 1  377 ? -13.262 58.111  149.834 1.00 49.03  ? 475  GLU B C   1 
ATOM   8058  O  O   . GLU B 1  377 ? -12.407 57.452  150.425 1.00 49.90  ? 475  GLU B O   1 
ATOM   8059  C  CB  . GLU B 1  377 ? -14.617 59.580  151.343 1.00 56.85  ? 475  GLU B CB  1 
ATOM   8060  C  CG  . GLU B 1  377 ? -15.877 59.780  152.177 1.00 64.40  ? 475  GLU B CG  1 
ATOM   8061  C  CD  . GLU B 1  377 ? -15.703 60.828  153.258 1.00 71.55  ? 475  GLU B CD  1 
ATOM   8062  O  OE1 . GLU B 1  377 ? -15.123 61.895  152.967 1.00 75.10  ? 475  GLU B OE1 1 
ATOM   8063  O  OE2 . GLU B 1  377 ? -16.143 60.582  154.402 1.00 72.43  ? 475  GLU B OE2 1 
ATOM   8064  N  N   . GLY B 1  378 ? -13.051 58.658  148.642 1.00 48.11  ? 476  GLY B N   1 
ATOM   8065  C  CA  . GLY B 1  378 ? -11.759 58.572  147.988 1.00 50.23  ? 476  GLY B CA  1 
ATOM   8066  C  C   . GLY B 1  378 ? -10.841 59.709  148.396 1.00 54.61  ? 476  GLY B C   1 
ATOM   8067  O  O   . GLY B 1  378 ? -11.216 60.569  149.192 1.00 60.46  ? 476  GLY B O   1 
ATOM   8068  N  N   . ASP B 1  379 ? -9.630  59.710  147.851 1.00 52.27  ? 477  ASP B N   1 
ATOM   8069  C  CA  . ASP B 1  379 ? -8.702  60.812  148.057 1.00 58.13  ? 477  ASP B CA  1 
ATOM   8070  C  C   . ASP B 1  379 ? -8.118  61.259  146.717 1.00 58.54  ? 477  ASP B C   1 
ATOM   8071  O  O   . ASP B 1  379 ? -8.054  60.466  145.778 1.00 57.84  ? 477  ASP B O   1 
ATOM   8072  C  CB  . ASP B 1  379 ? -7.601  60.415  149.061 1.00 63.27  ? 477  ASP B CB  1 
ATOM   8073  C  CG  . ASP B 1  379 ? -6.850  59.150  148.664 1.00 67.83  ? 477  ASP B CG  1 
ATOM   8074  O  OD1 . ASP B 1  379 ? -6.608  58.927  147.460 1.00 70.70  ? 477  ASP B OD1 1 
ATOM   8075  O  OD2 . ASP B 1  379 ? -6.496  58.371  149.573 1.00 67.99  ? 477  ASP B OD2 1 
ATOM   8076  N  N   . PRO B 1  380 ? -7.717  62.539  146.617 1.00 57.10  ? 478  PRO B N   1 
ATOM   8077  C  CA  . PRO B 1  380 ? -7.264  63.075  145.328 1.00 56.24  ? 478  PRO B CA  1 
ATOM   8078  C  C   . PRO B 1  380 ? -6.038  62.357  144.779 1.00 57.68  ? 478  PRO B C   1 
ATOM   8079  O  O   . PRO B 1  380 ? -5.861  62.288  143.565 1.00 60.34  ? 478  PRO B O   1 
ATOM   8080  C  CB  . PRO B 1  380 ? -6.931  64.536  145.654 1.00 55.04  ? 478  PRO B CB  1 
ATOM   8081  C  CG  . PRO B 1  380 ? -7.732  64.845  146.869 1.00 55.82  ? 478  PRO B CG  1 
ATOM   8082  C  CD  . PRO B 1  380 ? -7.742  63.576  147.663 1.00 56.26  ? 478  PRO B CD  1 
ATOM   8083  N  N   . PHE B 1  381 ? -5.208  61.829  145.669 1.00 57.97  ? 479  PHE B N   1 
ATOM   8084  C  CA  . PHE B 1  381 ? -3.996  61.134  145.262 1.00 61.01  ? 479  PHE B CA  1 
ATOM   8085  C  C   . PHE B 1  381 ? -4.271  59.846  144.487 1.00 57.28  ? 479  PHE B C   1 
ATOM   8086  O  O   . PHE B 1  381 ? -3.834  59.696  143.346 1.00 56.02  ? 479  PHE B O   1 
ATOM   8087  C  CB  . PHE B 1  381 ? -3.126  60.823  146.479 1.00 67.52  ? 479  PHE B CB  1 
ATOM   8088  C  CG  . PHE B 1  381 ? -1.851  60.119  146.136 1.00 72.17  ? 479  PHE B CG  1 
ATOM   8089  C  CD1 . PHE B 1  381 ? -1.733  58.753  146.310 1.00 71.02  ? 479  PHE B CD1 1 
ATOM   8090  C  CD2 . PHE B 1  381 ? -0.773  60.824  145.630 1.00 76.20  ? 479  PHE B CD2 1 
ATOM   8091  C  CE1 . PHE B 1  381 ? -0.563  58.106  145.991 1.00 71.87  ? 479  PHE B CE1 1 
ATOM   8092  C  CE2 . PHE B 1  381 ? 0.403   60.179  145.307 1.00 75.72  ? 479  PHE B CE2 1 
ATOM   8093  C  CZ  . PHE B 1  381 ? 0.508   58.819  145.487 1.00 73.66  ? 479  PHE B CZ  1 
ATOM   8094  N  N   . TRP B 1  382 ? -4.987  58.915  145.111 1.00 54.02  ? 480  TRP B N   1 
ATOM   8095  C  CA  . TRP B 1  382 ? -5.237  57.616  144.492 1.00 53.09  ? 480  TRP B CA  1 
ATOM   8096  C  C   . TRP B 1  382 ? -6.267  57.706  143.372 1.00 50.31  ? 480  TRP B C   1 
ATOM   8097  O  O   . TRP B 1  382 ? -6.217  56.928  142.418 1.00 50.50  ? 480  TRP B O   1 
ATOM   8098  C  CB  . TRP B 1  382 ? -5.682  56.595  145.541 1.00 53.58  ? 480  TRP B CB  1 
ATOM   8099  C  CG  . TRP B 1  382 ? -4.524  55.928  146.216 1.00 55.97  ? 480  TRP B CG  1 
ATOM   8100  C  CD1 . TRP B 1  382 ? -4.069  56.161  147.481 1.00 57.51  ? 480  TRP B CD1 1 
ATOM   8101  C  CD2 . TRP B 1  382 ? -3.647  54.949  145.647 1.00 53.68  ? 480  TRP B CD2 1 
ATOM   8102  N  NE1 . TRP B 1  382 ? -2.976  55.372  147.743 1.00 56.84  ? 480  TRP B NE1 1 
ATOM   8103  C  CE2 . TRP B 1  382 ? -2.694  54.621  146.632 1.00 54.91  ? 480  TRP B CE2 1 
ATOM   8104  C  CE3 . TRP B 1  382 ? -3.579  54.312  144.404 1.00 51.61  ? 480  TRP B CE3 1 
ATOM   8105  C  CZ2 . TRP B 1  382 ? -1.688  53.683  146.414 1.00 53.77  ? 480  TRP B CZ2 1 
ATOM   8106  C  CZ3 . TRP B 1  382 ? -2.579  53.382  144.190 1.00 51.25  ? 480  TRP B CZ3 1 
ATOM   8107  C  CH2 . TRP B 1  382 ? -1.647  53.076  145.189 1.00 52.83  ? 480  TRP B CH2 1 
ATOM   8108  N  N   . ASP B 1  383 ? -7.204  58.642  143.493 1.00 44.68  ? 481  ASP B N   1 
ATOM   8109  C  CA  . ASP B 1  383 ? -8.131  58.914  142.401 1.00 45.85  ? 481  ASP B CA  1 
ATOM   8110  C  C   . ASP B 1  383 ? -7.348  59.326  141.161 1.00 45.59  ? 481  ASP B C   1 
ATOM   8111  O  O   . ASP B 1  383 ? -7.668  58.916  140.047 1.00 43.65  ? 481  ASP B O   1 
ATOM   8112  C  CB  . ASP B 1  383 ? -9.135  60.008  142.781 1.00 50.96  ? 481  ASP B CB  1 
ATOM   8113  C  CG  . ASP B 1  383 ? -10.243 59.500  143.685 1.00 51.51  ? 481  ASP B CG  1 
ATOM   8114  O  OD1 . ASP B 1  383 ? -10.677 58.343  143.506 1.00 54.12  ? 481  ASP B OD1 1 
ATOM   8115  O  OD2 . ASP B 1  383 ? -10.690 60.263  144.567 1.00 50.17  ? 481  ASP B OD2 1 
ATOM   8116  N  N   . THR B 1  384 ? -6.307  60.128  141.369 1.00 50.06  ? 482  THR B N   1 
ATOM   8117  C  CA  . THR B 1  384 ? -5.446  60.582  140.281 1.00 54.32  ? 482  THR B CA  1 
ATOM   8118  C  C   . THR B 1  384 ? -4.709  59.428  139.601 1.00 53.80  ? 482  THR B C   1 
ATOM   8119  O  O   . THR B 1  384 ? -4.801  59.272  138.384 1.00 54.52  ? 482  THR B O   1 
ATOM   8120  C  CB  . THR B 1  384 ? -4.415  61.615  140.775 1.00 58.25  ? 482  THR B CB  1 
ATOM   8121  O  OG1 . THR B 1  384 ? -5.097  62.741  141.341 1.00 61.12  ? 482  THR B OG1 1 
ATOM   8122  C  CG2 . THR B 1  384 ? -3.540  62.087  139.626 1.00 58.14  ? 482  THR B CG2 1 
ATOM   8123  N  N   . ILE B 1  385 ? -3.984  58.626  140.382 1.00 51.81  ? 483  ILE B N   1 
ATOM   8124  C  CA  . ILE B 1  385 ? -3.243  57.485  139.839 1.00 55.75  ? 483  ILE B CA  1 
ATOM   8125  C  C   . ILE B 1  385 ? -4.141  56.559  139.034 1.00 56.61  ? 483  ILE B C   1 
ATOM   8126  O  O   . ILE B 1  385 ? -3.784  56.126  137.936 1.00 58.06  ? 483  ILE B O   1 
ATOM   8127  C  CB  . ILE B 1  385 ? -2.575  56.650  140.948 1.00 58.78  ? 483  ILE B CB  1 
ATOM   8128  C  CG1 . ILE B 1  385 ? -1.562  57.484  141.719 1.00 64.67  ? 483  ILE B CG1 1 
ATOM   8129  C  CG2 . ILE B 1  385 ? -1.876  55.439  140.358 1.00 58.19  ? 483  ILE B CG2 1 
ATOM   8130  C  CD1 . ILE B 1  385 ? -1.098  56.812  142.974 1.00 66.98  ? 483  ILE B CD1 1 
ATOM   8131  N  N   . ARG B 1  386 ? -5.313  56.269  139.587 1.00 53.64  ? 484  ARG B N   1 
ATOM   8132  C  CA  . ARG B 1  386 ? -6.292  55.427  138.919 1.00 54.55  ? 484  ARG B CA  1 
ATOM   8133  C  C   . ARG B 1  386 ? -6.708  56.063  137.595 1.00 60.05  ? 484  ARG B C   1 
ATOM   8134  O  O   . ARG B 1  386 ? -6.806  55.383  136.573 1.00 65.57  ? 484  ARG B O   1 
ATOM   8135  C  CB  . ARG B 1  386 ? -7.500  55.197  139.829 1.00 48.92  ? 484  ARG B CB  1 
ATOM   8136  C  CG  . ARG B 1  386 ? -8.734  54.694  139.118 1.00 45.64  ? 484  ARG B CG  1 
ATOM   8137  C  CD  . ARG B 1  386 ? -9.753  55.808  139.008 1.00 49.58  ? 484  ARG B CD  1 
ATOM   8138  N  NE  . ARG B 1  386 ? -10.451 56.050  140.267 1.00 53.16  ? 484  ARG B NE  1 
ATOM   8139  C  CZ  . ARG B 1  386 ? -11.188 57.128  140.519 1.00 51.15  ? 484  ARG B CZ  1 
ATOM   8140  N  NH1 . ARG B 1  386 ? -11.313 58.079  139.605 1.00 47.57  ? 484  ARG B NH1 1 
ATOM   8141  N  NH2 . ARG B 1  386 ? -11.792 57.260  141.692 1.00 50.92  ? 484  ARG B NH2 1 
ATOM   8142  N  N   . ASP B 1  387 ? -6.947  57.371  137.621 1.00 58.09  ? 485  ASP B N   1 
ATOM   8143  C  CA  . ASP B 1  387 ? -7.284  58.114  136.413 1.00 63.39  ? 485  ASP B CA  1 
ATOM   8144  C  C   . ASP B 1  387 ? -6.118  58.124  135.424 1.00 70.17  ? 485  ASP B C   1 
ATOM   8145  O  O   . ASP B 1  387 ? -6.299  57.851  134.237 1.00 70.75  ? 485  ASP B O   1 
ATOM   8146  C  CB  . ASP B 1  387 ? -7.692  59.549  136.754 1.00 62.38  ? 485  ASP B CB  1 
ATOM   8147  C  CG  . ASP B 1  387 ? -9.017  59.623  137.488 1.00 58.82  ? 485  ASP B CG  1 
ATOM   8148  O  OD1 . ASP B 1  387 ? -9.798  58.653  137.411 1.00 59.53  ? 485  ASP B OD1 1 
ATOM   8149  O  OD2 . ASP B 1  387 ? -9.280  60.656  138.141 1.00 56.72  ? 485  ASP B OD2 1 
ATOM   8150  N  N   . GLN B 1  388 ? -4.926  58.444  135.920 1.00 74.41  ? 486  GLN B N   1 
ATOM   8151  C  CA  . GLN B 1  388 ? -3.748  58.600  135.069 1.00 78.60  ? 486  GLN B CA  1 
ATOM   8152  C  C   . GLN B 1  388 ? -3.338  57.303  134.372 1.00 76.89  ? 486  GLN B C   1 
ATOM   8153  O  O   . GLN B 1  388 ? -2.915  57.320  133.217 1.00 76.98  ? 486  GLN B O   1 
ATOM   8154  C  CB  . GLN B 1  388 ? -2.566  59.133  135.886 1.00 82.14  ? 486  GLN B CB  1 
ATOM   8155  C  CG  . GLN B 1  388 ? -2.754  60.542  136.436 1.00 86.54  ? 486  GLN B CG  1 
ATOM   8156  C  CD  . GLN B 1  388 ? -2.929  61.584  135.350 1.00 93.80  ? 486  GLN B CD  1 
ATOM   8157  O  OE1 . GLN B 1  388 ? -2.329  61.492  134.279 1.00 98.54  ? 486  GLN B OE1 1 
ATOM   8158  N  NE2 . GLN B 1  388 ? -3.756  62.588  135.623 1.00 94.26  ? 486  GLN B NE2 1 
ATOM   8159  N  N   . ILE B 1  389 ? -3.461  56.181  135.075 1.00 75.40  ? 487  ILE B N   1 
ATOM   8160  C  CA  . ILE B 1  389 ? -2.978  54.904  134.555 1.00 73.65  ? 487  ILE B CA  1 
ATOM   8161  C  C   . ILE B 1  389 ? -4.053  54.105  133.822 1.00 73.93  ? 487  ILE B C   1 
ATOM   8162  O  O   . ILE B 1  389 ? -3.851  53.675  132.685 1.00 78.04  ? 487  ILE B O   1 
ATOM   8163  C  CB  . ILE B 1  389 ? -2.399  54.026  135.682 1.00 68.06  ? 487  ILE B CB  1 
ATOM   8164  C  CG1 . ILE B 1  389 ? -1.174  54.700  136.301 1.00 67.45  ? 487  ILE B CG1 1 
ATOM   8165  C  CG2 . ILE B 1  389 ? -2.030  52.650  135.152 1.00 65.54  ? 487  ILE B CG2 1 
ATOM   8166  C  CD1 . ILE B 1  389 ? -0.500  53.873  137.373 1.00 66.44  ? 487  ILE B CD1 1 
ATOM   8167  N  N   . LEU B 1  390 ? -5.197  53.913  134.470 1.00 70.95  ? 488  LEU B N   1 
ATOM   8168  C  CA  . LEU B 1  390 ? -6.244  53.056  133.925 1.00 71.65  ? 488  LEU B CA  1 
ATOM   8169  C  C   . LEU B 1  390 ? -7.280  53.845  133.136 1.00 74.25  ? 488  LEU B C   1 
ATOM   8170  O  O   . LEU B 1  390 ? -7.832  53.353  132.152 1.00 76.88  ? 488  LEU B O   1 
ATOM   8171  C  CB  . LEU B 1  390 ? -6.934  52.285  135.050 1.00 71.68  ? 488  LEU B CB  1 
ATOM   8172  C  CG  . LEU B 1  390 ? -6.039  51.390  135.908 1.00 72.17  ? 488  LEU B CG  1 
ATOM   8173  C  CD1 . LEU B 1  390 ? -6.834  50.786  137.052 1.00 70.10  ? 488  LEU B CD1 1 
ATOM   8174  C  CD2 . LEU B 1  390 ? -5.390  50.305  135.065 1.00 72.73  ? 488  LEU B CD2 1 
ATOM   8175  N  N   . GLY B 1  391 ? -7.546  55.068  133.579 1.00 73.26  ? 489  GLY B N   1 
ATOM   8176  C  CA  . GLY B 1  391 ? -8.571  55.891  132.968 1.00 70.75  ? 489  GLY B CA  1 
ATOM   8177  C  C   . GLY B 1  391 ? -9.509  56.438  134.022 1.00 67.45  ? 489  GLY B C   1 
ATOM   8178  O  O   . GLY B 1  391 ? -9.511  55.973  135.161 1.00 67.25  ? 489  GLY B O   1 
ATOM   8179  N  N   . LYS B 1  392 ? -10.313 57.425  133.646 1.00 65.41  ? 490  LYS B N   1 
ATOM   8180  C  CA  . LYS B 1  392 ? -11.253 58.020  134.584 1.00 62.45  ? 490  LYS B CA  1 
ATOM   8181  C  C   . LYS B 1  392 ? -12.611 57.340  134.481 1.00 63.23  ? 490  LYS B C   1 
ATOM   8182  O  O   . LYS B 1  392 ? -13.229 57.340  133.416 1.00 66.35  ? 490  LYS B O   1 
ATOM   8183  C  CB  . LYS B 1  392 ? -11.389 59.521  134.329 1.00 62.59  ? 490  LYS B CB  1 
ATOM   8184  C  CG  . LYS B 1  392 ? -12.214 60.261  135.371 1.00 64.10  ? 490  LYS B CG  1 
ATOM   8185  C  CD  . LYS B 1  392 ? -12.187 61.762  135.124 1.00 69.43  ? 490  LYS B CD  1 
ATOM   8186  C  CE  . LYS B 1  392 ? -12.950 62.515  136.200 1.00 69.58  ? 490  LYS B CE  1 
ATOM   8187  N  NZ  . LYS B 1  392 ? -12.852 63.990  136.016 1.00 70.57  ? 490  LYS B NZ  1 
ATOM   8188  N  N   . PRO B 1  393 ? -13.069 56.744  135.591 1.00 60.11  ? 491  PRO B N   1 
ATOM   8189  C  CA  . PRO B 1  393 ? -14.382 56.098  135.678 1.00 58.51  ? 491  PRO B CA  1 
ATOM   8190  C  C   . PRO B 1  393 ? -15.496 57.056  135.295 1.00 61.57  ? 491  PRO B C   1 
ATOM   8191  O  O   . PRO B 1  393 ? -15.476 58.212  135.719 1.00 63.77  ? 491  PRO B O   1 
ATOM   8192  C  CB  . PRO B 1  393 ? -14.492 55.705  137.154 1.00 54.84  ? 491  PRO B CB  1 
ATOM   8193  C  CG  . PRO B 1  393 ? -13.098 55.631  137.638 1.00 54.51  ? 491  PRO B CG  1 
ATOM   8194  C  CD  . PRO B 1  393 ? -12.316 56.638  136.850 1.00 56.47  ? 491  PRO B CD  1 
ATOM   8195  N  N   . SER B 1  394 ? -16.450 56.581  134.502 1.00 59.24  ? 492  SER B N   1 
ATOM   8196  C  CA  . SER B 1  394 ? -17.604 57.386  134.131 1.00 52.36  ? 492  SER B CA  1 
ATOM   8197  C  C   . SER B 1  394 ? -18.402 57.786  135.365 1.00 48.64  ? 492  SER B C   1 
ATOM   8198  O  O   . SER B 1  394 ? -18.238 57.204  136.435 1.00 45.75  ? 492  SER B O   1 
ATOM   8199  C  CB  . SER B 1  394 ? -18.494 56.620  133.150 1.00 50.06  ? 492  SER B CB  1 
ATOM   8200  O  OG  . SER B 1  394 ? -19.033 55.459  133.759 1.00 46.60  ? 492  SER B OG  1 
ATOM   8201  N  N   . GLU B 1  395 ? -19.266 58.782  135.214 1.00 51.49  ? 493  GLU B N   1 
ATOM   8202  C  CA  . GLU B 1  395 ? -20.084 59.234  136.328 1.00 53.25  ? 493  GLU B CA  1 
ATOM   8203  C  C   . GLU B 1  395 ? -21.184 58.219  136.613 1.00 51.51  ? 493  GLU B C   1 
ATOM   8204  O  O   . GLU B 1  395 ? -21.688 58.131  137.733 1.00 51.22  ? 493  GLU B O   1 
ATOM   8205  C  CB  . GLU B 1  395 ? -20.682 60.612  136.042 1.00 57.10  ? 493  GLU B CB  1 
ATOM   8206  C  CG  . GLU B 1  395 ? -19.668 61.744  136.100 1.00 64.15  ? 493  GLU B CG  1 
ATOM   8207  C  CD  . GLU B 1  395 ? -19.076 61.930  137.488 1.00 71.16  ? 493  GLU B CD  1 
ATOM   8208  O  OE1 . GLU B 1  395 ? -19.758 61.591  138.479 1.00 74.25  ? 493  GLU B OE1 1 
ATOM   8209  O  OE2 . GLU B 1  395 ? -17.929 62.415  137.588 1.00 72.95  ? 493  GLU B OE2 1 
ATOM   8210  N  N   . GLU B 1  396 ? -21.542 57.448  135.592 1.00 51.31  ? 494  GLU B N   1 
ATOM   8211  C  CA  . GLU B 1  396 ? -22.553 56.409  135.730 1.00 50.51  ? 494  GLU B CA  1 
ATOM   8212  C  C   . GLU B 1  396 ? -22.094 55.322  136.698 1.00 46.06  ? 494  GLU B C   1 
ATOM   8213  O  O   . GLU B 1  396 ? -22.841 54.917  137.586 1.00 45.04  ? 494  GLU B O   1 
ATOM   8214  C  CB  . GLU B 1  396 ? -22.874 55.790  134.367 1.00 55.51  ? 494  GLU B CB  1 
ATOM   8215  C  CG  . GLU B 1  396 ? -23.655 56.701  133.429 1.00 64.70  ? 494  GLU B CG  1 
ATOM   8216  C  CD  . GLU B 1  396 ? -22.756 57.647  132.643 1.00 73.05  ? 494  GLU B CD  1 
ATOM   8217  O  OE1 . GLU B 1  396 ? -21.554 57.748  132.973 1.00 69.16  ? 494  GLU B OE1 1 
ATOM   8218  O  OE2 . GLU B 1  396 ? -23.253 58.290  131.693 1.00 79.64  ? 494  GLU B OE2 1 
ATOM   8219  N  N   . ILE B 1  397 ? -20.858 54.861  136.527 1.00 43.85  ? 495  ILE B N   1 
ATOM   8220  C  CA  . ILE B 1  397 ? -20.333 53.763  137.333 1.00 42.33  ? 495  ILE B CA  1 
ATOM   8221  C  C   . ILE B 1  397 ? -20.006 54.224  138.755 1.00 44.76  ? 495  ILE B C   1 
ATOM   8222  O  O   . ILE B 1  397 ? -20.088 53.441  139.700 1.00 44.40  ? 495  ILE B O   1 
ATOM   8223  C  CB  . ILE B 1  397 ? -19.082 53.123  136.675 1.00 39.66  ? 495  ILE B CB  1 
ATOM   8224  C  CG1 . ILE B 1  397 ? -18.776 51.761  137.305 1.00 35.82  ? 495  ILE B CG1 1 
ATOM   8225  C  CG2 . ILE B 1  397 ? -17.871 54.036  136.772 1.00 40.59  ? 495  ILE B CG2 1 
ATOM   8226  C  CD1 . ILE B 1  397 ? -17.707 50.978  136.576 1.00 32.83  ? 495  ILE B CD1 1 
ATOM   8227  N  N   . LYS B 1  398 ? -19.647 55.495  138.907 1.00 48.36  ? 496  LYS B N   1 
ATOM   8228  C  CA  . LYS B 1  398 ? -19.378 56.058  140.226 1.00 45.65  ? 496  LYS B CA  1 
ATOM   8229  C  C   . LYS B 1  398 ? -20.671 56.179  141.021 1.00 45.05  ? 496  LYS B C   1 
ATOM   8230  O  O   . LYS B 1  398 ? -20.715 55.860  142.209 1.00 43.82  ? 496  LYS B O   1 
ATOM   8231  C  CB  . LYS B 1  398 ? -18.697 57.423  140.099 1.00 45.92  ? 496  LYS B CB  1 
ATOM   8232  C  CG  . LYS B 1  398 ? -17.282 57.355  139.547 1.00 50.55  ? 496  LYS B CG  1 
ATOM   8233  C  CD  . LYS B 1  398 ? -16.732 58.739  139.235 1.00 56.01  ? 496  LYS B CD  1 
ATOM   8234  C  CE  . LYS B 1  398 ? -16.745 59.640  140.456 1.00 58.20  ? 496  LYS B CE  1 
ATOM   8235  N  NZ  . LYS B 1  398 ? -16.215 60.996  140.142 1.00 58.70  ? 496  LYS B NZ  1 
ATOM   8236  N  N   . GLU B 1  399 ? -21.724 56.634  140.351 1.00 44.92  ? 497  GLU B N   1 
ATOM   8237  C  CA  . GLU B 1  399 ? -23.021 56.830  140.988 1.00 44.83  ? 497  GLU B CA  1 
ATOM   8238  C  C   . GLU B 1  399 ? -23.694 55.497  141.283 1.00 40.39  ? 497  GLU B C   1 
ATOM   8239  O  O   . GLU B 1  399 ? -24.377 55.344  142.296 1.00 41.41  ? 497  GLU B O   1 
ATOM   8240  C  CB  . GLU B 1  399 ? -23.928 57.687  140.105 1.00 47.81  ? 497  GLU B CB  1 
ATOM   8241  C  CG  . GLU B 1  399 ? -25.212 58.133  140.785 1.00 50.65  ? 497  GLU B CG  1 
ATOM   8242  C  CD  . GLU B 1  399 ? -24.966 59.049  141.969 1.00 53.90  ? 497  GLU B CD  1 
ATOM   8243  O  OE1 . GLU B 1  399 ? -24.039 59.884  141.897 1.00 54.53  ? 497  GLU B OE1 1 
ATOM   8244  O  OE2 . GLU B 1  399 ? -25.705 58.937  142.970 1.00 54.80  ? 497  GLU B OE2 1 
ATOM   8245  N  N   . CYS B 1  400 ? -23.493 54.535  140.391 1.00 34.18  ? 498  CYS B N   1 
ATOM   8246  C  CA  . CYS B 1  400 ? -24.093 53.218  140.540 1.00 27.78  ? 498  CYS B CA  1 
ATOM   8247  C  C   . CYS B 1  400 ? -23.505 52.475  141.736 1.00 31.31  ? 498  CYS B C   1 
ATOM   8248  O  O   . CYS B 1  400 ? -24.195 51.694  142.390 1.00 35.36  ? 498  CYS B O   1 
ATOM   8249  C  CB  . CYS B 1  400 ? -23.896 52.402  139.261 1.00 23.19  ? 498  CYS B CB  1 
ATOM   8250  S  SG  . CYS B 1  400 ? -24.845 50.870  139.184 1.00 41.31  ? 498  CYS B SG  1 
ATOM   8251  N  N   . HIS B 1  401 ? -22.234 52.734  142.027 1.00 31.12  ? 499  HIS B N   1 
ATOM   8252  C  CA  . HIS B 1  401 ? -21.517 51.987  143.056 1.00 25.28  ? 499  HIS B CA  1 
ATOM   8253  C  C   . HIS B 1  401 ? -21.557 52.621  144.444 1.00 27.63  ? 499  HIS B C   1 
ATOM   8254  O  O   . HIS B 1  401 ? -21.147 51.988  145.415 1.00 29.03  ? 499  HIS B O   1 
ATOM   8255  C  CB  . HIS B 1  401 ? -20.059 51.794  142.639 1.00 21.48  ? 499  HIS B CB  1 
ATOM   8256  C  CG  . HIS B 1  401 ? -19.836 50.608  141.756 1.00 21.76  ? 499  HIS B CG  1 
ATOM   8257  N  ND1 . HIS B 1  401 ? -19.617 49.342  142.256 1.00 21.13  ? 499  HIS B ND1 1 
ATOM   8258  C  CD2 . HIS B 1  401 ? -19.802 50.491  140.407 1.00 24.41  ? 499  HIS B CD2 1 
ATOM   8259  C  CE1 . HIS B 1  401 ? -19.455 48.498  141.253 1.00 20.08  ? 499  HIS B CE1 1 
ATOM   8260  N  NE2 . HIS B 1  401 ? -19.563 49.169  140.121 1.00 21.04  ? 499  HIS B NE2 1 
ATOM   8261  N  N   . LYS B 1  402 ? -22.046 53.857  144.539 1.00 28.22  ? 500  LYS B N   1 
ATOM   8262  C  CA  . LYS B 1  402 ? -22.099 54.570  145.818 1.00 30.52  ? 500  LYS B CA  1 
ATOM   8263  C  C   . LYS B 1  402 ? -22.755 53.741  146.921 1.00 30.91  ? 500  LYS B C   1 
ATOM   8264  O  O   . LYS B 1  402 ? -23.697 52.992  146.660 1.00 33.52  ? 500  LYS B O   1 
ATOM   8265  C  CB  . LYS B 1  402 ? -22.832 55.906  145.658 1.00 34.48  ? 500  LYS B CB  1 
ATOM   8266  C  CG  . LYS B 1  402 ? -21.967 57.015  145.080 1.00 43.02  ? 500  LYS B CG  1 
ATOM   8267  C  CD  . LYS B 1  402 ? -22.644 58.371  145.203 1.00 49.97  ? 500  LYS B CD  1 
ATOM   8268  C  CE  . LYS B 1  402 ? -21.774 59.481  144.630 1.00 54.41  ? 500  LYS B CE  1 
ATOM   8269  N  NZ  . LYS B 1  402 ? -21.277 59.168  143.264 1.00 56.93  ? 500  LYS B NZ  1 
ATOM   8270  N  N   . PRO B 1  403 ? -22.257 53.871  148.163 1.00 26.45  ? 501  PRO B N   1 
ATOM   8271  C  CA  . PRO B 1  403 ? -21.197 54.792  148.592 1.00 26.55  ? 501  PRO B CA  1 
ATOM   8272  C  C   . PRO B 1  403 ? -19.772 54.256  148.429 1.00 29.98  ? 501  PRO B C   1 
ATOM   8273  O  O   . PRO B 1  403 ? -18.861 54.769  149.079 1.00 33.46  ? 501  PRO B O   1 
ATOM   8274  C  CB  . PRO B 1  403 ? -21.515 55.001  150.071 1.00 25.03  ? 501  PRO B CB  1 
ATOM   8275  C  CG  . PRO B 1  403 ? -22.081 53.692  150.495 1.00 25.18  ? 501  PRO B CG  1 
ATOM   8276  C  CD  . PRO B 1  403 ? -22.838 53.144  149.307 1.00 23.88  ? 501  PRO B CD  1 
ATOM   8277  N  N   . LYS B 1  404 ? -19.584 53.242  147.591 1.00 28.21  ? 502  LYS B N   1 
ATOM   8278  C  CA  . LYS B 1  404 ? -18.251 52.702  147.338 1.00 25.74  ? 502  LYS B CA  1 
ATOM   8279  C  C   . LYS B 1  404 ? -17.393 53.659  146.515 1.00 25.93  ? 502  LYS B C   1 
ATOM   8280  O  O   . LYS B 1  404 ? -17.774 54.043  145.411 1.00 30.82  ? 502  LYS B O   1 
ATOM   8281  C  CB  . LYS B 1  404 ? -18.343 51.356  146.617 1.00 19.72  ? 502  LYS B CB  1 
ATOM   8282  C  CG  . LYS B 1  404 ? -17.003 50.820  146.142 1.00 19.71  ? 502  LYS B CG  1 
ATOM   8283  C  CD  . LYS B 1  404 ? -17.167 49.809  145.017 1.00 19.49  ? 502  LYS B CD  1 
ATOM   8284  C  CE  . LYS B 1  404 ? -17.793 48.516  145.512 1.00 18.49  ? 502  LYS B CE  1 
ATOM   8285  N  NZ  . LYS B 1  404 ? -18.066 47.570  144.393 1.00 18.37  ? 502  LYS B NZ  1 
ATOM   8286  N  N   . PRO B 1  405 ? -16.226 54.046  147.052 1.00 25.42  ? 503  PRO B N   1 
ATOM   8287  C  CA  . PRO B 1  405 ? -15.260 54.826  146.270 1.00 27.29  ? 503  PRO B CA  1 
ATOM   8288  C  C   . PRO B 1  405 ? -14.422 53.912  145.380 1.00 24.79  ? 503  PRO B C   1 
ATOM   8289  O  O   . PRO B 1  405 ? -13.729 53.026  145.880 1.00 26.90  ? 503  PRO B O   1 
ATOM   8290  C  CB  . PRO B 1  405 ? -14.404 55.503  147.341 1.00 22.96  ? 503  PRO B CB  1 
ATOM   8291  C  CG  . PRO B 1  405 ? -14.472 54.584  148.515 1.00 26.18  ? 503  PRO B CG  1 
ATOM   8292  C  CD  . PRO B 1  405 ? -15.784 53.838  148.442 1.00 24.82  ? 503  PRO B CD  1 
ATOM   8293  N  N   . ILE B 1  406 ? -14.488 54.126  144.071 1.00 23.23  ? 504  ILE B N   1 
ATOM   8294  C  CA  . ILE B 1  406 ? -13.875 53.205  143.121 1.00 28.02  ? 504  ILE B CA  1 
ATOM   8295  C  C   . ILE B 1  406 ? -12.357 53.345  143.056 1.00 28.91  ? 504  ILE B C   1 
ATOM   8296  O  O   . ILE B 1  406 ? -11.826 54.431  142.814 1.00 26.64  ? 504  ILE B O   1 
ATOM   8297  C  CB  . ILE B 1  406 ? -14.458 53.397  141.704 1.00 30.65  ? 504  ILE B CB  1 
ATOM   8298  C  CG1 . ILE B 1  406 ? -15.924 52.959  141.671 1.00 23.28  ? 504  ILE B CG1 1 
ATOM   8299  C  CG2 . ILE B 1  406 ? -13.652 52.616  140.679 1.00 27.75  ? 504  ILE B CG2 1 
ATOM   8300  C  CD1 . ILE B 1  406 ? -16.567 53.081  140.309 1.00 23.98  ? 504  ILE B CD1 1 
ATOM   8301  N  N   . LEU B 1  407 ? -11.668 52.229  143.275 1.00 29.37  ? 505  LEU B N   1 
ATOM   8302  C  CA  . LEU B 1  407 ? -10.223 52.163  143.112 1.00 32.20  ? 505  LEU B CA  1 
ATOM   8303  C  C   . LEU B 1  407 ? -9.889  51.566  141.750 1.00 37.05  ? 505  LEU B C   1 
ATOM   8304  O  O   . LEU B 1  407 ? -9.042  52.084  141.022 1.00 37.19  ? 505  LEU B O   1 
ATOM   8305  C  CB  . LEU B 1  407 ? -9.583  51.336  144.229 1.00 27.58  ? 505  LEU B CB  1 
ATOM   8306  C  CG  . LEU B 1  407 ? -8.055  51.261  144.209 1.00 27.29  ? 505  LEU B CG  1 
ATOM   8307  C  CD1 . LEU B 1  407 ? -7.447  52.631  144.457 1.00 25.51  ? 505  LEU B CD1 1 
ATOM   8308  C  CD2 . LEU B 1  407 ? -7.553  50.256  145.233 1.00 22.67  ? 505  LEU B CD2 1 
ATOM   8309  N  N   . LEU B 1  408 ? -10.566 50.474  141.410 1.00 37.36  ? 506  LEU B N   1 
ATOM   8310  C  CA  . LEU B 1  408 ? -10.393 49.834  140.112 1.00 34.37  ? 506  LEU B CA  1 
ATOM   8311  C  C   . LEU B 1  408 ? -11.738 49.675  139.418 1.00 34.60  ? 506  LEU B C   1 
ATOM   8312  O  O   . LEU B 1  408 ? -12.602 48.939  139.891 1.00 34.03  ? 506  LEU B O   1 
ATOM   8313  C  CB  . LEU B 1  408 ? -9.724  48.466  140.261 1.00 31.26  ? 506  LEU B CB  1 
ATOM   8314  C  CG  . LEU B 1  408 ? -8.383  48.385  140.992 1.00 27.10  ? 506  LEU B CG  1 
ATOM   8315  C  CD1 . LEU B 1  408 ? -7.979  46.932  141.195 1.00 23.26  ? 506  LEU B CD1 1 
ATOM   8316  C  CD2 . LEU B 1  408 ? -7.307  49.148  140.242 1.00 26.15  ? 506  LEU B CD2 1 
ATOM   8317  N  N   . HIS B 1  409 ? -11.912 50.365  138.296 1.00 38.68  ? 507  HIS B N   1 
ATOM   8318  C  CA  . HIS B 1  409 ? -13.141 50.257  137.518 1.00 44.17  ? 507  HIS B CA  1 
ATOM   8319  C  C   . HIS B 1  409 ? -12.979 49.185  136.441 1.00 47.04  ? 507  HIS B C   1 
ATOM   8320  O  O   . HIS B 1  409 ? -12.960 49.477  135.245 1.00 48.13  ? 507  HIS B O   1 
ATOM   8321  C  CB  . HIS B 1  409 ? -13.515 51.607  136.899 1.00 46.91  ? 507  HIS B CB  1 
ATOM   8322  C  CG  . HIS B 1  409 ? -12.417 52.234  136.097 1.00 54.15  ? 507  HIS B CG  1 
ATOM   8323  N  ND1 . HIS B 1  409 ? -12.384 52.189  134.720 1.00 58.52  ? 507  HIS B ND1 1 
ATOM   8324  C  CD2 . HIS B 1  409 ? -11.312 52.917  136.477 1.00 57.30  ? 507  HIS B CD2 1 
ATOM   8325  C  CE1 . HIS B 1  409 ? -11.307 52.820  134.286 1.00 62.83  ? 507  HIS B CE1 1 
ATOM   8326  N  NE2 . HIS B 1  409 ? -10.639 53.271  135.332 1.00 62.42  ? 507  HIS B NE2 1 
ATOM   8327  N  N   . THR B 1  410 ? -12.870 47.938  136.892 1.00 48.50  ? 508  THR B N   1 
ATOM   8328  C  CA  . THR B 1  410 ? -12.580 46.792  136.032 1.00 52.07  ? 508  THR B CA  1 
ATOM   8329  C  C   . THR B 1  410 ? -13.600 46.598  134.910 1.00 56.17  ? 508  THR B C   1 
ATOM   8330  O  O   . THR B 1  410 ? -13.284 46.027  133.864 1.00 57.67  ? 508  THR B O   1 
ATOM   8331  C  CB  . THR B 1  410 ? -12.506 45.498  136.863 1.00 47.96  ? 508  THR B CB  1 
ATOM   8332  O  OG1 . THR B 1  410 ? -13.729 45.324  137.589 1.00 46.23  ? 508  THR B OG1 1 
ATOM   8333  C  CG2 . THR B 1  410 ? -11.352 45.567  137.847 1.00 46.17  ? 508  THR B CG2 1 
ATOM   8334  N  N   . GLY B 1  411 ? -14.824 47.063  135.137 1.00 57.66  ? 509  GLY B N   1 
ATOM   8335  C  CA  . GLY B 1  411 ? -15.880 46.960  134.146 1.00 59.62  ? 509  GLY B CA  1 
ATOM   8336  C  C   . GLY B 1  411 ? -15.623 47.796  132.909 1.00 63.59  ? 509  GLY B C   1 
ATOM   8337  O  O   . GLY B 1  411 ? -16.224 47.569  131.859 1.00 65.82  ? 509  GLY B O   1 
ATOM   8338  N  N   . GLU B 1  412 ? -14.723 48.767  133.033 1.00 63.92  ? 510  GLU B N   1 
ATOM   8339  C  CA  . GLU B 1  412 ? -14.391 49.652  131.925 1.00 64.00  ? 510  GLU B CA  1 
ATOM   8340  C  C   . GLU B 1  412 ? -12.918 49.529  131.539 1.00 63.60  ? 510  GLU B C   1 
ATOM   8341  O  O   . GLU B 1  412 ? -12.324 50.463  131.000 1.00 63.55  ? 510  GLU B O   1 
ATOM   8342  C  CB  . GLU B 1  412 ? -14.734 51.097  132.293 1.00 64.92  ? 510  GLU B CB  1 
ATOM   8343  C  CG  . GLU B 1  412 ? -16.213 51.316  132.588 1.00 63.88  ? 510  GLU B CG  1 
ATOM   8344  C  CD  . GLU B 1  412 ? -16.519 52.716  133.086 1.00 66.17  ? 510  GLU B CD  1 
ATOM   8345  O  OE1 . GLU B 1  412 ? -15.566 53.475  133.358 1.00 66.34  ? 510  GLU B OE1 1 
ATOM   8346  O  OE2 . GLU B 1  412 ? -17.715 53.056  133.208 1.00 67.27  ? 510  GLU B OE2 1 
ATOM   8347  N  N   . LEU B 1  413 ? -12.341 48.364  131.819 1.00 63.49  ? 511  LEU B N   1 
ATOM   8348  C  CA  . LEU B 1  413 ? -10.958 48.059  131.459 1.00 63.33  ? 511  LEU B CA  1 
ATOM   8349  C  C   . LEU B 1  413 ? -10.889 46.726  130.717 1.00 62.42  ? 511  LEU B C   1 
ATOM   8350  O  O   . LEU B 1  413 ? -11.178 45.677  131.294 1.00 61.37  ? 511  LEU B O   1 
ATOM   8351  C  CB  . LEU B 1  413 ? -10.074 48.023  132.707 1.00 62.89  ? 511  LEU B CB  1 
ATOM   8352  C  CG  . LEU B 1  413 ? -9.984  49.325  133.507 1.00 64.77  ? 511  LEU B CG  1 
ATOM   8353  C  CD1 . LEU B 1  413 ? -9.279  49.096  134.835 1.00 65.02  ? 511  LEU B CD1 1 
ATOM   8354  C  CD2 . LEU B 1  413 ? -9.279  50.405  132.700 1.00 66.81  ? 511  LEU B CD2 1 
ATOM   8355  N  N   . SER B 1  414 ? -10.509 46.762  129.442 1.00 64.26  ? 512  SER B N   1 
ATOM   8356  C  CA  . SER B 1  414 ? -10.620 45.576  128.595 1.00 66.07  ? 512  SER B CA  1 
ATOM   8357  C  C   . SER B 1  414 ? -9.330  45.188  127.865 1.00 70.46  ? 512  SER B C   1 
ATOM   8358  O  O   . SER B 1  414 ? -9.366  44.399  126.920 1.00 73.39  ? 512  SER B O   1 
ATOM   8359  C  CB  . SER B 1  414 ? -11.737 45.780  127.567 1.00 66.92  ? 512  SER B CB  1 
ATOM   8360  O  OG  . SER B 1  414 ? -11.532 46.969  126.823 1.00 69.43  ? 512  SER B OG  1 
ATOM   8361  N  N   . LYS B 1  415 ? -8.198  45.736  128.297 1.00 71.24  ? 513  LYS B N   1 
ATOM   8362  C  CA  . LYS B 1  415 ? -6.907  45.398  127.696 1.00 76.30  ? 513  LYS B CA  1 
ATOM   8363  C  C   . LYS B 1  415 ? -5.991  44.705  128.701 1.00 76.97  ? 513  LYS B C   1 
ATOM   8364  O  O   . LYS B 1  415 ? -5.821  45.186  129.820 1.00 75.71  ? 513  LYS B O   1 
ATOM   8365  C  CB  . LYS B 1  415 ? -6.219  46.643  127.127 1.00 80.29  ? 513  LYS B CB  1 
ATOM   8366  C  CG  . LYS B 1  415 ? -6.915  47.243  125.916 1.00 83.06  ? 513  LYS B CG  1 
ATOM   8367  C  CD  . LYS B 1  415 ? -6.513  46.495  124.647 1.00 83.71  ? 513  LYS B CD  1 
ATOM   8368  C  CE  . LYS B 1  415 ? -7.337  46.926  123.444 1.00 82.95  ? 513  LYS B CE  1 
ATOM   8369  N  NZ  . LYS B 1  415 ? -6.915  46.213  122.207 1.00 82.07  ? 513  LYS B NZ  1 
ATOM   8370  N  N   . PRO B 1  416 ? -5.394  43.566  128.304 1.00 78.44  ? 514  PRO B N   1 
ATOM   8371  C  CA  . PRO B 1  416 ? -5.556  42.898  127.004 1.00 80.33  ? 514  PRO B CA  1 
ATOM   8372  C  C   . PRO B 1  416 ? -6.909  42.204  126.867 1.00 80.09  ? 514  PRO B C   1 
ATOM   8373  O  O   . PRO B 1  416 ? -7.452  42.105  125.767 1.00 82.08  ? 514  PRO B O   1 
ATOM   8374  C  CB  . PRO B 1  416 ? -4.418  41.875  126.995 1.00 81.56  ? 514  PRO B CB  1 
ATOM   8375  C  CG  . PRO B 1  416 ? -4.193  41.565  128.431 1.00 79.59  ? 514  PRO B CG  1 
ATOM   8376  C  CD  . PRO B 1  416 ? -4.448  42.846  129.176 1.00 78.73  ? 514  PRO B CD  1 
ATOM   8377  N  N   . HIS B 1  417 ? -7.433  41.726  127.989 1.00 77.41  ? 515  HIS B N   1 
ATOM   8378  C  CA  . HIS B 1  417 ? -8.761  41.137  128.044 1.00 74.50  ? 515  HIS B CA  1 
ATOM   8379  C  C   . HIS B 1  417 ? -9.545  41.831  129.154 1.00 73.14  ? 515  HIS B C   1 
ATOM   8380  O  O   . HIS B 1  417 ? -8.944  42.499  129.996 1.00 75.46  ? 515  HIS B O   1 
ATOM   8381  C  CB  . HIS B 1  417 ? -8.675  39.625  128.281 1.00 71.31  ? 515  HIS B CB  1 
ATOM   8382  C  CG  . HIS B 1  417 ? -7.980  38.882  127.184 1.00 70.93  ? 515  HIS B CG  1 
ATOM   8383  N  ND1 . HIS B 1  417 ? -8.585  38.598  125.978 1.00 71.27  ? 515  HIS B ND1 1 
ATOM   8384  C  CD2 . HIS B 1  417 ? -6.733  38.361  127.111 1.00 70.92  ? 515  HIS B CD2 1 
ATOM   8385  C  CE1 . HIS B 1  417 ? -7.739  37.937  125.209 1.00 72.18  ? 515  HIS B CE1 1 
ATOM   8386  N  NE2 . HIS B 1  417 ? -6.608  37.779  125.872 1.00 72.00  ? 515  HIS B NE2 1 
ATOM   8387  N  N   . PRO B 1  418 ? -10.886 41.710  129.139 1.00 68.61  ? 516  PRO B N   1 
ATOM   8388  C  CA  . PRO B 1  418 ? -11.712 42.232  130.234 1.00 65.15  ? 516  PRO B CA  1 
ATOM   8389  C  C   . PRO B 1  418 ? -11.167 41.846  131.609 1.00 59.66  ? 516  PRO B C   1 
ATOM   8390  O  O   . PRO B 1  418 ? -10.824 40.685  131.834 1.00 59.37  ? 516  PRO B O   1 
ATOM   8391  C  CB  . PRO B 1  418 ? -13.070 41.581  129.980 1.00 64.94  ? 516  PRO B CB  1 
ATOM   8392  C  CG  . PRO B 1  418 ? -13.129 41.442  128.499 1.00 66.73  ? 516  PRO B CG  1 
ATOM   8393  C  CD  . PRO B 1  418 ? -11.711 41.222  128.019 1.00 68.09  ? 516  PRO B CD  1 
ATOM   8394  N  N   . TRP B 1  419 ? -11.087 42.817  132.512 1.00 53.91  ? 517  TRP B N   1 
ATOM   8395  C  CA  . TRP B 1  419 ? -10.470 42.601  133.814 1.00 52.22  ? 517  TRP B CA  1 
ATOM   8396  C  C   . TRP B 1  419 ? -11.352 41.763  134.733 1.00 52.45  ? 517  TRP B C   1 
ATOM   8397  O  O   . TRP B 1  419 ? -10.866 40.865  135.422 1.00 51.37  ? 517  TRP B O   1 
ATOM   8398  C  CB  . TRP B 1  419 ? -10.156 43.942  134.479 1.00 53.47  ? 517  TRP B CB  1 
ATOM   8399  C  CG  . TRP B 1  419 ? -8.940  44.623  133.934 1.00 62.13  ? 517  TRP B CG  1 
ATOM   8400  C  CD1 . TRP B 1  419 ? -8.559  44.704  132.627 1.00 66.33  ? 517  TRP B CD1 1 
ATOM   8401  C  CD2 . TRP B 1  419 ? -7.938  45.315  134.688 1.00 63.88  ? 517  TRP B CD2 1 
ATOM   8402  N  NE1 . TRP B 1  419 ? -7.383  45.406  132.518 1.00 65.91  ? 517  TRP B NE1 1 
ATOM   8403  C  CE2 . TRP B 1  419 ? -6.981  45.793  133.770 1.00 63.83  ? 517  TRP B CE2 1 
ATOM   8404  C  CE3 . TRP B 1  419 ? -7.757  45.579  136.049 1.00 62.64  ? 517  TRP B CE3 1 
ATOM   8405  C  CZ2 . TRP B 1  419 ? -5.861  46.518  134.170 1.00 62.41  ? 517  TRP B CZ2 1 
ATOM   8406  C  CZ3 . TRP B 1  419 ? -6.645  46.299  136.443 1.00 61.17  ? 517  TRP B CZ3 1 
ATOM   8407  C  CH2 . TRP B 1  419 ? -5.711  46.760  135.508 1.00 61.51  ? 517  TRP B CH2 1 
ATOM   8408  N  N   . HIS B 1  420 ? -12.649 42.049  134.735 1.00 53.09  ? 518  HIS B N   1 
ATOM   8409  C  CA  . HIS B 1  420 ? -13.597 41.262  135.512 1.00 49.96  ? 518  HIS B CA  1 
ATOM   8410  C  C   . HIS B 1  420 ? -14.689 40.702  134.609 1.00 45.92  ? 518  HIS B C   1 
ATOM   8411  O  O   . HIS B 1  420 ? -14.998 41.285  133.569 1.00 48.60  ? 518  HIS B O   1 
ATOM   8412  C  CB  . HIS B 1  420 ? -14.205 42.112  136.629 1.00 51.65  ? 518  HIS B CB  1 
ATOM   8413  C  CG  . HIS B 1  420 ? -13.458 42.026  137.924 1.00 57.88  ? 518  HIS B CG  1 
ATOM   8414  N  ND1 . HIS B 1  420 ? -13.636 42.930  138.949 1.00 60.32  ? 518  HIS B ND1 1 
ATOM   8415  C  CD2 . HIS B 1  420 ? -12.529 41.142  138.359 1.00 61.44  ? 518  HIS B CD2 1 
ATOM   8416  C  CE1 . HIS B 1  420 ? -12.851 42.606  139.961 1.00 61.69  ? 518  HIS B CE1 1 
ATOM   8417  N  NE2 . HIS B 1  420 ? -12.168 41.525  139.628 1.00 62.23  ? 518  HIS B NE2 1 
ATOM   8418  N  N   . PRO B 1  421 ? -15.289 39.570  135.010 1.00 39.21  ? 519  PRO B N   1 
ATOM   8419  C  CA  . PRO B 1  421 ? -16.342 38.974  134.183 1.00 36.91  ? 519  PRO B CA  1 
ATOM   8420  C  C   . PRO B 1  421 ? -17.641 39.770  134.215 1.00 36.60  ? 519  PRO B C   1 
ATOM   8421  O  O   . PRO B 1  421 ? -17.969 40.392  135.226 1.00 33.90  ? 519  PRO B O   1 
ATOM   8422  C  CB  . PRO B 1  421 ? -16.541 37.589  134.808 1.00 34.18  ? 519  PRO B CB  1 
ATOM   8423  C  CG  . PRO B 1  421 ? -16.074 37.732  136.213 1.00 34.15  ? 519  PRO B CG  1 
ATOM   8424  C  CD  . PRO B 1  421 ? -14.967 38.744  136.188 1.00 36.40  ? 519  PRO B CD  1 
ATOM   8425  N  N   . ASP B 1  422 ? -18.365 39.752  133.101 1.00 37.32  ? 520  ASP B N   1 
ATOM   8426  C  CA  . ASP B 1  422 ? -19.701 40.325  133.041 1.00 34.16  ? 520  ASP B CA  1 
ATOM   8427  C  C   . ASP B 1  422 ? -20.731 39.207  133.048 1.00 28.80  ? 520  ASP B C   1 
ATOM   8428  O  O   . ASP B 1  422 ? -21.803 39.336  133.637 1.00 28.84  ? 520  ASP B O   1 
ATOM   8429  C  CB  . ASP B 1  422 ? -19.867 41.195  131.794 1.00 38.27  ? 520  ASP B CB  1 
ATOM   8430  C  CG  . ASP B 1  422 ? -19.017 42.449  131.840 1.00 40.80  ? 520  ASP B CG  1 
ATOM   8431  O  OD1 . ASP B 1  422 ? -18.523 42.797  132.933 1.00 42.34  ? 520  ASP B OD1 1 
ATOM   8432  O  OD2 . ASP B 1  422 ? -18.842 43.085  130.780 1.00 42.41  ? 520  ASP B OD2 1 
ATOM   8433  N  N   . ILE B 1  423 ? -20.391 38.107  132.384 1.00 26.64  ? 521  ILE B N   1 
ATOM   8434  C  CA  . ILE B 1  423 ? -21.279 36.955  132.298 1.00 24.79  ? 521  ILE B CA  1 
ATOM   8435  C  C   . ILE B 1  423 ? -21.011 35.993  133.447 1.00 27.77  ? 521  ILE B C   1 
ATOM   8436  O  O   . ILE B 1  423 ? -19.909 35.458  133.579 1.00 31.71  ? 521  ILE B O   1 
ATOM   8437  C  CB  . ILE B 1  423 ? -21.114 36.206  130.963 1.00 26.00  ? 521  ILE B CB  1 
ATOM   8438  C  CG1 . ILE B 1  423 ? -21.192 37.178  129.781 1.00 24.58  ? 521  ILE B CG1 1 
ATOM   8439  C  CG2 . ILE B 1  423 ? -22.151 35.102  130.845 1.00 26.97  ? 521  ILE B CG2 1 
ATOM   8440  C  CD1 . ILE B 1  423 ? -22.387 38.105  129.816 1.00 23.78  ? 521  ILE B CD1 1 
ATOM   8441  N  N   . VAL B 1  424 ? -22.028 35.769  134.273 1.00 25.94  ? 522  VAL B N   1 
ATOM   8442  C  CA  . VAL B 1  424 ? -21.875 34.948  135.467 1.00 23.33  ? 522  VAL B CA  1 
ATOM   8443  C  C   . VAL B 1  424 ? -22.866 33.786  135.481 1.00 24.92  ? 522  VAL B C   1 
ATOM   8444  O  O   . VAL B 1  424 ? -24.022 33.939  135.084 1.00 25.10  ? 522  VAL B O   1 
ATOM   8445  C  CB  . VAL B 1  424 ? -22.054 35.801  136.744 1.00 20.83  ? 522  VAL B CB  1 
ATOM   8446  C  CG1 . VAL B 1  424 ? -21.807 34.973  137.990 1.00 19.72  ? 522  VAL B CG1 1 
ATOM   8447  C  CG2 . VAL B 1  424 ? -21.118 36.999  136.714 1.00 20.02  ? 522  VAL B CG2 1 
ATOM   8448  N  N   . ASP B 1  425 ? -22.406 32.628  135.946 1.00 24.34  ? 523  ASP B N   1 
ATOM   8449  C  CA  . ASP B 1  425 ? -23.265 31.459  136.088 1.00 22.62  ? 523  ASP B CA  1 
ATOM   8450  C  C   . ASP B 1  425 ? -24.087 31.521  137.368 1.00 21.20  ? 523  ASP B C   1 
ATOM   8451  O  O   . ASP B 1  425 ? -23.560 31.797  138.445 1.00 20.72  ? 523  ASP B O   1 
ATOM   8452  C  CB  . ASP B 1  425 ? -22.440 30.166  136.085 1.00 25.36  ? 523  ASP B CB  1 
ATOM   8453  C  CG  . ASP B 1  425 ? -21.699 29.939  134.782 1.00 32.34  ? 523  ASP B CG  1 
ATOM   8454  O  OD1 . ASP B 1  425 ? -22.302 29.384  133.838 1.00 36.27  ? 523  ASP B OD1 1 
ATOM   8455  O  OD2 . ASP B 1  425 ? -20.507 30.304  134.703 1.00 33.60  ? 523  ASP B OD2 1 
ATOM   8456  N  N   . VAL B 1  426 ? -25.384 31.269  137.239 1.00 19.95  ? 524  VAL B N   1 
ATOM   8457  C  CA  . VAL B 1  426 ? -26.230 30.982  138.388 1.00 17.60  ? 524  VAL B CA  1 
ATOM   8458  C  C   . VAL B 1  426 ? -26.890 29.632  138.144 1.00 17.58  ? 524  VAL B C   1 
ATOM   8459  O  O   . VAL B 1  426 ? -27.385 29.363  137.050 1.00 18.59  ? 524  VAL B O   1 
ATOM   8460  C  CB  . VAL B 1  426 ? -27.294 32.086  138.638 1.00 16.43  ? 524  VAL B CB  1 
ATOM   8461  C  CG1 . VAL B 1  426 ? -26.625 33.392  139.047 1.00 15.80  ? 524  VAL B CG1 1 
ATOM   8462  C  CG2 . VAL B 1  426 ? -28.186 32.287  137.416 1.00 17.37  ? 524  VAL B CG2 1 
ATOM   8463  N  N   . GLN B 1  427 ? -26.869 28.764  139.148 1.00 16.89  ? 525  GLN B N   1 
ATOM   8464  C  CA  . GLN B 1  427 ? -27.421 27.433  138.969 1.00 15.94  ? 525  GLN B CA  1 
ATOM   8465  C  C   . GLN B 1  427 ? -27.799 26.770  140.287 1.00 24.96  ? 525  GLN B C   1 
ATOM   8466  O  O   . GLN B 1  427 ? -27.208 27.040  141.332 1.00 25.84  ? 525  GLN B O   1 
ATOM   8467  C  CB  . GLN B 1  427 ? -26.435 26.553  138.190 1.00 17.58  ? 525  GLN B CB  1 
ATOM   8468  C  CG  . GLN B 1  427 ? -25.730 25.488  139.006 1.00 19.97  ? 525  GLN B CG  1 
ATOM   8469  C  CD  . GLN B 1  427 ? -24.657 24.769  138.211 1.00 22.41  ? 525  GLN B CD  1 
ATOM   8470  O  OE1 . GLN B 1  427 ? -23.480 25.122  138.281 1.00 24.39  ? 525  GLN B OE1 1 
ATOM   8471  N  NE2 . GLN B 1  427 ? -25.057 23.755  137.452 1.00 21.25  ? 525  GLN B NE2 1 
ATOM   8472  N  N   . ILE B 1  428 ? -28.814 25.916  140.223 1.00 20.83  ? 526  ILE B N   1 
ATOM   8473  C  CA  . ILE B 1  428 ? -29.244 25.128  141.367 1.00 18.28  ? 526  ILE B CA  1 
ATOM   8474  C  C   . ILE B 1  428 ? -29.308 23.657  140.973 1.00 20.85  ? 526  ILE B C   1 
ATOM   8475  O  O   . ILE B 1  428 ? -29.767 23.320  139.883 1.00 16.25  ? 526  ILE B O   1 
ATOM   8476  C  CB  . ILE B 1  428 ? -30.628 25.585  141.893 1.00 17.84  ? 526  ILE B CB  1 
ATOM   8477  C  CG1 . ILE B 1  428 ? -30.594 27.056  142.318 1.00 16.73  ? 526  ILE B CG1 1 
ATOM   8478  C  CG2 . ILE B 1  428 ? -31.082 24.719  143.059 1.00 14.92  ? 526  ILE B CG2 1 
ATOM   8479  C  CD1 . ILE B 1  428 ? -31.942 27.592  142.763 1.00 14.71  ? 526  ILE B CD1 1 
ATOM   8480  N  N   . ILE B 1  429 ? -28.827 22.789  141.855 1.00 19.21  ? 527  ILE B N   1 
ATOM   8481  C  CA  . ILE B 1  429 ? -28.988 21.353  141.678 1.00 19.92  ? 527  ILE B CA  1 
ATOM   8482  C  C   . ILE B 1  429 ? -29.747 20.803  142.875 1.00 23.75  ? 527  ILE B C   1 
ATOM   8483  O  O   . ILE B 1  429 ? -29.386 21.068  144.021 1.00 25.17  ? 527  ILE B O   1 
ATOM   8484  C  CB  . ILE B 1  429 ? -27.634 20.627  141.533 1.00 19.78  ? 527  ILE B CB  1 
ATOM   8485  C  CG1 . ILE B 1  429 ? -27.075 20.819  140.123 1.00 24.89  ? 527  ILE B CG1 1 
ATOM   8486  C  CG2 . ILE B 1  429 ? -27.783 19.144  141.822 1.00 16.85  ? 527  ILE B CG2 1 
ATOM   8487  C  CD1 . ILE B 1  429 ? -25.767 20.092  139.881 1.00 29.49  ? 527  ILE B CD1 1 
ATOM   8488  N  N   . THR B 1  430 ? -30.805 20.045  142.614 1.00 16.31  ? 528  THR B N   1 
ATOM   8489  C  CA  . THR B 1  430 ? -31.595 19.487  143.700 1.00 17.29  ? 528  THR B CA  1 
ATOM   8490  C  C   . THR B 1  430 ? -31.445 17.975  143.775 1.00 18.15  ? 528  THR B C   1 
ATOM   8491  O  O   . THR B 1  430 ? -31.623 17.270  142.784 1.00 24.32  ? 528  THR B O   1 
ATOM   8492  C  CB  . THR B 1  430 ? -33.094 19.842  143.562 1.00 17.41  ? 528  THR B CB  1 
ATOM   8493  O  OG1 . THR B 1  430 ? -33.620 19.279  142.355 1.00 20.06  ? 528  THR B OG1 1 
ATOM   8494  C  CG2 . THR B 1  430 ? -33.289 21.352  143.541 1.00 15.94  ? 528  THR B CG2 1 
ATOM   8495  N  N   . LEU B 1  431 ? -31.097 17.492  144.962 1.00 17.02  ? 529  LEU B N   1 
ATOM   8496  C  CA  . LEU B 1  431 ? -31.125 16.069  145.258 1.00 19.82  ? 529  LEU B CA  1 
ATOM   8497  C  C   . LEU B 1  431 ? -32.279 15.802  146.210 1.00 23.99  ? 529  LEU B C   1 
ATOM   8498  O  O   . LEU B 1  431 ? -32.117 15.888  147.425 1.00 28.08  ? 529  LEU B O   1 
ATOM   8499  C  CB  . LEU B 1  431 ? -29.805 15.603  145.876 1.00 23.54  ? 529  LEU B CB  1 
ATOM   8500  C  CG  . LEU B 1  431 ? -28.501 16.078  145.231 1.00 26.83  ? 529  LEU B CG  1 
ATOM   8501  C  CD1 . LEU B 1  431 ? -27.305 15.499  145.972 1.00 24.40  ? 529  LEU B CD1 1 
ATOM   8502  C  CD2 . LEU B 1  431 ? -28.451 15.712  143.758 1.00 28.62  ? 529  LEU B CD2 1 
ATOM   8503  N  N   . GLY B 1  432 ? -33.446 15.495  145.653 1.00 24.66  ? 530  GLY B N   1 
ATOM   8504  C  CA  . GLY B 1  432 ? -34.634 15.277  146.456 1.00 23.01  ? 530  GLY B CA  1 
ATOM   8505  C  C   . GLY B 1  432 ? -35.033 16.535  147.203 1.00 23.42  ? 530  GLY B C   1 
ATOM   8506  O  O   . GLY B 1  432 ? -35.383 17.544  146.592 1.00 26.04  ? 530  GLY B O   1 
ATOM   8507  N  N   . SER B 1  433 ? -34.972 16.476  148.529 1.00 21.97  ? 531  SER B N   1 
ATOM   8508  C  CA  . SER B 1  433 ? -35.346 17.609  149.370 1.00 25.59  ? 531  SER B CA  1 
ATOM   8509  C  C   . SER B 1  433 ? -34.163 18.541  149.642 1.00 26.72  ? 531  SER B C   1 
ATOM   8510  O  O   . SER B 1  433 ? -34.292 19.528  150.366 1.00 25.73  ? 531  SER B O   1 
ATOM   8511  C  CB  . SER B 1  433 ? -35.939 17.116  150.691 1.00 30.73  ? 531  SER B CB  1 
ATOM   8512  O  OG  . SER B 1  433 ? -35.149 16.081  151.248 1.00 37.35  ? 531  SER B OG  1 
ATOM   8513  N  N   . LEU B 1  434 ? -33.011 18.223  149.058 1.00 26.74  ? 532  LEU B N   1 
ATOM   8514  C  CA  . LEU B 1  434 ? -31.812 19.038  149.229 1.00 20.64  ? 532  LEU B CA  1 
ATOM   8515  C  C   . LEU B 1  434 ? -31.549 19.903  148.005 1.00 22.50  ? 532  LEU B C   1 
ATOM   8516  O  O   . LEU B 1  434 ? -31.423 19.397  146.892 1.00 26.81  ? 532  LEU B O   1 
ATOM   8517  C  CB  . LEU B 1  434 ? -30.593 18.155  149.504 1.00 15.94  ? 532  LEU B CB  1 
ATOM   8518  C  CG  . LEU B 1  434 ? -29.237 18.870  149.478 1.00 22.48  ? 532  LEU B CG  1 
ATOM   8519  C  CD1 . LEU B 1  434 ? -29.114 19.860  150.629 1.00 15.06  ? 532  LEU B CD1 1 
ATOM   8520  C  CD2 . LEU B 1  434 ? -28.085 17.875  149.492 1.00 15.79  ? 532  LEU B CD2 1 
ATOM   8521  N  N   . ALA B 1  435 ? -31.456 21.211  148.216 1.00 17.88  ? 533  ALA B N   1 
ATOM   8522  C  CA  . ALA B 1  435 ? -31.158 22.130  147.128 1.00 17.90  ? 533  ALA B CA  1 
ATOM   8523  C  C   . ALA B 1  435 ? -29.779 22.754  147.314 1.00 20.68  ? 533  ALA B C   1 
ATOM   8524  O  O   . ALA B 1  435 ? -29.450 23.260  148.387 1.00 20.61  ? 533  ALA B O   1 
ATOM   8525  C  CB  . ALA B 1  435 ? -32.227 23.209  147.034 1.00 17.44  ? 533  ALA B CB  1 
ATOM   8526  N  N   . ILE B 1  436 ? -28.981 22.715  146.253 1.00 16.60  ? 534  ILE B N   1 
ATOM   8527  C  CA  . ILE B 1  436 ? -27.634 23.262  146.278 1.00 14.25  ? 534  ILE B CA  1 
ATOM   8528  C  C   . ILE B 1  436 ? -27.543 24.465  145.357 1.00 14.15  ? 534  ILE B C   1 
ATOM   8529  O  O   . ILE B 1  436 ? -27.663 24.334  144.141 1.00 18.38  ? 534  ILE B O   1 
ATOM   8530  C  CB  . ILE B 1  436 ? -26.589 22.213  145.850 1.00 14.62  ? 534  ILE B CB  1 
ATOM   8531  C  CG1 . ILE B 1  436 ? -26.580 21.037  146.828 1.00 16.27  ? 534  ILE B CG1 1 
ATOM   8532  C  CG2 . ILE B 1  436 ? -25.208 22.839  145.762 1.00 15.62  ? 534  ILE B CG2 1 
ATOM   8533  C  CD1 . ILE B 1  436 ? -25.740 19.866  146.365 1.00 15.33  ? 534  ILE B CD1 1 
ATOM   8534  N  N   . THR B 1  437 ? -27.338 25.641  145.939 1.00 13.77  ? 535  THR B N   1 
ATOM   8535  C  CA  . THR B 1  437 ? -27.192 26.854  145.148 1.00 15.74  ? 535  THR B CA  1 
ATOM   8536  C  C   . THR B 1  437 ? -25.722 27.129  144.867 1.00 16.74  ? 535  THR B C   1 
ATOM   8537  O  O   . THR B 1  437 ? -24.934 27.367  145.783 1.00 16.58  ? 535  THR B O   1 
ATOM   8538  C  CB  . THR B 1  437 ? -27.824 28.075  145.847 1.00 13.47  ? 535  THR B CB  1 
ATOM   8539  O  OG1 . THR B 1  437 ? -27.202 28.283  147.122 1.00 13.18  ? 535  THR B OG1 1 
ATOM   8540  C  CG2 . THR B 1  437 ? -29.317 27.860  146.045 1.00 16.17  ? 535  THR B CG2 1 
ATOM   8541  N  N   . ALA B 1  438 ? -25.358 27.081  143.591 1.00 19.80  ? 536  ALA B N   1 
ATOM   8542  C  CA  . ALA B 1  438 ? -23.988 27.348  143.179 1.00 14.38  ? 536  ALA B CA  1 
ATOM   8543  C  C   . ALA B 1  438 ? -23.718 28.846  143.169 1.00 22.81  ? 536  ALA B C   1 
ATOM   8544  O  O   . ALA B 1  438 ? -24.070 29.544  142.217 1.00 21.10  ? 536  ALA B O   1 
ATOM   8545  C  CB  . ALA B 1  438 ? -23.718 26.748  141.809 1.00 16.39  ? 536  ALA B CB  1 
ATOM   8546  N  N   . ILE B 1  439 ? -23.094 29.338  144.233 1.00 20.70  ? 537  ILE B N   1 
ATOM   8547  C  CA  . ILE B 1  439 ? -22.777 30.754  144.338 1.00 22.88  ? 537  ILE B CA  1 
ATOM   8548  C  C   . ILE B 1  439 ? -21.408 31.015  143.718 1.00 21.90  ? 537  ILE B C   1 
ATOM   8549  O  O   . ILE B 1  439 ? -20.436 30.326  144.031 1.00 25.09  ? 537  ILE B O   1 
ATOM   8550  C  CB  . ILE B 1  439 ? -22.810 31.238  145.805 1.00 29.23  ? 537  ILE B CB  1 
ATOM   8551  C  CG1 . ILE B 1  439 ? -24.185 31.821  146.142 1.00 27.04  ? 537  ILE B CG1 1 
ATOM   8552  C  CG2 . ILE B 1  439 ? -21.748 32.299  146.054 1.00 32.82  ? 537  ILE B CG2 1 
ATOM   8553  C  CD1 . ILE B 1  439 ? -25.336 30.858  145.971 1.00 26.43  ? 537  ILE B CD1 1 
ATOM   8554  N  N   . PRO B 1  440 ? -21.340 31.999  142.809 1.00 19.84  ? 538  PRO B N   1 
ATOM   8555  C  CA  . PRO B 1  440 ? -20.127 32.338  142.060 1.00 20.99  ? 538  PRO B CA  1 
ATOM   8556  C  C   . PRO B 1  440 ? -19.218 33.301  142.812 1.00 22.61  ? 538  PRO B C   1 
ATOM   8557  O  O   . PRO B 1  440 ? -18.729 34.267  142.224 1.00 20.23  ? 538  PRO B O   1 
ATOM   8558  C  CB  . PRO B 1  440 ? -20.682 33.001  140.805 1.00 15.59  ? 538  PRO B CB  1 
ATOM   8559  C  CG  . PRO B 1  440 ? -21.911 33.692  141.299 1.00 16.57  ? 538  PRO B CG  1 
ATOM   8560  C  CD  . PRO B 1  440 ? -22.496 32.792  142.359 1.00 16.89  ? 538  PRO B CD  1 
ATOM   8561  N  N   . GLY B 1  441 ? -18.991 33.037  144.093 1.00 14.45  ? 539  GLY B N   1 
ATOM   8562  C  CA  . GLY B 1  441 ? -18.185 33.925  144.907 1.00 14.34  ? 539  GLY B CA  1 
ATOM   8563  C  C   . GLY B 1  441 ? -18.317 33.671  146.392 1.00 17.95  ? 539  GLY B C   1 
ATOM   8564  O  O   . GLY B 1  441 ? -18.546 32.543  146.824 1.00 21.23  ? 539  GLY B O   1 
ATOM   8565  N  N   . GLU B 1  442 ? -18.182 34.734  147.176 1.00 19.57  ? 540  GLU B N   1 
ATOM   8566  C  CA  . GLU B 1  442 ? -18.141 34.612  148.626 1.00 18.97  ? 540  GLU B CA  1 
ATOM   8567  C  C   . GLU B 1  442 ? -19.272 35.381  149.302 1.00 20.60  ? 540  GLU B C   1 
ATOM   8568  O  O   . GLU B 1  442 ? -19.176 36.590  149.515 1.00 24.37  ? 540  GLU B O   1 
ATOM   8569  C  CB  . GLU B 1  442 ? -16.789 35.098  149.150 1.00 18.37  ? 540  GLU B CB  1 
ATOM   8570  C  CG  . GLU B 1  442 ? -15.605 34.526  148.391 1.00 19.30  ? 540  GLU B CG  1 
ATOM   8571  C  CD  . GLU B 1  442 ? -14.285 34.803  149.074 1.00 30.70  ? 540  GLU B CD  1 
ATOM   8572  O  OE1 . GLU B 1  442 ? -14.222 34.677  150.315 1.00 37.02  ? 540  GLU B OE1 1 
ATOM   8573  O  OE2 . GLU B 1  442 ? -13.310 35.148  148.373 1.00 32.28  ? 540  GLU B OE2 1 
ATOM   8574  N  N   . PHE B 1  443 ? -20.343 34.668  149.630 1.00 18.08  ? 541  PHE B N   1 
ATOM   8575  C  CA  . PHE B 1  443 ? -21.457 35.244  150.372 1.00 14.54  ? 541  PHE B CA  1 
ATOM   8576  C  C   . PHE B 1  443 ? -21.090 35.458  151.835 1.00 17.83  ? 541  PHE B C   1 
ATOM   8577  O  O   . PHE B 1  443 ? -20.498 34.584  152.465 1.00 19.43  ? 541  PHE B O   1 
ATOM   8578  C  CB  . PHE B 1  443 ? -22.691 34.344  150.270 1.00 13.85  ? 541  PHE B CB  1 
ATOM   8579  C  CG  . PHE B 1  443 ? -23.612 34.699  149.140 1.00 17.87  ? 541  PHE B CG  1 
ATOM   8580  C  CD1 . PHE B 1  443 ? -23.115 34.961  147.876 1.00 20.78  ? 541  PHE B CD1 1 
ATOM   8581  C  CD2 . PHE B 1  443 ? -24.981 34.762  149.342 1.00 14.94  ? 541  PHE B CD2 1 
ATOM   8582  C  CE1 . PHE B 1  443 ? -23.966 35.285  146.837 1.00 20.02  ? 541  PHE B CE1 1 
ATOM   8583  C  CE2 . PHE B 1  443 ? -25.834 35.084  148.307 1.00 15.68  ? 541  PHE B CE2 1 
ATOM   8584  C  CZ  . PHE B 1  443 ? -25.326 35.347  147.053 1.00 18.04  ? 541  PHE B CZ  1 
ATOM   8585  N  N   . THR B 1  444 ? -21.435 36.623  152.372 1.00 15.25  ? 542  THR B N   1 
ATOM   8586  C  CA  . THR B 1  444 ? -21.281 36.866  153.801 1.00 16.99  ? 542  THR B CA  1 
ATOM   8587  C  C   . THR B 1  444 ? -22.314 36.060  154.583 1.00 18.55  ? 542  THR B C   1 
ATOM   8588  O  O   . THR B 1  444 ? -23.170 35.397  153.996 1.00 15.35  ? 542  THR B O   1 
ATOM   8589  C  CB  . THR B 1  444 ? -21.415 38.359  154.152 1.00 18.46  ? 542  THR B CB  1 
ATOM   8590  O  OG1 . THR B 1  444 ? -22.699 38.842  153.738 1.00 14.60  ? 542  THR B OG1 1 
ATOM   8591  C  CG2 . THR B 1  444 ? -20.327 39.162  153.466 1.00 20.49  ? 542  THR B CG2 1 
ATOM   8592  N  N   . THR B 1  445 ? -22.218 36.112  155.908 1.00 21.79  ? 543  THR B N   1 
ATOM   8593  C  CA  . THR B 1  445 ? -23.118 35.367  156.780 1.00 20.01  ? 543  THR B CA  1 
ATOM   8594  C  C   . THR B 1  445 ? -24.592 35.678  156.515 1.00 19.39  ? 543  THR B C   1 
ATOM   8595  O  O   . THR B 1  445 ? -25.381 34.781  156.212 1.00 16.47  ? 543  THR B O   1 
ATOM   8596  C  CB  . THR B 1  445 ? -22.816 35.655  158.262 1.00 19.60  ? 543  THR B CB  1 
ATOM   8597  O  OG1 . THR B 1  445 ? -21.473 35.257  158.566 1.00 18.88  ? 543  THR B OG1 1 
ATOM   8598  C  CG2 . THR B 1  445 ? -23.781 34.901  159.159 1.00 17.99  ? 543  THR B CG2 1 
ATOM   8599  N  N   . MET B 1  446 ? -24.955 36.953  156.620 1.00 21.32  ? 544  MET B N   1 
ATOM   8600  C  CA  . MET B 1  446 ? -26.347 37.364  156.466 1.00 22.56  ? 544  MET B CA  1 
ATOM   8601  C  C   . MET B 1  446 ? -26.823 37.260  155.017 1.00 23.72  ? 544  MET B C   1 
ATOM   8602  O  O   . MET B 1  446 ? -28.006 37.029  154.760 1.00 23.48  ? 544  MET B O   1 
ATOM   8603  C  CB  . MET B 1  446 ? -26.541 38.792  156.981 1.00 18.91  ? 544  MET B CB  1 
ATOM   8604  C  CG  . MET B 1  446 ? -27.996 39.156  157.215 1.00 19.52  ? 544  MET B CG  1 
ATOM   8605  S  SD  . MET B 1  446 ? -28.737 38.175  158.535 1.00 24.98  ? 544  MET B SD  1 
ATOM   8606  C  CE  . MET B 1  446 ? -28.399 39.208  159.958 1.00 15.82  ? 544  MET B CE  1 
ATOM   8607  N  N   . SER B 1  447 ? -25.900 37.441  154.077 1.00 21.82  ? 545  SER B N   1 
ATOM   8608  C  CA  . SER B 1  447 ? -26.212 37.301  152.658 1.00 16.38  ? 545  SER B CA  1 
ATOM   8609  C  C   . SER B 1  447 ? -26.679 35.888  152.334 1.00 16.71  ? 545  SER B C   1 
ATOM   8610  O  O   . SER B 1  447 ? -27.658 35.700  151.614 1.00 20.75  ? 545  SER B O   1 
ATOM   8611  C  CB  . SER B 1  447 ? -24.999 37.659  151.798 1.00 17.90  ? 545  SER B CB  1 
ATOM   8612  O  OG  . SER B 1  447 ? -24.670 39.031  151.925 1.00 23.05  ? 545  SER B OG  1 
ATOM   8613  N  N   . GLY B 1  448 ? -25.970 34.900  152.870 1.00 16.67  ? 546  GLY B N   1 
ATOM   8614  C  CA  . GLY B 1  448 ? -26.304 33.506  152.645 1.00 14.66  ? 546  GLY B CA  1 
ATOM   8615  C  C   . GLY B 1  448 ? -27.609 33.120  153.310 1.00 15.11  ? 546  GLY B C   1 
ATOM   8616  O  O   . GLY B 1  448 ? -28.386 32.340  152.765 1.00 17.17  ? 546  GLY B O   1 
ATOM   8617  N  N   . ARG B 1  449 ? -27.839 33.664  154.501 1.00 17.78  ? 547  ARG B N   1 
ATOM   8618  C  CA  . ARG B 1  449 ? -29.088 33.453  155.227 1.00 16.66  ? 547  ARG B CA  1 
ATOM   8619  C  C   . ARG B 1  449 ? -30.289 33.952  154.431 1.00 20.07  ? 547  ARG B C   1 
ATOM   8620  O  O   . ARG B 1  449 ? -31.299 33.258  154.314 1.00 23.57  ? 547  ARG B O   1 
ATOM   8621  C  CB  . ARG B 1  449 ? -29.035 34.144  156.593 1.00 15.58  ? 547  ARG B CB  1 
ATOM   8622  C  CG  . ARG B 1  449 ? -28.139 33.443  157.604 1.00 13.93  ? 547  ARG B CG  1 
ATOM   8623  C  CD  . ARG B 1  449 ? -27.875 34.310  158.825 1.00 14.31  ? 547  ARG B CD  1 
ATOM   8624  N  NE  . ARG B 1  449 ? -26.994 33.641  159.782 1.00 18.30  ? 547  ARG B NE  1 
ATOM   8625  C  CZ  . ARG B 1  449 ? -26.606 34.166  160.940 1.00 17.48  ? 547  ARG B CZ  1 
ATOM   8626  N  NH1 . ARG B 1  449 ? -27.008 35.379  161.295 1.00 15.13  ? 547  ARG B NH1 1 
ATOM   8627  N  NH2 . ARG B 1  449 ? -25.804 33.479  161.742 1.00 18.04  ? 547  ARG B NH2 1 
ATOM   8628  N  N   . ARG B 1  450 ? -30.172 35.159  153.887 1.00 18.04  ? 548  ARG B N   1 
ATOM   8629  C  CA  . ARG B 1  450 ? -31.260 35.765  153.127 1.00 20.47  ? 548  ARG B CA  1 
ATOM   8630  C  C   . ARG B 1  450 ? -31.590 34.967  151.868 1.00 23.91  ? 548  ARG B C   1 
ATOM   8631  O  O   . ARG B 1  450 ? -32.760 34.719  151.581 1.00 27.23  ? 548  ARG B O   1 
ATOM   8632  C  CB  . ARG B 1  450 ? -30.923 37.214  152.765 1.00 14.32  ? 548  ARG B CB  1 
ATOM   8633  C  CG  . ARG B 1  450 ? -30.971 38.171  153.951 1.00 14.73  ? 548  ARG B CG  1 
ATOM   8634  C  CD  . ARG B 1  450 ? -30.854 39.626  153.516 1.00 18.38  ? 548  ARG B CD  1 
ATOM   8635  N  NE  . ARG B 1  450 ? -30.730 40.529  154.660 1.00 20.30  ? 548  ARG B NE  1 
ATOM   8636  C  CZ  . ARG B 1  450 ? -30.507 41.837  154.565 1.00 22.59  ? 548  ARG B CZ  1 
ATOM   8637  N  NH1 . ARG B 1  450 ? -30.384 42.410  153.375 1.00 23.71  ? 548  ARG B NH1 1 
ATOM   8638  N  NH2 . ARG B 1  450 ? -30.411 42.578  155.661 1.00 20.57  ? 548  ARG B NH2 1 
ATOM   8639  N  N   . LEU B 1  451 ? -30.565 34.567  151.121 1.00 22.80  ? 549  LEU B N   1 
ATOM   8640  C  CA  . LEU B 1  451 ? -30.782 33.830  149.878 1.00 20.62  ? 549  LEU B CA  1 
ATOM   8641  C  C   . LEU B 1  451 ? -31.326 32.427  150.151 1.00 18.92  ? 549  LEU B C   1 
ATOM   8642  O  O   . LEU B 1  451 ? -32.213 31.955  149.441 1.00 20.27  ? 549  LEU B O   1 
ATOM   8643  C  CB  . LEU B 1  451 ? -29.490 33.749  149.060 1.00 18.22  ? 549  LEU B CB  1 
ATOM   8644  C  CG  . LEU B 1  451 ? -29.646 33.202  147.637 1.00 17.81  ? 549  LEU B CG  1 
ATOM   8645  C  CD1 . LEU B 1  451 ? -28.848 34.033  146.647 1.00 13.46  ? 549  LEU B CD1 1 
ATOM   8646  C  CD2 . LEU B 1  451 ? -29.233 31.738  147.556 1.00 16.92  ? 549  LEU B CD2 1 
ATOM   8647  N  N   . ARG B 1  452 ? -30.788 31.768  151.175 1.00 16.82  ? 550  ARG B N   1 
ATOM   8648  C  CA  . ARG B 1  452 ? -31.258 30.446  151.587 1.00 18.30  ? 550  ARG B CA  1 
ATOM   8649  C  C   . ARG B 1  452 ? -32.758 30.436  151.847 1.00 21.79  ? 550  ARG B C   1 
ATOM   8650  O  O   . ARG B 1  452 ? -33.508 29.667  151.242 1.00 20.68  ? 550  ARG B O   1 
ATOM   8651  C  CB  . ARG B 1  452 ? -30.537 29.983  152.852 1.00 20.57  ? 550  ARG B CB  1 
ATOM   8652  C  CG  . ARG B 1  452 ? -29.271 29.186  152.627 1.00 23.08  ? 550  ARG B CG  1 
ATOM   8653  C  CD  . ARG B 1  452 ? -28.850 28.499  153.918 1.00 24.68  ? 550  ARG B CD  1 
ATOM   8654  N  NE  . ARG B 1  452 ? -27.458 28.764  154.268 1.00 27.08  ? 550  ARG B NE  1 
ATOM   8655  C  CZ  . ARG B 1  452 ? -27.073 29.613  155.215 1.00 23.03  ? 550  ARG B CZ  1 
ATOM   8656  N  NH1 . ARG B 1  452 ? -27.976 30.282  155.919 1.00 15.93  ? 550  ARG B NH1 1 
ATOM   8657  N  NH2 . ARG B 1  452 ? -25.784 29.788  155.464 1.00 28.32  ? 550  ARG B NH2 1 
ATOM   8658  N  N   . GLU B 1  453 ? -33.181 31.304  152.758 1.00 22.54  ? 551  GLU B N   1 
ATOM   8659  C  CA  . GLU B 1  453 ? -34.567 31.365  153.194 1.00 20.35  ? 551  GLU B CA  1 
ATOM   8660  C  C   . GLU B 1  453 ? -35.486 31.817  152.066 1.00 21.59  ? 551  GLU B C   1 
ATOM   8661  O  O   . GLU B 1  453 ? -36.624 31.357  151.966 1.00 24.06  ? 551  GLU B O   1 
ATOM   8662  C  CB  . GLU B 1  453 ? -34.692 32.296  154.397 1.00 18.41  ? 551  GLU B CB  1 
ATOM   8663  C  CG  . GLU B 1  453 ? -33.928 31.803  155.617 1.00 20.23  ? 551  GLU B CG  1 
ATOM   8664  C  CD  . GLU B 1  453 ? -33.744 32.876  156.672 1.00 27.99  ? 551  GLU B CD  1 
ATOM   8665  O  OE1 . GLU B 1  453 ? -34.425 33.919  156.587 1.00 37.17  ? 551  GLU B OE1 1 
ATOM   8666  O  OE2 . GLU B 1  453 ? -32.915 32.677  157.585 1.00 23.00  ? 551  GLU B OE2 1 
ATOM   8667  N  N   . ALA B 1  454 ? -34.988 32.709  151.214 1.00 24.11  ? 552  ALA B N   1 
ATOM   8668  C  CA  . ALA B 1  454 ? -35.758 33.186  150.070 1.00 26.47  ? 552  ALA B CA  1 
ATOM   8669  C  C   . ALA B 1  454 ? -35.979 32.071  149.055 1.00 24.31  ? 552  ALA B C   1 
ATOM   8670  O  O   . ALA B 1  454 ? -37.073 31.919  148.512 1.00 26.29  ? 552  ALA B O   1 
ATOM   8671  C  CB  . ALA B 1  454 ? -35.061 34.363  149.413 1.00 14.92  ? 552  ALA B CB  1 
ATOM   8672  N  N   . VAL B 1  455 ? -34.931 31.294  148.802 1.00 21.38  ? 553  VAL B N   1 
ATOM   8673  C  CA  . VAL B 1  455 ? -35.015 30.177  147.869 1.00 18.95  ? 553  VAL B CA  1 
ATOM   8674  C  C   . VAL B 1  455 ? -35.896 29.066  148.441 1.00 16.80  ? 553  VAL B C   1 
ATOM   8675  O  O   . VAL B 1  455 ? -36.692 28.461  147.722 1.00 16.70  ? 553  VAL B O   1 
ATOM   8676  C  CB  . VAL B 1  455 ? -33.613 29.629  147.527 1.00 14.50  ? 553  VAL B CB  1 
ATOM   8677  C  CG1 . VAL B 1  455 ? -33.707 28.272  146.859 1.00 14.28  ? 553  VAL B CG1 1 
ATOM   8678  C  CG2 . VAL B 1  455 ? -32.874 30.606  146.628 1.00 14.93  ? 553  VAL B CG2 1 
ATOM   8679  N  N   . GLN B 1  456 ? -35.762 28.816  149.740 1.00 14.87  ? 554  GLN B N   1 
ATOM   8680  C  CA  . GLN B 1  456 ? -36.613 27.851  150.424 1.00 17.84  ? 554  GLN B CA  1 
ATOM   8681  C  C   . GLN B 1  456 ? -38.080 28.245  150.301 1.00 21.62  ? 554  GLN B C   1 
ATOM   8682  O  O   . GLN B 1  456 ? -38.931 27.415  149.978 1.00 23.96  ? 554  GLN B O   1 
ATOM   8683  C  CB  . GLN B 1  456 ? -36.222 27.735  151.899 1.00 15.34  ? 554  GLN B CB  1 
ATOM   8684  C  CG  . GLN B 1  456 ? -37.081 26.759  152.690 1.00 15.92  ? 554  GLN B CG  1 
ATOM   8685  C  CD  . GLN B 1  456 ? -36.635 26.624  154.133 1.00 24.09  ? 554  GLN B CD  1 
ATOM   8686  O  OE1 . GLN B 1  456 ? -36.326 27.614  154.797 1.00 27.23  ? 554  GLN B OE1 1 
ATOM   8687  N  NE2 . GLN B 1  456 ? -36.605 25.393  154.630 1.00 25.06  ? 554  GLN B NE2 1 
ATOM   8688  N  N   . ALA B 1  457 ? -38.363 29.518  150.558 1.00 22.51  ? 555  ALA B N   1 
ATOM   8689  C  CA  . ALA B 1  457 ? -39.718 30.050  150.467 1.00 23.31  ? 555  ALA B CA  1 
ATOM   8690  C  C   . ALA B 1  457 ? -40.279 29.897  149.057 1.00 21.05  ? 555  ALA B C   1 
ATOM   8691  O  O   . ALA B 1  457 ? -41.452 29.569  148.880 1.00 24.59  ? 555  ALA B O   1 
ATOM   8692  C  CB  . ALA B 1  457 ? -39.744 31.510  150.891 1.00 16.84  ? 555  ALA B CB  1 
ATOM   8693  N  N   . GLU B 1  458 ? -39.433 30.144  148.060 1.00 20.89  ? 556  GLU B N   1 
ATOM   8694  C  CA  . GLU B 1  458 ? -39.826 30.009  146.662 1.00 18.46  ? 556  GLU B CA  1 
ATOM   8695  C  C   . GLU B 1  458 ? -40.263 28.586  146.338 1.00 20.81  ? 556  GLU B C   1 
ATOM   8696  O  O   . GLU B 1  458 ? -41.323 28.374  145.749 1.00 20.57  ? 556  GLU B O   1 
ATOM   8697  C  CB  . GLU B 1  458 ? -38.682 30.422  145.739 1.00 16.03  ? 556  GLU B CB  1 
ATOM   8698  C  CG  . GLU B 1  458 ? -39.078 30.486  144.276 1.00 29.76  ? 556  GLU B CG  1 
ATOM   8699  C  CD  . GLU B 1  458 ? -40.090 31.581  143.995 1.00 30.38  ? 556  GLU B CD  1 
ATOM   8700  O  OE1 . GLU B 1  458 ? -40.110 32.578  144.746 1.00 29.74  ? 556  GLU B OE1 1 
ATOM   8701  O  OE2 . GLU B 1  458 ? -40.867 31.447  143.026 1.00 29.59  ? 556  GLU B OE2 1 
ATOM   8702  N  N   . PHE B 1  459 ? -39.429 27.619  146.714 1.00 20.07  ? 557  PHE B N   1 
ATOM   8703  C  CA  . PHE B 1  459 ? -39.754 26.207  146.551 1.00 22.36  ? 557  PHE B CA  1 
ATOM   8704  C  C   . PHE B 1  459 ? -41.087 25.867  147.210 1.00 24.23  ? 557  PHE B C   1 
ATOM   8705  O  O   . PHE B 1  459 ? -41.894 25.123  146.655 1.00 25.07  ? 557  PHE B O   1 
ATOM   8706  C  CB  . PHE B 1  459 ? -38.648 25.327  147.141 1.00 23.96  ? 557  PHE B CB  1 
ATOM   8707  C  CG  . PHE B 1  459 ? -37.485 25.096  146.214 1.00 24.53  ? 557  PHE B CG  1 
ATOM   8708  C  CD1 . PHE B 1  459 ? -37.662 24.436  145.009 1.00 26.04  ? 557  PHE B CD1 1 
ATOM   8709  C  CD2 . PHE B 1  459 ? -36.211 25.521  146.556 1.00 15.32  ? 557  PHE B CD2 1 
ATOM   8710  C  CE1 . PHE B 1  459 ? -36.593 24.213  144.158 1.00 27.92  ? 557  PHE B CE1 1 
ATOM   8711  C  CE2 . PHE B 1  459 ? -35.139 25.300  145.709 1.00 15.10  ? 557  PHE B CE2 1 
ATOM   8712  C  CZ  . PHE B 1  459 ? -35.330 24.647  144.510 1.00 24.27  ? 557  PHE B CZ  1 
ATOM   8713  N  N   . ALA B 1  460 ? -41.312 26.429  148.394 1.00 26.17  ? 558  ALA B N   1 
ATOM   8714  C  CA  . ALA B 1  460 ? -42.524 26.170  149.163 1.00 25.92  ? 558  ALA B CA  1 
ATOM   8715  C  C   . ALA B 1  460 ? -43.763 26.697  148.451 1.00 28.50  ? 558  ALA B C   1 
ATOM   8716  O  O   . ALA B 1  460 ? -44.788 26.019  148.384 1.00 33.44  ? 558  ALA B O   1 
ATOM   8717  C  CB  . ALA B 1  460 ? -42.408 26.785  150.549 1.00 23.84  ? 558  ALA B CB  1 
ATOM   8718  N  N   . SER B 1  461 ? -43.660 27.911  147.920 1.00 23.40  ? 559  SER B N   1 
ATOM   8719  C  CA  . SER B 1  461 ? -44.753 28.528  147.176 1.00 20.71  ? 559  SER B CA  1 
ATOM   8720  C  C   . SER B 1  461 ? -45.186 27.703  145.966 1.00 22.11  ? 559  SER B C   1 
ATOM   8721  O  O   . SER B 1  461 ? -46.300 27.863  145.470 1.00 25.04  ? 559  SER B O   1 
ATOM   8722  C  CB  . SER B 1  461 ? -44.355 29.934  146.724 1.00 25.31  ? 559  SER B CB  1 
ATOM   8723  O  OG  . SER B 1  461 ? -44.242 30.807  147.833 1.00 33.50  ? 559  SER B OG  1 
ATOM   8724  N  N   . HIS B 1  462 ? -44.306 26.827  145.489 1.00 20.42  ? 560  HIS B N   1 
ATOM   8725  C  CA  . HIS B 1  462 ? -44.606 26.029  144.305 1.00 23.01  ? 560  HIS B CA  1 
ATOM   8726  C  C   . HIS B 1  462 ? -44.541 24.523  144.556 1.00 23.31  ? 560  HIS B C   1 
ATOM   8727  O  O   . HIS B 1  462 ? -44.184 23.751  143.666 1.00 21.75  ? 560  HIS B O   1 
ATOM   8728  C  CB  . HIS B 1  462 ? -43.672 26.417  143.160 1.00 23.00  ? 560  HIS B CB  1 
ATOM   8729  C  CG  . HIS B 1  462 ? -43.864 27.824  142.686 1.00 25.55  ? 560  HIS B CG  1 
ATOM   8730  N  ND1 . HIS B 1  462 ? -43.217 28.896  143.259 1.00 26.66  ? 560  HIS B ND1 1 
ATOM   8731  C  CD2 . HIS B 1  462 ? -44.647 28.335  141.707 1.00 23.37  ? 560  HIS B CD2 1 
ATOM   8732  C  CE1 . HIS B 1  462 ? -43.585 30.007  142.646 1.00 24.52  ? 560  HIS B CE1 1 
ATOM   8733  N  NE2 . HIS B 1  462 ? -44.452 29.694  141.700 1.00 20.99  ? 560  HIS B NE2 1 
ATOM   8734  N  N   . GLY B 1  463 ? -44.890 24.114  145.772 1.00 22.72  ? 561  GLY B N   1 
ATOM   8735  C  CA  . GLY B 1  463 ? -45.163 22.717  146.061 1.00 20.60  ? 561  GLY B CA  1 
ATOM   8736  C  C   . GLY B 1  463 ? -44.022 21.869  146.589 1.00 21.26  ? 561  GLY B C   1 
ATOM   8737  O  O   . GLY B 1  463 ? -44.236 20.724  146.983 1.00 22.94  ? 561  GLY B O   1 
ATOM   8738  N  N   . MET B 1  464 ? -42.813 22.417  146.606 1.00 21.18  ? 562  MET B N   1 
ATOM   8739  C  CA  . MET B 1  464 ? -41.671 21.682  147.137 1.00 23.52  ? 562  MET B CA  1 
ATOM   8740  C  C   . MET B 1  464 ? -41.404 22.094  148.579 1.00 24.53  ? 562  MET B C   1 
ATOM   8741  O  O   . MET B 1  464 ? -40.671 23.046  148.847 1.00 20.50  ? 562  MET B O   1 
ATOM   8742  C  CB  . MET B 1  464 ? -40.440 21.897  146.260 1.00 17.62  ? 562  MET B CB  1 
ATOM   8743  C  CG  . MET B 1  464 ? -40.471 21.049  144.995 1.00 17.91  ? 562  MET B CG  1 
ATOM   8744  S  SD  . MET B 1  464 ? -39.140 21.380  143.828 1.00 26.89  ? 562  MET B SD  1 
ATOM   8745  C  CE  . MET B 1  464 ? -37.724 20.765  144.737 1.00 17.00  ? 562  MET B CE  1 
ATOM   8746  N  N   . GLN B 1  465 ? -42.010 21.351  149.500 1.00 29.44  ? 563  GLN B N   1 
ATOM   8747  C  CA  . GLN B 1  465 ? -42.022 21.693  150.917 1.00 33.89  ? 563  GLN B CA  1 
ATOM   8748  C  C   . GLN B 1  465 ? -40.755 21.265  151.652 1.00 34.75  ? 563  GLN B C   1 
ATOM   8749  O  O   . GLN B 1  465 ? -40.084 20.313  151.252 1.00 35.32  ? 563  GLN B O   1 
ATOM   8750  C  CB  . GLN B 1  465 ? -43.240 21.052  151.590 1.00 37.35  ? 563  GLN B CB  1 
ATOM   8751  C  CG  . GLN B 1  465 ? -44.321 22.029  152.011 1.00 38.54  ? 563  GLN B CG  1 
ATOM   8752  C  CD  . GLN B 1  465 ? -44.686 23.008  150.916 1.00 39.95  ? 563  GLN B CD  1 
ATOM   8753  O  OE1 . GLN B 1  465 ? -44.336 24.185  150.984 1.00 44.34  ? 563  GLN B OE1 1 
ATOM   8754  N  NE2 . GLN B 1  465 ? -45.400 22.531  149.905 1.00 38.13  ? 563  GLN B NE2 1 
ATOM   8755  N  N   . ASN B 1  466 ? -40.452 21.979  152.735 1.00 35.22  ? 564  ASN B N   1 
ATOM   8756  C  CA  . ASN B 1  466 ? -39.358 21.640  153.644 1.00 33.87  ? 564  ASN B CA  1 
ATOM   8757  C  C   . ASN B 1  466 ? -38.032 21.375  152.938 1.00 30.69  ? 564  ASN B C   1 
ATOM   8758  O  O   . ASN B 1  466 ? -37.374 20.366  153.187 1.00 33.49  ? 564  ASN B O   1 
ATOM   8759  C  CB  . ASN B 1  466 ? -39.740 20.428  154.497 1.00 34.95  ? 564  ASN B CB  1 
ATOM   8760  C  CG  . ASN B 1  466 ? -40.891 20.721  155.440 1.00 40.92  ? 564  ASN B CG  1 
ATOM   8761  O  OD1 . ASN B 1  466 ? -41.266 21.877  155.639 1.00 44.58  ? 564  ASN B OD1 1 
ATOM   8762  N  ND2 . ASN B 1  466 ? -41.457 19.673  156.030 1.00 42.01  ? 564  ASN B ND2 1 
ATOM   8763  N  N   . MET B 1  467 ? -37.643 22.286  152.054 1.00 26.87  ? 565  MET B N   1 
ATOM   8764  C  CA  . MET B 1  467 ? -36.384 22.155  151.336 1.00 25.37  ? 565  MET B CA  1 
ATOM   8765  C  C   . MET B 1  467 ? -35.217 22.621  152.196 1.00 25.28  ? 565  MET B C   1 
ATOM   8766  O  O   . MET B 1  467 ? -35.255 23.708  152.771 1.00 26.37  ? 565  MET B O   1 
ATOM   8767  C  CB  . MET B 1  467 ? -36.420 22.958  150.035 1.00 21.11  ? 565  MET B CB  1 
ATOM   8768  C  CG  . MET B 1  467 ? -37.416 22.452  149.006 1.00 18.33  ? 565  MET B CG  1 
ATOM   8769  S  SD  . MET B 1  467 ? -36.968 20.852  148.314 1.00 21.11  ? 565  MET B SD  1 
ATOM   8770  C  CE  . MET B 1  467 ? -35.386 21.237  147.566 1.00 21.03  ? 565  MET B CE  1 
ATOM   8771  N  N   . THR B 1  468 ? -34.182 21.792  152.283 1.00 20.27  ? 566  THR B N   1 
ATOM   8772  C  CA  . THR B 1  468 ? -32.926 22.213  152.882 1.00 15.28  ? 566  THR B CA  1 
ATOM   8773  C  C   . THR B 1  468 ? -32.045 22.804  151.794 1.00 14.75  ? 566  THR B C   1 
ATOM   8774  O  O   . THR B 1  468 ? -31.641 22.111  150.862 1.00 19.50  ? 566  THR B O   1 
ATOM   8775  C  CB  . THR B 1  468 ? -32.195 21.049  153.574 1.00 23.43  ? 566  THR B CB  1 
ATOM   8776  O  OG1 . THR B 1  468 ? -32.971 20.588  154.687 1.00 23.76  ? 566  THR B OG1 1 
ATOM   8777  C  CG2 . THR B 1  468 ? -30.827 21.498  154.071 1.00 17.44  ? 566  THR B CG2 1 
ATOM   8778  N  N   . VAL B 1  469 ? -31.756 24.092  151.914 1.00 20.33  ? 567  VAL B N   1 
ATOM   8779  C  CA  . VAL B 1  469 ? -30.959 24.787  150.915 1.00 18.73  ? 567  VAL B CA  1 
ATOM   8780  C  C   . VAL B 1  469 ? -29.585 25.121  151.478 1.00 16.28  ? 567  VAL B C   1 
ATOM   8781  O  O   . VAL B 1  469 ? -29.470 25.662  152.576 1.00 15.69  ? 567  VAL B O   1 
ATOM   8782  C  CB  . VAL B 1  469 ? -31.650 26.081  150.438 1.00 18.64  ? 567  VAL B CB  1 
ATOM   8783  C  CG1 . VAL B 1  469 ? -30.868 26.716  149.300 1.00 14.31  ? 567  VAL B CG1 1 
ATOM   8784  C  CG2 . VAL B 1  469 ? -33.079 25.787  150.008 1.00 16.44  ? 567  VAL B CG2 1 
ATOM   8785  N  N   . VAL B 1  470 ? -28.542 24.785  150.731 1.00 16.13  ? 568  VAL B N   1 
ATOM   8786  C  CA  . VAL B 1  470 ? -27.189 25.112  151.151 1.00 17.23  ? 568  VAL B CA  1 
ATOM   8787  C  C   . VAL B 1  470 ? -26.552 26.093  150.183 1.00 22.67  ? 568  VAL B C   1 
ATOM   8788  O  O   . VAL B 1  470 ? -26.834 26.075  148.985 1.00 26.70  ? 568  VAL B O   1 
ATOM   8789  C  CB  . VAL B 1  470 ? -26.297 23.857  151.255 1.00 16.25  ? 568  VAL B CB  1 
ATOM   8790  C  CG1 . VAL B 1  470 ? -26.811 22.933  152.341 1.00 18.94  ? 568  VAL B CG1 1 
ATOM   8791  C  CG2 . VAL B 1  470 ? -26.232 23.131  149.920 1.00 13.78  ? 568  VAL B CG2 1 
ATOM   8792  N  N   . ILE B 1  471 ? -25.713 26.970  150.719 1.00 22.18  ? 569  ILE B N   1 
ATOM   8793  C  CA  . ILE B 1  471 ? -24.902 27.838  149.886 1.00 17.84  ? 569  ILE B CA  1 
ATOM   8794  C  C   . ILE B 1  471 ? -23.615 27.115  149.535 1.00 15.32  ? 569  ILE B C   1 
ATOM   8795  O  O   . ILE B 1  471 ? -22.860 26.717  150.417 1.00 18.76  ? 569  ILE B O   1 
ATOM   8796  C  CB  . ILE B 1  471 ? -24.572 29.168  150.583 1.00 17.88  ? 569  ILE B CB  1 
ATOM   8797  C  CG1 . ILE B 1  471 ? -25.851 29.963  150.844 1.00 17.62  ? 569  ILE B CG1 1 
ATOM   8798  C  CG2 . ILE B 1  471 ? -23.624 29.991  149.728 1.00 17.63  ? 569  ILE B CG2 1 
ATOM   8799  C  CD1 . ILE B 1  471 ? -26.431 30.598  149.602 1.00 14.97  ? 569  ILE B CD1 1 
ATOM   8800  N  N   . SER B 1  472 ? -23.381 26.917  148.244 1.00 19.19  ? 570  SER B N   1 
ATOM   8801  C  CA  . SER B 1  472 ? -22.118 26.351  147.797 1.00 20.67  ? 570  SER B CA  1 
ATOM   8802  C  C   . SER B 1  472 ? -21.276 27.483  147.223 1.00 18.80  ? 570  SER B C   1 
ATOM   8803  O  O   . SER B 1  472 ? -21.624 28.076  146.203 1.00 18.09  ? 570  SER B O   1 
ATOM   8804  C  CB  . SER B 1  472 ? -22.341 25.246  146.766 1.00 22.31  ? 570  SER B CB  1 
ATOM   8805  O  OG  . SER B 1  472 ? -21.107 24.781  146.251 1.00 27.17  ? 570  SER B OG  1 
ATOM   8806  N  N   . GLY B 1  473 ? -20.168 27.783  147.890 1.00 16.95  ? 571  GLY B N   1 
ATOM   8807  C  CA  . GLY B 1  473 ? -19.384 28.960  147.572 1.00 13.45  ? 571  GLY B CA  1 
ATOM   8808  C  C   . GLY B 1  473 ? -18.324 28.731  146.518 1.00 13.97  ? 571  GLY B C   1 
ATOM   8809  O  O   . GLY B 1  473 ? -17.893 27.601  146.294 1.00 15.40  ? 571  GLY B O   1 
ATOM   8810  N  N   . LEU B 1  474 ? -17.919 29.818  145.865 1.00 14.90  ? 572  LEU B N   1 
ATOM   8811  C  CA  . LEU B 1  474 ? -16.825 29.804  144.897 1.00 18.26  ? 572  LEU B CA  1 
ATOM   8812  C  C   . LEU B 1  474 ? -17.046 28.793  143.781 1.00 19.39  ? 572  LEU B C   1 
ATOM   8813  O  O   . LEU B 1  474 ? -16.202 27.934  143.523 1.00 24.06  ? 572  LEU B O   1 
ATOM   8814  C  CB  . LEU B 1  474 ? -15.510 29.528  145.614 1.00 17.38  ? 572  LEU B CB  1 
ATOM   8815  C  CG  . LEU B 1  474 ? -15.246 30.606  146.662 1.00 18.42  ? 572  LEU B CG  1 
ATOM   8816  C  CD1 . LEU B 1  474 ? -15.181 29.992  148.045 1.00 18.83  ? 572  LEU B CD1 1 
ATOM   8817  C  CD2 . LEU B 1  474 ? -13.976 31.371  146.339 1.00 16.67  ? 572  LEU B CD2 1 
ATOM   8818  N  N   . CYS B 1  475 ? -18.191 28.915  143.119 1.00 16.63  ? 573  CYS B N   1 
ATOM   8819  C  CA  . CYS B 1  475 ? -18.571 27.993  142.062 1.00 18.44  ? 573  CYS B CA  1 
ATOM   8820  C  C   . CYS B 1  475 ? -18.385 28.604  140.677 1.00 20.92  ? 573  CYS B C   1 
ATOM   8821  O  O   . CYS B 1  475 ? -18.620 29.796  140.480 1.00 24.71  ? 573  CYS B O   1 
ATOM   8822  C  CB  . CYS B 1  475 ? -20.027 27.557  142.242 1.00 16.88  ? 573  CYS B CB  1 
ATOM   8823  S  SG  . CYS B 1  475 ? -20.318 26.509  143.678 1.00 19.23  ? 573  CYS B SG  1 
ATOM   8824  N  N   . ASN B 1  476 ? -17.936 27.783  139.733 1.00 24.72  ? 574  ASN B N   1 
ATOM   8825  C  CA  . ASN B 1  476 ? -18.045 28.080  138.302 1.00 26.54  ? 574  ASN B CA  1 
ATOM   8826  C  C   . ASN B 1  476 ? -17.238 29.280  137.796 1.00 24.84  ? 574  ASN B C   1 
ATOM   8827  O  O   . ASN B 1  476 ? -16.562 29.193  136.770 1.00 25.95  ? 574  ASN B O   1 
ATOM   8828  C  CB  . ASN B 1  476 ? -19.521 28.280  137.944 1.00 24.02  ? 574  ASN B CB  1 
ATOM   8829  C  CG  . ASN B 1  476 ? -20.381 27.096  138.345 1.00 23.08  ? 574  ASN B CG  1 
ATOM   8830  O  OD1 . ASN B 1  476 ? -19.907 25.959  138.392 1.00 22.45  ? 574  ASN B OD1 1 
ATOM   8831  N  ND2 . ASN B 1  476 ? -21.648 27.357  138.647 1.00 22.58  ? 574  ASN B ND2 1 
ATOM   8832  N  N   . VAL B 1  477 ? -17.311 30.397  138.512 1.00 22.11  ? 575  VAL B N   1 
ATOM   8833  C  CA  . VAL B 1  477 ? -16.631 31.621  138.104 1.00 21.38  ? 575  VAL B CA  1 
ATOM   8834  C  C   . VAL B 1  477 ? -16.507 32.543  139.314 1.00 23.81  ? 575  VAL B C   1 
ATOM   8835  O  O   . VAL B 1  477 ? -17.422 32.627  140.133 1.00 30.15  ? 575  VAL B O   1 
ATOM   8836  C  CB  . VAL B 1  477 ? -17.384 32.327  136.947 1.00 21.75  ? 575  VAL B CB  1 
ATOM   8837  C  CG1 . VAL B 1  477 ? -18.842 32.578  137.319 1.00 20.49  ? 575  VAL B CG1 1 
ATOM   8838  C  CG2 . VAL B 1  477 ? -16.684 33.619  136.542 1.00 19.42  ? 575  VAL B CG2 1 
ATOM   8839  N  N   . TYR B 1  478 ? -15.374 33.228  139.435 1.00 21.19  ? 576  TYR B N   1 
ATOM   8840  C  CA  . TYR B 1  478 ? -15.128 34.044  140.616 1.00 18.88  ? 576  TYR B CA  1 
ATOM   8841  C  C   . TYR B 1  478 ? -15.478 35.512  140.398 1.00 20.44  ? 576  TYR B C   1 
ATOM   8842  O  O   . TYR B 1  478 ? -14.962 36.160  139.488 1.00 24.54  ? 576  TYR B O   1 
ATOM   8843  C  CB  . TYR B 1  478 ? -13.670 33.919  141.059 1.00 19.44  ? 576  TYR B CB  1 
ATOM   8844  C  CG  . TYR B 1  478 ? -13.404 34.585  142.387 1.00 20.52  ? 576  TYR B CG  1 
ATOM   8845  C  CD1 . TYR B 1  478 ? -13.987 34.104  143.552 1.00 19.31  ? 576  TYR B CD1 1 
ATOM   8846  C  CD2 . TYR B 1  478 ? -12.581 35.699  142.478 1.00 17.36  ? 576  TYR B CD2 1 
ATOM   8847  C  CE1 . TYR B 1  478 ? -13.753 34.707  144.770 1.00 23.37  ? 576  TYR B CE1 1 
ATOM   8848  C  CE2 . TYR B 1  478 ? -12.341 36.311  143.693 1.00 22.17  ? 576  TYR B CE2 1 
ATOM   8849  C  CZ  . TYR B 1  478 ? -12.928 35.810  144.836 1.00 22.91  ? 576  TYR B CZ  1 
ATOM   8850  O  OH  . TYR B 1  478 ? -12.697 36.412  146.052 1.00 22.19  ? 576  TYR B OH  1 
ATOM   8851  N  N   . THR B 1  479 ? -16.357 36.026  141.252 1.00 16.68  ? 577  THR B N   1 
ATOM   8852  C  CA  . THR B 1  479 ? -16.822 37.404  141.162 1.00 22.42  ? 577  THR B CA  1 
ATOM   8853  C  C   . THR B 1  479 ? -16.659 38.110  142.502 1.00 24.02  ? 577  THR B C   1 
ATOM   8854  O  O   . THR B 1  479 ? -17.378 39.066  142.803 1.00 20.16  ? 577  THR B O   1 
ATOM   8855  C  CB  . THR B 1  479 ? -18.298 37.482  140.723 1.00 20.19  ? 577  THR B CB  1 
ATOM   8856  O  OG1 . THR B 1  479 ? -19.126 36.846  141.706 1.00 15.82  ? 577  THR B OG1 1 
ATOM   8857  C  CG2 . THR B 1  479 ? -18.494 36.792  139.381 1.00 17.23  ? 577  THR B CG2 1 
ATOM   8858  N  N   . HIS B 1  480 ? -15.713 37.614  143.298 1.00 24.86  ? 578  HIS B N   1 
ATOM   8859  C  CA  . HIS B 1  480 ? -15.391 38.159  144.616 1.00 21.01  ? 578  HIS B CA  1 
ATOM   8860  C  C   . HIS B 1  480 ? -16.539 38.008  145.613 1.00 17.72  ? 578  HIS B C   1 
ATOM   8861  O  O   . HIS B 1  480 ? -17.185 36.964  145.671 1.00 17.54  ? 578  HIS B O   1 
ATOM   8862  C  CB  . HIS B 1  480 ? -14.975 39.627  144.508 1.00 17.55  ? 578  HIS B CB  1 
ATOM   8863  C  CG  . HIS B 1  480 ? -13.695 39.839  143.761 1.00 18.80  ? 578  HIS B CG  1 
ATOM   8864  N  ND1 . HIS B 1  480 ? -12.512 40.157  144.390 1.00 18.47  ? 578  HIS B ND1 1 
ATOM   8865  C  CD2 . HIS B 1  480 ? -13.414 39.777  142.438 1.00 20.98  ? 578  HIS B CD2 1 
ATOM   8866  C  CE1 . HIS B 1  480 ? -11.555 40.283  143.487 1.00 17.96  ? 578  HIS B CE1 1 
ATOM   8867  N  NE2 . HIS B 1  480 ? -12.076 40.056  142.295 1.00 21.86  ? 578  HIS B NE2 1 
ATOM   8868  N  N   . TYR B 1  481 ? -16.788 39.053  146.395 1.00 17.80  ? 579  TYR B N   1 
ATOM   8869  C  CA  . TYR B 1  481 ? -17.667 38.947  147.558 1.00 18.63  ? 579  TYR B CA  1 
ATOM   8870  C  C   . TYR B 1  481 ? -19.082 39.474  147.332 1.00 20.51  ? 579  TYR B C   1 
ATOM   8871  O  O   . TYR B 1  481 ? -19.329 40.281  146.435 1.00 25.69  ? 579  TYR B O   1 
ATOM   8872  C  CB  . TYR B 1  481 ? -17.041 39.678  148.746 1.00 17.97  ? 579  TYR B CB  1 
ATOM   8873  C  CG  . TYR B 1  481 ? -15.814 38.992  149.301 1.00 20.66  ? 579  TYR B CG  1 
ATOM   8874  C  CD1 . TYR B 1  481 ? -14.605 39.027  148.619 1.00 21.42  ? 579  TYR B CD1 1 
ATOM   8875  C  CD2 . TYR B 1  481 ? -15.865 38.310  150.510 1.00 19.34  ? 579  TYR B CD2 1 
ATOM   8876  C  CE1 . TYR B 1  481 ? -13.484 38.399  149.120 1.00 21.24  ? 579  TYR B CE1 1 
ATOM   8877  C  CE2 . TYR B 1  481 ? -14.748 37.681  151.021 1.00 16.63  ? 579  TYR B CE2 1 
ATOM   8878  C  CZ  . TYR B 1  481 ? -13.559 37.731  150.323 1.00 18.47  ? 579  TYR B CZ  1 
ATOM   8879  O  OH  . TYR B 1  481 ? -12.441 37.105  150.824 1.00 17.64  ? 579  TYR B OH  1 
ATOM   8880  N  N   . ILE B 1  482 ? -20.010 38.994  148.155 1.00 15.79  ? 580  ILE B N   1 
ATOM   8881  C  CA  . ILE B 1  482 ? -21.384 39.480  148.142 1.00 18.01  ? 580  ILE B CA  1 
ATOM   8882  C  C   . ILE B 1  482 ? -21.831 39.842  149.558 1.00 20.12  ? 580  ILE B C   1 
ATOM   8883  O  O   . ILE B 1  482 ? -21.886 38.984  150.439 1.00 23.33  ? 580  ILE B O   1 
ATOM   8884  C  CB  . ILE B 1  482 ? -22.366 38.440  147.551 1.00 18.98  ? 580  ILE B CB  1 
ATOM   8885  C  CG1 . ILE B 1  482 ? -22.051 38.152  146.080 1.00 17.84  ? 580  ILE B CG1 1 
ATOM   8886  C  CG2 . ILE B 1  482 ? -23.802 38.922  147.690 1.00 19.94  ? 580  ILE B CG2 1 
ATOM   8887  C  CD1 . ILE B 1  482 ? -21.041 37.036  145.859 1.00 14.59  ? 580  ILE B CD1 1 
ATOM   8888  N  N   . THR B 1  483 ? -22.131 41.119  149.775 1.00 18.42  ? 581  THR B N   1 
ATOM   8889  C  CA  . THR B 1  483 ? -22.598 41.595  151.074 1.00 16.11  ? 581  THR B CA  1 
ATOM   8890  C  C   . THR B 1  483 ? -24.059 42.016  150.978 1.00 17.17  ? 581  THR B C   1 
ATOM   8891  O  O   . THR B 1  483 ? -24.592 42.175  149.881 1.00 18.05  ? 581  THR B O   1 
ATOM   8892  C  CB  . THR B 1  483 ? -21.766 42.787  151.587 1.00 18.44  ? 581  THR B CB  1 
ATOM   8893  O  OG1 . THR B 1  483 ? -21.782 43.840  150.616 1.00 14.89  ? 581  THR B OG1 1 
ATOM   8894  C  CG2 . THR B 1  483 ? -20.332 42.368  151.849 1.00 14.24  ? 581  THR B CG2 1 
ATOM   8895  N  N   . THR B 1  484 ? -24.709 42.190  152.123 1.00 18.08  ? 582  THR B N   1 
ATOM   8896  C  CA  . THR B 1  484 ? -26.059 42.740  152.134 1.00 20.86  ? 582  THR B CA  1 
ATOM   8897  C  C   . THR B 1  484 ? -25.986 44.231  151.829 1.00 22.35  ? 582  THR B C   1 
ATOM   8898  O  O   . THR B 1  484 ? -24.924 44.842  151.957 1.00 17.78  ? 582  THR B O   1 
ATOM   8899  C  CB  . THR B 1  484 ? -26.769 42.524  153.483 1.00 21.47  ? 582  THR B CB  1 
ATOM   8900  O  OG1 . THR B 1  484 ? -26.149 43.334  154.489 1.00 21.27  ? 582  THR B OG1 1 
ATOM   8901  C  CG2 . THR B 1  484 ? -26.710 41.061  153.894 1.00 21.17  ? 582  THR B CG2 1 
ATOM   8902  N  N   . TYR B 1  485 ? -27.112 44.805  151.414 1.00 23.05  ? 583  TYR B N   1 
ATOM   8903  C  CA  . TYR B 1  485 ? -27.197 46.235  151.133 1.00 22.63  ? 583  TYR B CA  1 
ATOM   8904  C  C   . TYR B 1  485 ? -26.701 47.058  152.322 1.00 25.57  ? 583  TYR B C   1 
ATOM   8905  O  O   . TYR B 1  485 ? -25.974 48.037  152.155 1.00 24.58  ? 583  TYR B O   1 
ATOM   8906  C  CB  . TYR B 1  485 ? -28.636 46.626  150.786 1.00 21.07  ? 583  TYR B CB  1 
ATOM   8907  C  CG  . TYR B 1  485 ? -28.817 48.094  150.481 1.00 17.98  ? 583  TYR B CG  1 
ATOM   8908  C  CD1 . TYR B 1  485 ? -28.595 48.587  149.203 1.00 18.26  ? 583  TYR B CD1 1 
ATOM   8909  C  CD2 . TYR B 1  485 ? -29.205 48.988  151.471 1.00 21.26  ? 583  TYR B CD2 1 
ATOM   8910  C  CE1 . TYR B 1  485 ? -28.759 49.929  148.917 1.00 20.15  ? 583  TYR B CE1 1 
ATOM   8911  C  CE2 . TYR B 1  485 ? -29.368 50.332  151.195 1.00 23.38  ? 583  TYR B CE2 1 
ATOM   8912  C  CZ  . TYR B 1  485 ? -29.144 50.797  149.917 1.00 22.61  ? 583  TYR B CZ  1 
ATOM   8913  O  OH  . TYR B 1  485 ? -29.307 52.134  149.639 1.00 25.99  ? 583  TYR B OH  1 
ATOM   8914  N  N   . GLU B 1  486 ? -27.097 46.643  153.520 1.00 28.63  ? 584  GLU B N   1 
ATOM   8915  C  CA  . GLU B 1  486 ? -26.722 47.334  154.747 1.00 17.31  ? 584  GLU B CA  1 
ATOM   8916  C  C   . GLU B 1  486 ? -25.227 47.196  155.019 1.00 21.81  ? 584  GLU B C   1 
ATOM   8917  O  O   . GLU B 1  486 ? -24.566 48.156  155.414 1.00 26.04  ? 584  GLU B O   1 
ATOM   8918  C  CB  . GLU B 1  486 ? -27.522 46.789  155.935 1.00 17.43  ? 584  GLU B CB  1 
ATOM   8919  C  CG  . GLU B 1  486 ? -29.029 46.991  155.836 1.00 17.99  ? 584  GLU B CG  1 
ATOM   8920  C  CD  . GLU B 1  486 ? -29.724 45.902  155.034 1.00 28.90  ? 584  GLU B CD  1 
ATOM   8921  O  OE1 . GLU B 1  486 ? -29.030 45.092  154.384 1.00 30.32  ? 584  GLU B OE1 1 
ATOM   8922  O  OE2 . GLU B 1  486 ? -30.972 45.855  155.055 1.00 28.90  ? 584  GLU B OE2 1 
ATOM   8923  N  N   . GLU B 1  487 ? -24.701 45.994  154.811 1.00 16.19  ? 585  GLU B N   1 
ATOM   8924  C  CA  . GLU B 1  487 ? -23.274 45.738  154.976 1.00 17.37  ? 585  GLU B CA  1 
ATOM   8925  C  C   . GLU B 1  487 ? -22.443 46.509  153.953 1.00 18.02  ? 585  GLU B C   1 
ATOM   8926  O  O   . GLU B 1  487 ? -21.335 46.957  154.247 1.00 19.43  ? 585  GLU B O   1 
ATOM   8927  C  CB  . GLU B 1  487 ? -22.987 44.239  154.863 1.00 16.55  ? 585  GLU B CB  1 
ATOM   8928  C  CG  . GLU B 1  487 ? -23.409 43.428  156.079 1.00 15.08  ? 585  GLU B CG  1 
ATOM   8929  C  CD  . GLU B 1  487 ? -23.483 41.940  155.791 1.00 19.60  ? 585  GLU B CD  1 
ATOM   8930  O  OE1 . GLU B 1  487 ? -22.939 41.502  154.757 1.00 24.79  ? 585  GLU B OE1 1 
ATOM   8931  O  OE2 . GLU B 1  487 ? -24.081 41.207  156.606 1.00 19.14  ? 585  GLU B OE2 1 
ATOM   8932  N  N   . TYR B 1  488 ? -22.994 46.660  152.752 1.00 20.28  ? 586  TYR B N   1 
ATOM   8933  C  CA  . TYR B 1  488 ? -22.309 47.325  151.648 1.00 16.45  ? 586  TYR B CA  1 
ATOM   8934  C  C   . TYR B 1  488 ? -22.009 48.784  151.971 1.00 18.85  ? 586  TYR B C   1 
ATOM   8935  O  O   . TYR B 1  488 ? -21.015 49.342  151.506 1.00 17.50  ? 586  TYR B O   1 
ATOM   8936  C  CB  . TYR B 1  488 ? -23.155 47.226  150.376 1.00 19.05  ? 586  TYR B CB  1 
ATOM   8937  C  CG  . TYR B 1  488 ? -22.529 47.830  149.135 1.00 16.97  ? 586  TYR B CG  1 
ATOM   8938  C  CD1 . TYR B 1  488 ? -22.700 49.174  148.829 1.00 17.78  ? 586  TYR B CD1 1 
ATOM   8939  C  CD2 . TYR B 1  488 ? -21.783 47.050  148.260 1.00 16.68  ? 586  TYR B CD2 1 
ATOM   8940  C  CE1 . TYR B 1  488 ? -22.136 49.727  147.696 1.00 18.29  ? 586  TYR B CE1 1 
ATOM   8941  C  CE2 . TYR B 1  488 ? -21.217 47.594  147.123 1.00 19.60  ? 586  TYR B CE2 1 
ATOM   8942  C  CZ  . TYR B 1  488 ? -21.398 48.934  146.847 1.00 18.48  ? 586  TYR B CZ  1 
ATOM   8943  O  OH  . TYR B 1  488 ? -20.838 49.481  145.717 1.00 18.84  ? 586  TYR B OH  1 
ATOM   8944  N  N   . GLN B 1  489 ? -22.879 49.393  152.770 1.00 23.48  ? 587  GLN B N   1 
ATOM   8945  C  CA  . GLN B 1  489 ? -22.754 50.800  153.128 1.00 22.69  ? 587  GLN B CA  1 
ATOM   8946  C  C   . GLN B 1  489 ? -21.466 51.085  153.897 1.00 24.21  ? 587  GLN B C   1 
ATOM   8947  O  O   . GLN B 1  489 ? -20.848 52.133  153.713 1.00 29.70  ? 587  GLN B O   1 
ATOM   8948  C  CB  . GLN B 1  489 ? -23.961 51.246  153.957 1.00 23.89  ? 587  GLN B CB  1 
ATOM   8949  C  CG  . GLN B 1  489 ? -25.313 51.010  153.294 1.00 20.71  ? 587  GLN B CG  1 
ATOM   8950  C  CD  . GLN B 1  489 ? -25.397 51.587  151.894 1.00 21.16  ? 587  GLN B CD  1 
ATOM   8951  O  OE1 . GLN B 1  489 ? -25.147 52.773  151.680 1.00 20.83  ? 587  GLN B OE1 1 
ATOM   8952  N  NE2 . GLN B 1  489 ? -25.765 50.748  150.933 1.00 18.93  ? 587  GLN B NE2 1 
ATOM   8953  N  N   . ALA B 1  490 ? -21.065 50.145  154.751 1.00 23.33  ? 588  ALA B N   1 
ATOM   8954  C  CA  . ALA B 1  490 ? -19.910 50.331  155.629 1.00 21.57  ? 588  ALA B CA  1 
ATOM   8955  C  C   . ALA B 1  490 ? -18.590 50.280  154.864 1.00 22.47  ? 588  ALA B C   1 
ATOM   8956  O  O   . ALA B 1  490 ? -17.582 50.821  155.319 1.00 27.67  ? 588  ALA B O   1 
ATOM   8957  C  CB  . ALA B 1  490 ? -19.917 49.289  156.730 1.00 17.57  ? 588  ALA B CB  1 
ATOM   8958  N  N   . GLN B 1  491 ? -18.611 49.617  153.713 1.00 19.23  ? 589  GLN B N   1 
ATOM   8959  C  CA  . GLN B 1  491 ? -17.466 49.556  152.805 1.00 19.32  ? 589  GLN B CA  1 
ATOM   8960  C  C   . GLN B 1  491 ? -16.197 48.948  153.400 1.00 23.72  ? 589  GLN B C   1 
ATOM   8961  O  O   . GLN B 1  491 ? -15.093 49.433  153.148 1.00 22.33  ? 589  GLN B O   1 
ATOM   8962  C  CB  . GLN B 1  491 ? -17.154 50.953  152.261 1.00 19.52  ? 589  GLN B CB  1 
ATOM   8963  C  CG  . GLN B 1  491 ? -17.970 51.306  151.040 1.00 21.29  ? 589  GLN B CG  1 
ATOM   8964  C  CD  . GLN B 1  491 ? -17.825 50.266  149.946 1.00 18.30  ? 589  GLN B CD  1 
ATOM   8965  O  OE1 . GLN B 1  491 ? -16.744 50.084  149.388 1.00 18.40  ? 589  GLN B OE1 1 
ATOM   8966  N  NE2 . GLN B 1  491 ? -18.913 49.571  149.641 1.00 20.72  ? 589  GLN B NE2 1 
ATOM   8967  N  N   . ARG B 1  492 ? -16.354 47.885  154.182 1.00 26.05  ? 590  ARG B N   1 
ATOM   8968  C  CA  . ARG B 1  492 ? -15.212 47.062  154.559 1.00 22.96  ? 590  ARG B CA  1 
ATOM   8969  C  C   . ARG B 1  492 ? -14.823 46.195  153.365 1.00 22.24  ? 590  ARG B C   1 
ATOM   8970  O  O   . ARG B 1  492 ? -15.472 46.259  152.320 1.00 24.21  ? 590  ARG B O   1 
ATOM   8971  C  CB  . ARG B 1  492 ? -15.527 46.207  155.789 1.00 24.05  ? 590  ARG B CB  1 
ATOM   8972  C  CG  . ARG B 1  492 ? -15.560 47.003  157.088 1.00 29.46  ? 590  ARG B CG  1 
ATOM   8973  C  CD  . ARG B 1  492 ? -15.769 46.112  158.303 1.00 30.71  ? 590  ARG B CD  1 
ATOM   8974  N  NE  . ARG B 1  492 ? -14.693 45.141  158.481 1.00 30.06  ? 590  ARG B NE  1 
ATOM   8975  C  CZ  . ARG B 1  492 ? -13.528 45.407  159.063 1.00 24.38  ? 590  ARG B CZ  1 
ATOM   8976  N  NH1 . ARG B 1  492 ? -13.278 46.620  159.532 1.00 21.50  ? 590  ARG B NH1 1 
ATOM   8977  N  NH2 . ARG B 1  492 ? -12.614 44.454  159.180 1.00 22.03  ? 590  ARG B NH2 1 
ATOM   8978  N  N   . TYR B 1  493 ? -13.767 45.399  153.523 1.00 18.21  ? 591  TYR B N   1 
ATOM   8979  C  CA  . TYR B 1  493 ? -13.194 44.619  152.422 1.00 17.26  ? 591  TYR B CA  1 
ATOM   8980  C  C   . TYR B 1  493 ? -14.225 43.850  151.594 1.00 19.68  ? 591  TYR B C   1 
ATOM   8981  O  O   . TYR B 1  493 ? -14.213 43.917  150.364 1.00 19.00  ? 591  TYR B O   1 
ATOM   8982  C  CB  . TYR B 1  493 ? -12.147 43.636  152.955 1.00 16.60  ? 591  TYR B CB  1 
ATOM   8983  C  CG  . TYR B 1  493 ? -11.551 42.743  151.887 1.00 17.82  ? 591  TYR B CG  1 
ATOM   8984  C  CD1 . TYR B 1  493 ? -10.498 43.182  151.094 1.00 16.31  ? 591  TYR B CD1 1 
ATOM   8985  C  CD2 . TYR B 1  493 ? -12.044 41.461  151.671 1.00 17.76  ? 591  TYR B CD2 1 
ATOM   8986  C  CE1 . TYR B 1  493 ? -9.950  42.366  150.117 1.00 19.42  ? 591  TYR B CE1 1 
ATOM   8987  C  CE2 . TYR B 1  493 ? -11.503 40.642  150.700 1.00 16.75  ? 591  TYR B CE2 1 
ATOM   8988  C  CZ  . TYR B 1  493 ? -10.459 41.097  149.926 1.00 18.98  ? 591  TYR B CZ  1 
ATOM   8989  O  OH  . TYR B 1  493 ? -9.925  40.279  148.958 1.00 16.31  ? 591  TYR B OH  1 
ATOM   8990  N  N   . GLU B 1  494 ? -15.104 43.116  152.267 1.00 20.19  ? 592  GLU B N   1 
ATOM   8991  C  CA  . GLU B 1  494 ? -16.104 42.308  151.576 1.00 17.23  ? 592  GLU B CA  1 
ATOM   8992  C  C   . GLU B 1  494 ? -17.077 43.193  150.804 1.00 24.78  ? 592  GLU B C   1 
ATOM   8993  O  O   . GLU B 1  494 ? -17.495 42.855  149.695 1.00 24.58  ? 592  GLU B O   1 
ATOM   8994  C  CB  . GLU B 1  494 ? -16.871 41.426  152.565 1.00 14.17  ? 592  GLU B CB  1 
ATOM   8995  C  CG  . GLU B 1  494 ? -16.004 40.483  153.391 1.00 13.92  ? 592  GLU B CG  1 
ATOM   8996  C  CD  . GLU B 1  494 ? -15.492 41.116  154.671 1.00 14.89  ? 592  GLU B CD  1 
ATOM   8997  O  OE1 . GLU B 1  494 ? -15.761 42.313  154.900 1.00 15.94  ? 592  GLU B OE1 1 
ATOM   8998  O  OE2 . GLU B 1  494 ? -14.825 40.411  155.456 1.00 17.38  ? 592  GLU B OE2 1 
ATOM   8999  N  N   . ALA B 1  495 ? -17.424 44.331  151.395 1.00 25.28  ? 593  ALA B N   1 
ATOM   9000  C  CA  . ALA B 1  495 ? -18.338 45.279  150.771 1.00 21.76  ? 593  ALA B CA  1 
ATOM   9001  C  C   . ALA B 1  495 ? -17.678 45.969  149.582 1.00 22.82  ? 593  ALA B C   1 
ATOM   9002  O  O   . ALA B 1  495 ? -18.322 46.228  148.565 1.00 23.97  ? 593  ALA B O   1 
ATOM   9003  C  CB  . ALA B 1  495 ? -18.809 46.301  151.786 1.00 22.53  ? 593  ALA B CB  1 
ATOM   9004  N  N   . ALA B 1  496 ? -16.390 46.266  149.719 1.00 23.22  ? 594  ALA B N   1 
ATOM   9005  C  CA  . ALA B 1  496 ? -15.631 46.878  148.635 1.00 21.87  ? 594  ALA B CA  1 
ATOM   9006  C  C   . ALA B 1  496 ? -15.387 45.873  147.516 1.00 22.57  ? 594  ALA B C   1 
ATOM   9007  O  O   . ALA B 1  496 ? -15.120 46.255  146.377 1.00 17.56  ? 594  ALA B O   1 
ATOM   9008  C  CB  . ALA B 1  496 ? -14.312 47.431  149.152 1.00 21.82  ? 594  ALA B CB  1 
ATOM   9009  N  N   . SER B 1  497 ? -15.487 44.589  147.846 1.00 21.05  ? 595  SER B N   1 
ATOM   9010  C  CA  . SER B 1  497 ? -15.282 43.529  146.866 1.00 17.96  ? 595  SER B CA  1 
ATOM   9011  C  C   . SER B 1  497 ? -16.614 43.011  146.340 1.00 20.48  ? 595  SER B C   1 
ATOM   9012  O  O   . SER B 1  497 ? -16.680 41.947  145.727 1.00 21.74  ? 595  SER B O   1 
ATOM   9013  C  CB  . SER B 1  497 ? -14.472 42.379  147.470 1.00 17.56  ? 595  SER B CB  1 
ATOM   9014  O  OG  . SER B 1  497 ? -13.201 42.821  147.915 1.00 17.70  ? 595  SER B OG  1 
ATOM   9015  N  N   . THR B 1  498 ? -17.676 43.769  146.585 1.00 15.97  ? 596  THR B N   1 
ATOM   9016  C  CA  . THR B 1  498 ? -18.969 43.470  145.990 1.00 17.08  ? 596  THR B CA  1 
ATOM   9017  C  C   . THR B 1  498 ? -19.027 44.227  144.671 1.00 20.59  ? 596  THR B C   1 
ATOM   9018  O  O   . THR B 1  498 ? -19.463 45.376  144.617 1.00 26.21  ? 596  THR B O   1 
ATOM   9019  C  CB  . THR B 1  498 ? -20.132 43.873  146.911 1.00 19.46  ? 596  THR B CB  1 
ATOM   9020  O  OG1 . THR B 1  498 ? -19.980 43.225  148.180 1.00 19.82  ? 596  THR B OG1 1 
ATOM   9021  C  CG2 . THR B 1  498 ? -21.460 43.469  146.305 1.00 15.54  ? 596  THR B CG2 1 
ATOM   9022  N  N   . ILE B 1  499 ? -18.581 43.568  143.607 1.00 18.28  ? 597  ILE B N   1 
ATOM   9023  C  CA  . ILE B 1  499 ? -18.191 44.263  142.386 1.00 19.80  ? 597  ILE B CA  1 
ATOM   9024  C  C   . ILE B 1  499 ? -19.355 44.768  141.535 1.00 21.10  ? 597  ILE B C   1 
ATOM   9025  O  O   . ILE B 1  499 ? -19.177 45.678  140.733 1.00 24.23  ? 597  ILE B O   1 
ATOM   9026  C  CB  . ILE B 1  499 ? -17.287 43.367  141.508 1.00 22.08  ? 597  ILE B CB  1 
ATOM   9027  C  CG1 . ILE B 1  499 ? -18.045 42.137  141.013 1.00 20.14  ? 597  ILE B CG1 1 
ATOM   9028  C  CG2 . ILE B 1  499 ? -16.050 42.943  142.282 1.00 17.80  ? 597  ILE B CG2 1 
ATOM   9029  C  CD1 . ILE B 1  499 ? -17.217 41.246  140.110 1.00 18.13  ? 597  ILE B CD1 1 
ATOM   9030  N  N   . TYR B 1  500 ? -20.540 44.194  141.700 1.00 17.64  ? 598  TYR B N   1 
ATOM   9031  C  CA  . TYR B 1  500 ? -21.678 44.631  140.896 1.00 24.21  ? 598  TYR B CA  1 
ATOM   9032  C  C   . TYR B 1  500 ? -22.564 45.628  141.639 1.00 22.27  ? 598  TYR B C   1 
ATOM   9033  O  O   . TYR B 1  500 ? -23.716 45.843  141.267 1.00 23.48  ? 598  TYR B O   1 
ATOM   9034  C  CB  . TYR B 1  500 ? -22.500 43.423  140.440 1.00 25.68  ? 598  TYR B CB  1 
ATOM   9035  C  CG  . TYR B 1  500 ? -21.686 42.420  139.657 1.00 27.67  ? 598  TYR B CG  1 
ATOM   9036  C  CD1 . TYR B 1  500 ? -21.214 42.722  138.384 1.00 27.47  ? 598  TYR B CD1 1 
ATOM   9037  C  CD2 . TYR B 1  500 ? -21.383 41.174  140.190 1.00 22.32  ? 598  TYR B CD2 1 
ATOM   9038  C  CE1 . TYR B 1  500 ? -20.465 41.812  137.665 1.00 19.03  ? 598  TYR B CE1 1 
ATOM   9039  C  CE2 . TYR B 1  500 ? -20.635 40.256  139.476 1.00 18.73  ? 598  TYR B CE2 1 
ATOM   9040  C  CZ  . TYR B 1  500 ? -20.178 40.580  138.216 1.00 21.46  ? 598  TYR B CZ  1 
ATOM   9041  O  OH  . TYR B 1  500 ? -19.431 39.672  137.500 1.00 21.86  ? 598  TYR B OH  1 
ATOM   9042  N  N   . GLY B 1  501 ? -22.020 46.243  142.683 1.00 23.03  ? 599  GLY B N   1 
ATOM   9043  C  CA  . GLY B 1  501 ? -22.733 47.286  143.398 1.00 24.64  ? 599  GLY B CA  1 
ATOM   9044  C  C   . GLY B 1  501 ? -23.532 46.816  144.601 1.00 22.65  ? 599  GLY B C   1 
ATOM   9045  O  O   . GLY B 1  501 ? -23.505 45.636  144.955 1.00 17.90  ? 599  GLY B O   1 
ATOM   9046  N  N   . PRO B 1  502 ? -24.255 47.748  145.238 1.00 26.02  ? 600  PRO B N   1 
ATOM   9047  C  CA  . PRO B 1  502 ? -25.010 47.514  146.476 1.00 28.95  ? 600  PRO B CA  1 
ATOM   9048  C  C   . PRO B 1  502 ? -26.171 46.533  146.329 1.00 30.85  ? 600  PRO B C   1 
ATOM   9049  O  O   . PRO B 1  502 ? -26.640 45.995  147.331 1.00 35.44  ? 600  PRO B O   1 
ATOM   9050  C  CB  . PRO B 1  502 ? -25.538 48.910  146.833 1.00 29.01  ? 600  PRO B CB  1 
ATOM   9051  C  CG  . PRO B 1  502 ? -25.528 49.667  145.552 1.00 27.88  ? 600  PRO B CG  1 
ATOM   9052  C  CD  . PRO B 1  502 ? -24.347 49.149  144.793 1.00 27.41  ? 600  PRO B CD  1 
ATOM   9053  N  N   . HIS B 1  503 ? -26.624 46.303  145.103 1.00 28.44  ? 601  HIS B N   1 
ATOM   9054  C  CA  . HIS B 1  503 ? -27.798 45.470  144.882 1.00 27.97  ? 601  HIS B CA  1 
ATOM   9055  C  C   . HIS B 1  503 ? -27.427 44.101  144.326 1.00 28.78  ? 601  HIS B C   1 
ATOM   9056  O  O   . HIS B 1  503 ? -28.271 43.394  143.775 1.00 27.66  ? 601  HIS B O   1 
ATOM   9057  C  CB  . HIS B 1  503 ? -28.766 46.177  143.938 1.00 26.66  ? 601  HIS B CB  1 
ATOM   9058  C  CG  . HIS B 1  503 ? -29.175 47.536  144.412 1.00 23.52  ? 601  HIS B CG  1 
ATOM   9059  N  ND1 . HIS B 1  503 ? -29.883 47.736  145.578 1.00 19.43  ? 601  HIS B ND1 1 
ATOM   9060  C  CD2 . HIS B 1  503 ? -28.957 48.765  143.890 1.00 22.56  ? 601  HIS B CD2 1 
ATOM   9061  C  CE1 . HIS B 1  503 ? -30.094 49.028  145.746 1.00 22.60  ? 601  HIS B CE1 1 
ATOM   9062  N  NE2 . HIS B 1  503 ? -29.542 49.676  144.735 1.00 21.76  ? 601  HIS B NE2 1 
ATOM   9063  N  N   . THR B 1  504 ? -26.157 43.738  144.472 1.00 26.09  ? 602  THR B N   1 
ATOM   9064  C  CA  . THR B 1  504 ? -25.659 42.456  143.990 1.00 22.10  ? 602  THR B CA  1 
ATOM   9065  C  C   . THR B 1  504 ? -26.384 41.288  144.655 1.00 20.57  ? 602  THR B C   1 
ATOM   9066  O  O   . THR B 1  504 ? -26.741 40.315  143.992 1.00 23.54  ? 602  THR B O   1 
ATOM   9067  C  CB  . THR B 1  504 ? -24.147 42.323  144.232 1.00 21.96  ? 602  THR B CB  1 
ATOM   9068  O  OG1 . THR B 1  504 ? -23.468 43.424  143.618 1.00 23.11  ? 602  THR B OG1 1 
ATOM   9069  C  CG2 . THR B 1  504 ? -23.615 41.023  143.653 1.00 22.71  ? 602  THR B CG2 1 
ATOM   9070  N  N   . LEU B 1  505 ? -26.606 41.393  145.963 1.00 16.83  ? 603  LEU B N   1 
ATOM   9071  C  CA  . LEU B 1  505 ? -27.281 40.334  146.708 1.00 15.88  ? 603  LEU B CA  1 
ATOM   9072  C  C   . LEU B 1  505 ? -28.739 40.193  146.293 1.00 15.60  ? 603  LEU B C   1 
ATOM   9073  O  O   . LEU B 1  505 ? -29.207 39.089  146.013 1.00 16.82  ? 603  LEU B O   1 
ATOM   9074  C  CB  . LEU B 1  505 ? -27.201 40.591  148.213 1.00 15.85  ? 603  LEU B CB  1 
ATOM   9075  C  CG  . LEU B 1  505 ? -27.978 39.584  149.070 1.00 16.98  ? 603  LEU B CG  1 
ATOM   9076  C  CD1 . LEU B 1  505 ? -27.526 38.159  148.788 1.00 15.55  ? 603  LEU B CD1 1 
ATOM   9077  C  CD2 . LEU B 1  505 ? -27.850 39.905  150.550 1.00 20.93  ? 603  LEU B CD2 1 
ATOM   9078  N  N   . SER B 1  506 ? -29.453 41.315  146.261 1.00 16.46  ? 604  SER B N   1 
ATOM   9079  C  CA  . SER B 1  506 ? -30.858 41.325  145.868 1.00 18.32  ? 604  SER B CA  1 
ATOM   9080  C  C   . SER B 1  506 ? -31.046 40.785  144.453 1.00 17.19  ? 604  SER B C   1 
ATOM   9081  O  O   . SER B 1  506 ? -32.067 40.166  144.148 1.00 17.47  ? 604  SER B O   1 
ATOM   9082  C  CB  . SER B 1  506 ? -31.436 42.737  145.978 1.00 22.99  ? 604  SER B CB  1 
ATOM   9083  O  OG  . SER B 1  506 ? -31.615 43.115  147.332 1.00 25.23  ? 604  SER B OG  1 
ATOM   9084  N  N   . ALA B 1  507 ? -30.059 41.022  143.594 1.00 17.39  ? 605  ALA B N   1 
ATOM   9085  C  CA  . ALA B 1  507 ? -30.085 40.497  142.233 1.00 16.14  ? 605  ALA B CA  1 
ATOM   9086  C  C   . ALA B 1  507 ? -29.984 38.976  142.241 1.00 17.24  ? 605  ALA B C   1 
ATOM   9087  O  O   . ALA B 1  507 ? -30.743 38.291  141.556 1.00 15.81  ? 605  ALA B O   1 
ATOM   9088  C  CB  . ALA B 1  507 ? -28.958 41.100  141.410 1.00 16.49  ? 605  ALA B CB  1 
ATOM   9089  N  N   . TYR B 1  508 ? -29.044 38.455  143.026 1.00 16.90  ? 606  TYR B N   1 
ATOM   9090  C  CA  . TYR B 1  508 ? -28.834 37.013  143.129 1.00 15.53  ? 606  TYR B CA  1 
ATOM   9091  C  C   . TYR B 1  508 ? -30.039 36.317  143.740 1.00 19.56  ? 606  TYR B C   1 
ATOM   9092  O  O   . TYR B 1  508 ? -30.448 35.253  143.276 1.00 24.54  ? 606  TYR B O   1 
ATOM   9093  C  CB  . TYR B 1  508 ? -27.580 36.704  143.946 1.00 16.05  ? 606  TYR B CB  1 
ATOM   9094  C  CG  . TYR B 1  508 ? -26.299 36.849  143.162 1.00 16.23  ? 606  TYR B CG  1 
ATOM   9095  C  CD1 . TYR B 1  508 ? -26.202 36.368  141.862 1.00 18.12  ? 606  TYR B CD1 1 
ATOM   9096  C  CD2 . TYR B 1  508 ? -25.185 37.458  143.719 1.00 16.07  ? 606  TYR B CD2 1 
ATOM   9097  C  CE1 . TYR B 1  508 ? -25.032 36.493  141.138 1.00 17.24  ? 606  TYR B CE1 1 
ATOM   9098  C  CE2 . TYR B 1  508 ? -24.010 37.588  143.004 1.00 16.84  ? 606  TYR B CE2 1 
ATOM   9099  C  CZ  . TYR B 1  508 ? -23.939 37.105  141.714 1.00 18.27  ? 606  TYR B CZ  1 
ATOM   9100  O  OH  . TYR B 1  508 ? -22.772 37.232  140.998 1.00 21.09  ? 606  TYR B OH  1 
ATOM   9101  N  N   . ILE B 1  509 ? -30.598 36.915  144.788 1.00 18.59  ? 607  ILE B N   1 
ATOM   9102  C  CA  . ILE B 1  509 ? -31.794 36.375  145.419 1.00 20.45  ? 607  ILE B CA  1 
ATOM   9103  C  C   . ILE B 1  509 ? -32.908 36.271  144.387 1.00 23.70  ? 607  ILE B C   1 
ATOM   9104  O  O   . ILE B 1  509 ? -33.589 35.252  144.294 1.00 25.95  ? 607  ILE B O   1 
ATOM   9105  C  CB  . ILE B 1  509 ? -32.257 37.245  146.604 1.00 21.60  ? 607  ILE B CB  1 
ATOM   9106  C  CG1 . ILE B 1  509 ? -31.231 37.186  147.736 1.00 21.96  ? 607  ILE B CG1 1 
ATOM   9107  C  CG2 . ILE B 1  509 ? -33.615 36.785  147.102 1.00 14.93  ? 607  ILE B CG2 1 
ATOM   9108  C  CD1 . ILE B 1  509 ? -31.575 38.061  148.920 1.00 14.54  ? 607  ILE B CD1 1 
ATOM   9109  N  N   . GLN B 1  510 ? -33.065 37.327  143.597 1.00 23.92  ? 608  GLN B N   1 
ATOM   9110  C  CA  . GLN B 1  510 ? -34.036 37.349  142.512 1.00 23.96  ? 608  GLN B CA  1 
ATOM   9111  C  C   . GLN B 1  510 ? -33.750 36.263  141.476 1.00 23.03  ? 608  GLN B C   1 
ATOM   9112  O  O   . GLN B 1  510 ? -34.648 35.522  141.077 1.00 20.33  ? 608  GLN B O   1 
ATOM   9113  C  CB  . GLN B 1  510 ? -34.045 38.726  141.847 1.00 24.98  ? 608  GLN B CB  1 
ATOM   9114  C  CG  . GLN B 1  510 ? -34.956 38.836  140.641 1.00 28.85  ? 608  GLN B CG  1 
ATOM   9115  C  CD  . GLN B 1  510 ? -34.883 40.204  139.994 1.00 35.11  ? 608  GLN B CD  1 
ATOM   9116  O  OE1 . GLN B 1  510 ? -35.360 41.193  140.552 1.00 33.33  ? 608  GLN B OE1 1 
ATOM   9117  N  NE2 . GLN B 1  510 ? -34.271 40.270  138.816 1.00 36.85  ? 608  GLN B NE2 1 
ATOM   9118  N  N   . LEU B 1  511 ? -32.493 36.174  141.052 1.00 24.38  ? 609  LEU B N   1 
ATOM   9119  C  CA  . LEU B 1  511 ? -32.085 35.206  140.039 1.00 24.29  ? 609  LEU B CA  1 
ATOM   9120  C  C   . LEU B 1  511 ? -32.244 33.760  140.496 1.00 26.32  ? 609  LEU B C   1 
ATOM   9121  O  O   . LEU B 1  511 ? -32.719 32.914  139.739 1.00 30.62  ? 609  LEU B O   1 
ATOM   9122  C  CB  . LEU B 1  511 ? -30.632 35.450  139.625 1.00 22.52  ? 609  LEU B CB  1 
ATOM   9123  C  CG  . LEU B 1  511 ? -30.376 36.710  138.797 1.00 25.92  ? 609  LEU B CG  1 
ATOM   9124  C  CD1 . LEU B 1  511 ? -28.881 36.942  138.618 1.00 16.53  ? 609  LEU B CD1 1 
ATOM   9125  C  CD2 . LEU B 1  511 ? -31.082 36.613  137.454 1.00 17.21  ? 609  LEU B CD2 1 
ATOM   9126  N  N   . PHE B 1  512 ? -31.841 33.475  141.731 1.00 21.36  ? 610  PHE B N   1 
ATOM   9127  C  CA  . PHE B 1  512 ? -31.905 32.114  142.250 1.00 18.28  ? 610  PHE B CA  1 
ATOM   9128  C  C   . PHE B 1  512 ? -33.339 31.715  142.594 1.00 21.40  ? 610  PHE B C   1 
ATOM   9129  O  O   . PHE B 1  512 ? -33.706 30.546  142.474 1.00 25.88  ? 610  PHE B O   1 
ATOM   9130  C  CB  . PHE B 1  512 ? -30.989 31.961  143.466 1.00 18.10  ? 610  PHE B CB  1 
ATOM   9131  C  CG  . PHE B 1  512 ? -29.544 31.724  143.107 1.00 19.65  ? 610  PHE B CG  1 
ATOM   9132  C  CD1 . PHE B 1  512 ? -28.674 32.788  142.929 1.00 22.28  ? 610  PHE B CD1 1 
ATOM   9133  C  CD2 . PHE B 1  512 ? -29.059 30.437  142.947 1.00 20.21  ? 610  PHE B CD2 1 
ATOM   9134  C  CE1 . PHE B 1  512 ? -27.347 32.573  142.598 1.00 24.43  ? 610  PHE B CE1 1 
ATOM   9135  C  CE2 . PHE B 1  512 ? -27.732 30.214  142.617 1.00 22.58  ? 610  PHE B CE2 1 
ATOM   9136  C  CZ  . PHE B 1  512 ? -26.875 31.284  142.442 1.00 24.79  ? 610  PHE B CZ  1 
ATOM   9137  N  N   . ARG B 1  513 ? -34.143 32.685  143.024 1.00 18.13  ? 611  ARG B N   1 
ATOM   9138  C  CA  . ARG B 1  513 ? -35.578 32.474  143.202 1.00 15.41  ? 611  ARG B CA  1 
ATOM   9139  C  C   . ARG B 1  513 ? -36.229 31.982  141.916 1.00 17.74  ? 611  ARG B C   1 
ATOM   9140  O  O   . ARG B 1  513 ? -37.011 31.033  141.928 1.00 16.03  ? 611  ARG B O   1 
ATOM   9141  C  CB  . ARG B 1  513 ? -36.263 33.763  143.661 1.00 15.68  ? 611  ARG B CB  1 
ATOM   9142  C  CG  . ARG B 1  513 ? -36.301 33.965  145.164 1.00 18.77  ? 611  ARG B CG  1 
ATOM   9143  C  CD  . ARG B 1  513 ? -36.817 35.352  145.507 1.00 23.37  ? 611  ARG B CD  1 
ATOM   9144  N  NE  . ARG B 1  513 ? -38.232 35.512  145.191 1.00 31.53  ? 611  ARG B NE  1 
ATOM   9145  C  CZ  . ARG B 1  513 ? -39.226 35.125  145.982 1.00 41.30  ? 611  ARG B CZ  1 
ATOM   9146  N  NH1 . ARG B 1  513 ? -38.966 34.539  147.146 1.00 38.42  ? 611  ARG B NH1 1 
ATOM   9147  N  NH2 . ARG B 1  513 ? -40.484 35.316  145.605 1.00 46.45  ? 611  ARG B NH2 1 
ATOM   9148  N  N   . ASN B 1  514 ? -35.896 32.637  140.809 1.00 16.13  ? 612  ASN B N   1 
ATOM   9149  C  CA  . ASN B 1  514 ? -36.454 32.285  139.510 1.00 21.96  ? 612  ASN B CA  1 
ATOM   9150  C  C   . ASN B 1  514 ? -36.082 30.859  139.118 1.00 22.68  ? 612  ASN B C   1 
ATOM   9151  O  O   . ASN B 1  514 ? -36.921 30.093  138.645 1.00 27.54  ? 612  ASN B O   1 
ATOM   9152  C  CB  . ASN B 1  514 ? -35.977 33.275  138.445 1.00 19.38  ? 612  ASN B CB  1 
ATOM   9153  C  CG  . ASN B 1  514 ? -36.722 33.127  137.135 1.00 20.78  ? 612  ASN B CG  1 
ATOM   9154  O  OD1 . ASN B 1  514 ? -37.942 32.974  137.115 1.00 22.85  ? 612  ASN B OD1 1 
ATOM   9155  N  ND2 . ASN B 1  514 ? -35.989 33.172  136.030 1.00 24.29  ? 612  ASN B ND2 1 
ATOM   9156  N  N   . LEU B 1  515 ? -34.816 30.516  139.322 1.00 21.74  ? 613  LEU B N   1 
ATOM   9157  C  CA  . LEU B 1  515 ? -34.325 29.162  139.085 1.00 24.26  ? 613  LEU B CA  1 
ATOM   9158  C  C   . LEU B 1  515 ? -35.097 28.125  139.897 1.00 24.75  ? 613  LEU B C   1 
ATOM   9159  O  O   . LEU B 1  515 ? -35.522 27.101  139.362 1.00 25.87  ? 613  LEU B O   1 
ATOM   9160  C  CB  . LEU B 1  515 ? -32.834 29.076  139.416 1.00 25.20  ? 613  LEU B CB  1 
ATOM   9161  C  CG  . LEU B 1  515 ? -31.836 29.244  138.269 1.00 26.53  ? 613  LEU B CG  1 
ATOM   9162  C  CD1 . LEU B 1  515 ? -32.200 30.419  137.375 1.00 28.52  ? 613  LEU B CD1 1 
ATOM   9163  C  CD2 . LEU B 1  515 ? -30.437 29.418  138.832 1.00 24.35  ? 613  LEU B CD2 1 
ATOM   9164  N  N   . ALA B 1  516 ? -35.277 28.400  141.187 1.00 23.09  ? 614  ALA B N   1 
ATOM   9165  C  CA  . ALA B 1  516 ? -36.017 27.506  142.073 1.00 22.58  ? 614  ALA B CA  1 
ATOM   9166  C  C   . ALA B 1  516 ? -37.449 27.329  141.582 1.00 22.90  ? 614  ALA B C   1 
ATOM   9167  O  O   . ALA B 1  516 ? -37.987 26.223  141.590 1.00 28.01  ? 614  ALA B O   1 
ATOM   9168  C  CB  . ALA B 1  516 ? -36.005 28.037  143.497 1.00 15.40  ? 614  ALA B CB  1 
ATOM   9169  N  N   . LYS B 1  517 ? -38.053 28.431  141.152 1.00 21.99  ? 615  LYS B N   1 
ATOM   9170  C  CA  . LYS B 1  517 ? -39.402 28.415  140.606 1.00 20.85  ? 615  LYS B CA  1 
ATOM   9171  C  C   . LYS B 1  517 ? -39.460 27.573  139.333 1.00 23.14  ? 615  LYS B C   1 
ATOM   9172  O  O   . LYS B 1  517 ? -40.406 26.814  139.124 1.00 24.22  ? 615  LYS B O   1 
ATOM   9173  C  CB  . LYS B 1  517 ? -39.873 29.843  140.324 1.00 19.64  ? 615  LYS B CB  1 
ATOM   9174  C  CG  . LYS B 1  517 ? -41.261 29.947  139.722 1.00 18.12  ? 615  LYS B CG  1 
ATOM   9175  C  CD  . LYS B 1  517 ? -41.537 31.369  139.256 1.00 23.90  ? 615  LYS B CD  1 
ATOM   9176  C  CE  . LYS B 1  517 ? -42.950 31.517  138.716 1.00 36.08  ? 615  LYS B CE  1 
ATOM   9177  N  NZ  . LYS B 1  517 ? -43.222 32.901  138.232 1.00 40.62  ? 615  LYS B NZ  1 
ATOM   9178  N  N   . ALA B 1  518 ? -38.436 27.706  138.494 1.00 20.94  ? 616  ALA B N   1 
ATOM   9179  C  CA  . ALA B 1  518 ? -38.351 26.949  137.249 1.00 19.07  ? 616  ALA B CA  1 
ATOM   9180  C  C   . ALA B 1  518 ? -38.234 25.450  137.505 1.00 19.14  ? 616  ALA B C   1 
ATOM   9181  O  O   . ALA B 1  518 ? -38.773 24.640  136.752 1.00 21.24  ? 616  ALA B O   1 
ATOM   9182  C  CB  . ALA B 1  518 ? -37.174 27.432  136.418 1.00 18.08  ? 616  ALA B CB  1 
ATOM   9183  N  N   . ILE B 1  519 ? -37.522 25.087  138.567 1.00 19.27  ? 617  ILE B N   1 
ATOM   9184  C  CA  . ILE B 1  519 ? -37.352 23.684  138.929 1.00 24.32  ? 617  ILE B CA  1 
ATOM   9185  C  C   . ILE B 1  519 ? -38.652 23.114  139.487 1.00 26.85  ? 617  ILE B C   1 
ATOM   9186  O  O   . ILE B 1  519 ? -39.082 22.023  139.106 1.00 24.53  ? 617  ILE B O   1 
ATOM   9187  C  CB  . ILE B 1  519 ? -36.224 23.499  139.965 1.00 22.57  ? 617  ILE B CB  1 
ATOM   9188  C  CG1 . ILE B 1  519 ? -34.871 23.845  139.343 1.00 21.88  ? 617  ILE B CG1 1 
ATOM   9189  C  CG2 . ILE B 1  519 ? -36.210 22.072  140.500 1.00 18.75  ? 617  ILE B CG2 1 
ATOM   9190  C  CD1 . ILE B 1  519 ? -33.716 23.758  140.309 1.00 18.37  ? 617  ILE B CD1 1 
ATOM   9191  N  N   . ALA B 1  520 ? -39.278 23.871  140.382 1.00 24.76  ? 618  ALA B N   1 
ATOM   9192  C  CA  . ALA B 1  520 ? -40.504 23.438  141.039 1.00 22.57  ? 618  ALA B CA  1 
ATOM   9193  C  C   . ALA B 1  520 ? -41.680 23.331  140.066 1.00 24.70  ? 618  ALA B C   1 
ATOM   9194  O  O   . ALA B 1  520 ? -42.472 22.395  140.149 1.00 19.17  ? 618  ALA B O   1 
ATOM   9195  C  CB  . ALA B 1  520 ? -40.845 24.385  142.177 1.00 20.30  ? 618  ALA B CB  1 
ATOM   9196  N  N   . THR B 1  521 ? -41.796 24.289  139.150 1.00 27.07  ? 619  THR B N   1 
ATOM   9197  C  CA  . THR B 1  521 ? -42.894 24.289  138.185 1.00 27.37  ? 619  THR B CA  1 
ATOM   9198  C  C   . THR B 1  521 ? -42.580 23.442  136.956 1.00 29.59  ? 619  THR B C   1 
ATOM   9199  O  O   . THR B 1  521 ? -43.398 23.351  136.038 1.00 30.21  ? 619  THR B O   1 
ATOM   9200  C  CB  . THR B 1  521 ? -43.247 25.716  137.717 1.00 24.58  ? 619  THR B CB  1 
ATOM   9201  O  OG1 . THR B 1  521 ? -42.128 26.292  137.031 1.00 22.66  ? 619  THR B OG1 1 
ATOM   9202  C  CG2 . THR B 1  521 ? -43.624 26.590  138.901 1.00 25.90  ? 619  THR B CG2 1 
ATOM   9203  N  N   . ASP B 1  522 ? -41.388 22.848  136.940 1.00 31.18  ? 620  ASP B N   1 
ATOM   9204  C  CA  . ASP B 1  522 ? -40.951 21.988  135.842 1.00 31.73  ? 620  ASP B CA  1 
ATOM   9205  C  C   . ASP B 1  522 ? -40.922 22.759  134.524 1.00 32.61  ? 620  ASP B C   1 
ATOM   9206  O  O   . ASP B 1  522 ? -41.334 22.249  133.483 1.00 35.76  ? 620  ASP B O   1 
ATOM   9207  C  CB  . ASP B 1  522 ? -41.852 20.756  135.721 1.00 33.65  ? 620  ASP B CB  1 
ATOM   9208  C  CG  . ASP B 1  522 ? -41.119 19.549  135.175 1.00 37.92  ? 620  ASP B CG  1 
ATOM   9209  O  OD1 . ASP B 1  522 ? -40.885 19.494  133.950 1.00 38.03  ? 620  ASP B OD1 1 
ATOM   9210  O  OD2 . ASP B 1  522 ? -40.783 18.649  135.973 1.00 42.85  ? 620  ASP B OD2 1 
ATOM   9211  N  N   . THR B 1  523 ? -40.434 23.993  134.581 1.00 31.64  ? 621  THR B N   1 
ATOM   9212  C  CA  . THR B 1  523 ? -40.349 24.846  133.401 1.00 30.03  ? 621  THR B CA  1 
ATOM   9213  C  C   . THR B 1  523 ? -38.931 25.362  133.203 1.00 30.28  ? 621  THR B C   1 
ATOM   9214  O  O   . THR B 1  523 ? -38.730 26.501  132.785 1.00 28.92  ? 621  THR B O   1 
ATOM   9215  C  CB  . THR B 1  523 ? -41.306 26.049  133.496 1.00 28.76  ? 621  THR B CB  1 
ATOM   9216  O  OG1 . THR B 1  523 ? -40.916 26.889  134.590 1.00 27.21  ? 621  THR B OG1 1 
ATOM   9217  C  CG2 . THR B 1  523 ? -42.735 25.581  133.710 1.00 27.92  ? 621  THR B CG2 1 
ATOM   9218  N  N   . VAL B 1  524 ? -37.952 24.513  133.504 1.00 31.01  ? 622  VAL B N   1 
ATOM   9219  C  CA  . VAL B 1  524 ? -36.546 24.879  133.382 1.00 31.16  ? 622  VAL B CA  1 
ATOM   9220  C  C   . VAL B 1  524 ? -36.198 25.170  131.923 1.00 30.78  ? 622  VAL B C   1 
ATOM   9221  O  O   . VAL B 1  524 ? -35.347 26.012  131.628 1.00 28.75  ? 622  VAL B O   1 
ATOM   9222  C  CB  . VAL B 1  524 ? -35.630 23.756  133.936 1.00 19.61  ? 622  VAL B CB  1 
ATOM   9223  C  CG1 . VAL B 1  524 ? -34.168 24.035  133.636 1.00 19.58  ? 622  VAL B CG1 1 
ATOM   9224  C  CG2 . VAL B 1  524 ? -35.843 23.590  135.432 1.00 18.84  ? 622  VAL B CG2 1 
ATOM   9225  N  N   . ALA B 1  525 ? -36.896 24.501  131.012 1.00 29.77  ? 623  ALA B N   1 
ATOM   9226  C  CA  . ALA B 1  525 ? -36.691 24.709  129.584 1.00 30.73  ? 623  ALA B CA  1 
ATOM   9227  C  C   . ALA B 1  525 ? -37.130 26.104  129.143 1.00 34.21  ? 623  ALA B C   1 
ATOM   9228  O  O   . ALA B 1  525 ? -36.678 26.607  128.115 1.00 38.31  ? 623  ALA B O   1 
ATOM   9229  C  CB  . ALA B 1  525 ? -37.432 23.648  128.787 1.00 29.03  ? 623  ALA B CB  1 
ATOM   9230  N  N   . ASN B 1  526 ? -38.006 26.729  129.925 1.00 32.85  ? 624  ASN B N   1 
ATOM   9231  C  CA  . ASN B 1  526 ? -38.517 28.053  129.586 1.00 31.70  ? 624  ASN B CA  1 
ATOM   9232  C  C   . ASN B 1  526 ? -37.555 29.166  129.999 1.00 31.45  ? 624  ASN B C   1 
ATOM   9233  O  O   . ASN B 1  526 ? -37.729 30.324  129.617 1.00 34.19  ? 624  ASN B O   1 
ATOM   9234  C  CB  . ASN B 1  526 ? -39.887 28.275  130.232 1.00 33.81  ? 624  ASN B CB  1 
ATOM   9235  C  CG  . ASN B 1  526 ? -40.625 29.468  129.646 1.00 39.58  ? 624  ASN B CG  1 
ATOM   9236  O  OD1 . ASN B 1  526 ? -40.927 29.501  128.452 1.00 44.14  ? 624  ASN B OD1 1 
ATOM   9237  N  ND2 . ASN B 1  526 ? -40.919 30.455  130.486 1.00 38.00  ? 624  ASN B ND2 1 
ATOM   9238  N  N   . LEU B 1  527 ? -36.534 28.810  130.772 1.00 33.96  ? 625  LEU B N   1 
ATOM   9239  C  CA  . LEU B 1  527 ? -35.485 29.760  131.129 1.00 36.74  ? 625  LEU B CA  1 
ATOM   9240  C  C   . LEU B 1  527 ? -34.658 30.123  129.904 1.00 40.11  ? 625  LEU B C   1 
ATOM   9241  O  O   . LEU B 1  527 ? -34.295 29.251  129.114 1.00 41.85  ? 625  LEU B O   1 
ATOM   9242  C  CB  . LEU B 1  527 ? -34.571 29.187  132.214 1.00 32.31  ? 625  LEU B CB  1 
ATOM   9243  C  CG  . LEU B 1  527 ? -35.115 29.046  133.635 1.00 28.27  ? 625  LEU B CG  1 
ATOM   9244  C  CD1 . LEU B 1  527 ? -34.177 28.183  134.466 1.00 25.47  ? 625  LEU B CD1 1 
ATOM   9245  C  CD2 . LEU B 1  527 ? -35.319 30.408  134.283 1.00 22.26  ? 625  LEU B CD2 1 
ATOM   9246  N  N   . SER B 1  528 ? -34.356 31.406  129.746 1.00 38.08  ? 626  SER B N   1 
ATOM   9247  C  CA  . SER B 1  528 ? -33.480 31.834  128.665 1.00 40.91  ? 626  SER B CA  1 
ATOM   9248  C  C   . SER B 1  528 ? -32.053 31.388  128.958 1.00 40.23  ? 626  SER B C   1 
ATOM   9249  O  O   . SER B 1  528 ? -31.573 31.537  130.080 1.00 40.01  ? 626  SER B O   1 
ATOM   9250  C  CB  . SER B 1  528 ? -33.539 33.351  128.484 1.00 46.57  ? 626  SER B CB  1 
ATOM   9251  O  OG  . SER B 1  528 ? -33.149 34.019  129.670 1.00 49.39  ? 626  SER B OG  1 
ATOM   9252  N  N   . ARG B 1  529 ? -31.393 30.823  127.951 1.00 41.29  ? 627  ARG B N   1 
ATOM   9253  C  CA  . ARG B 1  529 ? -30.016 30.348  128.085 1.00 42.28  ? 627  ARG B CA  1 
ATOM   9254  C  C   . ARG B 1  529 ? -29.079 31.425  128.635 1.00 40.05  ? 627  ARG B C   1 
ATOM   9255  O  O   . ARG B 1  529 ? -28.192 31.138  129.440 1.00 42.03  ? 627  ARG B O   1 
ATOM   9256  C  CB  . ARG B 1  529 ? -29.501 29.830  126.738 1.00 46.02  ? 627  ARG B CB  1 
ATOM   9257  C  CG  . ARG B 1  529 ? -28.104 29.226  126.791 1.00 47.91  ? 627  ARG B CG  1 
ATOM   9258  C  CD  . ARG B 1  529 ? -27.551 28.989  125.394 1.00 51.67  ? 627  ARG B CD  1 
ATOM   9259  N  NE  . ARG B 1  529 ? -27.728 30.153  124.531 1.00 57.10  ? 627  ARG B NE  1 
ATOM   9260  C  CZ  . ARG B 1  529 ? -26.869 31.165  124.456 1.00 62.49  ? 627  ARG B CZ  1 
ATOM   9261  N  NH1 . ARG B 1  529 ? -25.768 31.159  125.196 1.00 64.92  ? 627  ARG B NH1 1 
ATOM   9262  N  NH2 . ARG B 1  529 ? -27.113 32.184  123.643 1.00 64.40  ? 627  ARG B NH2 1 
ATOM   9263  N  N   . GLY B 1  530 ? -29.284 32.663  128.198 1.00 34.72  ? 628  GLY B N   1 
ATOM   9264  C  CA  . GLY B 1  530 ? -28.410 33.757  128.575 1.00 29.90  ? 628  GLY B CA  1 
ATOM   9265  C  C   . GLY B 1  530 ? -27.200 33.860  127.666 1.00 31.58  ? 628  GLY B C   1 
ATOM   9266  O  O   . GLY B 1  530 ? -26.885 32.918  126.940 1.00 35.00  ? 628  GLY B O   1 
ATOM   9267  N  N   . PRO B 1  531 ? -26.513 35.010  127.703 1.00 29.78  ? 629  PRO B N   1 
ATOM   9268  C  CA  . PRO B 1  531 ? -25.344 35.258  126.853 1.00 30.71  ? 629  PRO B CA  1 
ATOM   9269  C  C   . PRO B 1  531 ? -24.181 34.327  127.173 1.00 32.56  ? 629  PRO B C   1 
ATOM   9270  O  O   . PRO B 1  531 ? -23.822 34.173  128.336 1.00 34.04  ? 629  PRO B O   1 
ATOM   9271  C  CB  . PRO B 1  531 ? -24.984 36.711  127.173 1.00 25.44  ? 629  PRO B CB  1 
ATOM   9272  C  CG  . PRO B 1  531 ? -25.519 36.936  128.542 1.00 27.90  ? 629  PRO B CG  1 
ATOM   9273  C  CD  . PRO B 1  531 ? -26.783 36.134  128.615 1.00 28.25  ? 629  PRO B CD  1 
ATOM   9274  N  N   . GLU B 1  532 ? -23.601 33.718  126.146 1.00 33.71  ? 630  GLU B N   1 
ATOM   9275  C  CA  . GLU B 1  532 ? -22.477 32.814  126.340 1.00 39.54  ? 630  GLU B CA  1 
ATOM   9276  C  C   . GLU B 1  532 ? -21.224 33.598  126.718 1.00 40.28  ? 630  GLU B C   1 
ATOM   9277  O  O   . GLU B 1  532 ? -20.912 34.613  126.096 1.00 41.02  ? 630  GLU B O   1 
ATOM   9278  C  CB  . GLU B 1  532 ? -22.237 31.982  125.077 1.00 46.77  ? 630  GLU B CB  1 
ATOM   9279  C  CG  . GLU B 1  532 ? -21.065 31.021  125.167 1.00 51.60  ? 630  GLU B CG  1 
ATOM   9280  C  CD  . GLU B 1  532 ? -21.022 30.046  124.008 1.00 59.10  ? 630  GLU B CD  1 
ATOM   9281  O  OE1 . GLU B 1  532 ? -22.083 29.801  123.398 1.00 60.39  ? 630  GLU B OE1 1 
ATOM   9282  O  OE2 . GLU B 1  532 ? -19.927 29.525  123.706 1.00 63.26  ? 630  GLU B OE2 1 
ATOM   9283  N  N   . PRO B 1  533 ? -20.505 33.130  127.750 1.00 42.80  ? 631  PRO B N   1 
ATOM   9284  C  CA  . PRO B 1  533 ? -19.261 33.757  128.208 1.00 43.89  ? 631  PRO B CA  1 
ATOM   9285  C  C   . PRO B 1  533 ? -18.102 33.487  127.254 1.00 44.99  ? 631  PRO B C   1 
ATOM   9286  O  O   . PRO B 1  533 ? -18.124 32.489  126.533 1.00 40.25  ? 631  PRO B O   1 
ATOM   9287  C  CB  . PRO B 1  533 ? -19.016 33.098  129.568 1.00 45.59  ? 631  PRO B CB  1 
ATOM   9288  C  CG  . PRO B 1  533 ? -19.696 31.784  129.477 1.00 47.42  ? 631  PRO B CG  1 
ATOM   9289  C  CD  . PRO B 1  533 ? -20.890 31.985  128.592 1.00 45.94  ? 631  PRO B CD  1 
ATOM   9290  N  N   . PRO B 1  534 ? -17.090 34.369  127.253 1.00 52.03  ? 632  PRO B N   1 
ATOM   9291  C  CA  . PRO B 1  534 ? -15.972 34.259  126.313 1.00 56.25  ? 632  PRO B CA  1 
ATOM   9292  C  C   . PRO B 1  534 ? -14.862 33.330  126.797 1.00 58.84  ? 632  PRO B C   1 
ATOM   9293  O  O   . PRO B 1  534 ? -14.746 33.061  127.994 1.00 55.15  ? 632  PRO B O   1 
ATOM   9294  C  CB  . PRO B 1  534 ? -15.465 35.695  126.221 1.00 53.28  ? 632  PRO B CB  1 
ATOM   9295  C  CG  . PRO B 1  534 ? -15.740 36.258  127.575 1.00 50.78  ? 632  PRO B CG  1 
ATOM   9296  C  CD  . PRO B 1  534 ? -16.984 35.577  128.092 1.00 51.46  ? 632  PRO B CD  1 
ATOM   9297  N  N   . PHE B 1  535 ? -14.058 32.845  125.857 1.00 62.83  ? 633  PHE B N   1 
ATOM   9298  C  CA  . PHE B 1  535 ? -12.873 32.059  126.171 1.00 63.64  ? 633  PHE B CA  1 
ATOM   9299  C  C   . PHE B 1  535 ? -11.666 32.730  125.526 1.00 64.40  ? 633  PHE B C   1 
ATOM   9300  O  O   . PHE B 1  535 ? -11.385 32.516  124.346 1.00 64.61  ? 633  PHE B O   1 
ATOM   9301  C  CB  . PHE B 1  535 ? -13.028 30.618  125.680 1.00 64.34  ? 633  PHE B CB  1 
ATOM   9302  C  CG  . PHE B 1  535 ? -12.081 29.649  126.331 1.00 64.06  ? 633  PHE B CG  1 
ATOM   9303  C  CD1 . PHE B 1  535 ? -12.398 29.066  127.548 1.00 63.24  ? 633  PHE B CD1 1 
ATOM   9304  C  CD2 . PHE B 1  535 ? -10.876 29.322  125.730 1.00 62.55  ? 633  PHE B CD2 1 
ATOM   9305  C  CE1 . PHE B 1  535 ? -11.532 28.174  128.152 1.00 63.06  ? 633  PHE B CE1 1 
ATOM   9306  C  CE2 . PHE B 1  535 ? -10.005 28.430  126.331 1.00 61.25  ? 633  PHE B CE2 1 
ATOM   9307  C  CZ  . PHE B 1  535 ? -10.334 27.856  127.543 1.00 61.48  ? 633  PHE B CZ  1 
ATOM   9308  N  N   . PHE B 1  536 ? -10.958 33.547  126.302 1.00 65.41  ? 634  PHE B N   1 
ATOM   9309  C  CA  . PHE B 1  536 ? -9.847  34.333  125.769 1.00 68.68  ? 634  PHE B CA  1 
ATOM   9310  C  C   . PHE B 1  536 ? -8.675  33.468  125.314 1.00 70.22  ? 634  PHE B C   1 
ATOM   9311  O  O   . PHE B 1  536 ? -8.252  32.544  126.006 1.00 67.13  ? 634  PHE B O   1 
ATOM   9312  C  CB  . PHE B 1  536 ? -9.386  35.351  126.812 1.00 68.03  ? 634  PHE B CB  1 
ATOM   9313  C  CG  . PHE B 1  536 ? -10.497 36.211  127.341 1.00 66.50  ? 634  PHE B CG  1 
ATOM   9314  C  CD1 . PHE B 1  536 ? -11.458 36.723  126.483 1.00 64.77  ? 634  PHE B CD1 1 
ATOM   9315  C  CD2 . PHE B 1  536 ? -10.587 36.503  128.690 1.00 65.15  ? 634  PHE B CD2 1 
ATOM   9316  C  CE1 . PHE B 1  536 ? -12.485 37.512  126.961 1.00 61.90  ? 634  PHE B CE1 1 
ATOM   9317  C  CE2 . PHE B 1  536 ? -11.613 37.294  129.175 1.00 64.03  ? 634  PHE B CE2 1 
ATOM   9318  C  CZ  . PHE B 1  536 ? -12.563 37.798  128.308 1.00 62.40  ? 634  PHE B CZ  1 
ATOM   9319  N  N   . LYS B 1  537 ? -8.162  33.801  124.134 1.00 72.51  ? 635  LYS B N   1 
ATOM   9320  C  CA  . LYS B 1  537 ? -7.129  33.018  123.465 1.00 72.68  ? 635  LYS B CA  1 
ATOM   9321  C  C   . LYS B 1  537 ? -5.690  33.353  123.862 1.00 73.72  ? 635  LYS B C   1 
ATOM   9322  O  O   . LYS B 1  537 ? -4.914  32.456  124.191 1.00 71.83  ? 635  LYS B O   1 
ATOM   9323  C  CB  . LYS B 1  537 ? -7.299  33.162  121.951 1.00 73.93  ? 635  LYS B CB  1 
ATOM   9324  C  CG  . LYS B 1  537 ? -8.632  32.613  121.460 1.00 74.54  ? 635  LYS B CG  1 
ATOM   9325  C  CD  . LYS B 1  537 ? -8.783  32.702  119.952 1.00 76.07  ? 635  LYS B CD  1 
ATOM   9326  C  CE  . LYS B 1  537 ? -10.240 32.526  119.548 1.00 76.96  ? 635  LYS B CE  1 
ATOM   9327  N  NZ  . LYS B 1  537 ? -10.455 32.791  118.100 1.00 79.89  ? 635  LYS B NZ  1 
ATOM   9328  N  N   . GLN B 1  538 ? -5.332  34.634  123.834 1.00 76.97  ? 636  GLN B N   1 
ATOM   9329  C  CA  . GLN B 1  538 ? -3.948  35.033  124.088 1.00 76.05  ? 636  GLN B CA  1 
ATOM   9330  C  C   . GLN B 1  538 ? -3.746  35.570  125.500 1.00 74.75  ? 636  GLN B C   1 
ATOM   9331  O  O   . GLN B 1  538 ? -3.817  36.778  125.731 1.00 76.94  ? 636  GLN B O   1 
ATOM   9332  C  CB  . GLN B 1  538 ? -3.498  36.095  123.082 1.00 77.71  ? 636  GLN B CB  1 
ATOM   9333  C  CG  . GLN B 1  538 ? -3.645  35.698  121.624 1.00 79.75  ? 636  GLN B CG  1 
ATOM   9334  C  CD  . GLN B 1  538 ? -4.968  36.152  121.034 1.00 82.15  ? 636  GLN B CD  1 
ATOM   9335  O  OE1 . GLN B 1  538 ? -5.729  36.880  121.673 1.00 82.70  ? 636  GLN B OE1 1 
ATOM   9336  N  NE2 . GLN B 1  538 ? -5.246  35.728  119.806 1.00 83.81  ? 636  GLN B NE2 1 
ATOM   9337  N  N   . LEU B 1  539 ? -3.482  34.670  126.440 1.00 71.04  ? 637  LEU B N   1 
ATOM   9338  C  CA  . LEU B 1  539 ? -3.184  35.068  127.810 1.00 66.73  ? 637  LEU B CA  1 
ATOM   9339  C  C   . LEU B 1  539 ? -1.715  35.454  127.946 1.00 68.66  ? 637  LEU B C   1 
ATOM   9340  O  O   . LEU B 1  539 ? -0.860  34.945  127.220 1.00 69.84  ? 637  LEU B O   1 
ATOM   9341  C  CB  . LEU B 1  539 ? -3.535  33.945  128.787 1.00 60.31  ? 637  LEU B CB  1 
ATOM   9342  C  CG  . LEU B 1  539 ? -5.016  33.572  128.861 1.00 60.46  ? 637  LEU B CG  1 
ATOM   9343  C  CD1 . LEU B 1  539 ? -5.260  32.555  129.963 1.00 57.13  ? 637  LEU B CD1 1 
ATOM   9344  C  CD2 . LEU B 1  539 ? -5.874  34.811  129.069 1.00 63.83  ? 637  LEU B CD2 1 
ATOM   9345  N  N   . ILE B 1  540 ? -1.424  36.357  128.876 1.00 67.70  ? 638  ILE B N   1 
ATOM   9346  C  CA  . ILE B 1  540 ? -0.059  36.833  129.070 1.00 63.86  ? 638  ILE B CA  1 
ATOM   9347  C  C   . ILE B 1  540 ? 0.695   35.979  130.090 1.00 58.82  ? 638  ILE B C   1 
ATOM   9348  O  O   . ILE B 1  540 ? 0.164   35.004  130.620 1.00 55.57  ? 638  ILE B O   1 
ATOM   9349  C  CB  . ILE B 1  540 ? -0.035  38.309  129.522 1.00 63.47  ? 638  ILE B CB  1 
ATOM   9350  C  CG1 . ILE B 1  540 ? -0.400  38.427  131.004 1.00 60.92  ? 638  ILE B CG1 1 
ATOM   9351  C  CG2 . ILE B 1  540 ? -0.976  39.147  128.662 1.00 63.80  ? 638  ILE B CG2 1 
ATOM   9352  C  CD1 . ILE B 1  540 ? -0.331  39.842  131.537 1.00 60.37  ? 638  ILE B CD1 1 
ATOM   9353  N  N   . PRO B 1  545 ? 12.471  31.639  132.352 1.00 48.46  ? 643  PRO B N   1 
ATOM   9354  C  CA  . PRO B 1  545 ? 13.540  31.088  131.508 1.00 49.90  ? 643  PRO B CA  1 
ATOM   9355  C  C   . PRO B 1  545 ? 14.022  29.719  131.988 1.00 49.36  ? 643  PRO B C   1 
ATOM   9356  O  O   . PRO B 1  545 ? 14.063  29.459  133.192 1.00 50.95  ? 643  PRO B O   1 
ATOM   9357  C  CB  . PRO B 1  545 ? 14.662  32.129  131.623 1.00 49.22  ? 643  PRO B CB  1 
ATOM   9358  C  CG  . PRO B 1  545 ? 14.344  32.931  132.840 1.00 49.50  ? 643  PRO B CG  1 
ATOM   9359  C  CD  . PRO B 1  545 ? 12.862  32.897  133.010 1.00 48.83  ? 643  PRO B CD  1 
ATOM   9360  N  N   . SER B 1  546 ? 14.389  28.860  131.043 1.00 47.32  ? 644  SER B N   1 
ATOM   9361  C  CA  . SER B 1  546 ? 14.801  27.491  131.342 1.00 48.13  ? 644  SER B CA  1 
ATOM   9362  C  C   . SER B 1  546 ? 16.138  27.396  132.071 1.00 43.28  ? 644  SER B C   1 
ATOM   9363  O  O   . SER B 1  546 ? 17.094  28.091  131.732 1.00 45.93  ? 644  SER B O   1 
ATOM   9364  C  CB  . SER B 1  546 ? 14.871  26.675  130.051 1.00 56.19  ? 644  SER B CB  1 
ATOM   9365  O  OG  . SER B 1  546 ? 13.576  26.418  129.537 1.00 61.41  ? 644  SER B OG  1 
ATOM   9366  N  N   . ILE B 1  547 ? 16.194  26.519  133.069 1.00 35.49  ? 645  ILE B N   1 
ATOM   9367  C  CA  . ILE B 1  547 ? 17.418  26.282  133.831 1.00 33.11  ? 645  ILE B CA  1 
ATOM   9368  C  C   . ILE B 1  547 ? 17.721  24.787  133.901 1.00 29.58  ? 645  ILE B C   1 
ATOM   9369  O  O   . ILE B 1  547 ? 16.849  23.983  134.228 1.00 33.13  ? 645  ILE B O   1 
ATOM   9370  C  CB  . ILE B 1  547 ? 17.318  26.845  135.266 1.00 32.31  ? 645  ILE B CB  1 
ATOM   9371  C  CG1 . ILE B 1  547 ? 17.122  28.364  135.239 1.00 30.82  ? 645  ILE B CG1 1 
ATOM   9372  C  CG2 . ILE B 1  547 ? 18.560  26.493  136.072 1.00 30.99  ? 645  ILE B CG2 1 
ATOM   9373  C  CD1 . ILE B 1  547 ? 18.280  29.116  134.623 1.00 32.50  ? 645  ILE B CD1 1 
ATOM   9374  N  N   . VAL B 1  548 ? 18.960  24.420  133.590 1.00 23.95  ? 646  VAL B N   1 
ATOM   9375  C  CA  . VAL B 1  548 ? 19.400  23.036  133.716 1.00 21.28  ? 646  VAL B CA  1 
ATOM   9376  C  C   . VAL B 1  548 ? 19.827  22.747  135.149 1.00 20.62  ? 646  VAL B C   1 
ATOM   9377  O  O   . VAL B 1  548 ? 20.705  23.420  135.686 1.00 21.30  ? 646  VAL B O   1 
ATOM   9378  C  CB  . VAL B 1  548 ? 20.571  22.721  132.764 1.00 22.25  ? 646  VAL B CB  1 
ATOM   9379  C  CG1 . VAL B 1  548 ? 21.196  21.377  133.108 1.00 22.14  ? 646  VAL B CG1 1 
ATOM   9380  C  CG2 . VAL B 1  548 ? 20.099  22.743  131.319 1.00 22.97  ? 646  VAL B CG2 1 
ATOM   9381  N  N   . ASP B 1  549 ? 19.204  21.749  135.766 1.00 19.92  ? 647  ASP B N   1 
ATOM   9382  C  CA  . ASP B 1  549 ? 19.544  21.384  137.135 1.00 19.36  ? 647  ASP B CA  1 
ATOM   9383  C  C   . ASP B 1  549 ? 20.955  20.815  137.209 1.00 25.71  ? 647  ASP B C   1 
ATOM   9384  O  O   . ASP B 1  549 ? 21.412  20.134  136.292 1.00 24.35  ? 647  ASP B O   1 
ATOM   9385  C  CB  . ASP B 1  549 ? 18.542  20.371  137.690 1.00 29.04  ? 647  ASP B CB  1 
ATOM   9386  C  CG  . ASP B 1  549 ? 17.122  20.899  137.698 1.00 29.30  ? 647  ASP B CG  1 
ATOM   9387  O  OD1 . ASP B 1  549 ? 16.755  21.613  138.656 1.00 23.69  ? 647  ASP B OD1 1 
ATOM   9388  O  OD2 . ASP B 1  549 ? 16.370  20.590  136.750 1.00 34.10  ? 647  ASP B OD2 1 
ATOM   9389  N  N   . ARG B 1  550 ? 21.645  21.105  138.305 1.00 24.71  ? 648  ARG B N   1 
ATOM   9390  C  CA  . ARG B 1  550 ? 23.000  20.612  138.502 1.00 25.86  ? 648  ARG B CA  1 
ATOM   9391  C  C   . ARG B 1  550 ? 23.142  19.953  139.867 1.00 23.78  ? 648  ARG B C   1 
ATOM   9392  O  O   . ARG B 1  550 ? 22.507  20.366  140.836 1.00 25.28  ? 648  ARG B O   1 
ATOM   9393  C  CB  . ARG B 1  550 ? 24.017  21.749  138.362 1.00 30.82  ? 648  ARG B CB  1 
ATOM   9394  C  CG  . ARG B 1  550 ? 23.933  22.532  137.059 1.00 39.14  ? 648  ARG B CG  1 
ATOM   9395  C  CD  . ARG B 1  550 ? 24.434  21.711  135.879 1.00 46.73  ? 648  ARG B CD  1 
ATOM   9396  N  NE  . ARG B 1  550 ? 24.396  22.467  134.630 1.00 51.30  ? 648  ARG B NE  1 
ATOM   9397  C  CZ  . ARG B 1  550 ? 24.687  21.958  133.436 1.00 51.98  ? 648  ARG B CZ  1 
ATOM   9398  N  NH1 . ARG B 1  550 ? 25.040  20.684  133.324 1.00 50.38  ? 648  ARG B NH1 1 
ATOM   9399  N  NH2 . ARG B 1  550 ? 24.626  22.723  132.354 1.00 51.60  ? 648  ARG B NH2 1 
ATOM   9400  N  N   . ALA B 1  551 ? 23.976  18.921  139.932 1.00 21.95  ? 649  ALA B N   1 
ATOM   9401  C  CA  . ALA B 1  551 ? 24.352  18.314  141.200 1.00 21.41  ? 649  ALA B CA  1 
ATOM   9402  C  C   . ALA B 1  551 ? 25.743  18.796  141.599 1.00 24.42  ? 649  ALA B C   1 
ATOM   9403  O  O   . ALA B 1  551 ? 26.541  19.161  140.735 1.00 22.95  ? 649  ALA B O   1 
ATOM   9404  C  CB  . ALA B 1  551 ? 24.315  16.795  141.100 1.00 20.01  ? 649  ALA B CB  1 
ATOM   9405  N  N   . PRO B 1  552 ? 26.035  18.819  142.909 1.00 26.23  ? 650  PRO B N   1 
ATOM   9406  C  CA  . PRO B 1  552 ? 27.391  19.156  143.355 1.00 23.75  ? 650  PRO B CA  1 
ATOM   9407  C  C   . PRO B 1  552 ? 28.429  18.213  142.753 1.00 26.24  ? 650  PRO B C   1 
ATOM   9408  O  O   . PRO B 1  552 ? 28.101  17.069  142.436 1.00 24.72  ? 650  PRO B O   1 
ATOM   9409  C  CB  . PRO B 1  552 ? 27.312  18.991  144.874 1.00 20.97  ? 650  PRO B CB  1 
ATOM   9410  C  CG  . PRO B 1  552 ? 25.878  19.237  145.195 1.00 20.24  ? 650  PRO B CG  1 
ATOM   9411  C  CD  . PRO B 1  552 ? 25.112  18.644  144.045 1.00 22.91  ? 650  PRO B CD  1 
ATOM   9412  N  N   . LYS B 1  553 ? 29.656  18.697  142.588 1.00 29.83  ? 651  LYS B N   1 
ATOM   9413  C  CA  . LYS B 1  553 ? 30.723  17.908  141.979 1.00 29.38  ? 651  LYS B CA  1 
ATOM   9414  C  C   . LYS B 1  553 ? 30.973  16.613  142.748 1.00 30.54  ? 651  LYS B C   1 
ATOM   9415  O  O   . LYS B 1  553 ? 31.148  16.627  143.966 1.00 29.84  ? 651  LYS B O   1 
ATOM   9416  C  CB  . LYS B 1  553 ? 32.012  18.726  141.899 1.00 31.92  ? 651  LYS B CB  1 
ATOM   9417  C  CG  . LYS B 1  553 ? 33.161  17.998  141.221 1.00 37.77  ? 651  LYS B CG  1 
ATOM   9418  C  CD  . LYS B 1  553 ? 34.113  18.979  140.558 1.00 42.92  ? 651  LYS B CD  1 
ATOM   9419  C  CE  . LYS B 1  553 ? 35.269  18.261  139.877 1.00 46.46  ? 651  LYS B CE  1 
ATOM   9420  N  NZ  . LYS B 1  553 ? 34.795  17.401  138.751 1.00 46.64  ? 651  LYS B NZ  1 
ATOM   9421  N  N   . GLY B 1  554 ? 30.985  15.495  142.030 1.00 24.38  ? 652  GLY B N   1 
ATOM   9422  C  CA  . GLY B 1  554 ? 31.192  14.199  142.650 1.00 24.54  ? 652  GLY B CA  1 
ATOM   9423  C  C   . GLY B 1  554 ? 29.914  13.637  143.243 1.00 23.52  ? 652  GLY B C   1 
ATOM   9424  O  O   . GLY B 1  554 ? 29.917  12.575  143.863 1.00 25.18  ? 652  GLY B O   1 
ATOM   9425  N  N   . ARG B 1  555 ? 28.815  14.354  143.045 1.00 25.93  ? 653  ARG B N   1 
ATOM   9426  C  CA  . ARG B 1  555 ? 27.519  13.929  143.555 1.00 28.96  ? 653  ARG B CA  1 
ATOM   9427  C  C   . ARG B 1  555 ? 26.519  13.764  142.418 1.00 32.54  ? 653  ARG B C   1 
ATOM   9428  O  O   . ARG B 1  555 ? 26.815  14.082  141.267 1.00 31.38  ? 653  ARG B O   1 
ATOM   9429  C  CB  . ARG B 1  555 ? 26.987  14.940  144.572 1.00 32.08  ? 653  ARG B CB  1 
ATOM   9430  C  CG  . ARG B 1  555 ? 27.802  15.059  145.846 1.00 37.62  ? 653  ARG B CG  1 
ATOM   9431  C  CD  . ARG B 1  555 ? 27.363  14.033  146.873 1.00 46.46  ? 653  ARG B CD  1 
ATOM   9432  N  NE  . ARG B 1  555 ? 27.708  14.442  148.232 1.00 52.27  ? 653  ARG B NE  1 
ATOM   9433  C  CZ  . ARG B 1  555 ? 27.317  13.799  149.327 1.00 52.06  ? 653  ARG B CZ  1 
ATOM   9434  N  NH1 . ARG B 1  555 ? 26.563  12.713  149.226 1.00 48.70  ? 653  ARG B NH1 1 
ATOM   9435  N  NH2 . ARG B 1  555 ? 27.678  14.244  150.524 1.00 52.41  ? 653  ARG B NH2 1 
ATOM   9436  N  N   . THR B 1  556 ? 25.333  13.268  142.749 1.00 20.53  ? 654  THR B N   1 
ATOM   9437  C  CA  . THR B 1  556 ? 24.259  13.147  141.773 1.00 28.90  ? 654  THR B CA  1 
ATOM   9438  C  C   . THR B 1  556 ? 22.919  13.428  142.441 1.00 24.80  ? 654  THR B C   1 
ATOM   9439  O  O   . THR B 1  556 ? 22.831  13.480  143.669 1.00 22.27  ? 654  THR B O   1 
ATOM   9440  C  CB  . THR B 1  556 ? 24.226  11.753  141.118 1.00 32.24  ? 654  THR B CB  1 
ATOM   9441  O  OG1 . THR B 1  556 ? 23.283  11.753  140.039 1.00 34.62  ? 654  THR B OG1 1 
ATOM   9442  C  CG2 . THR B 1  556 ? 23.832  10.687  142.129 1.00 20.35  ? 654  THR B CG2 1 
ATOM   9443  N  N   . PHE B 1  557 ? 21.886  13.631  141.630 1.00 23.55  ? 655  PHE B N   1 
ATOM   9444  C  CA  . PHE B 1  557 ? 20.559  13.957  142.145 1.00 21.25  ? 655  PHE B CA  1 
ATOM   9445  C  C   . PHE B 1  557 ? 20.010  12.844  143.031 1.00 17.79  ? 655  PHE B C   1 
ATOM   9446  O  O   . PHE B 1  557 ? 19.983  11.678  142.639 1.00 22.68  ? 655  PHE B O   1 
ATOM   9447  C  CB  . PHE B 1  557 ? 19.600  14.242  140.989 1.00 21.72  ? 655  PHE B CB  1 
ATOM   9448  C  CG  . PHE B 1  557 ? 20.041  15.377  140.112 1.00 23.63  ? 655  PHE B CG  1 
ATOM   9449  C  CD1 . PHE B 1  557 ? 19.906  16.689  140.537 1.00 24.67  ? 655  PHE B CD1 1 
ATOM   9450  C  CD2 . PHE B 1  557 ? 20.614  15.133  138.875 1.00 25.76  ? 655  PHE B CD2 1 
ATOM   9451  C  CE1 . PHE B 1  557 ? 20.318  17.739  139.738 1.00 27.74  ? 655  PHE B CE1 1 
ATOM   9452  C  CE2 . PHE B 1  557 ? 21.029  16.176  138.071 1.00 30.00  ? 655  PHE B CE2 1 
ATOM   9453  C  CZ  . PHE B 1  557 ? 20.882  17.482  138.503 1.00 31.57  ? 655  PHE B CZ  1 
ATOM   9454  N  N   . GLY B 1  558 ? 19.575  13.215  144.230 1.00 17.66  ? 656  GLY B N   1 
ATOM   9455  C  CA  . GLY B 1  558 ? 19.030  12.260  145.177 1.00 20.87  ? 656  GLY B CA  1 
ATOM   9456  C  C   . GLY B 1  558 ? 19.993  11.910  146.297 1.00 22.80  ? 656  GLY B C   1 
ATOM   9457  O  O   . GLY B 1  558 ? 19.590  11.342  147.312 1.00 27.88  ? 656  GLY B O   1 
ATOM   9458  N  N   . ASP B 1  559 ? 21.264  12.258  146.123 1.00 21.90  ? 657  ASP B N   1 
ATOM   9459  C  CA  . ASP B 1  559 ? 22.267  12.009  147.152 1.00 19.61  ? 657  ASP B CA  1 
ATOM   9460  C  C   . ASP B 1  559 ? 21.966  12.802  148.418 1.00 18.31  ? 657  ASP B C   1 
ATOM   9461  O  O   . ASP B 1  559 ? 21.509  13.940  148.355 1.00 20.96  ? 657  ASP B O   1 
ATOM   9462  C  CB  . ASP B 1  559 ? 23.668  12.353  146.642 1.00 24.53  ? 657  ASP B CB  1 
ATOM   9463  C  CG  . ASP B 1  559 ? 24.172  11.366  145.608 1.00 33.72  ? 657  ASP B CG  1 
ATOM   9464  O  OD1 . ASP B 1  559 ? 23.511  10.326  145.404 1.00 41.27  ? 657  ASP B OD1 1 
ATOM   9465  O  OD2 . ASP B 1  559 ? 25.233  11.629  145.003 1.00 31.02  ? 657  ASP B OD2 1 
ATOM   9466  N  N   . VAL B 1  560 ? 22.223  12.191  149.568 1.00 19.79  ? 658  VAL B N   1 
ATOM   9467  C  CA  . VAL B 1  560 ? 21.967  12.831  150.851 1.00 20.05  ? 658  VAL B CA  1 
ATOM   9468  C  C   . VAL B 1  560 ? 23.082  13.804  151.229 1.00 20.83  ? 658  VAL B C   1 
ATOM   9469  O  O   . VAL B 1  560 ? 24.249  13.422  151.313 1.00 24.08  ? 658  VAL B O   1 
ATOM   9470  C  CB  . VAL B 1  560 ? 21.804  11.783  151.966 1.00 18.08  ? 658  VAL B CB  1 
ATOM   9471  C  CG1 . VAL B 1  560 ? 21.630  12.459  153.312 1.00 17.99  ? 658  VAL B CG1 1 
ATOM   9472  C  CG2 . VAL B 1  560 ? 20.625  10.871  151.662 1.00 17.69  ? 658  VAL B CG2 1 
ATOM   9473  N  N   . LEU B 1  561 ? 22.713  15.062  151.450 1.00 18.00  ? 659  LEU B N   1 
ATOM   9474  C  CA  . LEU B 1  561 ? 23.655  16.073  151.917 1.00 23.84  ? 659  LEU B CA  1 
ATOM   9475  C  C   . LEU B 1  561 ? 23.679  16.125  153.440 1.00 22.79  ? 659  LEU B C   1 
ATOM   9476  O  O   . LEU B 1  561 ? 24.726  16.342  154.050 1.00 21.73  ? 659  LEU B O   1 
ATOM   9477  C  CB  . LEU B 1  561 ? 23.298  17.447  151.350 1.00 18.16  ? 659  LEU B CB  1 
ATOM   9478  C  CG  . LEU B 1  561 ? 23.475  17.620  149.843 1.00 18.21  ? 659  LEU B CG  1 
ATOM   9479  C  CD1 . LEU B 1  561 ? 22.979  18.986  149.395 1.00 17.94  ? 659  LEU B CD1 1 
ATOM   9480  C  CD2 . LEU B 1  561 ? 24.934  17.424  149.461 1.00 19.06  ? 659  LEU B CD2 1 
ATOM   9481  N  N   . GLN B 1  562 ? 22.512  15.927  154.043 1.00 24.85  ? 660  GLN B N   1 
ATOM   9482  C  CA  . GLN B 1  562 ? 22.376  15.884  155.493 1.00 26.63  ? 660  GLN B CA  1 
ATOM   9483  C  C   . GLN B 1  562 ? 21.453  14.745  155.905 1.00 23.38  ? 660  GLN B C   1 
ATOM   9484  O  O   . GLN B 1  562 ? 20.246  14.802  155.670 1.00 21.52  ? 660  GLN B O   1 
ATOM   9485  C  CB  . GLN B 1  562 ? 21.841  17.212  156.029 1.00 32.07  ? 660  GLN B CB  1 
ATOM   9486  C  CG  . GLN B 1  562 ? 21.690  17.246  157.542 1.00 36.02  ? 660  GLN B CG  1 
ATOM   9487  C  CD  . GLN B 1  562 ? 21.177  18.579  158.045 1.00 40.70  ? 660  GLN B CD  1 
ATOM   9488  O  OE1 . GLN B 1  562 ? 21.841  19.607  157.906 1.00 42.66  ? 660  GLN B OE1 1 
ATOM   9489  N  NE2 . GLN B 1  562 ? 19.984  18.571  158.630 1.00 38.82  ? 660  GLN B NE2 1 
ATOM   9490  N  N   . PRO B 1  563 ? 22.021  13.697  156.516 1.00 22.56  ? 661  PRO B N   1 
ATOM   9491  C  CA  . PRO B 1  563 ? 21.221  12.557  156.969 1.00 21.86  ? 661  PRO B CA  1 
ATOM   9492  C  C   . PRO B 1  563 ? 20.459  12.878  158.247 1.00 21.77  ? 661  PRO B C   1 
ATOM   9493  O  O   . PRO B 1  563 ? 20.750  13.881  158.900 1.00 23.86  ? 661  PRO B O   1 
ATOM   9494  C  CB  . PRO B 1  563 ? 22.271  11.473  157.213 1.00 19.27  ? 661  PRO B CB  1 
ATOM   9495  C  CG  . PRO B 1  563 ? 23.492  12.235  157.597 1.00 19.89  ? 661  PRO B CG  1 
ATOM   9496  C  CD  . PRO B 1  563 ? 23.456  13.515  156.800 1.00 21.81  ? 661  PRO B CD  1 
ATOM   9497  N  N   . ALA B 1  564 ? 19.485  12.044  158.592 1.00 18.16  ? 662  ALA B N   1 
ATOM   9498  C  CA  . ALA B 1  564 ? 18.767  12.216  159.845 1.00 24.46  ? 662  ALA B CA  1 
ATOM   9499  C  C   . ALA B 1  564 ? 19.642  11.784  161.018 1.00 26.70  ? 662  ALA B C   1 
ATOM   9500  O  O   . ALA B 1  564 ? 20.613  11.050  160.837 1.00 28.40  ? 662  ALA B O   1 
ATOM   9501  C  CB  . ALA B 1  564 ? 17.470  11.425  159.830 1.00 21.54  ? 662  ALA B CB  1 
ATOM   9502  N  N   . LYS B 1  565 ? 19.303  12.252  162.215 1.00 26.42  ? 663  LYS B N   1 
ATOM   9503  C  CA  . LYS B 1  565 ? 19.937  11.771  163.437 1.00 25.07  ? 663  LYS B CA  1 
ATOM   9504  C  C   . LYS B 1  565 ? 19.697  10.270  163.578 1.00 26.53  ? 663  LYS B C   1 
ATOM   9505  O  O   . LYS B 1  565 ? 18.720  9.748   163.041 1.00 26.37  ? 663  LYS B O   1 
ATOM   9506  C  CB  . LYS B 1  565 ? 19.400  12.527  164.655 1.00 26.73  ? 663  LYS B CB  1 
ATOM   9507  C  CG  . LYS B 1  565 ? 19.668  14.020  164.621 1.00 31.29  ? 663  LYS B CG  1 
ATOM   9508  C  CD  . LYS B 1  565 ? 19.137  14.708  165.869 1.00 39.65  ? 663  LYS B CD  1 
ATOM   9509  C  CE  . LYS B 1  565 ? 19.337  16.215  165.799 1.00 46.77  ? 663  LYS B CE  1 
ATOM   9510  N  NZ  . LYS B 1  565 ? 18.780  16.906  166.995 1.00 50.97  ? 663  LYS B NZ  1 
ATOM   9511  N  N   . PRO B 1  566 ? 20.590  9.567   164.293 1.00 25.30  ? 664  PRO B N   1 
ATOM   9512  C  CA  . PRO B 1  566 ? 20.416  8.120   164.469 1.00 24.69  ? 664  PRO B CA  1 
ATOM   9513  C  C   . PRO B 1  566 ? 19.145  7.752   165.233 1.00 27.42  ? 664  PRO B C   1 
ATOM   9514  O  O   . PRO B 1  566 ? 18.549  6.708   164.961 1.00 24.95  ? 664  PRO B O   1 
ATOM   9515  C  CB  . PRO B 1  566 ? 21.658  7.708   165.270 1.00 23.98  ? 664  PRO B CB  1 
ATOM   9516  C  CG  . PRO B 1  566 ? 22.646  8.800   165.049 1.00 23.31  ? 664  PRO B CG  1 
ATOM   9517  C  CD  . PRO B 1  566 ? 21.849  10.052  164.883 1.00 22.41  ? 664  PRO B CD  1 
ATOM   9518  N  N   . GLU B 1  567 ? 18.735  8.601   166.170 1.00 29.34  ? 665  GLU B N   1 
ATOM   9519  C  CA  . GLU B 1  567 ? 17.584  8.298   167.014 1.00 31.26  ? 665  GLU B CA  1 
ATOM   9520  C  C   . GLU B 1  567 ? 16.709  9.525   167.268 1.00 28.50  ? 665  GLU B C   1 
ATOM   9521  O  O   . GLU B 1  567 ? 17.206  10.645  167.393 1.00 28.57  ? 665  GLU B O   1 
ATOM   9522  C  CB  . GLU B 1  567 ? 18.050  7.701   168.344 1.00 38.22  ? 665  GLU B CB  1 
ATOM   9523  C  CG  . GLU B 1  567 ? 16.925  7.228   169.254 1.00 44.39  ? 665  GLU B CG  1 
ATOM   9524  C  CD  . GLU B 1  567 ? 17.435  6.496   170.479 1.00 52.87  ? 665  GLU B CD  1 
ATOM   9525  O  OE1 . GLU B 1  567 ? 18.547  5.931   170.415 1.00 54.75  ? 665  GLU B OE1 1 
ATOM   9526  O  OE2 . GLU B 1  567 ? 16.726  6.488   171.508 1.00 57.15  ? 665  GLU B OE2 1 
ATOM   9527  N  N   . TYR B 1  568 ? 15.402  9.299   167.343 1.00 26.70  ? 666  TYR B N   1 
ATOM   9528  C  CA  . TYR B 1  568 ? 14.449  10.358  167.647 1.00 25.07  ? 666  TYR B CA  1 
ATOM   9529  C  C   . TYR B 1  568 ? 13.449  9.907   168.702 1.00 22.57  ? 666  TYR B C   1 
ATOM   9530  O  O   . TYR B 1  568 ? 13.155  8.719   168.826 1.00 22.08  ? 666  TYR B O   1 
ATOM   9531  C  CB  . TYR B 1  568 ? 13.700  10.798  166.385 1.00 26.22  ? 666  TYR B CB  1 
ATOM   9532  C  CG  . TYR B 1  568 ? 14.558  11.508  165.366 1.00 25.65  ? 666  TYR B CG  1 
ATOM   9533  C  CD1 . TYR B 1  568 ? 15.230  10.800  164.379 1.00 25.11  ? 666  TYR B CD1 1 
ATOM   9534  C  CD2 . TYR B 1  568 ? 14.694  12.889  165.388 1.00 27.20  ? 666  TYR B CD2 1 
ATOM   9535  C  CE1 . TYR B 1  568 ? 16.017  11.448  163.445 1.00 26.34  ? 666  TYR B CE1 1 
ATOM   9536  C  CE2 . TYR B 1  568 ? 15.478  13.545  164.460 1.00 28.94  ? 666  TYR B CE2 1 
ATOM   9537  C  CZ  . TYR B 1  568 ? 16.136  12.821  163.490 1.00 30.02  ? 666  TYR B CZ  1 
ATOM   9538  O  OH  . TYR B 1  568 ? 16.917  13.476  162.565 1.00 35.94  ? 666  TYR B OH  1 
ATOM   9539  N  N   . ARG B 1  569 ? 12.949  10.863  169.475 1.00 27.24  ? 667  ARG B N   1 
ATOM   9540  C  CA  . ARG B 1  569 ? 11.812  10.619  170.349 1.00 32.88  ? 667  ARG B CA  1 
ATOM   9541  C  C   . ARG B 1  569 ? 10.572  11.164  169.652 1.00 32.31  ? 667  ARG B C   1 
ATOM   9542  O  O   . ARG B 1  569 ? 10.670  12.114  168.875 1.00 30.89  ? 667  ARG B O   1 
ATOM   9543  C  CB  . ARG B 1  569 ? 12.022  11.284  171.713 1.00 40.10  ? 667  ARG B CB  1 
ATOM   9544  C  CG  . ARG B 1  569 ? 10.903  11.058  172.720 1.00 48.21  ? 667  ARG B CG  1 
ATOM   9545  C  CD  . ARG B 1  569 ? 11.246  11.685  174.064 1.00 56.88  ? 667  ARG B CD  1 
ATOM   9546  N  NE  . ARG B 1  569 ? 11.496  13.120  173.949 1.00 64.30  ? 667  ARG B NE  1 
ATOM   9547  C  CZ  . ARG B 1  569 ? 11.967  13.880  174.934 1.00 66.36  ? 667  ARG B CZ  1 
ATOM   9548  N  NH1 . ARG B 1  569 ? 12.245  13.343  176.114 1.00 65.10  ? 667  ARG B NH1 1 
ATOM   9549  N  NH2 . ARG B 1  569 ? 12.163  15.177  174.736 1.00 67.19  ? 667  ARG B NH2 1 
ATOM   9550  N  N   . VAL B 1  570 ? 9.416   10.557  169.907 1.00 33.14  ? 668  VAL B N   1 
ATOM   9551  C  CA  . VAL B 1  570 ? 8.175   11.030  169.305 1.00 33.66  ? 668  VAL B CA  1 
ATOM   9552  C  C   . VAL B 1  570 ? 7.910   12.479  169.714 1.00 35.49  ? 668  VAL B C   1 
ATOM   9553  O  O   . VAL B 1  570 ? 8.180   12.876  170.849 1.00 38.61  ? 668  VAL B O   1 
ATOM   9554  C  CB  . VAL B 1  570 ? 6.978   10.134  169.690 1.00 37.63  ? 668  VAL B CB  1 
ATOM   9555  C  CG1 . VAL B 1  570 ? 7.188   8.722   169.165 1.00 38.89  ? 668  VAL B CG1 1 
ATOM   9556  C  CG2 . VAL B 1  570 ? 6.767   10.126  171.196 1.00 41.53  ? 668  VAL B CG2 1 
ATOM   9557  N  N   . GLY B 1  571 ? 7.404   13.271  168.777 1.00 33.55  ? 669  GLY B N   1 
ATOM   9558  C  CA  . GLY B 1  571 ? 7.196   14.685  169.023 1.00 32.49  ? 669  GLY B CA  1 
ATOM   9559  C  C   . GLY B 1  571 ? 8.269   15.533  168.366 1.00 34.42  ? 669  GLY B C   1 
ATOM   9560  O  O   . GLY B 1  571 ? 8.052   16.710  168.076 1.00 40.31  ? 669  GLY B O   1 
ATOM   9561  N  N   . GLU B 1  572 ? 9.435   14.936  168.139 1.00 31.84  ? 670  GLU B N   1 
ATOM   9562  C  CA  . GLU B 1  572 ? 10.551  15.644  167.520 1.00 30.71  ? 670  GLU B CA  1 
ATOM   9563  C  C   . GLU B 1  572 ? 10.444  15.622  165.998 1.00 29.44  ? 670  GLU B C   1 
ATOM   9564  O  O   . GLU B 1  572 ? 9.536   15.007  165.442 1.00 29.04  ? 670  GLU B O   1 
ATOM   9565  C  CB  . GLU B 1  572 ? 11.883  15.035  167.966 1.00 32.30  ? 670  GLU B CB  1 
ATOM   9566  C  CG  . GLU B 1  572 ? 12.101  15.077  169.469 1.00 37.33  ? 670  GLU B CG  1 
ATOM   9567  C  CD  . GLU B 1  572 ? 13.446  14.515  169.883 1.00 40.43  ? 670  GLU B CD  1 
ATOM   9568  O  OE1 . GLU B 1  572 ? 13.946  13.601  169.195 1.00 41.25  ? 670  GLU B OE1 1 
ATOM   9569  O  OE2 . GLU B 1  572 ? 14.000  14.982  170.900 1.00 41.34  ? 670  GLU B OE2 1 
ATOM   9570  N  N   . VAL B 1  573 ? 11.376  16.296  165.330 1.00 27.46  ? 671  VAL B N   1 
ATOM   9571  C  CA  . VAL B 1  573 ? 11.325  16.437  163.878 1.00 26.10  ? 671  VAL B CA  1 
ATOM   9572  C  C   . VAL B 1  573 ? 12.563  15.864  163.192 1.00 28.12  ? 671  VAL B C   1 
ATOM   9573  O  O   . VAL B 1  573 ? 13.675  16.357  163.379 1.00 28.29  ? 671  VAL B O   1 
ATOM   9574  C  CB  . VAL B 1  573 ? 11.171  17.915  163.465 1.00 25.56  ? 671  VAL B CB  1 
ATOM   9575  C  CG1 . VAL B 1  573 ? 11.211  18.050  161.951 1.00 24.51  ? 671  VAL B CG1 1 
ATOM   9576  C  CG2 . VAL B 1  573 ? 9.878   18.491  164.024 1.00 22.12  ? 671  VAL B CG2 1 
ATOM   9577  N  N   . ALA B 1  574 ? 12.361  14.816  162.400 1.00 29.05  ? 672  ALA B N   1 
ATOM   9578  C  CA  . ALA B 1  574 ? 13.439  14.226  161.615 1.00 26.56  ? 672  ALA B CA  1 
ATOM   9579  C  C   . ALA B 1  574 ? 13.593  14.968  160.291 1.00 25.65  ? 672  ALA B C   1 
ATOM   9580  O  O   . ALA B 1  574 ? 12.616  15.197  159.581 1.00 28.35  ? 672  ALA B O   1 
ATOM   9581  C  CB  . ALA B 1  574 ? 13.176  12.751  161.376 1.00 24.89  ? 672  ALA B CB  1 
ATOM   9582  N  N   . GLU B 1  575 ? 14.825  15.344  159.965 1.00 22.74  ? 673  GLU B N   1 
ATOM   9583  C  CA  . GLU B 1  575 ? 15.090  16.152  158.780 1.00 18.65  ? 673  GLU B CA  1 
ATOM   9584  C  C   . GLU B 1  575 ? 16.197  15.557  157.913 1.00 21.91  ? 673  GLU B C   1 
ATOM   9585  O  O   . GLU B 1  575 ? 17.286  15.260  158.402 1.00 28.40  ? 673  GLU B O   1 
ATOM   9586  C  CB  . GLU B 1  575 ? 15.459  17.576  159.197 1.00 17.63  ? 673  GLU B CB  1 
ATOM   9587  C  CG  . GLU B 1  575 ? 15.856  18.490  158.057 1.00 28.16  ? 673  GLU B CG  1 
ATOM   9588  C  CD  . GLU B 1  575 ? 16.132  19.905  158.527 1.00 40.13  ? 673  GLU B CD  1 
ATOM   9589  O  OE1 . GLU B 1  575 ? 15.281  20.471  159.244 1.00 45.01  ? 673  GLU B OE1 1 
ATOM   9590  O  OE2 . GLU B 1  575 ? 17.203  20.449  158.186 1.00 41.84  ? 673  GLU B OE2 1 
ATOM   9591  N  N   . VAL B 1  576 ? 15.913  15.378  156.627 1.00 18.15  ? 674  VAL B N   1 
ATOM   9592  C  CA  . VAL B 1  576 ? 16.910  14.872  155.690 1.00 17.01  ? 674  VAL B CA  1 
ATOM   9593  C  C   . VAL B 1  576 ? 17.022  15.795  154.480 1.00 20.59  ? 674  VAL B C   1 
ATOM   9594  O  O   . VAL B 1  576 ? 16.010  16.211  153.916 1.00 16.34  ? 674  VAL B O   1 
ATOM   9595  C  CB  . VAL B 1  576 ? 16.575  13.447  155.213 1.00 15.96  ? 674  VAL B CB  1 
ATOM   9596  C  CG1 . VAL B 1  576 ? 17.653  12.941  154.276 1.00 18.56  ? 674  VAL B CG1 1 
ATOM   9597  C  CG2 . VAL B 1  576 ? 16.430  12.508  156.399 1.00 18.36  ? 674  VAL B CG2 1 
ATOM   9598  N  N   . ILE B 1  577 ? 18.253  16.114  154.087 1.00 24.43  ? 675  ILE B N   1 
ATOM   9599  C  CA  . ILE B 1  577 ? 18.490  17.018  152.967 1.00 21.75  ? 675  ILE B CA  1 
ATOM   9600  C  C   . ILE B 1  577 ? 19.148  16.308  151.789 1.00 19.91  ? 675  ILE B C   1 
ATOM   9601  O  O   . ILE B 1  577 ? 20.195  15.679  151.936 1.00 20.90  ? 675  ILE B O   1 
ATOM   9602  C  CB  . ILE B 1  577 ? 19.378  18.206  153.383 1.00 24.28  ? 675  ILE B CB  1 
ATOM   9603  C  CG1 . ILE B 1  577 ? 18.779  18.927  154.593 1.00 24.00  ? 675  ILE B CG1 1 
ATOM   9604  C  CG2 . ILE B 1  577 ? 19.567  19.163  152.215 1.00 16.38  ? 675  ILE B CG2 1 
ATOM   9605  C  CD1 . ILE B 1  577 ? 19.585  20.121  155.055 1.00 23.78  ? 675  ILE B CD1 1 
ATOM   9606  N  N   . PHE B 1  578 ? 18.532  16.421  150.617 1.00 19.97  ? 676  PHE B N   1 
ATOM   9607  C  CA  . PHE B 1  578 ? 19.060  15.800  149.407 1.00 16.17  ? 676  PHE B CA  1 
ATOM   9608  C  C   . PHE B 1  578 ? 19.535  16.872  148.436 1.00 20.06  ? 676  PHE B C   1 
ATOM   9609  O  O   . PHE B 1  578 ? 19.052  18.004  148.475 1.00 22.72  ? 676  PHE B O   1 
ATOM   9610  C  CB  . PHE B 1  578 ? 17.996  14.937  148.722 1.00 15.86  ? 676  PHE B CB  1 
ATOM   9611  C  CG  . PHE B 1  578 ? 17.356  13.915  149.618 1.00 17.48  ? 676  PHE B CG  1 
ATOM   9612  C  CD1 . PHE B 1  578 ? 16.261  14.247  150.401 1.00 16.59  ? 676  PHE B CD1 1 
ATOM   9613  C  CD2 . PHE B 1  578 ? 17.832  12.615  149.659 1.00 18.40  ? 676  PHE B CD2 1 
ATOM   9614  C  CE1 . PHE B 1  578 ? 15.663  13.305  151.221 1.00 15.54  ? 676  PHE B CE1 1 
ATOM   9615  C  CE2 . PHE B 1  578 ? 17.238  11.668  150.476 1.00 19.51  ? 676  PHE B CE2 1 
ATOM   9616  C  CZ  . PHE B 1  578 ? 16.150  12.013  151.257 1.00 15.66  ? 676  PHE B CZ  1 
ATOM   9617  N  N   . VAL B 1  579 ? 20.471  16.529  147.557 1.00 19.43  ? 677  VAL B N   1 
ATOM   9618  C  CA  . VAL B 1  579 ? 20.734  17.407  146.427 1.00 23.36  ? 677  VAL B CA  1 
ATOM   9619  C  C   . VAL B 1  579 ? 19.525  17.229  145.519 1.00 25.71  ? 677  VAL B C   1 
ATOM   9620  O  O   . VAL B 1  579 ? 19.109  16.106  145.219 1.00 24.85  ? 677  VAL B O   1 
ATOM   9621  C  CB  . VAL B 1  579 ? 22.081  17.103  145.702 1.00 17.78  ? 677  VAL B CB  1 
ATOM   9622  C  CG1 . VAL B 1  579 ? 22.870  16.035  146.441 1.00 18.15  ? 677  VAL B CG1 1 
ATOM   9623  C  CG2 . VAL B 1  579 ? 21.870  16.728  144.236 1.00 17.94  ? 677  VAL B CG2 1 
ATOM   9624  N  N   . GLY B 1  580 ? 18.912  18.345  145.146 1.00 25.72  ? 678  GLY B N   1 
ATOM   9625  C  CA  . GLY B 1  580 ? 17.639  18.298  144.459 1.00 18.44  ? 678  GLY B CA  1 
ATOM   9626  C  C   . GLY B 1  580 ? 17.622  18.956  143.099 1.00 19.19  ? 678  GLY B C   1 
ATOM   9627  O  O   . GLY B 1  580 ? 18.603  19.557  142.662 1.00 21.10  ? 678  GLY B O   1 
ATOM   9628  N  N   . ALA B 1  581 ? 16.484  18.822  142.428 1.00 22.64  ? 679  ALA B N   1 
ATOM   9629  C  CA  . ALA B 1  581 ? 16.207  19.543  141.198 1.00 21.70  ? 679  ALA B CA  1 
ATOM   9630  C  C   . ALA B 1  581 ? 14.884  20.281  141.362 1.00 21.48  ? 679  ALA B C   1 
ATOM   9631  O  O   . ALA B 1  581 ? 14.202  20.112  142.373 1.00 22.17  ? 679  ALA B O   1 
ATOM   9632  C  CB  . ALA B 1  581 ? 16.160  18.594  140.016 1.00 22.96  ? 679  ALA B CB  1 
ATOM   9633  N  N   . ASN B 1  582 ? 14.522  21.095  140.376 1.00 16.47  ? 680  ASN B N   1 
ATOM   9634  C  CA  . ASN B 1  582 ? 13.301  21.886  140.458 1.00 17.17  ? 680  ASN B CA  1 
ATOM   9635  C  C   . ASN B 1  582 ? 12.053  21.002  140.458 1.00 21.54  ? 680  ASN B C   1 
ATOM   9636  O  O   . ASN B 1  582 ? 11.842  20.219  139.532 1.00 25.69  ? 680  ASN B O   1 
ATOM   9637  C  CB  . ASN B 1  582 ? 13.242  22.888  139.304 1.00 21.19  ? 680  ASN B CB  1 
ATOM   9638  C  CG  . ASN B 1  582 ? 12.284  24.037  139.571 1.00 26.05  ? 680  ASN B CG  1 
ATOM   9639  O  OD1 . ASN B 1  582 ? 11.176  23.837  140.068 1.00 32.01  ? 680  ASN B OD1 1 
ATOM   9640  N  ND2 . ASN B 1  582 ? 12.711  25.250  139.240 1.00 24.23  ? 680  ASN B ND2 1 
ATOM   9641  N  N   . PRO B 1  583 ? 11.228  21.123  141.511 1.00 21.92  ? 681  PRO B N   1 
ATOM   9642  C  CA  . PRO B 1  583 ? 9.969   20.388  141.687 1.00 23.00  ? 681  PRO B CA  1 
ATOM   9643  C  C   . PRO B 1  583 ? 9.001   20.526  140.511 1.00 23.77  ? 681  PRO B C   1 
ATOM   9644  O  O   . PRO B 1  583 ? 8.160   19.651  140.310 1.00 27.67  ? 681  PRO B O   1 
ATOM   9645  C  CB  . PRO B 1  583 ? 9.372   21.021  142.946 1.00 19.75  ? 681  PRO B CB  1 
ATOM   9646  C  CG  . PRO B 1  583 ? 10.548  21.506  143.710 1.00 16.36  ? 681  PRO B CG  1 
ATOM   9647  C  CD  . PRO B 1  583 ? 11.539  21.962  142.682 1.00 17.63  ? 681  PRO B CD  1 
ATOM   9648  N  N   . LYS B 1  584 ? 9.115   21.610  139.750 1.00 21.24  ? 682  LYS B N   1 
ATOM   9649  C  CA  . LYS B 1  584 ? 8.208   21.850  138.633 1.00 25.20  ? 682  LYS B CA  1 
ATOM   9650  C  C   . LYS B 1  584 ? 8.495   20.917  137.457 1.00 28.16  ? 682  LYS B C   1 
ATOM   9651  O  O   . LYS B 1  584 ? 7.695   20.817  136.526 1.00 28.87  ? 682  LYS B O   1 
ATOM   9652  C  CB  . LYS B 1  584 ? 8.290   23.310  138.182 1.00 25.73  ? 682  LYS B CB  1 
ATOM   9653  C  CG  . LYS B 1  584 ? 9.508   23.640  137.336 1.00 27.63  ? 682  LYS B CG  1 
ATOM   9654  C  CD  . LYS B 1  584 ? 9.604   25.137  137.090 1.00 30.42  ? 682  LYS B CD  1 
ATOM   9655  C  CE  . LYS B 1  584 ? 10.772  25.480  136.180 1.00 30.83  ? 682  LYS B CE  1 
ATOM   9656  N  NZ  . LYS B 1  584 ? 10.900  26.951  135.987 1.00 30.67  ? 682  LYS B NZ  1 
ATOM   9657  N  N   . ASN B 1  585 ? 9.640   20.242  137.503 1.00 26.51  ? 683  ASN B N   1 
ATOM   9658  C  CA  . ASN B 1  585 ? 9.978   19.229  136.507 1.00 23.25  ? 683  ASN B CA  1 
ATOM   9659  C  C   . ASN B 1  585 ? 9.114   17.977  136.639 1.00 22.23  ? 683  ASN B C   1 
ATOM   9660  O  O   . ASN B 1  585 ? 8.975   17.204  135.691 1.00 18.62  ? 683  ASN B O   1 
ATOM   9661  C  CB  . ASN B 1  585 ? 11.457  18.848  136.608 1.00 21.97  ? 683  ASN B CB  1 
ATOM   9662  C  CG  . ASN B 1  585 ? 12.383  20.010  136.303 1.00 24.16  ? 683  ASN B CG  1 
ATOM   9663  O  OD1 . ASN B 1  585 ? 12.040  20.904  135.529 1.00 31.98  ? 683  ASN B OD1 1 
ATOM   9664  N  ND2 . ASN B 1  585 ? 13.566  20.000  136.907 1.00 18.71  ? 683  ASN B ND2 1 
ATOM   9665  N  N   . SER B 1  586 ? 8.534   17.787  137.819 1.00 26.03  ? 684  SER B N   1 
ATOM   9666  C  CA  . SER B 1  586 ? 7.755   16.590  138.115 1.00 31.19  ? 684  SER B CA  1 
ATOM   9667  C  C   . SER B 1  586 ? 6.285   16.739  137.730 1.00 41.32  ? 684  SER B C   1 
ATOM   9668  O  O   . SER B 1  586 ? 5.464   15.877  138.039 1.00 48.74  ? 684  SER B O   1 
ATOM   9669  C  CB  . SER B 1  586 ? 7.870   16.238  139.598 1.00 30.25  ? 684  SER B CB  1 
ATOM   9670  O  OG  . SER B 1  586 ? 9.201   15.880  139.931 1.00 31.75  ? 684  SER B OG  1 
ATOM   9671  N  N   . VAL B 1  587 ? 5.957   17.835  137.055 1.00 50.16  ? 685  VAL B N   1 
ATOM   9672  C  CA  . VAL B 1  587 ? 4.582   18.095  136.644 1.00 54.61  ? 685  VAL B CA  1 
ATOM   9673  C  C   . VAL B 1  587 ? 4.358   17.623  135.204 1.00 64.74  ? 685  VAL B C   1 
ATOM   9674  O  O   . VAL B 1  587 ? 5.271   17.680  134.378 1.00 64.93  ? 685  VAL B O   1 
ATOM   9675  C  CB  . VAL B 1  587 ? 4.242   19.597  136.772 1.00 52.39  ? 685  VAL B CB  1 
ATOM   9676  C  CG1 . VAL B 1  587 ? 2.803   19.869  136.365 1.00 54.43  ? 685  VAL B CG1 1 
ATOM   9677  C  CG2 . VAL B 1  587 ? 4.466   20.060  138.196 1.00 48.77  ? 685  VAL B CG2 1 
ATOM   9678  N  N   . GLN B 1  588 ? 3.147   17.131  134.935 1.00 74.08  ? 686  GLN B N   1 
ATOM   9679  C  CA  . GLN B 1  588 ? 2.706   16.697  133.602 1.00 82.64  ? 686  GLN B CA  1 
ATOM   9680  C  C   . GLN B 1  588 ? 3.410   15.434  133.095 1.00 86.08  ? 686  GLN B C   1 
ATOM   9681  O  O   . GLN B 1  588 ? 4.265   15.511  132.210 1.00 85.62  ? 686  GLN B O   1 
ATOM   9682  C  CB  . GLN B 1  588 ? 2.893   17.830  132.585 1.00 84.45  ? 686  GLN B CB  1 
ATOM   9683  C  CG  . GLN B 1  588 ? 1.622   18.254  131.873 1.00 85.87  ? 686  GLN B CG  1 
ATOM   9684  C  CD  . GLN B 1  588 ? 1.799   19.546  131.101 1.00 86.30  ? 686  GLN B CD  1 
ATOM   9685  O  OE1 . GLN B 1  588 ? 2.908   20.067  130.985 1.00 86.16  ? 686  GLN B OE1 1 
ATOM   9686  N  NE2 . GLN B 1  588 ? 0.701   20.076  130.573 1.00 87.42  ? 686  GLN B NE2 1 
ATOM   9687  N  N   . ASN B 1  589 ? 3.052   14.274  133.647 1.00 87.52  ? 687  ASN B N   1 
ATOM   9688  C  CA  . ASN B 1  589 ? 2.093   14.187  134.747 1.00 87.27  ? 687  ASN B CA  1 
ATOM   9689  C  C   . ASN B 1  589 ? 2.724   14.174  136.155 1.00 84.93  ? 687  ASN B C   1 
ATOM   9690  O  O   . ASN B 1  589 ? 2.314   14.988  136.983 1.00 84.16  ? 687  ASN B O   1 
ATOM   9691  C  CB  . ASN B 1  589 ? 1.178   12.969  134.568 1.00 88.69  ? 687  ASN B CB  1 
ATOM   9692  C  CG  . ASN B 1  589 ? -0.144  13.329  133.916 1.00 90.88  ? 687  ASN B CG  1 
ATOM   9693  O  OD1 . ASN B 1  589 ? -0.229  14.285  133.144 1.00 92.69  ? 687  ASN B OD1 1 
ATOM   9694  N  ND2 . ASN B 1  589 ? -1.185  12.569  134.232 1.00 90.73  ? 687  ASN B ND2 1 
ATOM   9695  N  N   . GLN B 1  590 ? 3.696   13.307  136.472 1.00 83.14  ? 688  GLN B N   1 
ATOM   9696  C  CA  . GLN B 1  590 ? 4.303   12.276  135.624 1.00 81.26  ? 688  GLN B CA  1 
ATOM   9697  C  C   . GLN B 1  590 ? 4.212   10.931  136.333 1.00 80.06  ? 688  GLN B C   1 
ATOM   9698  O  O   . GLN B 1  590 ? 5.185   10.172  136.335 1.00 82.45  ? 688  GLN B O   1 
ATOM   9699  C  CB  . GLN B 1  590 ? 5.773   12.595  135.329 1.00 76.81  ? 688  GLN B CB  1 
ATOM   9700  C  CG  . GLN B 1  590 ? 6.020   13.769  134.404 1.00 73.13  ? 688  GLN B CG  1 
ATOM   9701  C  CD  . GLN B 1  590 ? 7.383   14.393  134.608 1.00 70.77  ? 688  GLN B CD  1 
ATOM   9702  O  OE1 . GLN B 1  590 ? 8.120   14.015  135.517 1.00 68.13  ? 688  GLN B OE1 1 
ATOM   9703  N  NE2 . GLN B 1  590 ? 7.726   15.357  133.762 1.00 73.29  ? 688  GLN B NE2 1 
ATOM   9704  N  N   . THR B 1  591 ? 3.059   10.663  136.952 1.00 73.04  ? 689  THR B N   1 
ATOM   9705  C  CA  . THR B 1  591 ? 2.822   9.509   137.840 1.00 65.10  ? 689  THR B CA  1 
ATOM   9706  C  C   . THR B 1  591 ? 3.577   9.800   139.126 1.00 56.37  ? 689  THR B C   1 
ATOM   9707  O  O   . THR B 1  591 ? 3.888   8.906   139.914 1.00 52.64  ? 689  THR B O   1 
ATOM   9708  C  CB  . THR B 1  591 ? 3.246   8.125   137.272 1.00 75.80  ? 689  THR B CB  1 
ATOM   9709  O  OG1 . THR B 1  591 ? 4.576   8.169   136.738 1.00 77.06  ? 689  THR B OG1 1 
ATOM   9710  C  CG2 . THR B 1  591 ? 2.277   7.673   136.215 1.00 76.39  ? 689  THR B CG2 1 
ATOM   9711  N  N   . HIS B 1  592 ? 3.861   11.083  139.315 1.00 51.91  ? 690  HIS B N   1 
ATOM   9712  C  CA  . HIS B 1  592 ? 4.560   11.578  140.482 1.00 47.05  ? 690  HIS B CA  1 
ATOM   9713  C  C   . HIS B 1  592 ? 3.545   11.829  141.590 1.00 42.65  ? 690  HIS B C   1 
ATOM   9714  O  O   . HIS B 1  592 ? 3.106   12.959  141.810 1.00 41.34  ? 690  HIS B O   1 
ATOM   9715  C  CB  . HIS B 1  592 ? 5.324   12.854  140.137 1.00 40.88  ? 690  HIS B CB  1 
ATOM   9716  C  CG  . HIS B 1  592 ? 6.402   13.196  141.115 1.00 33.85  ? 690  HIS B CG  1 
ATOM   9717  N  ND1 . HIS B 1  592 ? 6.189   14.022  142.197 1.00 30.04  ? 690  HIS B ND1 1 
ATOM   9718  C  CD2 . HIS B 1  592 ? 7.702   12.824  141.174 1.00 34.18  ? 690  HIS B CD2 1 
ATOM   9719  C  CE1 . HIS B 1  592 ? 7.312   14.142  142.882 1.00 33.44  ? 690  HIS B CE1 1 
ATOM   9720  N  NE2 . HIS B 1  592 ? 8.246   13.426  142.282 1.00 35.46  ? 690  HIS B NE2 1 
ATOM   9721  N  N   . GLN B 1  593 ? 3.172   10.753  142.275 1.00 35.77  ? 691  GLN B N   1 
ATOM   9722  C  CA  . GLN B 1  593 ? 2.167   10.810  143.325 1.00 31.63  ? 691  GLN B CA  1 
ATOM   9723  C  C   . GLN B 1  593 ? 2.715   11.484  144.576 1.00 34.35  ? 691  GLN B C   1 
ATOM   9724  O  O   . GLN B 1  593 ? 1.964   12.086  145.343 1.00 35.12  ? 691  GLN B O   1 
ATOM   9725  C  CB  . GLN B 1  593 ? 1.683   9.401   143.666 1.00 37.79  ? 691  GLN B CB  1 
ATOM   9726  C  CG  . GLN B 1  593 ? 1.074   8.645   142.497 1.00 49.17  ? 691  GLN B CG  1 
ATOM   9727  C  CD  . GLN B 1  593 ? 0.388   7.363   142.927 1.00 59.82  ? 691  GLN B CD  1 
ATOM   9728  O  OE1 . GLN B 1  593 ? 0.492   6.946   144.081 1.00 66.48  ? 691  GLN B OE1 1 
ATOM   9729  N  NE2 . GLN B 1  593 ? -0.313  6.725   141.997 1.00 61.55  ? 691  GLN B NE2 1 
ATOM   9730  N  N   . THR B 1  594 ? 4.024   11.376  144.783 1.00 19.58  ? 692  THR B N   1 
ATOM   9731  C  CA  . THR B 1  594 ? 4.649   11.963  145.962 1.00 20.04  ? 692  THR B CA  1 
ATOM   9732  C  C   . THR B 1  594 ? 6.100   12.390  145.717 1.00 22.49  ? 692  THR B C   1 
ATOM   9733  O  O   . THR B 1  594 ? 6.825   11.772  144.937 1.00 21.80  ? 692  THR B O   1 
ATOM   9734  C  CB  . THR B 1  594 ? 4.593   10.988  147.163 1.00 21.09  ? 692  THR B CB  1 
ATOM   9735  O  OG1 . THR B 1  594 ? 5.071   11.647  148.342 1.00 23.73  ? 692  THR B OG1 1 
ATOM   9736  C  CG2 . THR B 1  594 ? 5.433   9.747   146.897 1.00 19.06  ? 692  THR B CG2 1 
ATOM   9737  N  N   . PHE B 1  595 ? 6.508   13.466  146.382 1.00 21.84  ? 693  PHE B N   1 
ATOM   9738  C  CA  . PHE B 1  595 ? 7.894   13.913  146.348 1.00 20.59  ? 693  PHE B CA  1 
ATOM   9739  C  C   . PHE B 1  595 ? 8.703   13.136  147.373 1.00 24.05  ? 693  PHE B C   1 
ATOM   9740  O  O   . PHE B 1  595 ? 9.931   13.082  147.306 1.00 17.73  ? 693  PHE B O   1 
ATOM   9741  C  CB  . PHE B 1  595 ? 8.001   15.416  146.631 1.00 16.95  ? 693  PHE B CB  1 
ATOM   9742  C  CG  . PHE B 1  595 ? 7.747   16.287  145.432 1.00 19.76  ? 693  PHE B CG  1 
ATOM   9743  C  CD1 . PHE B 1  595 ? 8.754   16.528  144.510 1.00 21.86  ? 693  PHE B CD1 1 
ATOM   9744  C  CD2 . PHE B 1  595 ? 6.509   16.875  145.233 1.00 17.26  ? 693  PHE B CD2 1 
ATOM   9745  C  CE1 . PHE B 1  595 ? 8.527   17.332  143.406 1.00 18.36  ? 693  PHE B CE1 1 
ATOM   9746  C  CE2 . PHE B 1  595 ? 6.277   17.681  144.132 1.00 19.67  ? 693  PHE B CE2 1 
ATOM   9747  C  CZ  . PHE B 1  595 ? 7.288   17.908  143.218 1.00 18.52  ? 693  PHE B CZ  1 
ATOM   9748  N  N   . LEU B 1  596 ? 8.000   12.538  148.329 1.00 17.24  ? 694  LEU B N   1 
ATOM   9749  C  CA  . LEU B 1  596 ? 8.654   11.886  149.452 1.00 24.52  ? 694  LEU B CA  1 
ATOM   9750  C  C   . LEU B 1  596 ? 7.848   10.719  150.001 1.00 24.45  ? 694  LEU B C   1 
ATOM   9751  O  O   . LEU B 1  596 ? 6.626   10.676  149.872 1.00 24.36  ? 694  LEU B O   1 
ATOM   9752  C  CB  . LEU B 1  596 ? 8.907   12.906  150.568 1.00 24.10  ? 694  LEU B CB  1 
ATOM   9753  C  CG  . LEU B 1  596 ? 7.674   13.394  151.339 1.00 16.08  ? 694  LEU B CG  1 
ATOM   9754  C  CD1 . LEU B 1  596 ? 7.514   12.660  152.667 1.00 16.17  ? 694  LEU B CD1 1 
ATOM   9755  C  CD2 . LEU B 1  596 ? 7.719   14.898  151.551 1.00 15.55  ? 694  LEU B CD2 1 
ATOM   9756  N  N   . THR B 1  597 ? 8.546   9.771   150.616 1.00 17.90  ? 695  THR B N   1 
ATOM   9757  C  CA  . THR B 1  597 ? 7.895   8.758   151.432 1.00 18.18  ? 695  THR B CA  1 
ATOM   9758  C  C   . THR B 1  597 ? 8.636   8.608   152.752 1.00 18.20  ? 695  THR B C   1 
ATOM   9759  O  O   . THR B 1  597 ? 9.854   8.774   152.816 1.00 18.35  ? 695  THR B O   1 
ATOM   9760  C  CB  . THR B 1  597 ? 7.835   7.382   150.734 1.00 19.11  ? 695  THR B CB  1 
ATOM   9761  O  OG1 . THR B 1  597 ? 9.156   6.964   150.371 1.00 19.67  ? 695  THR B OG1 1 
ATOM   9762  C  CG2 . THR B 1  597 ? 6.957   7.438   149.492 1.00 19.33  ? 695  THR B CG2 1 
ATOM   9763  N  N   . VAL B 1  598 ? 7.890   8.312   153.808 1.00 18.20  ? 696  VAL B N   1 
ATOM   9764  C  CA  . VAL B 1  598 ? 8.489   7.836   155.044 1.00 19.55  ? 696  VAL B CA  1 
ATOM   9765  C  C   . VAL B 1  598 ? 8.173   6.354   155.147 1.00 21.82  ? 696  VAL B C   1 
ATOM   9766  O  O   . VAL B 1  598 ? 7.017   5.953   155.020 1.00 29.27  ? 696  VAL B O   1 
ATOM   9767  C  CB  . VAL B 1  598 ? 7.968   8.588   156.278 1.00 18.62  ? 696  VAL B CB  1 
ATOM   9768  C  CG1 . VAL B 1  598 ? 8.667   8.090   157.534 1.00 18.83  ? 696  VAL B CG1 1 
ATOM   9769  C  CG2 . VAL B 1  598 ? 8.176   10.084  156.108 1.00 17.45  ? 696  VAL B CG2 1 
ATOM   9770  N  N   . GLU B 1  599 ? 9.200   5.538   155.344 1.00 21.56  ? 697  GLU B N   1 
ATOM   9771  C  CA  . GLU B 1  599 ? 9.021   4.095   155.298 1.00 22.38  ? 697  GLU B CA  1 
ATOM   9772  C  C   . GLU B 1  599 ? 9.496   3.431   156.582 1.00 26.99  ? 697  GLU B C   1 
ATOM   9773  O  O   . GLU B 1  599 ? 10.522  3.806   157.147 1.00 29.16  ? 697  GLU B O   1 
ATOM   9774  C  CB  . GLU B 1  599 ? 9.758   3.509   154.093 1.00 21.73  ? 697  GLU B CB  1 
ATOM   9775  C  CG  . GLU B 1  599 ? 9.334   4.125   152.769 1.00 24.08  ? 697  GLU B CG  1 
ATOM   9776  C  CD  . GLU B 1  599 ? 10.003  3.478   151.575 1.00 29.18  ? 697  GLU B CD  1 
ATOM   9777  O  OE1 . GLU B 1  599 ? 10.812  2.549   151.774 1.00 29.82  ? 697  GLU B OE1 1 
ATOM   9778  O  OE2 . GLU B 1  599 ? 9.710   3.896   150.435 1.00 32.16  ? 697  GLU B OE2 1 
ATOM   9779  N  N   . LYS B 1  600 ? 8.729   2.449   157.042 1.00 30.67  ? 698  LYS B N   1 
ATOM   9780  C  CA  . LYS B 1  600 ? 9.050   1.724   158.263 1.00 29.33  ? 698  LYS B CA  1 
ATOM   9781  C  C   . LYS B 1  600 ? 9.500   0.310   157.920 1.00 31.46  ? 698  LYS B C   1 
ATOM   9782  O  O   . LYS B 1  600 ? 8.885   -0.358  157.090 1.00 28.01  ? 698  LYS B O   1 
ATOM   9783  C  CB  . LYS B 1  600 ? 7.842   1.698   159.200 1.00 28.82  ? 698  LYS B CB  1 
ATOM   9784  C  CG  . LYS B 1  600 ? 8.102   1.063   160.553 1.00 28.92  ? 698  LYS B CG  1 
ATOM   9785  C  CD  . LYS B 1  600 ? 6.879   1.189   161.448 1.00 32.09  ? 698  LYS B CD  1 
ATOM   9786  C  CE  . LYS B 1  600 ? 7.179   0.742   162.870 1.00 32.91  ? 698  LYS B CE  1 
ATOM   9787  N  NZ  . LYS B 1  600 ? 7.542   -0.700  162.936 1.00 33.80  ? 698  LYS B NZ  1 
ATOM   9788  N  N   . TYR B 1  601 ? 10.575  -0.140  158.557 1.00 37.35  ? 699  TYR B N   1 
ATOM   9789  C  CA  . TYR B 1  601 ? 11.092  -1.481  158.312 1.00 37.09  ? 699  TYR B CA  1 
ATOM   9790  C  C   . TYR B 1  601 ? 10.343  -2.535  159.119 1.00 37.72  ? 699  TYR B C   1 
ATOM   9791  O  O   . TYR B 1  601 ? 10.184  -2.409  160.333 1.00 35.43  ? 699  TYR B O   1 
ATOM   9792  C  CB  . TYR B 1  601 ? 12.587  -1.548  158.631 1.00 33.92  ? 699  TYR B CB  1 
ATOM   9793  C  CG  . TYR B 1  601 ? 13.199  -2.903  158.356 1.00 34.78  ? 699  TYR B CG  1 
ATOM   9794  C  CD1 . TYR B 1  601 ? 13.375  -3.354  157.055 1.00 36.55  ? 699  TYR B CD1 1 
ATOM   9795  C  CD2 . TYR B 1  601 ? 13.595  -3.732  159.397 1.00 37.12  ? 699  TYR B CD2 1 
ATOM   9796  C  CE1 . TYR B 1  601 ? 13.931  -4.593  156.797 1.00 39.34  ? 699  TYR B CE1 1 
ATOM   9797  C  CE2 . TYR B 1  601 ? 14.152  -4.972  159.150 1.00 41.62  ? 699  TYR B CE2 1 
ATOM   9798  C  CZ  . TYR B 1  601 ? 14.318  -5.397  157.848 1.00 43.61  ? 699  TYR B CZ  1 
ATOM   9799  O  OH  . TYR B 1  601 ? 14.873  -6.632  157.601 1.00 48.31  ? 699  TYR B OH  1 
ATOM   9800  N  N   . GLU B 1  602 ? 9.878   -3.572  158.430 1.00 42.84  ? 700  GLU B N   1 
ATOM   9801  C  CA  . GLU B 1  602 ? 9.225   -4.703  159.077 1.00 51.63  ? 700  GLU B CA  1 
ATOM   9802  C  C   . GLU B 1  602 ? 10.143  -5.920  159.047 1.00 51.72  ? 700  GLU B C   1 
ATOM   9803  O  O   . GLU B 1  602 ? 10.385  -6.497  157.988 1.00 53.71  ? 700  GLU B O   1 
ATOM   9804  C  CB  . GLU B 1  602 ? 7.892   -5.019  158.398 1.00 61.53  ? 700  GLU B CB  1 
ATOM   9805  C  CG  . GLU B 1  602 ? 6.889   -3.876  158.442 1.00 69.65  ? 700  GLU B CG  1 
ATOM   9806  C  CD  . GLU B 1  602 ? 6.400   -3.583  159.848 1.00 76.10  ? 700  GLU B CD  1 
ATOM   9807  O  OE1 . GLU B 1  602 ? 5.896   -4.516  160.509 1.00 82.44  ? 700  GLU B OE1 1 
ATOM   9808  O  OE2 . GLU B 1  602 ? 6.522   -2.421  160.292 1.00 72.43  ? 700  GLU B OE2 1 
ATOM   9809  N  N   . ALA B 1  603 ? 10.659  -6.295  160.213 1.00 51.64  ? 701  ALA B N   1 
ATOM   9810  C  CA  . ALA B 1  603 ? 11.651  -7.362  160.318 1.00 54.52  ? 701  ALA B CA  1 
ATOM   9811  C  C   . ALA B 1  603 ? 11.097  -8.717  159.883 1.00 57.42  ? 701  ALA B C   1 
ATOM   9812  O  O   . ALA B 1  603 ? 11.798  -9.508  159.253 1.00 56.54  ? 701  ALA B O   1 
ATOM   9813  C  CB  . ALA B 1  603 ? 12.181  -7.444  161.741 1.00 56.01  ? 701  ALA B CB  1 
ATOM   9814  N  N   . THR B 1  604 ? 9.840   -8.976  160.231 1.00 60.37  ? 702  THR B N   1 
ATOM   9815  C  CA  . THR B 1  604 ? 9.185   -10.241 159.910 1.00 63.96  ? 702  THR B CA  1 
ATOM   9816  C  C   . THR B 1  604 ? 9.171   -10.532 158.410 1.00 65.66  ? 702  THR B C   1 
ATOM   9817  O  O   . THR B 1  604 ? 9.498   -11.639 157.982 1.00 72.67  ? 702  THR B O   1 
ATOM   9818  C  CB  . THR B 1  604 ? 7.736   -10.267 160.428 1.00 62.47  ? 702  THR B CB  1 
ATOM   9819  O  OG1 . THR B 1  604 ? 6.999   -9.185  159.845 1.00 58.74  ? 702  THR B OG1 1 
ATOM   9820  C  CG2 . THR B 1  604 ? 7.711   -10.135 161.945 1.00 63.26  ? 702  THR B CG2 1 
ATOM   9821  N  N   . SER B 1  605 ? 8.791   -9.536  157.617 1.00 58.71  ? 703  SER B N   1 
ATOM   9822  C  CA  . SER B 1  605 ? 8.720   -9.699  156.169 1.00 55.32  ? 703  SER B CA  1 
ATOM   9823  C  C   . SER B 1  605 ? 10.015  -9.275  155.481 1.00 55.29  ? 703  SER B C   1 
ATOM   9824  O  O   . SER B 1  605 ? 10.156  -9.435  154.267 1.00 52.06  ? 703  SER B O   1 
ATOM   9825  C  CB  . SER B 1  605 ? 7.544   -8.901  155.600 1.00 52.41  ? 703  SER B CB  1 
ATOM   9826  O  OG  . SER B 1  605 ? 7.586   -7.552  156.033 1.00 51.71  ? 703  SER B OG  1 
ATOM   9827  N  N   . THR B 1  606 ? 10.957  -8.756  156.269 1.00 57.14  ? 704  THR B N   1 
ATOM   9828  C  CA  . THR B 1  606 ? 12.209  -8.199  155.754 1.00 57.57  ? 704  THR B CA  1 
ATOM   9829  C  C   . THR B 1  606 ? 11.932  -7.243  154.595 1.00 55.21  ? 704  THR B C   1 
ATOM   9830  O  O   . THR B 1  606 ? 12.418  -7.432  153.479 1.00 59.39  ? 704  THR B O   1 
ATOM   9831  C  CB  . THR B 1  606 ? 13.178  -9.313  155.296 1.00 58.67  ? 704  THR B CB  1 
ATOM   9832  O  OG1 . THR B 1  606 ? 13.151  -10.390 156.240 1.00 60.67  ? 704  THR B OG1 1 
ATOM   9833  C  CG2 . THR B 1  606 ? 14.603  -8.783  155.180 1.00 57.26  ? 704  THR B CG2 1 
ATOM   9834  N  N   . SER B 1  607 ? 11.125  -6.224  154.869 1.00 45.16  ? 705  SER B N   1 
ATOM   9835  C  CA  . SER B 1  607 ? 10.733  -5.265  153.847 1.00 41.70  ? 705  SER B CA  1 
ATOM   9836  C  C   . SER B 1  607 ? 10.417  -3.898  154.440 1.00 43.06  ? 705  SER B C   1 
ATOM   9837  O  O   . SER B 1  607 ? 10.143  -3.775  155.634 1.00 49.93  ? 705  SER B O   1 
ATOM   9838  C  CB  . SER B 1  607 ? 9.524   -5.787  153.071 1.00 42.00  ? 705  SER B CB  1 
ATOM   9839  O  OG  . SER B 1  607 ? 8.414   -5.968  153.932 1.00 42.08  ? 705  SER B OG  1 
ATOM   9840  N  N   . TRP B 1  608 ? 10.459  -2.873  153.596 1.00 36.08  ? 706  TRP B N   1 
ATOM   9841  C  CA  . TRP B 1  608 ? 10.104  -1.521  154.005 1.00 28.67  ? 706  TRP B CA  1 
ATOM   9842  C  C   . TRP B 1  608 ? 8.656   -1.229  153.633 1.00 27.90  ? 706  TRP B C   1 
ATOM   9843  O  O   . TRP B 1  608 ? 8.210   -1.563  152.536 1.00 25.83  ? 706  TRP B O   1 
ATOM   9844  C  CB  . TRP B 1  608 ? 11.036  -0.494  153.361 1.00 25.54  ? 706  TRP B CB  1 
ATOM   9845  C  CG  . TRP B 1  608 ? 12.441  -0.556  153.867 1.00 34.79  ? 706  TRP B CG  1 
ATOM   9846  C  CD1 . TRP B 1  608 ? 13.467  -1.292  153.351 1.00 27.38  ? 706  TRP B CD1 1 
ATOM   9847  C  CD2 . TRP B 1  608 ? 12.983  0.163   154.982 1.00 31.76  ? 706  TRP B CD2 1 
ATOM   9848  N  NE1 . TRP B 1  608 ? 14.612  -1.085  154.082 1.00 27.79  ? 706  TRP B NE1 1 
ATOM   9849  C  CE2 . TRP B 1  608 ? 14.341  -0.195  155.088 1.00 32.83  ? 706  TRP B CE2 1 
ATOM   9850  C  CE3 . TRP B 1  608 ? 12.450  1.071   155.902 1.00 29.01  ? 706  TRP B CE3 1 
ATOM   9851  C  CZ2 . TRP B 1  608 ? 15.175  0.323   156.077 1.00 30.59  ? 706  TRP B CZ2 1 
ATOM   9852  C  CZ3 . TRP B 1  608 ? 13.278  1.584   156.885 1.00 28.99  ? 706  TRP B CZ3 1 
ATOM   9853  C  CH2 . TRP B 1  608 ? 14.626  1.209   156.964 1.00 31.63  ? 706  TRP B CH2 1 
ATOM   9854  N  N   . GLN B 1  609 ? 7.921   -0.616  154.555 1.00 29.06  ? 707  GLN B N   1 
ATOM   9855  C  CA  . GLN B 1  609 ? 6.516   -0.307  154.326 1.00 32.03  ? 707  GLN B CA  1 
ATOM   9856  C  C   . GLN B 1  609 ? 6.260   1.189   154.452 1.00 31.76  ? 707  GLN B C   1 
ATOM   9857  O  O   . GLN B 1  609 ? 6.618   1.808   155.455 1.00 30.14  ? 707  GLN B O   1 
ATOM   9858  C  CB  . GLN B 1  609 ? 5.629   -1.079  155.305 1.00 38.92  ? 707  GLN B CB  1 
ATOM   9859  C  CG  . GLN B 1  609 ? 5.641   -2.587  155.095 1.00 48.21  ? 707  GLN B CG  1 
ATOM   9860  C  CD  . GLN B 1  609 ? 5.022   -3.001  153.771 1.00 49.94  ? 707  GLN B CD  1 
ATOM   9861  O  OE1 . GLN B 1  609 ? 4.179   -2.293  153.217 1.00 47.47  ? 707  GLN B OE1 1 
ATOM   9862  N  NE2 . GLN B 1  609 ? 5.439   -4.152  153.257 1.00 51.63  ? 707  GLN B NE2 1 
ATOM   9863  N  N   . ILE B 1  610 ? 5.650   1.768   153.421 1.00 29.60  ? 708  ILE B N   1 
ATOM   9864  C  CA  . ILE B 1  610 ? 5.365   3.198   153.405 1.00 25.34  ? 708  ILE B CA  1 
ATOM   9865  C  C   . ILE B 1  610 ? 4.331   3.567   154.464 1.00 27.63  ? 708  ILE B C   1 
ATOM   9866  O  O   . ILE B 1  610 ? 3.231   3.015   154.488 1.00 21.61  ? 708  ILE B O   1 
ATOM   9867  C  CB  . ILE B 1  610 ? 4.852   3.657   152.026 1.00 22.21  ? 708  ILE B CB  1 
ATOM   9868  C  CG1 . ILE B 1  610 ? 5.863   3.315   150.931 1.00 23.81  ? 708  ILE B CG1 1 
ATOM   9869  C  CG2 . ILE B 1  610 ? 4.557   5.147   152.040 1.00 20.18  ? 708  ILE B CG2 1 
ATOM   9870  C  CD1 . ILE B 1  610 ? 5.282   3.347   149.533 1.00 22.04  ? 708  ILE B CD1 1 
ATOM   9871  N  N   . VAL B 1  611 ? 4.687   4.507   155.334 1.00 27.28  ? 709  VAL B N   1 
ATOM   9872  C  CA  . VAL B 1  611 ? 3.784   4.953   156.388 1.00 24.66  ? 709  VAL B CA  1 
ATOM   9873  C  C   . VAL B 1  611 ? 3.322   6.387   156.127 1.00 26.22  ? 709  VAL B C   1 
ATOM   9874  O  O   . VAL B 1  611 ? 2.225   6.771   156.530 1.00 27.74  ? 709  VAL B O   1 
ATOM   9875  C  CB  . VAL B 1  611 ? 4.435   4.853   157.789 1.00 24.23  ? 709  VAL B CB  1 
ATOM   9876  C  CG1 . VAL B 1  611 ? 4.717   3.399   158.136 1.00 22.28  ? 709  VAL B CG1 1 
ATOM   9877  C  CG2 . VAL B 1  611 ? 5.709   5.678   157.865 1.00 24.85  ? 709  VAL B CG2 1 
ATOM   9878  N  N   . CYS B 1  612 ? 4.166   7.178   155.467 1.00 18.81  ? 710  CYS B N   1 
ATOM   9879  C  CA  . CYS B 1  612 ? 3.796   8.537   155.076 1.00 18.08  ? 710  CYS B CA  1 
ATOM   9880  C  C   . CYS B 1  612 ? 4.146   8.844   153.622 1.00 17.87  ? 710  CYS B C   1 
ATOM   9881  O  O   . CYS B 1  612 ? 5.019   8.209   153.031 1.00 24.44  ? 710  CYS B O   1 
ATOM   9882  C  CB  . CYS B 1  612 ? 4.482   9.564   155.981 1.00 22.23  ? 710  CYS B CB  1 
ATOM   9883  S  SG  . CYS B 1  612 ? 4.117   9.424   157.739 1.00 26.82  ? 710  CYS B SG  1 
ATOM   9884  N  N   . ASN B 1  613 ? 3.449   9.824   153.057 1.00 17.50  ? 711  ASN B N   1 
ATOM   9885  C  CA  . ASN B 1  613 ? 3.812   10.413  151.771 1.00 22.42  ? 711  ASN B CA  1 
ATOM   9886  C  C   . ASN B 1  613 ? 3.753   11.932  151.903 1.00 20.09  ? 711  ASN B C   1 
ATOM   9887  O  O   . ASN B 1  613 ? 3.569   12.438  153.008 1.00 16.38  ? 711  ASN B O   1 
ATOM   9888  C  CB  . ASN B 1  613 ? 2.899   9.905   150.649 1.00 17.93  ? 711  ASN B CB  1 
ATOM   9889  C  CG  . ASN B 1  613 ? 1.422   10.086  150.962 1.00 22.03  ? 711  ASN B CG  1 
ATOM   9890  O  OD1 . ASN B 1  613 ? 1.048   10.842  151.857 1.00 24.23  ? 711  ASN B OD1 1 
ATOM   9891  N  ND2 . ASN B 1  613 ? 0.574   9.380   150.223 1.00 19.24  ? 711  ASN B ND2 1 
ATOM   9892  N  N   . ASP B 1  614 ? 3.906   12.669  150.806 1.00 16.56  ? 712  ASP B N   1 
ATOM   9893  C  CA  . ASP B 1  614 ? 3.914   14.126  150.927 1.00 19.77  ? 712  ASP B CA  1 
ATOM   9894  C  C   . ASP B 1  614 ? 2.513   14.676  151.199 1.00 21.04  ? 712  ASP B C   1 
ATOM   9895  O  O   . ASP B 1  614 ? 2.348   15.860  151.489 1.00 24.43  ? 712  ASP B O   1 
ATOM   9896  C  CB  . ASP B 1  614 ? 4.527   14.794  149.685 1.00 20.16  ? 712  ASP B CB  1 
ATOM   9897  C  CG  . ASP B 1  614 ? 3.753   14.524  148.404 1.00 24.21  ? 712  ASP B CG  1 
ATOM   9898  O  OD1 . ASP B 1  614 ? 2.644   13.945  148.444 1.00 29.51  ? 712  ASP B OD1 1 
ATOM   9899  O  OD2 . ASP B 1  614 ? 4.270   14.911  147.334 1.00 19.42  ? 712  ASP B OD2 1 
ATOM   9900  N  N   . ALA B 1  615 ? 1.510   13.810  151.097 1.00 19.46  ? 713  ALA B N   1 
ATOM   9901  C  CA  . ALA B 1  615 ? 0.137   14.194  151.399 1.00 20.58  ? 713  ALA B CA  1 
ATOM   9902  C  C   . ALA B 1  615 ? -0.108  14.143  152.907 1.00 22.60  ? 713  ALA B C   1 
ATOM   9903  O  O   . ALA B 1  615 ? -1.005  14.814  153.423 1.00 17.01  ? 713  ALA B O   1 
ATOM   9904  C  CB  . ALA B 1  615 ? -0.845  13.295  150.664 1.00 17.76  ? 713  ALA B CB  1 
ATOM   9905  N  N   . SER B 1  616 ? 0.685   13.333  153.604 1.00 17.25  ? 714  SER B N   1 
ATOM   9906  C  CA  . SER B 1  616 ? 0.654   13.283  155.064 1.00 18.06  ? 714  SER B CA  1 
ATOM   9907  C  C   . SER B 1  616 ? 0.971   14.650  155.659 1.00 17.57  ? 714  SER B C   1 
ATOM   9908  O  O   . SER B 1  616 ? 1.968   15.276  155.298 1.00 15.87  ? 714  SER B O   1 
ATOM   9909  C  CB  . SER B 1  616 ? 1.645   12.243  155.598 1.00 16.90  ? 714  SER B CB  1 
ATOM   9910  O  OG  . SER B 1  616 ? 1.412   10.966  155.035 1.00 17.41  ? 714  SER B OG  1 
ATOM   9911  N  N   . TRP B 1  617 ? 0.118   15.112  156.567 1.00 19.41  ? 715  TRP B N   1 
ATOM   9912  C  CA  . TRP B 1  617 ? 0.314   16.408  157.204 1.00 22.87  ? 715  TRP B CA  1 
ATOM   9913  C  C   . TRP B 1  617 ? 1.495   16.397  158.173 1.00 24.37  ? 715  TRP B C   1 
ATOM   9914  O  O   . TRP B 1  617 ? 1.960   17.452  158.602 1.00 26.65  ? 715  TRP B O   1 
ATOM   9915  C  CB  . TRP B 1  617 ? -0.961  16.841  157.934 1.00 25.84  ? 715  TRP B CB  1 
ATOM   9916  C  CG  . TRP B 1  617 ? -2.033  17.345  157.013 1.00 29.69  ? 715  TRP B CG  1 
ATOM   9917  C  CD1 . TRP B 1  617 ? -2.801  16.603  156.164 1.00 31.68  ? 715  TRP B CD1 1 
ATOM   9918  C  CD2 . TRP B 1  617 ? -2.455  18.705  156.851 1.00 30.31  ? 715  TRP B CD2 1 
ATOM   9919  N  NE1 . TRP B 1  617 ? -3.675  17.416  155.483 1.00 31.06  ? 715  TRP B NE1 1 
ATOM   9920  C  CE2 . TRP B 1  617 ? -3.484  18.711  155.886 1.00 32.34  ? 715  TRP B CE2 1 
ATOM   9921  C  CE3 . TRP B 1  617 ? -2.064  19.918  157.428 1.00 26.15  ? 715  TRP B CE3 1 
ATOM   9922  C  CZ2 . TRP B 1  617 ? -4.126  19.883  155.485 1.00 31.23  ? 715  TRP B CZ2 1 
ATOM   9923  C  CZ3 . TRP B 1  617 ? -2.704  21.080  157.028 1.00 28.05  ? 715  TRP B CZ3 1 
ATOM   9924  C  CH2 . TRP B 1  617 ? -3.723  21.054  156.066 1.00 29.31  ? 715  TRP B CH2 1 
ATOM   9925  N  N   . GLU B 1  618 ? 1.978   15.204  158.509 1.00 28.03  ? 716  GLU B N   1 
ATOM   9926  C  CA  . GLU B 1  618 ? 3.124   15.066  159.403 1.00 30.55  ? 716  GLU B CA  1 
ATOM   9927  C  C   . GLU B 1  618 ? 4.431   15.336  158.672 1.00 25.86  ? 716  GLU B C   1 
ATOM   9928  O  O   . GLU B 1  618 ? 5.448   15.648  159.290 1.00 28.35  ? 716  GLU B O   1 
ATOM   9929  C  CB  . GLU B 1  618 ? 3.159   13.669  160.027 1.00 35.84  ? 716  GLU B CB  1 
ATOM   9930  C  CG  . GLU B 1  618 ? 1.829   13.212  160.586 1.00 44.98  ? 716  GLU B CG  1 
ATOM   9931  C  CD  . GLU B 1  618 ? 1.282   12.007  159.853 1.00 51.01  ? 716  GLU B CD  1 
ATOM   9932  O  OE1 . GLU B 1  618 ? 2.050   11.048  159.628 1.00 53.44  ? 716  GLU B OE1 1 
ATOM   9933  O  OE2 . GLU B 1  618 ? 0.086   12.021  159.494 1.00 53.42  ? 716  GLU B OE2 1 
ATOM   9934  N  N   . THR B 1  619 ? 4.398   15.209  157.351 1.00 23.65  ? 717  THR B N   1 
ATOM   9935  C  CA  . THR B 1  619 ? 5.591   15.410  156.541 1.00 23.76  ? 717  THR B CA  1 
ATOM   9936  C  C   . THR B 1  619 ? 5.575   16.764  155.842 1.00 23.30  ? 717  THR B C   1 
ATOM   9937  O  O   . THR B 1  619 ? 4.516   17.292  155.505 1.00 22.09  ? 717  THR B O   1 
ATOM   9938  C  CB  . THR B 1  619 ? 5.745   14.309  155.477 1.00 24.64  ? 717  THR B CB  1 
ATOM   9939  O  OG1 . THR B 1  619 ? 4.629   14.348  154.581 1.00 24.57  ? 717  THR B OG1 1 
ATOM   9940  C  CG2 . THR B 1  619 ? 5.813   12.942  156.134 1.00 26.82  ? 717  THR B CG2 1 
ATOM   9941  N  N   . ARG B 1  620 ? 6.762   17.322  155.632 1.00 23.50  ? 718  ARG B N   1 
ATOM   9942  C  CA  . ARG B 1  620 ? 6.904   18.574  154.905 1.00 23.15  ? 718  ARG B CA  1 
ATOM   9943  C  C   . ARG B 1  620 ? 8.016   18.464  153.874 1.00 20.72  ? 718  ARG B C   1 
ATOM   9944  O  O   . ARG B 1  620 ? 9.018   17.788  154.095 1.00 19.42  ? 718  ARG B O   1 
ATOM   9945  C  CB  . ARG B 1  620 ? 7.183   19.734  155.863 1.00 25.05  ? 718  ARG B CB  1 
ATOM   9946  C  CG  . ARG B 1  620 ? 6.078   19.977  156.876 1.00 22.57  ? 718  ARG B CG  1 
ATOM   9947  C  CD  . ARG B 1  620 ? 6.400   21.155  157.771 1.00 17.88  ? 718  ARG B CD  1 
ATOM   9948  N  NE  . ARG B 1  620 ? 5.557   21.177  158.961 1.00 17.69  ? 718  ARG B NE  1 
ATOM   9949  C  CZ  . ARG B 1  620 ? 5.658   22.084  159.926 1.00 22.85  ? 718  ARG B CZ  1 
ATOM   9950  N  NH1 . ARG B 1  620 ? 6.565   23.049  159.838 1.00 19.61  ? 718  ARG B NH1 1 
ATOM   9951  N  NH2 . ARG B 1  620 ? 4.852   22.030  160.977 1.00 27.02  ? 718  ARG B NH2 1 
ATOM   9952  N  N   . PHE B 1  621 ? 7.827   19.135  152.745 1.00 21.78  ? 719  PHE B N   1 
ATOM   9953  C  CA  . PHE B 1  621 ? 8.810   19.121  151.675 1.00 18.96  ? 719  PHE B CA  1 
ATOM   9954  C  C   . PHE B 1  621 ? 9.195   20.542  151.290 1.00 20.63  ? 719  PHE B C   1 
ATOM   9955  O  O   . PHE B 1  621 ? 8.392   21.274  150.718 1.00 23.13  ? 719  PHE B O   1 
ATOM   9956  C  CB  . PHE B 1  621 ? 8.265   18.362  150.462 1.00 14.98  ? 719  PHE B CB  1 
ATOM   9957  C  CG  . PHE B 1  621 ? 9.147   18.437  149.248 1.00 19.19  ? 719  PHE B CG  1 
ATOM   9958  C  CD1 . PHE B 1  621 ? 10.275  17.641  149.142 1.00 23.22  ? 719  PHE B CD1 1 
ATOM   9959  C  CD2 . PHE B 1  621 ? 8.834   19.289  148.201 1.00 18.11  ? 719  PHE B CD2 1 
ATOM   9960  C  CE1 . PHE B 1  621 ? 11.084  17.707  148.021 1.00 26.64  ? 719  PHE B CE1 1 
ATOM   9961  C  CE2 . PHE B 1  621 ? 9.637   19.358  147.077 1.00 21.22  ? 719  PHE B CE2 1 
ATOM   9962  C  CZ  . PHE B 1  621 ? 10.763  18.566  146.987 1.00 24.55  ? 719  PHE B CZ  1 
ATOM   9963  N  N   . TYR B 1  622 ? 10.423  20.928  151.619 1.00 20.72  ? 720  TYR B N   1 
ATOM   9964  C  CA  . TYR B 1  622 ? 10.938  22.240  151.253 1.00 17.74  ? 720  TYR B CA  1 
ATOM   9965  C  C   . TYR B 1  622 ? 11.941  22.120  150.114 1.00 19.93  ? 720  TYR B C   1 
ATOM   9966  O  O   . TYR B 1  622 ? 12.737  21.182  150.071 1.00 20.23  ? 720  TYR B O   1 
ATOM   9967  C  CB  . TYR B 1  622 ? 11.599  22.931  152.450 1.00 18.58  ? 720  TYR B CB  1 
ATOM   9968  C  CG  . TYR B 1  622 ? 10.664  23.300  153.582 1.00 22.62  ? 720  TYR B CG  1 
ATOM   9969  C  CD1 . TYR B 1  622 ? 10.313  22.370  154.553 1.00 22.20  ? 720  TYR B CD1 1 
ATOM   9970  C  CD2 . TYR B 1  622 ? 10.151  24.588  153.693 1.00 24.79  ? 720  TYR B CD2 1 
ATOM   9971  C  CE1 . TYR B 1  622 ? 9.466   22.710  155.595 1.00 24.26  ? 720  TYR B CE1 1 
ATOM   9972  C  CE2 . TYR B 1  622 ? 9.306   24.937  154.731 1.00 23.07  ? 720  TYR B CE2 1 
ATOM   9973  C  CZ  . TYR B 1  622 ? 8.966   23.993  155.678 1.00 26.04  ? 720  TYR B CZ  1 
ATOM   9974  O  OH  . TYR B 1  622 ? 8.124   24.336  156.713 1.00 29.29  ? 720  TYR B OH  1 
ATOM   9975  N  N   . TRP B 1  623 ? 11.895  23.075  149.193 1.00 15.54  ? 721  TRP B N   1 
ATOM   9976  C  CA  . TRP B 1  623 ? 12.876  23.153  148.121 1.00 16.16  ? 721  TRP B CA  1 
ATOM   9977  C  C   . TRP B 1  623 ? 13.580  24.503  148.170 1.00 17.88  ? 721  TRP B C   1 
ATOM   9978  O  O   . TRP B 1  623 ? 12.929  25.546  148.222 1.00 17.80  ? 721  TRP B O   1 
ATOM   9979  C  CB  . TRP B 1  623 ? 12.209  22.936  146.762 1.00 17.16  ? 721  TRP B CB  1 
ATOM   9980  C  CG  . TRP B 1  623 ? 13.150  23.019  145.595 1.00 21.94  ? 721  TRP B CG  1 
ATOM   9981  C  CD1 . TRP B 1  623 ? 14.056  22.076  145.202 1.00 23.43  ? 721  TRP B CD1 1 
ATOM   9982  C  CD2 . TRP B 1  623 ? 13.259  24.095  144.655 1.00 25.36  ? 721  TRP B CD2 1 
ATOM   9983  N  NE1 . TRP B 1  623 ? 14.728  22.503  144.082 1.00 18.81  ? 721  TRP B NE1 1 
ATOM   9984  C  CE2 . TRP B 1  623 ? 14.258  23.739  143.727 1.00 18.79  ? 721  TRP B CE2 1 
ATOM   9985  C  CE3 . TRP B 1  623 ? 12.611  25.326  144.510 1.00 23.01  ? 721  TRP B CE3 1 
ATOM   9986  C  CZ2 . TRP B 1  623 ? 14.624  24.568  142.669 1.00 19.65  ? 721  TRP B CZ2 1 
ATOM   9987  C  CZ3 . TRP B 1  623 ? 12.977  26.149  143.459 1.00 24.69  ? 721  TRP B CZ3 1 
ATOM   9988  C  CH2 . TRP B 1  623 ? 13.975  25.767  142.554 1.00 19.53  ? 721  TRP B CH2 1 
ATOM   9989  N  N   . HIS B 1  624 ? 14.909  24.484  148.161 1.00 18.51  ? 722  HIS B N   1 
ATOM   9990  C  CA  . HIS B 1  624 ? 15.677  25.723  148.217 1.00 21.92  ? 722  HIS B CA  1 
ATOM   9991  C  C   . HIS B 1  624 ? 16.593  25.854  147.006 1.00 22.34  ? 722  HIS B C   1 
ATOM   9992  O  O   . HIS B 1  624 ? 17.402  24.973  146.725 1.00 25.68  ? 722  HIS B O   1 
ATOM   9993  C  CB  . HIS B 1  624 ? 16.492  25.794  149.509 1.00 26.51  ? 722  HIS B CB  1 
ATOM   9994  C  CG  . HIS B 1  624 ? 17.121  27.131  149.751 1.00 37.55  ? 722  HIS B CG  1 
ATOM   9995  N  ND1 . HIS B 1  624 ? 18.438  27.400  149.448 1.00 43.40  ? 722  HIS B ND1 1 
ATOM   9996  C  CD2 . HIS B 1  624 ? 16.612  28.277  150.265 1.00 39.34  ? 722  HIS B CD2 1 
ATOM   9997  C  CE1 . HIS B 1  624 ? 18.714  28.653  149.765 1.00 42.53  ? 722  HIS B CE1 1 
ATOM   9998  N  NE2 . HIS B 1  624 ? 17.623  29.207  150.263 1.00 40.75  ? 722  HIS B NE2 1 
ATOM   9999  N  N   . LYS B 1  625 ? 16.453  26.967  146.294 1.00 20.55  ? 723  LYS B N   1 
ATOM   10000 C  CA  . LYS B 1  625 ? 17.211  27.217  145.075 1.00 21.88  ? 723  LYS B CA  1 
ATOM   10001 C  C   . LYS B 1  625 ? 18.607  27.766  145.371 1.00 23.53  ? 723  LYS B C   1 
ATOM   10002 O  O   . LYS B 1  625 ? 18.777  28.625  146.237 1.00 24.11  ? 723  LYS B O   1 
ATOM   10003 C  CB  . LYS B 1  625 ? 16.435  28.186  144.177 1.00 21.12  ? 723  LYS B CB  1 
ATOM   10004 C  CG  . LYS B 1  625 ? 17.004  28.368  142.783 1.00 26.15  ? 723  LYS B CG  1 
ATOM   10005 C  CD  . LYS B 1  625 ? 16.163  29.356  141.987 1.00 28.24  ? 723  LYS B CD  1 
ATOM   10006 C  CE  . LYS B 1  625 ? 16.825  29.719  140.668 1.00 35.19  ? 723  LYS B CE  1 
ATOM   10007 N  NZ  . LYS B 1  625 ? 15.944  30.582  139.830 1.00 39.21  ? 723  LYS B NZ  1 
ATOM   10008 N  N   . GLY B 1  626 ? 19.602  27.260  144.648 1.00 18.56  ? 724  GLY B N   1 
ATOM   10009 C  CA  . GLY B 1  626 ? 20.973  27.711  144.806 1.00 15.59  ? 724  GLY B CA  1 
ATOM   10010 C  C   . GLY B 1  626 ? 21.531  28.361  143.557 1.00 18.57  ? 724  GLY B C   1 
ATOM   10011 O  O   . GLY B 1  626 ? 20.781  28.801  142.687 1.00 20.06  ? 724  GLY B O   1 
ATOM   10012 N  N   . LEU B 1  627 ? 22.856  28.417  143.468 1.00 19.89  ? 725  LEU B N   1 
ATOM   10013 C  CA  . LEU B 1  627 ? 23.525  29.073  142.352 1.00 22.56  ? 725  LEU B CA  1 
ATOM   10014 C  C   . LEU B 1  627 ? 23.720  28.141  141.159 1.00 28.84  ? 725  LEU B C   1 
ATOM   10015 O  O   . LEU B 1  627 ? 24.141  26.995  141.317 1.00 31.02  ? 725  LEU B O   1 
ATOM   10016 C  CB  . LEU B 1  627 ? 24.880  29.628  142.798 1.00 19.53  ? 725  LEU B CB  1 
ATOM   10017 C  CG  . LEU B 1  627 ? 24.857  30.644  143.942 1.00 27.91  ? 725  LEU B CG  1 
ATOM   10018 C  CD1 . LEU B 1  627 ? 26.269  31.072  144.316 1.00 17.53  ? 725  LEU B CD1 1 
ATOM   10019 C  CD2 . LEU B 1  627 ? 24.011  31.851  143.566 1.00 17.12  ? 725  LEU B CD2 1 
ATOM   10020 N  N   . LEU B 1  628 ? 23.397  28.650  139.971 1.00 26.51  ? 726  LEU B N   1 
ATOM   10021 C  CA  . LEU B 1  628 ? 23.685  27.977  138.705 1.00 22.65  ? 726  LEU B CA  1 
ATOM   10022 C  C   . LEU B 1  628 ? 23.157  26.548  138.617 1.00 25.16  ? 726  LEU B C   1 
ATOM   10023 O  O   . LEU B 1  628 ? 23.882  25.636  138.219 1.00 32.04  ? 726  LEU B O   1 
ATOM   10024 C  CB  . LEU B 1  628 ? 25.195  27.977  138.452 1.00 27.11  ? 726  LEU B CB  1 
ATOM   10025 C  CG  . LEU B 1  628 ? 25.864  29.351  138.376 1.00 19.51  ? 726  LEU B CG  1 
ATOM   10026 C  CD1 . LEU B 1  628 ? 27.343  29.214  138.056 1.00 23.22  ? 726  LEU B CD1 1 
ATOM   10027 C  CD2 . LEU B 1  628 ? 25.173  30.219  137.342 1.00 19.92  ? 726  LEU B CD2 1 
ATOM   10028 N  N   . GLY B 1  629 ? 21.895  26.358  138.986 1.00 28.17  ? 727  GLY B N   1 
ATOM   10029 C  CA  . GLY B 1  629 ? 21.247  25.066  138.845 1.00 17.27  ? 727  GLY B CA  1 
ATOM   10030 C  C   . GLY B 1  629 ? 21.272  24.183  140.078 1.00 22.88  ? 727  GLY B C   1 
ATOM   10031 O  O   . GLY B 1  629 ? 20.636  23.129  140.097 1.00 21.11  ? 727  GLY B O   1 
ATOM   10032 N  N   . LEU B 1  630 ? 22.008  24.599  141.105 1.00 21.21  ? 728  LEU B N   1 
ATOM   10033 C  CA  . LEU B 1  630 ? 22.028  23.867  142.370 1.00 19.33  ? 728  LEU B CA  1 
ATOM   10034 C  C   . LEU B 1  630 ? 20.760  24.104  143.173 1.00 21.66  ? 728  LEU B C   1 
ATOM   10035 O  O   . LEU B 1  630 ? 20.169  25.182  143.119 1.00 25.81  ? 728  LEU B O   1 
ATOM   10036 C  CB  . LEU B 1  630 ? 23.250  24.245  143.212 1.00 17.93  ? 728  LEU B CB  1 
ATOM   10037 C  CG  . LEU B 1  630 ? 24.519  23.402  143.061 1.00 21.60  ? 728  LEU B CG  1 
ATOM   10038 C  CD1 . LEU B 1  630 ? 24.806  23.053  141.614 1.00 26.69  ? 728  LEU B CD1 1 
ATOM   10039 C  CD2 . LEU B 1  630 ? 25.694  24.132  143.675 1.00 17.08  ? 728  LEU B CD2 1 
ATOM   10040 N  N   . SER B 1  631 ? 20.342  23.081  143.907 1.00 22.22  ? 729  SER B N   1 
ATOM   10041 C  CA  . SER B 1  631 ? 19.158  23.180  144.747 1.00 25.51  ? 729  SER B CA  1 
ATOM   10042 C  C   . SER B 1  631 ? 19.084  22.014  145.732 1.00 27.50  ? 729  SER B C   1 
ATOM   10043 O  O   . SER B 1  631 ? 19.510  20.900  145.427 1.00 24.56  ? 729  SER B O   1 
ATOM   10044 C  CB  . SER B 1  631 ? 17.893  23.239  143.884 1.00 25.97  ? 729  SER B CB  1 
ATOM   10045 O  OG  . SER B 1  631 ? 17.738  22.066  143.104 1.00 28.60  ? 729  SER B OG  1 
ATOM   10046 N  N   . ASN B 1  632 ? 18.541  22.282  146.915 1.00 28.69  ? 730  ASN B N   1 
ATOM   10047 C  CA  . ASN B 1  632 ? 18.359  21.252  147.929 1.00 26.43  ? 730  ASN B CA  1 
ATOM   10048 C  C   . ASN B 1  632 ? 16.888  20.891  148.074 1.00 25.18  ? 730  ASN B C   1 
ATOM   10049 O  O   . ASN B 1  632 ? 16.007  21.726  147.860 1.00 22.11  ? 730  ASN B O   1 
ATOM   10050 C  CB  . ASN B 1  632 ? 18.900  21.713  149.281 1.00 25.68  ? 730  ASN B CB  1 
ATOM   10051 C  CG  . ASN B 1  632 ? 20.402  21.879  149.291 1.00 27.90  ? 730  ASN B CG  1 
ATOM   10052 O  OD1 . ASN B 1  632 ? 21.072  21.700  148.275 1.00 25.14  ? 730  ASN B OD1 1 
ATOM   10053 N  ND2 . ASN B 1  632 ? 20.939  22.234  150.452 1.00 38.45  ? 730  ASN B ND2 1 
ATOM   10054 N  N   . ALA B 1  633 ? 16.630  19.640  148.434 1.00 25.24  ? 731  ALA B N   1 
ATOM   10055 C  CA  . ALA B 1  633 ? 15.282  19.193  148.745 1.00 22.52  ? 731  ALA B CA  1 
ATOM   10056 C  C   . ALA B 1  633 ? 15.255  18.687  150.177 1.00 23.68  ? 731  ALA B C   1 
ATOM   10057 O  O   . ALA B 1  633 ? 15.882  17.678  150.501 1.00 28.76  ? 731  ALA B O   1 
ATOM   10058 C  CB  . ALA B 1  633 ? 14.833  18.110  147.780 1.00 20.18  ? 731  ALA B CB  1 
ATOM   10059 N  N   . THR B 1  634 ? 14.544  19.407  151.036 1.00 16.52  ? 732  THR B N   1 
ATOM   10060 C  CA  . THR B 1  634 ? 14.481  19.055  152.446 1.00 17.55  ? 732  THR B CA  1 
ATOM   10061 C  C   . THR B 1  634 ? 13.168  18.367  152.794 1.00 22.15  ? 732  THR B C   1 
ATOM   10062 O  O   . THR B 1  634 ? 12.088  18.893  152.527 1.00 14.01  ? 732  THR B O   1 
ATOM   10063 C  CB  . THR B 1  634 ? 14.654  20.296  153.344 1.00 18.91  ? 732  THR B CB  1 
ATOM   10064 O  OG1 . THR B 1  634 ? 15.881  20.959  153.013 1.00 21.57  ? 732  THR B OG1 1 
ATOM   10065 C  CG2 . THR B 1  634 ? 14.681  19.894  154.811 1.00 19.36  ? 732  THR B CG2 1 
ATOM   10066 N  N   . VAL B 1  635 ? 13.269  17.180  153.379 1.00 17.09  ? 733  VAL B N   1 
ATOM   10067 C  CA  . VAL B 1  635 ? 12.092  16.493  153.885 1.00 18.69  ? 733  VAL B CA  1 
ATOM   10068 C  C   . VAL B 1  635 ? 12.084  16.523  155.407 1.00 22.52  ? 733  VAL B C   1 
ATOM   10069 O  O   . VAL B 1  635 ? 13.035  16.077  156.050 1.00 24.28  ? 733  VAL B O   1 
ATOM   10070 C  CB  . VAL B 1  635 ? 12.026  15.034  153.409 1.00 14.84  ? 733  VAL B CB  1 
ATOM   10071 C  CG1 . VAL B 1  635 ? 10.806  14.349  153.998 1.00 15.07  ? 733  VAL B CG1 1 
ATOM   10072 C  CG2 . VAL B 1  635 ? 11.988  14.975  151.892 1.00 14.56  ? 733  VAL B CG2 1 
ATOM   10073 N  N   . GLU B 1  636 ? 11.007  17.052  155.977 1.00 22.01  ? 734  GLU B N   1 
ATOM   10074 C  CA  . GLU B 1  636 ? 10.845  17.078  157.423 1.00 21.83  ? 734  GLU B CA  1 
ATOM   10075 C  C   . GLU B 1  636 ? 9.754   16.103  157.836 1.00 20.73  ? 734  GLU B C   1 
ATOM   10076 O  O   . GLU B 1  636 ? 8.659   16.116  157.274 1.00 16.36  ? 734  GLU B O   1 
ATOM   10077 C  CB  . GLU B 1  636 ? 10.494  18.484  157.914 1.00 23.84  ? 734  GLU B CB  1 
ATOM   10078 C  CG  . GLU B 1  636 ? 11.595  19.516  157.757 1.00 28.60  ? 734  GLU B CG  1 
ATOM   10079 C  CD  . GLU B 1  636 ? 11.177  20.886  158.260 1.00 36.58  ? 734  GLU B CD  1 
ATOM   10080 O  OE1 . GLU B 1  636 ? 10.089  20.996  158.866 1.00 39.26  ? 734  GLU B OE1 1 
ATOM   10081 O  OE2 . GLU B 1  636 ? 11.936  21.855  158.053 1.00 42.14  ? 734  GLU B OE2 1 
ATOM   10082 N  N   . TRP B 1  637 ? 10.052  15.253  158.812 1.00 22.83  ? 735  TRP B N   1 
ATOM   10083 C  CA  . TRP B 1  637 ? 9.033   14.378  159.373 1.00 21.55  ? 735  TRP B CA  1 
ATOM   10084 C  C   . TRP B 1  637 ? 8.735   14.772  160.809 1.00 23.56  ? 735  TRP B C   1 
ATOM   10085 O  O   . TRP B 1  637 ? 9.517   14.489  161.715 1.00 28.38  ? 735  TRP B O   1 
ATOM   10086 C  CB  . TRP B 1  637 ? 9.462   12.911  159.315 1.00 21.54  ? 735  TRP B CB  1 
ATOM   10087 C  CG  . TRP B 1  637 ? 8.416   11.983  159.867 1.00 25.77  ? 735  TRP B CG  1 
ATOM   10088 C  CD1 . TRP B 1  637 ? 7.062   12.171  159.850 1.00 23.66  ? 735  TRP B CD1 1 
ATOM   10089 C  CD2 . TRP B 1  637 ? 8.636   10.730  160.526 1.00 22.44  ? 735  TRP B CD2 1 
ATOM   10090 N  NE1 . TRP B 1  637 ? 6.428   11.113  160.453 1.00 23.60  ? 735  TRP B NE1 1 
ATOM   10091 C  CE2 . TRP B 1  637 ? 7.372   10.214  160.877 1.00 22.26  ? 735  TRP B CE2 1 
ATOM   10092 C  CE3 . TRP B 1  637 ? 9.778   9.992   160.852 1.00 20.04  ? 735  TRP B CE3 1 
ATOM   10093 C  CZ2 . TRP B 1  637 ? 7.218   8.996   161.535 1.00 21.91  ? 735  TRP B CZ2 1 
ATOM   10094 C  CZ3 . TRP B 1  637 ? 9.624   8.784   161.507 1.00 21.63  ? 735  TRP B CZ3 1 
ATOM   10095 C  CH2 . TRP B 1  637 ? 8.354   8.298   161.841 1.00 22.63  ? 735  TRP B CH2 1 
ATOM   10096 N  N   . HIS B 1  638 ? 7.604   15.438  161.011 1.00 23.19  ? 736  HIS B N   1 
ATOM   10097 C  CA  . HIS B 1  638 ? 7.171   15.792  162.352 1.00 27.75  ? 736  HIS B CA  1 
ATOM   10098 C  C   . HIS B 1  638 ? 6.523   14.580  163.008 1.00 29.82  ? 736  HIS B C   1 
ATOM   10099 O  O   . HIS B 1  638 ? 5.319   14.357  162.873 1.00 33.90  ? 736  HIS B O   1 
ATOM   10100 C  CB  . HIS B 1  638 ? 6.208   16.978  162.312 1.00 27.22  ? 736  HIS B CB  1 
ATOM   10101 C  CG  . HIS B 1  638 ? 6.843   18.249  161.838 1.00 28.28  ? 736  HIS B CG  1 
ATOM   10102 N  ND1 . HIS B 1  638 ? 6.979   19.359  162.643 1.00 31.33  ? 736  HIS B ND1 1 
ATOM   10103 C  CD2 . HIS B 1  638 ? 7.391   18.579  160.645 1.00 27.58  ? 736  HIS B CD2 1 
ATOM   10104 C  CE1 . HIS B 1  638 ? 7.581   20.320  161.965 1.00 31.23  ? 736  HIS B CE1 1 
ATOM   10105 N  NE2 . HIS B 1  638 ? 7.840   19.873  160.750 1.00 30.40  ? 736  HIS B NE2 1 
ATOM   10106 N  N   . ILE B 1  639 ? 7.339   13.801  163.711 1.00 26.39  ? 737  ILE B N   1 
ATOM   10107 C  CA  . ILE B 1  639 ? 6.902   12.537  164.289 1.00 28.22  ? 737  ILE B CA  1 
ATOM   10108 C  C   . ILE B 1  639 ? 5.797   12.749  165.313 1.00 31.46  ? 737  ILE B C   1 
ATOM   10109 O  O   . ILE B 1  639 ? 6.004   13.407  166.330 1.00 33.20  ? 737  ILE B O   1 
ATOM   10110 C  CB  . ILE B 1  639 ? 8.072   11.788  164.957 1.00 25.81  ? 737  ILE B CB  1 
ATOM   10111 C  CG1 . ILE B 1  639 ? 9.228   11.617  163.973 1.00 21.86  ? 737  ILE B CG1 1 
ATOM   10112 C  CG2 . ILE B 1  639 ? 7.613   10.439  165.479 1.00 23.14  ? 737  ILE B CG2 1 
ATOM   10113 C  CD1 . ILE B 1  639 ? 10.553  11.345  164.641 1.00 27.09  ? 737  ILE B CD1 1 
ATOM   10114 N  N   . PRO B 1  640 ? 4.612   12.185  165.042 1.00 32.62  ? 738  PRO B N   1 
ATOM   10115 C  CA  . PRO B 1  640 ? 3.461   12.319  165.940 1.00 35.35  ? 738  PRO B CA  1 
ATOM   10116 C  C   . PRO B 1  640 ? 3.638   11.506  167.216 1.00 42.76  ? 738  PRO B C   1 
ATOM   10117 O  O   . PRO B 1  640 ? 4.404   10.541  167.230 1.00 45.99  ? 738  PRO B O   1 
ATOM   10118 C  CB  . PRO B 1  640 ? 2.297   11.778  165.107 1.00 31.23  ? 738  PRO B CB  1 
ATOM   10119 C  CG  . PRO B 1  640 ? 2.927   10.842  164.136 1.00 30.57  ? 738  PRO B CG  1 
ATOM   10120 C  CD  . PRO B 1  640 ? 4.307   11.364  163.857 1.00 31.64  ? 738  PRO B CD  1 
ATOM   10121 N  N   . ASP B 1  641 ? 2.944   11.902  168.278 1.00 45.61  ? 739  ASP B N   1 
ATOM   10122 C  CA  . ASP B 1  641 ? 2.988   11.176  169.542 1.00 47.12  ? 739  ASP B CA  1 
ATOM   10123 C  C   . ASP B 1  641 ? 2.435   9.765   169.377 1.00 45.36  ? 739  ASP B C   1 
ATOM   10124 O  O   . ASP B 1  641 ? 2.804   8.851   170.113 1.00 46.74  ? 739  ASP B O   1 
ATOM   10125 C  CB  . ASP B 1  641 ? 2.206   11.926  170.623 1.00 51.25  ? 739  ASP B CB  1 
ATOM   10126 C  CG  . ASP B 1  641 ? 2.745   13.323  170.874 1.00 52.31  ? 739  ASP B CG  1 
ATOM   10127 O  OD1 . ASP B 1  641 ? 3.914   13.585  170.522 1.00 54.10  ? 739  ASP B OD1 1 
ATOM   10128 O  OD2 . ASP B 1  641 ? 1.998   14.160  171.426 1.00 48.77  ? 739  ASP B OD2 1 
ATOM   10129 N  N   . THR B 1  642 ? 1.551   9.596   168.399 1.00 44.06  ? 740  THR B N   1 
ATOM   10130 C  CA  . THR B 1  642 ? 0.903   8.314   168.154 1.00 43.18  ? 740  THR B CA  1 
ATOM   10131 C  C   . THR B 1  642 ? 1.795   7.342   167.387 1.00 39.32  ? 740  THR B C   1 
ATOM   10132 O  O   . THR B 1  642 ? 1.480   6.157   167.281 1.00 35.80  ? 740  THR B O   1 
ATOM   10133 C  CB  . THR B 1  642 ? -0.407  8.499   167.365 1.00 43.62  ? 740  THR B CB  1 
ATOM   10134 O  OG1 . THR B 1  642 ? -0.124  9.132   166.111 1.00 42.22  ? 740  THR B OG1 1 
ATOM   10135 C  CG2 . THR B 1  642 ? -1.387  9.360   168.148 1.00 43.24  ? 740  THR B CG2 1 
ATOM   10136 N  N   . ALA B 1  643 ? 2.898   7.847   166.844 1.00 40.13  ? 741  ALA B N   1 
ATOM   10137 C  CA  . ALA B 1  643 ? 3.802   7.013   166.060 1.00 42.87  ? 741  ALA B CA  1 
ATOM   10138 C  C   . ALA B 1  643 ? 4.396   5.895   166.907 1.00 48.87  ? 741  ALA B C   1 
ATOM   10139 O  O   . ALA B 1  643 ? 4.791   6.112   168.052 1.00 52.86  ? 741  ALA B O   1 
ATOM   10140 C  CB  . ALA B 1  643 ? 4.908   7.857   165.450 1.00 41.28  ? 741  ALA B CB  1 
ATOM   10141 N  N   . GLN B 1  644 ? 4.458   4.698   166.335 1.00 49.52  ? 742  GLN B N   1 
ATOM   10142 C  CA  . GLN B 1  644 ? 5.024   3.551   167.029 1.00 49.27  ? 742  GLN B CA  1 
ATOM   10143 C  C   . GLN B 1  644 ? 6.528   3.489   166.792 1.00 45.68  ? 742  GLN B C   1 
ATOM   10144 O  O   . GLN B 1  644 ? 6.999   3.824   165.705 1.00 40.19  ? 742  GLN B O   1 
ATOM   10145 C  CB  . GLN B 1  644 ? 4.350   2.249   166.586 1.00 53.21  ? 742  GLN B CB  1 
ATOM   10146 C  CG  . GLN B 1  644 ? 4.516   1.908   165.116 1.00 56.30  ? 742  GLN B CG  1 
ATOM   10147 C  CD  . GLN B 1  644 ? 4.004   0.518   164.789 1.00 62.76  ? 742  GLN B CD  1 
ATOM   10148 O  OE1 . GLN B 1  644 ? 3.630   -0.242  165.682 1.00 66.49  ? 742  GLN B OE1 1 
ATOM   10149 N  NE2 . GLN B 1  644 ? 3.983   0.179   163.504 1.00 62.39  ? 742  GLN B NE2 1 
ATOM   10150 N  N   . PRO B 1  645 ? 7.290   3.085   167.820 1.00 49.75  ? 743  PRO B N   1 
ATOM   10151 C  CA  . PRO B 1  645 ? 8.740   2.916   167.684 1.00 49.31  ? 743  PRO B CA  1 
ATOM   10152 C  C   . PRO B 1  645 ? 9.091   1.947   166.558 1.00 44.10  ? 743  PRO B C   1 
ATOM   10153 O  O   . PRO B 1  645 ? 8.278   1.089   166.214 1.00 43.42  ? 743  PRO B O   1 
ATOM   10154 C  CB  . PRO B 1  645 ? 9.157   2.345   169.044 1.00 53.49  ? 743  PRO B CB  1 
ATOM   10155 C  CG  . PRO B 1  645 ? 8.105   2.806   169.985 1.00 55.94  ? 743  PRO B CG  1 
ATOM   10156 C  CD  . PRO B 1  645 ? 6.829   2.810   169.192 1.00 55.07  ? 743  PRO B CD  1 
ATOM   10157 N  N   . GLY B 1  646 ? 10.286  2.083   165.992 1.00 37.82  ? 744  GLY B N   1 
ATOM   10158 C  CA  . GLY B 1  646 ? 10.684  1.259   164.866 1.00 34.87  ? 744  GLY B CA  1 
ATOM   10159 C  C   . GLY B 1  646 ? 11.851  1.837   164.092 1.00 32.98  ? 744  GLY B C   1 
ATOM   10160 O  O   . GLY B 1  646 ? 12.418  2.866   164.465 1.00 31.10  ? 744  GLY B O   1 
ATOM   10161 N  N   . ILE B 1  647 ? 12.216  1.156   163.013 1.00 30.39  ? 745  ILE B N   1 
ATOM   10162 C  CA  . ILE B 1  647 ? 13.281  1.617   162.138 1.00 24.06  ? 745  ILE B CA  1 
ATOM   10163 C  C   . ILE B 1  647 ? 12.673  2.317   160.928 1.00 22.85  ? 745  ILE B C   1 
ATOM   10164 O  O   . ILE B 1  647 ? 11.815  1.759   160.244 1.00 22.67  ? 745  ILE B O   1 
ATOM   10165 C  CB  . ILE B 1  647 ? 14.178  0.450   161.680 1.00 27.68  ? 745  ILE B CB  1 
ATOM   10166 C  CG1 . ILE B 1  647 ? 14.950  -0.125  162.869 1.00 27.76  ? 745  ILE B CG1 1 
ATOM   10167 C  CG2 . ILE B 1  647 ? 15.133  0.906   160.591 1.00 29.73  ? 745  ILE B CG2 1 
ATOM   10168 C  CD1 . ILE B 1  647 ? 15.670  -1.424  162.564 1.00 27.96  ? 745  ILE B CD1 1 
ATOM   10169 N  N   . TYR B 1  648 ? 13.115  3.541   160.667 1.00 24.77  ? 746  TYR B N   1 
ATOM   10170 C  CA  . TYR B 1  648 ? 12.519  4.346   159.611 1.00 24.34  ? 746  TYR B CA  1 
ATOM   10171 C  C   . TYR B 1  648 ? 13.564  4.861   158.630 1.00 27.52  ? 746  TYR B C   1 
ATOM   10172 O  O   . TYR B 1  648 ? 14.757  4.890   158.930 1.00 32.43  ? 746  TYR B O   1 
ATOM   10173 C  CB  . TYR B 1  648 ? 11.754  5.529   160.210 1.00 24.06  ? 746  TYR B CB  1 
ATOM   10174 C  CG  . TYR B 1  648 ? 10.498  5.145   160.961 1.00 26.66  ? 746  TYR B CG  1 
ATOM   10175 C  CD1 . TYR B 1  648 ? 9.264   5.111   160.322 1.00 27.59  ? 746  TYR B CD1 1 
ATOM   10176 C  CD2 . TYR B 1  648 ? 10.544  4.822   162.312 1.00 26.75  ? 746  TYR B CD2 1 
ATOM   10177 C  CE1 . TYR B 1  648 ? 8.112   4.763   161.007 1.00 26.10  ? 746  TYR B CE1 1 
ATOM   10178 C  CE2 . TYR B 1  648 ? 9.399   4.472   163.005 1.00 28.36  ? 746  TYR B CE2 1 
ATOM   10179 C  CZ  . TYR B 1  648 ? 8.185   4.444   162.348 1.00 26.78  ? 746  TYR B CZ  1 
ATOM   10180 O  OH  . TYR B 1  648 ? 7.045   4.096   163.036 1.00 26.21  ? 746  TYR B OH  1 
ATOM   10181 N  N   . ARG B 1  649 ? 13.102  5.264   157.453 1.00 23.61  ? 747  ARG B N   1 
ATOM   10182 C  CA  . ARG B 1  649 ? 13.959  5.922   156.480 1.00 22.30  ? 747  ARG B CA  1 
ATOM   10183 C  C   . ARG B 1  649 ? 13.125  6.902   155.668 1.00 19.44  ? 747  ARG B C   1 
ATOM   10184 O  O   . ARG B 1  649 ? 11.909  6.754   155.558 1.00 19.95  ? 747  ARG B O   1 
ATOM   10185 C  CB  . ARG B 1  649 ? 14.641  4.902   155.566 1.00 25.18  ? 747  ARG B CB  1 
ATOM   10186 C  CG  . ARG B 1  649 ? 13.717  4.234   154.562 1.00 25.77  ? 747  ARG B CG  1 
ATOM   10187 C  CD  . ARG B 1  649 ? 14.478  3.240   153.698 1.00 25.89  ? 747  ARG B CD  1 
ATOM   10188 N  NE  . ARG B 1  649 ? 13.644  2.685   152.637 1.00 27.25  ? 747  ARG B NE  1 
ATOM   10189 C  CZ  . ARG B 1  649 ? 14.037  1.734   151.796 1.00 26.76  ? 747  ARG B CZ  1 
ATOM   10190 N  NH1 . ARG B 1  649 ? 15.255  1.219   151.896 1.00 23.41  ? 747  ARG B NH1 1 
ATOM   10191 N  NH2 . ARG B 1  649 ? 13.210  1.292   150.859 1.00 19.33  ? 747  ARG B NH2 1 
ATOM   10192 N  N   . ILE B 1  650 ? 13.784  7.902   155.098 1.00 19.15  ? 748  ILE B N   1 
ATOM   10193 C  CA  . ILE B 1  650 ? 13.089  8.922   154.328 1.00 21.44  ? 748  ILE B CA  1 
ATOM   10194 C  C   . ILE B 1  650 ? 13.582  8.927   152.888 1.00 21.64  ? 748  ILE B C   1 
ATOM   10195 O  O   . ILE B 1  650 ? 14.786  8.929   152.631 1.00 23.19  ? 748  ILE B O   1 
ATOM   10196 C  CB  . ILE B 1  650 ? 13.274  10.316  154.954 1.00 22.16  ? 748  ILE B CB  1 
ATOM   10197 C  CG1 . ILE B 1  650 ? 12.500  10.405  156.272 1.00 20.32  ? 748  ILE B CG1 1 
ATOM   10198 C  CG2 . ILE B 1  650 ? 12.809  11.399  153.999 1.00 16.00  ? 748  ILE B CG2 1 
ATOM   10199 C  CD1 . ILE B 1  650 ? 12.894  11.579  157.143 1.00 20.61  ? 748  ILE B CD1 1 
ATOM   10200 N  N   . ARG B 1  651 ? 12.642  8.920   151.950 1.00 20.05  ? 749  ARG B N   1 
ATOM   10201 C  CA  . ARG B 1  651 ? 12.985  8.876   150.537 1.00 20.22  ? 749  ARG B CA  1 
ATOM   10202 C  C   . ARG B 1  651 ? 12.515  10.121  149.796 1.00 23.64  ? 749  ARG B C   1 
ATOM   10203 O  O   . ARG B 1  651 ? 11.582  10.801  150.221 1.00 15.30  ? 749  ARG B O   1 
ATOM   10204 C  CB  . ARG B 1  651 ? 12.397  7.618   149.900 1.00 16.34  ? 749  ARG B CB  1 
ATOM   10205 C  CG  . ARG B 1  651 ? 12.930  6.335   150.519 1.00 16.99  ? 749  ARG B CG  1 
ATOM   10206 C  CD  . ARG B 1  651 ? 12.488  5.106   149.749 1.00 17.28  ? 749  ARG B CD  1 
ATOM   10207 N  NE  . ARG B 1  651 ? 13.120  4.985   148.441 1.00 17.24  ? 749  ARG B NE  1 
ATOM   10208 C  CZ  . ARG B 1  651 ? 12.625  4.254   147.447 1.00 23.75  ? 749  ARG B CZ  1 
ATOM   10209 N  NH1 . ARG B 1  651 ? 11.492  3.585   147.617 1.00 17.48  ? 749  ARG B NH1 1 
ATOM   10210 N  NH2 . ARG B 1  651 ? 13.258  4.194   146.284 1.00 25.76  ? 749  ARG B NH2 1 
ATOM   10211 N  N   . TYR B 1  652 ? 13.177  10.408  148.681 1.00 23.82  ? 750  TYR B N   1 
ATOM   10212 C  CA  . TYR B 1  652 ? 12.906  11.605  147.899 1.00 21.54  ? 750  TYR B CA  1 
ATOM   10213 C  C   . TYR B 1  652 ? 12.757  11.237  146.429 1.00 24.10  ? 750  TYR B C   1 
ATOM   10214 O  O   . TYR B 1  652 ? 13.558  10.476  145.887 1.00 24.94  ? 750  TYR B O   1 
ATOM   10215 C  CB  . TYR B 1  652 ? 14.028  12.627  148.101 1.00 18.65  ? 750  TYR B CB  1 
ATOM   10216 C  CG  . TYR B 1  652 ? 14.060  13.768  147.105 1.00 14.85  ? 750  TYR B CG  1 
ATOM   10217 C  CD1 . TYR B 1  652 ? 12.925  14.523  146.835 1.00 16.35  ? 750  TYR B CD1 1 
ATOM   10218 C  CD2 . TYR B 1  652 ? 15.237  14.100  146.447 1.00 16.27  ? 750  TYR B CD2 1 
ATOM   10219 C  CE1 . TYR B 1  652 ? 12.963  15.569  145.926 1.00 18.11  ? 750  TYR B CE1 1 
ATOM   10220 C  CE2 . TYR B 1  652 ? 15.284  15.141  145.543 1.00 17.12  ? 750  TYR B CE2 1 
ATOM   10221 C  CZ  . TYR B 1  652 ? 14.146  15.872  145.283 1.00 17.75  ? 750  TYR B CZ  1 
ATOM   10222 O  OH  . TYR B 1  652 ? 14.200  16.909  144.380 1.00 21.46  ? 750  TYR B OH  1 
ATOM   10223 N  N   . PHE B 1  653 ? 11.718  11.765  145.791 1.00 23.59  ? 751  PHE B N   1 
ATOM   10224 C  CA  . PHE B 1  653 ? 11.446  11.459  144.392 1.00 20.41  ? 751  PHE B CA  1 
ATOM   10225 C  C   . PHE B 1  653 ? 11.277  12.749  143.597 1.00 19.17  ? 751  PHE B C   1 
ATOM   10226 O  O   . PHE B 1  653 ? 10.407  13.564  143.904 1.00 17.58  ? 751  PHE B O   1 
ATOM   10227 C  CB  . PHE B 1  653 ? 10.199  10.578  144.272 1.00 19.32  ? 751  PHE B CB  1 
ATOM   10228 C  CG  . PHE B 1  653 ? 10.215  9.383   145.185 1.00 15.28  ? 751  PHE B CG  1 
ATOM   10229 C  CD1 . PHE B 1  653 ? 9.756   9.485   146.489 1.00 15.22  ? 751  PHE B CD1 1 
ATOM   10230 C  CD2 . PHE B 1  653 ? 10.715  8.167   144.752 1.00 15.68  ? 751  PHE B CD2 1 
ATOM   10231 C  CE1 . PHE B 1  653 ? 9.780   8.393   147.337 1.00 15.57  ? 751  PHE B CE1 1 
ATOM   10232 C  CE2 . PHE B 1  653 ? 10.742  7.072   145.597 1.00 16.01  ? 751  PHE B CE2 1 
ATOM   10233 C  CZ  . PHE B 1  653 ? 10.274  7.186   146.889 1.00 15.96  ? 751  PHE B CZ  1 
ATOM   10234 N  N   . GLY B 1  654 ? 12.116  12.936  142.584 1.00 18.31  ? 752  GLY B N   1 
ATOM   10235 C  CA  . GLY B 1  654 ? 12.091  14.155  141.798 1.00 19.06  ? 752  GLY B CA  1 
ATOM   10236 C  C   . GLY B 1  654 ? 12.497  13.969  140.350 1.00 20.92  ? 752  GLY B C   1 
ATOM   10237 O  O   . GLY B 1  654 ? 12.741  12.850  139.900 1.00 15.59  ? 752  GLY B O   1 
ATOM   10238 N  N   . HIS B 1  655 ? 12.573  15.080  139.623 1.00 21.77  ? 753  HIS B N   1 
ATOM   10239 C  CA  . HIS B 1  655 ? 12.960  15.066  138.218 1.00 23.19  ? 753  HIS B CA  1 
ATOM   10240 C  C   . HIS B 1  655 ? 13.951  16.181  137.900 1.00 25.98  ? 753  HIS B C   1 
ATOM   10241 O  O   . HIS B 1  655 ? 13.771  17.319  138.334 1.00 26.87  ? 753  HIS B O   1 
ATOM   10242 C  CB  . HIS B 1  655 ? 11.730  15.201  137.316 1.00 20.77  ? 753  HIS B CB  1 
ATOM   10243 C  CG  . HIS B 1  655 ? 10.839  14.000  137.323 1.00 19.90  ? 753  HIS B CG  1 
ATOM   10244 N  ND1 . HIS B 1  655 ? 9.848   13.812  138.262 1.00 21.72  ? 753  HIS B ND1 1 
ATOM   10245 C  CD2 . HIS B 1  655 ? 10.783  12.928  136.498 1.00 16.38  ? 753  HIS B CD2 1 
ATOM   10246 C  CE1 . HIS B 1  655 ? 9.228   12.671  138.022 1.00 25.36  ? 753  HIS B CE1 1 
ATOM   10247 N  NE2 . HIS B 1  655 ? 9.775   12.116  136.955 1.00 16.22  ? 753  HIS B NE2 1 
ATOM   10248 N  N   . ASN B 1  656 ? 14.989  15.852  137.135 1.00 24.59  ? 754  ASN B N   1 
ATOM   10249 C  CA  . ASN B 1  656 ? 15.982  16.843  136.736 1.00 25.46  ? 754  ASN B CA  1 
ATOM   10250 C  C   . ASN B 1  656 ? 15.877  17.174  135.249 1.00 25.83  ? 754  ASN B C   1 
ATOM   10251 O  O   . ASN B 1  656 ? 15.418  16.356  134.454 1.00 24.18  ? 754  ASN B O   1 
ATOM   10252 C  CB  . ASN B 1  656 ? 17.394  16.357  137.073 1.00 24.61  ? 754  ASN B CB  1 
ATOM   10253 C  CG  . ASN B 1  656 ? 17.799  15.135  136.274 1.00 24.25  ? 754  ASN B CG  1 
ATOM   10254 O  OD1 . ASN B 1  656 ? 17.229  14.054  136.435 1.00 24.70  ? 754  ASN B OD1 1 
ATOM   10255 N  ND2 . ASN B 1  656 ? 18.793  15.298  135.409 1.00 20.73  ? 754  ASN B ND2 1 
ATOM   10256 N  N   . ARG B 1  657 ? 16.301  18.380  134.883 1.00 25.23  ? 755  ARG B N   1 
ATOM   10257 C  CA  . ARG B 1  657 ? 16.192  18.855  133.507 1.00 24.59  ? 755  ARG B CA  1 
ATOM   10258 C  C   . ARG B 1  657 ? 17.559  18.963  132.827 1.00 29.88  ? 755  ARG B C   1 
ATOM   10259 O  O   . ARG B 1  657 ? 18.492  19.540  133.386 1.00 32.69  ? 755  ARG B O   1 
ATOM   10260 C  CB  . ARG B 1  657 ? 15.476  20.208  133.472 1.00 21.79  ? 755  ARG B CB  1 
ATOM   10261 C  CG  . ARG B 1  657 ? 15.125  20.682  132.074 1.00 25.83  ? 755  ARG B CG  1 
ATOM   10262 C  CD  . ARG B 1  657 ? 14.406  22.019  132.099 1.00 32.32  ? 755  ARG B CD  1 
ATOM   10263 N  NE  . ARG B 1  657 ? 14.192  22.537  130.751 1.00 43.14  ? 755  ARG B NE  1 
ATOM   10264 C  CZ  . ARG B 1  657 ? 15.083  23.251  130.071 1.00 54.74  ? 755  ARG B CZ  1 
ATOM   10265 N  NH1 . ARG B 1  657 ? 16.259  23.540  130.613 1.00 57.88  ? 755  ARG B NH1 1 
ATOM   10266 N  NH2 . ARG B 1  657 ? 14.797  23.677  128.847 1.00 58.89  ? 755  ARG B NH2 1 
ATOM   10267 N  N   . LYS B 1  658 ? 17.672  18.407  131.623 1.00 31.00  ? 756  LYS B N   1 
ATOM   10268 C  CA  . LYS B 1  658 ? 18.919  18.463  130.860 1.00 32.53  ? 756  LYS B CA  1 
ATOM   10269 C  C   . LYS B 1  658 ? 18.739  19.230  129.557 1.00 41.79  ? 756  LYS B C   1 
ATOM   10270 O  O   . LYS B 1  658 ? 17.633  19.310  129.025 1.00 44.97  ? 756  LYS B O   1 
ATOM   10271 C  CB  . LYS B 1  658 ? 19.426  17.060  130.529 1.00 28.76  ? 756  LYS B CB  1 
ATOM   10272 C  CG  . LYS B 1  658 ? 19.954  16.255  131.694 1.00 29.83  ? 756  LYS B CG  1 
ATOM   10273 C  CD  . LYS B 1  658 ? 20.525  14.929  131.199 1.00 33.41  ? 756  LYS B CD  1 
ATOM   10274 C  CE  . LYS B 1  658 ? 19.698  14.352  130.053 1.00 36.87  ? 756  LYS B CE  1 
ATOM   10275 N  NZ  . LYS B 1  658 ? 20.278  13.091  129.505 1.00 36.26  ? 756  LYS B NZ  1 
ATOM   10276 N  N   . GLN B 1  659 ? 19.833  19.785  129.043 1.00 45.82  ? 757  GLN B N   1 
ATOM   10277 C  CA  . GLN B 1  659 ? 19.815  20.473  127.756 1.00 49.55  ? 757  GLN B CA  1 
ATOM   10278 C  C   . GLN B 1  659 ? 21.227  20.639  127.205 1.00 53.43  ? 757  GLN B C   1 
ATOM   10279 O  O   . GLN B 1  659 ? 21.597  20.003  126.219 1.00 57.34  ? 757  GLN B O   1 
ATOM   10280 C  CB  . GLN B 1  659 ? 19.136  21.839  127.877 1.00 51.91  ? 757  GLN B CB  1 
ATOM   10281 C  CG  . GLN B 1  659 ? 19.012  22.586  126.558 1.00 55.81  ? 757  GLN B CG  1 
ATOM   10282 C  CD  . GLN B 1  659 ? 17.918  23.637  126.584 1.00 57.45  ? 757  GLN B CD  1 
ATOM   10283 O  OE1 . GLN B 1  659 ? 17.103  23.725  125.663 1.00 60.28  ? 757  GLN B OE1 1 
ATOM   10284 N  NE2 . GLN B 1  659 ? 17.897  24.445  127.638 1.00 53.65  ? 757  GLN B NE2 1 
ATOM   10285 N  N   . ALA B 1  665 ? 15.925  19.619  125.227 1.00 43.28  ? 763  ALA B N   1 
ATOM   10286 C  CA  . ALA B 1  665 ? 15.597  19.691  126.645 1.00 43.55  ? 763  ALA B CA  1 
ATOM   10287 C  C   . ALA B 1  665 ? 14.897  18.420  127.114 1.00 44.11  ? 763  ALA B C   1 
ATOM   10288 O  O   . ALA B 1  665 ? 13.805  18.094  126.652 1.00 48.15  ? 763  ALA B O   1 
ATOM   10289 C  CB  . ALA B 1  665 ? 14.731  20.908  126.927 1.00 44.38  ? 763  ALA B CB  1 
ATOM   10290 N  N   . VAL B 1  666 ? 15.532  17.707  128.038 1.00 39.89  ? 764  VAL B N   1 
ATOM   10291 C  CA  . VAL B 1  666 ? 15.031  16.411  128.483 1.00 36.78  ? 764  VAL B CA  1 
ATOM   10292 C  C   . VAL B 1  666 ? 14.909  16.365  130.004 1.00 35.30  ? 764  VAL B C   1 
ATOM   10293 O  O   . VAL B 1  666 ? 15.805  16.804  130.722 1.00 39.82  ? 764  VAL B O   1 
ATOM   10294 C  CB  . VAL B 1  666 ? 15.947  15.265  128.000 1.00 37.68  ? 764  VAL B CB  1 
ATOM   10295 C  CG1 . VAL B 1  666 ? 15.585  13.953  128.676 1.00 36.45  ? 764  VAL B CG1 1 
ATOM   10296 C  CG2 . VAL B 1  666 ? 15.866  15.127  126.488 1.00 38.25  ? 764  VAL B CG2 1 
ATOM   10297 N  N   . ILE B 1  667 ? 13.789  15.836  130.488 1.00 31.68  ? 765  ILE B N   1 
ATOM   10298 C  CA  . ILE B 1  667 ? 13.563  15.672  131.920 1.00 26.77  ? 765  ILE B CA  1 
ATOM   10299 C  C   . ILE B 1  667 ? 13.621  14.202  132.334 1.00 27.15  ? 765  ILE B C   1 
ATOM   10300 O  O   . ILE B 1  667 ? 12.901  13.363  131.793 1.00 23.93  ? 765  ILE B O   1 
ATOM   10301 C  CB  . ILE B 1  667 ? 12.210  16.269  132.343 1.00 23.88  ? 765  ILE B CB  1 
ATOM   10302 C  CG1 . ILE B 1  667 ? 12.155  17.755  131.984 1.00 25.89  ? 765  ILE B CG1 1 
ATOM   10303 C  CG2 . ILE B 1  667 ? 11.996  16.095  133.832 1.00 22.07  ? 765  ILE B CG2 1 
ATOM   10304 C  CD1 . ILE B 1  667 ? 10.884  18.447  132.427 1.00 25.89  ? 765  ILE B CD1 1 
ATOM   10305 N  N   . LEU B 1  668 ? 14.477  13.904  133.308 1.00 30.47  ? 766  LEU B N   1 
ATOM   10306 C  CA  . LEU B 1  668 ? 14.679  12.539  133.785 1.00 30.17  ? 766  LEU B CA  1 
ATOM   10307 C  C   . LEU B 1  668 ? 14.247  12.400  135.237 1.00 28.42  ? 766  LEU B C   1 
ATOM   10308 O  O   . LEU B 1  668 ? 14.252  13.374  135.983 1.00 30.12  ? 766  LEU B O   1 
ATOM   10309 C  CB  . LEU B 1  668 ? 16.149  12.127  133.658 1.00 30.87  ? 766  LEU B CB  1 
ATOM   10310 C  CG  . LEU B 1  668 ? 16.867  12.259  132.316 1.00 30.24  ? 766  LEU B CG  1 
ATOM   10311 C  CD1 . LEU B 1  668 ? 18.365  12.149  132.524 1.00 29.26  ? 766  LEU B CD1 1 
ATOM   10312 C  CD2 . LEU B 1  668 ? 16.390  11.192  131.357 1.00 30.52  ? 766  LEU B CD2 1 
ATOM   10313 N  N   . SER B 1  669 ? 13.872  11.189  135.634 1.00 25.48  ? 767  SER B N   1 
ATOM   10314 C  CA  . SER B 1  669 ? 13.493  10.927  137.018 1.00 25.40  ? 767  SER B CA  1 
ATOM   10315 C  C   . SER B 1  669 ? 14.693  10.458  137.837 1.00 28.30  ? 767  SER B C   1 
ATOM   10316 O  O   . SER B 1  669 ? 15.647  9.896   137.298 1.00 28.99  ? 767  SER B O   1 
ATOM   10317 C  CB  . SER B 1  669 ? 12.381  9.879   137.085 1.00 22.34  ? 767  SER B CB  1 
ATOM   10318 O  OG  . SER B 1  669 ? 12.838  8.626   136.608 1.00 23.83  ? 767  SER B OG  1 
ATOM   10319 N  N   . PHE B 1  670 ? 14.638  10.696  139.143 1.00 24.66  ? 768  PHE B N   1 
ATOM   10320 C  CA  . PHE B 1  670 ? 15.656  10.196  140.058 1.00 21.55  ? 768  PHE B CA  1 
ATOM   10321 C  C   . PHE B 1  670 ? 15.064  9.989   141.447 1.00 21.34  ? 768  PHE B C   1 
ATOM   10322 O  O   . PHE B 1  670 ? 13.983  10.491  141.751 1.00 15.85  ? 768  PHE B O   1 
ATOM   10323 C  CB  . PHE B 1  670 ? 16.849  11.156  140.121 1.00 16.67  ? 768  PHE B CB  1 
ATOM   10324 C  CG  . PHE B 1  670 ? 16.516  12.508  140.691 1.00 18.61  ? 768  PHE B CG  1 
ATOM   10325 C  CD1 . PHE B 1  670 ? 16.573  12.736  142.057 1.00 15.85  ? 768  PHE B CD1 1 
ATOM   10326 C  CD2 . PHE B 1  670 ? 16.147  13.553  139.858 1.00 18.04  ? 768  PHE B CD2 1 
ATOM   10327 C  CE1 . PHE B 1  670 ? 16.266  13.976  142.579 1.00 15.45  ? 768  PHE B CE1 1 
ATOM   10328 C  CE2 . PHE B 1  670 ? 15.840  14.797  140.377 1.00 15.73  ? 768  PHE B CE2 1 
ATOM   10329 C  CZ  . PHE B 1  670 ? 15.900  15.008  141.740 1.00 15.38  ? 768  PHE B CZ  1 
ATOM   10330 N  N   . GLU B 1  671 ? 15.776  9.245   142.286 1.00 21.66  ? 769  GLU B N   1 
ATOM   10331 C  CA  . GLU B 1  671 ? 15.322  8.999   143.648 1.00 22.81  ? 769  GLU B CA  1 
ATOM   10332 C  C   . GLU B 1  671 ? 16.469  9.100   144.647 1.00 24.36  ? 769  GLU B C   1 
ATOM   10333 O  O   . GLU B 1  671 ? 17.636  8.939   144.290 1.00 27.15  ? 769  GLU B O   1 
ATOM   10334 C  CB  . GLU B 1  671 ? 14.651  7.629   143.756 1.00 27.62  ? 769  GLU B CB  1 
ATOM   10335 C  CG  . GLU B 1  671 ? 15.535  6.462   143.360 1.00 38.40  ? 769  GLU B CG  1 
ATOM   10336 C  CD  . GLU B 1  671 ? 14.865  5.125   143.607 1.00 49.30  ? 769  GLU B CD  1 
ATOM   10337 O  OE1 . GLU B 1  671 ? 14.986  4.593   144.731 1.00 53.54  ? 769  GLU B OE1 1 
ATOM   10338 O  OE2 . GLU B 1  671 ? 14.212  4.609   142.677 1.00 52.18  ? 769  GLU B OE2 1 
ATOM   10339 N  N   . GLY B 1  672 ? 16.125  9.376   145.899 1.00 22.80  ? 770  GLY B N   1 
ATOM   10340 C  CA  . GLY B 1  672 ? 17.096  9.404   146.975 1.00 17.75  ? 770  GLY B CA  1 
ATOM   10341 C  C   . GLY B 1  672 ? 16.575  8.661   148.187 1.00 21.81  ? 770  GLY B C   1 
ATOM   10342 O  O   . GLY B 1  672 ? 15.376  8.684   148.463 1.00 24.07  ? 770  GLY B O   1 
ATOM   10343 N  N   . THR B 1  673 ? 17.472  7.999   148.909 1.00 24.17  ? 771  THR B N   1 
ATOM   10344 C  CA  . THR B 1  673 ? 17.086  7.253   150.100 1.00 24.73  ? 771  THR B CA  1 
ATOM   10345 C  C   . THR B 1  673 ? 18.028  7.557   151.256 1.00 26.05  ? 771  THR B C   1 
ATOM   10346 O  O   . THR B 1  673 ? 19.238  7.359   151.156 1.00 28.72  ? 771  THR B O   1 
ATOM   10347 C  CB  . THR B 1  673 ? 17.074  5.736   149.843 1.00 27.44  ? 771  THR B CB  1 
ATOM   10348 O  OG1 . THR B 1  673 ? 16.169  5.438   148.774 1.00 26.29  ? 771  THR B OG1 1 
ATOM   10349 C  CG2 . THR B 1  673 ? 16.638  4.986   151.096 1.00 18.34  ? 771  THR B CG2 1 
ATOM   10350 N  N   . SER B 1  674 ? 17.460  8.044   152.352 1.00 24.66  ? 772  SER B N   1 
ATOM   10351 C  CA  . SER B 1  674 ? 18.240  8.395   153.528 1.00 24.95  ? 772  SER B CA  1 
ATOM   10352 C  C   . SER B 1  674 ? 18.645  7.151   154.304 1.00 28.85  ? 772  SER B C   1 
ATOM   10353 O  O   . SER B 1  674 ? 17.944  6.142   154.262 1.00 39.23  ? 772  SER B O   1 
ATOM   10354 C  CB  . SER B 1  674 ? 17.444  9.337   154.431 1.00 22.44  ? 772  SER B CB  1 
ATOM   10355 O  OG  . SER B 1  674 ? 16.490  8.619   155.194 1.00 19.82  ? 772  SER B OG  1 
ATOM   10356 N  N   . PRO B 1  675 ? 19.792  7.215   155.000 1.00 22.51  ? 773  PRO B N   1 
ATOM   10357 C  CA  . PRO B 1  675 ? 20.190  6.154   155.931 1.00 24.36  ? 773  PRO B CA  1 
ATOM   10358 C  C   . PRO B 1  675 ? 19.096  5.861   156.955 1.00 29.04  ? 773  PRO B C   1 
ATOM   10359 O  O   . PRO B 1  675 ? 18.361  6.769   157.339 1.00 29.24  ? 773  PRO B O   1 
ATOM   10360 C  CB  . PRO B 1  675 ? 21.435  6.728   156.613 1.00 21.88  ? 773  PRO B CB  1 
ATOM   10361 C  CG  . PRO B 1  675 ? 21.993  7.692   155.634 1.00 19.80  ? 773  PRO B CG  1 
ATOM   10362 C  CD  . PRO B 1  675 ? 20.840  8.238   154.837 1.00 23.70  ? 773  PRO B CD  1 
ATOM   10363 N  N   . ALA B 1  676 ? 18.992  4.609   157.386 1.00 31.39  ? 774  ALA B N   1 
ATOM   10364 C  CA  . ALA B 1  676 ? 17.989  4.218   158.369 1.00 29.30  ? 774  ALA B CA  1 
ATOM   10365 C  C   . ALA B 1  676 ? 18.242  4.874   159.724 1.00 27.95  ? 774  ALA B C   1 
ATOM   10366 O  O   . ALA B 1  676 ? 19.387  5.060   160.131 1.00 32.12  ? 774  ALA B O   1 
ATOM   10367 C  CB  . ALA B 1  676 ? 17.957  2.706   158.513 1.00 22.27  ? 774  ALA B CB  1 
ATOM   10368 N  N   . PHE B 1  677 ? 17.161  5.230   160.410 1.00 26.43  ? 775  PHE B N   1 
ATOM   10369 C  CA  . PHE B 1  677 ? 17.241  5.791   161.753 1.00 24.94  ? 775  PHE B CA  1 
ATOM   10370 C  C   . PHE B 1  677 ? 16.111  5.215   162.600 1.00 26.46  ? 775  PHE B C   1 
ATOM   10371 O  O   . PHE B 1  677 ? 15.262  4.488   162.084 1.00 29.86  ? 775  PHE B O   1 
ATOM   10372 C  CB  . PHE B 1  677 ? 17.173  7.319   161.714 1.00 25.47  ? 775  PHE B CB  1 
ATOM   10373 C  CG  . PHE B 1  677 ? 15.903  7.859   161.117 1.00 24.61  ? 775  PHE B CG  1 
ATOM   10374 C  CD1 . PHE B 1  677 ? 15.771  8.005   159.746 1.00 21.58  ? 775  PHE B CD1 1 
ATOM   10375 C  CD2 . PHE B 1  677 ? 14.848  8.241   161.930 1.00 25.02  ? 775  PHE B CD2 1 
ATOM   10376 C  CE1 . PHE B 1  677 ? 14.606  8.505   159.196 1.00 20.40  ? 775  PHE B CE1 1 
ATOM   10377 C  CE2 . PHE B 1  677 ? 13.682  8.743   161.385 1.00 24.26  ? 775  PHE B CE2 1 
ATOM   10378 C  CZ  . PHE B 1  677 ? 13.561  8.875   160.016 1.00 22.20  ? 775  PHE B CZ  1 
ATOM   10379 N  N   . GLU B 1  678 ? 16.089  5.538   163.890 1.00 27.11  ? 776  GLU B N   1 
ATOM   10380 C  CA  . GLU B 1  678 ? 15.160  4.876   164.803 1.00 30.19  ? 776  GLU B CA  1 
ATOM   10381 C  C   . GLU B 1  678 ? 14.347  5.857   165.647 1.00 31.74  ? 776  GLU B C   1 
ATOM   10382 O  O   . GLU B 1  678 ? 14.844  6.902   166.065 1.00 32.18  ? 776  GLU B O   1 
ATOM   10383 C  CB  . GLU B 1  678 ? 15.926  3.914   165.714 1.00 31.69  ? 776  GLU B CB  1 
ATOM   10384 C  CG  . GLU B 1  678 ? 16.661  2.815   164.961 1.00 33.23  ? 776  GLU B CG  1 
ATOM   10385 C  CD  . GLU B 1  678 ? 17.464  1.909   165.873 1.00 37.46  ? 776  GLU B CD  1 
ATOM   10386 O  OE1 . GLU B 1  678 ? 17.590  2.228   167.073 1.00 42.12  ? 776  GLU B OE1 1 
ATOM   10387 O  OE2 . GLU B 1  678 ? 17.968  0.876   165.386 1.00 36.03  ? 776  GLU B OE2 1 
ATOM   10388 N  N   . VAL B 1  679 ? 13.085  5.506   165.879 1.00 33.65  ? 777  VAL B N   1 
ATOM   10389 C  CA  . VAL B 1  679 ? 12.198  6.282   166.740 1.00 30.40  ? 777  VAL B CA  1 
ATOM   10390 C  C   . VAL B 1  679 ? 11.842  5.572   168.049 1.00 29.16  ? 777  VAL B C   1 
ATOM   10391 O  O   . VAL B 1  679 ? 11.493  4.393   168.043 1.00 28.21  ? 777  VAL B O   1 
ATOM   10392 C  CB  . VAL B 1  679 ? 10.890  6.628   165.996 1.00 26.77  ? 777  VAL B CB  1 
ATOM   10393 C  CG1 . VAL B 1  679 ? 9.892   7.290   166.936 1.00 28.25  ? 777  VAL B CG1 1 
ATOM   10394 C  CG2 . VAL B 1  679 ? 11.181  7.522   164.804 1.00 22.57  ? 777  VAL B CG2 1 
ATOM   10395 N  N   . VAL B 1  680 ? 11.959  6.283   169.168 1.00 29.55  ? 778  VAL B N   1 
ATOM   10396 C  CA  . VAL B 1  680 ? 11.615  5.724   170.473 1.00 34.77  ? 778  VAL B CA  1 
ATOM   10397 C  C   . VAL B 1  680 ? 10.508  6.554   171.127 1.00 42.78  ? 778  VAL B C   1 
ATOM   10398 O  O   . VAL B 1  680 ? 10.323  7.724   170.791 1.00 42.28  ? 778  VAL B O   1 
ATOM   10399 C  CB  . VAL B 1  680 ? 12.836  5.653   171.413 1.00 34.03  ? 778  VAL B CB  1 
ATOM   10400 C  CG1 . VAL B 1  680 ? 13.940  4.824   170.784 1.00 33.87  ? 778  VAL B CG1 1 
ATOM   10401 C  CG2 . VAL B 1  680 ? 13.329  7.050   171.761 1.00 32.80  ? 778  VAL B CG2 1 
ATOM   10402 N  N   . THR B 1  681 ? 9.767   5.948   172.050 1.00 51.60  ? 779  THR B N   1 
ATOM   10403 C  CA  . THR B 1  681 ? 8.757   6.678   172.815 1.00 56.07  ? 779  THR B CA  1 
ATOM   10404 C  C   . THR B 1  681 ? 9.344   7.201   174.125 1.00 59.13  ? 779  THR B C   1 
ATOM   10405 O  O   . THR B 1  681 ? 9.006   8.295   174.579 1.00 59.58  ? 779  THR B O   1 
ATOM   10406 C  CB  . THR B 1  681 ? 7.525   5.802   173.121 1.00 58.25  ? 779  THR B CB  1 
ATOM   10407 O  OG1 . THR B 1  681 ? 7.073   5.172   171.916 1.00 60.42  ? 779  THR B OG1 1 
ATOM   10408 C  CG2 . THR B 1  681 ? 6.396   6.649   173.689 1.00 56.89  ? 779  THR B CG2 1 
HETATM 10409 C  C1  . NAG C 2  .   ? 20.363  -11.540 115.814 1.00 31.60  ? 1    NAG C C1  1 
HETATM 10410 C  C2  . NAG C 2  .   ? 20.642  -11.749 114.326 1.00 39.55  ? 1    NAG C C2  1 
HETATM 10411 C  C3  . NAG C 2  .   ? 22.090  -11.407 114.002 1.00 42.74  ? 1    NAG C C3  1 
HETATM 10412 C  C4  . NAG C 2  .   ? 22.404  -9.990  114.459 1.00 43.75  ? 1    NAG C C4  1 
HETATM 10413 C  C5  . NAG C 2  .   ? 22.116  -9.867  115.951 1.00 39.71  ? 1    NAG C C5  1 
HETATM 10414 C  C6  . NAG C 2  .   ? 22.337  -8.470  116.487 1.00 40.73  ? 1    NAG C C6  1 
HETATM 10415 C  C7  . NAG C 2  .   ? 19.192  -13.469 113.335 1.00 46.35  ? 1    NAG C C7  1 
HETATM 10416 C  C8  . NAG C 2  .   ? 19.062  -14.917 112.973 1.00 46.10  ? 1    NAG C C8  1 
HETATM 10417 N  N2  . NAG C 2  .   ? 20.340  -13.114 113.919 1.00 43.28  ? 1    NAG C N2  1 
HETATM 10418 O  O3  . NAG C 2  .   ? 22.296  -11.535 112.600 1.00 45.74  ? 1    NAG C O3  1 
HETATM 10419 O  O4  . NAG C 2  .   ? 23.766  -9.673  114.194 1.00 45.11  ? 1    NAG C O4  1 
HETATM 10420 O  O5  . NAG C 2  .   ? 20.740  -10.195 116.196 1.00 32.02  ? 1    NAG C O5  1 
HETATM 10421 O  O6  . NAG C 2  .   ? 21.116  -7.766  116.666 1.00 41.73  ? 1    NAG C O6  1 
HETATM 10422 O  O7  . NAG C 2  .   ? 18.297  -12.660 113.112 1.00 48.90  ? 1    NAG C O7  1 
HETATM 10423 C  C1  . NAG C 2  .   ? 24.076  -8.880  113.079 1.00 46.93  ? 2    NAG C C1  1 
HETATM 10424 C  C2  . NAG C 2  .   ? 25.294  -7.979  113.308 1.00 48.67  ? 2    NAG C C2  1 
HETATM 10425 C  C3  . NAG C 2  .   ? 26.002  -7.691  111.980 1.00 50.14  ? 2    NAG C C3  1 
HETATM 10426 C  C4  . NAG C 2  .   ? 26.282  -8.983  111.221 1.00 50.67  ? 2    NAG C C4  1 
HETATM 10427 C  C5  . NAG C 2  .   ? 24.998  -9.793  111.070 1.00 46.23  ? 2    NAG C C5  1 
HETATM 10428 C  C6  . NAG C 2  .   ? 25.206  -11.132 110.397 1.00 43.15  ? 2    NAG C C6  1 
HETATM 10429 C  C7  . NAG C 2  .   ? 25.202  -6.452  115.234 1.00 45.89  ? 2    NAG C C7  1 
HETATM 10430 C  C8  . NAG C 2  .   ? 24.719  -5.125  115.737 1.00 48.47  ? 2    NAG C C8  1 
HETATM 10431 N  N2  . NAG C 2  .   ? 24.909  -6.740  113.960 1.00 47.60  ? 2    NAG C N2  1 
HETATM 10432 O  O3  . NAG C 2  .   ? 27.221  -7.000  112.235 1.00 51.79  ? 2    NAG C O3  1 
HETATM 10433 O  O4  . NAG C 2  .   ? 26.839  -8.707  109.940 1.00 53.72  ? 2    NAG C O4  1 
HETATM 10434 O  O5  . NAG C 2  .   ? 24.469  -10.063 112.376 1.00 47.95  ? 2    NAG C O5  1 
HETATM 10435 O  O6  . NAG C 2  .   ? 24.341  -12.126 110.931 1.00 41.51  ? 2    NAG C O6  1 
HETATM 10436 O  O7  . NAG C 2  .   ? 25.833  -7.225  115.946 1.00 41.11  ? 2    NAG C O7  1 
HETATM 10437 C  C1  . NAG D 3  .   ? -0.161  -3.546  102.789 1.00 25.11  ? 1    NAG D C1  1 
HETATM 10438 C  C2  . NAG D 3  .   ? 0.300   -3.333  101.357 1.00 29.47  ? 1    NAG D C2  1 
HETATM 10439 C  C3  . NAG D 3  .   ? 1.727   -2.797  101.339 1.00 31.69  ? 1    NAG D C3  1 
HETATM 10440 C  C4  . NAG D 3  .   ? 1.853   -1.561  102.224 1.00 33.70  ? 1    NAG D C4  1 
HETATM 10441 C  C5  . NAG D 3  .   ? 1.257   -1.822  103.609 1.00 27.84  ? 1    NAG D C5  1 
HETATM 10442 C  C6  . NAG D 3  .   ? 1.191   -0.581  104.469 1.00 21.85  ? 1    NAG D C6  1 
HETATM 10443 C  C7  . NAG D 3  .   ? -0.801  -4.825  99.748  1.00 35.45  ? 1    NAG D C7  1 
HETATM 10444 C  C8  . NAG D 3  .   ? -0.735  -6.140  99.033  1.00 33.72  ? 1    NAG D C8  1 
HETATM 10445 N  N2  . NAG D 3  .   ? 0.207   -4.563  100.587 1.00 35.86  ? 1    NAG D N2  1 
HETATM 10446 O  O3  . NAG D 3  .   ? 2.070   -2.485  99.993  1.00 31.72  ? 1    NAG D O3  1 
HETATM 10447 O  O4  . NAG D 3  .   ? 3.226   -1.216  102.385 1.00 41.80  ? 1    NAG D O4  1 
HETATM 10448 O  O5  . NAG D 3  .   ? -0.086  -2.320  103.497 1.00 26.17  ? 1    NAG D O5  1 
HETATM 10449 O  O6  . NAG D 3  .   ? 1.274   -0.905  105.850 1.00 21.14  ? 1    NAG D O6  1 
HETATM 10450 O  O7  . NAG D 3  .   ? -1.724  -4.035  99.573  1.00 32.32  ? 1    NAG D O7  1 
HETATM 10451 C  C1  . NAG D 3  .   ? 3.618   -0.276  101.415 1.00 50.27  ? 2    NAG D C1  1 
HETATM 10452 C  C2  . NAG D 3  .   ? 4.652   0.687   101.958 1.00 50.44  ? 2    NAG D C2  1 
HETATM 10453 C  C3  . NAG D 3  .   ? 4.961   1.758   100.917 1.00 59.74  ? 2    NAG D C3  1 
HETATM 10454 C  C4  . NAG D 3  .   ? 5.267   1.155   99.547  1.00 68.47  ? 2    NAG D C4  1 
HETATM 10455 C  C5  . NAG D 3  .   ? 4.293   0.032   99.173  1.00 62.62  ? 2    NAG D C5  1 
HETATM 10456 C  C6  . NAG D 3  .   ? 4.766   -0.788  97.995  1.00 57.86  ? 2    NAG D C6  1 
HETATM 10457 C  C7  . NAG D 3  .   ? 4.639   0.926   104.402 1.00 40.95  ? 2    NAG D C7  1 
HETATM 10458 C  C8  . NAG D 3  .   ? 4.065   1.671   105.570 1.00 39.16  ? 2    NAG D C8  1 
HETATM 10459 N  N2  . NAG D 3  .   ? 4.199   1.299   103.196 1.00 43.27  ? 2    NAG D N2  1 
HETATM 10460 O  O3  . NAG D 3  .   ? 6.077   2.522   101.361 1.00 58.73  ? 2    NAG D O3  1 
HETATM 10461 O  O4  . NAG D 3  .   ? 5.112   2.181   98.570  1.00 77.76  ? 2    NAG D O4  1 
HETATM 10462 O  O5  . NAG D 3  .   ? 4.116   -0.889  100.260 1.00 58.43  ? 2    NAG D O5  1 
HETATM 10463 O  O6  . NAG D 3  .   ? 5.276   -2.046  98.415  1.00 55.08  ? 2    NAG D O6  1 
HETATM 10464 O  O7  . NAG D 3  .   ? 5.462   0.026   104.545 1.00 40.27  ? 2    NAG D O7  1 
HETATM 10465 C  C1  . BMA D 3  .   ? 6.287   2.601   97.911  1.00 79.69  ? 3    BMA D C1  1 
HETATM 10466 C  C2  . BMA D 3  .   ? 6.815   3.991   98.502  1.00 104.45 ? 3    BMA D C2  1 
HETATM 10467 C  C3  . BMA D 3  .   ? 8.366   4.191   98.442  1.00 81.21  ? 3    BMA D C3  1 
HETATM 10468 C  C4  . BMA D 3  .   ? 9.165   2.915   98.139  1.00 81.47  ? 3    BMA D C4  1 
HETATM 10469 C  C5  . BMA D 3  .   ? 8.424   2.116   97.088  1.00 80.51  ? 3    BMA D C5  1 
HETATM 10470 C  C6  . BMA D 3  .   ? 9.233   0.977   96.496  1.00 78.26  ? 3    BMA D C6  1 
HETATM 10471 O  O2  . BMA D 3  .   ? 6.425   4.202   99.850  1.00 104.52 ? 3    BMA D O2  1 
HETATM 10472 O  O3  . BMA D 3  .   ? 8.851   4.785   99.645  1.00 80.34  ? 3    BMA D O3  1 
HETATM 10473 O  O4  . BMA D 3  .   ? 10.460  3.253   97.665  1.00 82.17  ? 3    BMA D O4  1 
HETATM 10474 O  O5  . BMA D 3  .   ? 7.278   1.601   97.753  1.00 80.67  ? 3    BMA D O5  1 
HETATM 10475 O  O6  . BMA D 3  .   ? 9.784   1.432   95.261  1.00 75.88  ? 3    BMA D O6  1 
HETATM 10476 C  C1  . NAG E 2  .   ? 22.304  22.447  150.636 1.00 33.43  ? 1    NAG E C1  1 
HETATM 10477 C  C2  . NAG E 2  .   ? 22.600  23.942  150.531 1.00 38.75  ? 1    NAG E C2  1 
HETATM 10478 C  C3  . NAG E 2  .   ? 24.068  24.212  150.826 1.00 40.20  ? 1    NAG E C3  1 
HETATM 10479 C  C4  . NAG E 2  .   ? 24.416  23.660  152.201 1.00 40.28  ? 1    NAG E C4  1 
HETATM 10480 C  C5  . NAG E 2  .   ? 24.119  22.167  152.206 1.00 34.32  ? 1    NAG E C5  1 
HETATM 10481 C  C6  . NAG E 2  .   ? 24.398  21.504  153.531 1.00 30.97  ? 1    NAG E C6  1 
HETATM 10482 C  C7  . NAG E 2  .   ? 21.107  25.133  148.994 1.00 35.57  ? 1    NAG E C7  1 
HETATM 10483 C  C8  . NAG E 2  .   ? 20.893  25.598  147.588 1.00 35.36  ? 1    NAG E C8  1 
HETATM 10484 N  N2  . NAG E 2  .   ? 22.238  24.458  149.221 1.00 39.03  ? 1    NAG E N2  1 
HETATM 10485 O  O3  . NAG E 2  .   ? 24.336  25.606  150.747 1.00 44.93  ? 1    NAG E O3  1 
HETATM 10486 O  O4  . NAG E 2  .   ? 25.793  23.870  152.481 1.00 49.50  ? 1    NAG E O4  1 
HETATM 10487 O  O5  . NAG E 2  .   ? 22.728  21.958  151.925 1.00 33.06  ? 1    NAG E O5  1 
HETATM 10488 O  O6  . NAG E 2  .   ? 23.572  20.364  153.718 1.00 33.39  ? 1    NAG E O6  1 
HETATM 10489 O  O7  . NAG E 2  .   ? 20.293  25.356  149.885 1.00 33.80  ? 1    NAG E O7  1 
HETATM 10490 C  C1  . NAG E 2  .   ? 26.786  24.467  153.265 1.00 55.54  ? 2    NAG E C1  1 
HETATM 10491 C  C2  . NAG E 2  .   ? 27.125  25.842  153.844 1.00 57.18  ? 2    NAG E C2  1 
HETATM 10492 C  C3  . NAG E 2  .   ? 28.226  25.713  154.895 1.00 60.12  ? 2    NAG E C3  1 
HETATM 10493 C  C4  . NAG E 2  .   ? 27.878  24.649  155.930 1.00 59.90  ? 2    NAG E C4  1 
HETATM 10494 C  C5  . NAG E 2  .   ? 27.547  23.339  155.228 1.00 54.77  ? 2    NAG E C5  1 
HETATM 10495 C  C6  . NAG E 2  .   ? 27.120  22.239  156.174 1.00 43.63  ? 2    NAG E C6  1 
HETATM 10496 C  C7  . NAG E 2  .   ? 26.721  27.303  151.894 1.00 60.66  ? 2    NAG E C7  1 
HETATM 10497 C  C8  . NAG E 2  .   ? 27.361  28.218  150.896 1.00 59.11  ? 2    NAG E C8  1 
HETATM 10498 N  N2  . NAG E 2  .   ? 27.547  26.755  152.794 1.00 58.40  ? 2    NAG E N2  1 
HETATM 10499 O  O3  . NAG E 2  .   ? 28.423  26.972  155.527 1.00 61.45  ? 2    NAG E O3  1 
HETATM 10500 O  O4  . NAG E 2  .   ? 28.983  24.450  156.803 1.00 61.38  ? 2    NAG E O4  1 
HETATM 10501 O  O5  . NAG E 2  .   ? 26.458  23.562  154.323 1.00 58.41  ? 2    NAG E O5  1 
HETATM 10502 O  O6  . NAG E 2  .   ? 27.147  20.966  155.541 1.00 37.71  ? 2    NAG E O6  1 
HETATM 10503 O  O7  . NAG E 2  .   ? 25.514  27.074  151.885 1.00 65.36  ? 2    NAG E O7  1 
HETATM 10504 ZN ZN  . ZN  F 4  .   ? -14.225 -13.175 103.392 1.00 21.83  ? 801  ZN  A ZN  1 
HETATM 10505 CA CA  . CA  G 5  .   ? 1.242   -7.068  121.056 1.00 68.82  ? 802  CA  A CA  1 
HETATM 10506 C  C1  . NAG H 6  .   ? -42.817 -19.654 87.046  1.00 50.93  ? 805  NAG A C1  1 
HETATM 10507 C  C2  . NAG H 6  .   ? -43.640 -18.399 86.812  1.00 58.14  ? 805  NAG A C2  1 
HETATM 10508 C  C3  . NAG H 6  .   ? -43.823 -18.183 85.311  1.00 63.42  ? 805  NAG A C3  1 
HETATM 10509 C  C4  . NAG H 6  .   ? -42.478 -18.216 84.590  1.00 65.03  ? 805  NAG A C4  1 
HETATM 10510 C  C5  . NAG H 6  .   ? -41.655 -19.441 85.001  1.00 63.68  ? 805  NAG A C5  1 
HETATM 10511 C  C6  . NAG H 6  .   ? -40.244 -19.434 84.455  1.00 68.03  ? 805  NAG A C6  1 
HETATM 10512 C  C7  . NAG H 6  .   ? -45.542 -17.432 88.035  1.00 55.97  ? 805  NAG A C7  1 
HETATM 10513 C  C8  . NAG H 6  .   ? -46.860 -17.710 88.690  1.00 51.86  ? 805  NAG A C8  1 
HETATM 10514 N  N2  . NAG H 6  .   ? -44.929 -18.485 87.482  1.00 59.40  ? 805  NAG A N2  1 
HETATM 10515 O  O3  . NAG H 6  .   ? -44.471 -16.938 85.083  1.00 68.23  ? 805  NAG A O3  1 
HETATM 10516 O  O4  . NAG H 6  .   ? -42.697 -18.260 83.185  1.00 65.70  ? 805  NAG A O4  1 
HETATM 10517 O  O5  . NAG H 6  .   ? -41.546 -19.510 86.431  1.00 57.24  ? 805  NAG A O5  1 
HETATM 10518 O  O6  . NAG H 6  .   ? -39.785 -18.118 84.181  1.00 70.66  ? 805  NAG A O6  1 
HETATM 10519 O  O7  . NAG H 6  .   ? -45.057 -16.305 88.004  1.00 57.62  ? 805  NAG A O7  1 
HETATM 10520 C  C1  . NAG I 6  .   ? -2.672  -34.267 118.511 1.00 51.43  ? 806  NAG A C1  1 
HETATM 10521 C  C2  . NAG I 6  .   ? -2.202  -35.723 118.560 1.00 57.42  ? 806  NAG A C2  1 
HETATM 10522 C  C3  . NAG I 6  .   ? -2.964  -36.491 119.640 1.00 59.25  ?