data_4WNB
# 
_entry.id   4WNB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WNB         
WWPDB D_1000204129 
# 
_pdbx_database_PDB_obs_spr.date             2014-10-29 
_pdbx_database_PDB_obs_spr.details          ? 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           4WNB 
_pdbx_database_PDB_obs_spr.replace_pdb_id   4W7B 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WNB 
_pdbx_database_status.recvd_initial_deposition_date   2014-10-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guja, K.E.'      1 
'Yang, M.'        2 
'Sampson, N.'     3 
'Garcia-Diaz, M.' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Chem.Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1554-8937 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                2632 
_citation.page_last                 2645 
_citation.title                     
'A Distinct MaoC-like Enoyl-CoA Hydratase Architecture Mediates Cholesterol Catabolism in Mycobacterium tuberculosis.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/cb500232h 
_citation.pdbx_database_id_PubMed   25203216 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yang, M.'        1 ? 
primary 'Guja, K.E.'      2 ? 
primary 'Thomas, S.T.'    3 ? 
primary 'Garcia-Diaz, M.' 4 ? 
primary 'Sampson, N.S.'   5 ? 
# 
_cell.entry_id           4WNB 
_cell.length_a           51.882 
_cell.length_b           51.882 
_cell.length_c           436.235 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4WNB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hydratase ChsH2'                         20213.965 1   ? ? ? ? 
2 polymer     man 'Hydratase ChsH1'                         13965.812 1   ? ? ? ? 
3 non-polymer syn 'CADMIUM ION'                             112.411   2   ? ? ? ? 
4 non-polymer syn 'CALCIUM ION'                             40.078    1   ? ? ? ? 
5 non-polymer syn '3-oxo-4-pregnene-20-carboxyl-Coenzyme A' 1094.007  1   ? ? ? ? 
6 water       nat water                                     18.015    265 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVDDAAARAAGHPGIVAPPAMIQVWTMMGLGGV
RPKDDPLGPIIKLFDDAGYIGVVATNCEQTYHRYLLPGEQVSISAELGDVVGPKQTALGEGWFINQHIVWQVGDEDVAEM
NWRILKFKPAGSPSSVPDDLDPDAMMR
;
;MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVDDAAARAAGHPGIVAPPAMIQVWTMMGLGGV
RPKDDPLGPIIKLFDDAGYIGVVATNCEQTYHRYLLPGEQVSISAELGDVVGPKQTALGEGWFINQHIVWQVGDEDVAEM
NWRILKFKPAGSPSSVPDDLDPDAMMR
;
A ? 
2 'polypeptide(L)' no no 
;MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRL
GVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS
;
;MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRL
GVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   GLY n 
1 4   VAL n 
1 5   SER n 
1 6   ASP n 
1 7   ILE n 
1 8   GLN n 
1 9   GLU n 
1 10  ALA n 
1 11  VAL n 
1 12  ALA n 
1 13  GLN n 
1 14  ILE n 
1 15  LYS n 
1 16  ALA n 
1 17  ALA n 
1 18  GLY n 
1 19  PRO n 
1 20  SER n 
1 21  LYS n 
1 22  PRO n 
1 23  ARG n 
1 24  LEU n 
1 25  ALA n 
1 26  ARG n 
1 27  ASP n 
1 28  PRO n 
1 29  VAL n 
1 30  ASN n 
1 31  GLN n 
1 32  PRO n 
1 33  MET n 
1 34  ILE n 
1 35  ASN n 
1 36  ASN n 
1 37  TRP n 
1 38  VAL n 
1 39  GLU n 
1 40  ALA n 
1 41  ILE n 
1 42  GLY n 
1 43  ASP n 
1 44  ARG n 
1 45  ASN n 
1 46  PRO n 
1 47  ILE n 
1 48  TYR n 
1 49  VAL n 
1 50  ASP n 
1 51  ASP n 
1 52  ALA n 
1 53  ALA n 
1 54  ALA n 
1 55  ARG n 
1 56  ALA n 
1 57  ALA n 
1 58  GLY n 
1 59  HIS n 
1 60  PRO n 
1 61  GLY n 
1 62  ILE n 
1 63  VAL n 
1 64  ALA n 
1 65  PRO n 
1 66  PRO n 
1 67  ALA n 
1 68  MET n 
1 69  ILE n 
1 70  GLN n 
1 71  VAL n 
1 72  TRP n 
1 73  THR n 
1 74  MET n 
1 75  MET n 
1 76  GLY n 
1 77  LEU n 
1 78  GLY n 
1 79  GLY n 
1 80  VAL n 
1 81  ARG n 
1 82  PRO n 
1 83  LYS n 
1 84  ASP n 
1 85  ASP n 
1 86  PRO n 
1 87  LEU n 
1 88  GLY n 
1 89  PRO n 
1 90  ILE n 
1 91  ILE n 
1 92  LYS n 
1 93  LEU n 
1 94  PHE n 
1 95  ASP n 
1 96  ASP n 
1 97  ALA n 
1 98  GLY n 
1 99  TYR n 
1 100 ILE n 
1 101 GLY n 
1 102 VAL n 
1 103 VAL n 
1 104 ALA n 
1 105 THR n 
1 106 ASN n 
1 107 CYS n 
1 108 GLU n 
1 109 GLN n 
1 110 THR n 
1 111 TYR n 
1 112 HIS n 
1 113 ARG n 
1 114 TYR n 
1 115 LEU n 
1 116 LEU n 
1 117 PRO n 
1 118 GLY n 
1 119 GLU n 
1 120 GLN n 
1 121 VAL n 
1 122 SER n 
1 123 ILE n 
1 124 SER n 
1 125 ALA n 
1 126 GLU n 
1 127 LEU n 
1 128 GLY n 
1 129 ASP n 
1 130 VAL n 
1 131 VAL n 
1 132 GLY n 
1 133 PRO n 
1 134 LYS n 
1 135 GLN n 
1 136 THR n 
1 137 ALA n 
1 138 LEU n 
1 139 GLY n 
1 140 GLU n 
1 141 GLY n 
1 142 TRP n 
1 143 PHE n 
1 144 ILE n 
1 145 ASN n 
1 146 GLN n 
1 147 HIS n 
1 148 ILE n 
1 149 VAL n 
1 150 TRP n 
1 151 GLN n 
1 152 VAL n 
1 153 GLY n 
1 154 ASP n 
1 155 GLU n 
1 156 ASP n 
1 157 VAL n 
1 158 ALA n 
1 159 GLU n 
1 160 MET n 
1 161 ASN n 
1 162 TRP n 
1 163 ARG n 
1 164 ILE n 
1 165 LEU n 
1 166 LYS n 
1 167 PHE n 
1 168 LYS n 
1 169 PRO n 
1 170 ALA n 
1 171 GLY n 
1 172 SER n 
1 173 PRO n 
1 174 SER n 
1 175 SER n 
1 176 VAL n 
1 177 PRO n 
1 178 ASP n 
1 179 ASP n 
1 180 LEU n 
1 181 ASP n 
1 182 PRO n 
1 183 ASP n 
1 184 ALA n 
1 185 MET n 
1 186 MET n 
1 187 ARG n 
2 1   MET n 
2 2   THR n 
2 3   VAL n 
2 4   VAL n 
2 5   GLY n 
2 6   ALA n 
2 7   VAL n 
2 8   LEU n 
2 9   PRO n 
2 10  GLU n 
2 11  LEU n 
2 12  LYS n 
2 13  LEU n 
2 14  TYR n 
2 15  GLY n 
2 16  ASP n 
2 17  PRO n 
2 18  THR n 
2 19  PHE n 
2 20  ILE n 
2 21  VAL n 
2 22  SER n 
2 23  THR n 
2 24  ALA n 
2 25  LEU n 
2 26  ALA n 
2 27  THR n 
2 28  ARG n 
2 29  ASP n 
2 30  PHE n 
2 31  GLN n 
2 32  ASP n 
2 33  VAL n 
2 34  HIS n 
2 35  HIS n 
2 36  ASP n 
2 37  ARG n 
2 38  ASP n 
2 39  LYS n 
2 40  ALA n 
2 41  VAL n 
2 42  ALA n 
2 43  GLN n 
2 44  GLY n 
2 45  SER n 
2 46  LYS n 
2 47  ASP n 
2 48  ILE n 
2 49  PHE n 
2 50  VAL n 
2 51  ASN n 
2 52  ILE n 
2 53  LEU n 
2 54  THR n 
2 55  ASP n 
2 56  THR n 
2 57  GLY n 
2 58  LEU n 
2 59  VAL n 
2 60  GLN n 
2 61  ARG n 
2 62  TYR n 
2 63  VAL n 
2 64  THR n 
2 65  ASP n 
2 66  TRP n 
2 67  ALA n 
2 68  GLY n 
2 69  PRO n 
2 70  SER n 
2 71  ALA n 
2 72  LEU n 
2 73  ILE n 
2 74  LYS n 
2 75  SER n 
2 76  ILE n 
2 77  GLY n 
2 78  LEU n 
2 79  ARG n 
2 80  LEU n 
2 81  GLY n 
2 82  VAL n 
2 83  PRO n 
2 84  TRP n 
2 85  TYR n 
2 86  ALA n 
2 87  TYR n 
2 88  ASP n 
2 89  THR n 
2 90  VAL n 
2 91  THR n 
2 92  PHE n 
2 93  SER n 
2 94  GLY n 
2 95  GLU n 
2 96  VAL n 
2 97  THR n 
2 98  ALA n 
2 99  VAL n 
2 100 ASN n 
2 101 ASP n 
2 102 GLY n 
2 103 LEU n 
2 104 ILE n 
2 105 THR n 
2 106 VAL n 
2 107 LYS n 
2 108 VAL n 
2 109 VAL n 
2 110 GLY n 
2 111 ARG n 
2 112 ASN n 
2 113 THR n 
2 114 LEU n 
2 115 GLY n 
2 116 ASP n 
2 117 HIS n 
2 118 VAL n 
2 119 THR n 
2 120 ALA n 
2 121 THR n 
2 122 VAL n 
2 123 GLU n 
2 124 LEU n 
2 125 SER n 
2 126 MET n 
2 127 ARG n 
2 128 ASP n 
2 129 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 187 ? ? 'TBSG_03608, V459_03372' ? ? ? ? ? ? 'Mycobacterium tuberculosis KZN 4207' 478433 ? ? ? 
? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 129 ? ? TBCG_03470               ? ? ? ? ? ? 'Mycobacterium tuberculosis C'        348776 ? ? ? 
? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP I1SFB1_MYCTX I1SFB1 ? 1 
;MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVDDAAARAAGHPGIVAPPAMIQVWTMMGLGGV
RPKDDPLGPIIKLFDDAGYIGVVATNCEQTYHRYLLPGEQVSISAELGDVVGPKQTALGEGWFINQHIVWQVGDEDVAEM
NWRILKFKPAGSPSSVPDDLDPDAMMR
;
1 
2 UNP A2VPV3_MYCTX A2VPV3 ? 2 
;MTVVGAVLPELKLYGDPTFIVSTALATRDFQDVHHDRDKAVAQGSKDIFVNILTDTGLVQRYVTDWAGPSALIKSIGLRL
GVPWYAYDTVTFSGEVTAVNDGLITVKVVGRNTLGDHVTATVELSMRDS
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WNB A 1 ? 187 ? I1SFB1 1 ? 187 ? 1 187 
2 2 4WNB B 1 ? 129 ? A2VPV3 1 ? 129 ? 1 129 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4BN non-polymer         . '3-oxo-4-pregnene-20-carboxyl-Coenzyme A' ? 'C43 H66 N7 O18 P3 S' 1094.007 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'          89.093   
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'      175.209  
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'         132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'          133.103  
CA  non-polymer         . 'CALCIUM ION'                             ? 'Ca 2'                40.078   
CD  non-polymer         . 'CADMIUM ION'                             ? 'Cd 2'                112.411  
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'        121.158  
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'        146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'          147.129  
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'          75.067   
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'      156.162  
HOH non-polymer         . WATER                                     ? 'H2 O'                18.015   
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'         131.173  
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'         131.173  
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'      147.195  
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'       149.211  
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'         165.189  
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'          115.130  
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'          105.093  
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'          119.119  
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'       204.225  
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'         181.189  
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'         117.146  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WNB 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '20 mM CaCl2, 20 mM CdCl2, 20mM CoCl2, 20 mM NaCl, 25% PEG3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-06-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4WNB 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.76 
_reflns.d_resolution_low                 72.70 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       40369 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.0 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.76 
_reflns_shell.d_res_low                   1.80 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.605 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4WNB 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.76 
_refine.ls_d_res_low                             72.70 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     36445 
_refine.ls_number_reflns_R_free                  1824 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2176 
_refine.ls_R_factor_R_free                       0.2548 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2158 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.39 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  ? 2394 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.148  ? 3276 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.150 ? 870  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 377  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 413  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 1.7600 1.8076  . . 156 2551 100.00 . . . 0.3261 . 0.2932 . . . . . . . . 
'X-RAY DIFFRACTION' 1.8076 1.8608  . . 156 2579 100.00 . . . 0.3047 . 0.2753 . . . . . . . . 
'X-RAY DIFFRACTION' 1.8608 1.9209  . . 125 2599 100.00 . . . 0.3179 . 0.2650 . . . . . . . . 
'X-RAY DIFFRACTION' 1.9209 1.9895  . . 145 2590 100.00 . . . 0.2752 . 0.2621 . . . . . . . . 
'X-RAY DIFFRACTION' 1.9895 2.0692  . . 120 2598 100.00 . . . 0.2712 . 0.2520 . . . . . . . . 
'X-RAY DIFFRACTION' 2.0692 2.1634  . . 145 2620 100.00 . . . 0.2833 . 0.2385 . . . . . . . . 
'X-RAY DIFFRACTION' 2.1634 2.2774  . . 136 2592 100.00 . . . 0.2577 . 0.2353 . . . . . . . . 
'X-RAY DIFFRACTION' 2.2774 2.4201  . . 137 2639 100.00 . . . 0.2331 . 0.2236 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4201 2.6070  . . 143 2672 100.00 . . . 0.2766 . 0.2314 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6070 2.8694  . . 126 2690 100.00 . . . 0.3007 . 0.2212 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8694 3.2846  . . 167 2679 100.00 . . . 0.2670 . 0.2196 . . . . . . . . 
'X-RAY DIFFRACTION' 3.2846 4.1382  . . 131 2778 100.00 . . . 0.2126 . 0.1801 . . . . . . . . 
'X-RAY DIFFRACTION' 4.1382 72.7679 . . 137 3034 99.00  . . . 0.2161 . 0.1846 . . . . . . . . 
# 
_struct.entry_id                     4WNB 
_struct.title                        
'Crystal structure of the ChsH1-ChsH2 complex from Mycobacterium tuberculosis bound to 3-OPC-CoA' 
_struct.pdbx_descriptor              'Hydratase ChsH2, Hydratase ChsH1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4WNB 
_struct_keywords.text            LYASE 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 3 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 3  ? ALA A 17 ? GLY A 3  ALA A 17 1 ? 15 
HELX_P HELX_P2  AA2 ASN A 30 ? GLY A 42 ? ASN A 30 GLY A 42 1 ? 13 
HELX_P HELX_P3  AA3 ASN A 45 ? VAL A 49 ? ASN A 45 VAL A 49 5 ? 5  
HELX_P HELX_P4  AA4 ALA A 52 ? ALA A 57 ? ALA A 52 ALA A 57 1 ? 6  
HELX_P HELX_P5  AA5 PRO A 65 ? ALA A 67 ? PRO A 65 ALA A 67 5 ? 3  
HELX_P HELX_P6  AA6 MET A 68 ? THR A 73 ? MET A 68 THR A 73 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 86 ? ALA A 97 ? PRO A 86 ALA A 97 1 ? 12 
HELX_P HELX_P8  AA8 ASP B 16 ? THR B 27 ? ASP B 16 THR B 27 1 ? 12 
HELX_P HELX_P9  AA9 GLN B 31 ? HIS B 35 ? GLN B 31 HIS B 35 5 ? 5  
HELX_P HELX_P10 AB1 ASP B 36 ? GLN B 43 ? ASP B 36 GLN B 43 1 ? 8  
HELX_P HELX_P11 AB2 ASN B 51 ? GLY B 68 ? ASN B 51 GLY B 68 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 147 NE2 ? ? ? 1_555 C CD  . CD ? ? A HIS 147 A CD  201 1_555 ? ? ? ? ? ? ? 2.578 ? 
metalc2  metalc ? ? A ASP 156 OD2 ? ? ? 1_555 D CA  . CA ? ? A ASP 156 A CA  202 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc3  metalc ? ? A GLU 159 OE1 ? ? ? 1_555 C CD  . CD ? ? A GLU 159 A CD  201 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc4  metalc ? ? A GLU 159 OE2 ? ? ? 1_555 C CD  . CD ? ? A GLU 159 A CD  201 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc5  metalc ? ? B ASP 29  OD2 ? ? ? 1_555 F CD  . CD ? ? B ASP 29  B CD  201 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc6  metalc ? ? B GLN 31  NE2 ? ? ? 1_555 F CD  . CD ? ? B GLN 31  B CD  201 1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc7  metalc ? ? B HIS 34  NE2 ? ? ? 1_555 F CD  . CD ? ? B HIS 34  B CD  201 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc8  metalc ? ? F CD  .   CD  ? ? ? 1_555 H HOH . O  ? ? B CD  201 B HOH 329 1_555 ? ? ? ? ? ? ? 2.609 ? 
metalc9  metalc ? ? A ASP 6   OD2 ? ? ? 1_555 C CD  . CD ? ? A ASP 6   A CD  201 8_665 ? ? ? ? ? ? ? 2.565 ? 
metalc10 metalc ? ? A GLU 9   OE1 ? ? ? 1_555 D CA  . CA ? ? A GLU 9   A CA  202 8_665 ? ? ? ? ? ? ? 3.156 ? 
metalc11 metalc ? ? A GLU 9   OE2 ? ? ? 1_555 D CA  . CA ? ? A GLU 9   A CA  202 8_665 ? ? ? ? ? ? ? 2.221 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           132 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            132 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    133 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     133 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.01 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   10 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? anti-parallel 
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? anti-parallel 
AA1 8 9  ? anti-parallel 
AA1 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ARG A 23  ? LEU A 24  ? ARG A 23  LEU A 24  
AA1 2  VAL A 121 ? THR A 136 ? VAL A 121 THR A 136 
AA1 3  GLY A 139 ? VAL A 152 ? GLY A 139 VAL A 152 
AA1 4  GLU A 155 ? PHE A 167 ? GLU A 155 PHE A 167 
AA1 5  GLY A 101 ? TYR A 111 ? GLY A 101 TYR A 111 
AA1 6  LEU B 72  ? LEU B 80  ? LEU B 72  LEU B 80  
AA1 7  GLY B 115 ? SER B 125 ? GLY B 115 SER B 125 
AA1 8  LEU B 103 ? ASN B 112 ? LEU B 103 ASN B 112 
AA1 9  THR B 89  ? ASN B 100 ? THR B 89  ASN B 100 
AA1 10 LEU B 11  ? TYR B 14  ? LEU B 11  TYR B 14  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N ARG A 23  ? N ARG A 23  O ILE A 123 ? O ILE A 123 
AA1 2 3  N GLU A 126 ? N GLU A 126 O HIS A 147 ? O HIS A 147 
AA1 3 4  N ILE A 148 ? N ILE A 148 O MET A 160 ? O MET A 160 
AA1 4 5  O LEU A 165 ? O LEU A 165 N VAL A 103 ? N VAL A 103 
AA1 5 6  N CYS A 107 ? N CYS A 107 O LEU B 78  ? O LEU B 78  
AA1 6 7  N LYS B 74  ? N LYS B 74  O GLU B 123 ? O GLU B 123 
AA1 7 8  O ALA B 120 ? O ALA B 120 N VAL B 108 ? N VAL B 108 
AA1 8 9  O ARG B 111 ? O ARG B 111 N THR B 91  ? N THR B 91  
AA1 9 10 O PHE B 92  ? O PHE B 92  N LEU B 11  ? N LEU B 11  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CD  201 ? 4  'binding site for residue CD A 201'  
AC2 Software A CA  202 ? 4  'binding site for residue CA A 202'  
AC3 Software A 4BN 203 ? 15 'binding site for residue 4BN A 203' 
AC4 Software B CD  201 ? 5  'binding site for residue CD B 201'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASP A 6   ? ASP A 6   . ? 8_565 ? 
2  AC1 4  HIS A 147 ? HIS A 147 . ? 1_555 ? 
3  AC1 4  GLU A 159 ? GLU A 159 . ? 1_555 ? 
4  AC1 4  HOH G .   ? HOH A 337 . ? 1_555 ? 
5  AC2 4  GLU A 9   ? GLU A 9   . ? 8_565 ? 
6  AC2 4  HIS A 112 ? HIS A 112 . ? 1_555 ? 
7  AC2 4  ASP A 156 ? ASP A 156 . ? 1_555 ? 
8  AC2 4  GLU A 159 ? GLU A 159 . ? 1_555 ? 
9  AC3 15 VAL A 103 ? VAL A 103 . ? 1_555 ? 
10 AC3 15 ALA A 104 ? ALA A 104 . ? 1_555 ? 
11 AC3 15 ASN A 106 ? ASN A 106 . ? 1_555 ? 
12 AC3 15 LYS A 134 ? LYS A 134 . ? 1_555 ? 
13 AC3 15 THR A 136 ? THR A 136 . ? 1_555 ? 
14 AC3 15 ALA A 137 ? ALA A 137 . ? 1_555 ? 
15 AC3 15 PHE A 143 ? PHE A 143 . ? 1_555 ? 
16 AC3 15 ARG A 163 ? ARG A 163 . ? 1_555 ? 
17 AC3 15 HOH G .   ? HOH A 452 . ? 1_555 ? 
18 AC3 15 HOH G .   ? HOH A 457 . ? 1_555 ? 
19 AC3 15 HOH G .   ? HOH A 458 . ? 1_555 ? 
20 AC3 15 GLN B 31  ? GLN B 31  . ? 1_555 ? 
21 AC3 15 GLN B 43  ? GLN B 43  . ? 1_555 ? 
22 AC3 15 LEU B 80  ? LEU B 80  . ? 1_555 ? 
23 AC3 15 GLY B 81  ? GLY B 81  . ? 1_555 ? 
24 AC4 5  ASP B 29  ? ASP B 29  . ? 1_555 ? 
25 AC4 5  GLN B 31  ? GLN B 31  . ? 1_555 ? 
26 AC4 5  HIS B 34  ? HIS B 34  . ? 1_555 ? 
27 AC4 5  HOH H .   ? HOH B 329 . ? 1_555 ? 
28 AC4 5  HOH H .   ? HOH B 338 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4WNB 
_atom_sites.fract_transf_matrix[1][1]   0.019275 
_atom_sites.fract_transf_matrix[1][2]   0.011128 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022256 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002292 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CD 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 30.312  26.961  1.866   1.00 68.53  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 31.766  26.994  2.027   1.00 68.26  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 32.376  25.608  2.274   1.00 66.40  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 32.689  24.885  1.327   1.00 70.23  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 32.162  27.935  3.169   1.00 69.20  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 32.072  29.413  2.836   1.00 68.20  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 32.992  30.429  4.008   1.00 130.69 ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 32.594  32.072  3.414   1.00 67.72  ? 1   MET A CE    1 
ATOM   9    N  N     . THR A 1 2   ? 32.546  25.242  3.545   1.00 61.04  ? 2   THR A N     1 
ATOM   10   C  CA    . THR A 1 2   ? 33.300  24.035  3.889   1.00 57.66  ? 2   THR A CA    1 
ATOM   11   C  C     . THR A 1 2   ? 32.497  22.916  4.556   1.00 57.85  ? 2   THR A C     1 
ATOM   12   O  O     . THR A 1 2   ? 32.072  23.057  5.700   1.00 59.07  ? 2   THR A O     1 
ATOM   13   C  CB    . THR A 1 2   ? 34.469  24.358  4.846   1.00 53.06  ? 2   THR A CB    1 
ATOM   14   O  OG1   . THR A 1 2   ? 35.172  25.518  4.388   1.00 55.39  ? 2   THR A OG1   1 
ATOM   15   C  CG2   . THR A 1 2   ? 35.419  23.185  4.914   1.00 50.04  ? 2   THR A CG2   1 
ATOM   16   N  N     . GLY A 1 3   ? 32.329  21.797  3.849   1.00 49.12  ? 3   GLY A N     1 
ATOM   17   C  CA    . GLY A 1 3   ? 31.788  20.578  4.436   1.00 48.92  ? 3   GLY A CA    1 
ATOM   18   C  C     . GLY A 1 3   ? 30.296  20.298  4.294   1.00 48.91  ? 3   GLY A C     1 
ATOM   19   O  O     . GLY A 1 3   ? 29.538  21.120  3.788   1.00 44.98  ? 3   GLY A O     1 
ATOM   20   N  N     . VAL A 1 4   ? 29.887  19.129  4.785   1.00 52.36  ? 4   VAL A N     1 
ATOM   21   C  CA    . VAL A 1 4   ? 28.519  18.623  4.668   1.00 46.35  ? 4   VAL A CA    1 
ATOM   22   C  C     . VAL A 1 4   ? 27.441  19.454  5.371   1.00 47.81  ? 4   VAL A C     1 
ATOM   23   O  O     . VAL A 1 4   ? 26.393  19.745  4.780   1.00 41.07  ? 4   VAL A O     1 
ATOM   24   C  CB    . VAL A 1 4   ? 28.437  17.179  5.213   1.00 46.97  ? 4   VAL A CB    1 
ATOM   25   C  CG1   . VAL A 1 4   ? 26.986  16.716  5.317   1.00 43.61  ? 4   VAL A CG1   1 
ATOM   26   C  CG2   . VAL A 1 4   ? 29.239  16.240  4.323   1.00 47.23  ? 4   VAL A CG2   1 
ATOM   27   N  N     . SER A 1 5   ? 27.669  19.818  6.632   1.00 45.91  ? 5   SER A N     1 
ATOM   28   C  CA    . SER A 1 5   ? 26.679  20.628  7.335   1.00 45.76  ? 5   SER A CA    1 
ATOM   29   C  C     . SER A 1 5   ? 26.550  21.976  6.626   1.00 48.02  ? 5   SER A C     1 
ATOM   30   O  O     . SER A 1 5   ? 25.475  22.578  6.611   1.00 45.87  ? 5   SER A O     1 
ATOM   31   C  CB    . SER A 1 5   ? 27.039  20.808  8.822   1.00 46.36  ? 5   SER A CB    1 
ATOM   32   O  OG    . SER A 1 5   ? 28.236  21.542  8.996   1.00 49.04  ? 5   SER A OG    1 
ATOM   33   N  N     . ASP A 1 6   ? 27.643  22.427  6.011   1.00 42.63  ? 6   ASP A N     1 
ATOM   34   C  CA    . ASP A 1 6   ? 27.629  23.663  5.229   1.00 42.05  ? 6   ASP A CA    1 
ATOM   35   C  C     . ASP A 1 6   ? 26.926  23.477  3.885   1.00 39.69  ? 6   ASP A C     1 
ATOM   36   O  O     . ASP A 1 6   ? 26.288  24.404  3.388   1.00 42.91  ? 6   ASP A O     1 
ATOM   37   C  CB    . ASP A 1 6   ? 29.052  24.174  4.996   1.00 43.39  ? 6   ASP A CB    1 
ATOM   38   C  CG    . ASP A 1 6   ? 29.529  25.127  6.082   1.00 47.24  ? 6   ASP A CG    1 
ATOM   39   O  OD1   . ASP A 1 6   ? 28.973  25.133  7.221   1.00 45.24  ? 6   ASP A OD1   1 
ATOM   40   O  OD2   . ASP A 1 6   ? 30.491  25.874  5.780   1.00 42.50  ? 6   ASP A OD2   1 
ATOM   41   N  N     . ILE A 1 7   ? 27.045  22.288  3.292   1.00 38.44  ? 7   ILE A N     1 
ATOM   42   C  CA    . ILE A 1 7   ? 26.336  22.011  2.038   1.00 37.59  ? 7   ILE A CA    1 
ATOM   43   C  C     . ILE A 1 7   ? 24.830  21.999  2.314   1.00 41.48  ? 7   ILE A C     1 
ATOM   44   O  O     . ILE A 1 7   ? 24.059  22.605  1.574   1.00 34.21  ? 7   ILE A O     1 
ATOM   45   C  CB    . ILE A 1 7   ? 26.774  20.671  1.394   1.00 37.86  ? 7   ILE A CB    1 
ATOM   46   C  CG1   . ILE A 1 7   ? 28.202  20.784  0.847   1.00 44.11  ? 7   ILE A CG1   1 
ATOM   47   C  CG2   . ILE A 1 7   ? 25.821  20.265  0.278   1.00 33.93  ? 7   ILE A CG2   1 
ATOM   48   C  CD1   . ILE A 1 7   ? 28.863  19.449  0.574   1.00 43.95  ? 7   ILE A CD1   1 
ATOM   49   N  N     . GLN A 1 8   ? 24.423  21.341  3.402   1.00 36.53  ? 8   GLN A N     1 
ATOM   50   C  CA    . GLN A 1 8   ? 23.013  21.330  3.787   1.00 37.38  ? 8   GLN A CA    1 
ATOM   51   C  C     . GLN A 1 8   ? 22.489  22.752  3.975   1.00 36.36  ? 8   GLN A C     1 
ATOM   52   O  O     . GLN A 1 8   ? 21.390  23.064  3.537   1.00 35.68  ? 8   GLN A O     1 
ATOM   53   C  CB    . GLN A 1 8   ? 22.805  20.512  5.064   1.00 41.87  ? 8   GLN A CB    1 
ATOM   54   C  CG    . GLN A 1 8   ? 22.986  19.015  4.862   1.00 47.26  ? 8   GLN A CG    1 
ATOM   55   C  CD    . GLN A 1 8   ? 23.003  18.243  6.166   1.00 54.69  ? 8   GLN A CD    1 
ATOM   56   O  OE1   . GLN A 1 8   ? 22.345  18.623  7.137   1.00 57.92  ? 8   GLN A OE1   1 
ATOM   57   N  NE2   . GLN A 1 8   ? 23.773  17.158  6.202   1.00 55.46  ? 8   GLN A NE2   1 
ATOM   58   N  N     . GLU A 1 9   ? 23.284  23.605  4.623   1.00 37.25  ? 9   GLU A N     1 
ATOM   59   C  CA    . GLU A 1 9   ? 22.910  25.001  4.849   1.00 37.50  ? 9   GLU A CA    1 
ATOM   60   C  C     . GLU A 1 9   ? 22.785  25.797  3.553   1.00 36.11  ? 9   GLU A C     1 
ATOM   61   O  O     . GLU A 1 9   ? 21.887  26.639  3.405   1.00 35.92  ? 9   GLU A O     1 
ATOM   62   C  CB    . GLU A 1 9   ? 23.926  25.673  5.785   1.00 38.91  ? 9   GLU A CB    1 
ATOM   63   C  CG    . GLU A 1 9   ? 23.575  25.480  7.258   1.00 40.60  ? 9   GLU A CG    1 
ATOM   64   C  CD    . GLU A 1 9   ? 24.756  25.621  8.216   1.00 47.29  ? 9   GLU A CD    1 
ATOM   65   O  OE1   . GLU A 1 9   ? 25.709  26.371  7.919   1.00 45.05  ? 9   GLU A OE1   1 
ATOM   66   O  OE2   . GLU A 1 9   ? 24.708  24.970  9.280   1.00 43.42  ? 9   GLU A OE2   1 
ATOM   67   N  N     . ALA A 1 10  ? 23.671  25.512  2.605   1.00 35.30  ? 10  ALA A N     1 
ATOM   68   C  CA    . ALA A 1 10  ? 23.671  26.195  1.316   1.00 35.83  ? 10  ALA A CA    1 
ATOM   69   C  C     . ALA A 1 10  ? 22.461  25.777  0.489   1.00 32.88  ? 10  ALA A C     1 
ATOM   70   O  O     . ALA A 1 10  ? 21.816  26.613  -0.165  1.00 33.03  ? 10  ALA A O     1 
ATOM   71   C  CB    . ALA A 1 10  ? 24.968  25.903  0.558   1.00 33.83  ? 10  ALA A CB    1 
ATOM   72   N  N     . VAL A 1 11  ? 22.152  24.483  0.524   1.00 32.66  ? 11  VAL A N     1 
ATOM   73   C  CA    . VAL A 1 11  ? 20.947  23.979  -0.134  1.00 32.30  ? 11  VAL A CA    1 
ATOM   74   C  C     . VAL A 1 11  ? 19.718  24.693  0.427   1.00 32.21  ? 11  VAL A C     1 
ATOM   75   O  O     . VAL A 1 11  ? 18.864  25.143  -0.323  1.00 31.45  ? 11  VAL A O     1 
ATOM   76   C  CB    . VAL A 1 11  ? 20.785  22.452  0.042   1.00 31.89  ? 11  VAL A CB    1 
ATOM   77   C  CG1   . VAL A 1 11  ? 19.398  22.008  -0.400  1.00 34.89  ? 11  VAL A CG1   1 
ATOM   78   C  CG2   . VAL A 1 11  ? 21.863  21.710  -0.733  1.00 31.96  ? 11  VAL A CG2   1 
ATOM   79   N  N     . ALA A 1 12  ? 19.656  24.822  1.748   1.00 33.60  ? 12  ALA A N     1 
ATOM   80   C  CA    . ALA A 1 12  ? 18.533  25.488  2.398   1.00 34.39  ? 12  ALA A CA    1 
ATOM   81   C  C     . ALA A 1 12  ? 18.459  26.950  1.972   1.00 35.23  ? 12  ALA A C     1 
ATOM   82   O  O     . ALA A 1 12  ? 17.370  27.490  1.776   1.00 34.16  ? 12  ALA A O     1 
ATOM   83   C  CB    . ALA A 1 12  ? 18.639  25.375  3.918   1.00 36.14  ? 12  ALA A CB    1 
ATOM   84   N  N     . GLN A 1 13  ? 19.620  27.577  1.801   1.00 35.28  ? 13  GLN A N     1 
ATOM   85   C  CA    . GLN A 1 13  ? 19.683  28.974  1.370   1.00 36.07  ? 13  GLN A CA    1 
ATOM   86   C  C     . GLN A 1 13  ? 19.128  29.132  -0.053  1.00 38.08  ? 13  GLN A C     1 
ATOM   87   O  O     . GLN A 1 13  ? 18.352  30.056  -0.322  1.00 34.17  ? 13  GLN A O     1 
ATOM   88   C  CB    . GLN A 1 13  ? 21.122  29.500  1.455   1.00 42.64  ? 13  GLN A CB    1 
ATOM   89   C  CG    . GLN A 1 13  ? 21.233  31.015  1.568   1.00 44.38  ? 13  GLN A CG    1 
ATOM   90   N  N     . ILE A 1 14  ? 19.502  28.222  -0.952  1.00 31.57  ? 14  ILE A N     1 
ATOM   91   C  CA    . ILE A 1 14  ? 18.969  28.236  -2.322  1.00 34.27  ? 14  ILE A CA    1 
ATOM   92   C  C     . ILE A 1 14  ? 17.450  28.048  -2.330  1.00 30.15  ? 14  ILE A C     1 
ATOM   93   O  O     . ILE A 1 14  ? 16.721  28.761  -3.029  1.00 32.34  ? 14  ILE A O     1 
ATOM   94   C  CB    . ILE A 1 14  ? 19.634  27.145  -3.199  1.00 33.41  ? 14  ILE A CB    1 
ATOM   95   C  CG1   . ILE A 1 14  ? 21.113  27.472  -3.405  1.00 37.59  ? 14  ILE A CG1   1 
ATOM   96   C  CG2   . ILE A 1 14  ? 18.919  26.998  -4.558  1.00 28.01  ? 14  ILE A CG2   1 
ATOM   97   C  CD1   . ILE A 1 14  ? 21.941  26.288  -3.836  1.00 35.77  ? 14  ILE A CD1   1 
ATOM   98   N  N     . LYS A 1 15  ? 16.965  27.098  -1.542  1.00 30.65  ? 15  LYS A N     1 
ATOM   99   C  CA    . LYS A 1 15  ? 15.533  26.845  -1.484  1.00 30.82  ? 15  LYS A CA    1 
ATOM   100  C  C     . LYS A 1 15  ? 14.759  28.055  -0.971  1.00 36.83  ? 15  LYS A C     1 
ATOM   101  O  O     . LYS A 1 15  ? 13.635  28.308  -1.404  1.00 35.45  ? 15  LYS A O     1 
ATOM   102  C  CB    . LYS A 1 15  ? 15.239  25.639  -0.600  1.00 34.22  ? 15  LYS A CB    1 
ATOM   103  C  CG    . LYS A 1 15  ? 15.509  24.306  -1.261  1.00 35.25  ? 15  LYS A CG    1 
ATOM   104  C  CD    . LYS A 1 15  ? 15.034  23.181  -0.358  1.00 34.50  ? 15  LYS A CD    1 
ATOM   105  C  CE    . LYS A 1 15  ? 15.526  21.851  -0.872  1.00 40.27  ? 15  LYS A CE    1 
ATOM   106  N  NZ    . LYS A 1 15  ? 15.304  20.712  0.064   1.00 40.00  ? 15  LYS A NZ    1 
ATOM   107  N  N     . ALA A 1 16  ? 15.366  28.792  -0.041  1.00 39.30  ? 16  ALA A N     1 
ATOM   108  C  CA    . ALA A 1 16  ? 14.710  29.941  0.578   1.00 35.89  ? 16  ALA A CA    1 
ATOM   109  C  C     . ALA A 1 16  ? 14.430  31.040  -0.442  1.00 35.35  ? 16  ALA A C     1 
ATOM   110  O  O     . ALA A 1 16  ? 13.512  31.844  -0.257  1.00 37.54  ? 16  ALA A O     1 
ATOM   111  C  CB    . ALA A 1 16  ? 15.558  30.487  1.746   1.00 35.87  ? 16  ALA A CB    1 
ATOM   112  N  N     . ALA A 1 17  ? 15.197  31.059  -1.531  1.00 37.32  ? 17  ALA A N     1 
ATOM   113  C  CA    . ALA A 1 17  ? 14.990  32.047  -2.590  1.00 42.20  ? 17  ALA A CA    1 
ATOM   114  C  C     . ALA A 1 17  ? 13.690  31.788  -3.349  1.00 44.05  ? 17  ALA A C     1 
ATOM   115  O  O     . ALA A 1 17  ? 13.128  32.687  -3.974  1.00 44.91  ? 17  ALA A O     1 
ATOM   116  C  CB    . ALA A 1 17  ? 16.162  32.054  -3.544  1.00 38.18  ? 17  ALA A CB    1 
ATOM   117  N  N     . GLY A 1 18  ? 13.206  30.554  -3.285  1.00 39.79  ? 18  GLY A N     1 
ATOM   118  C  CA    . GLY A 1 18  ? 11.939  30.222  -3.897  1.00 32.59  ? 18  GLY A CA    1 
ATOM   119  C  C     . GLY A 1 18  ? 12.111  29.833  -5.354  1.00 30.50  ? 18  GLY A C     1 
ATOM   120  O  O     . GLY A 1 18  ? 13.221  29.875  -5.900  1.00 30.55  ? 18  GLY A O     1 
ATOM   121  N  N     . PRO A 1 19  ? 11.004  29.455  -5.996  1.00 31.70  ? 19  PRO A N     1 
ATOM   122  C  CA    . PRO A 1 19  ? 11.043  29.009  -7.394  1.00 32.25  ? 19  PRO A CA    1 
ATOM   123  C  C     . PRO A 1 19  ? 11.429  30.123  -8.367  1.00 29.48  ? 19  PRO A C     1 
ATOM   124  O  O     . PRO A 1 19  ? 11.192  31.306  -8.103  1.00 34.58  ? 19  PRO A O     1 
ATOM   125  C  CB    . PRO A 1 19  ? 9.609   28.539  -7.652  1.00 32.92  ? 19  PRO A CB    1 
ATOM   126  C  CG    . PRO A 1 19  ? 8.777   29.298  -6.668  1.00 35.32  ? 19  PRO A CG    1 
ATOM   127  C  CD    . PRO A 1 19  ? 9.637   29.464  -5.445  1.00 31.52  ? 19  PRO A CD    1 
ATOM   128  N  N     . SER A 1 20  ? 12.018  29.735  -9.489  1.00 27.15  ? 20  SER A N     1 
ATOM   129  C  CA    . SER A 1 20  ? 12.339  30.682  -10.546 1.00 32.91  ? 20  SER A CA    1 
ATOM   130  C  C     . SER A 1 20  ? 11.059  31.384  -11.020 1.00 33.26  ? 20  SER A C     1 
ATOM   131  O  O     . SER A 1 20  ? 9.957   30.815  -10.945 1.00 30.58  ? 20  SER A O     1 
ATOM   132  C  CB    . SER A 1 20  ? 13.030  29.964  -11.704 1.00 31.42  ? 20  SER A CB    1 
ATOM   133  O  OG    . SER A 1 20  ? 12.111  29.102  -12.357 1.00 30.02  ? 20  SER A OG    1 
ATOM   134  N  N     . LYS A 1 21  ? 11.181  32.625  -11.483 1.00 33.23  ? 21  LYS A N     1 
ATOM   135  C  CA    . LYS A 1 21  ? 9.997   33.332  -11.976 1.00 36.69  ? 21  LYS A CA    1 
ATOM   136  C  C     . LYS A 1 21  ? 9.651   32.734  -13.328 1.00 30.78  ? 21  LYS A C     1 
ATOM   137  O  O     . LYS A 1 21  ? 10.560  32.368  -14.075 1.00 32.79  ? 21  LYS A O     1 
ATOM   138  C  CB    . LYS A 1 21  ? 10.233  34.840  -12.074 1.00 47.80  ? 21  LYS A CB    1 
ATOM   139  C  CG    . LYS A 1 21  ? 11.231  35.274  -13.131 1.00 55.58  ? 21  LYS A CG    1 
ATOM   140  C  CD    . LYS A 1 21  ? 11.591  36.754  -12.988 1.00 62.25  ? 21  LYS A CD    1 
ATOM   141  C  CE    . LYS A 1 21  ? 12.272  37.035  -11.644 1.00 66.45  ? 21  LYS A CE    1 
ATOM   142  N  NZ    . LYS A 1 21  ? 12.771  38.441  -11.505 1.00 68.54  ? 21  LYS A NZ    1 
ATOM   143  N  N     . PRO A 1 22  ? 8.348   32.588  -13.619 1.00 33.44  ? 22  PRO A N     1 
ATOM   144  C  CA    . PRO A 1 22  ? 7.905   31.896  -14.838 1.00 31.92  ? 22  PRO A CA    1 
ATOM   145  C  C     . PRO A 1 22  ? 8.582   32.443  -16.074 1.00 29.95  ? 22  PRO A C     1 
ATOM   146  O  O     . PRO A 1 22  ? 8.670   33.653  -16.262 1.00 36.27  ? 22  PRO A O     1 
ATOM   147  C  CB    . PRO A 1 22  ? 6.400   32.154  -14.862 1.00 31.66  ? 22  PRO A CB    1 
ATOM   148  C  CG    . PRO A 1 22  ? 6.045   32.268  -13.407 1.00 37.30  ? 22  PRO A CG    1 
ATOM   149  C  CD    . PRO A 1 22  ? 7.213   32.987  -12.773 1.00 35.42  ? 22  PRO A CD    1 
ATOM   150  N  N     . ARG A 1 23  ? 9.096   31.533  -16.894 1.00 25.61  ? 23  ARG A N     1 
ATOM   151  C  CA    . ARG A 1 23  ? 9.758   31.908  -18.122 1.00 30.75  ? 23  ARG A CA    1 
ATOM   152  C  C     . ARG A 1 23  ? 8.903   31.409  -19.282 1.00 29.50  ? 23  ARG A C     1 
ATOM   153  O  O     . ARG A 1 23  ? 8.564   30.231  -19.336 1.00 30.99  ? 23  ARG A O     1 
ATOM   154  C  CB    . ARG A 1 23  ? 11.167  31.318  -18.157 1.00 31.85  ? 23  ARG A CB    1 
ATOM   155  C  CG    . ARG A 1 23  ? 11.869  31.461  -19.489 1.00 28.45  ? 23  ARG A CG    1 
ATOM   156  C  CD    . ARG A 1 23  ? 13.321  31.038  -19.381 1.00 34.68  ? 23  ARG A CD    1 
ATOM   157  N  NE    . ARG A 1 23  ? 13.515  29.646  -18.965 1.00 34.93  ? 23  ARG A NE    1 
ATOM   158  C  CZ    . ARG A 1 23  ? 13.432  28.601  -19.790 1.00 39.46  ? 23  ARG A CZ    1 
ATOM   159  N  NH1   . ARG A 1 23  ? 13.118  28.783  -21.063 1.00 38.31  ? 23  ARG A NH1   1 
ATOM   160  N  NH2   . ARG A 1 23  ? 13.640  27.371  -19.340 1.00 38.23  ? 23  ARG A NH2   1 
ATOM   161  N  N     . LEU A 1 24  ? 8.538   32.311  -20.191 1.00 27.05  ? 24  LEU A N     1 
ATOM   162  C  CA    A LEU A 1 24  ? 7.693   31.950  -21.330 0.49 26.22  ? 24  LEU A CA    1 
ATOM   163  C  CA    B LEU A 1 24  ? 7.695   31.963  -21.334 0.51 26.10  ? 24  LEU A CA    1 
ATOM   164  C  C     . LEU A 1 24  ? 8.436   31.182  -22.418 1.00 22.62  ? 24  LEU A C     1 
ATOM   165  O  O     . LEU A 1 24  ? 9.579   31.492  -22.750 1.00 25.84  ? 24  LEU A O     1 
ATOM   166  C  CB    A LEU A 1 24  ? 7.064   33.203  -21.939 0.49 29.51  ? 24  LEU A CB    1 
ATOM   167  C  CB    B LEU A 1 24  ? 7.091   33.228  -21.950 0.51 29.32  ? 24  LEU A CB    1 
ATOM   168  C  CG    A LEU A 1 24  ? 5.796   33.707  -21.249 0.49 33.85  ? 24  LEU A CG    1 
ATOM   169  C  CG    B LEU A 1 24  ? 5.852   33.832  -21.281 0.51 34.29  ? 24  LEU A CG    1 
ATOM   170  C  CD1   A LEU A 1 24  ? 5.434   35.088  -21.763 0.49 35.96  ? 24  LEU A CD1   1 
ATOM   171  C  CD1   B LEU A 1 24  ? 6.196   34.592  -20.003 0.51 38.64  ? 24  LEU A CD1   1 
ATOM   172  C  CD2   A LEU A 1 24  ? 4.644   32.731  -21.467 0.49 35.14  ? 24  LEU A CD2   1 
ATOM   173  C  CD2   B LEU A 1 24  ? 5.107   34.725  -22.267 0.51 37.45  ? 24  LEU A CD2   1 
ATOM   174  N  N     . ALA A 1 25  ? 7.768   30.174  -22.969 1.00 21.42  ? 25  ALA A N     1 
ATOM   175  C  CA    . ALA A 1 25  ? 8.278   29.419  -24.116 1.00 21.08  ? 25  ALA A CA    1 
ATOM   176  C  C     . ALA A 1 25  ? 8.519   30.352  -25.304 1.00 21.12  ? 25  ALA A C     1 
ATOM   177  O  O     . ALA A 1 25  ? 7.788   31.336  -25.476 1.00 21.85  ? 25  ALA A O     1 
ATOM   178  C  CB    . ALA A 1 25  ? 7.293   28.328  -24.498 1.00 25.17  ? 25  ALA A CB    1 
ATOM   179  N  N     . ARG A 1 26  ? 9.534   30.062  -26.114 1.00 20.88  ? 26  ARG A N     1 
ATOM   180  C  CA    . ARG A 1 26  ? 9.823   30.888  -27.294 1.00 22.11  ? 26  ARG A CA    1 
ATOM   181  C  C     . ARG A 1 26  ? 8.588   31.060  -28.174 1.00 25.42  ? 26  ARG A C     1 
ATOM   182  O  O     . ARG A 1 26  ? 8.289   32.162  -28.627 1.00 27.59  ? 26  ARG A O     1 
ATOM   183  C  CB    . ARG A 1 26  ? 10.945  30.289  -28.149 1.00 22.96  ? 26  ARG A CB    1 
ATOM   184  C  CG    . ARG A 1 26  ? 11.523  31.277  -29.172 1.00 25.73  ? 26  ARG A CG    1 
ATOM   185  C  CD    . ARG A 1 26  ? 12.492  30.585  -30.108 1.00 22.73  ? 26  ARG A CD    1 
ATOM   186  N  NE    . ARG A 1 26  ? 11.796  29.519  -30.818 1.00 22.54  ? 26  ARG A NE    1 
ATOM   187  C  CZ    . ARG A 1 26  ? 12.361  28.708  -31.706 1.00 21.25  ? 26  ARG A CZ    1 
ATOM   188  N  NH1   . ARG A 1 26  ? 13.650  28.824  -31.997 1.00 21.70  ? 26  ARG A NH1   1 
ATOM   189  N  NH2   . ARG A 1 26  ? 11.626  27.775  -32.292 1.00 21.14  ? 26  ARG A NH2   1 
ATOM   190  N  N     . ASP A 1 27  ? 7.893   29.955  -28.414 1.00 22.04  ? 27  ASP A N     1 
ATOM   191  C  CA    . ASP A 1 27  ? 6.695   29.931  -29.244 1.00 26.79  ? 27  ASP A CA    1 
ATOM   192  C  C     . ASP A 1 27  ? 5.543   29.322  -28.487 1.00 28.01  ? 27  ASP A C     1 
ATOM   193  O  O     . ASP A 1 27  ? 5.760   28.514  -27.586 1.00 23.69  ? 27  ASP A O     1 
ATOM   194  C  CB    . ASP A 1 27  ? 6.898   29.103  -30.518 1.00 23.72  ? 27  ASP A CB    1 
ATOM   195  C  CG    . ASP A 1 27  ? 8.293   29.191  -31.056 1.00 30.45  ? 27  ASP A CG    1 
ATOM   196  O  OD1   . ASP A 1 27  ? 8.608   30.170  -31.764 1.00 27.13  ? 27  ASP A OD1   1 
ATOM   197  O  OD2   . ASP A 1 27  ? 9.070   28.263  -30.769 1.00 36.80  ? 27  ASP A OD2   1 
ATOM   198  N  N     . PRO A 1 28  ? 4.307   29.662  -28.897 1.00 24.96  ? 28  PRO A N     1 
ATOM   199  C  CA    . PRO A 1 28  ? 3.151   28.854  -28.504 1.00 22.42  ? 28  PRO A CA    1 
ATOM   200  C  C     . PRO A 1 28  ? 3.268   27.436  -29.023 1.00 21.50  ? 28  PRO A C     1 
ATOM   201  O  O     . PRO A 1 28  ? 4.068   27.171  -29.943 1.00 23.54  ? 28  PRO A O     1 
ATOM   202  C  CB    . PRO A 1 28  ? 1.956   29.565  -29.175 1.00 31.84  ? 28  PRO A CB    1 
ATOM   203  C  CG    . PRO A 1 28  ? 2.466   30.872  -29.624 1.00 29.84  ? 28  PRO A CG    1 
ATOM   204  C  CD    . PRO A 1 28  ? 3.942   30.759  -29.808 1.00 29.71  ? 28  PRO A CD    1 
ATOM   205  N  N     . VAL A 1 29  ? 2.489   26.534  -28.441 1.00 21.60  ? 29  VAL A N     1 
ATOM   206  C  CA    . VAL A 1 29  ? 2.333   25.204  -28.990 1.00 21.32  ? 29  VAL A CA    1 
ATOM   207  C  C     . VAL A 1 29  ? 1.975   25.413  -30.449 1.00 21.59  ? 29  VAL A C     1 
ATOM   208  O  O     . VAL A 1 29  ? 1.100   26.218  -30.765 1.00 22.33  ? 29  VAL A O     1 
ATOM   209  C  CB    . VAL A 1 29  ? 1.257   24.390  -28.249 1.00 21.82  ? 29  VAL A CB    1 
ATOM   210  C  CG1   . VAL A 1 29  ? 1.022   23.050  -28.929 1.00 21.77  ? 29  VAL A CG1   1 
ATOM   211  C  CG2   . VAL A 1 29  ? 1.664   24.193  -26.771 1.00 23.56  ? 29  VAL A CG2   1 
ATOM   212  N  N     . ASN A 1 30  ? 2.699   24.772  -31.349 1.00 21.14  ? 30  ASN A N     1 
ATOM   213  C  CA    . ASN A 1 30  ? 2.473   25.061  -32.758 1.00 23.09  ? 30  ASN A CA    1 
ATOM   214  C  C     . ASN A 1 30  ? 2.643   23.832  -33.657 1.00 22.16  ? 30  ASN A C     1 
ATOM   215  O  O     . ASN A 1 30  ? 3.403   22.906  -33.358 1.00 20.83  ? 30  ASN A O     1 
ATOM   216  C  CB    . ASN A 1 30  ? 3.393   26.204  -33.216 1.00 21.50  ? 30  ASN A CB    1 
ATOM   217  C  CG    . ASN A 1 30  ? 4.887   25.803  -33.233 1.00 20.86  ? 30  ASN A CG    1 
ATOM   218  O  OD1   . ASN A 1 30  ? 5.367   25.219  -34.209 1.00 20.82  ? 30  ASN A OD1   1 
ATOM   219  N  ND2   . ASN A 1 30  ? 5.618   26.142  -32.161 1.00 20.53  ? 30  ASN A ND2   1 
ATOM   220  N  N     . GLN A 1 31  ? 1.907   23.824  -34.767 1.00 23.49  ? 31  GLN A N     1 
ATOM   221  C  CA    . GLN A 1 31  ? 1.874   22.637  -35.612 1.00 23.58  ? 31  GLN A CA    1 
ATOM   222  C  C     . GLN A 1 31  ? 3.196   22.328  -36.314 1.00 22.67  ? 31  GLN A C     1 
ATOM   223  O  O     . GLN A 1 31  ? 3.534   21.146  -36.462 1.00 22.38  ? 31  GLN A O     1 
ATOM   224  C  CB    . GLN A 1 31  ? 0.782   22.748  -36.689 1.00 24.67  ? 31  GLN A CB    1 
ATOM   225  C  CG    . GLN A 1 31  ? 0.532   21.420  -37.362 1.00 24.93  ? 31  GLN A CG    1 
ATOM   226  C  CD    . GLN A 1 31  ? -0.051  20.419  -36.398 1.00 25.38  ? 31  GLN A CD    1 
ATOM   227  O  OE1   . GLN A 1 31  ? -0.947  20.759  -35.623 1.00 28.19  ? 31  GLN A OE1   1 
ATOM   228  N  NE2   . GLN A 1 31  ? 0.440   19.181  -36.431 1.00 24.94  ? 31  GLN A NE2   1 
ATOM   229  N  N     . PRO A 1 32  ? 3.916   23.365  -36.794 1.00 22.31  ? 32  PRO A N     1 
ATOM   230  C  CA    . PRO A 1 32  ? 5.195   23.019  -37.432 1.00 21.48  ? 32  PRO A CA    1 
ATOM   231  C  C     . PRO A 1 32  ? 6.188   22.287  -36.526 1.00 20.53  ? 32  PRO A C     1 
ATOM   232  O  O     . PRO A 1 32  ? 6.871   21.360  -36.983 1.00 20.09  ? 32  PRO A O     1 
ATOM   233  C  CB    . PRO A 1 32  ? 5.755   24.382  -37.824 1.00 21.38  ? 32  PRO A CB    1 
ATOM   234  C  CG    . PRO A 1 32  ? 4.509   25.178  -38.183 1.00 22.45  ? 32  PRO A CG    1 
ATOM   235  C  CD    . PRO A 1 32  ? 3.544   24.767  -37.088 1.00 23.24  ? 32  PRO A CD    1 
ATOM   236  N  N     . MET A 1 33  ? 6.277   22.688  -35.272 1.00 20.26  ? 33  MET A N     1 
ATOM   237  C  CA    . MET A 1 33  ? 7.196   21.980  -34.378 1.00 20.11  ? 33  MET A CA    1 
ATOM   238  C  C     . MET A 1 33  ? 6.631   20.625  -33.954 1.00 19.74  ? 33  MET A C     1 
ATOM   239  O  O     . MET A 1 33  ? 7.388   19.677  -33.737 1.00 19.21  ? 33  MET A O     1 
ATOM   240  C  CB    . MET A 1 33  ? 7.541   22.840  -33.158 1.00 19.08  ? 33  MET A CB    1 
ATOM   241  C  CG    . MET A 1 33  ? 8.468   23.983  -33.518 1.00 24.67  ? 33  MET A CG    1 
ATOM   242  S  SD    . MET A 1 33  ? 8.762   25.059  -32.117 1.00 29.92  ? 33  MET A SD    1 
ATOM   243  C  CE    . MET A 1 33  ? 9.071   23.845  -30.821 1.00 33.38  ? 33  MET A CE    1 
ATOM   244  N  N     . ILE A 1 34  ? 5.309   20.521  -33.822 1.00 20.65  ? 34  ILE A N     1 
ATOM   245  C  CA    . ILE A 1 34  ? 4.723   19.203  -33.654 1.00 21.10  ? 34  ILE A CA    1 
ATOM   246  C  C     . ILE A 1 34  ? 5.091   18.299  -34.838 1.00 21.02  ? 34  ILE A C     1 
ATOM   247  O  O     . ILE A 1 34  ? 5.485   17.142  -34.652 1.00 20.82  ? 34  ILE A O     1 
ATOM   248  C  CB    . ILE A 1 34  ? 3.194   19.240  -33.541 1.00 22.24  ? 34  ILE A CB    1 
ATOM   249  C  CG1   . ILE A 1 34  ? 2.760   19.895  -32.233 1.00 22.41  ? 34  ILE A CG1   1 
ATOM   250  C  CG2   . ILE A 1 34  ? 2.651   17.829  -33.585 1.00 22.77  ? 34  ILE A CG2   1 
ATOM   251  C  CD1   . ILE A 1 34  ? 1.229   20.116  -32.139 1.00 23.61  ? 34  ILE A CD1   1 
ATOM   252  N  N     . ASN A 1 35  ? 4.962   18.832  -36.055 1.00 21.26  ? 35  ASN A N     1 
ATOM   253  C  CA    . ASN A 1 35  ? 5.305   18.054  -37.236 1.00 21.24  ? 35  ASN A CA    1 
ATOM   254  C  C     . ASN A 1 35  ? 6.774   17.579  -37.226 1.00 20.23  ? 35  ASN A C     1 
ATOM   255  O  O     . ASN A 1 35  ? 7.056   16.423  -37.552 1.00 20.18  ? 35  ASN A O     1 
ATOM   256  C  CB    . ASN A 1 35  ? 5.028   18.853  -38.519 1.00 21.66  ? 35  ASN A CB    1 
ATOM   257  C  CG    . ASN A 1 35  ? 3.549   19.026  -38.788 1.00 25.45  ? 35  ASN A CG    1 
ATOM   258  O  OD1   . ASN A 1 35  ? 2.716   18.268  -38.265 1.00 23.37  ? 35  ASN A OD1   1 
ATOM   259  N  ND2   . ASN A 1 35  ? 3.206   20.017  -39.612 1.00 23.28  ? 35  ASN A ND2   1 
ATOM   260  N  N     . ASN A 1 36  ? 7.699   18.472  -36.878 1.00 19.49  ? 36  ASN A N     1 
ATOM   261  C  CA    . ASN A 1 36  ? 9.117   18.094  -36.805 1.00 18.56  ? 36  ASN A CA    1 
ATOM   262  C  C     . ASN A 1 36  ? 9.320   16.959  -35.819 1.00 18.36  ? 36  ASN A C     1 
ATOM   263  O  O     . ASN A 1 36  ? 10.098  16.043  -36.063 1.00 17.99  ? 36  ASN A O     1 
ATOM   264  C  CB    . ASN A 1 36  ? 10.003  19.285  -36.394 1.00 17.90  ? 36  ASN A CB    1 
ATOM   265  C  CG    . ASN A 1 36  ? 10.135  20.313  -37.489 1.00 18.03  ? 36  ASN A CG    1 
ATOM   266  O  OD1   . ASN A 1 36  ? 9.830   20.028  -38.642 1.00 18.46  ? 36  ASN A OD1   1 
ATOM   267  N  ND2   . ASN A 1 36  ? 10.608  21.509  -37.138 1.00 19.68  ? 36  ASN A ND2   1 
ATOM   268  N  N     . TRP A 1 37  ? 8.608   17.038  -34.697 1.00 18.68  ? 37  TRP A N     1 
ATOM   269  C  CA    . TRP A 1 37  ? 8.796   16.071  -33.618 1.00 18.57  ? 37  TRP A CA    1 
ATOM   270  C  C     . TRP A 1 37  ? 8.211   14.701  -33.988 1.00 19.20  ? 37  TRP A C     1 
ATOM   271  O  O     . TRP A 1 37  ? 8.904   13.693  -33.869 1.00 18.92  ? 37  TRP A O     1 
ATOM   272  C  CB    . TRP A 1 37  ? 8.172   16.627  -32.319 1.00 18.82  ? 37  TRP A CB    1 
ATOM   273  C  CG    . TRP A 1 37  ? 8.419   15.879  -31.049 1.00 18.72  ? 37  TRP A CG    1 
ATOM   274  C  CD1   . TRP A 1 37  ? 9.370   16.160  -30.094 1.00 18.04  ? 37  TRP A CD1   1 
ATOM   275  C  CD2   . TRP A 1 37  ? 7.652   14.782  -30.538 1.00 20.68  ? 37  TRP A CD2   1 
ATOM   276  N  NE1   . TRP A 1 37  ? 9.246   15.288  -29.025 1.00 18.29  ? 37  TRP A NE1   1 
ATOM   277  C  CE2   . TRP A 1 37  ? 8.213   14.423  -29.282 1.00 20.08  ? 37  TRP A CE2   1 
ATOM   278  C  CE3   . TRP A 1 37  ? 6.563   14.047  -31.031 1.00 23.32  ? 37  TRP A CE3   1 
ATOM   279  C  CZ2   . TRP A 1 37  ? 7.716   13.363  -28.516 1.00 23.03  ? 37  TRP A CZ2   1 
ATOM   280  C  CZ3   . TRP A 1 37  ? 6.074   12.992  -30.272 1.00 23.68  ? 37  TRP A CZ3   1 
ATOM   281  C  CH2   . TRP A 1 37  ? 6.647   12.666  -29.026 1.00 20.70  ? 37  TRP A CH2   1 
ATOM   282  N  N     . VAL A 1 38  ? 6.966   14.655  -34.472 1.00 20.20  ? 38  VAL A N     1 
ATOM   283  C  CA    . VAL A 1 38  ? 6.355   13.362  -34.788 1.00 20.91  ? 38  VAL A CA    1 
ATOM   284  C  C     . VAL A 1 38  ? 7.106   12.725  -35.966 1.00 23.60  ? 38  VAL A C     1 
ATOM   285  O  O     . VAL A 1 38  ? 7.280   11.504  -36.021 1.00 22.62  ? 38  VAL A O     1 
ATOM   286  C  CB    . VAL A 1 38  ? 4.827   13.492  -35.090 1.00 30.26  ? 38  VAL A CB    1 
ATOM   287  C  CG1   . VAL A 1 38  ? 4.093   14.048  -33.880 1.00 22.37  ? 38  VAL A CG1   1 
ATOM   288  C  CG2   . VAL A 1 38  ? 4.581   14.357  -36.294 1.00 22.16  ? 38  VAL A CG2   1 
ATOM   289  N  N     . GLU A 1 39  ? 7.592   13.563  -36.879 1.00 20.43  ? 39  GLU A N     1 
ATOM   290  C  CA    . GLU A 1 39  ? 8.449   13.117  -37.984 1.00 22.34  ? 39  GLU A CA    1 
ATOM   291  C  C     . GLU A 1 39  ? 9.710   12.382  -37.497 1.00 21.57  ? 39  GLU A C     1 
ATOM   292  O  O     . GLU A 1 39  ? 10.044  11.292  -37.977 1.00 19.99  ? 39  GLU A O     1 
ATOM   293  C  CB    . GLU A 1 39  ? 8.845   14.323  -38.864 1.00 21.80  ? 39  GLU A CB    1 
ATOM   294  C  CG    . GLU A 1 39  ? 9.981   14.093  -39.851 1.00 33.86  ? 39  GLU A CG    1 
ATOM   295  C  CD    . GLU A 1 39  ? 10.314  15.339  -40.696 1.00 42.92  ? 39  GLU A CD    1 
ATOM   296  O  OE1   . GLU A 1 39  ? 10.022  15.333  -41.912 1.00 45.90  ? 39  GLU A OE1   1 
ATOM   297  O  OE2   . GLU A 1 39  ? 10.872  16.321  -40.156 1.00 37.58  ? 39  GLU A OE2   1 
ATOM   298  N  N     . ALA A 1 40  ? 10.420  12.996  -36.561 1.00 18.32  ? 40  ALA A N     1 
ATOM   299  C  CA    . ALA A 1 40  ? 11.681  12.435  -36.089 1.00 17.62  ? 40  ALA A CA    1 
ATOM   300  C  C     . ALA A 1 40  ? 11.454  11.239  -35.154 1.00 17.96  ? 40  ALA A C     1 
ATOM   301  O  O     . ALA A 1 40  ? 12.161  10.228  -35.259 1.00 19.88  ? 40  ALA A O     1 
ATOM   302  C  CB    . ALA A 1 40  ? 12.498  13.503  -35.402 1.00 16.85  ? 40  ALA A CB    1 
ATOM   303  N  N     . ILE A 1 41  ? 10.461  11.356  -34.269 1.00 18.50  ? 41  ILE A N     1 
ATOM   304  C  CA    . ILE A 1 41  ? 10.156  10.312  -33.281 1.00 20.50  ? 41  ILE A CA    1 
ATOM   305  C  C     . ILE A 1 41  ? 9.525   9.103   -33.989 1.00 22.79  ? 41  ILE A C     1 
ATOM   306  O  O     . ILE A 1 41  ? 9.645   7.957   -33.545 1.00 24.90  ? 41  ILE A O     1 
ATOM   307  C  CB    . ILE A 1 41  ? 9.207   10.834  -32.171 1.00 26.49  ? 41  ILE A CB    1 
ATOM   308  C  CG1   . ILE A 1 41  ? 9.863   11.969  -31.375 1.00 18.65  ? 41  ILE A CG1   1 
ATOM   309  C  CG2   . ILE A 1 41  ? 8.782   9.706   -31.219 1.00 27.56  ? 41  ILE A CG2   1 
ATOM   310  C  CD1   . ILE A 1 41  ? 11.164  11.572  -30.652 1.00 21.15  ? 41  ILE A CD1   1 
ATOM   311  N  N     . GLY A 1 42  ? 8.867   9.370   -35.111 1.00 21.50  ? 42  GLY A N     1 
ATOM   312  C  CA    . GLY A 1 42  ? 8.205   8.322   -35.865 1.00 22.70  ? 42  GLY A CA    1 
ATOM   313  C  C     . GLY A 1 42  ? 6.863   7.913   -35.262 1.00 31.08  ? 42  GLY A C     1 
ATOM   314  O  O     . GLY A 1 42  ? 6.375   6.812   -35.530 1.00 31.68  ? 42  GLY A O     1 
ATOM   315  N  N     . ASP A 1 43  ? 6.284   8.784   -34.435 1.00 22.72  ? 43  ASP A N     1 
ATOM   316  C  CA    . ASP A 1 43  ? 4.936   8.576   -33.846 1.00 24.10  ? 43  ASP A CA    1 
ATOM   317  C  C     . ASP A 1 43  ? 3.819   9.007   -34.796 1.00 25.72  ? 43  ASP A C     1 
ATOM   318  O  O     . ASP A 1 43  ? 3.623   10.197  -35.018 1.00 33.18  ? 43  ASP A O     1 
ATOM   319  C  CB    . ASP A 1 43  ? 4.808   9.356   -32.535 1.00 26.91  ? 43  ASP A CB    1 
ATOM   320  C  CG    . ASP A 1 43  ? 3.651   8.894   -31.680 1.00 31.26  ? 43  ASP A CG    1 
ATOM   321  O  OD1   . ASP A 1 43  ? 2.764   8.185   -32.201 1.00 30.19  ? 43  ASP A OD1   1 
ATOM   322  O  OD2   . ASP A 1 43  ? 3.622   9.274   -30.486 1.00 27.30  ? 43  ASP A OD2   1 
ATOM   323  N  N     . ARG A 1 44  ? 3.070   8.045   -35.336 1.00 26.76  ? 44  ARG A N     1 
ATOM   324  C  CA    . ARG A 1 44  ? 2.047   8.340   -36.338 1.00 30.72  ? 44  ARG A CA    1 
ATOM   325  C  C     . ARG A 1 44  ? 0.650   8.584   -35.755 1.00 35.55  ? 44  ARG A C     1 
ATOM   326  O  O     . ARG A 1 44  ? -0.329  8.646   -36.504 1.00 30.64  ? 44  ARG A O     1 
ATOM   327  C  CB    . ARG A 1 44  ? 1.988   7.204   -37.366 1.00 38.34  ? 44  ARG A CB    1 
ATOM   328  C  CG    . ARG A 1 44  ? 3.375   6.815   -37.893 1.00 44.22  ? 44  ARG A CG    1 
ATOM   329  C  CD    . ARG A 1 44  ? 3.342   6.097   -39.236 1.00 52.08  ? 44  ARG A CD    1 
ATOM   330  N  NE    . ARG A 1 44  ? 2.910   4.704   -39.131 1.00 60.71  ? 44  ARG A NE    1 
ATOM   331  C  CZ    . ARG A 1 44  ? 3.726   3.674   -38.920 1.00 62.18  ? 44  ARG A CZ    1 
ATOM   332  N  NH1   . ARG A 1 44  ? 5.032   3.869   -38.782 1.00 59.64  ? 44  ARG A NH1   1 
ATOM   333  N  NH2   . ARG A 1 44  ? 3.233   2.444   -38.847 1.00 63.99  ? 44  ARG A NH2   1 
ATOM   334  N  N     . ASN A 1 45  ? 0.563   8.753   -34.435 1.00 34.53  ? 45  ASN A N     1 
ATOM   335  C  CA    . ASN A 1 45  ? -0.710  9.046   -33.765 1.00 30.63  ? 45  ASN A CA    1 
ATOM   336  C  C     . ASN A 1 45  ? -1.459  10.189  -34.442 1.00 31.57  ? 45  ASN A C     1 
ATOM   337  O  O     . ASN A 1 45  ? -0.994  11.330  -34.475 1.00 27.91  ? 45  ASN A O     1 
ATOM   338  C  CB    . ASN A 1 45  ? -0.461  9.366   -32.283 1.00 29.96  ? 45  ASN A CB    1 
ATOM   339  C  CG    . ASN A 1 45  ? -1.738  9.301   -31.434 1.00 35.35  ? 45  ASN A CG    1 
ATOM   340  O  OD1   . ASN A 1 45  ? -2.842  9.600   -31.909 1.00 40.06  ? 45  ASN A OD1   1 
ATOM   341  N  ND2   . ASN A 1 45  ? -1.581  8.927   -30.154 1.00 31.93  ? 45  ASN A ND2   1 
ATOM   342  N  N     . PRO A 1 46  ? -2.636  9.878   -35.019 1.00 29.09  ? 46  PRO A N     1 
ATOM   343  C  CA    . PRO A 1 46  ? -3.378  10.850  -35.824 1.00 30.81  ? 46  PRO A CA    1 
ATOM   344  C  C     . PRO A 1 46  ? -3.776  12.121  -35.094 1.00 29.46  ? 46  PRO A C     1 
ATOM   345  O  O     . PRO A 1 46  ? -3.933  13.153  -35.738 1.00 29.40  ? 46  PRO A O     1 
ATOM   346  C  CB    . PRO A 1 46  ? -4.639  10.073  -36.237 1.00 35.06  ? 46  PRO A CB    1 
ATOM   347  C  CG    . PRO A 1 46  ? -4.254  8.646   -36.138 1.00 35.93  ? 46  PRO A CG    1 
ATOM   348  C  CD    . PRO A 1 46  ? -3.245  8.538   -35.044 1.00 30.13  ? 46  PRO A CD    1 
ATOM   349  N  N     . ILE A 1 47  ? -3.947  12.059  -33.775 1.00 35.15  ? 47  ILE A N     1 
ATOM   350  C  CA    . ILE A 1 47  ? -4.476  13.210  -33.055 1.00 35.25  ? 47  ILE A CA    1 
ATOM   351  C  C     . ILE A 1 47  ? -3.498  14.394  -32.994 1.00 33.00  ? 47  ILE A C     1 
ATOM   352  O  O     . ILE A 1 47  ? -3.909  15.526  -32.742 1.00 28.66  ? 47  ILE A O     1 
ATOM   353  C  CB    . ILE A 1 47  ? -4.920  12.804  -31.625 1.00 33.40  ? 47  ILE A CB    1 
ATOM   354  C  CG1   . ILE A 1 47  ? -3.714  12.516  -30.735 1.00 30.30  ? 47  ILE A CG1   1 
ATOM   355  C  CG2   . ILE A 1 47  ? -5.794  11.571  -31.704 1.00 33.80  ? 47  ILE A CG2   1 
ATOM   356  C  CD1   . ILE A 1 47  ? -4.069  12.091  -29.309 1.00 35.82  ? 47  ILE A CD1   1 
ATOM   357  N  N     . TYR A 1 48  ? -2.219  14.144  -33.281 1.00 27.43  ? 48  TYR A N     1 
ATOM   358  C  CA    . TYR A 1 48  ? -1.223  15.218  -33.299 1.00 28.09  ? 48  TYR A CA    1 
ATOM   359  C  C     . TYR A 1 48  ? -1.209  15.979  -34.629 1.00 31.65  ? 48  TYR A C     1 
ATOM   360  O  O     . TYR A 1 48  ? -0.634  17.070  -34.717 1.00 25.66  ? 48  TYR A O     1 
ATOM   361  C  CB    . TYR A 1 48  ? 0.186   14.665  -33.018 1.00 25.22  ? 48  TYR A CB    1 
ATOM   362  C  CG    . TYR A 1 48  ? 0.288   13.811  -31.766 1.00 25.28  ? 48  TYR A CG    1 
ATOM   363  C  CD1   . TYR A 1 48  ? -0.414  14.150  -30.609 1.00 25.79  ? 48  TYR A CD1   1 
ATOM   364  C  CD2   . TYR A 1 48  ? 1.067   12.657  -31.746 1.00 26.06  ? 48  TYR A CD2   1 
ATOM   365  C  CE1   . TYR A 1 48  ? -0.331  13.370  -29.477 1.00 29.50  ? 48  TYR A CE1   1 
ATOM   366  C  CE2   . TYR A 1 48  ? 1.154   11.878  -30.623 1.00 25.10  ? 48  TYR A CE2   1 
ATOM   367  C  CZ    . TYR A 1 48  ? 0.445   12.239  -29.493 1.00 27.71  ? 48  TYR A CZ    1 
ATOM   368  O  OH    . TYR A 1 48  ? 0.531   11.458  -28.371 1.00 31.76  ? 48  TYR A OH    1 
ATOM   369  N  N     . VAL A 1 49  ? -1.860  15.424  -35.656 1.00 32.62  ? 49  VAL A N     1 
ATOM   370  C  CA    . VAL A 1 49  ? -1.730  15.987  -36.997 1.00 27.59  ? 49  VAL A CA    1 
ATOM   371  C  C     . VAL A 1 49  ? -3.037  16.124  -37.788 1.00 34.08  ? 49  VAL A C     1 
ATOM   372  O  O     . VAL A 1 49  ? -3.019  16.653  -38.897 1.00 28.44  ? 49  VAL A O     1 
ATOM   373  C  CB    . VAL A 1 49  ? -0.720  15.158  -37.845 1.00 27.77  ? 49  VAL A CB    1 
ATOM   374  C  CG1   . VAL A 1 49  ? 0.692   15.224  -37.217 1.00 25.11  ? 49  VAL A CG1   1 
ATOM   375  C  CG2   . VAL A 1 49  ? -1.147  13.715  -37.960 1.00 27.04  ? 49  VAL A CG2   1 
ATOM   376  N  N     . ASP A 1 50  ? -4.165  15.700  -37.217 1.00 29.32  ? 50  ASP A N     1 
ATOM   377  C  CA    . ASP A 1 50  ? -5.425  15.700  -37.968 1.00 35.13  ? 50  ASP A CA    1 
ATOM   378  C  C     . ASP A 1 50  ? -6.610  16.068  -37.064 1.00 33.26  ? 50  ASP A C     1 
ATOM   379  O  O     . ASP A 1 50  ? -6.983  15.299  -36.175 1.00 36.44  ? 50  ASP A O     1 
ATOM   380  C  CB    . ASP A 1 50  ? -5.628  14.333  -38.626 1.00 33.93  ? 50  ASP A CB    1 
ATOM   381  C  CG    . ASP A 1 50  ? -6.952  14.214  -39.362 1.00 47.84  ? 50  ASP A CG    1 
ATOM   382  O  OD1   . ASP A 1 50  ? -7.640  15.237  -39.588 1.00 48.38  ? 50  ASP A OD1   1 
ATOM   383  O  OD2   . ASP A 1 50  ? -7.298  13.069  -39.717 1.00 51.84  ? 50  ASP A OD2   1 
ATOM   384  N  N     . ASP A 1 51  ? -7.163  17.259  -37.308 1.00 38.53  ? 51  ASP A N     1 
ATOM   385  C  CA    . ASP A 1 51  ? -8.221  17.847  -36.471 1.00 39.20  ? 51  ASP A CA    1 
ATOM   386  C  C     . ASP A 1 51  ? -9.388  16.884  -36.300 1.00 40.28  ? 51  ASP A C     1 
ATOM   387  O  O     . ASP A 1 51  ? -9.944  16.742  -35.207 1.00 43.72  ? 51  ASP A O     1 
ATOM   388  C  CB    . ASP A 1 51  ? -8.729  19.163  -37.077 1.00 36.67  ? 51  ASP A CB    1 
ATOM   389  C  CG    . ASP A 1 51  ? -7.844  20.352  -36.742 1.00 49.24  ? 51  ASP A CG    1 
ATOM   390  O  OD1   . ASP A 1 51  ? -7.285  20.402  -35.618 1.00 43.36  ? 51  ASP A OD1   1 
ATOM   391  O  OD2   . ASP A 1 51  ? -7.707  21.245  -37.611 1.00 52.37  ? 51  ASP A OD2   1 
ATOM   392  N  N     . ALA A 1 52  ? -9.745  16.215  -37.392 1.00 45.75  ? 52  ALA A N     1 
ATOM   393  C  CA    . ALA A 1 52  ? -10.877 15.300  -37.398 1.00 45.27  ? 52  ALA A CA    1 
ATOM   394  C  C     . ALA A 1 52  ? -10.627 14.103  -36.488 1.00 44.55  ? 52  ALA A C     1 
ATOM   395  O  O     . ALA A 1 52  ? -11.518 13.687  -35.737 1.00 42.69  ? 52  ALA A O     1 
ATOM   396  C  CB    . ALA A 1 52  ? -11.182 14.835  -38.833 1.00 45.55  ? 52  ALA A CB    1 
ATOM   397  N  N     . ALA A 1 53  ? -9.403  13.585  -36.538 1.00 36.55  ? 53  ALA A N     1 
ATOM   398  C  CA    . ALA A 1 53  ? -9.004  12.395  -35.787 1.00 35.03  ? 53  ALA A CA    1 
ATOM   399  C  C     . ALA A 1 53  ? -8.843  12.701  -34.303 1.00 43.81  ? 53  ALA A C     1 
ATOM   400  O  O     . ALA A 1 53  ? -9.039  11.836  -33.436 1.00 35.68  ? 53  ALA A O     1 
ATOM   401  C  CB    . ALA A 1 53  ? -7.705  11.844  -36.336 1.00 40.84  ? 53  ALA A CB    1 
ATOM   402  N  N     . ALA A 1 54  ? -8.455  13.941  -34.027 1.00 39.45  ? 54  ALA A N     1 
ATOM   403  C  CA    . ALA A 1 54  ? -8.331  14.425  -32.661 1.00 37.69  ? 54  ALA A CA    1 
ATOM   404  C  C     . ALA A 1 54  ? -9.715  14.745  -32.106 1.00 44.21  ? 54  ALA A C     1 
ATOM   405  O  O     . ALA A 1 54  ? -9.878  15.667  -31.315 1.00 45.85  ? 54  ALA A O     1 
ATOM   406  C  CB    . ALA A 1 54  ? -7.466  15.619  -32.612 1.00 37.69  ? 54  ALA A CB    1 
ATOM   407  N  N     . ARG A 1 55  ? -10.701 13.952  -32.506 1.00 42.06  ? 55  ARG A N     1 
ATOM   408  C  CA    . ARG A 1 55  ? -12.055 14.122  -32.009 1.00 41.38  ? 55  ARG A CA    1 
ATOM   409  C  C     . ARG A 1 55  ? -12.729 12.779  -31.776 1.00 45.12  ? 55  ARG A C     1 
ATOM   410  O  O     . ARG A 1 55  ? -13.572 12.656  -30.897 1.00 42.71  ? 55  ARG A O     1 
ATOM   411  C  CB    . ARG A 1 55  ? -12.863 14.985  -32.967 1.00 37.96  ? 55  ARG A CB    1 
ATOM   412  C  CG    . ARG A 1 55  ? -12.456 16.441  -32.882 1.00 37.21  ? 55  ARG A CG    1 
ATOM   413  C  CD    . ARG A 1 55  ? -13.356 17.369  -33.666 1.00 41.62  ? 55  ARG A CD    1 
ATOM   414  N  NE    . ARG A 1 55  ? -12.804 18.723  -33.694 1.00 45.00  ? 55  ARG A NE    1 
ATOM   415  C  CZ    . ARG A 1 55  ? -12.350 19.324  -34.792 1.00 44.41  ? 55  ARG A CZ    1 
ATOM   416  N  NH1   . ARG A 1 55  ? -12.403 18.695  -35.964 1.00 37.18  ? 55  ARG A NH1   1 
ATOM   417  N  NH2   . ARG A 1 55  ? -11.862 20.562  -34.714 1.00 45.94  ? 55  ARG A NH2   1 
ATOM   418  N  N     . ALA A 1 56  ? -12.343 11.762  -32.535 1.00 45.68  ? 56  ALA A N     1 
ATOM   419  C  CA    . ALA A 1 56  ? -12.868 10.422  -32.297 1.00 43.34  ? 56  ALA A CA    1 
ATOM   420  C  C     . ALA A 1 56  ? -12.329 9.894   -30.970 1.00 46.45  ? 56  ALA A C     1 
ATOM   421  O  O     . ALA A 1 56  ? -12.964 9.063   -30.305 1.00 42.31  ? 56  ALA A O     1 
ATOM   422  C  CB    . ALA A 1 56  ? -12.504 9.480   -33.445 1.00 42.04  ? 56  ALA A CB    1 
ATOM   423  N  N     . ALA A 1 57  ? -11.159 10.399  -30.581 1.00 38.30  ? 57  ALA A N     1 
ATOM   424  C  CA    . ALA A 1 57  ? -10.554 10.028  -29.313 1.00 39.83  ? 57  ALA A CA    1 
ATOM   425  C  C     . ALA A 1 57  ? -10.973 11.009  -28.215 1.00 42.91  ? 57  ALA A C     1 
ATOM   426  O  O     . ALA A 1 57  ? -10.573 10.863  -27.060 1.00 45.76  ? 57  ALA A O     1 
ATOM   427  C  CB    . ALA A 1 57  ? -9.037  9.987   -29.448 1.00 43.42  ? 57  ALA A CB    1 
ATOM   428  N  N     . GLY A 1 58  ? -11.733 12.034  -28.591 1.00 37.61  ? 58  GLY A N     1 
ATOM   429  C  CA    . GLY A 1 58  ? -12.372 12.893  -27.608 1.00 38.43  ? 58  GLY A CA    1 
ATOM   430  C  C     . GLY A 1 58  ? -11.767 14.260  -27.325 1.00 40.25  ? 58  GLY A C     1 
ATOM   431  O  O     . GLY A 1 58  ? -12.149 14.915  -26.341 1.00 37.33  ? 58  GLY A O     1 
ATOM   432  N  N     . HIS A 1 59  ? -10.825 14.694  -28.162 1.00 37.01  ? 59  HIS A N     1 
ATOM   433  C  CA    . HIS A 1 59  ? -10.179 16.003  -27.985 1.00 34.79  ? 59  HIS A CA    1 
ATOM   434  C  C     . HIS A 1 59  ? -10.919 17.066  -28.792 1.00 35.32  ? 59  HIS A C     1 
ATOM   435  O  O     . HIS A 1 59  ? -11.749 16.729  -29.634 1.00 37.34  ? 59  HIS A O     1 
ATOM   436  C  CB    . HIS A 1 59  ? -8.695  15.935  -28.396 1.00 33.23  ? 59  HIS A CB    1 
ATOM   437  C  CG    . HIS A 1 59  ? -7.918  14.899  -27.654 1.00 32.74  ? 59  HIS A CG    1 
ATOM   438  N  ND1   . HIS A 1 59  ? -7.374  15.132  -26.411 1.00 32.22  ? 59  HIS A ND1   1 
ATOM   439  C  CD2   . HIS A 1 59  ? -7.632  13.611  -27.957 1.00 32.79  ? 59  HIS A CD2   1 
ATOM   440  C  CE1   . HIS A 1 59  ? -6.763  14.038  -25.991 1.00 35.35  ? 59  HIS A CE1   1 
ATOM   441  N  NE2   . HIS A 1 59  ? -6.906  13.099  -26.910 1.00 36.43  ? 59  HIS A NE2   1 
ATOM   442  N  N     . PRO A 1 60  ? -10.642 18.357  -28.534 1.00 34.80  ? 60  PRO A N     1 
ATOM   443  C  CA    . PRO A 1 60  ? -11.326 19.388  -29.328 1.00 35.39  ? 60  PRO A CA    1 
ATOM   444  C  C     . PRO A 1 60  ? -10.922 19.383  -30.799 1.00 35.00  ? 60  PRO A C     1 
ATOM   445  O  O     . PRO A 1 60  ? -11.762 19.322  -31.683 1.00 41.42  ? 60  PRO A O     1 
ATOM   446  C  CB    . PRO A 1 60  ? -10.887 20.694  -28.666 1.00 34.77  ? 60  PRO A CB    1 
ATOM   447  C  CG    . PRO A 1 60  ? -10.443 20.309  -27.301 1.00 34.76  ? 60  PRO A CG    1 
ATOM   448  C  CD    . PRO A 1 60  ? -9.863  18.940  -27.427 1.00 36.30  ? 60  PRO A CD    1 
ATOM   449  N  N     . GLY A 1 61  ? -9.621  19.482  -31.032 1.00 33.62  ? 61  GLY A N     1 
ATOM   450  C  CA    . GLY A 1 61  ? -9.021  19.332  -32.348 1.00 33.10  ? 61  GLY A CA    1 
ATOM   451  C  C     . GLY A 1 61  ? -7.624  18.801  -32.077 1.00 31.71  ? 61  GLY A C     1 
ATOM   452  O  O     . GLY A 1 61  ? -7.405  18.217  -31.019 1.00 31.51  ? 61  GLY A O     1 
ATOM   453  N  N     . ILE A 1 62  ? -6.694  18.976  -33.018 1.00 30.85  ? 62  ILE A N     1 
ATOM   454  C  CA    . ILE A 1 62  ? -5.304  18.547  -32.820 1.00 29.75  ? 62  ILE A CA    1 
ATOM   455  C  C     . ILE A 1 62  ? -4.770  18.928  -31.441 1.00 32.98  ? 62  ILE A C     1 
ATOM   456  O  O     . ILE A 1 62  ? -4.896  20.081  -31.018 1.00 29.01  ? 62  ILE A O     1 
ATOM   457  C  CB    . ILE A 1 62  ? -4.365  19.159  -33.887 1.00 31.35  ? 62  ILE A CB    1 
ATOM   458  C  CG1   . ILE A 1 62  ? -4.652  18.545  -35.257 1.00 32.05  ? 62  ILE A CG1   1 
ATOM   459  C  CG2   . ILE A 1 62  ? -2.878  18.992  -33.490 1.00 27.31  ? 62  ILE A CG2   1 
ATOM   460  C  CD1   . ILE A 1 62  ? -4.047  19.324  -36.426 1.00 34.63  ? 62  ILE A CD1   1 
ATOM   461  N  N     . VAL A 1 63  ? -4.184  17.948  -30.757 1.00 30.37  ? 63  VAL A N     1 
ATOM   462  C  CA    . VAL A 1 63  ? -3.507  18.183  -29.492 1.00 27.75  ? 63  VAL A CA    1 
ATOM   463  C  C     . VAL A 1 63  ? -1.994  17.914  -29.659 1.00 26.43  ? 63  VAL A C     1 
ATOM   464  O  O     . VAL A 1 63  ? -1.587  17.122  -30.520 1.00 26.21  ? 63  VAL A O     1 
ATOM   465  C  CB    . VAL A 1 63  ? -4.077  17.296  -28.365 1.00 28.43  ? 63  VAL A CB    1 
ATOM   466  C  CG1   . VAL A 1 63  ? -5.456  17.778  -27.932 1.00 29.66  ? 63  VAL A CG1   1 
ATOM   467  C  CG2   . VAL A 1 63  ? -4.154  15.845  -28.792 1.00 28.78  ? 63  VAL A CG2   1 
ATOM   468  N  N     . ALA A 1 64  ? -1.171  18.593  -28.858 1.00 28.19  ? 64  ALA A N     1 
ATOM   469  C  CA    . ALA A 1 64  ? 0.279   18.331  -28.855 1.00 24.42  ? 64  ALA A CA    1 
ATOM   470  C  C     . ALA A 1 64  ? 0.566   17.051  -28.099 1.00 24.40  ? 64  ALA A C     1 
ATOM   471  O  O     . ALA A 1 64  ? -0.141  16.742  -27.124 1.00 27.29  ? 64  ALA A O     1 
ATOM   472  C  CB    . ALA A 1 64  ? 1.051   19.491  -28.233 1.00 23.65  ? 64  ALA A CB    1 
ATOM   473  N  N     . PRO A 1 65  ? 1.594   16.298  -28.529 1.00 23.68  ? 65  PRO A N     1 
ATOM   474  C  CA    . PRO A 1 65  ? 2.076   15.152  -27.756 1.00 28.78  ? 65  PRO A CA    1 
ATOM   475  C  C     . PRO A 1 65  ? 2.420   15.589  -26.337 1.00 23.30  ? 65  PRO A C     1 
ATOM   476  O  O     . PRO A 1 65  ? 3.135   16.573  -26.157 1.00 22.53  ? 65  PRO A O     1 
ATOM   477  C  CB    . PRO A 1 65  ? 3.332   14.704  -28.519 1.00 22.65  ? 65  PRO A CB    1 
ATOM   478  C  CG    . PRO A 1 65  ? 3.105   15.185  -29.923 1.00 22.68  ? 65  PRO A CG    1 
ATOM   479  C  CD    . PRO A 1 65  ? 2.386   16.500  -29.762 1.00 22.99  ? 65  PRO A CD    1 
ATOM   480  N  N     . PRO A 1 66  ? 1.869   14.899  -25.341 1.00 26.61  ? 66  PRO A N     1 
ATOM   481  C  CA    . PRO A 1 66  ? 2.190   15.246  -23.953 1.00 27.55  ? 66  PRO A CA    1 
ATOM   482  C  C     . PRO A 1 66  ? 3.700   15.317  -23.717 1.00 22.67  ? 66  PRO A C     1 
ATOM   483  O  O     . PRO A 1 66  ? 4.163   16.237  -23.045 1.00 22.18  ? 66  PRO A O     1 
ATOM   484  C  CB    . PRO A 1 66  ? 1.559   14.109  -23.160 1.00 24.80  ? 66  PRO A CB    1 
ATOM   485  C  CG    . PRO A 1 66  ? 0.364   13.715  -23.994 1.00 31.28  ? 66  PRO A CG    1 
ATOM   486  C  CD    . PRO A 1 66  ? 0.770   13.919  -25.442 1.00 25.18  ? 66  PRO A CD    1 
ATOM   487  N  N     . ALA A 1 67  ? 4.446   14.381  -24.296 1.00 22.28  ? 67  ALA A N     1 
ATOM   488  C  CA    . ALA A 1 67  ? 5.893   14.306  -24.111 1.00 21.26  ? 67  ALA A CA    1 
ATOM   489  C  C     . ALA A 1 67  ? 6.640   15.456  -24.793 1.00 20.33  ? 67  ALA A C     1 
ATOM   490  O  O     . ALA A 1 67  ? 7.865   15.517  -24.712 1.00 19.48  ? 67  ALA A O     1 
ATOM   491  C  CB    . ALA A 1 67  ? 6.424   12.960  -24.631 1.00 25.33  ? 67  ALA A CB    1 
ATOM   492  N  N     . MET A 1 68  ? 5.915   16.365  -25.451 1.00 20.56  ? 68  MET A N     1 
ATOM   493  C  CA    . MET A 1 68  ? 6.547   17.558  -26.015 1.00 19.84  ? 68  MET A CA    1 
ATOM   494  C  C     . MET A 1 68  ? 6.615   18.714  -25.005 1.00 20.12  ? 68  MET A C     1 
ATOM   495  O  O     . MET A 1 68  ? 7.165   19.764  -25.320 1.00 19.15  ? 68  MET A O     1 
ATOM   496  C  CB    . MET A 1 68  ? 5.811   18.027  -27.282 1.00 23.54  ? 68  MET A CB    1 
ATOM   497  C  CG    . MET A 1 68  ? 6.249   17.301  -28.541 1.00 19.97  ? 68  MET A CG    1 
ATOM   498  S  SD    . MET A 1 68  ? 5.707   18.166  -30.051 1.00 20.24  ? 68  MET A SD    1 
ATOM   499  C  CE    . MET A 1 68  ? 6.964   19.438  -30.147 1.00 19.24  ? 68  MET A CE    1 
ATOM   500  N  N     . ILE A 1 69  ? 6.087   18.523  -23.797 1.00 20.20  ? 69  ILE A N     1 
ATOM   501  C  CA    . ILE A 1 69  ? 5.890   19.674  -22.906 1.00 20.27  ? 69  ILE A CA    1 
ATOM   502  C  C     . ILE A 1 69  ? 7.237   20.392  -22.655 1.00 22.80  ? 69  ILE A C     1 
ATOM   503  O  O     . ILE A 1 69  ? 7.330   21.614  -22.729 1.00 19.09  ? 69  ILE A O     1 
ATOM   504  C  CB    . ILE A 1 69  ? 5.185   19.262  -21.545 1.00 21.03  ? 69  ILE A CB    1 
ATOM   505  C  CG1   . ILE A 1 69  ? 4.964   20.495  -20.671 1.00 23.47  ? 69  ILE A CG1   1 
ATOM   506  C  CG2   . ILE A 1 69  ? 5.975   18.211  -20.775 1.00 20.78  ? 69  ILE A CG2   1 
ATOM   507  C  CD1   . ILE A 1 69  ? 3.922   21.451  -21.237 1.00 23.36  ? 69  ILE A CD1   1 
ATOM   508  N  N     . GLN A 1 70  ? 8.294   19.624  -22.457 1.00 19.04  ? 70  GLN A N     1 
ATOM   509  C  CA    . GLN A 1 70  ? 9.596   20.210  -22.165 1.00 18.16  ? 70  GLN A CA    1 
ATOM   510  C  C     . GLN A 1 70  ? 10.183  20.895  -23.408 1.00 17.59  ? 70  GLN A C     1 
ATOM   511  O  O     . GLN A 1 70  ? 10.958  21.847  -23.312 1.00 17.09  ? 70  GLN A O     1 
ATOM   512  C  CB    . GLN A 1 70  ? 10.527  19.115  -21.640 1.00 18.14  ? 70  GLN A CB    1 
ATOM   513  C  CG    . GLN A 1 70  ? 11.744  19.597  -20.913 1.00 26.19  ? 70  GLN A CG    1 
ATOM   514  C  CD    . GLN A 1 70  ? 12.521  18.438  -20.323 1.00 29.48  ? 70  GLN A CD    1 
ATOM   515  O  OE1   . GLN A 1 70  ? 11.983  17.345  -20.177 1.00 27.32  ? 70  GLN A OE1   1 
ATOM   516  N  NE2   . GLN A 1 70  ? 13.790  18.665  -19.997 1.00 33.60  ? 70  GLN A NE2   1 
ATOM   517  N  N     . VAL A 1 71  ? 9.806   20.419  -24.588 1.00 17.41  ? 71  VAL A N     1 
ATOM   518  C  CA    . VAL A 1 71  ? 10.351  20.991  -25.821 1.00 16.95  ? 71  VAL A CA    1 
ATOM   519  C  C     . VAL A 1 71  ? 10.040  22.496  -25.973 1.00 17.08  ? 71  VAL A C     1 
ATOM   520  O  O     . VAL A 1 71  ? 10.896  23.270  -26.415 1.00 16.58  ? 71  VAL A O     1 
ATOM   521  C  CB    . VAL A 1 71  ? 9.808   20.223  -27.065 1.00 17.30  ? 71  VAL A CB    1 
ATOM   522  C  CG1   . VAL A 1 71  ? 10.305  20.853  -28.377 1.00 18.57  ? 71  VAL A CG1   1 
ATOM   523  C  CG2   . VAL A 1 71  ? 10.211  18.760  -26.993 1.00 20.45  ? 71  VAL A CG2   1 
ATOM   524  N  N     . TRP A 1 72  ? 8.823   22.913  -25.601 1.00 17.85  ? 72  TRP A N     1 
ATOM   525  C  CA    . TRP A 1 72  ? 8.401   24.293  -25.835 1.00 24.36  ? 72  TRP A CA    1 
ATOM   526  C  C     . TRP A 1 72  ? 9.303   25.298  -25.110 1.00 17.82  ? 72  TRP A C     1 
ATOM   527  O  O     . TRP A 1 72  ? 9.576   26.376  -25.634 1.00 20.29  ? 72  TRP A O     1 
ATOM   528  C  CB    . TRP A 1 72  ? 6.921   24.489  -25.423 1.00 19.21  ? 72  TRP A CB    1 
ATOM   529  C  CG    . TRP A 1 72  ? 6.015   23.441  -25.999 1.00 19.73  ? 72  TRP A CG    1 
ATOM   530  C  CD1   . TRP A 1 72  ? 5.332   22.481  -25.322 1.00 20.24  ? 72  TRP A CD1   1 
ATOM   531  C  CD2   . TRP A 1 72  ? 5.760   23.208  -27.393 1.00 19.90  ? 72  TRP A CD2   1 
ATOM   532  N  NE1   . TRP A 1 72  ? 4.631   21.684  -26.199 1.00 20.75  ? 72  TRP A NE1   1 
ATOM   533  C  CE2   . TRP A 1 72  ? 4.885   22.109  -27.479 1.00 20.53  ? 72  TRP A CE2   1 
ATOM   534  C  CE3   . TRP A 1 72  ? 6.171   23.837  -28.566 1.00 19.66  ? 72  TRP A CE3   1 
ATOM   535  C  CZ2   . TRP A 1 72  ? 4.445   21.600  -28.693 1.00 20.88  ? 72  TRP A CZ2   1 
ATOM   536  C  CZ3   . TRP A 1 72  ? 5.719   23.343  -29.773 1.00 20.02  ? 72  TRP A CZ3   1 
ATOM   537  C  CH2   . TRP A 1 72  ? 4.858   22.239  -29.828 1.00 20.62  ? 72  TRP A CH2   1 
ATOM   538  N  N     . THR A 1 73  ? 9.800   24.923  -23.927 1.00 17.59  ? 73  THR A N     1 
ATOM   539  C  CA    . THR A 1 73  ? 10.572  25.838  -23.097 1.00 22.98  ? 73  THR A CA    1 
ATOM   540  C  C     . THR A 1 73  ? 12.088  25.556  -23.069 1.00 20.72  ? 73  THR A C     1 
ATOM   541  O  O     . THR A 1 73  ? 12.808  26.122  -22.252 1.00 18.25  ? 73  THR A O     1 
ATOM   542  C  CB    . THR A 1 73  ? 10.014  25.842  -21.636 1.00 21.73  ? 73  THR A CB    1 
ATOM   543  O  OG1   . THR A 1 73  ? 9.942   24.508  -21.126 1.00 17.81  ? 73  THR A OG1   1 
ATOM   544  C  CG2   . THR A 1 73  ? 8.589   26.418  -21.608 1.00 18.78  ? 73  THR A CG2   1 
ATOM   545  N  N     . MET A 1 74  ? 12.580  24.706  -23.973 1.00 19.42  ? 74  MET A N     1 
ATOM   546  C  CA    . MET A 1 74  ? 14.017  24.485  -24.087 1.00 22.51  ? 74  MET A CA    1 
ATOM   547  C  C     . MET A 1 74  ? 14.690  25.810  -24.414 1.00 20.89  ? 74  MET A C     1 
ATOM   548  O  O     . MET A 1 74  ? 14.140  26.626  -25.155 1.00 24.16  ? 74  MET A O     1 
ATOM   549  C  CB    . MET A 1 74  ? 14.335  23.421  -25.161 1.00 18.79  ? 74  MET A CB    1 
ATOM   550  C  CG    . MET A 1 74  ? 13.896  22.033  -24.749 1.00 18.67  ? 74  MET A CG    1 
ATOM   551  S  SD    . MET A 1 74  ? 14.843  21.368  -23.367 1.00 22.22  ? 74  MET A SD    1 
ATOM   552  C  CE    . MET A 1 74  ? 16.340  20.972  -24.297 1.00 23.34  ? 74  MET A CE    1 
ATOM   553  N  N     . MET A 1 75  ? 15.865  26.028  -23.828 1.00 27.37  ? 75  MET A N     1 
ATOM   554  C  CA    . MET A 1 75  ? 16.607  27.285  -23.987 1.00 32.94  ? 75  MET A CA    1 
ATOM   555  C  C     . MET A 1 75  ? 17.007  27.600  -25.423 1.00 36.41  ? 75  MET A C     1 
ATOM   556  O  O     . MET A 1 75  ? 17.086  28.769  -25.805 1.00 40.72  ? 75  MET A O     1 
ATOM   557  C  CB    . MET A 1 75  ? 17.869  27.275  -23.114 1.00 36.79  ? 75  MET A CB    1 
ATOM   558  C  CG    . MET A 1 75  ? 17.619  27.358  -21.610 1.00 43.70  ? 75  MET A CG    1 
ATOM   559  S  SD    . MET A 1 75  ? 16.766  28.867  -21.085 1.00 61.09  ? 75  MET A SD    1 
ATOM   560  C  CE    . MET A 1 75  ? 17.796  30.126  -21.825 1.00 48.06  ? 75  MET A CE    1 
ATOM   561  N  N     . GLY A 1 76  ? 17.283  26.575  -26.223 1.00 27.85  ? 76  GLY A N     1 
ATOM   562  C  CA    . GLY A 1 76  ? 17.669  26.820  -27.596 1.00 30.61  ? 76  GLY A CA    1 
ATOM   563  C  C     . GLY A 1 76  ? 19.168  26.950  -27.770 1.00 27.64  ? 76  GLY A C     1 
ATOM   564  O  O     . GLY A 1 76  ? 19.944  26.888  -26.807 1.00 29.25  ? 76  GLY A O     1 
ATOM   565  N  N     . LEU A 1 77  ? 19.572  27.162  -29.009 1.00 24.03  ? 77  LEU A N     1 
ATOM   566  C  CA    . LEU A 1 77  ? 20.977  27.223  -29.350 1.00 26.66  ? 77  LEU A CA    1 
ATOM   567  C  C     . LEU A 1 77  ? 21.659  28.368  -28.599 1.00 37.98  ? 77  LEU A C     1 
ATOM   568  O  O     . LEU A 1 77  ? 21.258  29.524  -28.715 1.00 36.24  ? 77  LEU A O     1 
ATOM   569  C  CB    . LEU A 1 77  ? 21.110  27.380  -30.859 1.00 27.37  ? 77  LEU A CB    1 
ATOM   570  C  CG    . LEU A 1 77  ? 22.396  26.954  -31.539 1.00 31.80  ? 77  LEU A CG    1 
ATOM   571  C  CD1   . LEU A 1 77  ? 22.814  25.567  -31.078 1.00 33.02  ? 77  LEU A CD1   1 
ATOM   572  C  CD2   . LEU A 1 77  ? 22.154  26.991  -33.047 1.00 33.31  ? 77  LEU A CD2   1 
ATOM   573  N  N     . GLY A 1 78  ? 22.648  28.034  -27.778 1.00 40.42  ? 78  GLY A N     1 
ATOM   574  C  CA    . GLY A 1 78  ? 23.376  29.034  -27.016 1.00 46.83  ? 78  GLY A CA    1 
ATOM   575  C  C     . GLY A 1 78  ? 22.621  29.761  -25.911 1.00 49.96  ? 78  GLY A C     1 
ATOM   576  O  O     . GLY A 1 78  ? 23.061  30.814  -25.451 1.00 55.61  ? 78  GLY A O     1 
ATOM   577  N  N     . GLY A 1 79  ? 21.497  29.210  -25.466 1.00 43.10  ? 79  GLY A N     1 
ATOM   578  C  CA    . GLY A 1 79  ? 20.727  29.848  -24.411 1.00 41.46  ? 79  GLY A CA    1 
ATOM   579  C  C     . GLY A 1 79  ? 21.366  29.715  -23.037 1.00 40.06  ? 79  GLY A C     1 
ATOM   580  O  O     . GLY A 1 79  ? 22.072  28.742  -22.767 1.00 43.90  ? 79  GLY A O     1 
ATOM   581  N  N     . VAL A 1 80  ? 21.112  30.691  -22.169 1.00 37.21  ? 80  VAL A N     1 
ATOM   582  C  CA    . VAL A 1 80  ? 21.632  30.675  -20.800 1.00 37.27  ? 80  VAL A CA    1 
ATOM   583  C  C     . VAL A 1 80  ? 20.503  30.784  -19.778 1.00 40.33  ? 80  VAL A C     1 
ATOM   584  O  O     . VAL A 1 80  ? 19.660  31.677  -19.875 1.00 37.63  ? 80  VAL A O     1 
ATOM   585  C  CB    . VAL A 1 80  ? 22.637  31.824  -20.569 1.00 44.79  ? 80  VAL A CB    1 
ATOM   586  C  CG1   . VAL A 1 80  ? 22.929  32.008  -19.077 1.00 41.17  ? 80  VAL A CG1   1 
ATOM   587  C  CG2   . VAL A 1 80  ? 23.923  31.573  -21.355 1.00 41.08  ? 80  VAL A CG2   1 
ATOM   588  N  N     . ARG A 1 81  ? 20.491  29.871  -18.807 1.00 49.26  ? 81  ARG A N     1 
ATOM   589  C  CA    . ARG A 1 81  ? 19.476  29.865  -17.749 1.00 53.37  ? 81  ARG A CA    1 
ATOM   590  C  C     . ARG A 1 81  ? 19.429  31.195  -17.012 1.00 47.65  ? 81  ARG A C     1 
ATOM   591  O  O     . ARG A 1 81  ? 20.471  31.817  -16.777 1.00 46.78  ? 81  ARG A O     1 
ATOM   592  C  CB    . ARG A 1 81  ? 19.741  28.736  -16.743 1.00 62.82  ? 81  ARG A CB    1 
ATOM   593  C  CG    . ARG A 1 81  ? 19.562  27.328  -17.295 1.00 68.45  ? 81  ARG A CG    1 
ATOM   594  C  CD    . ARG A 1 81  ? 18.093  27.023  -17.549 1.00 73.63  ? 81  ARG A CD    1 
ATOM   595  N  NE    . ARG A 1 81  ? 17.900  25.739  -18.222 1.00 78.36  ? 81  ARG A NE    1 
ATOM   596  C  CZ    . ARG A 1 81  ? 17.725  24.580  -17.594 1.00 81.44  ? 81  ARG A CZ    1 
ATOM   597  N  NH1   . ARG A 1 81  ? 17.721  24.534  -16.268 1.00 83.14  ? 81  ARG A NH1   1 
ATOM   598  N  NH2   . ARG A 1 81  ? 17.555  23.465  -18.295 1.00 81.46  ? 81  ARG A NH2   1 
ATOM   599  N  N     . PRO A 1 82  ? 18.218  31.638  -16.645 1.00 40.14  ? 82  PRO A N     1 
ATOM   600  C  CA    . PRO A 1 82  ? 18.095  32.844  -15.823 1.00 41.43  ? 82  PRO A CA    1 
ATOM   601  C  C     . PRO A 1 82  ? 18.754  32.633  -14.460 1.00 39.03  ? 82  PRO A C     1 
ATOM   602  O  O     . PRO A 1 82  ? 18.995  31.487  -14.062 1.00 37.63  ? 82  PRO A O     1 
ATOM   603  C  CB    . PRO A 1 82  ? 16.578  33.045  -15.694 1.00 38.38  ? 82  PRO A CB    1 
ATOM   604  C  CG    . PRO A 1 82  ? 15.975  31.718  -16.035 1.00 40.10  ? 82  PRO A CG    1 
ATOM   605  C  CD    . PRO A 1 82  ? 16.908  31.066  -17.008 1.00 33.71  ? 82  PRO A CD    1 
ATOM   606  N  N     . LYS A 1 83  ? 19.054  33.725  -13.769 1.00 44.63  ? 83  LYS A N     1 
ATOM   607  C  CA    . LYS A 1 83  ? 19.842  33.658  -12.547 1.00 46.66  ? 83  LYS A CA    1 
ATOM   608  C  C     . LYS A 1 83  ? 19.057  32.984  -11.420 1.00 47.71  ? 83  LYS A C     1 
ATOM   609  O  O     . LYS A 1 83  ? 19.639  32.379  -10.517 1.00 47.12  ? 83  LYS A O     1 
ATOM   610  C  CB    . LYS A 1 83  ? 20.282  35.063  -12.128 1.00 52.02  ? 83  LYS A CB    1 
ATOM   611  C  CG    . LYS A 1 83  ? 21.285  35.100  -10.981 1.00 59.18  ? 83  LYS A CG    1 
ATOM   612  C  CD    . LYS A 1 83  ? 21.736  36.527  -10.673 1.00 59.64  ? 83  LYS A CD    1 
ATOM   613  C  CE    . LYS A 1 83  ? 22.939  36.539  -9.744  1.00 59.56  ? 83  LYS A CE    1 
ATOM   614  N  NZ    . LYS A 1 83  ? 23.539  37.895  -9.626  1.00 61.20  ? 83  LYS A NZ    1 
ATOM   615  N  N     . ASP A 1 84  ? 17.733  33.078  -11.486 1.00 38.18  ? 84  ASP A N     1 
ATOM   616  C  CA    . ASP A 1 84  ? 16.901  32.555  -10.413 1.00 41.18  ? 84  ASP A CA    1 
ATOM   617  C  C     . ASP A 1 84  ? 16.520  31.075  -10.595 1.00 34.44  ? 84  ASP A C     1 
ATOM   618  O  O     . ASP A 1 84  ? 15.772  30.528  -9.785  1.00 32.39  ? 84  ASP A O     1 
ATOM   619  C  CB    . ASP A 1 84  ? 15.648  33.426  -10.252 1.00 43.72  ? 84  ASP A CB    1 
ATOM   620  C  CG    . ASP A 1 84  ? 14.713  33.356  -11.447 1.00 45.16  ? 84  ASP A CG    1 
ATOM   621  O  OD1   . ASP A 1 84  ? 15.113  32.819  -12.501 1.00 44.81  ? 84  ASP A OD1   1 
ATOM   622  O  OD2   . ASP A 1 84  ? 13.568  33.850  -11.318 1.00 47.39  ? 84  ASP A OD2   1 
ATOM   623  N  N     . ASP A 1 85  ? 17.034  30.431  -11.642 1.00 33.91  ? 85  ASP A N     1 
ATOM   624  C  CA    . ASP A 1 85  ? 16.951  28.968  -11.763 1.00 35.21  ? 85  ASP A CA    1 
ATOM   625  C  C     . ASP A 1 85  ? 17.874  28.310  -10.736 1.00 29.51  ? 85  ASP A C     1 
ATOM   626  O  O     . ASP A 1 85  ? 19.089  28.476  -10.805 1.00 30.14  ? 85  ASP A O     1 
ATOM   627  C  CB    . ASP A 1 85  ? 17.333  28.505  -13.176 1.00 31.39  ? 85  ASP A CB    1 
ATOM   628  C  CG    . ASP A 1 85  ? 17.062  27.012  -13.409 1.00 35.55  ? 85  ASP A CG    1 
ATOM   629  O  OD1   . ASP A 1 85  ? 17.034  26.221  -12.444 1.00 41.83  ? 85  ASP A OD1   1 
ATOM   630  O  OD2   . ASP A 1 85  ? 16.879  26.626  -14.577 1.00 47.71  ? 85  ASP A OD2   1 
ATOM   631  N  N     . PRO A 1 86  ? 17.305  27.540  -9.792  1.00 32.10  ? 86  PRO A N     1 
ATOM   632  C  CA    . PRO A 1 86  ? 18.132  26.959  -8.723  1.00 36.47  ? 86  PRO A CA    1 
ATOM   633  C  C     . PRO A 1 86  ? 19.185  25.956  -9.228  1.00 36.60  ? 86  PRO A C     1 
ATOM   634  O  O     . PRO A 1 86  ? 20.154  25.693  -8.507  1.00 41.58  ? 86  PRO A O     1 
ATOM   635  C  CB    . PRO A 1 86  ? 17.102  26.266  -7.823  1.00 34.26  ? 86  PRO A CB    1 
ATOM   636  C  CG    . PRO A 1 86  ? 15.946  25.992  -8.718  1.00 33.58  ? 86  PRO A CG    1 
ATOM   637  C  CD    . PRO A 1 86  ? 15.890  27.141  -9.678  1.00 31.70  ? 86  PRO A CD    1 
ATOM   638  N  N     . LEU A 1 87  ? 18.996  25.417  -10.429 1.00 39.47  ? 87  LEU A N     1 
ATOM   639  C  CA    . LEU A 1 87  ? 19.946  24.477  -11.023 1.00 38.65  ? 87  LEU A CA    1 
ATOM   640  C  C     . LEU A 1 87  ? 21.344  25.056  -11.048 1.00 32.77  ? 87  LEU A C     1 
ATOM   641  O  O     . LEU A 1 87  ? 22.297  24.377  -10.710 1.00 30.79  ? 87  LEU A O     1 
ATOM   642  C  CB    . LEU A 1 87  ? 19.545  24.096  -12.449 1.00 45.49  ? 87  LEU A CB    1 
ATOM   643  C  CG    . LEU A 1 87  ? 20.532  23.197  -13.216 1.00 45.42  ? 87  LEU A CG    1 
ATOM   644  C  CD1   . LEU A 1 87  ? 20.444  21.750  -12.723 1.00 46.98  ? 87  LEU A CD1   1 
ATOM   645  C  CD2   . LEU A 1 87  ? 20.332  23.274  -14.741 1.00 46.94  ? 87  LEU A CD2   1 
ATOM   646  N  N     . GLY A 1 88  ? 21.454  26.309  -11.477 1.00 35.18  ? 88  GLY A N     1 
ATOM   647  C  CA    . GLY A 1 88  ? 22.739  26.986  -11.521 1.00 37.10  ? 88  GLY A CA    1 
ATOM   648  C  C     . GLY A 1 88  ? 23.508  26.926  -10.206 1.00 31.96  ? 88  GLY A C     1 
ATOM   649  O  O     . GLY A 1 88  ? 24.591  26.338  -10.153 1.00 30.54  ? 88  GLY A O     1 
ATOM   650  N  N     . PRO A 1 89  ? 22.957  27.533  -9.142  1.00 31.16  ? 89  PRO A N     1 
ATOM   651  C  CA    . PRO A 1 89  ? 23.642  27.563  -7.843  1.00 31.75  ? 89  PRO A CA    1 
ATOM   652  C  C     . PRO A 1 89  ? 23.984  26.178  -7.317  1.00 31.93  ? 89  PRO A C     1 
ATOM   653  O  O     . PRO A 1 89  ? 25.054  25.991  -6.732  1.00 36.70  ? 89  PRO A O     1 
ATOM   654  C  CB    . PRO A 1 89  ? 22.624  28.248  -6.926  1.00 34.85  ? 89  PRO A CB    1 
ATOM   655  C  CG    . PRO A 1 89  ? 21.841  29.101  -7.832  1.00 35.88  ? 89  PRO A CG    1 
ATOM   656  C  CD    . PRO A 1 89  ? 21.746  28.368  -9.136  1.00 30.89  ? 89  PRO A CD    1 
ATOM   657  N  N     . ILE A 1 90  ? 23.093  25.217  -7.545  1.00 33.34  ? 90  ILE A N     1 
ATOM   658  C  CA    . ILE A 1 90  ? 23.264  23.894  -6.965  1.00 36.63  ? 90  ILE A CA    1 
ATOM   659  C  C     . ILE A 1 90  ? 24.407  23.139  -7.669  1.00 37.83  ? 90  ILE A C     1 
ATOM   660  O  O     . ILE A 1 90  ? 25.181  22.439  -7.015  1.00 33.76  ? 90  ILE A O     1 
ATOM   661  C  CB    . ILE A 1 90  ? 21.926  23.090  -7.001  1.00 36.54  ? 90  ILE A CB    1 
ATOM   662  C  CG1   . ILE A 1 90  ? 21.877  22.063  -5.876  1.00 41.63  ? 90  ILE A CG1   1 
ATOM   663  C  CG2   . ILE A 1 90  ? 21.684  22.431  -8.342  1.00 46.73  ? 90  ILE A CG2   1 
ATOM   664  C  CD1   . ILE A 1 90  ? 21.715  22.676  -4.496  1.00 38.64  ? 90  ILE A CD1   1 
ATOM   665  N  N     . ILE A 1 91  ? 24.545  23.303  -8.985  1.00 30.44  ? 91  ILE A N     1 
ATOM   666  C  CA    . ILE A 1 91  ? 25.658  22.678  -9.694  1.00 30.53  ? 91  ILE A CA    1 
ATOM   667  C  C     . ILE A 1 91  ? 26.973  23.307  -9.244  1.00 31.43  ? 91  ILE A C     1 
ATOM   668  O  O     . ILE A 1 91  ? 27.948  22.612  -8.959  1.00 35.36  ? 91  ILE A O     1 
ATOM   669  C  CB    . ILE A 1 91  ? 25.523  22.822  -11.225 1.00 29.96  ? 91  ILE A CB    1 
ATOM   670  C  CG1   . ILE A 1 91  ? 24.296  22.062  -11.739 1.00 33.80  ? 91  ILE A CG1   1 
ATOM   671  C  CG2   . ILE A 1 91  ? 26.778  22.320  -11.914 1.00 30.38  ? 91  ILE A CG2   1 
ATOM   672  C  CD1   . ILE A 1 91  ? 24.389  20.558  -11.579 1.00 36.67  ? 91  ILE A CD1   1 
ATOM   673  N  N     . LYS A 1 92  ? 26.975  24.634  -9.193  1.00 31.68  ? 92  LYS A N     1 
ATOM   674  C  CA    . LYS A 1 92  ? 28.125  25.419  -8.764  1.00 34.28  ? 92  LYS A CA    1 
ATOM   675  C  C     . LYS A 1 92  ? 28.566  25.022  -7.361  1.00 36.17  ? 92  LYS A C     1 
ATOM   676  O  O     . LYS A 1 92  ? 29.755  24.873  -7.095  1.00 40.12  ? 92  LYS A O     1 
ATOM   677  C  CB    . LYS A 1 92  ? 27.784  26.913  -8.809  1.00 39.50  ? 92  LYS A CB    1 
ATOM   678  C  CG    . LYS A 1 92  ? 28.859  27.838  -8.241  1.00 46.81  ? 92  LYS A CG    1 
ATOM   679  C  CD    . LYS A 1 92  ? 29.879  28.214  -9.299  1.00 51.48  ? 92  LYS A CD    1 
ATOM   680  C  CE    . LYS A 1 92  ? 30.756  29.367  -8.835  1.00 54.51  ? 92  LYS A CE    1 
ATOM   681  N  NZ    . LYS A 1 92  ? 31.441  29.060  -7.551  1.00 56.30  ? 92  LYS A NZ    1 
ATOM   682  N  N     . LEU A 1 93  ? 27.597  24.857  -6.468  1.00 33.76  ? 93  LEU A N     1 
ATOM   683  C  CA    . LEU A 1 93  ? 27.878  24.424  -5.104  1.00 36.59  ? 93  LEU A CA    1 
ATOM   684  C  C     . LEU A 1 93  ? 28.631  23.096  -5.081  1.00 39.38  ? 93  LEU A C     1 
ATOM   685  O  O     . LEU A 1 93  ? 29.679  22.967  -4.437  1.00 40.20  ? 93  LEU A O     1 
ATOM   686  C  CB    . LEU A 1 93  ? 26.575  24.299  -4.313  1.00 38.39  ? 93  LEU A CB    1 
ATOM   687  C  CG    . LEU A 1 93  ? 26.679  23.686  -2.919  1.00 38.53  ? 93  LEU A CG    1 
ATOM   688  C  CD1   . LEU A 1 93  ? 27.448  24.609  -1.995  1.00 37.67  ? 93  LEU A CD1   1 
ATOM   689  C  CD2   . LEU A 1 93  ? 25.298  23.375  -2.355  1.00 35.83  ? 93  LEU A CD2   1 
ATOM   690  N  N     . PHE A 1 94  ? 28.108  22.110  -5.801  1.00 34.11  ? 94  PHE A N     1 
ATOM   691  C  CA    . PHE A 1 94  ? 28.670  20.768  -5.733  1.00 34.50  ? 94  PHE A CA    1 
ATOM   692  C  C     . PHE A 1 94  ? 29.962  20.607  -6.540  1.00 38.62  ? 94  PHE A C     1 
ATOM   693  O  O     . PHE A 1 94  ? 30.821  19.795  -6.175  1.00 37.05  ? 94  PHE A O     1 
ATOM   694  C  CB    . PHE A 1 94  ? 27.624  19.741  -6.174  1.00 34.86  ? 94  PHE A CB    1 
ATOM   695  C  CG    . PHE A 1 94  ? 26.632  19.417  -5.095  1.00 33.99  ? 94  PHE A CG    1 
ATOM   696  C  CD1   . PHE A 1 94  ? 27.015  18.658  -3.998  1.00 35.24  ? 94  PHE A CD1   1 
ATOM   697  C  CD2   . PHE A 1 94  ? 25.336  19.899  -5.151  1.00 33.38  ? 94  PHE A CD2   1 
ATOM   698  C  CE1   . PHE A 1 94  ? 26.123  18.372  -2.985  1.00 35.90  ? 94  PHE A CE1   1 
ATOM   699  C  CE2   . PHE A 1 94  ? 24.437  19.618  -4.140  1.00 34.05  ? 94  PHE A CE2   1 
ATOM   700  C  CZ    . PHE A 1 94  ? 24.828  18.852  -3.060  1.00 35.33  ? 94  PHE A CZ    1 
ATOM   701  N  N     . ASP A 1 95  ? 30.102  21.370  -7.622  1.00 36.22  ? 95  ASP A N     1 
ATOM   702  C  CA    . ASP A 1 95  ? 31.350  21.366  -8.386  1.00 42.35  ? 95  ASP A CA    1 
ATOM   703  C  C     . ASP A 1 95  ? 32.496  21.828  -7.492  1.00 48.71  ? 95  ASP A C     1 
ATOM   704  O  O     . ASP A 1 95  ? 33.564  21.211  -7.462  1.00 49.45  ? 95  ASP A O     1 
ATOM   705  C  CB    . ASP A 1 95  ? 31.259  22.264  -9.621  1.00 43.37  ? 95  ASP A CB    1 
ATOM   706  C  CG    . ASP A 1 95  ? 30.609  21.569  -10.806 1.00 39.98  ? 95  ASP A CG    1 
ATOM   707  O  OD1   . ASP A 1 95  ? 30.529  20.319  -10.785 1.00 35.85  ? 95  ASP A OD1   1 
ATOM   708  O  OD2   . ASP A 1 95  ? 30.197  22.272  -11.759 1.00 43.10  ? 95  ASP A OD2   1 
ATOM   709  N  N     . ASP A 1 96  ? 32.256  22.917  -6.764  1.00 52.21  ? 96  ASP A N     1 
ATOM   710  C  CA    . ASP A 1 96  ? 33.266  23.503  -5.891  1.00 56.26  ? 96  ASP A CA    1 
ATOM   711  C  C     . ASP A 1 96  ? 33.646  22.558  -4.759  1.00 57.00  ? 96  ASP A C     1 
ATOM   712  O  O     . ASP A 1 96  ? 34.782  22.570  -4.294  1.00 57.16  ? 96  ASP A O     1 
ATOM   713  C  CB    . ASP A 1 96  ? 32.775  24.830  -5.313  1.00 59.16  ? 96  ASP A CB    1 
ATOM   714  C  CG    . ASP A 1 96  ? 32.648  25.912  -6.365  1.00 61.88  ? 96  ASP A CG    1 
ATOM   715  O  OD1   . ASP A 1 96  ? 33.299  25.798  -7.427  1.00 61.05  ? 96  ASP A OD1   1 
ATOM   716  O  OD2   . ASP A 1 96  ? 31.894  26.879  -6.125  1.00 64.01  ? 96  ASP A OD2   1 
ATOM   717  N  N     . ALA A 1 97  ? 32.694  21.743  -4.318  1.00 48.66  ? 97  ALA A N     1 
ATOM   718  C  CA    . ALA A 1 97  ? 32.957  20.760  -3.277  1.00 44.59  ? 97  ALA A CA    1 
ATOM   719  C  C     . ALA A 1 97  ? 33.642  19.514  -3.833  1.00 43.89  ? 97  ALA A C     1 
ATOM   720  O  O     . ALA A 1 97  ? 33.881  18.556  -3.103  1.00 49.15  ? 97  ALA A O     1 
ATOM   721  C  CB    . ALA A 1 97  ? 31.663  20.380  -2.577  1.00 45.78  ? 97  ALA A CB    1 
ATOM   722  N  N     . GLY A 1 98  ? 33.937  19.517  -5.131  1.00 46.77  ? 98  GLY A N     1 
ATOM   723  C  CA    . GLY A 1 98  ? 34.660  18.416  -5.746  1.00 47.42  ? 98  GLY A CA    1 
ATOM   724  C  C     . GLY A 1 98  ? 33.802  17.366  -6.431  1.00 48.91  ? 98  GLY A C     1 
ATOM   725  O  O     . GLY A 1 98  ? 34.323  16.423  -7.033  1.00 48.24  ? 98  GLY A O     1 
ATOM   726  N  N     . TYR A 1 99  ? 32.485  17.514  -6.342  1.00 43.80  ? 99  TYR A N     1 
ATOM   727  C  CA    . TYR A 1 99  ? 31.582  16.563  -6.981  1.00 40.62  ? 99  TYR A CA    1 
ATOM   728  C  C     . TYR A 1 99  ? 31.344  16.976  -8.435  1.00 44.94  ? 99  TYR A C     1 
ATOM   729  O  O     . TYR A 1 99  ? 30.230  17.321  -8.826  1.00 40.84  ? 99  TYR A O     1 
ATOM   730  C  CB    . TYR A 1 99  ? 30.262  16.467  -6.209  1.00 37.09  ? 99  TYR A CB    1 
ATOM   731  C  CG    . TYR A 1 99  ? 30.418  15.958  -4.783  1.00 38.85  ? 99  TYR A CG    1 
ATOM   732  C  CD1   . TYR A 1 99  ? 30.438  14.595  -4.508  1.00 35.65  ? 99  TYR A CD1   1 
ATOM   733  C  CD2   . TYR A 1 99  ? 30.529  16.842  -3.715  1.00 39.18  ? 99  TYR A CD2   1 
ATOM   734  C  CE1   . TYR A 1 99  ? 30.580  14.125  -3.215  1.00 40.37  ? 99  TYR A CE1   1 
ATOM   735  C  CE2   . TYR A 1 99  ? 30.673  16.380  -2.413  1.00 39.72  ? 99  TYR A CE2   1 
ATOM   736  C  CZ    . TYR A 1 99  ? 30.694  15.021  -2.172  1.00 41.23  ? 99  TYR A CZ    1 
ATOM   737  O  OH    . TYR A 1 99  ? 30.827  14.552  -0.885  1.00 46.95  ? 99  TYR A OH    1 
ATOM   738  N  N     . ILE A 1 100 ? 32.404  16.906  -9.235  1.00 46.32  ? 100 ILE A N     1 
ATOM   739  C  CA    . ILE A 1 100 ? 32.440  17.539  -10.549 1.00 48.07  ? 100 ILE A CA    1 
ATOM   740  C  C     . ILE A 1 100 ? 31.639  16.796  -11.625 1.00 43.01  ? 100 ILE A C     1 
ATOM   741  O  O     . ILE A 1 100 ? 31.181  17.409  -12.589 1.00 44.45  ? 100 ILE A O     1 
ATOM   742  C  CB    . ILE A 1 100 ? 33.904  17.695  -11.024 1.00 45.46  ? 100 ILE A CB    1 
ATOM   743  C  CG1   . ILE A 1 100 ? 34.560  16.324  -11.179 1.00 47.88  ? 100 ILE A CG1   1 
ATOM   744  C  CG2   . ILE A 1 100 ? 34.687  18.539  -10.038 1.00 47.47  ? 100 ILE A CG2   1 
ATOM   745  C  CD1   . ILE A 1 100 ? 36.026  16.379  -11.571 1.00 47.72  ? 100 ILE A CD1   1 
ATOM   746  N  N     . GLY A 1 101 ? 31.479  15.485  -11.463 1.00 36.48  ? 101 GLY A N     1 
ATOM   747  C  CA    . GLY A 1 101 ? 30.725  14.687  -12.416 1.00 35.73  ? 101 GLY A CA    1 
ATOM   748  C  C     . GLY A 1 101 ? 29.225  14.842  -12.244 1.00 38.83  ? 101 GLY A C     1 
ATOM   749  O  O     . GLY A 1 101 ? 28.748  15.256  -11.177 1.00 33.92  ? 101 GLY A O     1 
ATOM   750  N  N     . VAL A 1 102 ? 28.480  14.521  -13.300 1.00 34.59  ? 102 VAL A N     1 
ATOM   751  C  CA    . VAL A 1 102 ? 27.023  14.582  -13.265 1.00 29.68  ? 102 VAL A CA    1 
ATOM   752  C  C     . VAL A 1 102 ? 26.412  13.535  -14.204 1.00 33.79  ? 102 VAL A C     1 
ATOM   753  O  O     . VAL A 1 102 ? 26.949  13.255  -15.281 1.00 32.91  ? 102 VAL A O     1 
ATOM   754  C  CB    . VAL A 1 102 ? 26.498  15.995  -13.649 1.00 27.26  ? 102 VAL A CB    1 
ATOM   755  C  CG1   . VAL A 1 102 ? 26.828  16.317  -15.106 1.00 30.15  ? 102 VAL A CG1   1 
ATOM   756  C  CG2   . VAL A 1 102 ? 24.966  16.111  -13.412 1.00 26.64  ? 102 VAL A CG2   1 
ATOM   757  N  N     . VAL A 1 103 ? 25.306  12.942  -13.767 1.00 29.41  ? 103 VAL A N     1 
ATOM   758  C  CA    . VAL A 1 103 ? 24.455  12.121  -14.627 1.00 30.17  ? 103 VAL A CA    1 
ATOM   759  C  C     . VAL A 1 103 ? 23.014  12.265  -14.172 1.00 29.95  ? 103 VAL A C     1 
ATOM   760  O  O     . VAL A 1 103 ? 22.728  12.407  -12.979 1.00 27.52  ? 103 VAL A O     1 
ATOM   761  C  CB    . VAL A 1 103 ? 24.823  10.617  -14.614 1.00 31.51  ? 103 VAL A CB    1 
ATOM   762  C  CG1   . VAL A 1 103 ? 26.046  10.337  -15.464 1.00 37.58  ? 103 VAL A CG1   1 
ATOM   763  C  CG2   . VAL A 1 103 ? 24.989  10.113  -13.191 1.00 31.90  ? 103 VAL A CG2   1 
ATOM   764  N  N     . ALA A 1 104 ? 22.100  12.241  -15.134 1.00 26.21  ? 104 ALA A N     1 
ATOM   765  C  CA    . ALA A 1 104 ? 20.693  12.213  -14.819 1.00 25.98  ? 104 ALA A CA    1 
ATOM   766  C  C     . ALA A 1 104 ? 20.309  10.779  -14.452 1.00 29.37  ? 104 ALA A C     1 
ATOM   767  O  O     . ALA A 1 104 ? 20.806  9.830   -15.064 1.00 30.08  ? 104 ALA A O     1 
ATOM   768  C  CB    . ALA A 1 104 ? 19.870  12.714  -15.996 1.00 25.15  ? 104 ALA A CB    1 
ATOM   769  N  N     . THR A 1 105 ? 19.431  10.616  -13.466 1.00 27.11  ? 105 THR A N     1 
ATOM   770  C  CA    . THR A 1 105 ? 19.063  9.275   -13.028 1.00 28.04  ? 105 THR A CA    1 
ATOM   771  C  C     . THR A 1 105 ? 17.592  8.962   -13.192 1.00 27.98  ? 105 THR A C     1 
ATOM   772  O  O     . THR A 1 105 ? 17.240  7.815   -13.437 1.00 32.52  ? 105 THR A O     1 
ATOM   773  C  CB    . THR A 1 105 ? 19.434  9.041   -11.547 1.00 31.37  ? 105 THR A CB    1 
ATOM   774  O  OG1   . THR A 1 105 ? 18.676  9.933   -10.721 1.00 32.79  ? 105 THR A OG1   1 
ATOM   775  C  CG2   . THR A 1 105 ? 20.922  9.257   -11.322 1.00 29.36  ? 105 THR A CG2   1 
ATOM   776  N  N     . ASN A 1 106 ? 16.738  9.978   -13.044 1.00 27.82  ? 106 ASN A N     1 
ATOM   777  C  CA    . ASN A 1 106 ? 15.288  9.813   -13.079 1.00 30.72  ? 106 ASN A CA    1 
ATOM   778  C  C     . ASN A 1 106 ? 14.608  11.014  -13.676 1.00 35.18  ? 106 ASN A C     1 
ATOM   779  O  O     . ASN A 1 106 ? 14.992  12.152  -13.420 1.00 35.05  ? 106 ASN A O     1 
ATOM   780  C  CB    . ASN A 1 106 ? 14.690  9.612   -11.688 1.00 31.97  ? 106 ASN A CB    1 
ATOM   781  C  CG    . ASN A 1 106 ? 15.282  8.448   -10.965 1.00 35.58  ? 106 ASN A CG    1 
ATOM   782  O  OD1   . ASN A 1 106 ? 16.352  8.556   -10.374 1.00 31.27  ? 106 ASN A OD1   1 
ATOM   783  N  ND2   . ASN A 1 106 ? 14.578  7.322   -10.985 1.00 41.42  ? 106 ASN A ND2   1 
ATOM   784  N  N     . CYS A 1 107 ? 13.571  10.752  -14.449 1.00 27.84  ? 107 CYS A N     1 
ATOM   785  C  CA    . CYS A 1 107 ? 12.785  11.814  -15.036 1.00 27.11  ? 107 CYS A CA    1 
ATOM   786  C  C     . CYS A 1 107 ? 11.328  11.392  -15.039 1.00 32.92  ? 107 CYS A C     1 
ATOM   787  O  O     . CYS A 1 107 ? 10.946  10.474  -15.758 1.00 36.84  ? 107 CYS A O     1 
ATOM   788  C  CB    . CYS A 1 107 ? 13.267  12.117  -16.449 1.00 30.09  ? 107 CYS A CB    1 
ATOM   789  S  SG    . CYS A 1 107 ? 12.341  13.442  -17.241 1.00 46.56  ? 107 CYS A SG    1 
ATOM   790  N  N     . GLU A 1 108 ? 10.520  12.051  -14.219 1.00 26.62  ? 108 GLU A N     1 
ATOM   791  C  CA    . GLU A 1 108 ? 9.112   11.722  -14.129 1.00 35.05  ? 108 GLU A CA    1 
ATOM   792  C  C     . GLU A 1 108 ? 8.229   12.902  -14.527 1.00 28.43  ? 108 GLU A C     1 
ATOM   793  O  O     . GLU A 1 108 ? 8.240   13.932  -13.868 1.00 34.82  ? 108 GLU A O     1 
ATOM   794  C  CB    . GLU A 1 108 ? 8.780   11.269  -12.703 1.00 43.61  ? 108 GLU A CB    1 
ATOM   795  C  CG    . GLU A 1 108 ? 7.307   11.021  -12.471 1.00 53.82  ? 108 GLU A CG    1 
ATOM   796  C  CD    . GLU A 1 108 ? 7.018   10.499  -11.077 1.00 61.28  ? 108 GLU A CD    1 
ATOM   797  O  OE1   . GLU A 1 108 ? 7.966   10.402  -10.259 1.00 62.34  ? 108 GLU A OE1   1 
ATOM   798  O  OE2   . GLU A 1 108 ? 5.837   10.186  -10.806 1.00 65.22  ? 108 GLU A OE2   1 
ATOM   799  N  N     . GLN A 1 109 ? 7.435   12.749  -15.584 1.00 25.88  ? 109 GLN A N     1 
ATOM   800  C  CA    . GLN A 1 109 ? 6.568   13.841  -16.026 1.00 25.48  ? 109 GLN A CA    1 
ATOM   801  C  C     . GLN A 1 109 ? 5.100   13.528  -15.800 1.00 31.15  ? 109 GLN A C     1 
ATOM   802  O  O     . GLN A 1 109 ? 4.672   12.415  -16.047 1.00 27.05  ? 109 GLN A O     1 
ATOM   803  C  CB    . GLN A 1 109 ? 6.783   14.151  -17.511 1.00 24.73  ? 109 GLN A CB    1 
ATOM   804  C  CG    . GLN A 1 109 ? 8.202   14.540  -17.828 1.00 25.72  ? 109 GLN A CG    1 
ATOM   805  C  CD    . GLN A 1 109 ? 8.379   15.090  -19.225 1.00 27.02  ? 109 GLN A CD    1 
ATOM   806  O  OE1   . GLN A 1 109 ? 7.621   14.769  -20.154 1.00 24.93  ? 109 GLN A OE1   1 
ATOM   807  N  NE2   . GLN A 1 109 ? 9.382   15.944  -19.383 1.00 26.40  ? 109 GLN A NE2   1 
ATOM   808  N  N     . THR A 1 110 ? 4.347   14.524  -15.343 1.00 26.32  ? 110 THR A N     1 
ATOM   809  C  CA    . THR A 1 110 ? 2.910   14.393  -15.140 1.00 27.89  ? 110 THR A CA    1 
ATOM   810  C  C     . THR A 1 110 ? 2.176   15.387  -16.016 1.00 31.16  ? 110 THR A C     1 
ATOM   811  O  O     . THR A 1 110 ? 2.518   16.575  -16.045 1.00 26.10  ? 110 THR A O     1 
ATOM   812  C  CB    . THR A 1 110 ? 2.539   14.611  -13.654 1.00 27.98  ? 110 THR A CB    1 
ATOM   813  O  OG1   . THR A 1 110 ? 3.140   13.569  -12.894 1.00 28.60  ? 110 THR A OG1   1 
ATOM   814  C  CG2   . THR A 1 110 ? 1.043   14.564  -13.454 1.00 36.17  ? 110 THR A CG2   1 
ATOM   815  N  N     . TYR A 1 111 ? 1.188   14.887  -16.754 1.00 31.01  ? 111 TYR A N     1 
ATOM   816  C  CA    . TYR A 1 111 ? 0.412   15.699  -17.687 1.00 27.01  ? 111 TYR A CA    1 
ATOM   817  C  C     . TYR A 1 111 ? -1.023  15.837  -17.203 1.00 31.84  ? 111 TYR A C     1 
ATOM   818  O  O     . TYR A 1 111 ? -1.787  14.868  -17.231 1.00 31.49  ? 111 TYR A O     1 
ATOM   819  C  CB    . TYR A 1 111 ? 0.432   15.075  -19.088 1.00 26.64  ? 111 TYR A CB    1 
ATOM   820  C  CG    . TYR A 1 111 ? 1.798   14.570  -19.482 1.00 26.01  ? 111 TYR A CG    1 
ATOM   821  C  CD1   . TYR A 1 111 ? 2.844   15.454  -19.730 1.00 26.86  ? 111 TYR A CD1   1 
ATOM   822  C  CD2   . TYR A 1 111 ? 2.050   13.211  -19.593 1.00 26.41  ? 111 TYR A CD2   1 
ATOM   823  C  CE1   . TYR A 1 111 ? 4.098   14.998  -20.086 1.00 26.37  ? 111 TYR A CE1   1 
ATOM   824  C  CE2   . TYR A 1 111 ? 3.304   12.746  -19.952 1.00 31.31  ? 111 TYR A CE2   1 
ATOM   825  C  CZ    . TYR A 1 111 ? 4.324   13.646  -20.193 1.00 26.57  ? 111 TYR A CZ    1 
ATOM   826  O  OH    . TYR A 1 111 ? 5.568   13.181  -20.554 1.00 24.74  ? 111 TYR A OH    1 
ATOM   827  N  N     . HIS A 1 112 ? -1.388  17.039  -16.773 1.00 30.43  ? 112 HIS A N     1 
ATOM   828  C  CA    . HIS A 1 112 ? -2.715  17.272  -16.222 1.00 29.01  ? 112 HIS A CA    1 
ATOM   829  C  C     . HIS A 1 112 ? -3.762  17.279  -17.335 1.00 29.15  ? 112 HIS A C     1 
ATOM   830  O  O     . HIS A 1 112 ? -4.871  16.784  -17.153 1.00 35.76  ? 112 HIS A O     1 
ATOM   831  C  CB    . HIS A 1 112 ? -2.740  18.581  -15.451 1.00 28.86  ? 112 HIS A CB    1 
ATOM   832  C  CG    . HIS A 1 112 ? -1.984  18.530  -14.154 1.00 35.13  ? 112 HIS A CG    1 
ATOM   833  N  ND1   . HIS A 1 112 ? -2.167  17.526  -13.226 1.00 44.15  ? 112 HIS A ND1   1 
ATOM   834  C  CD2   . HIS A 1 112 ? -1.056  19.363  -13.625 1.00 37.74  ? 112 HIS A CD2   1 
ATOM   835  C  CE1   . HIS A 1 112 ? -1.385  17.742  -12.183 1.00 43.40  ? 112 HIS A CE1   1 
ATOM   836  N  NE2   . HIS A 1 112 ? -0.696  18.847  -12.404 1.00 38.99  ? 112 HIS A NE2   1 
ATOM   837  N  N     . ARG A 1 113 ? -3.394  17.838  -18.483 1.00 28.34  ? 113 ARG A N     1 
ATOM   838  C  CA    . ARG A 1 113 ? -4.244  17.792  -19.673 1.00 30.38  ? 113 ARG A CA    1 
ATOM   839  C  C     . ARG A 1 113 ? -3.397  17.927  -20.931 1.00 27.79  ? 113 ARG A C     1 
ATOM   840  O  O     . ARG A 1 113 ? -2.223  18.304  -20.855 1.00 26.91  ? 113 ARG A O     1 
ATOM   841  C  CB    . ARG A 1 113 ? -5.284  18.907  -19.659 1.00 29.15  ? 113 ARG A CB    1 
ATOM   842  C  CG    . ARG A 1 113 ? -4.706  20.320  -19.776 1.00 28.44  ? 113 ARG A CG    1 
ATOM   843  C  CD    . ARG A 1 113 ? -5.812  21.315  -20.140 1.00 29.08  ? 113 ARG A CD    1 
ATOM   844  N  NE    . ARG A 1 113 ? -5.406  22.724  -20.112 1.00 28.69  ? 113 ARG A NE    1 
ATOM   845  C  CZ    . ARG A 1 113 ? -5.017  23.411  -21.181 1.00 33.08  ? 113 ARG A CZ    1 
ATOM   846  N  NH1   . ARG A 1 113 ? -4.939  22.809  -22.361 1.00 33.89  ? 113 ARG A NH1   1 
ATOM   847  N  NH2   . ARG A 1 113 ? -4.678  24.690  -21.070 1.00 29.16  ? 113 ARG A NH2   1 
ATOM   848  N  N     . TYR A 1 114 ? -4.009  17.643  -22.081 1.00 28.08  ? 114 TYR A N     1 
ATOM   849  C  CA    . TYR A 1 114 ? -3.372  17.911  -23.369 1.00 33.34  ? 114 TYR A CA    1 
ATOM   850  C  C     . TYR A 1 114 ? -3.442  19.394  -23.730 1.00 27.27  ? 114 TYR A C     1 
ATOM   851  O  O     . TYR A 1 114 ? -4.396  20.096  -23.376 1.00 33.25  ? 114 TYR A O     1 
ATOM   852  C  CB    . TYR A 1 114 ? -4.023  17.084  -24.480 1.00 28.87  ? 114 TYR A CB    1 
ATOM   853  C  CG    . TYR A 1 114 ? -3.654  15.621  -24.472 1.00 31.39  ? 114 TYR A CG    1 
ATOM   854  C  CD1   . TYR A 1 114 ? -3.893  14.830  -23.353 1.00 35.49  ? 114 TYR A CD1   1 
ATOM   855  C  CD2   . TYR A 1 114 ? -3.090  15.023  -25.589 1.00 28.10  ? 114 TYR A CD2   1 
ATOM   856  C  CE1   . TYR A 1 114 ? -3.555  13.490  -23.341 1.00 36.33  ? 114 TYR A CE1   1 
ATOM   857  C  CE2   . TYR A 1 114 ? -2.764  13.686  -25.597 1.00 28.36  ? 114 TYR A CE2   1 
ATOM   858  C  CZ    . TYR A 1 114 ? -3.001  12.920  -24.470 1.00 28.81  ? 114 TYR A CZ    1 
ATOM   859  O  OH    . TYR A 1 114 ? -2.669  11.586  -24.448 1.00 29.21  ? 114 TYR A OH    1 
ATOM   860  N  N     . LEU A 1 115 ? -2.436  19.852  -24.467 1.00 26.59  ? 115 LEU A N     1 
ATOM   861  C  CA    . LEU A 1 115 ? -2.340  21.239  -24.911 1.00 28.24  ? 115 LEU A CA    1 
ATOM   862  C  C     . LEU A 1 115 ? -2.777  21.393  -26.359 1.00 26.91  ? 115 LEU A C     1 
ATOM   863  O  O     . LEU A 1 115 ? -2.707  20.448  -27.160 1.00 27.05  ? 115 LEU A O     1 
ATOM   864  C  CB    . LEU A 1 115 ? -0.907  21.763  -24.770 1.00 26.62  ? 115 LEU A CB    1 
ATOM   865  C  CG    . LEU A 1 115 ? -0.287  21.654  -23.386 1.00 25.23  ? 115 LEU A CG    1 
ATOM   866  C  CD1   . LEU A 1 115 ? 1.040   22.369  -23.381 1.00 30.93  ? 115 LEU A CD1   1 
ATOM   867  C  CD2   . LEU A 1 115 ? -1.261  22.239  -22.344 1.00 29.65  ? 115 LEU A CD2   1 
ATOM   868  N  N     . LEU A 1 116 ? -3.194  22.602  -26.707 1.00 28.44  ? 116 LEU A N     1 
ATOM   869  C  CA    . LEU A 1 116 ? -3.671  22.862  -28.059 1.00 29.34  ? 116 LEU A CA    1 
ATOM   870  C  C     . LEU A 1 116 ? -2.747  23.848  -28.741 1.00 27.60  ? 116 LEU A C     1 
ATOM   871  O  O     . LEU A 1 116 ? -2.223  24.739  -28.096 1.00 27.24  ? 116 LEU A O     1 
ATOM   872  C  CB    . LEU A 1 116 ? -5.109  23.408  -28.030 1.00 33.93  ? 116 LEU A CB    1 
ATOM   873  C  CG    . LEU A 1 116 ? -6.160  22.584  -27.287 1.00 36.65  ? 116 LEU A CG    1 
ATOM   874  C  CD1   . LEU A 1 116 ? -7.397  23.428  -26.995 1.00 40.70  ? 116 LEU A CD1   1 
ATOM   875  C  CD2   . LEU A 1 116 ? -6.547  21.351  -28.081 1.00 35.09  ? 116 LEU A CD2   1 
ATOM   876  N  N     . PRO A 1 117 ? -2.535  23.682  -30.058 1.00 27.93  ? 117 PRO A N     1 
ATOM   877  C  CA    . PRO A 1 117 ? -1.855  24.718  -30.840 1.00 28.06  ? 117 PRO A CA    1 
ATOM   878  C  C     . PRO A 1 117 ? -2.373  26.117  -30.505 1.00 30.14  ? 117 PRO A C     1 
ATOM   879  O  O     . PRO A 1 117 ? -3.581  26.321  -30.400 1.00 32.62  ? 117 PRO A O     1 
ATOM   880  C  CB    . PRO A 1 117 ? -2.181  24.326  -32.281 1.00 28.86  ? 117 PRO A CB    1 
ATOM   881  C  CG    . PRO A 1 117 ? -2.242  22.816  -32.219 1.00 31.02  ? 117 PRO A CG    1 
ATOM   882  C  CD    . PRO A 1 117 ? -2.858  22.494  -30.860 1.00 30.16  ? 117 PRO A CD    1 
ATOM   883  N  N     . GLY A 1 118 ? -1.463  27.060  -30.310 1.00 28.19  ? 118 GLY A N     1 
ATOM   884  C  CA    . GLY A 1 118 ? -1.843  28.402  -29.931 1.00 28.65  ? 118 GLY A CA    1 
ATOM   885  C  C     . GLY A 1 118 ? -1.668  28.682  -28.443 1.00 28.07  ? 118 GLY A C     1 
ATOM   886  O  O     . GLY A 1 118 ? -1.424  29.826  -28.062 1.00 29.03  ? 118 GLY A O     1 
ATOM   887  N  N     . GLU A 1 119 ? -1.772  27.653  -27.604 1.00 29.38  ? 119 GLU A N     1 
ATOM   888  C  CA    . GLU A 1 119 ? -1.553  27.834  -26.157 1.00 30.70  ? 119 GLU A CA    1 
ATOM   889  C  C     . GLU A 1 119 ? -0.082  28.089  -25.890 1.00 39.43  ? 119 GLU A C     1 
ATOM   890  O  O     . GLU A 1 119 ? 0.772   27.461  -26.512 1.00 33.97  ? 119 GLU A O     1 
ATOM   891  C  CB    . GLU A 1 119 ? -2.023  26.615  -25.368 1.00 31.05  ? 119 GLU A CB    1 
ATOM   892  C  CG    . GLU A 1 119 ? -3.522  26.425  -25.437 1.00 34.42  ? 119 GLU A CG    1 
ATOM   893  C  CD    . GLU A 1 119 ? -4.041  25.423  -24.429 1.00 37.41  ? 119 GLU A CD    1 
ATOM   894  O  OE1   . GLU A 1 119 ? -3.762  24.213  -24.583 1.00 32.66  ? 119 GLU A OE1   1 
ATOM   895  O  OE2   . GLU A 1 119 ? -4.746  25.849  -23.481 1.00 35.50  ? 119 GLU A OE2   1 
ATOM   896  N  N     . GLN A 1 120 ? 0.220   29.023  -24.994 1.00 30.58  ? 120 GLN A N     1 
ATOM   897  C  CA    . GLN A 1 120 ? 1.609   29.305  -24.689 1.00 32.48  ? 120 GLN A CA    1 
ATOM   898  C  C     . GLN A 1 120 ? 1.929   28.980  -23.234 1.00 25.58  ? 120 GLN A C     1 
ATOM   899  O  O     . GLN A 1 120 ? 1.230   29.384  -22.287 1.00 25.93  ? 120 GLN A O     1 
ATOM   900  C  CB    . GLN A 1 120 ? 1.971   30.755  -24.993 1.00 39.54  ? 120 GLN A CB    1 
ATOM   901  C  CG    . GLN A 1 120 ? 3.482   31.022  -25.000 1.00 39.21  ? 120 GLN A CG    1 
ATOM   902  C  CD    . GLN A 1 120 ? 3.863   32.213  -25.869 1.00 37.47  ? 120 GLN A CD    1 
ATOM   903  O  OE1   . GLN A 1 120 ? 2.998   32.954  -26.338 1.00 46.76  ? 120 GLN A OE1   1 
ATOM   904  N  NE2   . GLN A 1 120 ? 5.153   32.397  -26.091 1.00 42.65  ? 120 GLN A NE2   1 
ATOM   905  N  N     . VAL A 1 121 ? 3.027   28.253  -23.093 1.00 25.88  ? 121 VAL A N     1 
ATOM   906  C  CA    . VAL A 1 121 ? 3.438   27.618  -21.854 1.00 24.32  ? 121 VAL A CA    1 
ATOM   907  C  C     . VAL A 1 121 ? 4.500   28.462  -21.177 1.00 24.21  ? 121 VAL A C     1 
ATOM   908  O  O     . VAL A 1 121 ? 5.279   29.147  -21.848 1.00 24.22  ? 121 VAL A O     1 
ATOM   909  C  CB    . VAL A 1 121 ? 3.997   26.189  -22.157 1.00 35.08  ? 121 VAL A CB    1 
ATOM   910  C  CG1   . VAL A 1 121 ? 4.553   25.533  -20.928 1.00 37.85  ? 121 VAL A CG1   1 
ATOM   911  C  CG2   . VAL A 1 121 ? 2.910   25.318  -22.789 1.00 35.20  ? 121 VAL A CG2   1 
ATOM   912  N  N     . SER A 1 122 ? 4.517   28.423  -19.841 1.00 24.24  ? 122 SER A N     1 
ATOM   913  C  CA    . SER A 1 122 ? 5.598   28.996  -19.075 1.00 24.17  ? 122 SER A CA    1 
ATOM   914  C  C     . SER A 1 122 ? 6.187   27.900  -18.194 1.00 23.82  ? 122 SER A C     1 
ATOM   915  O  O     . SER A 1 122 ? 5.523   26.909  -17.902 1.00 28.81  ? 122 SER A O     1 
ATOM   916  C  CB    . SER A 1 122 ? 5.113   30.154  -18.209 1.00 30.54  ? 122 SER A CB    1 
ATOM   917  O  OG    . SER A 1 122 ? 4.310   29.643  -17.162 1.00 35.91  ? 122 SER A OG    1 
ATOM   918  N  N     . ILE A 1 123 ? 7.428   28.091  -17.781 1.00 24.42  ? 123 ILE A N     1 
ATOM   919  C  CA    . ILE A 1 123 ? 8.106   27.134  -16.912 1.00 23.46  ? 123 ILE A CA    1 
ATOM   920  C  C     . ILE A 1 123 ? 8.655   27.801  -15.649 1.00 25.19  ? 123 ILE A C     1 
ATOM   921  O  O     . ILE A 1 123 ? 9.248   28.877  -15.713 1.00 24.90  ? 123 ILE A O     1 
ATOM   922  C  CB    . ILE A 1 123 ? 9.260   26.411  -17.681 1.00 22.96  ? 123 ILE A CB    1 
ATOM   923  C  CG1   . ILE A 1 123 ? 9.977   25.400  -16.796 1.00 22.98  ? 123 ILE A CG1   1 
ATOM   924  C  CG2   . ILE A 1 123 ? 10.273  27.407  -18.265 1.00 24.12  ? 123 ILE A CG2   1 
ATOM   925  C  CD1   . ILE A 1 123 ? 11.044  24.585  -17.569 1.00 22.50  ? 123 ILE A CD1   1 
ATOM   926  N  N     . SER A 1 124 ? 8.427   27.153  -14.508 1.00 24.10  ? 124 SER A N     1 
ATOM   927  C  CA    . SER A 1 124 ? 9.056   27.533  -13.245 1.00 24.55  ? 124 SER A CA    1 
ATOM   928  C  C     . SER A 1 124 ? 9.761   26.321  -12.608 1.00 24.50  ? 124 SER A C     1 
ATOM   929  O  O     . SER A 1 124 ? 9.237   25.208  -12.653 1.00 25.38  ? 124 SER A O     1 
ATOM   930  C  CB    . SER A 1 124 ? 8.010   28.107  -12.283 1.00 31.51  ? 124 SER A CB    1 
ATOM   931  O  OG    . SER A 1 124 ? 8.643   28.685  -11.144 1.00 36.49  ? 124 SER A OG    1 
ATOM   932  N  N     . ALA A 1 125 ? 10.927  26.545  -11.999 1.00 24.67  ? 125 ALA A N     1 
ATOM   933  C  CA    . ALA A 1 125 ? 11.730  25.464  -11.409 1.00 24.75  ? 125 ALA A CA    1 
ATOM   934  C  C     . ALA A 1 125 ? 11.995  25.684  -9.921  1.00 26.27  ? 125 ALA A C     1 
ATOM   935  O  O     . ALA A 1 125 ? 12.224  26.808  -9.488  1.00 26.04  ? 125 ALA A O     1 
ATOM   936  C  CB    . ALA A 1 125 ? 13.060  25.326  -12.160 1.00 25.72  ? 125 ALA A CB    1 
ATOM   937  N  N     . GLU A 1 126 ? 11.966  24.604  -9.143  1.00 27.50  ? 126 GLU A N     1 
ATOM   938  C  CA    . GLU A 1 126 ? 12.228  24.669  -7.704  1.00 26.95  ? 126 GLU A CA    1 
ATOM   939  C  C     . GLU A 1 126 ? 13.118  23.515  -7.283  1.00 27.19  ? 126 GLU A C     1 
ATOM   940  O  O     . GLU A 1 126 ? 13.061  22.446  -7.863  1.00 26.80  ? 126 GLU A O     1 
ATOM   941  C  CB    . GLU A 1 126 ? 10.915  24.633  -6.908  1.00 27.71  ? 126 GLU A CB    1 
ATOM   942  C  CG    . GLU A 1 126 ? 10.988  25.285  -5.571  1.00 39.22  ? 126 GLU A CG    1 
ATOM   943  C  CD    . GLU A 1 126 ? 9.619   25.396  -4.919  1.00 45.28  ? 126 GLU A CD    1 
ATOM   944  O  OE1   . GLU A 1 126 ? 9.556   25.708  -3.712  1.00 49.81  ? 126 GLU A OE1   1 
ATOM   945  O  OE2   . GLU A 1 126 ? 8.610   25.168  -5.624  1.00 44.23  ? 126 GLU A OE2   1 
ATOM   946  N  N     . LEU A 1 127 ? 13.955  23.734  -6.277  1.00 27.93  ? 127 LEU A N     1 
ATOM   947  C  CA    . LEU A 1 127 ? 14.791  22.663  -5.750  1.00 32.79  ? 127 LEU A CA    1 
ATOM   948  C  C     . LEU A 1 127 ? 13.971  21.738  -4.836  1.00 33.98  ? 127 LEU A C     1 
ATOM   949  O  O     . LEU A 1 127 ? 13.218  22.215  -3.988  1.00 32.80  ? 127 LEU A O     1 
ATOM   950  C  CB    . LEU A 1 127 ? 15.970  23.256  -4.984  1.00 32.21  ? 127 LEU A CB    1 
ATOM   951  C  CG    . LEU A 1 127 ? 17.240  22.435  -4.855  1.00 36.82  ? 127 LEU A CG    1 
ATOM   952  C  CD1   . LEU A 1 127 ? 17.901  22.284  -6.213  1.00 38.93  ? 127 LEU A CD1   1 
ATOM   953  C  CD2   . LEU A 1 127 ? 18.170  23.114  -3.860  1.00 36.08  ? 127 LEU A CD2   1 
ATOM   954  N  N     . GLY A 1 128 ? 14.109  20.425  -5.014  1.00 35.03  ? 128 GLY A N     1 
ATOM   955  C  CA    . GLY A 1 128 ? 13.414  19.466  -4.163  1.00 33.55  ? 128 GLY A CA    1 
ATOM   956  C  C     . GLY A 1 128 ? 14.381  18.870  -3.162  1.00 35.44  ? 128 GLY A C     1 
ATOM   957  O  O     . GLY A 1 128 ? 15.309  19.549  -2.724  1.00 34.56  ? 128 GLY A O     1 
ATOM   958  N  N     . ASP A 1 129 ? 14.190  17.601  -2.810  1.00 35.28  ? 129 ASP A N     1 
ATOM   959  C  CA    . ASP A 1 129 ? 15.097  16.928  -1.882  1.00 33.38  ? 129 ASP A CA    1 
ATOM   960  C  C     . ASP A 1 129 ? 16.536  16.833  -2.396  1.00 33.35  ? 129 ASP A C     1 
ATOM   961  O  O     . ASP A 1 129 ? 16.791  16.500  -3.560  1.00 31.73  ? 129 ASP A O     1 
ATOM   962  C  CB    . ASP A 1 129 ? 14.588  15.524  -1.555  1.00 37.99  ? 129 ASP A CB    1 
ATOM   963  C  CG    . ASP A 1 129 ? 13.361  15.541  -0.669  1.00 47.09  ? 129 ASP A CG    1 
ATOM   964  O  OD1   . ASP A 1 129 ? 13.117  16.572  -0.009  1.00 46.64  ? 129 ASP A OD1   1 
ATOM   965  O  OD2   . ASP A 1 129 ? 12.641  14.520  -0.635  1.00 55.25  ? 129 ASP A OD2   1 
ATOM   966  N  N     . VAL A 1 130 ? 17.480  17.129  -1.510  1.00 33.69  ? 130 VAL A N     1 
ATOM   967  C  CA    . VAL A 1 130 ? 18.881  16.911  -1.817  1.00 33.54  ? 130 VAL A CA    1 
ATOM   968  C  C     . VAL A 1 130 ? 19.440  15.918  -0.800  1.00 35.10  ? 130 VAL A C     1 
ATOM   969  O  O     . VAL A 1 130 ? 19.425  16.163  0.413   1.00 36.43  ? 130 VAL A O     1 
ATOM   970  C  CB    . VAL A 1 130 ? 19.675  18.221  -1.812  1.00 33.22  ? 130 VAL A CB    1 
ATOM   971  C  CG1   . VAL A 1 130 ? 21.159  17.950  -2.036  1.00 33.68  ? 130 VAL A CG1   1 
ATOM   972  C  CG2   . VAL A 1 130 ? 19.125  19.172  -2.874  1.00 31.81  ? 130 VAL A CG2   1 
ATOM   973  N  N     . VAL A 1 131 ? 19.912  14.784  -1.301  1.00 41.54  ? 131 VAL A N     1 
ATOM   974  C  CA    . VAL A 1 131 ? 20.253  13.662  -0.435  1.00 41.26  ? 131 VAL A CA    1 
ATOM   975  C  C     . VAL A 1 131 ? 21.694  13.220  -0.618  1.00 42.70  ? 131 VAL A C     1 
ATOM   976  O  O     . VAL A 1 131 ? 22.128  12.978  -1.740  1.00 40.52  ? 131 VAL A O     1 
ATOM   977  C  CB    . VAL A 1 131 ? 19.319  12.472  -0.700  1.00 44.18  ? 131 VAL A CB    1 
ATOM   978  C  CG1   . VAL A 1 131 ? 19.723  11.271  0.144   1.00 49.81  ? 131 VAL A CG1   1 
ATOM   979  C  CG2   . VAL A 1 131 ? 17.884  12.870  -0.414  1.00 45.93  ? 131 VAL A CG2   1 
ATOM   980  N  N     . GLY A 1 132 ? 22.434  13.103  0.486   1.00 38.43  ? 132 GLY A N     1 
ATOM   981  C  CA    . GLY A 1 132 ? 23.827  12.704  0.410   1.00 38.88  ? 132 GLY A CA    1 
ATOM   982  C  C     . GLY A 1 132 ? 24.613  12.971  1.686   1.00 43.81  ? 132 GLY A C     1 
ATOM   983  O  O     . GLY A 1 132 ? 24.068  13.485  2.666   1.00 45.87  ? 132 GLY A O     1 
ATOM   984  N  N     . PRO A 1 133 ? 25.908  12.616  1.686   1.00 44.36  ? 133 PRO A N     1 
ATOM   985  C  CA    . PRO A 1 133 ? 26.607  11.940  0.588   1.00 46.67  ? 133 PRO A CA    1 
ATOM   986  C  C     . PRO A 1 133 ? 26.309  10.440  0.543   1.00 50.64  ? 133 PRO A C     1 
ATOM   987  O  O     . PRO A 1 133 ? 26.104  9.834   1.595   1.00 53.70  ? 133 PRO A O     1 
ATOM   988  C  CB    . PRO A 1 133 ? 28.079  12.194  0.911   1.00 44.64  ? 133 PRO A CB    1 
ATOM   989  C  CG    . PRO A 1 133 ? 28.116  12.289  2.404   1.00 49.53  ? 133 PRO A CG    1 
ATOM   990  C  CD    . PRO A 1 133 ? 26.804  12.900  2.824   1.00 48.23  ? 133 PRO A CD    1 
ATOM   991  N  N     . LYS A 1 134 ? 26.284  9.857   -0.654  1.00 51.60  ? 134 LYS A N     1 
ATOM   992  C  CA    . LYS A 1 134 ? 26.023  8.427   -0.813  1.00 54.21  ? 134 LYS A CA    1 
ATOM   993  C  C     . LYS A 1 134 ? 27.083  7.752   -1.680  1.00 56.24  ? 134 LYS A C     1 
ATOM   994  O  O     . LYS A 1 134 ? 27.686  8.388   -2.542  1.00 57.01  ? 134 LYS A O     1 
ATOM   995  C  CB    . LYS A 1 134 ? 24.631  8.195   -1.406  1.00 55.86  ? 134 LYS A CB    1 
ATOM   996  C  CG    . LYS A 1 134 ? 23.515  8.259   -0.376  1.00 58.73  ? 134 LYS A CG    1 
ATOM   997  C  CD    . LYS A 1 134 ? 22.155  7.962   -0.993  1.00 58.69  ? 134 LYS A CD    1 
ATOM   998  C  CE    . LYS A 1 134 ? 21.090  7.754   0.089   1.00 57.97  ? 134 LYS A CE    1 
ATOM   999  N  NZ    . LYS A 1 134 ? 21.440  6.649   1.043   1.00 63.86  ? 134 LYS A NZ    1 
ATOM   1000 N  N     . GLN A 1 135 ? 27.314  6.464   -1.433  1.00 55.88  ? 135 GLN A N     1 
ATOM   1001 C  CA    . GLN A 1 135 ? 28.301  5.697   -2.189  1.00 53.55  ? 135 GLN A CA    1 
ATOM   1002 C  C     . GLN A 1 135 ? 27.641  5.026   -3.388  1.00 53.00  ? 135 GLN A C     1 
ATOM   1003 O  O     . GLN A 1 135 ? 26.688  4.261   -3.234  1.00 53.32  ? 135 GLN A O     1 
ATOM   1004 C  CB    . GLN A 1 135 ? 28.972  4.655   -1.294  1.00 55.76  ? 135 GLN A CB    1 
ATOM   1005 C  CG    . GLN A 1 135 ? 29.300  5.180   0.090   1.00 59.13  ? 135 GLN A CG    1 
ATOM   1006 C  CD    . GLN A 1 135 ? 30.237  6.373   0.055   1.00 61.63  ? 135 GLN A CD    1 
ATOM   1007 O  OE1   . GLN A 1 135 ? 31.265  6.353   -0.627  1.00 62.64  ? 135 GLN A OE1   1 
ATOM   1008 N  NE2   . GLN A 1 135 ? 29.883  7.426   0.790   1.00 60.33  ? 135 GLN A NE2   1 
ATOM   1009 N  N     . THR A 1 136 ? 28.137  5.337   -4.583  1.00 54.68  ? 136 THR A N     1 
ATOM   1010 C  CA    . THR A 1 136 ? 27.550  4.832   -5.826  1.00 51.33  ? 136 THR A CA    1 
ATOM   1011 C  C     . THR A 1 136 ? 28.608  4.247   -6.751  1.00 51.34  ? 136 THR A C     1 
ATOM   1012 O  O     . THR A 1 136 ? 29.799  4.453   -6.538  1.00 52.79  ? 136 THR A O     1 
ATOM   1013 C  CB    . THR A 1 136 ? 26.803  5.942   -6.607  1.00 44.95  ? 136 THR A CB    1 
ATOM   1014 O  OG1   . THR A 1 136 ? 27.755  6.768   -7.290  1.00 41.11  ? 136 THR A OG1   1 
ATOM   1015 C  CG2   . THR A 1 136 ? 25.963  6.797   -5.665  1.00 43.76  ? 136 THR A CG2   1 
ATOM   1016 N  N     . ALA A 1 137 ? 28.163  3.552   -7.797  1.00 53.46  ? 137 ALA A N     1 
ATOM   1017 C  CA    . ALA A 1 137 ? 29.071  2.932   -8.763  1.00 51.78  ? 137 ALA A CA    1 
ATOM   1018 C  C     . ALA A 1 137 ? 30.019  3.952   -9.385  1.00 50.64  ? 137 ALA A C     1 
ATOM   1019 O  O     . ALA A 1 137 ? 31.149  3.628   -9.748  1.00 52.98  ? 137 ALA A O     1 
ATOM   1020 C  CB    . ALA A 1 137 ? 28.279  2.220   -9.850  1.00 48.84  ? 137 ALA A CB    1 
ATOM   1021 N  N     . LEU A 1 138 ? 29.558  5.192   -9.491  1.00 44.76  ? 138 LEU A N     1 
ATOM   1022 C  CA    . LEU A 1 138 ? 30.351  6.248   -10.098 1.00 41.71  ? 138 LEU A CA    1 
ATOM   1023 C  C     . LEU A 1 138 ? 31.170  6.988   -9.057  1.00 46.62  ? 138 LEU A C     1 
ATOM   1024 O  O     . LEU A 1 138 ? 31.934  7.896   -9.393  1.00 49.33  ? 138 LEU A O     1 
ATOM   1025 C  CB    . LEU A 1 138 ? 29.443  7.230   -10.846 1.00 41.11  ? 138 LEU A CB    1 
ATOM   1026 C  CG    . LEU A 1 138 ? 28.361  6.591   -11.714 1.00 44.36  ? 138 LEU A CG    1 
ATOM   1027 C  CD1   . LEU A 1 138 ? 27.470  7.652   -12.338 1.00 36.94  ? 138 LEU A CD1   1 
ATOM   1028 C  CD2   . LEU A 1 138 ? 28.993  5.723   -12.786 1.00 45.83  ? 138 LEU A CD2   1 
ATOM   1029 N  N     . GLY A 1 139 ? 31.009  6.600   -7.792  1.00 53.26  ? 139 GLY A N     1 
ATOM   1030 C  CA    . GLY A 1 139 ? 31.701  7.257   -6.698  1.00 52.62  ? 139 GLY A CA    1 
ATOM   1031 C  C     . GLY A 1 139 ? 30.775  7.918   -5.689  1.00 50.84  ? 139 GLY A C     1 
ATOM   1032 O  O     . GLY A 1 139 ? 29.551  7.816   -5.787  1.00 51.97  ? 139 GLY A O     1 
ATOM   1033 N  N     . GLU A 1 140 ? 31.361  8.592   -4.704  1.00 50.93  ? 140 GLU A N     1 
ATOM   1034 C  CA    . GLU A 1 140 ? 30.572  9.292   -3.697  1.00 47.61  ? 140 GLU A CA    1 
ATOM   1035 C  C     . GLU A 1 140 ? 29.846  10.468  -4.339  1.00 43.15  ? 140 GLU A C     1 
ATOM   1036 O  O     . GLU A 1 140 ? 30.408  11.179  -5.174  1.00 37.18  ? 140 GLU A O     1 
ATOM   1037 C  CB    . GLU A 1 140 ? 31.454  9.772   -2.545  1.00 50.34  ? 140 GLU A CB    1 
ATOM   1038 C  CG    . GLU A 1 140 ? 30.685  10.438  -1.418  1.00 55.43  ? 140 GLU A CG    1 
ATOM   1039 C  CD    . GLU A 1 140 ? 31.589  10.953  -0.310  1.00 61.76  ? 140 GLU A CD    1 
ATOM   1040 O  OE1   . GLU A 1 140 ? 32.403  11.868  -0.572  1.00 63.42  ? 140 GLU A OE1   1 
ATOM   1041 O  OE2   . GLU A 1 140 ? 31.482  10.438  0.823   1.00 65.10  ? 140 GLU A OE2   1 
ATOM   1042 N  N     . GLY A 1 141 ? 28.592  10.674  -3.954  1.00 43.86  ? 141 GLY A N     1 
ATOM   1043 C  CA    . GLY A 1 141 ? 27.813  11.721  -4.573  1.00 41.59  ? 141 GLY A CA    1 
ATOM   1044 C  C     . GLY A 1 141 ? 26.556  12.107  -3.834  1.00 41.40  ? 141 GLY A C     1 
ATOM   1045 O  O     . GLY A 1 141 ? 26.214  11.522  -2.804  1.00 39.39  ? 141 GLY A O     1 
ATOM   1046 N  N     . TRP A 1 142 ? 25.873  13.111  -4.375  1.00 37.77  ? 142 TRP A N     1 
ATOM   1047 C  CA    . TRP A 1 142 ? 24.630  13.617  -3.811  1.00 31.66  ? 142 TRP A CA    1 
ATOM   1048 C  C     . TRP A 1 142 ? 23.534  13.555  -4.868  1.00 34.44  ? 142 TRP A C     1 
ATOM   1049 O  O     . TRP A 1 142 ? 23.742  13.998  -5.999  1.00 31.49  ? 142 TRP A O     1 
ATOM   1050 C  CB    . TRP A 1 142 ? 24.794  15.057  -3.328  1.00 31.85  ? 142 TRP A CB    1 
ATOM   1051 C  CG    . TRP A 1 142 ? 25.693  15.222  -2.113  1.00 36.23  ? 142 TRP A CG    1 
ATOM   1052 C  CD1   . TRP A 1 142 ? 27.019  14.932  -2.024  1.00 36.76  ? 142 TRP A CD1   1 
ATOM   1053 C  CD2   . TRP A 1 142 ? 25.311  15.757  -0.842  1.00 38.15  ? 142 TRP A CD2   1 
ATOM   1054 N  NE1   . TRP A 1 142 ? 27.490  15.237  -0.760  1.00 41.00  ? 142 TRP A NE1   1 
ATOM   1055 C  CE2   . TRP A 1 142 ? 26.458  15.749  -0.019  1.00 40.97  ? 142 TRP A CE2   1 
ATOM   1056 C  CE3   . TRP A 1 142 ? 24.109  16.236  -0.319  1.00 34.67  ? 142 TRP A CE3   1 
ATOM   1057 C  CZ2   . TRP A 1 142 ? 26.433  16.199  1.299   1.00 45.51  ? 142 TRP A CZ2   1 
ATOM   1058 C  CZ3   . TRP A 1 142 ? 24.084  16.688  0.981   1.00 37.08  ? 142 TRP A CZ3   1 
ATOM   1059 C  CH2   . TRP A 1 142 ? 25.237  16.666  1.780   1.00 42.33  ? 142 TRP A CH2   1 
ATOM   1060 N  N     . PHE A 1 143 ? 22.375  13.018  -4.500  1.00 30.71  ? 143 PHE A N     1 
ATOM   1061 C  CA    . PHE A 1 143 ? 21.224  13.020  -5.399  1.00 30.22  ? 143 PHE A CA    1 
ATOM   1062 C  C     . PHE A 1 143 ? 20.397  14.291  -5.232  1.00 31.84  ? 143 PHE A C     1 
ATOM   1063 O  O     . PHE A 1 143 ? 19.958  14.633  -4.141  1.00 29.71  ? 143 PHE A O     1 
ATOM   1064 C  CB    . PHE A 1 143 ? 20.367  11.780  -5.160  1.00 32.33  ? 143 PHE A CB    1 
ATOM   1065 C  CG    . PHE A 1 143 ? 21.048  10.502  -5.562  1.00 35.13  ? 143 PHE A CG    1 
ATOM   1066 C  CD1   . PHE A 1 143 ? 21.804  9.786   -4.648  1.00 37.68  ? 143 PHE A CD1   1 
ATOM   1067 C  CD2   . PHE A 1 143 ? 20.952  10.029  -6.864  1.00 31.66  ? 143 PHE A CD2   1 
ATOM   1068 C  CE1   . PHE A 1 143 ? 22.441  8.618   -5.022  1.00 37.69  ? 143 PHE A CE1   1 
ATOM   1069 C  CE2   . PHE A 1 143 ? 21.581  8.864   -7.242  1.00 32.34  ? 143 PHE A CE2   1 
ATOM   1070 C  CZ    . PHE A 1 143 ? 22.328  8.157   -6.323  1.00 36.29  ? 143 PHE A CZ    1 
ATOM   1071 N  N     . ILE A 1 144 ? 20.198  14.990  -6.340  1.00 27.42  ? 144 ILE A N     1 
ATOM   1072 C  CA    . ILE A 1 144 ? 19.505  16.263  -6.344  1.00 26.89  ? 144 ILE A CA    1 
ATOM   1073 C  C     . ILE A 1 144 ? 18.231  16.198  -7.162  1.00 25.99  ? 144 ILE A C     1 
ATOM   1074 O  O     . ILE A 1 144 ? 18.275  15.872  -8.350  1.00 25.35  ? 144 ILE A O     1 
ATOM   1075 C  CB    . ILE A 1 144 ? 20.396  17.364  -6.925  1.00 26.76  ? 144 ILE A CB    1 
ATOM   1076 C  CG1   . ILE A 1 144 ? 21.647  17.539  -6.051  1.00 27.98  ? 144 ILE A CG1   1 
ATOM   1077 C  CG2   . ILE A 1 144 ? 19.609  18.653  -7.087  1.00 26.43  ? 144 ILE A CG2   1 
ATOM   1078 C  CD1   . ILE A 1 144 ? 22.810  18.128  -6.825  1.00 30.17  ? 144 ILE A CD1   1 
ATOM   1079 N  N     . ASN A 1 145 ? 17.110  16.518  -6.527  1.00 26.25  ? 145 ASN A N     1 
ATOM   1080 C  CA    . ASN A 1 145 ? 15.830  16.568  -7.222  1.00 25.78  ? 145 ASN A CA    1 
ATOM   1081 C  C     . ASN A 1 145 ? 15.430  17.986  -7.572  1.00 25.54  ? 145 ASN A C     1 
ATOM   1082 O  O     . ASN A 1 145 ? 15.579  18.904  -6.770  1.00 26.38  ? 145 ASN A O     1 
ATOM   1083 C  CB    . ASN A 1 145 ? 14.718  15.935  -6.374  1.00 33.25  ? 145 ASN A CB    1 
ATOM   1084 C  CG    . ASN A 1 145 ? 15.021  14.499  -6.002  1.00 38.11  ? 145 ASN A CG    1 
ATOM   1085 O  OD1   . ASN A 1 145 ? 14.854  13.589  -6.810  1.00 43.51  ? 145 ASN A OD1   1 
ATOM   1086 N  ND2   . ASN A 1 145 ? 15.468  14.290  -4.774  1.00 44.43  ? 145 ASN A ND2   1 
ATOM   1087 N  N     . GLN A 1 146 ? 14.904  18.151  -8.774  1.00 25.90  ? 146 GLN A N     1 
ATOM   1088 C  CA    . GLN A 1 146 ? 14.375  19.437  -9.190  1.00 26.86  ? 146 GLN A CA    1 
ATOM   1089 C  C     . GLN A 1 146 ? 12.936  19.260  -9.613  1.00 28.30  ? 146 GLN A C     1 
ATOM   1090 O  O     . GLN A 1 146 ? 12.567  18.269  -10.238 1.00 26.43  ? 146 GLN A O     1 
ATOM   1091 C  CB    . GLN A 1 146 ? 15.210  20.029  -10.324 1.00 29.67  ? 146 GLN A CB    1 
ATOM   1092 C  CG    . GLN A 1 146 ? 14.785  21.423  -10.741 1.00 42.42  ? 146 GLN A CG    1 
ATOM   1093 C  CD    . GLN A 1 146 ? 15.827  22.105  -11.596 1.00 48.93  ? 146 GLN A CD    1 
ATOM   1094 O  OE1   . GLN A 1 146 ? 15.701  22.160  -12.821 1.00 51.16  ? 146 GLN A OE1   1 
ATOM   1095 N  NE2   . GLN A 1 146 ? 16.878  22.620  -10.957 1.00 53.59  ? 146 GLN A NE2   1 
ATOM   1096 N  N     . HIS A 1 147 ? 12.121  20.236  -9.269  1.00 24.29  ? 147 HIS A N     1 
ATOM   1097 C  CA    . HIS A 1 147 ? 10.715  20.138  -9.543  1.00 26.73  ? 147 HIS A CA    1 
ATOM   1098 C  C     . HIS A 1 147 ? 10.295  21.260  -10.482 1.00 25.97  ? 147 HIS A C     1 
ATOM   1099 O  O     . HIS A 1 147 ? 10.443  22.445  -10.158 1.00 26.02  ? 147 HIS A O     1 
ATOM   1100 C  CB    . HIS A 1 147 ? 9.953   20.181  -8.224  1.00 25.94  ? 147 HIS A CB    1 
ATOM   1101 C  CG    . HIS A 1 147 ? 8.478   20.239  -8.384  1.00 33.64  ? 147 HIS A CG    1 
ATOM   1102 N  ND1   . HIS A 1 147 ? 7.776   21.420  -8.300  1.00 39.85  ? 147 HIS A ND1   1 
ATOM   1103 C  CD2   . HIS A 1 147 ? 7.565   19.269  -8.611  1.00 33.69  ? 147 HIS A CD2   1 
ATOM   1104 C  CE1   . HIS A 1 147 ? 6.492   21.176  -8.474  1.00 41.88  ? 147 HIS A CE1   1 
ATOM   1105 N  NE2   . HIS A 1 147 ? 6.340   19.882  -8.672  1.00 37.60  ? 147 HIS A NE2   1 
ATOM   1106 N  N     . ILE A 1 148 ? 9.764   20.871  -11.639 1.00 23.06  ? 148 ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 148 ? 9.406   21.804  -12.704 1.00 24.25  ? 148 ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 148 ? 7.894   21.870  -12.876 1.00 23.64  ? 148 ILE A C     1 
ATOM   1109 O  O     . ILE A 1 148 ? 7.233   20.843  -12.893 1.00 27.71  ? 148 ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 148 ? 10.003  21.382  -14.079 1.00 23.01  ? 148 ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 148 ? 11.520  21.203  -14.029 1.00 25.22  ? 148 ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 148 ? 9.529   22.326  -15.184 1.00 25.97  ? 148 ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 148 ? 12.251  22.173  -13.203 1.00 28.86  ? 148 ILE A CD1   1 
ATOM   1114 N  N     . VAL A 1 149 ? 7.345   23.069  -13.003 1.00 22.75  ? 149 VAL A N     1 
ATOM   1115 C  CA    . VAL A 1 149 ? 5.922   23.204  -13.285 1.00 23.15  ? 149 VAL A CA    1 
ATOM   1116 C  C     . VAL A 1 149 ? 5.718   24.016  -14.555 1.00 22.64  ? 149 VAL A C     1 
ATOM   1117 O  O     . VAL A 1 149 ? 6.362   25.051  -14.751 1.00 23.64  ? 149 VAL A O     1 
ATOM   1118 C  CB    . VAL A 1 149 ? 5.158   23.868  -12.109 1.00 24.70  ? 149 VAL A CB    1 
ATOM   1119 C  CG1   . VAL A 1 149 ? 3.708   24.169  -12.503 1.00 27.65  ? 149 VAL A CG1   1 
ATOM   1120 C  CG2   . VAL A 1 149 ? 5.194   22.964  -10.910 1.00 26.87  ? 149 VAL A CG2   1 
ATOM   1121 N  N     . TRP A 1 150 ? 4.853   23.506  -15.426 1.00 22.38  ? 150 TRP A N     1 
ATOM   1122 C  CA    . TRP A 1 150 ? 4.435   24.231  -16.618 1.00 22.20  ? 150 TRP A CA    1 
ATOM   1123 C  C     . TRP A 1 150 ? 3.011   24.740  -16.480 1.00 23.04  ? 150 TRP A C     1 
ATOM   1124 O  O     . TRP A 1 150 ? 2.117   24.007  -16.035 1.00 23.64  ? 150 TRP A O     1 
ATOM   1125 C  CB    . TRP A 1 150 ? 4.515   23.359  -17.865 1.00 21.64  ? 150 TRP A CB    1 
ATOM   1126 C  CG    . TRP A 1 150 ? 5.908   23.057  -18.324 1.00 21.18  ? 150 TRP A CG    1 
ATOM   1127 C  CD1   . TRP A 1 150 ? 6.700   23.842  -19.114 1.00 21.25  ? 150 TRP A CD1   1 
ATOM   1128 C  CD2   . TRP A 1 150 ? 6.672   21.882  -18.037 1.00 21.01  ? 150 TRP A CD2   1 
ATOM   1129 N  NE1   . TRP A 1 150 ? 7.908   23.228  -19.339 1.00 21.18  ? 150 TRP A NE1   1 
ATOM   1130 C  CE2   . TRP A 1 150 ? 7.908   22.014  -18.711 1.00 20.95  ? 150 TRP A CE2   1 
ATOM   1131 C  CE3   . TRP A 1 150 ? 6.425   20.719  -17.304 1.00 22.70  ? 150 TRP A CE3   1 
ATOM   1132 C  CZ2   . TRP A 1 150 ? 8.904   21.040  -18.643 1.00 21.00  ? 150 TRP A CZ2   1 
ATOM   1133 C  CZ3   . TRP A 1 150 ? 7.424   19.740  -17.245 1.00 21.23  ? 150 TRP A CZ3   1 
ATOM   1134 C  CH2   . TRP A 1 150 ? 8.642   19.912  -17.910 1.00 24.24  ? 150 TRP A CH2   1 
ATOM   1135 N  N     . GLN A 1 151 ? 2.806   25.980  -16.905 1.00 23.41  ? 151 GLN A N     1 
ATOM   1136 C  CA    . GLN A 1 151 ? 1.498   26.613  -16.820 1.00 24.45  ? 151 GLN A CA    1 
ATOM   1137 C  C     . GLN A 1 151 ? 1.072   27.197  -18.161 1.00 25.35  ? 151 GLN A C     1 
ATOM   1138 O  O     . GLN A 1 151 ? 1.913   27.600  -18.964 1.00 26.12  ? 151 GLN A O     1 
ATOM   1139 C  CB    . GLN A 1 151 ? 1.496   27.728  -15.784 1.00 25.78  ? 151 GLN A CB    1 
ATOM   1140 C  CG    . GLN A 1 151 ? 1.920   27.278  -14.399 1.00 31.34  ? 151 GLN A CG    1 
ATOM   1141 C  CD    . GLN A 1 151 ? 1.954   28.427  -13.414 1.00 39.45  ? 151 GLN A CD    1 
ATOM   1142 O  OE1   . GLN A 1 151 ? 0.945   29.096  -13.185 1.00 39.75  ? 151 GLN A OE1   1 
ATOM   1143 N  NE2   . GLN A 1 151 ? 3.122   28.672  -12.837 1.00 45.87  ? 151 GLN A NE2   1 
ATOM   1144 N  N     . VAL A 1 152 ? -0.234  27.223  -18.397 1.00 25.02  ? 152 VAL A N     1 
ATOM   1145 C  CA    . VAL A 1 152 ? -0.798  28.065  -19.460 1.00 28.92  ? 152 VAL A CA    1 
ATOM   1146 C  C     . VAL A 1 152 ? -1.505  29.196  -18.732 1.00 32.61  ? 152 VAL A C     1 
ATOM   1147 O  O     . VAL A 1 152 ? -2.589  29.001  -18.183 1.00 32.95  ? 152 VAL A O     1 
ATOM   1148 C  CB    . VAL A 1 152 ? -1.793  27.324  -20.383 1.00 30.39  ? 152 VAL A CB    1 
ATOM   1149 C  CG1   . VAL A 1 152 ? -2.431  28.306  -21.379 1.00 33.12  ? 152 VAL A CG1   1 
ATOM   1150 C  CG2   . VAL A 1 152 ? -1.104  26.182  -21.123 1.00 34.70  ? 152 VAL A CG2   1 
ATOM   1151 N  N     . GLY A 1 153 ? -0.883  30.367  -18.701 1.00 29.28  ? 153 GLY A N     1 
ATOM   1152 C  CA    . GLY A 1 153 ? -1.386  31.421  -17.842 1.00 33.69  ? 153 GLY A CA    1 
ATOM   1153 C  C     . GLY A 1 153 ? -1.164  31.007  -16.398 1.00 31.03  ? 153 GLY A C     1 
ATOM   1154 O  O     . GLY A 1 153 ? -0.033  30.761  -15.982 1.00 34.29  ? 153 GLY A O     1 
ATOM   1155 N  N     . ASP A 1 154 ? -2.251  30.911  -15.639 1.00 36.20  ? 154 ASP A N     1 
ATOM   1156 C  CA    . ASP A 1 154 ? -2.162  30.560  -14.226 1.00 41.37  ? 154 ASP A CA    1 
ATOM   1157 C  C     . ASP A 1 154 ? -2.592  29.116  -13.981 1.00 39.22  ? 154 ASP A C     1 
ATOM   1158 O  O     . ASP A 1 154 ? -2.668  28.665  -12.834 1.00 37.91  ? 154 ASP A O     1 
ATOM   1159 C  CB    . ASP A 1 154 ? -3.014  31.521  -13.384 1.00 49.22  ? 154 ASP A CB    1 
ATOM   1160 C  CG    . ASP A 1 154 ? -2.415  32.918  -13.306 1.00 53.13  ? 154 ASP A CG    1 
ATOM   1161 O  OD1   . ASP A 1 154 ? -1.172  33.031  -13.189 1.00 55.64  ? 154 ASP A OD1   1 
ATOM   1162 O  OD2   . ASP A 1 154 ? -3.186  33.900  -13.362 1.00 59.04  ? 154 ASP A OD2   1 
ATOM   1163 N  N     . GLU A 1 155 ? -2.866  28.394  -15.062 1.00 30.98  ? 155 GLU A N     1 
ATOM   1164 C  CA    . GLU A 1 155 ? -3.287  27.000  -14.968 1.00 30.16  ? 155 GLU A CA    1 
ATOM   1165 C  C     . GLU A 1 155 ? -2.105  26.017  -15.023 1.00 35.83  ? 155 GLU A C     1 
ATOM   1166 O  O     . GLU A 1 155 ? -1.372  25.979  -16.012 1.00 28.85  ? 155 GLU A O     1 
ATOM   1167 C  CB    . GLU A 1 155 ? -4.275  26.676  -16.088 1.00 29.17  ? 155 GLU A CB    1 
ATOM   1168 C  CG    . GLU A 1 155 ? -4.668  25.215  -16.138 1.00 30.02  ? 155 GLU A CG    1 
ATOM   1169 C  CD    . GLU A 1 155 ? -5.420  24.840  -17.407 1.00 28.87  ? 155 GLU A CD    1 
ATOM   1170 O  OE1   . GLU A 1 155 ? -5.554  25.693  -18.318 1.00 36.24  ? 155 GLU A OE1   1 
ATOM   1171 O  OE2   . GLU A 1 155 ? -5.874  23.677  -17.490 1.00 34.10  ? 155 GLU A OE2   1 
ATOM   1172 N  N     . ASP A 1 156 ? -1.934  25.242  -13.950 1.00 35.21  ? 156 ASP A N     1 
ATOM   1173 C  CA    . ASP A 1 156 ? -0.957  24.141  -13.863 1.00 31.43  ? 156 ASP A CA    1 
ATOM   1174 C  C     . ASP A 1 156 ? -1.345  23.085  -14.905 1.00 32.83  ? 156 ASP A C     1 
ATOM   1175 O  O     . ASP A 1 156 ? -2.403  22.471  -14.788 1.00 28.21  ? 156 ASP A O     1 
ATOM   1176 C  CB    . ASP A 1 156 ? -0.936  23.572  -12.403 1.00 31.83  ? 156 ASP A CB    1 
ATOM   1177 C  CG    . ASP A 1 156 ? 0.006   22.352  -12.218 1.00 36.12  ? 156 ASP A CG    1 
ATOM   1178 O  OD1   . ASP A 1 156 ? 0.755   22.035  -13.155 1.00 30.43  ? 156 ASP A OD1   1 
ATOM   1179 O  OD2   . ASP A 1 156 ? 0.026   21.706  -11.121 1.00 29.65  ? 156 ASP A OD2   1 
ATOM   1180 N  N     . VAL A 1 157 ? -0.525  22.888  -15.945 1.00 26.54  ? 157 VAL A N     1 
ATOM   1181 C  CA    . VAL A 1 157 ? -0.865  21.899  -16.974 1.00 26.26  ? 157 VAL A CA    1 
ATOM   1182 C  C     . VAL A 1 157 ? 0.059   20.668  -17.012 1.00 31.74  ? 157 VAL A C     1 
ATOM   1183 O  O     . VAL A 1 157 ? -0.300  19.644  -17.591 1.00 28.43  ? 157 VAL A O     1 
ATOM   1184 C  CB    . VAL A 1 157 ? -0.881  22.530  -18.402 1.00 28.95  ? 157 VAL A CB    1 
ATOM   1185 C  CG1   . VAL A 1 157 ? -1.948  23.613  -18.513 1.00 26.34  ? 157 VAL A CG1   1 
ATOM   1186 C  CG2   . VAL A 1 157 ? 0.478   23.093  -18.777 1.00 25.17  ? 157 VAL A CG2   1 
ATOM   1187 N  N     . ALA A 1 158 ? 1.236   20.763  -16.400 1.00 25.57  ? 158 ALA A N     1 
ATOM   1188 C  CA    . ALA A 1 158 ? 2.161   19.639  -16.366 1.00 25.34  ? 158 ALA A CA    1 
ATOM   1189 C  C     . ALA A 1 158 ? 3.294   19.880  -15.384 1.00 26.09  ? 158 ALA A C     1 
ATOM   1190 O  O     . ALA A 1 158 ? 3.565   21.018  -14.999 1.00 25.25  ? 158 ALA A O     1 
ATOM   1191 C  CB    . ALA A 1 158 ? 2.740   19.373  -17.773 1.00 24.73  ? 158 ALA A CB    1 
ATOM   1192 N  N     . GLU A 1 159 ? 3.977   18.808  -15.010 1.00 28.48  ? 159 GLU A N     1 
ATOM   1193 C  CA    . GLU A 1 159 ? 5.134   18.953  -14.143 1.00 25.63  ? 159 GLU A CA    1 
ATOM   1194 C  C     . GLU A 1 159 ? 6.145   17.861  -14.384 1.00 26.97  ? 159 GLU A C     1 
ATOM   1195 O  O     . GLU A 1 159 ? 5.855   16.839  -15.011 1.00 25.22  ? 159 GLU A O     1 
ATOM   1196 C  CB    . GLU A 1 159 ? 4.713   18.950  -12.686 1.00 34.44  ? 159 GLU A CB    1 
ATOM   1197 C  CG    . GLU A 1 159 ? 4.121   17.647  -12.250 1.00 28.70  ? 159 GLU A CG    1 
ATOM   1198 C  CD    . GLU A 1 159 ? 4.222   17.490  -10.776 1.00 39.01  ? 159 GLU A CD    1 
ATOM   1199 O  OE1   . GLU A 1 159 ? 3.363   18.097  -10.089 1.00 30.47  ? 159 GLU A OE1   1 
ATOM   1200 O  OE2   . GLU A 1 159 ? 5.167   16.778  -10.349 1.00 35.62  ? 159 GLU A OE2   1 
ATOM   1201 N  N     . MET A 1 160 ? 7.352   18.103  -13.901 1.00 25.31  ? 160 MET A N     1 
ATOM   1202 C  CA    . MET A 1 160 ? 8.427   17.153  -14.053 1.00 25.20  ? 160 MET A CA    1 
ATOM   1203 C  C     . MET A 1 160 ? 9.199   17.141  -12.761 1.00 28.63  ? 160 MET A C     1 
ATOM   1204 O  O     . MET A 1 160 ? 9.515   18.194  -12.203 1.00 28.51  ? 160 MET A O     1 
ATOM   1205 C  CB    . MET A 1 160 ? 9.333   17.510  -15.217 1.00 25.20  ? 160 MET A CB    1 
ATOM   1206 C  CG    . MET A 1 160 ? 10.622  16.703  -15.247 1.00 24.52  ? 160 MET A CG    1 
ATOM   1207 S  SD    . MET A 1 160 ? 11.526  16.898  -16.785 1.00 29.24  ? 160 MET A SD    1 
ATOM   1208 C  CE    . MET A 1 160 ? 11.908  18.649  -16.739 1.00 34.74  ? 160 MET A CE    1 
ATOM   1209 N  N     . ASN A 1 161 ? 9.430   15.954  -12.237 1.00 26.10  ? 161 ASN A N     1 
ATOM   1210 C  CA    . ASN A 1 161 ? 10.372  15.838  -11.150 1.00 26.67  ? 161 ASN A CA    1 
ATOM   1211 C  C     . ASN A 1 161 ? 11.552  15.091  -11.690 1.00 29.16  ? 161 ASN A C     1 
ATOM   1212 O  O     . ASN A 1 161 ? 11.426  13.957  -12.159 1.00 30.75  ? 161 ASN A O     1 
ATOM   1213 C  CB    . ASN A 1 161 ? 9.772   15.134  -9.938  1.00 36.10  ? 161 ASN A CB    1 
ATOM   1214 C  CG    . ASN A 1 161 ? 10.533  15.452  -8.678  1.00 38.52  ? 161 ASN A CG    1 
ATOM   1215 O  OD1   . ASN A 1 161 ? 11.665  14.997  -8.483  1.00 51.87  ? 161 ASN A OD1   1 
ATOM   1216 N  ND2   . ASN A 1 161 ? 9.932   16.268  -7.825  1.00 49.28  ? 161 ASN A ND2   1 
ATOM   1217 N  N     . TRP A 1 162 ? 12.707  15.731  -11.704 1.00 26.53  ? 162 TRP A N     1 
ATOM   1218 C  CA    . TRP A 1 162 ? 13.839  14.991  -12.189 1.00 27.51  ? 162 TRP A CA    1 
ATOM   1219 C  C     . TRP A 1 162 ? 15.009  15.054  -11.225 1.00 26.37  ? 162 TRP A C     1 
ATOM   1220 O  O     . TRP A 1 162 ? 15.083  15.890  -10.311 1.00 26.79  ? 162 TRP A O     1 
ATOM   1221 C  CB    . TRP A 1 162 ? 14.229  15.451  -13.586 1.00 33.63  ? 162 TRP A CB    1 
ATOM   1222 C  CG    . TRP A 1 162 ? 14.874  16.767  -13.677 1.00 35.21  ? 162 TRP A CG    1 
ATOM   1223 C  CD1   . TRP A 1 162 ? 14.360  17.968  -13.294 1.00 43.15  ? 162 TRP A CD1   1 
ATOM   1224 C  CD2   . TRP A 1 162 ? 16.163  17.032  -14.228 1.00 42.83  ? 162 TRP A CD2   1 
ATOM   1225 N  NE1   . TRP A 1 162 ? 15.266  18.975  -13.564 1.00 48.63  ? 162 TRP A NE1   1 
ATOM   1226 C  CE2   . TRP A 1 162 ? 16.381  18.422  -14.137 1.00 46.88  ? 162 TRP A CE2   1 
ATOM   1227 C  CE3   . TRP A 1 162 ? 17.155  16.229  -14.793 1.00 46.66  ? 162 TRP A CE3   1 
ATOM   1228 C  CZ2   . TRP A 1 162 ? 17.556  19.022  -14.585 1.00 50.55  ? 162 TRP A CZ2   1 
ATOM   1229 C  CZ3   . TRP A 1 162 ? 18.313  16.826  -15.244 1.00 48.57  ? 162 TRP A CZ3   1 
ATOM   1230 C  CH2   . TRP A 1 162 ? 18.509  18.206  -15.130 1.00 49.84  ? 162 TRP A CH2   1 
ATOM   1231 N  N     . ARG A 1 163 ? 15.884  14.088  -11.393 1.00 26.60  ? 163 ARG A N     1 
ATOM   1232 C  CA    . ARG A 1 163 ? 16.903  13.838  -10.397 1.00 27.37  ? 163 ARG A CA    1 
ATOM   1233 C  C     . ARG A 1 163 ? 18.243  13.675  -11.085 1.00 27.15  ? 163 ARG A C     1 
ATOM   1234 O  O     . ARG A 1 163 ? 18.342  13.026  -12.133 1.00 26.85  ? 163 ARG A O     1 
ATOM   1235 C  CB    . ARG A 1 163 ? 16.544  12.596  -9.579  1.00 29.17  ? 163 ARG A CB    1 
ATOM   1236 C  CG    . ARG A 1 163 ? 17.493  12.298  -8.419  1.00 29.49  ? 163 ARG A CG    1 
ATOM   1237 C  CD    . ARG A 1 163 ? 16.998  11.087  -7.621  1.00 34.45  ? 163 ARG A CD    1 
ATOM   1238 N  NE    . ARG A 1 163 ? 15.621  11.265  -7.157  1.00 37.72  ? 163 ARG A NE    1 
ATOM   1239 C  CZ    . ARG A 1 163 ? 14.753  10.273  -6.972  1.00 40.00  ? 163 ARG A CZ    1 
ATOM   1240 N  NH1   . ARG A 1 163 ? 15.106  9.019   -7.221  1.00 45.28  ? 163 ARG A NH1   1 
ATOM   1241 N  NH2   . ARG A 1 163 ? 13.528  10.534  -6.544  1.00 42.82  ? 163 ARG A NH2   1 
ATOM   1242 N  N     . ILE A 1 164 ? 19.267  14.298  -10.521 1.00 27.49  ? 164 ILE A N     1 
ATOM   1243 C  CA    . ILE A 1 164 ? 20.610  14.082  -11.003 1.00 27.60  ? 164 ILE A CA    1 
ATOM   1244 C  C     . ILE A 1 164 ? 21.475  13.623  -9.853  1.00 28.63  ? 164 ILE A C     1 
ATOM   1245 O  O     . ILE A 1 164 ? 21.156  13.869  -8.688  1.00 29.29  ? 164 ILE A O     1 
ATOM   1246 C  CB    . ILE A 1 164 ? 21.227  15.339  -11.612 1.00 27.29  ? 164 ILE A CB    1 
ATOM   1247 C  CG1   . ILE A 1 164 ? 21.285  16.457  -10.573 1.00 29.18  ? 164 ILE A CG1   1 
ATOM   1248 C  CG2   . ILE A 1 164 ? 20.418  15.790  -12.832 1.00 26.46  ? 164 ILE A CG2   1 
ATOM   1249 C  CD1   . ILE A 1 164 ? 22.059  17.666  -11.028 1.00 27.95  ? 164 ILE A CD1   1 
ATOM   1250 N  N     . LEU A 1 165 ? 22.557  12.951  -10.217 1.00 28.92  ? 165 LEU A N     1 
ATOM   1251 C  CA    . LEU A 1 165 ? 23.609  12.574  -9.289  1.00 29.96  ? 165 LEU A CA    1 
ATOM   1252 C  C     . LEU A 1 165 ? 24.837  13.427  -9.580  1.00 30.33  ? 165 LEU A C     1 
ATOM   1253 O  O     . LEU A 1 165 ? 25.378  13.381  -10.684 1.00 29.77  ? 165 LEU A O     1 
ATOM   1254 C  CB    . LEU A 1 165 ? 23.932  11.084  -9.424  1.00 30.51  ? 165 LEU A CB    1 
ATOM   1255 C  CG    . LEU A 1 165 ? 25.147  10.593  -8.622  1.00 31.68  ? 165 LEU A CG    1 
ATOM   1256 C  CD1   . LEU A 1 165 ? 24.867  10.682  -7.132  1.00 32.66  ? 165 LEU A CD1   1 
ATOM   1257 C  CD2   . LEU A 1 165 ? 25.542  9.168   -9.019  1.00 32.27  ? 165 LEU A CD2   1 
ATOM   1258 N  N     . LYS A 1 166 ? 25.257  14.226  -8.603  1.00 30.80  ? 166 LYS A N     1 
ATOM   1259 C  CA    . LYS A 1 166 ? 26.536  14.926  -8.685  1.00 31.38  ? 166 LYS A CA    1 
ATOM   1260 C  C     . LYS A 1 166 ? 27.536  14.125  -7.866  1.00 32.52  ? 166 LYS A C     1 
ATOM   1261 O  O     . LYS A 1 166 ? 27.291  13.847  -6.692  1.00 33.31  ? 166 LYS A O     1 
ATOM   1262 C  CB    . LYS A 1 166 ? 26.430  16.365  -8.172  1.00 31.76  ? 166 LYS A CB    1 
ATOM   1263 C  CG    . LYS A 1 166 ? 25.518  17.264  -9.000  1.00 31.92  ? 166 LYS A CG    1 
ATOM   1264 C  CD    . LYS A 1 166 ? 26.225  17.712  -10.273 1.00 30.60  ? 166 LYS A CD    1 
ATOM   1265 C  CE    . LYS A 1 166 ? 27.420  18.602  -9.951  1.00 34.35  ? 166 LYS A CE    1 
ATOM   1266 N  NZ    . LYS A 1 166 ? 28.438  18.604  -11.035 1.00 35.61  ? 166 LYS A NZ    1 
ATOM   1267 N  N     . PHE A 1 167 ? 28.645  13.735  -8.486  1.00 32.80  ? 167 PHE A N     1 
ATOM   1268 C  CA    . PHE A 1 167 ? 29.559  12.785  -7.861  1.00 40.13  ? 167 PHE A CA    1 
ATOM   1269 C  C     . PHE A 1 167 ? 31.040  13.095  -8.075  1.00 42.81  ? 167 PHE A C     1 
ATOM   1270 O  O     . PHE A 1 167 ? 31.410  13.898  -8.937  1.00 37.61  ? 167 PHE A O     1 
ATOM   1271 C  CB    . PHE A 1 167 ? 29.264  11.371  -8.370  1.00 41.58  ? 167 PHE A CB    1 
ATOM   1272 C  CG    . PHE A 1 167 ? 29.454  11.209  -9.853  1.00 43.98  ? 167 PHE A CG    1 
ATOM   1273 C  CD1   . PHE A 1 167 ? 28.453  11.588  -10.742 1.00 41.81  ? 167 PHE A CD1   1 
ATOM   1274 C  CD2   . PHE A 1 167 ? 30.631  10.675  -10.362 1.00 42.93  ? 167 PHE A CD2   1 
ATOM   1275 C  CE1   . PHE A 1 167 ? 28.627  11.443  -12.111 1.00 42.76  ? 167 PHE A CE1   1 
ATOM   1276 C  CE2   . PHE A 1 167 ? 30.811  10.522  -11.730 1.00 44.72  ? 167 PHE A CE2   1 
ATOM   1277 C  CZ    . PHE A 1 167 ? 29.804  10.909  -12.608 1.00 43.42  ? 167 PHE A CZ    1 
ATOM   1278 N  N     . LYS A 1 168 ? 31.868  12.458  -7.245  1.00 44.27  ? 168 LYS A N     1 
ATOM   1279 C  CA    . LYS A 1 168 ? 33.323  12.454  -7.388  1.00 49.56  ? 168 LYS A CA    1 
ATOM   1280 C  C     . LYS A 1 168 ? 33.781  11.228  -8.170  1.00 47.04  ? 168 LYS A C     1 
ATOM   1281 O  O     . LYS A 1 168 ? 33.631  10.097  -7.697  1.00 46.11  ? 168 LYS A O     1 
ATOM   1282 C  CB    . LYS A 1 168 ? 34.007  12.469  -6.016  1.00 49.93  ? 168 LYS A CB    1 
ATOM   1283 C  CG    . LYS A 1 168 ? 33.778  13.732  -5.205  1.00 54.56  ? 168 LYS A CG    1 
ATOM   1284 C  CD    . LYS A 1 168 ? 34.413  13.621  -3.812  1.00 56.82  ? 168 LYS A CD    1 
ATOM   1285 C  CE    . LYS A 1 168 ? 34.103  14.842  -2.945  1.00 56.40  ? 168 LYS A CE    1 
ATOM   1286 N  NZ    . LYS A 1 168 ? 34.553  14.644  -1.539  1.00 59.74  ? 168 LYS A NZ    1 
ATOM   1287 N  N     . PRO A 1 169 ? 34.334  11.452  -9.375  1.00 47.31  ? 169 PRO A N     1 
ATOM   1288 C  CA    . PRO A 1 169 ? 34.866  10.391  -10.238 1.00 50.78  ? 169 PRO A CA    1 
ATOM   1289 C  C     . PRO A 1 169 ? 36.232  9.893   -9.771  1.00 53.21  ? 169 PRO A C     1 
ATOM   1290 O  O     . PRO A 1 169 ? 36.280  9.099   -8.832  1.00 54.98  ? 169 PRO A O     1 
ATOM   1291 C  CB    . PRO A 1 169 ? 34.975  11.075  -11.601 1.00 48.44  ? 169 PRO A CB    1 
ATOM   1292 C  CG    . PRO A 1 169 ? 35.199  12.507  -11.271 1.00 50.60  ? 169 PRO A CG    1 
ATOM   1293 C  CD    . PRO A 1 169 ? 34.423  12.778  -10.012 1.00 49.43  ? 169 PRO A CD    1 
ATOM   1294 N  N     . THR B 2 2   ? -8.092  -4.108  -21.042 1.00 66.02  ? 2   THR B N     1 
ATOM   1295 C  CA    . THR B 2 2   ? -6.903  -4.953  -20.989 1.00 65.00  ? 2   THR B CA    1 
ATOM   1296 C  C     . THR B 2 2   ? -6.750  -5.579  -19.606 1.00 66.71  ? 2   THR B C     1 
ATOM   1297 O  O     . THR B 2 2   ? -7.479  -5.226  -18.681 1.00 68.43  ? 2   THR B O     1 
ATOM   1298 C  CB    . THR B 2 2   ? -5.622  -4.156  -21.342 1.00 62.33  ? 2   THR B CB    1 
ATOM   1299 O  OG1   . THR B 2 2   ? -4.516  -5.056  -21.510 1.00 61.47  ? 2   THR B OG1   1 
ATOM   1300 C  CG2   . THR B 2 2   ? -5.300  -3.141  -20.246 1.00 62.38  ? 2   THR B CG2   1 
ATOM   1301 N  N     . VAL B 2 3   ? -5.811  -6.514  -19.468 1.00 66.39  ? 3   VAL B N     1 
ATOM   1302 C  CA    . VAL B 2 3   ? -5.612  -7.209  -18.196 1.00 68.10  ? 3   VAL B CA    1 
ATOM   1303 C  C     . VAL B 2 3   ? -4.182  -7.090  -17.691 1.00 66.91  ? 3   VAL B C     1 
ATOM   1304 O  O     . VAL B 2 3   ? -3.245  -6.894  -18.464 1.00 64.85  ? 3   VAL B O     1 
ATOM   1305 C  CB    . VAL B 2 3   ? -5.965  -8.723  -18.290 1.00 69.78  ? 3   VAL B CB    1 
ATOM   1306 C  CG1   . VAL B 2 3   ? -7.366  -8.923  -18.849 1.00 71.19  ? 3   VAL B CG1   1 
ATOM   1307 C  CG2   . VAL B 2 3   ? -4.923  -9.490  -19.111 1.00 68.40  ? 3   VAL B CG2   1 
ATOM   1308 N  N     . VAL B 2 4   ? -4.026  -7.214  -16.381 1.00 68.37  ? 4   VAL B N     1 
ATOM   1309 C  CA    . VAL B 2 4   ? -2.705  -7.269  -15.784 1.00 67.79  ? 4   VAL B CA    1 
ATOM   1310 C  C     . VAL B 2 4   ? -1.950  -8.485  -16.326 1.00 67.50  ? 4   VAL B C     1 
ATOM   1311 O  O     . VAL B 2 4   ? -2.444  -9.611  -16.279 1.00 69.08  ? 4   VAL B O     1 
ATOM   1312 C  CB    . VAL B 2 4   ? -2.791  -7.322  -14.248 1.00 69.83  ? 4   VAL B CB    1 
ATOM   1313 C  CG1   . VAL B 2 4   ? -1.416  -7.531  -13.635 1.00 69.58  ? 4   VAL B CG1   1 
ATOM   1314 C  CG2   . VAL B 2 4   ? -3.435  -6.047  -13.721 1.00 70.14  ? 4   VAL B CG2   1 
ATOM   1315 N  N     . GLY B 2 5   ? -0.764  -8.248  -16.877 1.00 65.61  ? 5   GLY B N     1 
ATOM   1316 C  CA    . GLY B 2 5   ? 0.037   -9.324  -17.430 1.00 65.36  ? 5   GLY B CA    1 
ATOM   1317 C  C     . GLY B 2 5   ? -0.001  -9.360  -18.945 1.00 63.68  ? 5   GLY B C     1 
ATOM   1318 O  O     . GLY B 2 5   ? 0.765   -10.094 -19.571 1.00 63.19  ? 5   GLY B O     1 
ATOM   1319 N  N     . ALA B 2 6   ? -0.902  -8.574  -19.530 1.00 62.98  ? 6   ALA B N     1 
ATOM   1320 C  CA    . ALA B 2 6   ? -0.935  -8.375  -20.976 1.00 61.26  ? 6   ALA B CA    1 
ATOM   1321 C  C     . ALA B 2 6   ? 0.393   -7.810  -21.471 1.00 59.07  ? 6   ALA B C     1 
ATOM   1322 O  O     . ALA B 2 6   ? 0.926   -6.867  -20.889 1.00 58.39  ? 6   ALA B O     1 
ATOM   1323 C  CB    . ALA B 2 6   ? -2.077  -7.449  -21.362 1.00 61.03  ? 6   ALA B CB    1 
ATOM   1324 N  N     . VAL B 2 7   ? 0.926   -8.391  -22.540 1.00 58.53  ? 7   VAL B N     1 
ATOM   1325 C  CA    . VAL B 2 7   ? 2.193   -7.938  -23.103 1.00 63.60  ? 7   VAL B CA    1 
ATOM   1326 C  C     . VAL B 2 7   ? 1.972   -7.118  -24.377 1.00 59.79  ? 7   VAL B C     1 
ATOM   1327 O  O     . VAL B 2 7   ? 1.202   -7.515  -25.252 1.00 60.17  ? 7   VAL B O     1 
ATOM   1328 C  CB    . VAL B 2 7   ? 3.123   -9.137  -23.406 1.00 65.45  ? 7   VAL B CB    1 
ATOM   1329 C  CG1   . VAL B 2 7   ? 4.346   -8.693  -24.199 1.00 62.59  ? 7   VAL B CG1   1 
ATOM   1330 C  CG2   . VAL B 2 7   ? 3.533   -9.826  -22.111 1.00 63.74  ? 7   VAL B CG2   1 
ATOM   1331 N  N     . LEU B 2 8   ? 2.634   -5.967  -24.470 1.00 56.91  ? 8   LEU B N     1 
ATOM   1332 C  CA    . LEU B 2 8   ? 2.522   -5.121  -25.658 1.00 53.50  ? 8   LEU B CA    1 
ATOM   1333 C  C     . LEU B 2 8   ? 3.319   -5.721  -26.809 1.00 50.39  ? 8   LEU B C     1 
ATOM   1334 O  O     . LEU B 2 8   ? 4.250   -6.496  -26.580 1.00 52.20  ? 8   LEU B O     1 
ATOM   1335 C  CB    . LEU B 2 8   ? 3.020   -3.696  -25.375 1.00 49.36  ? 8   LEU B CB    1 
ATOM   1336 C  CG    . LEU B 2 8   ? 2.601   -2.944  -24.109 1.00 57.71  ? 8   LEU B CG    1 
ATOM   1337 C  CD1   . LEU B 2 8   ? 2.894   -1.458  -24.266 1.00 55.43  ? 8   LEU B CD1   1 
ATOM   1338 C  CD2   . LEU B 2 8   ? 1.137   -3.173  -23.737 1.00 59.78  ? 8   LEU B CD2   1 
ATOM   1339 N  N     . PRO B 2 9   ? 2.962   -5.366  -28.055 1.00 52.07  ? 9   PRO B N     1 
ATOM   1340 C  CA    . PRO B 2 9   ? 3.806   -5.796  -29.175 1.00 52.29  ? 9   PRO B CA    1 
ATOM   1341 C  C     . PRO B 2 9   ? 5.187   -5.156  -29.104 1.00 52.55  ? 9   PRO B C     1 
ATOM   1342 O  O     . PRO B 2 9   ? 5.324   -4.004  -28.689 1.00 48.79  ? 9   PRO B O     1 
ATOM   1343 C  CB    . PRO B 2 9   ? 3.036   -5.320  -30.411 1.00 51.93  ? 9   PRO B CB    1 
ATOM   1344 C  CG    . PRO B 2 9   ? 2.120   -4.253  -29.915 1.00 56.14  ? 9   PRO B CG    1 
ATOM   1345 C  CD    . PRO B 2 9   ? 1.768   -4.632  -28.508 1.00 53.13  ? 9   PRO B CD    1 
ATOM   1346 N  N     . GLU B 2 10  ? 6.200   -5.922  -29.486 1.00 53.87  ? 10  GLU B N     1 
ATOM   1347 C  CA    . GLU B 2 10  ? 7.578   -5.457  -29.509 1.00 57.99  ? 10  GLU B CA    1 
ATOM   1348 C  C     . GLU B 2 10  ? 7.768   -4.300  -30.503 1.00 56.97  ? 10  GLU B C     1 
ATOM   1349 O  O     . GLU B 2 10  ? 7.023   -4.183  -31.479 1.00 56.28  ? 10  GLU B O     1 
ATOM   1350 C  CB    . GLU B 2 10  ? 8.492   -6.632  -29.864 1.00 61.58  ? 10  GLU B CB    1 
ATOM   1351 C  CG    . GLU B 2 10  ? 9.972   -6.361  -29.777 1.00 67.99  ? 10  GLU B CG    1 
ATOM   1352 C  CD    . GLU B 2 10  ? 10.798  -7.523  -30.299 1.00 72.56  ? 10  GLU B CD    1 
ATOM   1353 O  OE1   . GLU B 2 10  ? 11.104  -7.535  -31.513 1.00 72.11  ? 10  GLU B OE1   1 
ATOM   1354 O  OE2   . GLU B 2 10  ? 11.140  -8.422  -29.498 1.00 74.45  ? 10  GLU B OE2   1 
ATOM   1355 N  N     . LEU B 2 11  ? 8.744   -3.437  -30.231 1.00 45.62  ? 11  LEU B N     1 
ATOM   1356 C  CA    . LEU B 2 11  ? 9.161   -2.387  -31.168 1.00 40.34  ? 11  LEU B CA    1 
ATOM   1357 C  C     . LEU B 2 11  ? 10.683  -2.261  -31.142 1.00 36.73  ? 11  LEU B C     1 
ATOM   1358 O  O     . LEU B 2 11  ? 11.267  -1.955  -30.103 1.00 36.78  ? 11  LEU B O     1 
ATOM   1359 C  CB    . LEU B 2 11  ? 8.508   -1.034  -30.835 1.00 35.95  ? 11  LEU B CB    1 
ATOM   1360 C  CG    . LEU B 2 11  ? 8.996   0.145   -31.700 1.00 33.22  ? 11  LEU B CG    1 
ATOM   1361 C  CD1   . LEU B 2 11  ? 8.636   -0.078  -33.163 1.00 32.56  ? 11  LEU B CD1   1 
ATOM   1362 C  CD2   . LEU B 2 11  ? 8.458   1.486   -31.224 1.00 30.41  ? 11  LEU B CD2   1 
ATOM   1363 N  N     . LYS B 2 12  ? 11.336  -2.518  -32.274 1.00 34.72  ? 12  LYS B N     1 
ATOM   1364 C  CA    . LYS B 2 12  ? 12.790  -2.360  -32.344 1.00 35.26  ? 12  LYS B CA    1 
ATOM   1365 C  C     . LYS B 2 12  ? 13.116  -1.102  -33.130 1.00 35.31  ? 12  LYS B C     1 
ATOM   1366 O  O     . LYS B 2 12  ? 12.504  -0.841  -34.165 1.00 33.13  ? 12  LYS B O     1 
ATOM   1367 C  CB    . LYS B 2 12  ? 13.466  -3.582  -32.980 1.00 39.71  ? 12  LYS B CB    1 
ATOM   1368 C  CG    . LYS B 2 12  ? 13.364  -4.865  -32.163 1.00 45.19  ? 12  LYS B CG    1 
ATOM   1369 C  CD    . LYS B 2 12  ? 13.910  -6.068  -32.931 1.00 48.42  ? 12  LYS B CD    1 
ATOM   1370 C  CE    . LYS B 2 12  ? 15.383  -5.894  -33.296 1.00 48.20  ? 12  LYS B CE    1 
ATOM   1371 N  NZ    . LYS B 2 12  ? 15.866  -7.004  -34.181 1.00 51.84  ? 12  LYS B NZ    1 
ATOM   1372 N  N     . LEU B 2 13  ? 14.059  -0.317  -32.617 1.00 31.95  ? 13  LEU B N     1 
ATOM   1373 C  CA    . LEU B 2 13  ? 14.463  0.925   -33.256 1.00 33.06  ? 13  LEU B CA    1 
ATOM   1374 C  C     . LEU B 2 13  ? 15.963  0.971   -33.472 1.00 31.15  ? 13  LEU B C     1 
ATOM   1375 O  O     . LEU B 2 13  ? 16.749  0.802   -32.540 1.00 26.07  ? 13  LEU B O     1 
ATOM   1376 C  CB    . LEU B 2 13  ? 14.025  2.133   -32.433 1.00 30.09  ? 13  LEU B CB    1 
ATOM   1377 C  CG    . LEU B 2 13  ? 12.516  2.317   -32.295 1.00 34.06  ? 13  LEU B CG    1 
ATOM   1378 C  CD1   . LEU B 2 13  ? 12.210  3.486   -31.381 1.00 42.10  ? 13  LEU B CD1   1 
ATOM   1379 C  CD2   . LEU B 2 13  ? 11.855  2.506   -33.652 1.00 39.53  ? 13  LEU B CD2   1 
ATOM   1380 N  N     . TYR B 2 14  ? 16.361  1.210   -34.716 1.00 24.47  ? 14  TYR B N     1 
ATOM   1381 C  CA    . TYR B 2 14  ? 17.769  1.305   -35.047 1.00 23.98  ? 14  TYR B CA    1 
ATOM   1382 C  C     . TYR B 2 14  ? 18.231  2.738   -34.841 1.00 30.67  ? 14  TYR B C     1 
ATOM   1383 O  O     . TYR B 2 14  ? 17.704  3.655   -35.464 1.00 27.54  ? 14  TYR B O     1 
ATOM   1384 C  CB    . TYR B 2 14  ? 18.009  0.854   -36.486 1.00 24.37  ? 14  TYR B CB    1 
ATOM   1385 C  CG    . TYR B 2 14  ? 19.459  0.830   -36.914 1.00 30.32  ? 14  TYR B CG    1 
ATOM   1386 C  CD1   . TYR B 2 14  ? 20.397  0.041   -36.252 1.00 34.46  ? 14  TYR B CD1   1 
ATOM   1387 C  CD2   . TYR B 2 14  ? 19.880  1.562   -38.012 1.00 33.10  ? 14  TYR B CD2   1 
ATOM   1388 C  CE1   . TYR B 2 14  ? 21.728  0.011   -36.663 1.00 35.36  ? 14  TYR B CE1   1 
ATOM   1389 C  CE2   . TYR B 2 14  ? 21.199  1.549   -38.425 1.00 31.88  ? 14  TYR B CE2   1 
ATOM   1390 C  CZ    . TYR B 2 14  ? 22.119  0.779   -37.751 1.00 37.76  ? 14  TYR B CZ    1 
ATOM   1391 O  OH    . TYR B 2 14  ? 23.425  0.775   -38.190 1.00 36.87  ? 14  TYR B OH    1 
ATOM   1392 N  N     . GLY B 2 15  ? 19.223  2.923   -33.976 1.00 27.56  ? 15  GLY B N     1 
ATOM   1393 C  CA    . GLY B 2 15  ? 19.744  4.246   -33.698 1.00 25.88  ? 15  GLY B CA    1 
ATOM   1394 C  C     . GLY B 2 15  ? 20.847  4.716   -34.628 1.00 20.34  ? 15  GLY B C     1 
ATOM   1395 O  O     . GLY B 2 15  ? 21.961  4.962   -34.192 1.00 22.02  ? 15  GLY B O     1 
ATOM   1396 N  N     . ASP B 2 16  ? 20.540  4.858   -35.913 1.00 19.24  ? 16  ASP B N     1 
ATOM   1397 C  CA    . ASP B 2 16  ? 21.505  5.417   -36.845 1.00 22.61  ? 16  ASP B CA    1 
ATOM   1398 C  C     . ASP B 2 16  ? 21.697  6.900   -36.508 1.00 20.35  ? 16  ASP B C     1 
ATOM   1399 O  O     . ASP B 2 16  ? 20.873  7.493   -35.800 1.00 19.40  ? 16  ASP B O     1 
ATOM   1400 C  CB    . ASP B 2 16  ? 21.032  5.229   -38.282 1.00 29.76  ? 16  ASP B CB    1 
ATOM   1401 C  CG    . ASP B 2 16  ? 19.605  5.673   -38.465 1.00 35.59  ? 16  ASP B CG    1 
ATOM   1402 O  OD1   . ASP B 2 16  ? 19.373  6.879   -38.656 1.00 32.32  ? 16  ASP B OD1   1 
ATOM   1403 O  OD2   . ASP B 2 16  ? 18.708  4.819   -38.368 1.00 44.99  ? 16  ASP B OD2   1 
ATOM   1404 N  N     . PRO B 2 17  ? 22.811  7.488   -36.961 1.00 16.95  ? 17  PRO B N     1 
ATOM   1405 C  CA    . PRO B 2 17  ? 23.093  8.885   -36.602 1.00 13.47  ? 17  PRO B CA    1 
ATOM   1406 C  C     . PRO B 2 17  ? 21.954  9.851   -36.979 1.00 11.06  ? 17  PRO B C     1 
ATOM   1407 O  O     . PRO B 2 17  ? 21.643  10.755  -36.200 1.00 13.68  ? 17  PRO B O     1 
ATOM   1408 C  CB    . PRO B 2 17  ? 24.385  9.176   -37.377 1.00 15.75  ? 17  PRO B CB    1 
ATOM   1409 C  CG    . PRO B 2 17  ? 25.129  7.798   -37.299 1.00 13.56  ? 17  PRO B CG    1 
ATOM   1410 C  CD    . PRO B 2 17  ? 23.992  6.821   -37.556 1.00 14.49  ? 17  PRO B CD    1 
ATOM   1411 N  N     . THR B 2 18  ? 21.303  9.630   -38.122 1.00 11.62  ? 18  THR B N     1 
ATOM   1412 C  CA    . THR B 2 18  ? 20.230  10.530  -38.551 1.00 9.95   ? 18  THR B CA    1 
ATOM   1413 C  C     . THR B 2 18  ? 19.092  10.492  -37.514 1.00 16.04  ? 18  THR B C     1 
ATOM   1414 O  O     . THR B 2 18  ? 18.517  11.515  -37.148 1.00 11.94  ? 18  THR B O     1 
ATOM   1415 C  CB    . THR B 2 18  ? 19.701  10.146  -39.948 1.00 13.18  ? 18  THR B CB    1 
ATOM   1416 O  OG1   . THR B 2 18  ? 20.756  10.306  -40.920 1.00 12.76  ? 18  THR B OG1   1 
ATOM   1417 C  CG2   . THR B 2 18  ? 18.500  11.015  -40.321 1.00 17.86  ? 18  THR B CG2   1 
ATOM   1418 N  N     . PHE B 2 19  ? 18.810  9.307   -36.991 1.00 13.91  ? 19  PHE B N     1 
ATOM   1419 C  CA    . PHE B 2 19  ? 17.762  9.205   -35.990 1.00 13.91  ? 19  PHE B CA    1 
ATOM   1420 C  C     . PHE B 2 19  ? 18.163  9.960   -34.719 1.00 12.49  ? 19  PHE B C     1 
ATOM   1421 O  O     . PHE B 2 19  ? 17.373  10.724  -34.152 1.00 12.75  ? 19  PHE B O     1 
ATOM   1422 C  CB    . PHE B 2 19  ? 17.474  7.735   -35.650 1.00 17.04  ? 19  PHE B CB    1 
ATOM   1423 C  CG    . PHE B 2 19  ? 16.506  7.567   -34.501 1.00 15.79  ? 19  PHE B CG    1 
ATOM   1424 C  CD1   . PHE B 2 19  ? 15.144  7.598   -34.713 1.00 20.93  ? 19  PHE B CD1   1 
ATOM   1425 C  CD2   . PHE B 2 19  ? 16.970  7.382   -33.208 1.00 20.26  ? 19  PHE B CD2   1 
ATOM   1426 C  CE1   . PHE B 2 19  ? 14.262  7.456   -33.677 1.00 25.13  ? 19  PHE B CE1   1 
ATOM   1427 C  CE2   . PHE B 2 19  ? 16.070  7.242   -32.169 1.00 17.17  ? 19  PHE B CE2   1 
ATOM   1428 C  CZ    . PHE B 2 19  ? 14.731  7.283   -32.402 1.00 17.48  ? 19  PHE B CZ    1 
ATOM   1429 N  N     . ILE B 2 20  ? 19.387  9.708   -34.263 1.00 10.00  ? 20  ILE B N     1 
ATOM   1430 C  CA    . ILE B 2 20  ? 19.872  10.362  -33.040 1.00 9.62   ? 20  ILE B CA    1 
ATOM   1431 C  C     . ILE B 2 20  ? 19.884  11.887  -33.186 1.00 10.75  ? 20  ILE B C     1 
ATOM   1432 O  O     . ILE B 2 20  ? 19.387  12.609  -32.322 1.00 10.89  ? 20  ILE B O     1 
ATOM   1433 C  CB    . ILE B 2 20  ? 21.264  9.845   -32.664 1.00 13.00  ? 20  ILE B CB    1 
ATOM   1434 C  CG1   . ILE B 2 20  ? 21.138  8.364   -32.259 1.00 15.53  ? 20  ILE B CG1   1 
ATOM   1435 C  CG2   . ILE B 2 20  ? 21.855  10.673  -31.494 1.00 15.55  ? 20  ILE B CG2   1 
ATOM   1436 C  CD1   . ILE B 2 20  ? 22.456  7.710   -31.840 1.00 21.66  ? 20  ILE B CD1   1 
ATOM   1437 N  N     . VAL B 2 21  ? 20.436  12.389  -34.292 1.00 8.58   ? 21  VAL B N     1 
ATOM   1438 C  CA    . VAL B 2 21  ? 20.501  13.836  -34.511 1.00 8.23   ? 21  VAL B CA    1 
ATOM   1439 C  C     . VAL B 2 21  ? 19.102  14.486  -34.712 1.00 11.01  ? 21  VAL B C     1 
ATOM   1440 O  O     . VAL B 2 21  ? 18.780  15.542  -34.130 1.00 7.92   ? 21  VAL B O     1 
ATOM   1441 C  CB    . VAL B 2 21  ? 21.373  14.145  -35.738 1.00 8.33   ? 21  VAL B CB    1 
ATOM   1442 C  CG1   . VAL B 2 21  ? 21.295  15.613  -36.104 1.00 13.51  ? 21  VAL B CG1   1 
ATOM   1443 C  CG2   . VAL B 2 21  ? 22.852  13.750  -35.443 1.00 8.77   ? 21  VAL B CG2   1 
ATOM   1444 N  N     . SER B 2 22  ? 18.285  13.883  -35.569 1.00 10.92  ? 22  SER B N     1 
ATOM   1445 C  CA    . SER B 2 22  ? 17.002  14.498  -35.913 1.00 9.17   ? 22  SER B CA    1 
ATOM   1446 C  C     . SER B 2 22  ? 16.065  14.498  -34.698 1.00 9.84   ? 22  SER B C     1 
ATOM   1447 O  O     . SER B 2 22  ? 15.337  15.459  -34.488 1.00 10.77  ? 22  SER B O     1 
ATOM   1448 C  CB    . SER B 2 22  ? 16.344  13.790  -37.088 1.00 12.01  ? 22  SER B CB    1 
ATOM   1449 O  OG    . SER B 2 22  ? 16.021  12.441  -36.798 1.00 11.81  ? 22  SER B OG    1 
ATOM   1450 N  N     . THR B 2 23  ? 16.108  13.440  -33.895 1.00 9.48   ? 23  THR B N     1 
ATOM   1451 C  CA    . THR B 2 23  ? 15.241  13.453  -32.718 1.00 11.63  ? 23  THR B CA    1 
ATOM   1452 C  C     . THR B 2 23  ? 15.760  14.490  -31.709 1.00 10.98  ? 23  THR B C     1 
ATOM   1453 O  O     . THR B 2 23  ? 14.960  15.238  -31.139 1.00 9.80   ? 23  THR B O     1 
ATOM   1454 C  CB    . THR B 2 23  ? 15.118  12.065  -32.060 1.00 9.92   ? 23  THR B CB    1 
ATOM   1455 O  OG1   . THR B 2 23  ? 16.430  11.546  -31.778 1.00 10.94  ? 23  THR B OG1   1 
ATOM   1456 C  CG2   . THR B 2 23  ? 14.379  11.119  -32.987 1.00 12.02  ? 23  THR B CG2   1 
ATOM   1457 N  N     . ALA B 2 24  ? 17.072  14.545  -31.476 1.00 9.02   ? 24  ALA B N     1 
ATOM   1458 C  CA    . ALA B 2 24  ? 17.563  15.520  -30.497 1.00 8.82   ? 24  ALA B CA    1 
ATOM   1459 C  C     . ALA B 2 24  ? 17.169  16.946  -30.917 1.00 9.26   ? 24  ALA B C     1 
ATOM   1460 O  O     . ALA B 2 24  ? 16.681  17.724  -30.099 1.00 8.72   ? 24  ALA B O     1 
ATOM   1461 C  CB    . ALA B 2 24  ? 19.086  15.414  -30.319 1.00 10.23  ? 24  ALA B CB    1 
ATOM   1462 N  N     . LEU B 2 25  ? 17.352  17.284  -32.194 1.00 8.68   ? 25  LEU B N     1 
ATOM   1463 C  CA    . LEU B 2 25  ? 17.084  18.665  -32.593 1.00 10.87  ? 25  LEU B CA    1 
ATOM   1464 C  C     . LEU B 2 25  ? 15.577  18.923  -32.666 1.00 10.77  ? 25  LEU B C     1 
ATOM   1465 O  O     . LEU B 2 25  ? 15.138  20.055  -32.419 1.00 10.77  ? 25  LEU B O     1 
ATOM   1466 C  CB    . LEU B 2 25  ? 17.784  19.005  -33.921 1.00 11.02  ? 25  LEU B CB    1 
ATOM   1467 C  CG    . LEU B 2 25  ? 19.154  19.683  -33.700 1.00 10.91  ? 25  LEU B CG    1 
ATOM   1468 C  CD1   . LEU B 2 25  ? 20.129  18.714  -33.036 1.00 12.39  ? 25  LEU B CD1   1 
ATOM   1469 C  CD2   . LEU B 2 25  ? 19.732  20.210  -35.011 1.00 9.18   ? 25  LEU B CD2   1 
ATOM   1470 N  N     . ALA B 2 26  ? 14.782  17.891  -32.968 1.00 10.41  ? 26  ALA B N     1 
ATOM   1471 C  CA    . ALA B 2 26  ? 13.313  18.047  -32.910 1.00 11.81  ? 26  ALA B CA    1 
ATOM   1472 C  C     . ALA B 2 26  ? 12.789  18.233  -31.465 1.00 13.15  ? 26  ALA B C     1 
ATOM   1473 O  O     . ALA B 2 26  ? 11.681  18.764  -31.278 1.00 12.37  ? 26  ALA B O     1 
ATOM   1474 C  CB    . ALA B 2 26  ? 12.609  16.857  -33.561 1.00 11.39  ? 26  ALA B CB    1 
ATOM   1475 N  N     . THR B 2 27  ? 13.573  17.817  -30.467 1.00 9.67   ? 27  THR B N     1 
ATOM   1476 C  CA    . THR B 2 27  ? 13.209  18.088  -29.063 1.00 10.26  ? 27  THR B CA    1 
ATOM   1477 C  C     . THR B 2 27  ? 13.906  19.366  -28.561 1.00 13.35  ? 27  THR B C     1 
ATOM   1478 O  O     . THR B 2 27  ? 13.841  19.691  -27.370 1.00 13.14  ? 27  THR B O     1 
ATOM   1479 C  CB    . THR B 2 27  ? 13.550  16.921  -28.121 1.00 15.47  ? 27  THR B CB    1 
ATOM   1480 O  OG1   . THR B 2 27  ? 14.969  16.697  -28.090 1.00 17.53  ? 27  THR B OG1   1 
ATOM   1481 C  CG2   . THR B 2 27  ? 12.832  15.650  -28.566 1.00 12.24  ? 27  THR B CG2   1 
ATOM   1482 N  N     . ARG B 2 28  ? 14.521  20.083  -29.502 1.00 12.22  ? 28  ARG B N     1 
ATOM   1483 C  CA    A ARG B 2 28  ? 15.181  21.364  -29.232 0.43 10.93  ? 28  ARG B CA    1 
ATOM   1484 C  CA    B ARG B 2 28  ? 15.234  21.355  -29.287 0.57 10.59  ? 28  ARG B CA    1 
ATOM   1485 C  C     . ARG B 2 28  ? 16.320  21.218  -28.227 1.00 17.37  ? 28  ARG B C     1 
ATOM   1486 O  O     . ARG B 2 28  ? 16.561  22.123  -27.417 1.00 13.72  ? 28  ARG B O     1 
ATOM   1487 C  CB    A ARG B 2 28  ? 14.162  22.407  -28.740 0.43 13.78  ? 28  ARG B CB    1 
ATOM   1488 C  CB    B ARG B 2 28  ? 14.258  22.499  -28.954 0.57 14.86  ? 28  ARG B CB    1 
ATOM   1489 C  CG    A ARG B 2 28  ? 13.039  22.680  -29.745 0.43 14.96  ? 28  ARG B CG    1 
ATOM   1490 C  CG    B ARG B 2 28  ? 13.540  23.018  -30.224 0.57 17.52  ? 28  ARG B CG    1 
ATOM   1491 C  CD    A ARG B 2 28  ? 12.201  23.903  -29.363 0.43 18.61  ? 28  ARG B CD    1 
ATOM   1492 C  CD    B ARG B 2 28  ? 12.894  24.402  -30.091 0.57 21.41  ? 28  ARG B CD    1 
ATOM   1493 N  NE    A ARG B 2 28  ? 13.007  25.121  -29.352 0.43 16.72  ? 28  ARG B NE    1 
ATOM   1494 N  NE    B ARG B 2 28  ? 13.816  25.485  -29.730 0.57 17.52  ? 28  ARG B NE    1 
ATOM   1495 C  CZ    A ARG B 2 28  ? 13.017  26.003  -28.363 0.43 14.95  ? 28  ARG B CZ    1 
ATOM   1496 C  CZ    B ARG B 2 28  ? 14.744  25.996  -30.533 0.57 19.24  ? 28  ARG B CZ    1 
ATOM   1497 N  NH1   A ARG B 2 28  ? 12.249  25.816  -27.301 0.43 14.24  ? 28  ARG B NH1   1 
ATOM   1498 N  NH1   B ARG B 2 28  ? 14.932  25.512  -31.755 0.57 11.56  ? 28  ARG B NH1   1 
ATOM   1499 N  NH2   A ARG B 2 28  ? 13.796  27.077  -28.439 0.43 23.23  ? 28  ARG B NH2   1 
ATOM   1500 N  NH2   B ARG B 2 28  ? 15.506  26.988  -30.101 0.57 20.49  ? 28  ARG B NH2   1 
ATOM   1501 N  N     . ASP B 2 29  ? 17.012  20.081  -28.300 1.00 11.22  ? 29  ASP B N     1 
ATOM   1502 C  CA    . ASP B 2 29  ? 18.124  19.762  -27.431 1.00 10.87  ? 29  ASP B CA    1 
ATOM   1503 C  C     . ASP B 2 29  ? 19.401  19.865  -28.279 1.00 13.56  ? 29  ASP B C     1 
ATOM   1504 O  O     . ASP B 2 29  ? 19.660  18.996  -29.122 1.00 11.57  ? 29  ASP B O     1 
ATOM   1505 C  CB    . ASP B 2 29  ? 17.959  18.337  -26.869 1.00 11.09  ? 29  ASP B CB    1 
ATOM   1506 C  CG    . ASP B 2 29  ? 19.025  17.945  -25.857 1.00 19.69  ? 29  ASP B CG    1 
ATOM   1507 O  OD1   . ASP B 2 29  ? 20.130  18.526  -25.816 1.00 13.11  ? 29  ASP B OD1   1 
ATOM   1508 O  OD2   . ASP B 2 29  ? 18.715  16.990  -25.126 1.00 13.02  ? 29  ASP B OD2   1 
ATOM   1509 N  N     . PHE B 2 30  ? 20.176  20.926  -28.063 1.00 10.99  ? 30  PHE B N     1 
ATOM   1510 C  CA    . PHE B 2 30  ? 21.325  21.196  -28.912 1.00 11.15  ? 30  PHE B CA    1 
ATOM   1511 C  C     . PHE B 2 30  ? 22.641  20.802  -28.216 1.00 11.63  ? 30  PHE B C     1 
ATOM   1512 O  O     . PHE B 2 30  ? 23.732  21.195  -28.677 1.00 12.04  ? 30  PHE B O     1 
ATOM   1513 C  CB    . PHE B 2 30  ? 21.330  22.673  -29.301 1.00 11.47  ? 30  PHE B CB    1 
ATOM   1514 C  CG    . PHE B 2 30  ? 20.228  23.051  -30.272 1.00 11.18  ? 30  PHE B CG    1 
ATOM   1515 C  CD1   . PHE B 2 30  ? 20.416  22.934  -31.647 1.00 14.10  ? 30  PHE B CD1   1 
ATOM   1516 C  CD2   . PHE B 2 30  ? 19.008  23.477  -29.802 1.00 13.74  ? 30  PHE B CD2   1 
ATOM   1517 C  CE1   . PHE B 2 30  ? 19.391  23.271  -32.543 1.00 12.70  ? 30  PHE B CE1   1 
ATOM   1518 C  CE2   . PHE B 2 30  ? 17.977  23.816  -30.685 1.00 21.44  ? 30  PHE B CE2   1 
ATOM   1519 C  CZ    . PHE B 2 30  ? 18.172  23.709  -32.056 1.00 16.53  ? 30  PHE B CZ    1 
ATOM   1520 N  N     . GLN B 2 31  ? 22.557  20.014  -27.140 1.00 12.69  ? 31  GLN B N     1 
ATOM   1521 C  CA    . GLN B 2 31  ? 23.782  19.541  -26.457 1.00 13.23  ? 31  GLN B CA    1 
ATOM   1522 C  C     . GLN B 2 31  ? 24.671  18.825  -27.458 1.00 12.35  ? 31  GLN B C     1 
ATOM   1523 O  O     . GLN B 2 31  ? 24.195  17.994  -28.241 1.00 11.88  ? 31  GLN B O     1 
ATOM   1524 C  CB    . GLN B 2 31  ? 23.513  18.558  -25.299 1.00 17.48  ? 31  GLN B CB    1 
ATOM   1525 C  CG    . GLN B 2 31  ? 22.696  18.995  -24.104 1.00 30.62  ? 31  GLN B CG    1 
ATOM   1526 C  CD    . GLN B 2 31  ? 22.727  17.902  -23.010 1.00 30.65  ? 31  GLN B CD    1 
ATOM   1527 O  OE1   . GLN B 2 31  ? 23.627  17.069  -22.995 1.00 47.16  ? 31  GLN B OE1   1 
ATOM   1528 N  NE2   . GLN B 2 31  ? 21.759  17.915  -22.117 1.00 21.19  ? 31  GLN B NE2   1 
ATOM   1529 N  N     . ASP B 2 32  ? 25.971  19.098  -27.437 1.00 13.89  ? 32  ASP B N     1 
ATOM   1530 C  CA    . ASP B 2 32  ? 26.789  18.531  -28.503 1.00 14.44  ? 32  ASP B CA    1 
ATOM   1531 C  C     . ASP B 2 32  ? 26.859  16.993  -28.458 1.00 17.76  ? 32  ASP B C     1 
ATOM   1532 O  O     . ASP B 2 32  ? 27.070  16.381  -29.489 1.00 18.91  ? 32  ASP B O     1 
ATOM   1533 C  CB    . ASP B 2 32  ? 28.205  19.156  -28.508 1.00 23.92  ? 32  ASP B CB    1 
ATOM   1534 C  CG    . ASP B 2 32  ? 28.779  19.324  -27.131 1.00 38.21  ? 32  ASP B CG    1 
ATOM   1535 O  OD1   . ASP B 2 32  ? 28.397  18.533  -26.229 1.00 37.00  ? 32  ASP B OD1   1 
ATOM   1536 O  OD2   . ASP B 2 32  ? 29.629  20.236  -26.953 1.00 36.71  ? 32  ASP B OD2   1 
ATOM   1537 N  N     . VAL B 2 33  ? 26.621  16.366  -27.297 1.00 13.28  ? 33  VAL B N     1 
ATOM   1538 C  CA    . VAL B 2 33  ? 26.689  14.908  -27.207 1.00 17.33  ? 33  VAL B CA    1 
ATOM   1539 C  C     . VAL B 2 33  ? 25.674  14.144  -28.074 1.00 20.56  ? 33  VAL B C     1 
ATOM   1540 O  O     . VAL B 2 33  ? 25.837  12.941  -28.295 1.00 18.81  ? 33  VAL B O     1 
ATOM   1541 C  CB    . VAL B 2 33  ? 26.537  14.417  -25.724 1.00 17.27  ? 33  VAL B CB    1 
ATOM   1542 C  CG1   . VAL B 2 33  ? 27.793  14.791  -24.923 1.00 18.35  ? 33  VAL B CG1   1 
ATOM   1543 C  CG2   . VAL B 2 33  ? 25.273  14.965  -25.074 1.00 19.04  ? 33  VAL B CG2   1 
ATOM   1544 N  N     . HIS B 2 34  ? 24.657  14.814  -28.598 1.00 14.51  ? 34  HIS B N     1 
ATOM   1545 C  CA    . HIS B 2 34  ? 23.696  14.122  -29.443 1.00 11.94  ? 34  HIS B CA    1 
ATOM   1546 C  C     . HIS B 2 34  ? 23.923  14.375  -30.928 1.00 12.09  ? 34  HIS B C     1 
ATOM   1547 O  O     . HIS B 2 34  ? 23.193  13.819  -31.754 1.00 15.23  ? 34  HIS B O     1 
ATOM   1548 C  CB    . HIS B 2 34  ? 22.253  14.514  -29.097 1.00 11.60  ? 34  HIS B CB    1 
ATOM   1549 C  CG    . HIS B 2 34  ? 22.011  14.608  -27.629 1.00 11.90  ? 34  HIS B CG    1 
ATOM   1550 N  ND1   . HIS B 2 34  ? 22.166  13.532  -26.783 1.00 12.57  ? 34  HIS B ND1   1 
ATOM   1551 C  CD2   . HIS B 2 34  ? 21.625  15.649  -26.856 1.00 12.20  ? 34  HIS B CD2   1 
ATOM   1552 C  CE1   . HIS B 2 34  ? 21.913  13.913  -25.540 1.00 12.91  ? 34  HIS B CE1   1 
ATOM   1553 N  NE2   . HIS B 2 34  ? 21.608  15.196  -25.561 1.00 12.88  ? 34  HIS B NE2   1 
ATOM   1554 N  N     . HIS B 2 35  ? 24.920  15.188  -31.285 1.00 12.46  ? 35  HIS B N     1 
ATOM   1555 C  CA    . HIS B 2 35  ? 25.202  15.399  -32.712 1.00 13.17  ? 35  HIS B CA    1 
ATOM   1556 C  C     . HIS B 2 35  ? 26.658  15.596  -33.087 1.00 14.76  ? 35  HIS B C     1 
ATOM   1557 O  O     . HIS B 2 35  ? 26.979  15.620  -34.264 1.00 21.07  ? 35  HIS B O     1 
ATOM   1558 C  CB    . HIS B 2 35  ? 24.420  16.598  -33.259 1.00 11.99  ? 35  HIS B CB    1 
ATOM   1559 C  CG    . HIS B 2 35  ? 24.838  17.914  -32.666 1.00 12.09  ? 35  HIS B CG    1 
ATOM   1560 N  ND1   . HIS B 2 35  ? 24.177  18.495  -31.604 1.00 12.00  ? 35  HIS B ND1   1 
ATOM   1561 C  CD2   . HIS B 2 35  ? 25.857  18.755  -32.978 1.00 14.17  ? 35  HIS B CD2   1 
ATOM   1562 C  CE1   . HIS B 2 35  ? 24.761  19.642  -31.292 1.00 12.24  ? 35  HIS B CE1   1 
ATOM   1563 N  NE2   . HIS B 2 35  ? 25.797  19.813  -32.094 1.00 12.73  ? 35  HIS B NE2   1 
ATOM   1564 N  N     . ASP B 2 36  ? 27.539  15.704  -32.106 1.00 12.95  ? 36  ASP B N     1 
ATOM   1565 C  CA    . ASP B 2 36  ? 28.942  15.992  -32.375 1.00 13.67  ? 36  ASP B CA    1 
ATOM   1566 C  C     . ASP B 2 36  ? 29.764  14.866  -31.735 1.00 17.56  ? 36  ASP B C     1 
ATOM   1567 O  O     . ASP B 2 36  ? 29.991  14.826  -30.529 1.00 16.50  ? 36  ASP B O     1 
ATOM   1568 C  CB    . ASP B 2 36  ? 29.305  17.386  -31.829 1.00 15.10  ? 36  ASP B CB    1 
ATOM   1569 C  CG    . ASP B 2 36  ? 30.767  17.769  -32.063 1.00 15.46  ? 36  ASP B CG    1 
ATOM   1570 O  OD1   . ASP B 2 36  ? 31.601  16.890  -32.380 1.00 17.61  ? 36  ASP B OD1   1 
ATOM   1571 O  OD2   . ASP B 2 36  ? 31.072  18.970  -31.925 1.00 20.88  ? 36  ASP B OD2   1 
ATOM   1572 N  N     . ARG B 2 37  ? 30.176  13.917  -32.557 1.00 16.22  ? 37  ARG B N     1 
ATOM   1573 C  CA    . ARG B 2 37  ? 30.909  12.769  -32.050 1.00 16.63  ? 37  ARG B CA    1 
ATOM   1574 C  C     . ARG B 2 37  ? 32.190  13.168  -31.316 1.00 17.26  ? 37  ARG B C     1 
ATOM   1575 O  O     . ARG B 2 37  ? 32.489  12.619  -30.262 1.00 17.61  ? 37  ARG B O     1 
ATOM   1576 C  CB    . ARG B 2 37  ? 31.250  11.829  -33.197 1.00 16.87  ? 37  ARG B CB    1 
ATOM   1577 C  CG    . ARG B 2 37  ? 32.328  10.815  -32.872 1.00 18.94  ? 37  ARG B CG    1 
ATOM   1578 C  CD    . ARG B 2 37  ? 32.605  9.966   -34.095 1.00 17.94  ? 37  ARG B CD    1 
ATOM   1579 N  NE    . ARG B 2 37  ? 31.508  9.037   -34.342 1.00 24.32  ? 37  ARG B NE    1 
ATOM   1580 C  CZ    . ARG B 2 37  ? 31.320  8.406   -35.496 1.00 24.15  ? 37  ARG B CZ    1 
ATOM   1581 N  NH1   . ARG B 2 37  ? 32.161  8.619   -36.501 1.00 22.88  ? 37  ARG B NH1   1 
ATOM   1582 N  NH2   . ARG B 2 37  ? 30.294  7.573   -35.649 1.00 20.94  ? 37  ARG B NH2   1 
ATOM   1583 N  N     . ASP B 2 38  ? 32.943  14.107  -31.877 1.00 17.53  ? 38  ASP B N     1 
ATOM   1584 C  CA    . ASP B 2 38  ? 34.215  14.499  -31.280 1.00 21.83  ? 38  ASP B CA    1 
ATOM   1585 C  C     . ASP B 2 38  ? 34.011  15.093  -29.884 1.00 20.21  ? 38  ASP B C     1 
ATOM   1586 O  O     . ASP B 2 38  ? 34.768  14.788  -28.963 1.00 19.05  ? 38  ASP B O     1 
ATOM   1587 C  CB    . ASP B 2 38  ? 34.949  15.477  -32.190 1.00 19.40  ? 38  ASP B CB    1 
ATOM   1588 C  CG    . ASP B 2 38  ? 35.329  14.845  -33.531 1.00 18.71  ? 38  ASP B CG    1 
ATOM   1589 O  OD1   . ASP B 2 38  ? 35.420  13.605  -33.607 1.00 22.08  ? 38  ASP B OD1   1 
ATOM   1590 O  OD2   . ASP B 2 38  ? 35.520  15.594  -34.499 1.00 19.40  ? 38  ASP B OD2   1 
ATOM   1591 N  N     . LYS B 2 39  ? 32.973  15.904  -29.713 1.00 18.33  ? 39  LYS B N     1 
ATOM   1592 C  CA    . LYS B 2 39  ? 32.676  16.439  -28.373 1.00 18.63  ? 39  LYS B CA    1 
ATOM   1593 C  C     . LYS B 2 39  ? 32.173  15.351  -27.420 1.00 22.33  ? 39  LYS B C     1 
ATOM   1594 O  O     . LYS B 2 39  ? 32.463  15.386  -26.211 1.00 20.24  ? 39  LYS B O     1 
ATOM   1595 C  CB    . LYS B 2 39  ? 31.649  17.572  -28.444 1.00 18.32  ? 39  LYS B CB    1 
ATOM   1596 C  CG    . LYS B 2 39  ? 32.171  18.897  -28.969 1.00 22.94  ? 39  LYS B CG    1 
ATOM   1597 C  CD    . LYS B 2 39  ? 33.082  19.615  -27.990 1.00 32.77  ? 39  LYS B CD    1 
ATOM   1598 C  CE    . LYS B 2 39  ? 33.375  21.011  -28.525 1.00 32.17  ? 39  LYS B CE    1 
ATOM   1599 N  NZ    . LYS B 2 39  ? 34.340  21.751  -27.669 1.00 39.04  ? 39  LYS B NZ    1 
ATOM   1600 N  N     . ALA B 2 40  ? 31.436  14.379  -27.951 1.00 17.80  ? 40  ALA B N     1 
ATOM   1601 C  CA    . ALA B 2 40  ? 30.959  13.262  -27.139 1.00 17.72  ? 40  ALA B CA    1 
ATOM   1602 C  C     . ALA B 2 40  ? 32.143  12.431  -26.635 1.00 21.01  ? 40  ALA B C     1 
ATOM   1603 O  O     . ALA B 2 40  ? 32.218  12.078  -25.467 1.00 20.90  ? 40  ALA B O     1 
ATOM   1604 C  CB    . ALA B 2 40  ? 29.982  12.375  -27.934 1.00 19.35  ? 40  ALA B CB    1 
ATOM   1605 N  N     . VAL B 2 41  ? 33.066  12.132  -27.535 1.00 18.72  ? 41  VAL B N     1 
ATOM   1606 C  CA    . VAL B 2 41  ? 34.248  11.351  -27.180 1.00 21.55  ? 41  VAL B CA    1 
ATOM   1607 C  C     . VAL B 2 41  ? 35.107  12.131  -26.195 1.00 21.08  ? 41  VAL B C     1 
ATOM   1608 O  O     . VAL B 2 41  ? 35.603  11.562  -25.207 1.00 25.77  ? 41  VAL B O     1 
ATOM   1609 C  CB    . VAL B 2 41  ? 35.043  10.966  -28.458 1.00 22.72  ? 41  VAL B CB    1 
ATOM   1610 C  CG1   . VAL B 2 41  ? 36.422  10.378  -28.115 1.00 20.80  ? 41  VAL B CG1   1 
ATOM   1611 C  CG2   . VAL B 2 41  ? 34.224  9.982   -29.285 1.00 19.80  ? 41  VAL B CG2   1 
ATOM   1612 N  N     . ALA B 2 42  ? 35.261  13.432  -26.433 1.00 20.65  ? 42  ALA B N     1 
ATOM   1613 C  CA    . ALA B 2 42  ? 36.046  14.285  -25.547 1.00 21.54  ? 42  ALA B CA    1 
ATOM   1614 C  C     . ALA B 2 42  ? 35.488  14.283  -24.131 1.00 33.22  ? 42  ALA B C     1 
ATOM   1615 O  O     . ALA B 2 42  ? 36.231  14.444  -23.161 1.00 34.09  ? 42  ALA B O     1 
ATOM   1616 C  CB    . ALA B 2 42  ? 36.093  15.704  -26.076 1.00 21.39  ? 42  ALA B CB    1 
ATOM   1617 N  N     . GLN B 2 43  ? 34.175  14.107  -24.016 1.00 23.94  ? 43  GLN B N     1 
ATOM   1618 C  CA    . GLN B 2 43  ? 33.525  14.131  -22.711 1.00 24.53  ? 43  GLN B CA    1 
ATOM   1619 C  C     . GLN B 2 43  ? 33.371  12.729  -22.157 1.00 29.46  ? 43  GLN B C     1 
ATOM   1620 O  O     . GLN B 2 43  ? 32.651  12.518  -21.183 1.00 38.39  ? 43  GLN B O     1 
ATOM   1621 C  CB    . GLN B 2 43  ? 32.166  14.835  -22.798 1.00 28.33  ? 43  GLN B CB    1 
ATOM   1622 C  CG    . GLN B 2 43  ? 32.253  16.311  -23.147 1.00 31.76  ? 43  GLN B CG    1 
ATOM   1623 C  CD    . GLN B 2 43  ? 30.874  16.945  -23.301 1.00 41.31  ? 43  GLN B CD    1 
ATOM   1624 O  OE1   . GLN B 2 43  ? 30.017  16.790  -22.434 1.00 47.98  ? 43  GLN B OE1   1 
ATOM   1625 N  NE2   . GLN B 2 43  ? 30.651  17.641  -24.410 1.00 34.51  ? 43  GLN B NE2   1 
ATOM   1626 N  N     . GLY B 2 44  ? 34.060  11.770  -22.772 1.00 28.99  ? 44  GLY B N     1 
ATOM   1627 C  CA    . GLY B 2 44  ? 34.145  10.428  -22.226 1.00 31.66  ? 44  GLY B CA    1 
ATOM   1628 C  C     . GLY B 2 44  ? 33.121  9.408   -22.700 1.00 33.90  ? 44  GLY B C     1 
ATOM   1629 O  O     . GLY B 2 44  ? 33.097  8.280   -22.196 1.00 32.34  ? 44  GLY B O     1 
ATOM   1630 N  N     . SER B 2 45  ? 32.281  9.792   -23.665 1.00 22.33  ? 45  SER B N     1 
ATOM   1631 C  CA    . SER B 2 45  ? 31.308  8.870   -24.254 1.00 22.46  ? 45  SER B CA    1 
ATOM   1632 C  C     . SER B 2 45  ? 31.919  8.142   -25.441 1.00 23.07  ? 45  SER B C     1 
ATOM   1633 O  O     . SER B 2 45  ? 32.897  8.616   -26.023 1.00 29.21  ? 45  SER B O     1 
ATOM   1634 C  CB    . SER B 2 45  ? 30.045  9.619   -24.691 1.00 20.79  ? 45  SER B CB    1 
ATOM   1635 O  OG    . SER B 2 45  ? 29.341  10.107  -23.557 1.00 31.62  ? 45  SER B OG    1 
ATOM   1636 N  N     . LYS B 2 46  ? 31.356  6.989   -25.791 1.00 23.77  ? 46  LYS B N     1 
ATOM   1637 C  CA    A LYS B 2 46  ? 31.834  6.223   -26.942 0.52 24.86  ? 46  LYS B CA    1 
ATOM   1638 C  CA    B LYS B 2 46  ? 31.834  6.223   -26.942 0.48 24.96  ? 46  LYS B CA    1 
ATOM   1639 C  C     . LYS B 2 46  ? 31.505  6.924   -28.262 1.00 26.40  ? 46  LYS B C     1 
ATOM   1640 O  O     . LYS B 2 46  ? 32.347  6.998   -29.164 1.00 24.37  ? 46  LYS B O     1 
ATOM   1641 C  CB    . LYS B 2 46  ? 31.229  4.819   -26.942 1.00 27.09  ? 46  LYS B CB    1 
ATOM   1642 C  CG    . LYS B 2 46  ? 31.656  3.963   -28.145 1.00 36.98  ? 46  LYS B CG    1 
ATOM   1643 C  CD    . LYS B 2 46  ? 30.515  3.101   -28.673 1.00 39.73  ? 46  LYS B CD    1 
ATOM   1644 C  CE    . LYS B 2 46  ? 30.950  2.280   -29.895 1.00 43.96  ? 46  LYS B CE    1 
ATOM   1645 N  NZ    . LYS B 2 46  ? 29.792  1.618   -30.558 1.00 44.24  ? 46  LYS B NZ    1 
ATOM   1646 N  N     . ASP B 2 47  ? 30.281  7.438   -28.359 1.00 22.00  ? 47  ASP B N     1 
ATOM   1647 C  CA    . ASP B 2 47  ? 29.758  8.067   -29.576 1.00 18.51  ? 47  ASP B CA    1 
ATOM   1648 C  C     . ASP B 2 47  ? 28.640  9.030   -29.185 1.00 17.35  ? 47  ASP B C     1 
ATOM   1649 O  O     . ASP B 2 47  ? 28.360  9.217   -28.009 1.00 17.16  ? 47  ASP B O     1 
ATOM   1650 C  CB    . ASP B 2 47  ? 29.219  7.002   -30.541 1.00 18.89  ? 47  ASP B CB    1 
ATOM   1651 C  CG    . ASP B 2 47  ? 29.295  7.423   -32.004 1.00 26.58  ? 47  ASP B CG    1 
ATOM   1652 O  OD1   . ASP B 2 47  ? 29.456  8.629   -32.297 1.00 20.00  ? 47  ASP B OD1   1 
ATOM   1653 O  OD2   . ASP B 2 47  ? 29.210  6.514   -32.864 1.00 27.07  ? 47  ASP B OD2   1 
ATOM   1654 N  N     . ILE B 2 48  ? 27.994  9.655   -30.166 1.00 16.23  ? 48  ILE B N     1 
ATOM   1655 C  CA    . ILE B 2 48  ? 26.778  10.387  -29.844 1.00 15.64  ? 48  ILE B CA    1 
ATOM   1656 C  C     . ILE B 2 48  ? 25.721  9.400   -29.338 1.00 17.43  ? 48  ILE B C     1 
ATOM   1657 O  O     . ILE B 2 48  ? 25.778  8.192   -29.648 1.00 16.54  ? 48  ILE B O     1 
ATOM   1658 C  CB    . ILE B 2 48  ? 26.240  11.149  -31.061 1.00 15.11  ? 48  ILE B CB    1 
ATOM   1659 C  CG1   . ILE B 2 48  ? 25.943  10.171  -32.201 1.00 16.31  ? 48  ILE B CG1   1 
ATOM   1660 C  CG2   . ILE B 2 48  ? 27.238  12.229  -31.497 1.00 15.24  ? 48  ILE B CG2   1 
ATOM   1661 C  CD1   . ILE B 2 48  ? 25.152  10.820  -33.345 1.00 14.77  ? 48  ILE B CD1   1 
ATOM   1662 N  N     . PHE B 2 49  ? 24.755  9.897   -28.575 1.00 15.36  ? 49  PHE B N     1 
ATOM   1663 C  CA    . PHE B 2 49  ? 23.732  9.027   -27.997 1.00 16.21  ? 49  PHE B CA    1 
ATOM   1664 C  C     . PHE B 2 49  ? 22.373  9.709   -27.919 1.00 16.67  ? 49  PHE B C     1 
ATOM   1665 O  O     . PHE B 2 49  ? 22.276  10.941  -27.909 1.00 15.01  ? 49  PHE B O     1 
ATOM   1666 C  CB    . PHE B 2 49  ? 24.180  8.518   -26.608 1.00 16.25  ? 49  PHE B CB    1 
ATOM   1667 C  CG    . PHE B 2 49  ? 24.564  9.610   -25.629 1.00 18.25  ? 49  PHE B CG    1 
ATOM   1668 C  CD1   . PHE B 2 49  ? 23.598  10.219  -24.827 1.00 16.33  ? 49  PHE B CD1   1 
ATOM   1669 C  CD2   . PHE B 2 49  ? 25.891  10.000  -25.488 1.00 19.36  ? 49  PHE B CD2   1 
ATOM   1670 C  CE1   . PHE B 2 49  ? 23.948  11.211  -23.904 1.00 16.71  ? 49  PHE B CE1   1 
ATOM   1671 C  CE2   . PHE B 2 49  ? 26.256  10.992  -24.561 1.00 17.20  ? 49  PHE B CE2   1 
ATOM   1672 C  CZ    . PHE B 2 49  ? 25.269  11.597  -23.768 1.00 18.87  ? 49  PHE B CZ    1 
ATOM   1673 N  N     . VAL B 2 50  ? 21.316  8.901   -27.884 1.00 14.90  ? 50  VAL B N     1 
ATOM   1674 C  CA    . VAL B 2 50  ? 19.940  9.402   -27.832 1.00 14.82  ? 50  VAL B CA    1 
ATOM   1675 C  C     . VAL B 2 50  ? 19.671  10.206  -26.547 1.00 14.58  ? 50  VAL B C     1 
ATOM   1676 O  O     . VAL B 2 50  ? 20.087  9.791   -25.456 1.00 15.80  ? 50  VAL B O     1 
ATOM   1677 C  CB    . VAL B 2 50  ? 18.944  8.217   -27.947 1.00 19.91  ? 50  VAL B CB    1 
ATOM   1678 C  CG1   . VAL B 2 50  ? 17.524  8.672   -27.793 1.00 18.85  ? 50  VAL B CG1   1 
ATOM   1679 C  CG2   . VAL B 2 50  ? 19.156  7.494   -29.283 1.00 18.69  ? 50  VAL B CG2   1 
ATOM   1680 N  N     . ASN B 2 51  ? 18.966  11.331  -26.669 1.00 14.16  ? 51  ASN B N     1 
ATOM   1681 C  CA    . ASN B 2 51  ? 18.723  12.198  -25.518 1.00 17.27  ? 51  ASN B CA    1 
ATOM   1682 C  C     . ASN B 2 51  ? 17.491  11.757  -24.717 1.00 24.20  ? 51  ASN B C     1 
ATOM   1683 O  O     . ASN B 2 51  ? 16.738  10.882  -25.132 1.00 15.78  ? 51  ASN B O     1 
ATOM   1684 C  CB    . ASN B 2 51  ? 18.616  13.679  -25.960 1.00 14.13  ? 51  ASN B CB    1 
ATOM   1685 C  CG    . ASN B 2 51  ? 17.256  14.055  -26.544 1.00 16.35  ? 51  ASN B CG    1 
ATOM   1686 O  OD1   . ASN B 2 51  ? 16.561  13.232  -27.113 1.00 17.43  ? 51  ASN B OD1   1 
ATOM   1687 N  ND2   . ASN B 2 51  ? 16.886  15.335  -26.411 1.00 17.48  ? 51  ASN B ND2   1 
ATOM   1688 N  N     . ILE B 2 52  ? 17.308  12.350  -23.550 1.00 15.97  ? 52  ILE B N     1 
ATOM   1689 C  CA    . ILE B 2 52  ? 16.289  11.887  -22.630 1.00 15.57  ? 52  ILE B CA    1 
ATOM   1690 C  C     . ILE B 2 52  ? 14.877  12.246  -23.141 1.00 16.40  ? 52  ILE B C     1 
ATOM   1691 O  O     . ILE B 2 52  ? 13.931  11.471  -22.952 1.00 18.66  ? 52  ILE B O     1 
ATOM   1692 C  CB    . ILE B 2 52  ? 16.556  12.465  -21.216 1.00 16.56  ? 52  ILE B CB    1 
ATOM   1693 C  CG1   . ILE B 2 52  ? 17.876  11.892  -20.666 1.00 22.23  ? 52  ILE B CG1   1 
ATOM   1694 C  CG2   . ILE B 2 52  ? 15.390  12.178  -20.256 1.00 22.90  ? 52  ILE B CG2   1 
ATOM   1695 C  CD1   . ILE B 2 52  ? 18.502  12.711  -19.499 1.00 21.93  ? 52  ILE B CD1   1 
ATOM   1696 N  N     . LEU B 2 53  ? 14.741  13.392  -23.815 1.00 15.62  ? 53  LEU B N     1 
ATOM   1697 C  CA    A LEU B 2 53  ? 13.427  13.800  -24.327 0.58 18.07  ? 53  LEU B CA    1 
ATOM   1698 C  CA    B LEU B 2 53  ? 13.447  13.818  -24.354 0.42 17.03  ? 53  LEU B CA    1 
ATOM   1699 C  C     . LEU B 2 53  ? 12.950  12.863  -25.427 1.00 17.31  ? 53  LEU B C     1 
ATOM   1700 O  O     . LEU B 2 53  ? 11.752  12.654  -25.588 1.00 16.72  ? 53  LEU B O     1 
ATOM   1701 C  CB    A LEU B 2 53  ? 13.449  15.240  -24.832 0.58 14.01  ? 53  LEU B CB    1 
ATOM   1702 C  CB    B LEU B 2 53  ? 13.540  15.229  -24.922 0.42 13.94  ? 53  LEU B CB    1 
ATOM   1703 C  CG    A LEU B 2 53  ? 13.049  16.276  -23.778 0.58 14.80  ? 53  LEU B CG    1 
ATOM   1704 C  CG    B LEU B 2 53  ? 13.762  16.315  -23.873 0.42 15.96  ? 53  LEU B CG    1 
ATOM   1705 C  CD1   A LEU B 2 53  ? 13.117  17.717  -24.293 0.58 15.63  ? 53  LEU B CD1   1 
ATOM   1706 C  CD1   B LEU B 2 53  ? 13.851  17.703  -24.490 0.42 16.08  ? 53  LEU B CD1   1 
ATOM   1707 C  CD2   A LEU B 2 53  ? 11.651  15.948  -23.231 0.58 19.33  ? 53  LEU B CD2   1 
ATOM   1708 C  CD2   B LEU B 2 53  ? 12.625  16.232  -22.900 0.42 18.48  ? 53  LEU B CD2   1 
ATOM   1709 N  N     . THR B 2 54  ? 13.884  12.297  -26.177 1.00 15.53  ? 54  THR B N     1 
ATOM   1710 C  CA    . THR B 2 54  ? 13.522  11.313  -27.186 1.00 16.41  ? 54  THR B CA    1 
ATOM   1711 C  C     . THR B 2 54  ? 13.097  10.013  -26.494 1.00 18.63  ? 54  THR B C     1 
ATOM   1712 O  O     . THR B 2 54  ? 12.132  9.360   -26.921 1.00 18.86  ? 54  THR B O     1 
ATOM   1713 C  CB    . THR B 2 54  ? 14.689  11.068  -28.159 1.00 15.89  ? 54  THR B CB    1 
ATOM   1714 O  OG1   . THR B 2 54  ? 14.982  12.287  -28.860 1.00 14.81  ? 54  THR B OG1   1 
ATOM   1715 C  CG2   . THR B 2 54  ? 14.384  9.960   -29.159 1.00 16.97  ? 54  THR B CG2   1 
ATOM   1716 N  N     . ASP B 2 55  ? 13.798  9.633   -25.428 1.00 18.33  ? 55  ASP B N     1 
ATOM   1717 C  CA    . ASP B 2 55  ? 13.352  8.482   -24.625 1.00 22.73  ? 55  ASP B CA    1 
ATOM   1718 C  C     . ASP B 2 55  ? 11.894  8.640   -24.211 1.00 21.90  ? 55  ASP B C     1 
ATOM   1719 O  O     . ASP B 2 55  ? 11.092  7.717   -24.348 1.00 22.64  ? 55  ASP B O     1 
ATOM   1720 C  CB    . ASP B 2 55  ? 14.193  8.291   -23.343 1.00 25.81  ? 55  ASP B CB    1 
ATOM   1721 C  CG    . ASP B 2 55  ? 15.554  7.643   -23.595 1.00 32.32  ? 55  ASP B CG    1 
ATOM   1722 O  OD1   . ASP B 2 55  ? 15.722  6.929   -24.606 1.00 24.83  ? 55  ASP B OD1   1 
ATOM   1723 O  OD2   . ASP B 2 55  ? 16.457  7.838   -22.747 1.00 33.40  ? 55  ASP B OD2   1 
ATOM   1724 N  N     . THR B 2 56  ? 11.560  9.811   -23.676 1.00 20.19  ? 56  THR B N     1 
ATOM   1725 C  CA    . THR B 2 56  ? 10.208  10.074  -23.213 1.00 21.08  ? 56  THR B CA    1 
ATOM   1726 C  C     . THR B 2 56  ? 9.217   9.946   -24.377 1.00 21.18  ? 56  THR B C     1 
ATOM   1727 O  O     . THR B 2 56  ? 8.145   9.349   -24.249 1.00 26.70  ? 56  THR B O     1 
ATOM   1728 C  CB    . THR B 2 56  ? 10.114  11.476  -22.591 1.00 26.36  ? 56  THR B CB    1 
ATOM   1729 O  OG1   . THR B 2 56  ? 11.125  11.617  -21.586 1.00 22.75  ? 56  THR B OG1   1 
ATOM   1730 C  CG2   . THR B 2 56  ? 8.763   11.701  -21.958 1.00 22.70  ? 56  THR B CG2   1 
ATOM   1731 N  N     . GLY B 2 57  ? 9.600   10.495  -25.520 1.00 19.84  ? 57  GLY B N     1 
ATOM   1732 C  CA    . GLY B 2 57  ? 8.723   10.494  -26.677 1.00 20.37  ? 57  GLY B CA    1 
ATOM   1733 C  C     . GLY B 2 57  ? 8.497   9.102   -27.245 1.00 25.55  ? 57  GLY B C     1 
ATOM   1734 O  O     . GLY B 2 57  ? 7.400   8.785   -27.712 1.00 26.53  ? 57  GLY B O     1 
ATOM   1735 N  N     . LEU B 2 58  ? 9.538   8.275   -27.222 1.00 21.61  ? 58  LEU B N     1 
ATOM   1736 C  CA    . LEU B 2 58  ? 9.414   6.906   -27.727 1.00 24.13  ? 58  LEU B CA    1 
ATOM   1737 C  C     . LEU B 2 58  ? 8.592   6.031   -26.798 1.00 26.72  ? 58  LEU B C     1 
ATOM   1738 O  O     . LEU B 2 58  ? 7.833   5.172   -27.250 1.00 27.28  ? 58  LEU B O     1 
ATOM   1739 C  CB    . LEU B 2 58  ? 10.787  6.285   -27.927 1.00 24.91  ? 58  LEU B CB    1 
ATOM   1740 C  CG    . LEU B 2 58  ? 11.652  6.924   -29.012 1.00 27.61  ? 58  LEU B CG    1 
ATOM   1741 C  CD1   . LEU B 2 58  ? 13.025  6.292   -28.982 1.00 24.12  ? 58  LEU B CD1   1 
ATOM   1742 C  CD2   . LEU B 2 58  ? 10.985  6.742   -30.380 1.00 26.54  ? 58  LEU B CD2   1 
ATOM   1743 N  N     . VAL B 2 59  ? 8.743   6.249   -25.495 1.00 24.13  ? 59  VAL B N     1 
ATOM   1744 C  CA    . VAL B 2 59  ? 7.968   5.495   -24.532 1.00 25.63  ? 59  VAL B CA    1 
ATOM   1745 C  C     . VAL B 2 59  ? 6.502   5.819   -24.743 1.00 31.80  ? 59  VAL B C     1 
ATOM   1746 O  O     . VAL B 2 59  ? 5.656   4.918   -24.808 1.00 30.67  ? 59  VAL B O     1 
ATOM   1747 C  CB    . VAL B 2 59  ? 8.396   5.808   -23.087 1.00 25.45  ? 59  VAL B CB    1 
ATOM   1748 C  CG1   . VAL B 2 59  ? 7.382   5.249   -22.101 1.00 27.10  ? 59  VAL B CG1   1 
ATOM   1749 C  CG2   . VAL B 2 59  ? 9.765   5.222   -22.825 1.00 27.94  ? 59  VAL B CG2   1 
ATOM   1750 N  N     . GLN B 2 60  ? 6.211   7.106   -24.886 1.00 25.37  ? 60  GLN B N     1 
ATOM   1751 C  CA    . GLN B 2 60  ? 4.860   7.560   -25.208 1.00 26.06  ? 60  GLN B CA    1 
ATOM   1752 C  C     . GLN B 2 60  ? 4.309   6.922   -26.491 1.00 26.88  ? 60  GLN B C     1 
ATOM   1753 O  O     . GLN B 2 60  ? 3.175   6.409   -26.521 1.00 28.33  ? 60  GLN B O     1 
ATOM   1754 C  CB    . GLN B 2 60  ? 4.844   9.072   -25.351 1.00 30.95  ? 60  GLN B CB    1 
ATOM   1755 C  CG    . GLN B 2 60  ? 3.495   9.626   -25.748 1.00 32.49  ? 60  GLN B CG    1 
ATOM   1756 C  CD    . GLN B 2 60  ? 3.536   11.116  -25.977 1.00 31.53  ? 60  GLN B CD    1 
ATOM   1757 O  OE1   . GLN B 2 60  ? 3.432   11.905  -25.043 1.00 41.14  ? 60  GLN B OE1   1 
ATOM   1758 N  NE2   . GLN B 2 60  ? 3.692   11.508  -27.223 1.00 33.10  ? 60  GLN B NE2   1 
ATOM   1759 N  N     . ARG B 2 61  ? 5.118   6.961   -27.548 1.00 26.25  ? 61  ARG B N     1 
ATOM   1760 C  CA    . ARG B 2 61  ? 4.754   6.345   -28.825 1.00 32.48  ? 61  ARG B CA    1 
ATOM   1761 C  C     . ARG B 2 61  ? 4.484   4.843   -28.706 1.00 33.97  ? 61  ARG B C     1 
ATOM   1762 O  O     . ARG B 2 61  ? 3.495   4.330   -29.245 1.00 38.03  ? 61  ARG B O     1 
ATOM   1763 C  CB    . ARG B 2 61  ? 5.853   6.579   -29.858 1.00 25.94  ? 61  ARG B CB    1 
ATOM   1764 C  CG    . ARG B 2 61  ? 5.567   5.890   -31.201 1.00 27.37  ? 61  ARG B CG    1 
ATOM   1765 C  CD    . ARG B 2 61  ? 6.798   5.914   -32.100 1.00 31.24  ? 61  ARG B CD    1 
ATOM   1766 N  NE    . ARG B 2 61  ? 6.799   4.781   -33.029 1.00 31.01  ? 61  ARG B NE    1 
ATOM   1767 C  CZ    . ARG B 2 61  ? 7.829   4.453   -33.800 1.00 32.30  ? 61  ARG B CZ    1 
ATOM   1768 N  NH1   . ARG B 2 61  ? 8.946   5.168   -33.762 1.00 28.89  ? 61  ARG B NH1   1 
ATOM   1769 N  NH2   . ARG B 2 61  ? 7.741   3.410   -34.619 1.00 28.68  ? 61  ARG B NH2   1 
ATOM   1770 N  N     . TYR B 2 62  ? 5.371   4.150   -28.000 1.00 31.75  ? 62  TYR B N     1 
ATOM   1771 C  CA    . TYR B 2 62  ? 5.277   2.705   -27.813 1.00 41.49  ? 62  TYR B CA    1 
ATOM   1772 C  C     . TYR B 2 62  ? 3.964   2.289   -27.156 1.00 40.72  ? 62  TYR B C     1 
ATOM   1773 O  O     . TYR B 2 62  ? 3.341   1.303   -27.560 1.00 33.77  ? 62  TYR B O     1 
ATOM   1774 C  CB    . TYR B 2 62  ? 6.459   2.204   -26.980 1.00 38.49  ? 62  TYR B CB    1 
ATOM   1775 C  CG    . TYR B 2 62  ? 6.462   0.710   -26.754 1.00 41.73  ? 62  TYR B CG    1 
ATOM   1776 C  CD1   . TYR B 2 62  ? 6.656   -0.171  -27.813 1.00 42.80  ? 62  TYR B CD1   1 
ATOM   1777 C  CD2   . TYR B 2 62  ? 6.280   0.176   -25.480 1.00 44.49  ? 62  TYR B CD2   1 
ATOM   1778 C  CE1   . TYR B 2 62  ? 6.662   -1.543  -27.616 1.00 40.96  ? 62  TYR B CE1   1 
ATOM   1779 C  CE2   . TYR B 2 62  ? 6.289   -1.196  -25.271 1.00 44.77  ? 62  TYR B CE2   1 
ATOM   1780 C  CZ    . TYR B 2 62  ? 6.478   -2.051  -26.346 1.00 45.80  ? 62  TYR B CZ    1 
ATOM   1781 O  OH    . TYR B 2 62  ? 6.486   -3.417  -26.147 1.00 47.30  ? 62  TYR B OH    1 
ATOM   1782 N  N     . VAL B 2 63  ? 3.537   3.052   -26.157 1.00 36.94  ? 63  VAL B N     1 
ATOM   1783 C  CA    . VAL B 2 63  ? 2.311   2.736   -25.433 1.00 35.54  ? 63  VAL B CA    1 
ATOM   1784 C  C     . VAL B 2 63  ? 1.072   3.140   -26.232 1.00 38.88  ? 63  VAL B C     1 
ATOM   1785 O  O     . VAL B 2 63  ? 0.083   2.408   -26.252 1.00 43.46  ? 63  VAL B O     1 
ATOM   1786 C  CB    . VAL B 2 63  ? 2.307   3.411   -24.037 1.00 36.06  ? 63  VAL B CB    1 
ATOM   1787 C  CG1   . VAL B 2 63  ? 0.996   3.175   -23.318 1.00 39.54  ? 63  VAL B CG1   1 
ATOM   1788 C  CG2   . VAL B 2 63  ? 3.450   2.874   -23.216 1.00 36.30  ? 63  VAL B CG2   1 
ATOM   1789 N  N     . THR B 2 64  ? 1.118   4.272   -26.930 1.00 32.70  ? 64  THR B N     1 
ATOM   1790 C  CA    . THR B 2 64  ? -0.040  4.657   -27.733 1.00 36.85  ? 64  THR B CA    1 
ATOM   1791 C  C     . THR B 2 64  ? -0.124  3.848   -29.031 1.00 42.39  ? 64  THR B C     1 
ATOM   1792 O  O     . THR B 2 64  ? -1.212  3.685   -29.588 1.00 40.69  ? 64  THR B O     1 
ATOM   1793 C  CB    . THR B 2 64  ? -0.048  6.154   -28.066 1.00 39.05  ? 64  THR B CB    1 
ATOM   1794 O  OG1   . THR B 2 64  ? 1.106   6.481   -28.847 1.00 30.75  ? 64  THR B OG1   1 
ATOM   1795 C  CG2   . THR B 2 64  ? -0.049  6.977   -26.791 1.00 31.67  ? 64  THR B CG2   1 
ATOM   1796 N  N     . ASP B 2 65  ? 1.006   3.323   -29.504 1.00 39.67  ? 65  ASP B N     1 
ATOM   1797 C  CA    . ASP B 2 65  ? 0.967   2.382   -30.632 1.00 43.99  ? 65  ASP B CA    1 
ATOM   1798 C  C     . ASP B 2 65  ? 0.052   1.201   -30.307 1.00 45.30  ? 65  ASP B C     1 
ATOM   1799 O  O     . ASP B 2 65  ? -0.726  0.750   -31.149 1.00 43.80  ? 65  ASP B O     1 
ATOM   1800 C  CB    . ASP B 2 65  ? 2.364   1.868   -30.979 1.00 37.50  ? 65  ASP B CB    1 
ATOM   1801 C  CG    . ASP B 2 65  ? 3.127   2.812   -31.895 1.00 38.10  ? 65  ASP B CG    1 
ATOM   1802 O  OD1   . ASP B 2 65  ? 2.583   3.877   -32.263 1.00 36.54  ? 65  ASP B OD1   1 
ATOM   1803 O  OD2   . ASP B 2 65  ? 4.282   2.488   -32.232 1.00 43.63  ? 65  ASP B OD2   1 
ATOM   1804 N  N     . TRP B 2 66  ? 0.159   0.716   -29.074 1.00 44.39  ? 66  TRP B N     1 
ATOM   1805 C  CA    . TRP B 2 66  ? -0.640  -0.411  -28.595 1.00 43.65  ? 66  TRP B CA    1 
ATOM   1806 C  C     . TRP B 2 66  ? -2.029  0.017   -28.142 1.00 47.62  ? 66  TRP B C     1 
ATOM   1807 O  O     . TRP B 2 66  ? -3.028  -0.578  -28.543 1.00 48.75  ? 66  TRP B O     1 
ATOM   1808 C  CB    . TRP B 2 66  ? 0.091   -1.117  -27.447 1.00 47.71  ? 66  TRP B CB    1 
ATOM   1809 C  CG    . TRP B 2 66  ? -0.807  -1.899  -26.527 1.00 51.71  ? 66  TRP B CG    1 
ATOM   1810 C  CD1   . TRP B 2 66  ? -1.285  -3.158  -26.728 1.00 55.88  ? 66  TRP B CD1   1 
ATOM   1811 C  CD2   . TRP B 2 66  ? -1.326  -1.469  -25.259 1.00 51.23  ? 66  TRP B CD2   1 
ATOM   1812 N  NE1   . TRP B 2 66  ? -2.076  -3.539  -25.666 1.00 57.04  ? 66  TRP B NE1   1 
ATOM   1813 C  CE2   . TRP B 2 66  ? -2.113  -2.520  -24.751 1.00 53.93  ? 66  TRP B CE2   1 
ATOM   1814 C  CE3   . TRP B 2 66  ? -1.198  -0.299  -24.502 1.00 47.42  ? 66  TRP B CE3   1 
ATOM   1815 C  CZ2   . TRP B 2 66  ? -2.769  -2.435  -23.526 1.00 55.39  ? 66  TRP B CZ2   1 
ATOM   1816 C  CZ3   . TRP B 2 66  ? -1.853  -0.214  -23.291 1.00 48.79  ? 66  TRP B CZ3   1 
ATOM   1817 C  CH2   . TRP B 2 66  ? -2.627  -1.276  -22.813 1.00 54.10  ? 66  TRP B CH2   1 
ATOM   1818 N  N     . ALA B 2 67  ? -2.093  1.044   -27.301 1.00 42.92  ? 67  ALA B N     1 
ATOM   1819 C  CA    . ALA B 2 67  ? -3.361  1.475   -26.712 1.00 44.35  ? 67  ALA B CA    1 
ATOM   1820 C  C     . ALA B 2 67  ? -4.259  2.175   -27.720 1.00 45.49  ? 67  ALA B C     1 
ATOM   1821 O  O     . ALA B 2 67  ? -5.484  2.110   -27.622 1.00 50.64  ? 67  ALA B O     1 
ATOM   1822 C  CB    . ALA B 2 67  ? -3.112  2.391   -25.514 1.00 42.75  ? 67  ALA B CB    1 
ATOM   1823 N  N     . GLY B 2 68  ? -3.653  2.858   -28.683 1.00 42.80  ? 68  GLY B N     1 
ATOM   1824 C  CA    . GLY B 2 68  ? -4.414  3.521   -29.727 1.00 42.13  ? 68  GLY B CA    1 
ATOM   1825 C  C     . GLY B 2 68  ? -4.673  4.987   -29.442 1.00 39.60  ? 68  GLY B C     1 
ATOM   1826 O  O     . GLY B 2 68  ? -4.296  5.492   -28.382 1.00 39.14  ? 68  GLY B O     1 
ATOM   1827 N  N     . PRO B 2 69  ? -5.324  5.679   -30.388 1.00 40.24  ? 69  PRO B N     1 
ATOM   1828 C  CA    . PRO B 2 69  ? -5.535  7.134   -30.378 1.00 39.31  ? 69  PRO B CA    1 
ATOM   1829 C  C     . PRO B 2 69  ? -6.344  7.662   -29.204 1.00 47.67  ? 69  PRO B C     1 
ATOM   1830 O  O     . PRO B 2 69  ? -6.156  8.829   -28.852 1.00 42.13  ? 69  PRO B O     1 
ATOM   1831 C  CB    . PRO B 2 69  ? -6.303  7.392   -31.676 1.00 43.42  ? 69  PRO B CB    1 
ATOM   1832 C  CG    . PRO B 2 69  ? -6.092  6.187   -32.507 1.00 42.96  ? 69  PRO B CG    1 
ATOM   1833 C  CD    . PRO B 2 69  ? -5.929  5.047   -31.571 1.00 40.23  ? 69  PRO B CD    1 
ATOM   1834 N  N     . SER B 2 70  ? -7.230  6.844   -28.631 1.00 47.40  ? 70  SER B N     1 
ATOM   1835 C  CA    . SER B 2 70  ? -8.139  7.317   -27.584 1.00 50.44  ? 70  SER B CA    1 
ATOM   1836 C  C     . SER B 2 70  ? -7.492  7.337   -26.203 1.00 49.08  ? 70  SER B C     1 
ATOM   1837 O  O     . SER B 2 70  ? -8.059  7.884   -25.249 1.00 47.89  ? 70  SER B O     1 
ATOM   1838 C  CB    . SER B 2 70  ? -9.416  6.465   -27.553 1.00 54.86  ? 70  SER B CB    1 
ATOM   1839 O  OG    . SER B 2 70  ? -9.146  5.148   -27.110 1.00 58.05  ? 70  SER B OG    1 
ATOM   1840 N  N     . ALA B 2 71  ? -6.306  6.743   -26.106 1.00 47.20  ? 71  ALA B N     1 
ATOM   1841 C  CA    . ALA B 2 71  ? -5.569  6.707   -24.849 1.00 43.88  ? 71  ALA B CA    1 
ATOM   1842 C  C     . ALA B 2 71  ? -5.170  8.112   -24.416 1.00 40.57  ? 71  ALA B C     1 
ATOM   1843 O  O     . ALA B 2 71  ? -4.772  8.935   -25.235 1.00 37.67  ? 71  ALA B O     1 
ATOM   1844 C  CB    . ALA B 2 71  ? -4.347  5.827   -24.977 1.00 46.42  ? 71  ALA B CB    1 
ATOM   1845 N  N     . LEU B 2 72  ? -5.300  8.387   -23.124 1.00 42.47  ? 72  LEU B N     1 
ATOM   1846 C  CA    . LEU B 2 72  ? -4.898  9.669   -22.570 1.00 46.12  ? 72  LEU B CA    1 
ATOM   1847 C  C     . LEU B 2 72  ? -3.721  9.427   -21.656 1.00 45.77  ? 72  LEU B C     1 
ATOM   1848 O  O     . LEU B 2 72  ? -3.863  8.780   -20.623 1.00 42.97  ? 72  LEU B O     1 
ATOM   1849 C  CB    . LEU B 2 72  ? -6.041  10.325  -21.798 1.00 45.71  ? 72  LEU B CB    1 
ATOM   1850 C  CG    . LEU B 2 72  ? -7.250  10.765  -22.615 1.00 46.23  ? 72  LEU B CG    1 
ATOM   1851 C  CD1   . LEU B 2 72  ? -8.434  10.957  -21.698 1.00 49.63  ? 72  LEU B CD1   1 
ATOM   1852 C  CD2   . LEU B 2 72  ? -6.935  12.053  -23.343 1.00 44.56  ? 72  LEU B CD2   1 
ATOM   1853 N  N     . ILE B 2 73  ? -2.556  9.934   -22.042 1.00 30.92  ? 73  ILE B N     1 
ATOM   1854 C  CA    . ILE B 2 73  ? -1.347  9.716   -21.274 1.00 29.70  ? 73  ILE B CA    1 
ATOM   1855 C  C     . ILE B 2 73  ? -1.334  10.614  -20.042 1.00 32.10  ? 73  ILE B C     1 
ATOM   1856 O  O     . ILE B 2 73  ? -1.377  11.841  -20.173 1.00 30.04  ? 73  ILE B O     1 
ATOM   1857 C  CB    . ILE B 2 73  ? -0.085  10.003  -22.121 1.00 28.09  ? 73  ILE B CB    1 
ATOM   1858 C  CG1   . ILE B 2 73  ? -0.045  9.092   -23.355 1.00 28.16  ? 73  ILE B CG1   1 
ATOM   1859 C  CG2   . ILE B 2 73  ? 1.179   9.871   -21.260 1.00 30.38  ? 73  ILE B CG2   1 
ATOM   1860 C  CD1   . ILE B 2 73  ? -0.058  7.617   -23.031 1.00 28.82  ? 73  ILE B CD1   1 
ATOM   1861 N  N     . LYS B 2 74  ? -1.264  10.009  -18.855 1.00 32.29  ? 74  LYS B N     1 
ATOM   1862 C  CA    . LYS B 2 74  ? -1.331  10.763  -17.604 1.00 31.03  ? 74  LYS B CA    1 
ATOM   1863 C  C     . LYS B 2 74  ? 0.053   11.082  -17.029 1.00 31.97  ? 74  LYS B C     1 
ATOM   1864 O  O     . LYS B 2 74  ? 0.284   12.178  -16.504 1.00 30.85  ? 74  LYS B O     1 
ATOM   1865 C  CB    . LYS B 2 74  ? -2.153  9.994   -16.564 1.00 37.44  ? 74  LYS B CB    1 
ATOM   1866 C  CG    . LYS B 2 74  ? -3.569  9.672   -17.012 1.00 34.58  ? 74  LYS B CG    1 
ATOM   1867 C  CD    . LYS B 2 74  ? -4.324  10.933  -17.411 1.00 36.05  ? 74  LYS B CD    1 
ATOM   1868 C  CE    . LYS B 2 74  ? -5.810  10.639  -17.597 1.00 42.22  ? 74  LYS B CE    1 
ATOM   1869 N  NZ    . LYS B 2 74  ? -6.615  11.862  -17.895 1.00 44.78  ? 74  LYS B NZ    1 
ATOM   1870 N  N     . SER B 2 75  ? 0.967   10.122  -17.136 1.00 31.49  ? 75  SER B N     1 
ATOM   1871 C  CA    . SER B 2 75  ? 2.305   10.285  -16.600 1.00 31.75  ? 75  SER B CA    1 
ATOM   1872 C  C     . SER B 2 75  ? 3.284   9.327   -17.265 1.00 28.70  ? 75  SER B C     1 
ATOM   1873 O  O     . SER B 2 75  ? 2.922   8.208   -17.641 1.00 31.74  ? 75  SER B O     1 
ATOM   1874 C  CB    . SER B 2 75  ? 2.302   10.067  -15.085 1.00 34.08  ? 75  SER B CB    1 
ATOM   1875 O  OG    . SER B 2 75  ? 2.346   8.686   -14.772 1.00 37.28  ? 75  SER B OG    1 
ATOM   1876 N  N     . ILE B 2 76  ? 4.523   9.786   -17.416 1.00 25.80  ? 76  ILE B N     1 
ATOM   1877 C  CA    . ILE B 2 76  ? 5.627   8.957   -17.889 1.00 25.22  ? 76  ILE B CA    1 
ATOM   1878 C  C     . ILE B 2 76  ? 6.817   9.102   -16.946 1.00 25.00  ? 76  ILE B C     1 
ATOM   1879 O  O     . ILE B 2 76  ? 7.370   10.192  -16.789 1.00 24.91  ? 76  ILE B O     1 
ATOM   1880 C  CB    . ILE B 2 76  ? 6.060   9.329   -19.321 1.00 27.49  ? 76  ILE B CB    1 
ATOM   1881 C  CG1   . ILE B 2 76  ? 4.896   9.120   -20.306 1.00 25.48  ? 76  ILE B CG1   1 
ATOM   1882 C  CG2   . ILE B 2 76  ? 7.289   8.523   -19.737 1.00 29.23  ? 76  ILE B CG2   1 
ATOM   1883 C  CD1   . ILE B 2 76  ? 5.243   9.511   -21.756 1.00 23.66  ? 76  ILE B CD1   1 
ATOM   1884 N  N     . GLY B 2 77  ? 7.192   7.999   -16.306 1.00 28.18  ? 77  GLY B N     1 
ATOM   1885 C  CA    . GLY B 2 77  ? 8.305   7.991   -15.375 1.00 33.03  ? 77  GLY B CA    1 
ATOM   1886 C  C     . GLY B 2 77  ? 9.464   7.171   -15.902 1.00 34.77  ? 77  GLY B C     1 
ATOM   1887 O  O     . GLY B 2 77  ? 9.306   5.996   -16.232 1.00 40.06  ? 77  GLY B O     1 
ATOM   1888 N  N     . LEU B 2 78  ? 10.633  7.792   -15.979 1.00 24.99  ? 78  LEU B N     1 
ATOM   1889 C  CA    . LEU B 2 78  ? 11.813  7.146   -16.534 1.00 24.82  ? 78  LEU B CA    1 
ATOM   1890 C  C     . LEU B 2 78  ? 12.870  6.916   -15.475 1.00 31.52  ? 78  LEU B C     1 
ATOM   1891 O  O     . LEU B 2 78  ? 13.193  7.828   -14.707 1.00 29.03  ? 78  LEU B O     1 
ATOM   1892 C  CB    . LEU B 2 78  ? 12.424  7.985   -17.654 1.00 31.65  ? 78  LEU B CB    1 
ATOM   1893 C  CG    . LEU B 2 78  ? 11.584  8.353   -18.873 1.00 28.17  ? 78  LEU B CG    1 
ATOM   1894 C  CD1   . LEU B 2 78  ? 12.495  9.013   -19.887 1.00 26.47  ? 78  LEU B CD1   1 
ATOM   1895 C  CD2   . LEU B 2 78  ? 10.893  7.119   -19.458 1.00 34.36  ? 78  LEU B CD2   1 
ATOM   1896 N  N     . ARG B 2 79  ? 13.401  5.697   -15.429 1.00 30.21  ? 79  ARG B N     1 
ATOM   1897 C  CA    . ARG B 2 79  ? 14.654  5.447   -14.730 1.00 31.74  ? 79  ARG B CA    1 
ATOM   1898 C  C     . ARG B 2 79  ? 15.715  5.215   -15.787 1.00 27.03  ? 79  ARG B C     1 
ATOM   1899 O  O     . ARG B 2 79  ? 15.593  4.298   -16.598 1.00 30.67  ? 79  ARG B O     1 
ATOM   1900 C  CB    . ARG B 2 79  ? 14.563  4.248   -13.781 1.00 36.65  ? 79  ARG B CB    1 
ATOM   1901 C  CG    . ARG B 2 79  ? 15.856  4.035   -13.000 1.00 44.24  ? 79  ARG B CG    1 
ATOM   1902 C  CD    . ARG B 2 79  ? 15.676  3.113   -11.797 1.00 50.91  ? 79  ARG B CD    1 
ATOM   1903 N  NE    . ARG B 2 79  ? 15.677  1.697   -12.160 1.00 56.56  ? 79  ARG B NE    1 
ATOM   1904 C  CZ    . ARG B 2 79  ? 14.580  0.957   -12.311 1.00 59.71  ? 79  ARG B CZ    1 
ATOM   1905 N  NH1   . ARG B 2 79  ? 13.379  1.495   -12.140 1.00 59.23  ? 79  ARG B NH1   1 
ATOM   1906 N  NH2   . ARG B 2 79  ? 14.681  -0.324  -12.636 1.00 60.89  ? 79  ARG B NH2   1 
ATOM   1907 N  N     . LEU B 2 80  ? 16.745  6.052   -15.785 1.00 29.80  ? 80  LEU B N     1 
ATOM   1908 C  CA    . LEU B 2 80  ? 17.715  6.067   -16.874 1.00 30.71  ? 80  LEU B CA    1 
ATOM   1909 C  C     . LEU B 2 80  ? 18.810  5.016   -16.712 1.00 33.71  ? 80  LEU B C     1 
ATOM   1910 O  O     . LEU B 2 80  ? 19.364  4.839   -15.624 1.00 38.36  ? 80  LEU B O     1 
ATOM   1911 C  CB    . LEU B 2 80  ? 18.343  7.456   -17.000 1.00 30.22  ? 80  LEU B CB    1 
ATOM   1912 C  CG    . LEU B 2 80  ? 17.334  8.598   -17.145 1.00 32.59  ? 80  LEU B CG    1 
ATOM   1913 C  CD1   . LEU B 2 80  ? 18.058  9.920   -17.183 1.00 33.33  ? 80  LEU B CD1   1 
ATOM   1914 C  CD2   . LEU B 2 80  ? 16.493  8.421   -18.409 1.00 32.05  ? 80  LEU B CD2   1 
ATOM   1915 N  N     . GLY B 2 81  ? 19.122  4.324   -17.805 1.00 26.41  ? 81  GLY B N     1 
ATOM   1916 C  CA    . GLY B 2 81  ? 20.112  3.262   -17.771 1.00 27.02  ? 81  GLY B CA    1 
ATOM   1917 C  C     . GLY B 2 81  ? 21.310  3.480   -18.683 1.00 31.59  ? 81  GLY B C     1 
ATOM   1918 O  O     . GLY B 2 81  ? 21.845  4.596   -18.789 1.00 29.14  ? 81  GLY B O     1 
ATOM   1919 N  N     . VAL B 2 82  ? 21.730  2.412   -19.358 1.00 27.54  ? 82  VAL B N     1 
ATOM   1920 C  CA    . VAL B 2 82  ? 22.931  2.469   -20.180 1.00 26.13  ? 82  VAL B CA    1 
ATOM   1921 C  C     . VAL B 2 82  ? 22.665  3.344   -21.398 1.00 25.02  ? 82  VAL B C     1 
ATOM   1922 O  O     . VAL B 2 82  ? 21.512  3.505   -21.803 1.00 27.67  ? 82  VAL B O     1 
ATOM   1923 C  CB    . VAL B 2 82  ? 23.400  1.066   -20.632 1.00 26.58  ? 82  VAL B CB    1 
ATOM   1924 C  CG1   . VAL B 2 82  ? 23.758  0.200   -19.400 1.00 27.88  ? 82  VAL B CG1   1 
ATOM   1925 C  CG2   . VAL B 2 82  ? 22.348  0.401   -21.497 1.00 30.62  ? 82  VAL B CG2   1 
ATOM   1926 N  N     . PRO B 2 83  ? 23.727  3.928   -21.965 1.00 26.22  ? 83  PRO B N     1 
ATOM   1927 C  CA    . PRO B 2 83  ? 23.546  4.802   -23.138 1.00 27.16  ? 83  PRO B CA    1 
ATOM   1928 C  C     . PRO B 2 83  ? 23.074  4.055   -24.371 1.00 29.05  ? 83  PRO B C     1 
ATOM   1929 O  O     . PRO B 2 83  ? 23.379  2.866   -24.536 1.00 26.80  ? 83  PRO B O     1 
ATOM   1930 C  CB    . PRO B 2 83  ? 24.951  5.370   -23.381 1.00 28.86  ? 83  PRO B CB    1 
ATOM   1931 C  CG    . PRO B 2 83  ? 25.664  5.213   -22.053 1.00 30.09  ? 83  PRO B CG    1 
ATOM   1932 C  CD    . PRO B 2 83  ? 25.105  3.967   -21.453 1.00 31.43  ? 83  PRO B CD    1 
ATOM   1933 N  N     . TRP B 2 84  ? 22.337  4.770   -25.220 1.00 22.54  ? 84  TRP B N     1 
ATOM   1934 C  CA    . TRP B 2 84  ? 21.915  4.286   -26.528 1.00 22.09  ? 84  TRP B CA    1 
ATOM   1935 C  C     . TRP B 2 84  ? 22.756  4.992   -27.570 1.00 21.90  ? 84  TRP B C     1 
ATOM   1936 O  O     . TRP B 2 84  ? 22.414  6.093   -28.027 1.00 23.07  ? 84  TRP B O     1 
ATOM   1937 C  CB    . TRP B 2 84  ? 20.433  4.549   -26.762 1.00 21.56  ? 84  TRP B CB    1 
ATOM   1938 C  CG    . TRP B 2 84  ? 19.902  4.050   -28.082 1.00 21.23  ? 84  TRP B CG    1 
ATOM   1939 C  CD1   . TRP B 2 84  ? 20.595  3.385   -29.081 1.00 21.37  ? 84  TRP B CD1   1 
ATOM   1940 C  CD2   . TRP B 2 84  ? 18.557  4.157   -28.538 1.00 20.83  ? 84  TRP B CD2   1 
ATOM   1941 N  NE1   . TRP B 2 84  ? 19.745  3.092   -30.128 1.00 21.11  ? 84  TRP B NE1   1 
ATOM   1942 C  CE2   . TRP B 2 84  ? 18.491  3.546   -29.817 1.00 20.78  ? 84  TRP B CE2   1 
ATOM   1943 C  CE3   . TRP B 2 84  ? 17.395  4.708   -27.991 1.00 21.56  ? 84  TRP B CE3   1 
ATOM   1944 C  CZ2   . TRP B 2 84  ? 17.314  3.495   -30.549 1.00 20.52  ? 84  TRP B CZ2   1 
ATOM   1945 C  CZ3   . TRP B 2 84  ? 16.227  4.647   -28.718 1.00 23.20  ? 84  TRP B CZ3   1 
ATOM   1946 C  CH2   . TRP B 2 84  ? 16.194  4.046   -29.983 1.00 24.24  ? 84  TRP B CH2   1 
ATOM   1947 N  N     . TYR B 2 85  ? 23.859  4.345   -27.934 1.00 23.87  ? 85  TYR B N     1 
ATOM   1948 C  CA    . TYR B 2 85  ? 24.845  4.923   -28.828 1.00 22.38  ? 85  TYR B CA    1 
ATOM   1949 C  C     . TYR B 2 85  ? 24.464  4.691   -30.272 1.00 23.15  ? 85  TYR B C     1 
ATOM   1950 O  O     . TYR B 2 85  ? 23.668  3.790   -30.569 1.00 23.07  ? 85  TYR B O     1 
ATOM   1951 C  CB    . TYR B 2 85  ? 26.222  4.310   -28.573 1.00 23.18  ? 85  TYR B CB    1 
ATOM   1952 C  CG    . TYR B 2 85  ? 26.916  4.775   -27.313 1.00 23.69  ? 85  TYR B CG    1 
ATOM   1953 C  CD1   . TYR B 2 85  ? 27.148  6.122   -27.073 1.00 23.37  ? 85  TYR B CD1   1 
ATOM   1954 C  CD2   . TYR B 2 85  ? 27.394  3.843   -26.387 1.00 29.49  ? 85  TYR B CD2   1 
ATOM   1955 C  CE1   . TYR B 2 85  ? 27.809  6.538   -25.917 1.00 32.19  ? 85  TYR B CE1   1 
ATOM   1956 C  CE2   . TYR B 2 85  ? 28.048  4.246   -25.248 1.00 35.67  ? 85  TYR B CE2   1 
ATOM   1957 C  CZ    . TYR B 2 85  ? 28.259  5.585   -25.016 1.00 31.83  ? 85  TYR B CZ    1 
ATOM   1958 O  OH    . TYR B 2 85  ? 28.919  5.961   -23.871 1.00 31.05  ? 85  TYR B OH    1 
ATOM   1959 N  N     . ALA B 2 86  ? 25.032  5.510   -31.156 1.00 22.13  ? 86  ALA B N     1 
ATOM   1960 C  CA    . ALA B 2 86  ? 24.890  5.304   -32.588 1.00 20.86  ? 86  ALA B CA    1 
ATOM   1961 C  C     . ALA B 2 86  ? 25.125  3.840   -32.941 1.00 22.82  ? 86  ALA B C     1 
ATOM   1962 O  O     . ALA B 2 86  ? 26.037  3.188   -32.402 1.00 27.11  ? 86  ALA B O     1 
ATOM   1963 C  CB    . ALA B 2 86  ? 25.846  6.195   -33.355 1.00 20.64  ? 86  ALA B CB    1 
ATOM   1964 N  N     . TYR B 2 87  ? 24.243  3.346   -33.806 1.00 22.50  ? 87  TYR B N     1 
ATOM   1965 C  CA    . TYR B 2 87  ? 24.285  2.017   -34.405 1.00 25.38  ? 87  TYR B CA    1 
ATOM   1966 C  C     . TYR B 2 87  ? 23.881  0.903   -33.457 1.00 33.44  ? 87  TYR B C     1 
ATOM   1967 O  O     . TYR B 2 87  ? 23.966  -0.266  -33.821 1.00 35.47  ? 87  TYR B O     1 
ATOM   1968 C  CB    . TYR B 2 87  ? 25.671  1.717   -34.967 1.00 22.58  ? 87  TYR B CB    1 
ATOM   1969 C  CG    . TYR B 2 87  ? 26.146  2.742   -35.955 1.00 24.48  ? 87  TYR B CG    1 
ATOM   1970 C  CD1   . TYR B 2 87  ? 25.541  2.871   -37.202 1.00 26.87  ? 87  TYR B CD1   1 
ATOM   1971 C  CD2   . TYR B 2 87  ? 27.198  3.585   -35.643 1.00 23.69  ? 87  TYR B CD2   1 
ATOM   1972 C  CE1   . TYR B 2 87  ? 25.979  3.811   -38.109 1.00 21.53  ? 87  TYR B CE1   1 
ATOM   1973 C  CE2   . TYR B 2 87  ? 27.637  4.531   -36.536 1.00 22.52  ? 87  TYR B CE2   1 
ATOM   1974 C  CZ    . TYR B 2 87  ? 27.031  4.628   -37.775 1.00 21.41  ? 87  TYR B CZ    1 
ATOM   1975 O  OH    . TYR B 2 87  ? 27.481  5.564   -38.664 1.00 24.77  ? 87  TYR B OH    1 
ATOM   1976 N  N     . ASP B 2 88  ? 23.456  1.249   -32.245 1.00 29.93  ? 88  ASP B N     1 
ATOM   1977 C  CA    . ASP B 2 88  ? 22.896  0.236   -31.363 1.00 31.37  ? 88  ASP B CA    1 
ATOM   1978 C  C     . ASP B 2 88  ? 21.391  0.225   -31.611 1.00 29.48  ? 88  ASP B C     1 
ATOM   1979 O  O     . ASP B 2 88  ? 20.816  1.204   -32.107 1.00 26.25  ? 88  ASP B O     1 
ATOM   1980 C  CB    . ASP B 2 88  ? 23.241  0.511   -29.891 1.00 25.84  ? 88  ASP B CB    1 
ATOM   1981 C  CG    . ASP B 2 88  ? 23.215  -0.745  -29.035 1.00 35.63  ? 88  ASP B CG    1 
ATOM   1982 O  OD1   . ASP B 2 88  ? 22.548  -1.733  -29.418 1.00 36.16  ? 88  ASP B OD1   1 
ATOM   1983 O  OD2   . ASP B 2 88  ? 23.861  -0.735  -27.972 1.00 32.87  ? 88  ASP B OD2   1 
ATOM   1984 N  N     . THR B 2 89  ? 20.768  -0.908  -31.327 1.00 32.63  ? 89  THR B N     1 
ATOM   1985 C  CA    . THR B 2 89  ? 19.337  -1.102  -31.523 1.00 33.34  ? 89  THR B CA    1 
ATOM   1986 C  C     . THR B 2 89  ? 18.661  -1.268  -30.174 1.00 41.05  ? 89  THR B C     1 
ATOM   1987 O  O     . THR B 2 89  ? 19.038  -2.143  -29.390 1.00 37.19  ? 89  THR B O     1 
ATOM   1988 C  CB    . THR B 2 89  ? 19.036  -2.348  -32.391 1.00 34.38  ? 89  THR B CB    1 
ATOM   1989 O  OG1   . THR B 2 89  ? 19.511  -2.125  -33.726 1.00 34.07  ? 89  THR B OG1   1 
ATOM   1990 C  CG2   . THR B 2 89  ? 17.555  -2.626  -32.439 1.00 31.72  ? 89  THR B CG2   1 
ATOM   1991 N  N     . VAL B 2 90  ? 17.667  -0.436  -29.892 1.00 30.42  ? 90  VAL B N     1 
ATOM   1992 C  CA    . VAL B 2 90  ? 16.901  -0.636  -28.674 1.00 31.72  ? 90  VAL B CA    1 
ATOM   1993 C  C     . VAL B 2 90  ? 15.615  -1.399  -28.960 1.00 36.10  ? 90  VAL B C     1 
ATOM   1994 O  O     . VAL B 2 90  ? 14.853  -1.071  -29.867 1.00 37.19  ? 90  VAL B O     1 
ATOM   1995 C  CB    . VAL B 2 90  ? 16.589  0.692   -27.971 1.00 29.47  ? 90  VAL B CB    1 
ATOM   1996 C  CG1   . VAL B 2 90  ? 15.412  0.536   -26.997 1.00 30.60  ? 90  VAL B CG1   1 
ATOM   1997 C  CG2   . VAL B 2 90  ? 17.814  1.160   -27.236 1.00 29.46  ? 90  VAL B CG2   1 
ATOM   1998 N  N     . THR B 2 91  ? 15.395  -2.447  -28.182 1.00 36.64  ? 91  THR B N     1 
ATOM   1999 C  CA    . THR B 2 91  ? 14.159  -3.199  -28.259 1.00 41.07  ? 91  THR B CA    1 
ATOM   2000 C  C     . THR B 2 91  ? 13.244  -2.813  -27.103 1.00 41.97  ? 91  THR B C     1 
ATOM   2001 O  O     . THR B 2 91  ? 13.620  -2.948  -25.939 1.00 41.09  ? 91  THR B O     1 
ATOM   2002 C  CB    . THR B 2 91  ? 14.428  -4.716  -28.223 1.00 45.10  ? 91  THR B CB    1 
ATOM   2003 O  OG1   . THR B 2 91  ? 15.362  -5.057  -29.255 1.00 44.18  ? 91  THR B OG1   1 
ATOM   2004 C  CG2   . THR B 2 91  ? 13.145  -5.485  -28.424 1.00 42.17  ? 91  THR B CG2   1 
ATOM   2005 N  N     . PHE B 2 92  ? 12.052  -2.314  -27.415 1.00 37.14  ? 92  PHE B N     1 
ATOM   2006 C  CA    . PHE B 2 92  ? 11.084  -2.028  -26.362 1.00 39.60  ? 92  PHE B CA    1 
ATOM   2007 C  C     . PHE B 2 92  ? 10.205  -3.242  -26.126 1.00 40.30  ? 92  PHE B C     1 
ATOM   2008 O  O     . PHE B 2 92  ? 9.638   -3.792  -27.064 1.00 43.40  ? 92  PHE B O     1 
ATOM   2009 C  CB    . PHE B 2 92  ? 10.217  -0.820  -26.711 1.00 35.24  ? 92  PHE B CB    1 
ATOM   2010 C  CG    . PHE B 2 92  ? 10.941  0.491   -26.616 1.00 36.63  ? 92  PHE B CG    1 
ATOM   2011 C  CD1   . PHE B 2 92  ? 11.559  1.037   -27.727 1.00 36.54  ? 92  PHE B CD1   1 
ATOM   2012 C  CD2   . PHE B 2 92  ? 11.005  1.179   -25.412 1.00 35.37  ? 92  PHE B CD2   1 
ATOM   2013 C  CE1   . PHE B 2 92  ? 12.234  2.251   -27.647 1.00 32.56  ? 92  PHE B CE1   1 
ATOM   2014 C  CE2   . PHE B 2 92  ? 11.684  2.397   -25.318 1.00 36.96  ? 92  PHE B CE2   1 
ATOM   2015 C  CZ    . PHE B 2 92  ? 12.298  2.933   -26.440 1.00 36.04  ? 92  PHE B CZ    1 
ATOM   2016 N  N     . SER B 2 93  ? 10.108  -3.654  -24.867 1.00 42.81  ? 93  SER B N     1 
ATOM   2017 C  CA    . SER B 2 93  ? 9.162   -4.681  -24.461 1.00 52.02  ? 93  SER B CA    1 
ATOM   2018 C  C     . SER B 2 93  ? 8.247   -4.081  -23.406 1.00 52.22  ? 93  SER B C     1 
ATOM   2019 O  O     . SER B 2 93  ? 8.658   -3.203  -22.645 1.00 51.67  ? 93  SER B O     1 
ATOM   2020 C  CB    . SER B 2 93  ? 9.882   -5.920  -23.929 1.00 52.70  ? 93  SER B CB    1 
ATOM   2021 O  OG    . SER B 2 93  ? 10.753  -5.585  -22.862 1.00 57.57  ? 93  SER B OG    1 
ATOM   2022 N  N     . GLY B 2 94  ? 7.002   -4.539  -23.377 1.00 50.28  ? 94  GLY B N     1 
ATOM   2023 C  CA    . GLY B 2 94  ? 6.013   -3.982  -22.477 1.00 48.44  ? 94  GLY B CA    1 
ATOM   2024 C  C     . GLY B 2 94  ? 5.258   -5.056  -21.720 1.00 57.24  ? 94  GLY B C     1 
ATOM   2025 O  O     . GLY B 2 94  ? 5.138   -6.198  -22.175 1.00 54.26  ? 94  GLY B O     1 
ATOM   2026 N  N     . GLU B 2 95  ? 4.754   -4.676  -20.553 1.00 57.29  ? 95  GLU B N     1 
ATOM   2027 C  CA    . GLU B 2 95  ? 3.939   -5.557  -19.728 1.00 59.66  ? 95  GLU B CA    1 
ATOM   2028 C  C     . GLU B 2 95  ? 2.996   -4.697  -18.898 1.00 56.12  ? 95  GLU B C     1 
ATOM   2029 O  O     . GLU B 2 95  ? 3.423   -3.726  -18.261 1.00 49.22  ? 95  GLU B O     1 
ATOM   2030 C  CB    . GLU B 2 95  ? 4.818   -6.430  -18.826 1.00 65.98  ? 95  GLU B CB    1 
ATOM   2031 C  CG    . GLU B 2 95  ? 4.059   -7.367  -17.893 1.00 72.37  ? 95  GLU B CG    1 
ATOM   2032 C  CD    . GLU B 2 95  ? 4.900   -7.794  -16.699 1.00 77.58  ? 95  GLU B CD    1 
ATOM   2033 O  OE1   . GLU B 2 95  ? 6.093   -7.415  -16.651 1.00 77.95  ? 95  GLU B OE1   1 
ATOM   2034 O  OE2   . GLU B 2 95  ? 4.368   -8.497  -15.808 1.00 81.70  ? 95  GLU B OE2   1 
ATOM   2035 N  N     . VAL B 2 96  ? 1.711   -5.027  -18.930 1.00 51.81  ? 96  VAL B N     1 
ATOM   2036 C  CA    . VAL B 2 96  ? 0.750   -4.339  -18.082 1.00 52.77  ? 96  VAL B CA    1 
ATOM   2037 C  C     . VAL B 2 96  ? 0.898   -4.858  -16.657 1.00 54.62  ? 96  VAL B C     1 
ATOM   2038 O  O     . VAL B 2 96  ? 0.934   -6.069  -16.432 1.00 56.41  ? 96  VAL B O     1 
ATOM   2039 C  CB    . VAL B 2 96  ? -0.696  -4.528  -18.566 1.00 54.25  ? 96  VAL B CB    1 
ATOM   2040 C  CG1   . VAL B 2 96  ? -1.679  -4.039  -17.511 1.00 55.82  ? 96  VAL B CG1   1 
ATOM   2041 C  CG2   . VAL B 2 96  ? -0.907  -3.790  -19.868 1.00 52.68  ? 96  VAL B CG2   1 
ATOM   2042 N  N     . THR B 2 97  ? 1.010   -3.936  -15.705 1.00 56.58  ? 97  THR B N     1 
ATOM   2043 C  CA    . THR B 2 97  ? 1.243   -4.298  -14.309 1.00 58.61  ? 97  THR B CA    1 
ATOM   2044 C  C     . THR B 2 97  ? 0.047   -4.005  -13.412 1.00 63.32  ? 97  THR B C     1 
ATOM   2045 O  O     . THR B 2 97  ? -0.135  -4.655  -12.376 1.00 65.89  ? 97  THR B O     1 
ATOM   2046 C  CB    . THR B 2 97  ? 2.460   -3.558  -13.735 1.00 56.81  ? 97  THR B CB    1 
ATOM   2047 O  OG1   . THR B 2 97  ? 2.234   -2.146  -13.812 1.00 53.91  ? 97  THR B OG1   1 
ATOM   2048 C  CG2   . THR B 2 97  ? 3.716   -3.913  -14.507 1.00 53.68  ? 97  THR B CG2   1 
ATOM   2049 N  N     . ALA B 2 98  ? -0.765  -3.026  -13.799 1.00 57.48  ? 98  ALA B N     1 
ATOM   2050 C  CA    . ALA B 2 98  ? -1.895  -2.630  -12.965 1.00 59.34  ? 98  ALA B CA    1 
ATOM   2051 C  C     . ALA B 2 98  ? -3.102  -2.170  -13.775 1.00 59.42  ? 98  ALA B C     1 
ATOM   2052 O  O     . ALA B 2 98  ? -2.959  -1.564  -14.838 1.00 57.58  ? 98  ALA B O     1 
ATOM   2053 C  CB    . ALA B 2 98  ? -1.469  -1.535  -11.999 1.00 59.09  ? 98  ALA B CB    1 
ATOM   2054 N  N     . VAL B 2 99  ? -4.293  -2.483  -13.269 1.00 61.81  ? 99  VAL B N     1 
ATOM   2055 C  CA    . VAL B 2 99  ? -5.546  -1.963  -13.811 1.00 62.52  ? 99  VAL B CA    1 
ATOM   2056 C  C     . VAL B 2 99  ? -6.486  -1.625  -12.654 1.00 71.69  ? 99  VAL B C     1 
ATOM   2057 O  O     . VAL B 2 99  ? -6.844  -2.504  -11.864 1.00 67.03  ? 99  VAL B O     1 
ATOM   2058 C  CB    . VAL B 2 99  ? -6.256  -2.970  -14.756 1.00 63.59  ? 99  VAL B CB    1 
ATOM   2059 C  CG1   . VAL B 2 99  ? -7.475  -2.319  -15.385 1.00 64.47  ? 99  VAL B CG1   1 
ATOM   2060 C  CG2   . VAL B 2 99  ? -5.318  -3.488  -15.843 1.00 63.26  ? 99  VAL B CG2   1 
ATOM   2061 N  N     . ASN B 2 100 ? -6.886  -0.360  -12.547 1.00 78.65  ? 100 ASN B N     1 
ATOM   2062 C  CA    . ASN B 2 100 ? -7.758  0.065   -11.450 1.00 84.85  ? 100 ASN B CA    1 
ATOM   2063 C  C     . ASN B 2 100 ? -8.491  1.378   -11.725 1.00 87.69  ? 100 ASN B C     1 
ATOM   2064 O  O     . ASN B 2 100 ? -7.870  2.385   -12.061 1.00 87.73  ? 100 ASN B O     1 
ATOM   2065 C  CB    . ASN B 2 100 ? -6.951  0.199   -10.155 1.00 84.88  ? 100 ASN B CB    1 
ATOM   2066 N  N     . ASP B 2 101 ? -9.814  1.353   -11.568 1.00 84.52  ? 101 ASP B N     1 
ATOM   2067 C  CA    . ASP B 2 101 ? -10.667 2.532   -11.750 1.00 82.03  ? 101 ASP B CA    1 
ATOM   2068 C  C     . ASP B 2 101 ? -10.528 3.150   -13.147 1.00 78.60  ? 101 ASP B C     1 
ATOM   2069 O  O     . ASP B 2 101 ? -10.737 4.351   -13.334 1.00 73.58  ? 101 ASP B O     1 
ATOM   2070 C  CB    . ASP B 2 101 ? -10.362 3.584   -10.676 1.00 79.19  ? 101 ASP B CB    1 
ATOM   2071 N  N     . GLY B 2 102 ? -10.188 2.319   -14.127 1.00 80.28  ? 102 GLY B N     1 
ATOM   2072 C  CA    . GLY B 2 102 ? -9.985  2.792   -15.482 1.00 80.43  ? 102 GLY B CA    1 
ATOM   2073 C  C     . GLY B 2 102 ? -8.646  3.489   -15.676 1.00 75.70  ? 102 GLY B C     1 
ATOM   2074 O  O     . GLY B 2 102 ? -8.456  4.232   -16.641 1.00 75.15  ? 102 GLY B O     1 
ATOM   2075 N  N     . LEU B 2 103 ? -7.717  3.258   -14.753 1.00 65.89  ? 103 LEU B N     1 
ATOM   2076 C  CA    . LEU B 2 103 ? -6.365  3.782   -14.892 1.00 58.66  ? 103 LEU B CA    1 
ATOM   2077 C  C     . LEU B 2 103 ? -5.387  2.630   -15.096 1.00 58.35  ? 103 LEU B C     1 
ATOM   2078 O  O     . LEU B 2 103 ? -5.233  1.773   -14.226 1.00 56.33  ? 103 LEU B O     1 
ATOM   2079 C  CB    . LEU B 2 103 ? -5.973  4.611   -13.673 1.00 52.94  ? 103 LEU B CB    1 
ATOM   2080 N  N     . ILE B 2 104 ? -4.738  2.612   -16.258 1.00 50.92  ? 104 ILE B N     1 
ATOM   2081 C  CA    . ILE B 2 104 ? -3.832  1.525   -16.634 1.00 50.45  ? 104 ILE B CA    1 
ATOM   2082 C  C     . ILE B 2 104 ? -2.374  1.893   -16.375 1.00 49.38  ? 104 ILE B C     1 
ATOM   2083 O  O     . ILE B 2 104 ? -1.958  3.012   -16.663 1.00 46.08  ? 104 ILE B O     1 
ATOM   2084 C  CB    . ILE B 2 104 ? -3.981  1.153   -18.135 1.00 51.15  ? 104 ILE B CB    1 
ATOM   2085 C  CG1   . ILE B 2 104 ? -5.457  0.986   -18.513 1.00 56.60  ? 104 ILE B CG1   1 
ATOM   2086 C  CG2   . ILE B 2 104 ? -3.172  -0.101  -18.476 1.00 50.13  ? 104 ILE B CG2   1 
ATOM   2087 C  CD1   . ILE B 2 104 ? -6.096  2.246   -19.090 1.00 55.97  ? 104 ILE B CD1   1 
ATOM   2088 N  N     . THR B 2 105 ? -1.598  0.950   -15.847 1.00 48.50  ? 105 THR B N     1 
ATOM   2089 C  CA    . THR B 2 105 ? -0.172  1.174   -15.639 1.00 50.68  ? 105 THR B CA    1 
ATOM   2090 C  C     . THR B 2 105 ? 0.653   0.163   -16.435 1.00 52.40  ? 105 THR B C     1 
ATOM   2091 O  O     . THR B 2 105 ? 0.433   -1.047  -16.340 1.00 54.27  ? 105 THR B O     1 
ATOM   2092 C  CB    . THR B 2 105 ? 0.206   1.097   -14.142 1.00 49.20  ? 105 THR B CB    1 
ATOM   2093 O  OG1   . THR B 2 105 ? -0.582  2.039   -13.403 1.00 48.08  ? 105 THR B OG1   1 
ATOM   2094 C  CG2   . THR B 2 105 ? 1.685   1.416   -13.945 1.00 46.74  ? 105 THR B CG2   1 
ATOM   2095 N  N     . VAL B 2 106 ? 1.586   0.666   -17.241 1.00 43.69  ? 106 VAL B N     1 
ATOM   2096 C  CA    . VAL B 2 106 ? 2.429   -0.201  -18.053 1.00 43.15  ? 106 VAL B CA    1 
ATOM   2097 C  C     . VAL B 2 106 ? 3.896   -0.053  -17.661 1.00 41.78  ? 106 VAL B C     1 
ATOM   2098 O  O     . VAL B 2 106 ? 4.391   1.062   -17.485 1.00 42.86  ? 106 VAL B O     1 
ATOM   2099 C  CB    . VAL B 2 106 ? 2.266   0.104   -19.566 1.00 45.59  ? 106 VAL B CB    1 
ATOM   2100 C  CG1   . VAL B 2 106 ? 3.055   -0.892  -20.408 1.00 47.98  ? 106 VAL B CG1   1 
ATOM   2101 C  CG2   . VAL B 2 106 ? 0.799   0.104   -19.955 1.00 47.16  ? 106 VAL B CG2   1 
ATOM   2102 N  N     . LYS B 2 107 ? 4.581   -1.177  -17.499 1.00 43.65  ? 107 LYS B N     1 
ATOM   2103 C  CA    . LYS B 2 107 ? 6.022   -1.159  -17.329 1.00 49.13  ? 107 LYS B CA    1 
ATOM   2104 C  C     . LYS B 2 107 ? 6.676   -1.355  -18.684 1.00 50.79  ? 107 LYS B C     1 
ATOM   2105 O  O     . LYS B 2 107 ? 6.428   -2.351  -19.368 1.00 55.23  ? 107 LYS B O     1 
ATOM   2106 C  CB    . LYS B 2 107 ? 6.493   -2.243  -16.364 1.00 55.24  ? 107 LYS B CB    1 
ATOM   2107 C  CG    . LYS B 2 107 ? 8.002   -2.245  -16.166 1.00 58.08  ? 107 LYS B CG    1 
ATOM   2108 C  CD    . LYS B 2 107 ? 8.521   -3.607  -15.740 1.00 63.67  ? 107 LYS B CD    1 
ATOM   2109 C  CE    . LYS B 2 107 ? 9.995   -3.543  -15.366 1.00 64.82  ? 107 LYS B CE    1 
ATOM   2110 N  NZ    . LYS B 2 107 ? 10.222  -2.764  -14.115 1.00 66.69  ? 107 LYS B NZ    1 
ATOM   2111 N  N     . VAL B 2 108 ? 7.509   -0.397  -19.069 1.00 45.08  ? 108 VAL B N     1 
ATOM   2112 C  CA    . VAL B 2 108 ? 8.228   -0.477  -20.326 1.00 37.74  ? 108 VAL B CA    1 
ATOM   2113 C  C     . VAL B 2 108 ? 9.716   -0.623  -20.052 1.00 39.14  ? 108 VAL B C     1 
ATOM   2114 O  O     . VAL B 2 108 ? 10.264  0.044   -19.173 1.00 41.35  ? 108 VAL B O     1 
ATOM   2115 C  CB    . VAL B 2 108 ? 7.965   0.769   -21.202 1.00 34.93  ? 108 VAL B CB    1 
ATOM   2116 C  CG1   . VAL B 2 108 ? 8.756   0.705   -22.519 1.00 33.41  ? 108 VAL B CG1   1 
ATOM   2117 C  CG2   . VAL B 2 108 ? 6.474   0.930   -21.462 1.00 35.59  ? 108 VAL B CG2   1 
ATOM   2118 N  N     . VAL B 2 109 ? 10.363  -1.516  -20.791 1.00 36.84  ? 109 VAL B N     1 
ATOM   2119 C  CA    . VAL B 2 109 ? 11.810  -1.612  -20.764 1.00 35.14  ? 109 VAL B CA    1 
ATOM   2120 C  C     . VAL B 2 109 ? 12.362  -1.493  -22.177 1.00 37.20  ? 109 VAL B C     1 
ATOM   2121 O  O     . VAL B 2 109 ? 11.890  -2.168  -23.099 1.00 34.42  ? 109 VAL B O     1 
ATOM   2122 C  CB    . VAL B 2 109 ? 12.300  -2.931  -20.150 1.00 41.38  ? 109 VAL B CB    1 
ATOM   2123 C  CG1   . VAL B 2 109 ? 13.823  -2.924  -20.054 1.00 40.18  ? 109 VAL B CG1   1 
ATOM   2124 C  CG2   . VAL B 2 109 ? 11.664  -3.149  -18.785 1.00 38.67  ? 109 VAL B CG2   1 
ATOM   2125 N  N     . GLY B 2 110 ? 13.350  -0.618  -22.339 1.00 37.91  ? 110 GLY B N     1 
ATOM   2126 C  CA    . GLY B 2 110 ? 14.101  -0.518  -23.575 1.00 36.26  ? 110 GLY B CA    1 
ATOM   2127 C  C     . GLY B 2 110 ? 15.477  -1.127  -23.387 1.00 37.23  ? 110 GLY B C     1 
ATOM   2128 O  O     . GLY B 2 110 ? 16.258  -0.679  -22.542 1.00 33.36  ? 110 GLY B O     1 
ATOM   2129 N  N     . ARG B 2 111 ? 15.768  -2.163  -24.171 1.00 39.08  ? 111 ARG B N     1 
ATOM   2130 C  CA    . ARG B 2 111 ? 17.025  -2.895  -24.056 1.00 37.08  ? 111 ARG B CA    1 
ATOM   2131 C  C     . ARG B 2 111 ? 17.872  -2.747  -25.310 1.00 35.89  ? 111 ARG B C     1 
ATOM   2132 O  O     . ARG B 2 111 ? 17.352  -2.813  -26.418 1.00 35.48  ? 111 ARG B O     1 
ATOM   2133 C  CB    . ARG B 2 111 ? 16.761  -4.392  -23.797 1.00 40.20  ? 111 ARG B CB    1 
ATOM   2134 C  CG    . ARG B 2 111 ? 15.738  -4.683  -22.719 1.00 41.19  ? 111 ARG B CG    1 
ATOM   2135 C  CD    . ARG B 2 111 ? 15.686  -6.171  -22.401 1.00 44.82  ? 111 ARG B CD    1 
ATOM   2136 N  NE    . ARG B 2 111 ? 15.547  -6.399  -20.966 1.00 47.15  ? 111 ARG B NE    1 
ATOM   2137 C  CZ    . ARG B 2 111 ? 14.384  -6.496  -20.333 1.00 48.15  ? 111 ARG B CZ    1 
ATOM   2138 N  NH1   . ARG B 2 111 ? 13.248  -6.404  -21.014 1.00 49.94  ? 111 ARG B NH1   1 
ATOM   2139 N  NH2   . ARG B 2 111 ? 14.359  -6.695  -19.020 1.00 49.81  ? 111 ARG B NH2   1 
ATOM   2140 N  N     . ASN B 2 112 ? 19.172  -2.544  -25.141 1.00 31.43  ? 112 ASN B N     1 
ATOM   2141 C  CA    . ASN B 2 112 ? 20.081  -2.627  -26.279 1.00 39.76  ? 112 ASN B CA    1 
ATOM   2142 C  C     . ASN B 2 112 ? 21.248  -3.556  -25.942 1.00 40.62  ? 112 ASN B C     1 
ATOM   2143 O  O     . ASN B 2 112 ? 21.165  -4.324  -24.975 1.00 40.91  ? 112 ASN B O     1 
ATOM   2144 C  CB    . ASN B 2 112 ? 20.563  -1.227  -26.717 1.00 31.47  ? 112 ASN B CB    1 
ATOM   2145 C  CG    . ASN B 2 112 ? 21.335  -0.472  -25.631 1.00 34.49  ? 112 ASN B CG    1 
ATOM   2146 O  OD1   . ASN B 2 112 ? 21.996  -1.059  -24.779 1.00 38.68  ? 112 ASN B OD1   1 
ATOM   2147 N  ND2   . ASN B 2 112 ? 21.259  0.851   -25.683 1.00 27.42  ? 112 ASN B ND2   1 
ATOM   2148 N  N     . THR B 2 113 ? 22.329  -3.491  -26.713 1.00 41.55  ? 113 THR B N     1 
ATOM   2149 C  CA    . THR B 2 113 ? 23.444  -4.412  -26.505 1.00 44.31  ? 113 THR B CA    1 
ATOM   2150 C  C     . THR B 2 113 ? 24.122  -4.186  -25.157 1.00 47.51  ? 113 THR B C     1 
ATOM   2151 O  O     . THR B 2 113 ? 24.587  -5.138  -24.522 1.00 44.84  ? 113 THR B O     1 
ATOM   2152 C  CB    . THR B 2 113 ? 24.506  -4.302  -27.620 1.00 44.52  ? 113 THR B CB    1 
ATOM   2153 O  OG1   . THR B 2 113 ? 25.161  -3.027  -27.544 1.00 48.66  ? 113 THR B OG1   1 
ATOM   2154 C  CG2   . THR B 2 113 ? 23.870  -4.481  -28.988 1.00 37.93  ? 113 THR B CG2   1 
ATOM   2155 N  N     . LEU B 2 114 ? 24.165  -2.932  -24.718 1.00 42.10  ? 114 LEU B N     1 
ATOM   2156 C  CA    . LEU B 2 114 ? 24.792  -2.582  -23.446 1.00 42.99  ? 114 LEU B CA    1 
ATOM   2157 C  C     . LEU B 2 114 ? 23.942  -2.964  -22.231 1.00 42.93  ? 114 LEU B C     1 
ATOM   2158 O  O     . LEU B 2 114 ? 24.419  -2.914  -21.095 1.00 45.75  ? 114 LEU B O     1 
ATOM   2159 C  CB    . LEU B 2 114 ? 25.098  -1.083  -23.410 1.00 40.09  ? 114 LEU B CB    1 
ATOM   2160 C  CG    . LEU B 2 114 ? 26.272  -0.583  -24.248 1.00 39.28  ? 114 LEU B CG    1 
ATOM   2161 C  CD1   . LEU B 2 114 ? 26.420  0.932   -24.121 1.00 37.95  ? 114 LEU B CD1   1 
ATOM   2162 C  CD2   . LEU B 2 114 ? 27.553  -1.295  -23.836 1.00 43.16  ? 114 LEU B CD2   1 
ATOM   2163 N  N     . GLY B 2 115 ? 22.687  -3.341  -22.470 1.00 46.15  ? 115 GLY B N     1 
ATOM   2164 C  CA    . GLY B 2 115 ? 21.783  -3.739  -21.401 1.00 47.20  ? 115 GLY B CA    1 
ATOM   2165 C  C     . GLY B 2 115 ? 20.472  -2.962  -21.369 1.00 44.15  ? 115 GLY B C     1 
ATOM   2166 O  O     . GLY B 2 115 ? 19.884  -2.673  -22.415 1.00 43.25  ? 115 GLY B O     1 
ATOM   2167 N  N     . ASP B 2 116 ? 20.005  -2.630  -20.165 1.00 39.09  ? 116 ASP B N     1 
ATOM   2168 C  CA    . ASP B 2 116 ? 18.763  -1.875  -20.005 1.00 35.61  ? 116 ASP B CA    1 
ATOM   2169 C  C     . ASP B 2 116 ? 18.997  -0.377  -20.182 1.00 31.92  ? 116 ASP B C     1 
ATOM   2170 O  O     . ASP B 2 116 ? 19.619  0.271   -19.341 1.00 31.85  ? 116 ASP B O     1 
ATOM   2171 C  CB    . ASP B 2 116 ? 18.134  -2.136  -18.636 1.00 42.99  ? 116 ASP B CB    1 
ATOM   2172 C  CG    . ASP B 2 116 ? 17.600  -3.549  -18.489 1.00 47.85  ? 116 ASP B CG    1 
ATOM   2173 O  OD1   . ASP B 2 116 ? 17.583  -4.308  -19.482 1.00 51.00  ? 116 ASP B OD1   1 
ATOM   2174 O  OD2   . ASP B 2 116 ? 17.180  -3.893  -17.370 1.00 49.45  ? 116 ASP B OD2   1 
ATOM   2175 N  N     . HIS B 2 117 ? 18.503  0.167   -21.289 1.00 32.92  ? 117 HIS B N     1 
ATOM   2176 C  CA    . HIS B 2 117 ? 18.739  1.567   -21.628 1.00 28.91  ? 117 HIS B CA    1 
ATOM   2177 C  C     . HIS B 2 117 ? 17.806  2.495   -20.862 1.00 28.64  ? 117 HIS B C     1 
ATOM   2178 O  O     . HIS B 2 117 ? 18.189  3.599   -20.467 1.00 27.91  ? 117 HIS B O     1 
ATOM   2179 C  CB    . HIS B 2 117 ? 18.569  1.780   -23.135 1.00 27.83  ? 117 HIS B CB    1 
ATOM   2180 C  CG    . HIS B 2 117 ? 18.357  3.208   -23.522 1.00 26.39  ? 117 HIS B CG    1 
ATOM   2181 N  ND1   . HIS B 2 117 ? 19.304  4.185   -23.309 1.00 25.65  ? 117 HIS B ND1   1 
ATOM   2182 C  CD2   . HIS B 2 117 ? 17.300  3.826   -24.098 1.00 25.77  ? 117 HIS B CD2   1 
ATOM   2183 C  CE1   . HIS B 2 117 ? 18.841  5.347   -23.743 1.00 25.98  ? 117 HIS B CE1   1 
ATOM   2184 N  NE2   . HIS B 2 117 ? 17.630  5.153   -24.233 1.00 26.96  ? 117 HIS B NE2   1 
ATOM   2185 N  N     . VAL B 2 118 ? 16.573  2.045   -20.676 1.00 31.54  ? 118 VAL B N     1 
ATOM   2186 C  CA    . VAL B 2 118 ? 15.563  2.835   -19.983 1.00 31.86  ? 118 VAL B CA    1 
ATOM   2187 C  C     . VAL B 2 118 ? 14.466  1.940   -19.413 1.00 36.38  ? 118 VAL B C     1 
ATOM   2188 O  O     . VAL B 2 118 ? 14.030  0.988   -20.056 1.00 34.31  ? 118 VAL B O     1 
ATOM   2189 C  CB    . VAL B 2 118 ? 14.921  3.895   -20.918 1.00 34.37  ? 118 VAL B CB    1 
ATOM   2190 C  CG1   . VAL B 2 118 ? 14.177  3.228   -22.074 1.00 30.21  ? 118 VAL B CG1   1 
ATOM   2191 C  CG2   . VAL B 2 118 ? 13.986  4.799   -20.125 1.00 38.84  ? 118 VAL B CG2   1 
ATOM   2192 N  N     . THR B 2 119 ? 14.035  2.241   -18.194 1.00 34.52  ? 119 THR B N     1 
ATOM   2193 C  CA    . THR B 2 119 ? 12.892  1.562   -17.609 1.00 38.65  ? 119 THR B CA    1 
ATOM   2194 C  C     . THR B 2 119 ? 11.814  2.593   -17.343 1.00 39.88  ? 119 THR B C     1 
ATOM   2195 O  O     . THR B 2 119 ? 12.084  3.635   -16.747 1.00 41.88  ? 119 THR B O     1 
ATOM   2196 C  CB    . THR B 2 119 ? 13.253  0.841   -16.313 1.00 38.63  ? 119 THR B CB    1 
ATOM   2197 O  OG1   . THR B 2 119 ? 14.384  -0.011  -16.540 1.00 37.87  ? 119 THR B OG1   1 
ATOM   2198 C  CG2   . THR B 2 119 ? 12.078  0.004   -15.841 1.00 44.82  ? 119 THR B CG2   1 
ATOM   2199 N  N     . ALA B 2 120 ? 10.595  2.310   -17.784 1.00 33.60  ? 120 ALA B N     1 
ATOM   2200 C  CA    . ALA B 2 120 ? 9.545   3.316   -17.734 1.00 35.87  ? 120 ALA B CA    1 
ATOM   2201 C  C     . ALA B 2 120 ? 8.240   2.821   -17.116 1.00 38.28  ? 120 ALA B C     1 
ATOM   2202 O  O     . ALA B 2 120 ? 7.830   1.670   -17.300 1.00 39.56  ? 120 ALA B O     1 
ATOM   2203 C  CB    . ALA B 2 120 ? 9.284   3.857   -19.135 1.00 34.94  ? 120 ALA B CB    1 
ATOM   2204 N  N     . THR B 2 121 ? 7.591   3.709   -16.375 1.00 35.40  ? 121 THR B N     1 
ATOM   2205 C  CA    . THR B 2 121 ? 6.267   3.437   -15.858 1.00 37.15  ? 121 THR B CA    1 
ATOM   2206 C  C     . THR B 2 121 ? 5.336   4.451   -16.479 1.00 38.05  ? 121 THR B C     1 
ATOM   2207 O  O     . THR B 2 121 ? 5.548   5.663   -16.353 1.00 38.47  ? 121 THR B O     1 
ATOM   2208 C  CB    . THR B 2 121 ? 6.210   3.515   -14.319 1.00 38.53  ? 121 THR B CB    1 
ATOM   2209 O  OG1   . THR B 2 121 ? 7.139   2.583   -13.762 1.00 39.27  ? 121 THR B OG1   1 
ATOM   2210 C  CG2   . THR B 2 121 ? 4.820   3.184   -13.823 1.00 40.54  ? 121 THR B CG2   1 
ATOM   2211 N  N     . VAL B 2 122 ? 4.324   3.956   -17.182 1.00 37.35  ? 122 VAL B N     1 
ATOM   2212 C  CA    . VAL B 2 122 ? 3.372   4.823   -17.853 1.00 37.04  ? 122 VAL B CA    1 
ATOM   2213 C  C     . VAL B 2 122 ? 1.956   4.646   -17.294 1.00 39.13  ? 122 VAL B C     1 
ATOM   2214 O  O     . VAL B 2 122 ? 1.473   3.523   -17.158 1.00 40.82  ? 122 VAL B O     1 
ATOM   2215 C  CB    . VAL B 2 122 ? 3.366   4.559   -19.371 1.00 36.28  ? 122 VAL B CB    1 
ATOM   2216 C  CG1   . VAL B 2 122 ? 2.383   5.478   -20.065 1.00 36.19  ? 122 VAL B CG1   1 
ATOM   2217 C  CG2   . VAL B 2 122 ? 4.755   4.751   -19.924 1.00 34.38  ? 122 VAL B CG2   1 
ATOM   2218 N  N     . GLU B 2 123 ? 1.312   5.766   -16.968 1.00 39.15  ? 123 GLU B N     1 
ATOM   2219 C  CA    . GLU B 2 123 ? -0.092  5.787   -16.562 1.00 45.04  ? 123 GLU B CA    1 
ATOM   2220 C  C     . GLU B 2 123 ? -0.957  6.443   -17.642 1.00 47.61  ? 123 GLU B C     1 
ATOM   2221 O  O     . GLU B 2 123 ? -0.626  7.517   -18.160 1.00 39.42  ? 123 GLU B O     1 
ATOM   2222 C  CB    . GLU B 2 123 ? -0.262  6.530   -15.234 1.00 42.69  ? 123 GLU B CB    1 
ATOM   2223 C  CG    . GLU B 2 123 ? 0.522   5.926   -14.074 1.00 48.77  ? 123 GLU B CG    1 
ATOM   2224 C  CD    . GLU B 2 123 ? 0.381   6.716   -12.775 1.00 53.68  ? 123 GLU B CD    1 
ATOM   2225 O  OE1   . GLU B 2 123 ? 0.440   7.969   -12.808 1.00 52.30  ? 123 GLU B OE1   1 
ATOM   2226 O  OE2   . GLU B 2 123 ? 0.215   6.077   -11.713 1.00 54.30  ? 123 GLU B OE2   1 
ATOM   2227 N  N     . LEU B 2 124 ? -2.066  5.792   -17.985 1.00 42.75  ? 124 LEU B N     1 
ATOM   2228 C  CA    . LEU B 2 124 ? -2.982  6.317   -18.996 1.00 43.04  ? 124 LEU B CA    1 
ATOM   2229 C  C     . LEU B 2 124 ? -4.447  5.941   -18.738 1.00 45.69  ? 124 LEU B C     1 
ATOM   2230 O  O     . LEU B 2 124 ? -4.731  5.037   -17.957 1.00 47.37  ? 124 LEU B O     1 
ATOM   2231 C  CB    . LEU B 2 124 ? -2.577  5.820   -20.389 1.00 42.12  ? 124 LEU B CB    1 
ATOM   2232 C  CG    . LEU B 2 124 ? -2.768  4.321   -20.660 1.00 43.54  ? 124 LEU B CG    1 
ATOM   2233 C  CD1   . LEU B 2 124 ? -3.029  4.080   -22.142 1.00 43.52  ? 124 LEU B CD1   1 
ATOM   2234 C  CD2   . LEU B 2 124 ? -1.572  3.503   -20.194 1.00 42.83  ? 124 LEU B CD2   1 
ATOM   2235 N  N     . SER B 2 125 ? -5.356  6.660   -19.398 1.00 51.83  ? 125 SER B N     1 
ATOM   2236 C  CA    . SER B 2 125 ? -6.767  6.279   -19.512 1.00 55.76  ? 125 SER B CA    1 
ATOM   2237 C  C     . SER B 2 125 ? -7.000  5.483   -20.793 1.00 60.76  ? 125 SER B C     1 
ATOM   2238 O  O     . SER B 2 125 ? -6.073  5.280   -21.586 1.00 54.60  ? 125 SER B O     1 
ATOM   2239 C  CB    . SER B 2 125 ? -7.672  7.509   -19.519 1.00 52.78  ? 125 SER B CB    1 
ATOM   2240 O  OG    . SER B 2 125 ? -7.849  8.032   -18.219 1.00 51.10  ? 125 SER B OG    1 
ATOM   2241 N  N     . MET B 2 126 ? -8.249  5.073   -21.007 1.00 64.93  ? 126 MET B N     1 
ATOM   2242 C  CA    . MET B 2 126 ? -8.611  4.233   -22.144 1.00 67.44  ? 126 MET B CA    1 
ATOM   2243 C  C     . MET B 2 126 ? -8.279  4.903   -23.469 1.00 67.54  ? 126 MET B C     1 
ATOM   2244 O  O     . MET B 2 126 ? -7.842  4.242   -24.411 1.00 67.94  ? 126 MET B O     1 
ATOM   2245 C  CB    . MET B 2 126 ? -10.100 3.879   -22.102 1.00 68.47  ? 126 MET B CB    1 
ATOM   2246 C  CG    . MET B 2 126 ? -10.527 2.889   -23.178 1.00 73.41  ? 126 MET B CG    1 
ATOM   2247 S  SD    . MET B 2 126 ? -12.205 2.243   -22.971 1.00 88.14  ? 126 MET B SD    1 
ATOM   2248 C  CE    . MET B 2 126 ? -12.096 1.486   -21.348 1.00 67.08  ? 126 MET B CE    1 
HETATM 2249 CD CD    . CD  C 3 .   ? 4.861   17.870  -8.032  0.76 37.08  ? 201 CD  A CD    1 
HETATM 2250 CA CA    . CA  D 4 .   ? 0.413   19.776  -10.759 1.00 22.62  ? 202 CA  A CA    1 
HETATM 2251 O  O1    . 4BN E 5 .   ? 29.669  21.914  -18.602 0.94 76.68  ? 203 4BN A O1    1 
HETATM 2252 C  C3    . 4BN E 5 .   ? 29.056  20.867  -18.434 0.94 74.89  ? 203 4BN A C3    1 
HETATM 2253 C  C2    . 4BN E 5 .   ? 27.618  20.885  -18.115 0.94 73.91  ? 203 4BN A C2    1 
HETATM 2254 C  C4    . 4BN E 5 .   ? 29.728  19.571  -18.554 0.94 71.67  ? 203 4BN A C4    1 
HETATM 2255 C  C5    . 4BN E 5 .   ? 29.081  18.553  -19.149 0.94 69.04  ? 203 4BN A C5    1 
HETATM 2256 C  C10   . 4BN E 5 .   ? 27.655  18.771  -19.720 0.94 69.68  ? 203 4BN A C10   1 
HETATM 2257 C  C1    . 4BN E 5 .   ? 27.063  20.249  -19.405 0.94 74.96  ? 203 4BN A C1    1 
HETATM 2258 C  C19   . 4BN E 5 .   ? 27.681  18.596  -21.260 0.94 57.53  ? 203 4BN A C19   1 
HETATM 2259 C  C9    . 4BN E 5 .   ? 26.826  17.828  -19.158 0.94 69.15  ? 203 4BN A C9    1 
HETATM 2260 C  C11   . 4BN E 5 .   ? 25.263  17.958  -19.790 0.94 63.80  ? 203 4BN A C11   1 
HETATM 2261 C  C12   . 4BN E 5 .   ? 24.396  16.646  -19.374 0.94 54.83  ? 203 4BN A C12   1 
HETATM 2262 C  C13   . 4BN E 5 .   ? 25.102  15.446  -19.637 0.94 54.57  ? 203 4BN A C13   1 
HETATM 2263 C  C18   . 4BN E 5 .   ? 25.277  15.224  -21.151 0.94 54.23  ? 203 4BN A C18   1 
HETATM 2264 C  C17   . 4BN E 5 .   ? 24.402  14.201  -19.007 0.94 47.82  ? 203 4BN A C17   1 
HETATM 2265 C  C20   . 4BN E 5 .   ? 23.238  13.619  -19.745 0.94 47.84  ? 203 4BN A C20   1 
HETATM 2266 C  C21   . 4BN E 5 .   ? 21.978  14.445  -19.714 0.94 46.88  ? 203 4BN A C21   1 
HETATM 2267 C  C16   . 4BN E 5 .   ? 25.509  13.130  -18.936 0.94 49.63  ? 203 4BN A C16   1 
HETATM 2268 C  C15   . 4BN E 5 .   ? 26.927  13.946  -19.110 0.94 61.71  ? 203 4BN A C15   1 
HETATM 2269 C  C14   . 4BN E 5 .   ? 26.419  15.435  -18.969 0.94 57.34  ? 203 4BN A C14   1 
HETATM 2270 C  C8    . 4BN E 5 .   ? 27.352  16.371  -19.491 0.94 58.88  ? 203 4BN A C8    1 
HETATM 2271 C  C7    . 4BN E 5 .   ? 28.725  16.187  -18.807 0.94 62.43  ? 203 4BN A C7    1 
HETATM 2272 C  C6    . 4BN E 5 .   ? 29.757  17.235  -19.269 0.94 64.96  ? 203 4BN A C6    1 
HETATM 2273 O  "O1'" . 4BN E 5 .   ? 22.750  12.260  -17.809 0.94 39.85  ? 203 4BN A "O1'" 1 
HETATM 2274 C  "C1'" . 4BN E 5 .   ? 22.876  12.289  -19.026 0.94 44.78  ? 203 4BN A "C1'" 1 
HETATM 2275 S  S1P   . 4BN E 5 .   ? 22.259  10.868  -19.974 0.94 48.42  ? 203 4BN A S1P   1 
HETATM 2276 C  C2P   . 4BN E 5 .   ? 22.825  9.425   -19.008 0.94 43.74  ? 203 4BN A C2P   1 
HETATM 2277 C  C3P   . 4BN E 5 .   ? 21.658  9.001   -18.081 0.94 52.85  ? 203 4BN A C3P   1 
HETATM 2278 N  N4P   . 4BN E 5 .   ? 21.988  8.082   -17.023 0.94 57.85  ? 203 4BN A N4P   1 
HETATM 2279 C  C5P   . 4BN E 5 .   ? 22.994  7.012   -17.037 0.94 56.75  ? 203 4BN A C5P   1 
HETATM 2280 O  O5P   . 4BN E 5 .   ? 23.726  6.787   -18.009 0.94 57.30  ? 203 4BN A O5P   1 
HETATM 2281 C  C6P   . 4BN E 5 .   ? 23.137  6.137   -15.789 0.94 53.97  ? 203 4BN A C6P   1 
HETATM 2282 C  C7P   . 4BN E 5 .   ? 22.583  6.872   -14.551 0.94 50.04  ? 203 4BN A C7P   1 
HETATM 2283 N  N8P   . 4BN E 5 .   ? 22.381  5.979   -13.433 0.94 50.05  ? 203 4BN A N8P   1 
HETATM 2284 C  C9P   . 4BN E 5 .   ? 23.484  5.240   -12.831 0.94 47.87  ? 203 4BN A C9P   1 
HETATM 2285 O  O9P   . 4BN E 5 .   ? 24.610  5.361   -13.288 0.94 49.64  ? 203 4BN A O9P   1 
HETATM 2286 C  CAP   . 4BN E 5 .   ? 23.260  4.310   -11.638 0.94 43.46  ? 203 4BN A CAP   1 
HETATM 2287 O  OAP   . 4BN E 5 .   ? 21.941  3.867   -11.557 0.94 41.83  ? 203 4BN A OAP   1 
HETATM 2288 C  CBP   . 4BN E 5 .   ? 23.593  4.995   -10.304 0.94 40.90  ? 203 4BN A CBP   1 
HETATM 2289 C  CDP   . 4BN E 5 .   ? 25.059  5.488   -10.276 0.94 37.40  ? 203 4BN A CDP   1 
HETATM 2290 C  CEP   . 4BN E 5 .   ? 22.651  6.172   -10.040 0.94 42.50  ? 203 4BN A CEP   1 
HETATM 2291 C  CCP   . 4BN E 5 .   ? 23.390  3.915   -9.178  0.94 61.85  ? 203 4BN A CCP   1 
HETATM 2292 O  O6A   . 4BN E 5 .   ? 24.501  3.032   -9.282  0.94 64.67  ? 203 4BN A O6A   1 
HETATM 2293 P  P2A   . 4BN E 5 .   ? 24.829  2.021   -8.073  0.94 66.10  ? 203 4BN A P2A   1 
HETATM 2294 O  O4A   . 4BN E 5 .   ? 25.730  2.653   -7.079  0.94 64.77  ? 203 4BN A O4A   1 
HETATM 2295 O  O5A   . 4BN E 5 .   ? 25.661  0.896   -8.575  0.94 68.53  ? 203 4BN A O5A   1 
HETATM 2296 O  O3A   . 4BN E 5 .   ? 23.476  1.468   -7.404  0.94 40.89  ? 203 4BN A O3A   1 
HETATM 2297 P  P1A   . 4BN E 5 .   ? 23.254  1.275   -5.814  0.94 59.63  ? 203 4BN A P1A   1 
HETATM 2298 O  O1A   . 4BN E 5 .   ? 24.189  0.250   -5.280  0.94 63.20  ? 203 4BN A O1A   1 
HETATM 2299 O  O2A   . 4BN E 5 .   ? 21.927  0.696   -5.526  0.94 52.89  ? 203 4BN A O2A   1 
HETATM 2300 O  O5B   . 4BN E 5 .   ? 23.430  2.651   -5.004  0.94 58.93  ? 203 4BN A O5B   1 
HETATM 2301 C  C5B   . 4BN E 5 .   ? 23.128  2.580   -3.614  0.94 61.23  ? 203 4BN A C5B   1 
HETATM 2302 C  C4B   . 4BN E 5 .   ? 22.761  3.917   -3.080  0.94 58.07  ? 203 4BN A C4B   1 
HETATM 2303 C  C3B   . 4BN E 5 .   ? 21.452  3.803   -2.384  0.94 61.05  ? 203 4BN A C3B   1 
HETATM 2304 O  O3B   . 4BN E 5 .   ? 21.612  4.269   -1.045  0.94 67.86  ? 203 4BN A O3B   1 
HETATM 2305 P  P3B   . 4BN E 5 .   ? 22.129  3.257   0.067   0.94 74.17  ? 203 4BN A P3B   1 
HETATM 2306 O  O9A   . 4BN E 5 .   ? 21.842  1.812   -0.198  0.94 72.57  ? 203 4BN A O9A   1 
HETATM 2307 O  O8A   . 4BN E 5 .   ? 21.524  3.513   1.377   0.94 75.17  ? 203 4BN A O8A   1 
HETATM 2308 O  O7A   . 4BN E 5 .   ? 23.602  3.336   0.266   0.94 70.06  ? 203 4BN A O7A   1 
HETATM 2309 C  C2B   . 4BN E 5 .   ? 20.494  4.667   -3.097  0.94 60.12  ? 203 4BN A C2B   1 
HETATM 2310 O  O2B   . 4BN E 5 .   ? 19.877  5.544   -2.159  0.94 65.34  ? 203 4BN A O2B   1 
HETATM 2311 O  O4B   . 4BN E 5 .   ? 22.609  4.892   -4.147  0.94 55.77  ? 203 4BN A O4B   1 
HETATM 2312 C  C1B   . 4BN E 5 .   ? 21.274  5.460   -4.094  0.94 54.14  ? 203 4BN A C1B   1 
HETATM 2313 N  N9A   . 4BN E 5 .   ? 20.631  5.440   -5.374  0.94 50.70  ? 203 4BN A N9A   1 
HETATM 2314 C  C4A   . 4BN E 5 .   ? 19.631  6.337   -5.739  0.94 47.30  ? 203 4BN A C4A   1 
HETATM 2315 N  N3A   . 4BN E 5 .   ? 19.019  7.355   -5.144  0.94 44.35  ? 203 4BN A N3A   1 
HETATM 2316 C  C2A   . 4BN E 5 .   ? 18.082  8.046   -5.748  0.94 43.87  ? 203 4BN A C2A   1 
HETATM 2317 C  C8A   . 4BN E 5 .   ? 20.861  4.590   -6.428  0.94 49.51  ? 203 4BN A C8A   1 
HETATM 2318 N  N7A   . 4BN E 5 .   ? 20.045  4.894   -7.480  0.94 44.33  ? 203 4BN A N7A   1 
HETATM 2319 C  C5A   . 4BN E 5 .   ? 19.244  5.989   -7.103  0.94 46.02  ? 203 4BN A C5A   1 
HETATM 2320 C  C6A   . 4BN E 5 .   ? 18.214  6.785   -7.714  0.94 46.36  ? 203 4BN A C6A   1 
HETATM 2321 N  N1A   . 4BN E 5 .   ? 17.685  7.781   -6.987  0.94 42.71  ? 203 4BN A N1A   1 
HETATM 2322 N  N6A   . 4BN E 5 .   ? 17.752  6.527   -9.064  0.94 44.17  ? 203 4BN A N6A   1 
HETATM 2323 CD CD    . CD  F 3 .   ? 20.585  16.428  -23.841 1.00 15.88  ? 201 CD  B CD    1 
HETATM 2324 O  O     . HOH G 6 .   ? 27.709  27.378  8.422   1.00 17.03  ? 301 HOH A O     1 
HETATM 2325 O  O     . HOH G 6 .   ? 7.014   31.951  -32.145 1.00 54.55  ? 302 HOH A O     1 
HETATM 2326 O  O     . HOH G 6 .   ? -12.515 17.314  -25.942 1.00 41.98  ? 303 HOH A O     1 
HETATM 2327 O  O     . HOH G 6 .   ? 8.786   13.606  -43.336 1.00 37.00  ? 304 HOH A O     1 
HETATM 2328 O  O     . HOH G 6 .   ? 12.140  16.339  -37.921 1.00 16.05  ? 305 HOH A O     1 
HETATM 2329 O  O     . HOH G 6 .   ? 30.633  21.668  7.329   1.00 34.14  ? 306 HOH A O     1 
HETATM 2330 O  O     . HOH G 6 .   ? 9.475   34.487  -28.430 1.00 53.41  ? 307 HOH A O     1 
HETATM 2331 O  O     . HOH G 6 .   ? -13.571 12.089  -35.132 1.00 53.05  ? 308 HOH A O     1 
HETATM 2332 O  O     . HOH G 6 .   ? -14.420 16.925  -29.703 1.00 31.67  ? 309 HOH A O     1 
HETATM 2333 O  O     . HOH G 6 .   ? 10.963  17.736  -5.827  1.00 34.59  ? 310 HOH A O     1 
HETATM 2334 O  O     . HOH G 6 .   ? 15.661  30.457  -31.243 1.00 33.77  ? 311 HOH A O     1 
HETATM 2335 O  O     . HOH G 6 .   ? 26.744  28.092  6.096   1.00 45.08  ? 312 HOH A O     1 
HETATM 2336 O  O     . HOH G 6 .   ? 22.243  24.567  10.399  1.00 38.45  ? 313 HOH A O     1 
HETATM 2337 O  O     . HOH G 6 .   ? -14.037 20.745  -31.115 1.00 43.39  ? 314 HOH A O     1 
HETATM 2338 O  O     . HOH G 6 .   ? 9.138   9.132   -39.475 1.00 49.85  ? 315 HOH A O     1 
HETATM 2339 O  O     . HOH G 6 .   ? -1.755  28.787  -10.209 1.00 48.31  ? 316 HOH A O     1 
HETATM 2340 O  O     . HOH G 6 .   ? -3.474  26.056  -11.780 1.00 44.62  ? 317 HOH A O     1 
HETATM 2341 O  O     . HOH G 6 .   ? 32.093  17.678  5.674   1.00 58.12  ? 318 HOH A O     1 
HETATM 2342 O  O     . HOH G 6 .   ? 22.779  40.377  -10.641 1.00 46.07  ? 319 HOH A O     1 
HETATM 2343 O  O     . HOH G 6 .   ? 23.408  19.804  9.460   1.00 52.05  ? 320 HOH A O     1 
HETATM 2344 O  O     . HOH G 6 .   ? 23.864  22.266  9.372   1.00 46.38  ? 321 HOH A O     1 
HETATM 2345 O  O     . HOH G 6 .   ? -9.376  17.137  -40.837 1.00 57.40  ? 322 HOH A O     1 
HETATM 2346 O  O     . HOH G 6 .   ? 11.911  24.350  -2.599  1.00 50.87  ? 323 HOH A O     1 
HETATM 2347 O  O     . HOH G 6 .   ? 33.273  21.434  1.169   1.00 39.56  ? 324 HOH A O     1 
HETATM 2348 O  O     . HOH G 6 .   ? 36.218  25.137  1.735   1.00 45.25  ? 325 HOH A O     1 
HETATM 2349 O  O     . HOH G 6 .   ? 5.551   15.707  -39.905 1.00 39.11  ? 326 HOH A O     1 
HETATM 2350 O  O     . HOH G 6 .   ? 11.860  16.240  -3.835  1.00 23.01  ? 327 HOH A O     1 
HETATM 2351 O  O     . HOH G 6 .   ? -4.145  21.778  -12.557 1.00 45.51  ? 328 HOH A O     1 
HETATM 2352 O  O     . HOH G 6 .   ? -12.380 13.728  -23.668 1.00 44.64  ? 329 HOH A O     1 
HETATM 2353 O  O     . HOH G 6 .   ? 29.655  18.902  8.658   1.00 44.04  ? 330 HOH A O     1 
HETATM 2354 O  O     . HOH G 6 .   ? 0.600   20.891  -40.841 1.00 29.86  ? 331 HOH A O     1 
HETATM 2355 O  O     . HOH G 6 .   ? 11.688  22.025  -34.366 1.00 26.22  ? 332 HOH A O     1 
HETATM 2356 O  O     . HOH G 6 .   ? 18.786  31.084  -27.150 1.00 42.99  ? 333 HOH A O     1 
HETATM 2357 O  O     . HOH G 6 .   ? 0.460   18.684  -40.562 1.00 41.12  ? 334 HOH A O     1 
HETATM 2358 O  O     . HOH G 6 .   ? 8.130   24.528  -9.159  1.00 35.75  ? 335 HOH A O     1 
HETATM 2359 O  O     . HOH G 6 .   ? -4.545  24.149  -12.204 1.00 37.47  ? 336 HOH A O     1 
HETATM 2360 O  O     . HOH G 6 .   ? 6.668   15.997  -7.122  1.00 38.75  ? 337 HOH A O     1 
HETATM 2361 O  O     . HOH G 6 .   ? -12.963 8.410   -26.756 1.00 57.77  ? 338 HOH A O     1 
HETATM 2362 O  O     . HOH G 6 .   ? -14.125 12.439  -38.048 1.00 42.56  ? 339 HOH A O     1 
HETATM 2363 O  O     . HOH G 6 .   ? 35.445  28.000  1.627   1.00 39.90  ? 340 HOH A O     1 
HETATM 2364 O  O     . HOH G 6 .   ? 6.521   26.193  -9.088  1.00 42.55  ? 341 HOH A O     1 
HETATM 2365 O  O     . HOH G 6 .   ? -16.165 8.788   -32.549 1.00 36.37  ? 342 HOH A O     1 
HETATM 2366 O  O     . HOH G 6 .   ? 14.174  19.919  -36.519 1.00 25.17  ? 343 HOH A O     1 
HETATM 2367 O  O     . HOH G 6 .   ? 19.289  32.499  -30.891 1.00 59.39  ? 344 HOH A O     1 
HETATM 2368 O  O     . HOH G 6 .   ? 31.046  16.125  7.485   1.00 45.66  ? 345 HOH A O     1 
HETATM 2369 O  O     . HOH G 6 .   ? -13.397 7.735   -36.353 0.50 57.25  ? 346 HOH A O     1 
HETATM 2370 O  O     . HOH G 6 .   ? 12.148  23.062  -20.958 1.00 17.17  ? 347 HOH A O     1 
HETATM 2371 O  O     . HOH G 6 .   ? 4.310   26.994  -25.719 1.00 19.26  ? 348 HOH A O     1 
HETATM 2372 O  O     . HOH G 6 .   ? 8.558   16.571  -22.210 1.00 23.14  ? 349 HOH A O     1 
HETATM 2373 O  O     . HOH G 6 .   ? -0.196  18.204  -24.703 1.00 23.87  ? 350 HOH A O     1 
HETATM 2374 O  O     . HOH G 6 .   ? 14.299  26.315  -5.032  1.00 23.89  ? 351 HOH A O     1 
HETATM 2375 O  O     . HOH G 6 .   ? 3.181   19.472  -25.304 1.00 24.04  ? 352 HOH A O     1 
HETATM 2376 O  O     . HOH G 6 .   ? 5.322   27.989  -14.671 1.00 25.08  ? 353 HOH A O     1 
HETATM 2377 O  O     . HOH G 6 .   ? 0.404   18.686  -20.516 1.00 25.46  ? 354 HOH A O     1 
HETATM 2378 O  O     . HOH G 6 .   ? 8.573   26.867  -28.088 1.00 25.58  ? 355 HOH A O     1 
HETATM 2379 O  O     . HOH G 6 .   ? 1.980   18.678  -22.913 1.00 25.73  ? 356 HOH A O     1 
HETATM 2380 O  O     . HOH G 6 .   ? 11.768  28.613  -24.944 1.00 26.63  ? 357 HOH A O     1 
HETATM 2381 O  O     . HOH G 6 .   ? 1.596   11.859  -35.672 1.00 26.81  ? 358 HOH A O     1 
HETATM 2382 O  O     . HOH G 6 .   ? 11.640  7.504   -36.704 1.00 27.20  ? 359 HOH A O     1 
HETATM 2383 O  O     . HOH G 6 .   ? 14.671  24.749  -20.166 1.00 28.18  ? 360 HOH A O     1 
HETATM 2384 O  O     . HOH G 6 .   ? -2.882  23.378  -36.101 1.00 28.30  ? 361 HOH A O     1 
HETATM 2385 O  O     . HOH G 6 .   ? 0.223   26.254  -35.277 1.00 28.76  ? 362 HOH A O     1 
HETATM 2386 O  O     . HOH G 6 .   ? -1.804  31.045  -24.107 1.00 29.31  ? 363 HOH A O     1 
HETATM 2387 O  O     . HOH G 6 .   ? 15.614  28.597  -5.337  1.00 29.32  ? 364 HOH A O     1 
HETATM 2388 O  O     . HOH G 6 .   ? 16.954  18.325  0.998   1.00 29.66  ? 365 HOH A O     1 
HETATM 2389 O  O     . HOH G 6 .   ? 14.376  21.949  -18.088 1.00 30.00  ? 366 HOH A O     1 
HETATM 2390 O  O     . HOH G 6 .   ? 11.707  29.902  -14.762 1.00 30.79  ? 367 HOH A O     1 
HETATM 2391 O  O     . HOH G 6 .   ? 16.798  24.061  -21.797 1.00 31.77  ? 368 HOH A O     1 
HETATM 2392 O  O     . HOH G 6 .   ? 20.749  27.859  5.487   1.00 32.12  ? 369 HOH A O     1 
HETATM 2393 O  O     . HOH G 6 .   ? -6.258  20.232  -39.651 1.00 32.66  ? 370 HOH A O     1 
HETATM 2394 O  O     . HOH G 6 .   ? -6.861  17.400  -22.211 1.00 32.69  ? 371 HOH A O     1 
HETATM 2395 O  O     . HOH G 6 .   ? 29.848  21.259  -13.846 1.00 33.17  ? 372 HOH A O     1 
HETATM 2396 O  O     . HOH G 6 .   ? 1.697   30.834  -20.174 1.00 33.40  ? 373 HOH A O     1 
HETATM 2397 O  O     . HOH G 6 .   ? -8.147  17.749  -24.850 1.00 33.42  ? 374 HOH A O     1 
HETATM 2398 O  O     . HOH G 6 .   ? 15.175  24.048  3.689   1.00 33.59  ? 375 HOH A O     1 
HETATM 2399 O  O     . HOH G 6 .   ? 1.341   9.266   -28.872 1.00 34.09  ? 376 HOH A O     1 
HETATM 2400 O  O     . HOH G 6 .   ? -1.529  10.290  -26.623 1.00 34.12  ? 377 HOH A O     1 
HETATM 2401 O  O     . HOH G 6 .   ? 9.666   11.752  -18.166 1.00 34.42  ? 378 HOH A O     1 
HETATM 2402 O  O     . HOH G 6 .   ? 5.090   10.433  -38.048 1.00 35.77  ? 379 HOH A O     1 
HETATM 2403 O  O     . HOH G 6 .   ? 15.138  26.741  2.942   1.00 35.83  ? 380 HOH A O     1 
HETATM 2404 O  O     . HOH G 6 .   ? 11.995  30.526  -22.813 1.00 35.89  ? 381 HOH A O     1 
HETATM 2405 O  O     . HOH G 6 .   ? 29.471  24.864  1.277   1.00 36.01  ? 382 HOH A O     1 
HETATM 2406 O  O     . HOH G 6 .   ? -4.677  21.582  -16.375 1.00 36.26  ? 383 HOH A O     1 
HETATM 2407 O  O     . HOH G 6 .   ? 14.042  26.917  -15.955 1.00 36.40  ? 384 HOH A O     1 
HETATM 2408 O  O     . HOH G 6 .   ? 19.151  21.809  3.655   1.00 36.77  ? 385 HOH A O     1 
HETATM 2409 O  O     . HOH G 6 .   ? 9.468   35.094  -20.101 1.00 36.94  ? 386 HOH A O     1 
HETATM 2410 O  O     . HOH G 6 .   ? 12.132  26.759  -3.078  1.00 37.15  ? 387 HOH A O     1 
HETATM 2411 O  O     . HOH G 6 .   ? 28.107  19.426  -13.763 1.00 37.42  ? 388 HOH A O     1 
HETATM 2412 O  O     . HOH G 6 .   ? 14.980  31.427  -7.406  1.00 37.49  ? 389 HOH A O     1 
HETATM 2413 O  O     . HOH G 6 .   ? -6.719  17.873  -39.819 1.00 37.68  ? 390 HOH A O     1 
HETATM 2414 O  O     . HOH G 6 .   ? 5.819   14.192  -11.963 1.00 37.73  ? 391 HOH A O     1 
HETATM 2415 O  O     . HOH G 6 .   ? -7.165  19.802  -24.658 1.00 38.27  ? 392 HOH A O     1 
HETATM 2416 O  O     . HOH G 6 .   ? 20.677  13.434  2.929   1.00 38.50  ? 393 HOH A O     1 
HETATM 2417 O  O     . HOH G 6 .   ? 13.044  32.663  -14.470 1.00 38.82  ? 394 HOH A O     1 
HETATM 2418 O  O     . HOH G 6 .   ? 16.699  22.240  2.527   1.00 38.87  ? 395 HOH A O     1 
HETATM 2419 O  O     . HOH G 6 .   ? -6.273  23.499  -31.845 1.00 38.92  ? 396 HOH A O     1 
HETATM 2420 O  O     . HOH G 6 .   ? -4.956  29.073  -23.681 1.00 39.02  ? 397 HOH A O     1 
HETATM 2421 O  O     . HOH G 6 .   ? 12.668  12.161  -10.594 1.00 39.14  ? 398 HOH A O     1 
HETATM 2422 O  O     . HOH G 6 .   ? 6.620   5.532   -37.647 1.00 39.37  ? 399 HOH A O     1 
HETATM 2423 O  O     . HOH G 6 .   ? -5.058  28.320  -18.903 1.00 39.41  ? 400 HOH A O     1 
HETATM 2424 O  O     . HOH G 6 .   ? 1.893   11.330  -38.252 1.00 39.54  ? 401 HOH A O     1 
HETATM 2425 O  O     . HOH G 6 .   ? 26.507  26.235  -12.433 1.00 39.84  ? 402 HOH A O     1 
HETATM 2426 O  O     . HOH G 6 .   ? 16.634  11.007  -3.922  1.00 40.03  ? 403 HOH A O     1 
HETATM 2427 O  O     . HOH G 6 .   ? 19.837  26.109  7.233   1.00 40.97  ? 404 HOH A O     1 
HETATM 2428 O  O     . HOH G 6 .   ? 6.612   29.916  -9.785  1.00 41.00  ? 405 HOH A O     1 
HETATM 2429 O  O     . HOH G 6 .   ? 30.369  15.183  -16.119 1.00 41.12  ? 406 HOH A O     1 
HETATM 2430 O  O     . HOH G 6 .   ? 2.533   13.554  -40.124 1.00 41.47  ? 407 HOH A O     1 
HETATM 2431 O  O     . HOH G 6 .   ? 19.006  32.866  3.021   1.00 41.52  ? 408 HOH A O     1 
HETATM 2432 O  O     . HOH G 6 .   ? 23.477  25.272  -26.908 1.00 42.13  ? 409 HOH A O     1 
HETATM 2433 O  O     . HOH G 6 .   ? 13.635  29.164  -16.064 1.00 42.13  ? 410 HOH A O     1 
HETATM 2434 O  O     . HOH G 6 .   ? 15.944  20.289  -17.675 1.00 42.43  ? 411 HOH A O     1 
HETATM 2435 O  O     . HOH G 6 .   ? 10.204  14.702  0.084   1.00 42.56  ? 412 HOH A O     1 
HETATM 2436 O  O     . HOH G 6 .   ? -2.058  19.194  -39.579 1.00 42.64  ? 413 HOH A O     1 
HETATM 2437 O  O     . HOH G 6 .   ? 14.556  14.951  -17.363 1.00 42.84  ? 414 HOH A O     1 
HETATM 2438 O  O     . HOH G 6 .   ? 18.463  22.016  6.031   1.00 43.08  ? 415 HOH A O     1 
HETATM 2439 O  O     . HOH G 6 .   ? 25.918  28.106  -5.329  1.00 43.72  ? 416 HOH A O     1 
HETATM 2440 O  O     . HOH G 6 .   ? 20.660  17.593  2.507   1.00 44.51  ? 417 HOH A O     1 
HETATM 2441 O  O     . HOH G 6 .   ? 10.971  16.409  1.447   1.00 44.53  ? 418 HOH A O     1 
HETATM 2442 O  O     . HOH G 6 .   ? 30.256  13.060  -15.468 1.00 44.73  ? 419 HOH A O     1 
HETATM 2443 O  O     . HOH G 6 .   ? -6.494  21.257  -32.357 1.00 45.34  ? 420 HOH A O     1 
HETATM 2444 O  O     . HOH G 6 .   ? -3.011  14.942  -41.344 1.00 46.17  ? 421 HOH A O     1 
HETATM 2445 O  O     . HOH G 6 .   ? -1.976  25.432  -36.662 1.00 46.34  ? 422 HOH A O     1 
HETATM 2446 O  O     . HOH G 6 .   ? 6.468   34.068  -27.532 1.00 46.51  ? 423 HOH A O     1 
HETATM 2447 O  O     . HOH G 6 .   ? 10.790  34.693  -22.787 1.00 46.92  ? 424 HOH A O     1 
HETATM 2448 O  O     . HOH G 6 .   ? 31.648  19.643  -13.651 1.00 47.03  ? 425 HOH A O     1 
HETATM 2449 O  O     . HOH G 6 .   ? 27.066  27.347  3.592   1.00 47.48  ? 426 HOH A O     1 
HETATM 2450 O  O     . HOH G 6 .   ? -6.629  19.891  -15.550 1.00 47.58  ? 427 HOH A O     1 
HETATM 2451 O  O     . HOH G 6 .   ? 10.527  32.748  -5.647  1.00 47.81  ? 428 HOH A O     1 
HETATM 2452 O  O     . HOH G 6 .   ? 17.834  32.392  0.512   1.00 48.07  ? 429 HOH A O     1 
HETATM 2453 O  O     . HOH G 6 .   ? -5.654  25.584  -31.420 1.00 48.14  ? 430 HOH A O     1 
HETATM 2454 O  O     . HOH G 6 .   ? 13.186  15.177  -19.637 1.00 48.18  ? 431 HOH A O     1 
HETATM 2455 O  O     . HOH G 6 .   ? -10.446 17.536  -23.801 1.00 48.52  ? 432 HOH A O     1 
HETATM 2456 O  O     . HOH G 6 .   ? 23.505  25.334  -15.365 1.00 48.61  ? 433 HOH A O     1 
HETATM 2457 O  O     . HOH G 6 .   ? -9.760  12.679  -30.410 1.00 48.80  ? 434 HOH A O     1 
HETATM 2458 O  O     . HOH G 6 .   ? 16.376  24.076  -13.693 1.00 48.98  ? 435 HOH A O     1 
HETATM 2459 O  O     . HOH G 6 .   ? 36.501  21.945  -8.125  1.00 49.03  ? 436 HOH A O     1 
HETATM 2460 O  O     . HOH G 6 .   ? 20.759  23.357  7.038   1.00 49.80  ? 437 HOH A O     1 
HETATM 2461 O  O     . HOH G 6 .   ? 16.716  15.850  1.914   1.00 50.31  ? 438 HOH A O     1 
HETATM 2462 O  O     . HOH G 6 .   ? 6.367   8.336   -39.352 1.00 50.72  ? 439 HOH A O     1 
HETATM 2463 O  O     . HOH G 6 .   ? 15.571  15.934  -20.346 1.00 51.00  ? 440 HOH A O     1 
HETATM 2464 O  O     . HOH G 6 .   ? 19.819  33.143  -23.098 1.00 51.08  ? 441 HOH A O     1 
HETATM 2465 O  O     . HOH G 6 .   ? -5.242  23.613  -35.158 1.00 51.85  ? 442 HOH A O     1 
HETATM 2466 O  O     . HOH G 6 .   ? 17.793  17.756  -10.732 1.00 52.29  ? 443 HOH A O     1 
HETATM 2467 O  O     . HOH G 6 .   ? 13.051  33.982  -16.662 1.00 52.82  ? 444 HOH A O     1 
HETATM 2468 O  O     . HOH G 6 .   ? 8.994   5.001   -38.612 1.00 53.59  ? 445 HOH A O     1 
HETATM 2469 O  O     . HOH G 6 .   ? -4.258  15.612  -13.245 1.00 54.07  ? 446 HOH A O     1 
HETATM 2470 O  O     . HOH G 6 .   ? -7.599  16.641  -18.150 1.00 54.87  ? 447 HOH A O     1 
HETATM 2471 O  O     . HOH G 6 .   ? -5.923  29.973  -21.054 1.00 55.43  ? 448 HOH A O     1 
HETATM 2472 O  O     . HOH G 6 .   ? 20.715  29.496  -12.818 1.00 56.09  ? 449 HOH A O     1 
HETATM 2473 O  O     . HOH G 6 .   ? -0.619  9.454   -38.727 1.00 57.22  ? 450 HOH A O     1 
HETATM 2474 O  O     . HOH G 6 .   ? 10.895  35.412  -16.892 1.00 57.24  ? 451 HOH A O     1 
HETATM 2475 O  O     . HOH G 6 .   ? 24.963  0.063   -11.443 1.00 57.29  ? 452 HOH A O     1 
HETATM 2476 O  O     . HOH G 6 .   ? 5.822   12.212  -39.963 1.00 57.44  ? 453 HOH A O     1 
HETATM 2477 O  O     . HOH G 6 .   ? 10.436  9.767   -10.365 1.00 57.86  ? 454 HOH A O     1 
HETATM 2478 O  O     . HOH G 6 .   ? -6.568  18.324  -13.957 1.00 59.54  ? 455 HOH A O     1 
HETATM 2479 O  O     . HOH G 6 .   ? 18.992  22.443  -21.877 1.00 66.58  ? 456 HOH A O     1 
HETATM 2480 O  O     . HOH G 6 .   ? 19.218  4.524   -10.626 1.00 45.44  ? 457 HOH A O     1 
HETATM 2481 O  O     . HOH G 6 .   ? 20.437  2.933   -13.727 1.00 46.39  ? 458 HOH A O     1 
HETATM 2482 O  O     . HOH G 6 .   ? -12.638 6.267   -28.181 1.00 48.67  ? 459 HOH A O     1 
HETATM 2483 O  O     . HOH H 6 .   ? 14.435  28.858  -27.266 1.00 54.70  ? 301 HOH B O     1 
HETATM 2484 O  O     . HOH H 6 .   ? 21.147  8.681   -42.496 1.00 8.65   ? 302 HOH B O     1 
HETATM 2485 O  O     . HOH H 6 .   ? 37.156  14.470  -29.007 1.00 46.56  ? 303 HOH B O     1 
HETATM 2486 O  O     . HOH H 6 .   ? 28.054  15.605  -36.542 1.00 27.64  ? 304 HOH B O     1 
HETATM 2487 O  O     . HOH H 6 .   ? 30.102  21.373  -31.846 1.00 21.88  ? 305 HOH B O     1 
HETATM 2488 O  O     . HOH H 6 .   ? 32.244  15.541  -34.499 1.00 26.48  ? 306 HOH B O     1 
HETATM 2489 O  O     . HOH H 6 .   ? 25.486  23.187  -28.595 1.00 39.98  ? 307 HOH B O     1 
HETATM 2490 O  O     . HOH H 6 .   ? 28.755  4.038   -31.942 1.00 34.92  ? 308 HOH B O     1 
HETATM 2491 O  O     . HOH H 6 .   ? 25.849  5.960   -40.768 1.00 19.37  ? 309 HOH B O     1 
HETATM 2492 O  O     . HOH H 6 .   ? 23.492  2.022   -40.618 1.00 41.37  ? 310 HOH B O     1 
HETATM 2493 O  O     . HOH H 6 .   ? 37.556  14.952  -36.255 1.00 23.85  ? 311 HOH B O     1 
HETATM 2494 O  O     . HOH H 6 .   ? 14.346  22.425  -33.649 1.00 22.33  ? 312 HOH B O     1 
HETATM 2495 O  O     . HOH H 6 .   ? 30.289  22.485  -28.587 1.00 35.74  ? 313 HOH B O     1 
HETATM 2496 O  O     . HOH H 6 .   ? 14.551  -8.401  -36.353 0.50 43.12  ? 314 HOH B O     1 
HETATM 2497 O  O     . HOH H 6 .   ? 14.584  17.074  -36.809 1.00 11.13  ? 315 HOH B O     1 
HETATM 2498 O  O     . HOH H 6 .   ? 31.889  5.383   -33.281 1.00 54.59  ? 316 HOH B O     1 
HETATM 2499 O  O     . HOH H 6 .   ? -6.389  -8.004  -14.782 1.00 31.26  ? 317 HOH B O     1 
HETATM 2500 O  O     . HOH H 6 .   ? 34.912  9.798   -36.353 0.50 26.25  ? 318 HOH B O     1 
HETATM 2501 O  O     . HOH H 6 .   ? -8.489  -4.859  -12.956 1.00 52.08  ? 319 HOH B O     1 
HETATM 2502 O  O     . HOH H 6 .   ? 19.476  9.607   -43.639 1.00 33.74  ? 320 HOH B O     1 
HETATM 2503 O  O     . HOH H 6 .   ? 30.079  14.171  -35.662 1.00 26.28  ? 321 HOH B O     1 
HETATM 2504 O  O     . HOH H 6 .   ? 30.193  -1.623  -31.741 1.00 56.35  ? 322 HOH B O     1 
HETATM 2505 O  O     . HOH H 6 .   ? 27.753  -1.343  -31.345 1.00 44.49  ? 323 HOH B O     1 
HETATM 2506 O  O     . HOH H 6 .   ? 27.336  4.289   -42.197 1.00 56.78  ? 324 HOH B O     1 
HETATM 2507 O  O     . HOH H 6 .   ? 25.011  0.580   -41.740 1.00 66.98  ? 325 HOH B O     1 
HETATM 2508 O  O     . HOH H 6 .   ? 33.526  22.096  -31.936 1.00 36.79  ? 326 HOH B O     1 
HETATM 2509 O  O     . HOH H 6 .   ? 21.668  6.007   -41.886 1.00 43.20  ? 327 HOH B O     1 
HETATM 2510 O  O     . HOH H 6 .   ? 36.146  7.489   -34.941 1.00 43.99  ? 328 HOH B O     1 
HETATM 2511 O  O     . HOH H 6 .   ? 19.754  14.309  -22.565 1.00 5.03   ? 329 HOH B O     1 
HETATM 2512 O  O     . HOH H 6 .   ? 21.986  17.932  -29.920 1.00 8.85   ? 330 HOH B O     1 
HETATM 2513 O  O     . HOH H 6 .   ? 18.375  11.906  -29.650 1.00 13.31  ? 331 HOH B O     1 
HETATM 2514 O  O     . HOH H 6 .   ? 14.362  10.249  -37.035 1.00 14.03  ? 332 HOH B O     1 
HETATM 2515 O  O     . HOH H 6 .   ? 10.148  20.389  -32.899 1.00 15.57  ? 333 HOH B O     1 
HETATM 2516 O  O     . HOH H 6 .   ? 10.079  14.749  -26.292 1.00 16.85  ? 334 HOH B O     1 
HETATM 2517 O  O     . HOH H 6 .   ? 27.769  20.446  -23.767 1.00 20.45  ? 335 HOH B O     1 
HETATM 2518 O  O     . HOH H 6 .   ? 21.408  7.444   -24.545 1.00 21.49  ? 336 HOH B O     1 
HETATM 2519 O  O     . HOH H 6 .   ? 20.200  22.712  -25.767 1.00 23.25  ? 337 HOH B O     1 
HETATM 2520 O  O     . HOH H 6 .   ? 19.506  18.638  -22.513 1.00 25.44  ? 338 HOH B O     1 
HETATM 2521 O  O     . HOH H 6 .   ? 19.255  5.762   -13.131 1.00 27.41  ? 339 HOH B O     1 
HETATM 2522 O  O     . HOH H 6 .   ? 24.447  1.648   -27.061 1.00 28.32  ? 340 HOH B O     1 
HETATM 2523 O  O     . HOH H 6 .   ? 17.933  23.845  -25.741 1.00 29.23  ? 341 HOH B O     1 
HETATM 2524 O  O     . HOH H 6 .   ? 3.769   5.235   -34.510 1.00 29.44  ? 342 HOH B O     1 
HETATM 2525 O  O     . HOH H 6 .   ? 26.725  21.579  -26.008 1.00 29.94  ? 343 HOH B O     1 
HETATM 2526 O  O     . HOH H 6 .   ? 22.200  8.314   -22.119 1.00 30.67  ? 344 HOH B O     1 
HETATM 2527 O  O     . HOH H 6 .   ? 17.895  6.363   -20.573 1.00 30.87  ? 345 HOH B O     1 
HETATM 2528 O  O     . HOH H 6 .   ? 20.087  20.980  -23.367 1.00 32.65  ? 346 HOH B O     1 
HETATM 2529 O  O     . HOH H 6 .   ? 26.824  1.064   -31.082 1.00 32.66  ? 347 HOH B O     1 
HETATM 2530 O  O     . HOH H 6 .   ? -3.357  8.523   -27.756 1.00 32.83  ? 348 HOH B O     1 
HETATM 2531 O  O     . HOH H 6 .   ? 1.509   5.807   -31.324 1.00 33.01  ? 349 HOH B O     1 
HETATM 2532 O  O     . HOH H 6 .   ? 21.923  -2.470  -33.874 1.00 33.24  ? 350 HOH B O     1 
HETATM 2533 O  O     . HOH H 6 .   ? 18.949  9.288   -22.782 1.00 33.51  ? 351 HOH B O     1 
HETATM 2534 O  O     . HOH H 6 .   ? 1.374   -8.955  -27.704 1.00 35.39  ? 352 HOH B O     1 
HETATM 2535 O  O     . HOH H 6 .   ? 27.964  8.050   -22.284 1.00 35.65  ? 353 HOH B O     1 
HETATM 2536 O  O     . HOH H 6 .   ? 17.056  7.247   -39.521 1.00 37.51  ? 354 HOH B O     1 
HETATM 2537 O  O     . HOH H 6 .   ? 5.307   1.698   -34.565 1.00 38.45  ? 355 HOH B O     1 
HETATM 2538 O  O     . HOH H 6 .   ? 4.865   10.150  -28.668 1.00 38.80  ? 356 HOH B O     1 
HETATM 2539 O  O     . HOH H 6 .   ? 25.773  8.759   -21.752 1.00 39.64  ? 357 HOH B O     1 
HETATM 2540 O  O     . HOH H 6 .   ? 30.260  20.645  -24.709 1.00 39.80  ? 358 HOH B O     1 
HETATM 2541 O  O     . HOH H 6 .   ? 4.576   6.889   -14.392 1.00 40.49  ? 359 HOH B O     1 
HETATM 2542 O  O     . HOH H 6 .   ? 35.701  8.831   -25.007 1.00 40.75  ? 360 HOH B O     1 
HETATM 2543 O  O     . HOH H 6 .   ? -9.383  3.709   -31.226 1.00 41.07  ? 361 HOH B O     1 
HETATM 2544 O  O     . HOH H 6 .   ? 11.160  7.721   -12.056 1.00 41.19  ? 362 HOH B O     1 
HETATM 2545 O  O     . HOH H 6 .   ? 5.902   -6.296  -33.303 1.00 41.76  ? 363 HOH B O     1 
HETATM 2546 O  O     . HOH H 6 .   ? 25.431  20.553  -23.511 1.00 41.77  ? 364 HOH B O     1 
HETATM 2547 O  O     . HOH H 6 .   ? -2.931  13.635  -19.585 1.00 42.16  ? 365 HOH B O     1 
HETATM 2548 O  O     . HOH H 6 .   ? 33.000  7.551   -31.675 1.00 42.38  ? 366 HOH B O     1 
HETATM 2549 O  O     . HOH H 6 .   ? -6.737  1.723   -23.102 1.00 42.92  ? 367 HOH B O     1 
HETATM 2550 O  O     . HOH H 6 .   ? 14.956  -1.989  -36.456 1.00 43.12  ? 368 HOH B O     1 
HETATM 2551 O  O     . HOH H 6 .   ? 29.062  14.630  -21.517 1.00 43.32  ? 369 HOH B O     1 
HETATM 2552 O  O     . HOH H 6 .   ? 15.195  8.470   -38.879 1.00 43.94  ? 370 HOH B O     1 
HETATM 2553 O  O     . HOH H 6 .   ? -11.921 3.666   -25.974 1.00 43.95  ? 371 HOH B O     1 
HETATM 2554 O  O     . HOH H 6 .   ? 3.595   -1.273  -29.037 1.00 44.02  ? 372 HOH B O     1 
HETATM 2555 O  O     . HOH H 6 .   ? 17.069  1.333   -16.857 1.00 44.20  ? 373 HOH B O     1 
HETATM 2556 O  O     . HOH H 6 .   ? -6.375  10.287  -26.676 1.00 44.73  ? 374 HOH B O     1 
HETATM 2557 O  O     . HOH H 6 .   ? -3.125  1.115   -12.837 1.00 44.87  ? 375 HOH B O     1 
HETATM 2558 O  O     . HOH H 6 .   ? 27.244  17.898  -24.381 1.00 44.94  ? 376 HOH B O     1 
HETATM 2559 O  O     . HOH H 6 .   ? 29.614  4.160   -22.368 1.00 45.06  ? 377 HOH B O     1 
HETATM 2560 O  O     . HOH H 6 .   ? 20.484  6.749   -20.189 1.00 45.08  ? 378 HOH B O     1 
HETATM 2561 O  O     . HOH H 6 .   ? 30.133  24.228  -26.550 1.00 45.85  ? 379 HOH B O     1 
HETATM 2562 O  O     . HOH H 6 .   ? -5.546  13.018  -20.089 1.00 46.24  ? 380 HOH B O     1 
HETATM 2563 O  O     . HOH H 6 .   ? -10.851 7.593   -21.389 1.00 46.70  ? 381 HOH B O     1 
HETATM 2564 O  O     . HOH H 6 .   ? 34.080  7.380   -19.486 1.00 47.12  ? 382 HOH B O     1 
HETATM 2565 O  O     . HOH H 6 .   ? 26.894  0.987   -28.086 1.00 47.75  ? 383 HOH B O     1 
HETATM 2566 O  O     . HOH H 6 .   ? 23.142  -7.765  -25.040 1.00 47.82  ? 384 HOH B O     1 
HETATM 2567 O  O     . HOH H 6 .   ? -10.108 4.818   -19.111 1.00 48.62  ? 385 HOH B O     1 
HETATM 2568 O  O     . HOH H 6 .   ? 15.841  4.340   -37.242 1.00 49.62  ? 386 HOH B O     1 
HETATM 2569 O  O     . HOH H 6 .   ? 17.953  -4.631  -29.267 1.00 49.71  ? 387 HOH B O     1 
HETATM 2570 O  O     . HOH H 6 .   ? -12.051 6.290   -25.099 1.00 50.51  ? 388 HOH B O     1 
HETATM 2571 O  O     . HOH H 6 .   ? -10.964 8.622   -23.347 1.00 50.63  ? 389 HOH B O     1 
HETATM 2572 O  O     . HOH H 6 .   ? 19.978  -5.706  -31.281 1.00 50.79  ? 390 HOH B O     1 
HETATM 2573 O  O     . HOH H 6 .   ? 0.801   6.277   -9.472  1.00 50.97  ? 391 HOH B O     1 
HETATM 2574 O  O     . HOH H 6 .   ? -10.412 -4.311  -24.113 1.00 51.44  ? 392 HOH B O     1 
HETATM 2575 O  O     . HOH H 6 .   ? -10.513 5.785   -16.360 1.00 51.65  ? 393 HOH B O     1 
HETATM 2576 O  O     . HOH H 6 .   ? 10.152  3.608   -36.840 1.00 52.26  ? 394 HOH B O     1 
HETATM 2577 O  O     . HOH H 6 .   ? 32.940  5.553   -23.102 1.00 52.43  ? 395 HOH B O     1 
HETATM 2578 O  O     . HOH H 6 .   ? 17.430  -2.844  -36.148 1.00 53.08  ? 396 HOH B O     1 
HETATM 2579 O  O     . HOH H 6 .   ? 18.471  1.551   -13.843 1.00 53.37  ? 397 HOH B O     1 
HETATM 2580 O  O     . HOH H 6 .   ? 16.560  4.928   -39.449 1.00 53.54  ? 398 HOH B O     1 
HETATM 2581 O  O     . HOH H 6 .   ? 14.303  5.907   -37.720 1.00 55.44  ? 399 HOH B O     1 
HETATM 2582 O  O     . HOH H 6 .   ? 10.331  -7.960  -19.634 1.00 55.50  ? 400 HOH B O     1 
HETATM 2583 O  O     . HOH H 6 .   ? 18.892  -5.812  -20.587 1.00 56.40  ? 401 HOH B O     1 
HETATM 2584 O  O     . HOH H 6 .   ? 11.045  5.449   -35.879 1.00 56.55  ? 402 HOH B O     1 
HETATM 2585 O  O     . HOH H 6 .   ? 9.124   -5.820  -19.291 1.00 56.82  ? 403 HOH B O     1 
HETATM 2586 O  O     . HOH H 6 .   ? -15.030 2.062   -22.705 1.00 58.87  ? 404 HOH B O     1 
HETATM 2587 O  O     . HOH H 6 .   ? -10.178 6.396   -30.988 1.00 59.57  ? 405 HOH B O     1 
HETATM 2588 O  O     . HOH H 6 .   ? 28.113  23.274  -25.168 1.00 60.64  ? 406 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 0.7664 1.0452 0.7924 0.1036  -0.1954 -0.0634 1   MET A N   
2    C CA  . MET A 1   ? 0.7495 1.0401 0.8040 0.1013  -0.2123 -0.0673 1   MET A CA  
3    C C   . MET A 1   ? 0.7232 1.0186 0.7812 0.1076  -0.2188 -0.0608 1   MET A C   
4    O O   . MET A 1   ? 0.7597 1.0675 0.8411 0.1086  -0.2107 -0.0552 1   MET A O   
5    C CB  . MET A 1   ? 0.7691 1.0492 0.8108 0.0998  -0.2308 -0.0777 1   MET A CB  
6    C CG  . MET A 1   ? 0.7564 1.0295 0.8055 0.0911  -0.2292 -0.0852 1   MET A CG  
7    S SD  . MET A 1   ? 1.5519 1.8155 1.5981 0.0874  -0.2561 -0.0980 1   MET A SD  
8    C CE  . MET A 1   ? 0.7587 1.0068 0.8077 0.0775  -0.2513 -0.1046 1   MET A CE  
9    N N   . THR A 2   ? 0.6692 0.9489 0.7012 0.1108  -0.2312 -0.0609 2   THR A N   
10   C CA  . THR A 2   ? 0.6262 0.9035 0.6610 0.1150  -0.2390 -0.0550 2   THR A CA  
11   C C   . THR A 2   ? 0.6483 0.9061 0.6436 0.1203  -0.2376 -0.0461 2   THR A C   
12   O O   . THR A 2   ? 0.6805 0.9224 0.6413 0.1208  -0.2436 -0.0469 2   THR A O   
13   C CB  . THR A 2   ? 0.5663 0.8422 0.6077 0.1137  -0.2579 -0.0612 2   THR A CB  
14   O OG1 . THR A 2   ? 0.5794 0.8715 0.6536 0.1059  -0.2611 -0.0693 2   THR A OG1 
15   C CG2 . THR A 2   ? 0.5226 0.8018 0.5769 0.1188  -0.2653 -0.0564 2   THR A CG2 
16   N N   . GLY A 3   ? 0.5359 0.7943 0.5360 0.1236  -0.2303 -0.0376 3   GLY A N   
17   C CA  . GLY A 3   ? 0.5513 0.7898 0.5177 0.1268  -0.2321 -0.0277 3   GLY A CA  
18   C C   . GLY A 3   ? 0.5637 0.7945 0.5002 0.1249  -0.2180 -0.0203 3   GLY A C   
19   O O   . GLY A 3   ? 0.5099 0.7508 0.4485 0.1225  -0.2056 -0.0237 3   GLY A O   
20   N N   . VAL A 4   ? 0.6231 0.8355 0.5307 0.1253  -0.2207 -0.0098 4   VAL A N   
21   C CA  . VAL A 4   ? 0.5590 0.7641 0.4379 0.1214  -0.2080 -0.0003 4   VAL A CA  
22   C C   . VAL A 4   ? 0.5868 0.7933 0.4364 0.1170  -0.1992 -0.0025 4   VAL A C   
23   O O   . VAL A 4   ? 0.4989 0.7157 0.3457 0.1144  -0.1830 -0.0013 4   VAL A O   
24   C CB  . VAL A 4   ? 0.5839 0.7654 0.4355 0.1203  -0.2163 0.0123  4   VAL A CB  
25   C CG1 . VAL A 4   ? 0.5552 0.7290 0.3727 0.1127  -0.2039 0.0232  4   VAL A CG1 
26   C CG2 . VAL A 4   ? 0.5791 0.7584 0.4571 0.1262  -0.2216 0.0147  4   VAL A CG2 
27   N N   . SER A 5   ? 0.5732 0.7704 0.4007 0.1165  -0.2091 -0.0061 5   SER A N   
28   C CA  . SER A 5   ? 0.5800 0.7790 0.3795 0.1138  -0.2001 -0.0099 5   SER A CA  
29   C C   . SER A 5   ? 0.5950 0.8115 0.4182 0.1162  -0.1923 -0.0222 5   SER A C   
30   O O   . SER A 5   ? 0.5700 0.7935 0.3793 0.1153  -0.1787 -0.0250 5   SER A O   
31   C CB  . SER A 5   ? 0.6016 0.7864 0.3733 0.1138  -0.2131 -0.0126 5   SER A CB  
32   O OG  . SER A 5   ? 0.6274 0.8141 0.4219 0.1179  -0.2275 -0.0236 5   SER A OG  
33   N N   . ASP A 6   ? 0.5119 0.7359 0.3718 0.1187  -0.2007 -0.0293 6   ASP A N   
34   C CA  . ASP A 6   ? 0.4916 0.7300 0.3761 0.1191  -0.1952 -0.0397 6   ASP A CA  
35   C C   . ASP A 6   ? 0.4522 0.7022 0.3536 0.1175  -0.1774 -0.0347 6   ASP A C   
36   O O   . ASP A 6   ? 0.4899 0.7442 0.3964 0.1156  -0.1652 -0.0399 6   ASP A O   
37   C CB  . ASP A 6   ? 0.4949 0.7388 0.4149 0.1188  -0.2090 -0.0472 6   ASP A CB  
38   C CG  . ASP A 6   ? 0.5503 0.7853 0.4593 0.1186  -0.2229 -0.0576 6   ASP A CG  
39   O OD1 . ASP A 6   ? 0.5421 0.7635 0.4134 0.1201  -0.2246 -0.0579 6   ASP A OD1 
40   O OD2 . ASP A 6   ? 0.4779 0.7200 0.4170 0.1159  -0.2319 -0.0653 6   ASP A OD2 
41   N N   . ILE A 7   ? 0.4335 0.6836 0.3435 0.1176  -0.1751 -0.0246 7   ILE A N   
42   C CA  . ILE A 7   ? 0.4161 0.6722 0.3401 0.1147  -0.1569 -0.0189 7   ILE A CA  
43   C C   . ILE A 7   ? 0.4761 0.7303 0.3695 0.1115  -0.1426 -0.0147 7   ILE A C   
44   O O   . ILE A 7   ? 0.3789 0.6405 0.2803 0.1098  -0.1276 -0.0171 7   ILE A O   
45   C CB  . ILE A 7   ? 0.4162 0.6700 0.3523 0.1168  -0.1595 -0.0098 7   ILE A CB  
46   C CG1 . ILE A 7   ? 0.4792 0.7434 0.4533 0.1209  -0.1695 -0.0156 7   ILE A CG1 
47   C CG2 . ILE A 7   ? 0.3641 0.6202 0.3047 0.1136  -0.1414 -0.0031 7   ILE A CG2 
48   C CD1 . ILE A 7   ? 0.4769 0.7344 0.4587 0.1256  -0.1769 -0.0093 7   ILE A CD1 
49   N N   . GLN A 8   ? 0.4280 0.6737 0.2861 0.1107  -0.1476 -0.0086 8   GLN A N   
50   C CA  . GLN A 8   ? 0.4475 0.6968 0.2761 0.1067  -0.1339 -0.0047 8   GLN A CA  
51   C C   . GLN A 8   ? 0.4322 0.6908 0.2584 0.1097  -0.1268 -0.0175 8   GLN A C   
52   O O   . GLN A 8   ? 0.4209 0.6897 0.2449 0.1084  -0.1109 -0.0180 8   GLN A O   
53   C CB  . GLN A 8   ? 0.5213 0.7571 0.3126 0.1028  -0.1401 0.0036  8   GLN A CB  
54   C CG  . GLN A 8   ? 0.5959 0.8175 0.3824 0.0985  -0.1453 0.0180  8   GLN A CG  
55   C CD  . GLN A 8   ? 0.7088 0.9100 0.4592 0.0932  -0.1547 0.0263  8   GLN A CD  
56   O OE1 . GLN A 8   ? 0.7584 0.9605 0.4818 0.0894  -0.1493 0.0252  8   GLN A OE1 
57   N NE2 . GLN A 8   ? 0.7252 0.9072 0.4746 0.0935  -0.1693 0.0344  8   GLN A NE2 
58   N N   . GLU A 9   ? 0.4449 0.6989 0.2715 0.1143  -0.1401 -0.0283 9   GLU A N   
59   C CA  . GLU A 9   ? 0.4485 0.7056 0.2709 0.1185  -0.1374 -0.0419 9   GLU A CA  
60   C C   . GLU A 9   ? 0.4188 0.6808 0.2725 0.1181  -0.1275 -0.0469 9   GLU A C   
61   O O   . GLU A 9   ? 0.4172 0.6835 0.2642 0.1213  -0.1177 -0.0540 9   GLU A O   
62   C CB  . GLU A 9   ? 0.4714 0.7182 0.2890 0.1222  -0.1567 -0.0520 9   GLU A CB  
63   C CG  . GLU A 9   ? 0.5088 0.7450 0.2889 0.1222  -0.1589 -0.0514 9   GLU A CG  
64   C CD  . GLU A 9   ? 0.5997 0.8211 0.3759 0.1232  -0.1793 -0.0559 9   GLU A CD  
65   O OE1 . GLU A 9   ? 0.5638 0.7838 0.3643 0.1246  -0.1914 -0.0649 9   GLU A OE1 
66   O OE2 . GLU A 9   ? 0.5632 0.7747 0.3118 0.1213  -0.1832 -0.0500 9   GLU A OE2 
67   N N   . ALA A 10  ? 0.3976 0.6595 0.2841 0.1149  -0.1302 -0.0432 10  ALA A N   
68   C CA  . ALA A 10  ? 0.3935 0.6589 0.3090 0.1132  -0.1213 -0.0461 10  ALA A CA  
69   C C   . ALA A 10  ? 0.3542 0.6269 0.2680 0.1122  -0.1029 -0.0396 10  ALA A C   
70   O O   . ALA A 10  ? 0.3536 0.6283 0.2731 0.1135  -0.0933 -0.0447 10  ALA A O   
71   C CB  . ALA A 10  ? 0.3558 0.6236 0.3059 0.1099  -0.1282 -0.0434 10  ALA A CB  
72   N N   . VAL A 11  ? 0.3537 0.6287 0.2587 0.1097  -0.0993 -0.0282 11  VAL A N   
73   C CA  . VAL A 11  ? 0.3480 0.6304 0.2488 0.1074  -0.0833 -0.0214 11  VAL A CA  
74   C C   . VAL A 11  ? 0.3518 0.6423 0.2298 0.1102  -0.0746 -0.0277 11  VAL A C   
75   O O   . VAL A 11  ? 0.3375 0.6355 0.2222 0.1116  -0.0626 -0.0302 11  VAL A O   
76   C CB  . VAL A 11  ? 0.3478 0.6275 0.2364 0.1027  -0.0838 -0.0078 11  VAL A CB  
77   C CG1 . VAL A 11  ? 0.3858 0.6745 0.2654 0.0984  -0.0683 -0.0013 11  VAL A CG1 
78   C CG2 . VAL A 11  ? 0.3427 0.6158 0.2558 0.1027  -0.0908 -0.0029 11  VAL A CG2 
79   N N   . ALA A 12  ? 0.3788 0.6685 0.2295 0.1124  -0.0813 -0.0311 12  ALA A N   
80   C CA  . ALA A 12  ? 0.3930 0.6937 0.2201 0.1172  -0.0734 -0.0386 12  ALA A CA  
81   C C   . ALA A 12  ? 0.4007 0.6988 0.2390 0.1249  -0.0731 -0.0531 12  ALA A C   
82   O O   . ALA A 12  ? 0.3854 0.6947 0.2179 0.1300  -0.0623 -0.0590 12  ALA A O   
83   C CB  . ALA A 12  ? 0.4267 0.7245 0.2219 0.1184  -0.0816 -0.0401 12  ALA A CB  
84   N N   . GLN A 13  ? 0.4006 0.6841 0.2556 0.1255  -0.0857 -0.0588 13  GLN A N   
85   C CA  . GLN A 13  ? 0.4101 0.6852 0.2750 0.1306  -0.0882 -0.0713 13  GLN A CA  
86   C C   . GLN A 13  ? 0.4275 0.7061 0.3133 0.1295  -0.0755 -0.0686 13  GLN A C   
87   O O   . GLN A 13  ? 0.3796 0.6577 0.2609 0.1363  -0.0707 -0.0775 13  GLN A O   
88   C CB  . GLN A 13  ? 0.4933 0.7531 0.3738 0.1276  -0.1050 -0.0756 13  GLN A CB  
89   C CG  . GLN A 13  ? 0.5210 0.7663 0.3989 0.1325  -0.1134 -0.0901 13  GLN A CG  
90   N N   . ILE A 14  ? 0.3370 0.6185 0.2438 0.1223  -0.0709 -0.0570 14  ILE A N   
91   C CA  . ILE A 14  ? 0.3643 0.6492 0.2888 0.1211  -0.0588 -0.0534 14  ILE A CA  
92   C C   . ILE A 14  ? 0.3122 0.6116 0.2217 0.1251  -0.0457 -0.0533 14  ILE A C   
93   O O   . ILE A 14  ? 0.3382 0.6388 0.2518 0.1300  -0.0389 -0.0587 14  ILE A O   
94   C CB  . ILE A 14  ? 0.3457 0.6320 0.2919 0.1140  -0.0567 -0.0414 14  ILE A CB  
95   C CG1 . ILE A 14  ? 0.3944 0.6723 0.3615 0.1105  -0.0679 -0.0429 14  ILE A CG1 
96   C CG2 . ILE A 14  ? 0.2715 0.5620 0.2307 0.1133  -0.0436 -0.0371 14  ILE A CG2 
97   C CD1 . ILE A 14  ? 0.3644 0.6462 0.3483 0.1065  -0.0696 -0.0333 14  ILE A CD1 
98   N N   . LYS A 15  ? 0.3206 0.6317 0.2123 0.1226  -0.0426 -0.0469 15  LYS A N   
99   C CA  . LYS A 15  ? 0.3205 0.6508 0.1996 0.1242  -0.0296 -0.0459 15  LYS A CA  
100  C C   . LYS A 15  ? 0.3992 0.7364 0.2637 0.1357  -0.0280 -0.0608 15  LYS A C   
101  O O   . LYS A 15  ? 0.3767 0.7288 0.2416 0.1405  -0.0176 -0.0644 15  LYS A O   
102  C CB  . LYS A 15  ? 0.3667 0.7072 0.2264 0.1169  -0.0278 -0.0353 15  LYS A CB  
103  C CG  . LYS A 15  ? 0.3774 0.7135 0.2483 0.1068  -0.0266 -0.0203 15  LYS A CG  
104  C CD  . LYS A 15  ? 0.3733 0.7171 0.2204 0.0984  -0.0250 -0.0093 15  LYS A CD  
105  C CE  . LYS A 15  ? 0.4481 0.7793 0.3027 0.0895  -0.0289 0.0049  15  LYS A CE  
106  N NZ  . LYS A 15  ? 0.4538 0.7838 0.2823 0.0800  -0.0316 0.0172  15  LYS A NZ  
107  N N   . ALA A 16  ? 0.4386 0.7647 0.2898 0.1411  -0.0394 -0.0704 16  ALA A N   
108  C CA  . ALA A 16  ? 0.4001 0.7293 0.2341 0.1540  -0.0403 -0.0862 16  ALA A CA  
109  C C   . ALA A 16  ? 0.3920 0.7115 0.2395 0.1619  -0.0400 -0.0956 16  ALA A C   
110  O O   . ALA A 16  ? 0.4204 0.7442 0.2616 0.1727  -0.0367 -0.1061 16  ALA A O   
111  C CB  . ALA A 16  ? 0.4106 0.7243 0.2281 0.1575  -0.0553 -0.0944 16  ALA A CB  
112  N N   . ALA A 17  ? 0.4144 0.7175 0.2860 0.1549  -0.0428 -0.0895 17  ALA A N   
113  C CA  . ALA A 17  ? 0.4767 0.7666 0.3602 0.1601  -0.0427 -0.0958 17  ALA A CA  
114  C C   . ALA A 17  ? 0.4925 0.8012 0.3799 0.1643  -0.0287 -0.0941 17  ALA A C   
115  O O   . ALA A 17  ? 0.5053 0.8072 0.3940 0.1734  -0.0284 -0.1025 17  ALA A O   
116  C CB  . ALA A 17  ? 0.4241 0.6954 0.3313 0.1497  -0.0478 -0.0882 17  ALA A CB  
117  N N   . GLY A 18  ? 0.4309 0.7617 0.3191 0.1574  -0.0185 -0.0833 18  GLY A N   
118  C CA  . GLY A 18  ? 0.3310 0.6804 0.2268 0.1583  -0.0066 -0.0800 18  GLY A CA  
119  C C   . GLY A 18  ? 0.3001 0.6441 0.2147 0.1531  -0.0019 -0.0722 18  GLY A C   
120  O O   . GLY A 18  ? 0.3034 0.6265 0.2307 0.1471  -0.0080 -0.0675 18  GLY A O   
121  N N   . PRO A 19  ? 0.3084 0.6618 0.2342 0.1498  0.0048  -0.0663 19  PRO A N   
122  C CA  . PRO A 19  ? 0.3123 0.6586 0.2543 0.1442  0.0086  -0.0581 19  PRO A CA  
123  C C   . PRO A 19  ? 0.2820 0.6084 0.2298 0.1520  0.0052  -0.0654 19  PRO A C   
124  O O   . PRO A 19  ? 0.3522 0.6704 0.2913 0.1628  -0.0002 -0.0775 19  PRO A O   
125  C CB  . PRO A 19  ? 0.3152 0.6734 0.2621 0.1392  0.0129  -0.0531 19  PRO A CB  
126  C CG  . PRO A 19  ? 0.3451 0.7145 0.2826 0.1473  0.0109  -0.0628 19  PRO A CG  
127  C CD  . PRO A 19  ? 0.3013 0.6711 0.2251 0.1505  0.0076  -0.0674 19  PRO A CD  
128  N N   . SER A 20  ? 0.2508 0.5680 0.2128 0.1466  0.0077  -0.0578 20  SER A N   
129  C CA  . SER A 20  ? 0.3284 0.6248 0.2972 0.1506  0.0049  -0.0611 20  SER A CA  
130  C C   . SER A 20  ? 0.3365 0.6280 0.2992 0.1571  0.0043  -0.0666 20  SER A C   
131  O O   . SER A 20  ? 0.2990 0.6023 0.2607 0.1530  0.0070  -0.0627 20  SER A O   
132  C CB  . SER A 20  ? 0.3068 0.5955 0.2916 0.1410  0.0084  -0.0495 20  SER A CB  
133  O OG  . SER A 20  ? 0.2874 0.5799 0.2735 0.1351  0.0137  -0.0419 20  SER A OG  
134  N N   . LYS A 21  ? 0.3433 0.6168 0.3023 0.1672  -0.0007 -0.0757 21  LYS A N   
135  C CA  . LYS A 21  ? 0.3916 0.6580 0.3445 0.1743  -0.0035 -0.0808 21  LYS A CA  
136  C C   . LYS A 21  ? 0.3150 0.5769 0.2777 0.1663  0.0016  -0.0703 21  LYS A C   
137  O O   . LYS A 21  ? 0.3400 0.5940 0.3118 0.1601  0.0050  -0.0630 21  LYS A O   
138  C CB  . LYS A 21  ? 0.5437 0.7866 0.4858 0.1890  -0.0125 -0.0942 21  LYS A CB  
139  C CG  . LYS A 21  ? 0.6498 0.8645 0.5976 0.1834  -0.0153 -0.0888 21  LYS A CG  
140  C CD  . LYS A 21  ? 0.7505 0.9304 0.6842 0.1890  -0.0293 -0.0980 21  LYS A CD  
141  C CE  . LYS A 21  ? 0.8068 0.9842 0.7337 0.1874  -0.0372 -0.1041 21  LYS A CE  
142  N NZ  . LYS A 21  ? 0.8507 0.9898 0.7638 0.1900  -0.0529 -0.1122 21  LYS A NZ  
143  N N   . PRO A 22  ? 0.3467 0.6158 0.3081 0.1665  0.0020  -0.0700 22  PRO A N   
144  C CA  . PRO A 22  ? 0.3259 0.5920 0.2948 0.1589  0.0061  -0.0611 22  PRO A CA  
145  C C   . PRO A 22  ? 0.3081 0.5514 0.2785 0.1614  0.0058  -0.0596 22  PRO A C   
146  O O   . PRO A 22  ? 0.3959 0.6235 0.3586 0.1729  0.0002  -0.0680 22  PRO A O   
147  C CB  . PRO A 22  ? 0.3202 0.5969 0.2858 0.1644  0.0036  -0.0663 22  PRO A CB  
148  C CG  . PRO A 22  ? 0.3868 0.6830 0.3476 0.1680  0.0021  -0.0724 22  PRO A CG  
149  C CD  . PRO A 22  ? 0.3691 0.6531 0.3235 0.1739  -0.0015 -0.0782 22  PRO A CD  
150  N N   . ARG A 23  ? 0.2512 0.4915 0.2303 0.1513  0.0113  -0.0491 23  ARG A N   
151  C CA  . ARG A 23  ? 0.3215 0.5440 0.3030 0.1526  0.0126  -0.0459 23  ARG A CA  
152  C C   . ARG A 23  ? 0.3066 0.5258 0.2884 0.1498  0.0144  -0.0410 23  ARG A C   
153  O O   . ARG A 23  ? 0.3205 0.5495 0.3074 0.1407  0.0174  -0.0348 23  ARG A O   
154  C CB  . ARG A 23  ? 0.3315 0.5552 0.3234 0.1447  0.0171  -0.0385 23  ARG A CB  
155  C CG  . ARG A 23  ? 0.2911 0.5023 0.2876 0.1440  0.0209  -0.0328 23  ARG A CG  
156  C CD  . ARG A 23  ? 0.3637 0.5810 0.3730 0.1372  0.0246  -0.0269 23  ARG A CD  
157  N NE  . ARG A 23  ? 0.3613 0.5891 0.3767 0.1270  0.0265  -0.0207 23  ARG A NE  
158  C CZ  . ARG A 23  ? 0.4190 0.6436 0.4367 0.1204  0.0298  -0.0137 23  ARG A CZ  
159  N NH1 . ARG A 23  ? 0.4090 0.6228 0.4236 0.1220  0.0322  -0.0116 23  ARG A NH1 
160  N NH2 . ARG A 23  ? 0.3999 0.6314 0.4212 0.1140  0.0298  -0.0094 23  ARG A NH2 
161  N N   . LEU A 24  ? 0.2829 0.4871 0.2578 0.1589  0.0114  -0.0447 24  LEU A N   
162  C CA  A LEU A 24  ? 0.2738 0.4749 0.2476 0.1583  0.0118  -0.0416 24  LEU A CA  
163  C CA  B LEU A 24  ? 0.2724 0.4733 0.2462 0.1585  0.0118  -0.0416 24  LEU A CA  
164  C C   . LEU A 24  ? 0.2287 0.4229 0.2078 0.1509  0.0177  -0.0318 24  LEU A C   
165  O O   . LEU A 24  ? 0.2721 0.4572 0.2525 0.1512  0.0210  -0.0286 24  LEU A O   
166  C CB  A LEU A 24  ? 0.3246 0.5100 0.2866 0.1724  0.0051  -0.0491 24  LEU A CB  
167  C CB  B LEU A 24  ? 0.3224 0.5072 0.2843 0.1726  0.0051  -0.0492 24  LEU A CB  
168  C CG  A LEU A 24  ? 0.3779 0.5735 0.3348 0.1803  -0.0016 -0.0589 24  LEU A CG  
169  C CG  B LEU A 24  ? 0.3846 0.5778 0.3405 0.1814  -0.0021 -0.0594 24  LEU A CG  
170  C CD1 A LEU A 24  ? 0.4166 0.5903 0.3594 0.1961  -0.0107 -0.0675 24  LEU A CD1 
171  C CD1 B LEU A 24  ? 0.4409 0.6350 0.3924 0.1875  -0.0063 -0.0677 24  LEU A CD1 
172  C CD2 A LEU A 24  ? 0.3855 0.6005 0.3490 0.1741  0.0001  -0.0564 24  LEU A CD2 
173  C CD2 B LEU A 24  ? 0.4339 0.6103 0.3787 0.1938  -0.0093 -0.0647 24  LEU A CD2 
174  N N   . ALA A 25  ? 0.2107 0.4107 0.1926 0.1450  0.0190  -0.0275 25  ALA A N   
175  C CA  . ALA A 25  ? 0.2080 0.4006 0.1922 0.1401  0.0233  -0.0199 25  ALA A CA  
176  C C   . ALA A 25  ? 0.2174 0.3924 0.1928 0.1490  0.0236  -0.0199 25  ALA A C   
177  O O   . ALA A 25  ? 0.2321 0.3997 0.1983 0.1595  0.0183  -0.0261 25  ALA A O   
178  C CB  . ALA A 25  ? 0.2564 0.4573 0.2425 0.1359  0.0224  -0.0180 25  ALA A CB  
179  N N   . ARG A 26  ? 0.2161 0.3843 0.1928 0.1461  0.0296  -0.0131 26  ARG A N   
180  C CA  . ARG A 26  ? 0.2409 0.3925 0.2065 0.1551  0.0318  -0.0114 26  ARG A CA  
181  C C   . ARG A 26  ? 0.2894 0.4325 0.2438 0.1630  0.0263  -0.0143 26  ARG A C   
182  O O   . ARG A 26  ? 0.3270 0.4535 0.2679 0.1752  0.0223  -0.0179 26  ARG A O   
183  C CB  . ARG A 26  ? 0.2512 0.4017 0.2195 0.1495  0.0407  -0.0029 26  ARG A CB  
184  C CG  . ARG A 26  ? 0.2982 0.4270 0.2523 0.1518  0.0436  0.0016  26  ARG A CG  
185  C CD  . ARG A 26  ? 0.2589 0.3900 0.2148 0.1447  0.0531  0.0099  26  ARG A CD  
186  N NE  . ARG A 26  ? 0.2548 0.3923 0.2093 0.1497  0.0538  0.0094  26  ARG A NE  
187  C CZ  . ARG A 26  ? 0.2383 0.3766 0.1923 0.1456  0.0593  0.0143  26  ARG A CZ  
188  N NH1 . ARG A 26  ? 0.2418 0.3844 0.1985 0.1410  0.0693  0.0199  26  ARG A NH1 
189  N NH2 . ARG A 26  ? 0.2386 0.3748 0.1896 0.1462  0.0546  0.0132  26  ARG A NH2 
190  N N   . ASP A 27  ? 0.2418 0.3947 0.2011 0.1569  0.0252  -0.0131 27  ASP A N   
191  C CA  . ASP A 27  ? 0.3055 0.4553 0.2570 0.1634  0.0199  -0.0160 27  ASP A CA  
192  C C   . ASP A 27  ? 0.3117 0.4806 0.2718 0.1593  0.0154  -0.0205 27  ASP A C   
193  O O   . ASP A 27  ? 0.2491 0.4313 0.2196 0.1498  0.0179  -0.0186 27  ASP A O   
194  C CB  . ASP A 27  ? 0.2699 0.4140 0.2172 0.1622  0.0233  -0.0102 27  ASP A CB  
195  C CG  . ASP A 27  ? 0.3596 0.4940 0.3035 0.1610  0.0317  -0.0034 27  ASP A CG  
196  O OD1 . ASP A 27  ? 0.3277 0.4456 0.2573 0.1704  0.0340  -0.0022 27  ASP A OD1 
197  O OD2 . ASP A 27  ? 0.4337 0.5765 0.3881 0.1513  0.0363  0.0005  27  ASP A OD2 
198  N N   . PRO A 28  ? 0.2742 0.4449 0.2292 0.1670  0.0090  -0.0262 28  PRO A N   
199  C CA  . PRO A 28  ? 0.2320 0.4241 0.1957 0.1630  0.0065  -0.0293 28  PRO A CA  
200  C C   . PRO A 28  ? 0.2169 0.4142 0.1859 0.1553  0.0098  -0.0233 28  PRO A C   
201  O O   . PRO A 28  ? 0.2494 0.4321 0.2129 0.1555  0.0128  -0.0181 28  PRO A O   
202  C CB  . PRO A 28  ? 0.3543 0.5449 0.3104 0.1746  -0.0011 -0.0366 28  PRO A CB  
203  C CG  . PRO A 28  ? 0.3419 0.5081 0.2837 0.1852  -0.0039 -0.0381 28  PRO A CG  
204  C CD  . PRO A 28  ? 0.3455 0.4979 0.2855 0.1804  0.0035  -0.0299 28  PRO A CD  
205  N N   . VAL A 29  ? 0.2078 0.4262 0.1866 0.1494  0.0093  -0.0244 29  VAL A N   
206  C CA  . VAL A 29  ? 0.2009 0.4253 0.1837 0.1449  0.0102  -0.0206 29  VAL A CA  
207  C C   . VAL A 29  ? 0.2117 0.4237 0.1850 0.1539  0.0066  -0.0222 29  VAL A C   
208  O O   . VAL A 29  ? 0.2222 0.4350 0.1913 0.1621  0.0014  -0.0283 29  VAL A O   
209  C CB  . VAL A 29  ? 0.1943 0.4466 0.1883 0.1395  0.0091  -0.0226 29  VAL A CB  
210  C CG1 . VAL A 29  ? 0.1899 0.4491 0.1880 0.1367  0.0086  -0.0193 29  VAL A CG1 
211  C CG2 . VAL A 29  ? 0.2107 0.4739 0.2107 0.1312  0.0127  -0.0203 29  VAL A CG2 
212  N N   . ASN A 30  ? 0.2121 0.4111 0.1800 0.1539  0.0088  -0.0172 30  ASN A N   
213  C CA  . ASN A 30  ? 0.2460 0.4302 0.2011 0.1636  0.0056  -0.0184 30  ASN A CA  
214  C C   . ASN A 30  ? 0.2362 0.4172 0.1885 0.1638  0.0057  -0.0155 30  ASN A C   
215  O O   . ASN A 30  ? 0.2173 0.3996 0.1744 0.1575  0.0098  -0.0111 30  ASN A O   
216  C CB  . ASN A 30  ? 0.2377 0.3996 0.1797 0.1692  0.0083  -0.0159 30  ASN A CB  
217  C CG  . ASN A 30  ? 0.2326 0.3857 0.1745 0.1632  0.0163  -0.0086 30  ASN A CG  
218  O OD1 . ASN A 30  ? 0.2377 0.3815 0.1719 0.1652  0.0187  -0.0052 30  ASN A OD1 
219  N ND2 . ASN A 30  ? 0.2244 0.3811 0.1744 0.1568  0.0201  -0.0071 30  ASN A ND2 
220  N N   . GLN A 31  ? 0.1451 0.5200 0.2275 0.0666  -0.0068 -0.0290 31  GLN A N   
221  C CA  . GLN A 31  ? 0.1434 0.5243 0.2280 0.0599  -0.0069 -0.0309 31  GLN A CA  
222  C C   . GLN A 31  ? 0.1381 0.5045 0.2187 0.0581  -0.0066 -0.0271 31  GLN A C   
223  O O   . GLN A 31  ? 0.1339 0.4992 0.2173 0.0499  -0.0052 -0.0277 31  GLN A O   
224  C CB  . GLN A 31  ? 0.1513 0.5497 0.2363 0.0642  -0.0101 -0.0356 31  GLN A CB  
225  C CG  . GLN A 31  ? 0.1503 0.5576 0.2395 0.0560  -0.0098 -0.0391 31  GLN A CG  
226  C CD  . GLN A 31  ? 0.1510 0.5657 0.2477 0.0467  -0.0070 -0.0421 31  GLN A CD  
227  O OE1 . GLN A 31  ? 0.1823 0.6068 0.2818 0.0480  -0.0066 -0.0446 31  GLN A OE1 
228  N NE2 . GLN A 31  ? 0.1456 0.5561 0.2458 0.0372  -0.0049 -0.0418 31  GLN A NE2 
229  N N   . PRO A 32  ? 0.1391 0.4951 0.2134 0.0656  -0.0078 -0.0235 32  PRO A N   
230  C CA  . PRO A 32  ? 0.1340 0.4774 0.2048 0.0632  -0.0072 -0.0204 32  PRO A CA  
231  C C   . PRO A 32  ? 0.1257 0.4558 0.1984 0.0556  -0.0041 -0.0184 32  PRO A C   
232  O O   . PRO A 32  ? 0.1215 0.4473 0.1946 0.0498  -0.0035 -0.0184 32  PRO A O   
233  C CB  . PRO A 32  ? 0.1378 0.4722 0.2022 0.0727  -0.0083 -0.0166 32  PRO A CB  
234  C CG  . PRO A 32  ? 0.1470 0.4952 0.2110 0.0807  -0.0111 -0.0190 32  PRO A CG  
235  C CD  . PRO A 32  ? 0.1517 0.5093 0.2220 0.0766  -0.0101 -0.0227 32  PRO A CD  
236  N N   . MET A 33  ? 0.1240 0.4479 0.1977 0.0560  -0.0023 -0.0171 33  MET A N   
237  C CA  . MET A 33  ? 0.1257 0.4376 0.2007 0.0495  0.0005  -0.0153 33  MET A CA  
238  C C   . MET A 33  ? 0.1161 0.4367 0.1972 0.0408  0.0020  -0.0178 33  MET A C   
239  O O   . MET A 33  ? 0.1114 0.4245 0.1940 0.0345  0.0037  -0.0169 33  MET A O   
240  C CB  . MET A 33  ? 0.1163 0.4187 0.1900 0.0528  0.0021  -0.0133 33  MET A CB  
241  C CG  . MET A 33  ? 0.1932 0.4828 0.2616 0.0594  0.0015  -0.0106 33  MET A CG  
242  S SD  . MET A 33  ? 0.2632 0.5427 0.3311 0.0633  0.0030  -0.0094 33  MET A SD  
243  C CE  . MET A 33  ? 0.3068 0.5834 0.3781 0.0547  0.0059  -0.0097 33  MET A CE  
244  N N   . ILE A 34  ? 0.1210 0.4577 0.2061 0.0403  0.0015  -0.0211 34  ILE A N   
245  C CA  . ILE A 34  ? 0.1213 0.4677 0.2128 0.0316  0.0029  -0.0238 34  ILE A CA  
246  C C   . ILE A 34  ? 0.1200 0.4665 0.2123 0.0272  0.0019  -0.0251 34  ILE A C   
247  O O   . ILE A 34  ? 0.1173 0.4603 0.2132 0.0193  0.0038  -0.0252 34  ILE A O   
248  C CB  . ILE A 34  ? 0.1277 0.4936 0.2236 0.0317  0.0023  -0.0282 34  ILE A CB  
249  C CG1 . ILE A 34  ? 0.1292 0.4968 0.2256 0.0342  0.0037  -0.0277 34  ILE A CG1 
250  C CG2 . ILE A 34  ? 0.1289 0.5045 0.2318 0.0219  0.0040  -0.0314 34  ILE A CG2 
251  C CD1 . ILE A 34  ? 0.1363 0.5241 0.2367 0.0356  0.0028  -0.0327 34  ILE A CD1 
252  N N   . ASN A 35  ? 0.1228 0.4735 0.2116 0.0326  -0.0010 -0.0263 35  ASN A N   
253  C CA  . ASN A 35  ? 0.1222 0.4738 0.2112 0.0291  -0.0022 -0.0281 35  ASN A CA  
254  C C   . ASN A 35  ? 0.1157 0.4503 0.2026 0.0257  -0.0010 -0.0251 35  ASN A C   
255  O O   . ASN A 35  ? 0.1140 0.4481 0.2045 0.0185  -0.0004 -0.0269 35  ASN A O   
256  C CB  . ASN A 35  ? 0.1269 0.4853 0.2110 0.0368  -0.0055 -0.0291 35  ASN A CB  
257  C CG  . ASN A 35  ? 0.1675 0.5451 0.2546 0.0394  -0.0073 -0.0338 35  ASN A CG  
258  O OD1 . ASN A 35  ? 0.1356 0.5231 0.2293 0.0333  -0.0060 -0.0373 35  ASN A OD1 
259  N ND2 . ASN A 35  ? 0.1397 0.5230 0.2218 0.0485  -0.0101 -0.0339 35  ASN A ND2 
260  N N   . ASN A 36  ? 0.1126 0.4339 0.1941 0.0307  -0.0005 -0.0210 36  ASN A N   
261  C CA  . ASN A 36  ? 0.1067 0.4123 0.1862 0.0280  0.0007  -0.0188 36  ASN A CA  
262  C C   . ASN A 36  ? 0.1037 0.4055 0.1884 0.0201  0.0033  -0.0189 36  ASN A C   
263  O O   . ASN A 36  ? 0.1007 0.3961 0.1868 0.0149  0.0038  -0.0195 36  ASN A O   
264  C CB  . ASN A 36  ? 0.1046 0.3970 0.1784 0.0344  0.0012  -0.0150 36  ASN A CB  
265  C CG  . ASN A 36  ? 0.1078 0.4012 0.1759 0.0417  -0.0009 -0.0140 36  ASN A CG  
266  O OD1 . ASN A 36  ? 0.1105 0.4127 0.1780 0.0417  -0.0028 -0.0159 36  ASN A OD1 
267  N ND2 . ASN A 36  ? 0.1330 0.4176 0.1970 0.0481  -0.0004 -0.0110 36  ASN A ND2 
268  N N   . TRP A 37  ? 0.1052 0.4116 0.1928 0.0194  0.0049  -0.0185 37  TRP A N   
269  C CA  . TRP A 37  ? 0.1035 0.4066 0.1954 0.0126  0.0079  -0.0177 37  TRP A CA  
270  C C   . TRP A 37  ? 0.1060 0.4186 0.2048 0.0040  0.0085  -0.0208 37  TRP A C   
271  O O   . TRP A 37  ? 0.1039 0.4098 0.2052 -0.0019 0.0098  -0.0205 37  TRP A O   
272  C CB  . TRP A 37  ? 0.1053 0.4119 0.1977 0.0146  0.0096  -0.0164 37  TRP A CB  
273  C CG  . TRP A 37  ? 0.1043 0.4073 0.1995 0.0093  0.0129  -0.0146 37  TRP A CG  
274  C CD1 . TRP A 37  ? 0.1009 0.3915 0.1928 0.0113  0.0145  -0.0115 37  TRP A CD1 
275  C CD2 . TRP A 37  ? 0.1237 0.4368 0.2254 0.0012  0.0154  -0.0156 37  TRP A CD2 
276  N NE1 . TRP A 37  ? 0.1023 0.3951 0.1976 0.0054  0.0177  -0.0103 37  TRP A NE1 
277  C CE2 . TRP A 37  ? 0.1184 0.4246 0.2199 -0.0012 0.0185  -0.0125 37  TRP A CE2 
278  C CE3 . TRP A 37  ? 0.1503 0.4778 0.2581 -0.0045 0.0155  -0.0191 37  TRP A CE3 
279  C CZ2 . TRP A 37  ? 0.1518 0.4648 0.2585 -0.0093 0.0220  -0.0120 37  TRP A CZ2 
280  C CZ3 . TRP A 37  ? 0.1508 0.4844 0.2645 -0.0131 0.0191  -0.0191 37  TRP A CZ3 
281  C CH2 . TRP A 37  ? 0.1158 0.4421 0.2287 -0.0155 0.0224  -0.0152 37  TRP A CH2 
282  N N   . VAL A 38  ? 0.1124 0.4406 0.2146 0.0033  0.0074  -0.0243 38  VAL A N   
283  C CA  . VAL A 38  ? 0.1159 0.4533 0.2254 -0.0055 0.0082  -0.0280 38  VAL A CA  
284  C C   . VAL A 38  ? 0.1519 0.4839 0.2611 -0.0078 0.0064  -0.0298 38  VAL A C   
285  O O   . VAL A 38  ? 0.1380 0.4689 0.2526 -0.0158 0.0076  -0.0314 38  VAL A O   
286  C CB  . VAL A 38  ? 0.2266 0.5831 0.3399 -0.0054 0.0073  -0.0324 38  VAL A CB  
287  C CG1 . VAL A 38  ? 0.1245 0.4869 0.2386 -0.0037 0.0092  -0.0312 38  VAL A CG1 
288  C CG2 . VAL A 38  ? 0.1238 0.4858 0.2325 0.0022  0.0035  -0.0344 38  VAL A CG2 
289  N N   . GLU A 39  ? 0.1150 0.4435 0.2178 -0.0008 0.0037  -0.0294 39  GLU A N   
290  C CA  . GLU A 39  ? 0.1417 0.4644 0.2428 -0.0020 0.0019  -0.0309 39  GLU A CA  
291  C C   . GLU A 39  ? 0.1367 0.4445 0.2384 -0.0064 0.0036  -0.0290 39  GLU A C   
292  O O   . GLU A 39  ? 0.1158 0.4221 0.2214 -0.0126 0.0034  -0.0318 39  GLU A O   
293  C CB  . GLU A 39  ? 0.1382 0.4588 0.2312 0.0068  -0.0006 -0.0297 39  GLU A CB  
294  C CG  . GLU A 39  ? 0.2950 0.6074 0.3843 0.0067  -0.0019 -0.0302 39  GLU A CG  
295  C CD  . GLU A 39  ? 0.4126 0.7244 0.4937 0.0153  -0.0038 -0.0284 39  GLU A CD  
296  O OE1 . GLU A 39  ? 0.4479 0.7686 0.5273 0.0168  -0.0060 -0.0311 39  GLU A OE1 
297  O OE2 . GLU A 39  ? 0.3495 0.6524 0.4261 0.0205  -0.0030 -0.0243 39  GLU A OE2 
298  N N   . ALA A 40  ? 0.1004 0.3975 0.1983 -0.0029 0.0051  -0.0248 40  ALA A N   
299  C CA  . ALA A 40  ? 0.0961 0.3795 0.1938 -0.0056 0.0064  -0.0233 40  ALA A CA  
300  C C   . ALA A 40  ? 0.0978 0.3823 0.2025 -0.0138 0.0091  -0.0231 40  ALA A C   
301  O O   . ALA A 40  ? 0.1230 0.4017 0.2308 -0.0191 0.0094  -0.0243 40  ALA A O   
302  C CB  . ALA A 40  ? 0.0922 0.3644 0.1837 0.0009  0.0071  -0.0195 40  ALA A CB  
303  N N   . ILE A 41  ? 0.1009 0.3936 0.2083 -0.0148 0.0111  -0.0219 41  ILE A N   
304  C CA  . ILE A 41  ? 0.1234 0.4184 0.2369 -0.0228 0.0145  -0.0210 41  ILE A CA  
305  C C   . ILE A 41  ? 0.1473 0.4503 0.2684 -0.0315 0.0144  -0.0252 41  ILE A C   
306  O O   . ILE A 41  ? 0.1728 0.4739 0.2993 -0.0399 0.0167  -0.0250 41  ILE A O   
307  C CB  . ILE A 41  ? 0.1966 0.4994 0.3104 -0.0216 0.0169  -0.0189 41  ILE A CB  
308  C CG1 . ILE A 41  ? 0.1027 0.3965 0.2096 -0.0135 0.0170  -0.0152 41  ILE A CG1 
309  C CG2 . ILE A 41  ? 0.2067 0.5135 0.3268 -0.0310 0.0210  -0.0178 41  ILE A CG2 
310  C CD1 . ILE A 41  ? 0.1395 0.4199 0.2444 -0.0143 0.0187  -0.0123 41  ILE A CD1 
311  N N   . GLY A 42  ? 0.1278 0.4398 0.2491 -0.0295 0.0117  -0.0291 42  GLY A N   
312  C CA  . GLY A 42  ? 0.1378 0.4583 0.2662 -0.0370 0.0112  -0.0340 42  GLY A CA  
313  C C   . GLY A 42  ? 0.2374 0.5710 0.3724 -0.0429 0.0140  -0.0354 42  GLY A C   
314  O O   . GLY A 42  ? 0.2409 0.5796 0.3833 -0.0516 0.0150  -0.0389 42  GLY A O   
315  N N   . ASP A 43  ? 0.1306 0.4694 0.2630 -0.0385 0.0153  -0.0329 43  ASP A N   
316  C CA  . ASP A 43  ? 0.1415 0.4947 0.2794 -0.0431 0.0179  -0.0347 43  ASP A CA  
317  C C   . ASP A 43  ? 0.1564 0.5252 0.2956 -0.0400 0.0151  -0.0403 43  ASP A C   
318  O O   . ASP A 43  ? 0.2517 0.6239 0.3853 -0.0309 0.0127  -0.0400 43  ASP A O   
319  C CB  . ASP A 43  ? 0.1785 0.5313 0.3129 -0.0392 0.0202  -0.0303 43  ASP A CB  
320  C CG  . ASP A 43  ? 0.2274 0.5926 0.3678 -0.0461 0.0241  -0.0312 43  ASP A CG  
321  O OD1 . ASP A 43  ? 0.2080 0.5843 0.3550 -0.0527 0.0246  -0.0361 43  ASP A OD1 
322  O OD2 . ASP A 43  ? 0.1783 0.5425 0.3164 -0.0449 0.0267  -0.0275 43  ASP A OD2 
323  N N   . ARG A 44  ? 0.1637 0.5424 0.3105 -0.0477 0.0157  -0.0456 44  ARG A N   
324  C CA  . ARG A 44  ? 0.2083 0.6027 0.3565 -0.0450 0.0129  -0.0518 44  ARG A CA  
325  C C   . ARG A 44  ? 0.2624 0.6738 0.4145 -0.0462 0.0147  -0.0547 44  ARG A C   
326  O O   . ARG A 44  ? 0.1942 0.6210 0.3491 -0.0454 0.0130  -0.0609 44  ARG A O   
327  C CB  . ARG A 44  ? 0.3019 0.6987 0.4561 -0.0520 0.0121  -0.0574 44  ARG A CB  
328  C CG  . ARG A 44  ? 0.3828 0.7632 0.5341 -0.0520 0.0105  -0.0553 44  ARG A CG  
329  C CD  . ARG A 44  ? 0.4801 0.8641 0.6346 -0.0548 0.0079  -0.0617 44  ARG A CD  
330  N NE  . ARG A 44  ? 0.5852 0.9718 0.7498 -0.0666 0.0105  -0.0655 44  ARG A NE  
331  C CZ  . ARG A 44  ? 0.6069 0.9804 0.7751 -0.0739 0.0119  -0.0642 44  ARG A CZ  
332  N NH1 . ARG A 44  ? 0.5819 0.9398 0.7444 -0.0704 0.0108  -0.0596 44  ARG A NH1 
333  N NH2 . ARG A 44  ? 0.6259 1.0020 0.8035 -0.0849 0.0143  -0.0679 44  ARG A NH2 
334  N N   . ASN A 45  ? 0.2502 0.6597 0.4022 -0.0477 0.0182  -0.0505 45  ASN A N   
335  C CA  . ASN A 45  ? 0.1943 0.6199 0.3496 -0.0486 0.0201  -0.0531 45  ASN A CA  
336  C C   . ASN A 45  ? 0.2031 0.6415 0.3549 -0.0387 0.0159  -0.0572 45  ASN A C   
337  O O   . ASN A 45  ? 0.1613 0.5937 0.3054 -0.0286 0.0132  -0.0540 45  ASN A O   
338  C CB  . ASN A 45  ? 0.1886 0.6083 0.3414 -0.0485 0.0236  -0.0471 45  ASN A CB  
339  C CG  . ASN A 45  ? 0.2498 0.6857 0.4075 -0.0531 0.0270  -0.0498 45  ASN A CG  
340  O OD1 . ASN A 45  ? 0.3030 0.7557 0.4634 -0.0514 0.0254  -0.0561 45  ASN A OD1 
341  N ND2 . ASN A 45  ? 0.2079 0.6392 0.3662 -0.0586 0.0318  -0.0452 45  ASN A ND2 
342  N N   . PRO A 46  ? 0.1638 0.6202 0.3213 -0.0416 0.0154  -0.0647 46  PRO A N   
343  C CA  . PRO A 46  ? 0.1821 0.6520 0.3366 -0.0322 0.0112  -0.0695 46  PRO A CA  
344  C C   . PRO A 46  ? 0.1651 0.6395 0.3149 -0.0236 0.0103  -0.0677 46  PRO A C   
345  O O   . PRO A 46  ? 0.1648 0.6432 0.3092 -0.0133 0.0063  -0.0689 46  PRO A O   
346  C CB  . PRO A 46  ? 0.2265 0.7160 0.3897 -0.0393 0.0122  -0.0783 46  PRO A CB  
347  C CG  . PRO A 46  ? 0.2378 0.7198 0.4077 -0.0516 0.0158  -0.0779 46  PRO A CG  
348  C CD  . PRO A 46  ? 0.1712 0.6352 0.3384 -0.0539 0.0188  -0.0693 46  PRO A CD  
349  N N   . ILE A 47  ? 0.2367 0.7107 0.3884 -0.0274 0.0141  -0.0650 47  ILE A N   
350  C CA  . ILE A 47  ? 0.2368 0.7175 0.3852 -0.0198 0.0134  -0.0648 47  ILE A CA  
351  C C   . ILE A 47  ? 0.2165 0.6819 0.3556 -0.0090 0.0107  -0.0587 47  ILE A C   
352  O O   . ILE A 47  ? 0.1610 0.6314 0.2965 -0.0004 0.0087  -0.0593 47  ILE A O   
353  C CB  . ILE A 47  ? 0.2105 0.6956 0.3632 -0.0272 0.0185  -0.0637 47  ILE A CB  
354  C CG1 . ILE A 47  ? 0.1787 0.6442 0.3284 -0.0301 0.0215  -0.0554 47  ILE A CG1 
355  C CG2 . ILE A 47  ? 0.2080 0.7063 0.3700 -0.0391 0.0219  -0.0693 47  ILE A CG2 
356  C CD1 . ILE A 47  ? 0.2463 0.7154 0.3992 -0.0373 0.0268  -0.0535 47  ILE A CD1 
357  N N   . TYR A 48  ? 0.1532 0.6003 0.2887 -0.0094 0.0105  -0.0535 48  TYR A N   
358  C CA  . TYR A 48  ? 0.1695 0.6014 0.2965 0.0001  0.0082  -0.0481 48  TYR A CA  
359  C C   . TYR A 48  ? 0.2156 0.6493 0.3377 0.0088  0.0036  -0.0500 48  TYR A C   
360  O O   . TYR A 48  ? 0.1451 0.5695 0.2603 0.0176  0.0016  -0.0464 48  TYR A O   
361  C CB  . TYR A 48  ? 0.1404 0.5524 0.2653 -0.0037 0.0101  -0.0422 48  TYR A CB  
362  C CG  . TYR A 48  ? 0.1408 0.5498 0.2699 -0.0124 0.0149  -0.0398 48  TYR A CG  
363  C CD1 . TYR A 48  ? 0.1441 0.5612 0.2745 -0.0125 0.0171  -0.0398 48  TYR A CD1 
364  C CD2 . TYR A 48  ? 0.1532 0.5521 0.2847 -0.0205 0.0172  -0.0375 48  TYR A CD2 
365  C CE1 . TYR A 48  ? 0.1907 0.6058 0.3242 -0.0205 0.0218  -0.0372 48  TYR A CE1 
366  C CE2 . TYR A 48  ? 0.1408 0.5372 0.2757 -0.0283 0.0218  -0.0349 48  TYR A CE2 
367  C CZ  . TYR A 48  ? 0.1709 0.5756 0.3065 -0.0284 0.0243  -0.0345 48  TYR A CZ  
368  O OH  . TYR A 48  ? 0.2220 0.6247 0.3602 -0.0363 0.0292  -0.0314 48  TYR A OH  
369  N N   . VAL A 49  ? 0.2225 0.6687 0.3481 0.0063  0.0021  -0.0556 49  VAL A N   
370  C CA  . VAL A 49  ? 0.1600 0.6075 0.2807 0.0139  -0.0021 -0.0570 49  VAL A CA  
371  C C   . VAL A 49  ? 0.2343 0.7032 0.3575 0.0169  -0.0046 -0.0646 49  VAL A C   
372  O O   . VAL A 49  ? 0.1635 0.6351 0.2820 0.0241  -0.0081 -0.0659 49  VAL A O   
373  C CB  . VAL A 49  ? 0.1663 0.6027 0.2862 0.0094  -0.0023 -0.0556 49  VAL A CB  
374  C CG1 . VAL A 49  ? 0.1411 0.5559 0.2570 0.0088  -0.0006 -0.0483 49  VAL A CG1 
375  C CG2 . VAL A 49  ? 0.1516 0.5954 0.2802 -0.0019 -0.0002 -0.0603 49  VAL A CG2 
376  N N   . ASP A 50  ? 0.1664 0.6509 0.2966 0.0118  -0.0028 -0.0699 50  ASP A N   
377  C CA  . ASP A 50  ? 0.2317 0.7379 0.3652 0.0138  -0.0051 -0.0784 50  ASP A CA  
378  C C   . ASP A 50  ? 0.2016 0.7234 0.3389 0.0144  -0.0040 -0.0827 50  ASP A C   
379  O O   . ASP A 50  ? 0.2381 0.7642 0.3821 0.0049  0.0000  -0.0840 50  ASP A O   
380  C CB  . ASP A 50  ? 0.2122 0.7246 0.3525 0.0038  -0.0039 -0.0836 50  ASP A CB  
381  C CG  . ASP A 50  ? 0.3790 0.9149 0.5236 0.0048  -0.0058 -0.0935 50  ASP A CG  
382  O OD1 . ASP A 50  ? 0.3833 0.9304 0.5244 0.0147  -0.0088 -0.0963 50  ASP A OD1 
383  O OD2 . ASP A 50  ? 0.4250 0.9680 0.5768 -0.0044 -0.0041 -0.0988 50  ASP A OD2 
384  N N   . ASP A 51  ? 0.2670 0.7971 0.4000 0.0256  -0.0075 -0.0847 51  ASP A N   
385  C CA  . ASP A 51  ? 0.2700 0.8142 0.4053 0.0285  -0.0072 -0.0887 51  ASP A CA  
386  C C   . ASP A 51  ? 0.2737 0.8384 0.4184 0.0193  -0.0049 -0.0973 51  ASP A C   
387  O O   . ASP A 51  ? 0.3134 0.8851 0.4625 0.0144  -0.0018 -0.0989 51  ASP A O   
388  C CB  . ASP A 51  ? 0.2372 0.7892 0.3669 0.0425  -0.0120 -0.0912 51  ASP A CB  
389  C CG  . ASP A 51  ? 0.4050 0.9391 0.5268 0.0517  -0.0133 -0.0833 51  ASP A CG  
390  O OD1 . ASP A 51  ? 0.3345 0.8567 0.4563 0.0483  -0.0104 -0.0782 51  ASP A OD1 
391  O OD2 . ASP A 51  ? 0.4475 0.9795 0.5630 0.0623  -0.0172 -0.0824 51  ASP A OD2 
392  N N   . ALA A 52  ? 0.3387 0.9130 0.4864 0.0166  -0.0062 -0.1031 52  ALA A N   
393  C CA  . ALA A 52  ? 0.3229 0.9174 0.4798 0.0080  -0.0041 -0.1124 52  ALA A CA  
394  C C   . ALA A 52  ? 0.3135 0.9018 0.4773 -0.0065 0.0017  -0.1100 52  ALA A C   
395  O O   . ALA A 52  ? 0.2831 0.8851 0.4537 -0.0135 0.0050  -0.1148 52  ALA A O   
396  C CB  . ALA A 52  ? 0.3227 0.9271 0.4809 0.0085  -0.0068 -0.1190 52  ALA A CB  
397  N N   . ALA A 53  ? 0.2197 0.7874 0.3816 -0.0106 0.0030  -0.1026 53  ALA A N   
398  C CA  . ALA A 53  ? 0.2015 0.7605 0.3692 -0.0238 0.0084  -0.0994 53  ALA A CA  
399  C C   . ALA A 53  ? 0.3150 0.8678 0.4818 -0.0253 0.0118  -0.0938 53  ALA A C   
400  O O   . ALA A 53  ? 0.2096 0.7636 0.3824 -0.0362 0.0169  -0.0933 53  ALA A O   
401  C CB  . ALA A 53  ? 0.2826 0.8215 0.4477 -0.0262 0.0081  -0.0936 53  ALA A CB  
402  N N   . ALA A 54  ? 0.2647 0.8106 0.4238 -0.0143 0.0091  -0.0893 54  ALA A N   
403  C CA  . ALA A 54  ? 0.2446 0.7857 0.4019 -0.0137 0.0116  -0.0847 54  ALA A CA  
404  C C   . ALA A 54  ? 0.3182 0.8817 0.4798 -0.0135 0.0123  -0.0920 54  ALA A C   
405  O O   . ALA A 54  ? 0.3396 0.9044 0.4979 -0.0073 0.0118  -0.0907 54  ALA A O   
406  C CB  . ALA A 54  ? 0.2525 0.7788 0.4008 -0.0024 0.0085  -0.0785 54  ALA A CB  
407  N N   . ARG A 55  ? 0.2827 0.8638 0.4517 -0.0207 0.0136  -0.1001 55  ARG A N   
408  C CA  . ARG A 55  ? 0.2648 0.8688 0.4387 -0.0220 0.0147  -0.1082 55  ARG A CA  
409  C C   . ARG A 55  ? 0.3052 0.9205 0.4888 -0.0367 0.0200  -0.1132 55  ARG A C   
410  O O   . ARG A 55  ? 0.2685 0.8977 0.4566 -0.0419 0.0234  -0.1169 55  ARG A O   
411  C CB  . ARG A 55  ? 0.2168 0.8367 0.3888 -0.0110 0.0091  -0.1160 55  ARG A CB  
412  C CG  . ARG A 55  ? 0.2129 0.8246 0.3761 0.0032  0.0049  -0.1117 55  ARG A CG  
413  C CD  . ARG A 55  ? 0.2639 0.8922 0.4251 0.0146  -0.0003 -0.1195 55  ARG A CD  
414  N NE  . ARG A 55  ? 0.3136 0.9301 0.4661 0.0280  -0.0042 -0.1142 55  ARG A NE  
415  C CZ  . ARG A 55  ? 0.3106 0.9198 0.4569 0.0376  -0.0086 -0.1123 55  ARG A CZ  
416  N NH1 . ARG A 55  ? 0.2171 0.8307 0.3646 0.0357  -0.0100 -0.1156 55  ARG A NH1 
417  N NH2 . ARG A 55  ? 0.3363 0.9342 0.4752 0.0490  -0.0115 -0.1073 55  ARG A NH2 
418  N N   . ALA A 56  ? 0.3132 0.9222 0.5002 -0.0438 0.0209  -0.1132 56  ALA A N   
419  C CA  . ALA A 56  ? 0.2779 0.8944 0.4744 -0.0588 0.0265  -0.1172 56  ALA A CA  
420  C C   . ALA A 56  ? 0.3213 0.9251 0.5184 -0.0677 0.0325  -0.1090 56  ALA A C   
421  O O   . ALA A 56  ? 0.2636 0.8761 0.4676 -0.0795 0.0382  -0.1115 56  ALA A O   
422  C CB  . ALA A 56  ? 0.2621 0.8732 0.4620 -0.0639 0.0258  -0.1191 56  ALA A CB  
423  N N   . ALA A 57  ? 0.2274 0.8110 0.4170 -0.0618 0.0314  -0.0993 57  ALA A N   
424  C CA  . ALA A 57  ? 0.2512 0.8222 0.4398 -0.0681 0.0366  -0.0912 57  ALA A CA  
425  C C   . ALA A 57  ? 0.2889 0.8675 0.4741 -0.0624 0.0369  -0.0905 57  ALA A C   
426  O O   . ALA A 57  ? 0.3282 0.8988 0.5117 -0.0663 0.0410  -0.0842 57  ALA A O   
427  C CB  . ALA A 57  ? 0.3072 0.8528 0.4897 -0.0652 0.0354  -0.0818 57  ALA A CB  
428  N N   . GLY A 58  ? 0.2173 0.8106 0.4010 -0.0526 0.0323  -0.0969 58  GLY A N   
429  C CA  . GLY A 58  ? 0.2244 0.8292 0.4065 -0.0481 0.0326  -0.0987 58  GLY A CA  
430  C C   . GLY A 58  ? 0.2537 0.8485 0.4271 -0.0344 0.0283  -0.0941 58  GLY A C   
431  O O   . GLY A 58  ? 0.2149 0.8165 0.3869 -0.0314 0.0291  -0.0946 58  GLY A O   
432  N N   . HIS A 59  ? 0.2199 0.7987 0.3877 -0.0265 0.0241  -0.0898 59  HIS A N   
433  C CA  . HIS A 59  ? 0.1984 0.7656 0.3579 -0.0138 0.0202  -0.0853 59  HIS A CA  
434  C C   . HIS A 59  ? 0.2016 0.7814 0.3591 -0.0023 0.0146  -0.0919 59  HIS A C   
435  O O   . HIS A 59  ? 0.2206 0.8158 0.3824 -0.0038 0.0132  -0.0994 59  HIS A O   
436  C CB  . HIS A 59  ? 0.1889 0.7310 0.3428 -0.0116 0.0191  -0.0767 59  HIS A CB  
437  C CG  . HIS A 59  ? 0.1864 0.7156 0.3418 -0.0219 0.0243  -0.0703 59  HIS A CG  
438  N ND1 . HIS A 59  ? 0.1840 0.7040 0.3362 -0.0219 0.0270  -0.0645 59  HIS A ND1 
439  C CD2 . HIS A 59  ? 0.1872 0.7118 0.3470 -0.0325 0.0274  -0.0692 59  HIS A CD2 
440  C CE1 . HIS A 59  ? 0.2263 0.7365 0.3804 -0.0317 0.0315  -0.0597 59  HIS A CE1 
441  N NE2 . HIS A 59  ? 0.2377 0.7499 0.3965 -0.0384 0.0319  -0.0623 59  HIS A NE2 
442  N N   . PRO A 60  ? 0.1991 0.7728 0.3503 0.0092  0.0113  -0.0896 60  PRO A N   
443  C CA  . PRO A 60  ? 0.2036 0.7883 0.3526 0.0207  0.0060  -0.0956 60  PRO A CA  
444  C C   . PRO A 60  ? 0.2017 0.7802 0.3478 0.0252  0.0023  -0.0952 60  PRO A C   
445  O O   . PRO A 60  ? 0.2770 0.8712 0.4255 0.0272  -0.0002 -0.1026 60  PRO A O   
446  C CB  . PRO A 60  ? 0.2012 0.7757 0.3440 0.0311  0.0040  -0.0916 60  PRO A CB  
447  C CG  . PRO A 60  ? 0.2033 0.7706 0.3469 0.0239  0.0088  -0.0867 60  PRO A CG  
448  C CD  . PRO A 60  ? 0.2245 0.7837 0.3711 0.0122  0.0126  -0.0827 60  PRO A CD  
449  N N   . GLY A 61  ? 0.1936 0.7495 0.3343 0.0271  0.0019  -0.0868 61  GLY A N   
450  C CA  . GLY A 61  ? 0.1909 0.7383 0.3285 0.0296  -0.0008 -0.0851 61  GLY A CA  
451  C C   . GLY A 61  ? 0.1818 0.7063 0.3169 0.0243  0.0017  -0.0763 61  GLY A C   
452  O O   . GLY A 61  ? 0.1796 0.7001 0.3175 0.0165  0.0059  -0.0735 61  GLY A O   
453  N N   . ILE A 62  ? 0.1773 0.6877 0.3072 0.0285  -0.0006 -0.0722 62  ILE A N   
454  C CA  . ILE A 62  ? 0.1715 0.6601 0.2987 0.0244  0.0014  -0.0644 62  ILE A CA  
455  C C   . ILE A 62  ? 0.2168 0.6944 0.3420 0.0244  0.0040  -0.0592 62  ILE A C   
456  O O   . ILE A 62  ? 0.1679 0.6449 0.2896 0.0329  0.0024  -0.0587 62  ILE A O   
457  C CB  . ILE A 62  ? 0.1988 0.6735 0.3187 0.0322  -0.0020 -0.0605 62  ILE A CB  
458  C CG1 . ILE A 62  ? 0.2044 0.6876 0.3259 0.0306  -0.0041 -0.0648 62  ILE A CG1 
459  C CG2 . ILE A 62  ? 0.1566 0.6083 0.2727 0.0299  -0.0001 -0.0526 62  ILE A CG2 
460  C CD1 . ILE A 62  ? 0.2422 0.7176 0.3562 0.0400  -0.0080 -0.0624 62  ILE A CD1 
461  N N   . VAL A 63  ? 0.1857 0.6549 0.3134 0.0151  0.0080  -0.0556 63  VAL A N   
462  C CA  . VAL A 63  ? 0.1573 0.6145 0.2826 0.0147  0.0106  -0.0502 63  VAL A CA  
463  C C   . VAL A 63  ? 0.1494 0.5844 0.2704 0.0138  0.0111  -0.0435 63  VAL A C   
464  O O   . VAL A 63  ? 0.1475 0.5785 0.2697 0.0095  0.0109  -0.0433 63  VAL A O   
465  C CB  . VAL A 63  ? 0.1608 0.6273 0.2921 0.0048  0.0154  -0.0512 63  VAL A CB  
466  C CG1 . VAL A 63  ? 0.1683 0.6557 0.3028 0.0067  0.0152  -0.0576 63  VAL A CG1 
467  C CG2 . VAL A 63  ? 0.1623 0.6317 0.2995 -0.0064 0.0181  -0.0524 63  VAL A CG2 
468  N N   . ALA A 64  ? 0.1780 0.5991 0.2941 0.0182  0.0117  -0.0388 64  ALA A N   
469  C CA  . ALA A 64  ? 0.1383 0.5390 0.2505 0.0171  0.0125  -0.0330 64  ALA A CA  
470  C C   . ALA A 64  ? 0.1375 0.5359 0.2536 0.0068  0.0168  -0.0309 64  ALA A C   
471  O O   . ALA A 64  ? 0.1696 0.5781 0.2892 0.0024  0.0198  -0.0320 64  ALA A O   
472  C CB  . ALA A 64  ? 0.1351 0.5224 0.2412 0.0250  0.0117  -0.0295 64  ALA A CB  
473  N N   . PRO A 65  ? 0.1330 0.5185 0.2483 0.0030  0.0174  -0.0280 65  PRO A N   
474  C CA  . PRO A 65  ? 0.1985 0.5785 0.3164 -0.0059 0.0216  -0.0250 65  PRO A CA  
475  C C   . PRO A 65  ? 0.1319 0.5067 0.2467 -0.0038 0.0239  -0.0215 65  PRO A C   
476  O O   . PRO A 65  ? 0.1277 0.4917 0.2368 0.0040  0.0220  -0.0194 65  PRO A O   
477  C CB  . PRO A 65  ? 0.1269 0.4913 0.2424 -0.0065 0.0205  -0.0225 65  PRO A CB  
478  C CG  . PRO A 65  ? 0.1265 0.4943 0.2409 -0.0017 0.0164  -0.0257 65  PRO A CG  
479  C CD  . PRO A 65  ? 0.1288 0.5042 0.2405 0.0068  0.0143  -0.0273 65  PRO A CD  
480  N N   . PRO A 66  ? 0.1699 0.5530 0.2883 -0.0109 0.0280  -0.0211 66  PRO A N   
481  C CA  . PRO A 66  ? 0.1840 0.5633 0.2993 -0.0092 0.0304  -0.0179 66  PRO A CA  
482  C C   . PRO A 66  ? 0.1306 0.4904 0.2402 -0.0061 0.0302  -0.0132 66  PRO A C   
483  O O   . PRO A 66  ? 0.1282 0.4815 0.2330 0.0007  0.0294  -0.0118 66  PRO A O   
484  C CB  . PRO A 66  ? 0.1443 0.5335 0.2645 -0.0198 0.0357  -0.0173 66  PRO A CB  
485  C CG  . PRO A 66  ? 0.2190 0.6238 0.3457 -0.0244 0.0352  -0.0227 66  PRO A CG  
486  C CD  . PRO A 66  ? 0.1441 0.5427 0.2699 -0.0202 0.0307  -0.0244 66  PRO A CD  
487  N N   . ALA A 67  ? 0.1283 0.4793 0.2388 -0.0110 0.0309  -0.0114 67  ALA A N   
488  C CA  . ALA A 67  ? 0.1227 0.4564 0.2285 -0.0088 0.0309  -0.0076 67  ALA A CA  
489  C C   . ALA A 67  ? 0.1164 0.4389 0.2170 0.0007  0.0266  -0.0081 67  ALA A C   
490  O O   . ALA A 67  ? 0.1118 0.4199 0.2083 0.0032  0.0262  -0.0058 67  ALA A O   
491  C CB  . ALA A 67  ? 0.1750 0.5037 0.2838 -0.0169 0.0325  -0.0063 67  ALA A CB  
492  N N   . MET A 68  ? 0.1172 0.4464 0.2177 0.0059  0.0235  -0.0112 68  MET A N   
493  C CA  . MET A 68  ? 0.1132 0.4321 0.2085 0.0146  0.0202  -0.0112 68  MET A CA  
494  C C   . MET A 68  ? 0.1191 0.4348 0.2107 0.0211  0.0201  -0.0107 68  MET A C   
495  O O   . MET A 68  ? 0.1114 0.4174 0.1988 0.0279  0.0179  -0.0105 68  MET A O   
496  C CB  . MET A 68  ? 0.1572 0.4841 0.2534 0.0176  0.0169  -0.0144 68  MET A CB  
497  C CG  . MET A 68  ? 0.1128 0.4363 0.2098 0.0144  0.0157  -0.0149 68  MET A CG  
498  S SD  . MET A 68  ? 0.1147 0.4445 0.2100 0.0208  0.0114  -0.0178 68  MET A SD  
499  C CE  . MET A 68  ? 0.1106 0.4222 0.1983 0.0293  0.0100  -0.0147 68  MET A CE  
500  N N   . ILE A 69  ? 0.1170 0.4406 0.2101 0.0188  0.0226  -0.0104 69  ILE A N   
501  C CA  . ILE A 69  ? 0.1185 0.4427 0.2091 0.0250  0.0221  -0.0112 69  ILE A CA  
502  C C   . ILE A 69  ? 0.1585 0.4641 0.2436 0.0303  0.0212  -0.0092 69  ILE A C   
503  O O   . ILE A 69  ? 0.1139 0.4147 0.1965 0.0370  0.0192  -0.0104 69  ILE A O   
504  C CB  . ILE A 69  ? 0.1233 0.4595 0.2162 0.0211  0.0254  -0.0111 69  ILE A CB  
505  C CG1 . ILE A 69  ? 0.1546 0.4921 0.2451 0.0278  0.0244  -0.0126 69  ILE A CG1 
506  C CG2 . ILE A 69  ? 0.1225 0.4526 0.2145 0.0155  0.0288  -0.0073 69  ILE A CG2 
507  C CD1 . ILE A 69  ? 0.1493 0.4969 0.2415 0.0328  0.0216  -0.0167 69  ILE A CD1 
508  N N   . GLN A 70  ? 0.1149 0.4102 0.1984 0.0272  0.0228  -0.0066 70  GLN A N   
509  C CA  . GLN A 70  ? 0.1110 0.3895 0.1896 0.0315  0.0222  -0.0054 70  GLN A CA  
510  C C   . GLN A 70  ? 0.1078 0.3759 0.1844 0.0354  0.0195  -0.0061 70  GLN A C   
511  O O   . GLN A 70  ? 0.1064 0.3636 0.1794 0.0403  0.0185  -0.0062 70  GLN A O   
512  C CB  . GLN A 70  ? 0.1131 0.3853 0.1908 0.0271  0.0245  -0.0028 70  GLN A CB  
513  C CG  . GLN A 70  ? 0.2213 0.4796 0.2943 0.0311  0.0245  -0.0021 70  GLN A CG  
514  C CD  . GLN A 70  ? 0.2642 0.5194 0.3363 0.0272  0.0269  0.0004  70  GLN A CD  
515  O OE1 . GLN A 70  ? 0.2326 0.4975 0.3078 0.0212  0.0293  0.0021  70  GLN A OE1 
516  N NE2 . GLN A 70  ? 0.3222 0.5641 0.3903 0.0303  0.0265  0.0004  70  GLN A NE2 
517  N N   . VAL A 71  ? 0.1032 0.3763 0.1820 0.0330  0.0184  -0.0066 71  VAL A N   
518  C CA  . VAL A 71  ? 0.1010 0.3657 0.1775 0.0364  0.0160  -0.0069 71  VAL A CA  
519  C C   . VAL A 71  ? 0.1035 0.3675 0.1782 0.0437  0.0142  -0.0080 71  VAL A C   
520  O O   . VAL A 71  ? 0.1020 0.3546 0.1735 0.0476  0.0133  -0.0075 71  VAL A O   
521  C CB  . VAL A 71  ? 0.1015 0.3749 0.1809 0.0328  0.0149  -0.0078 71  VAL A CB  
522  C CG1 . VAL A 71  ? 0.1208 0.3876 0.1972 0.0367  0.0125  -0.0080 71  VAL A CG1 
523  C CG2 . VAL A 71  ? 0.1408 0.4136 0.2227 0.0254  0.0168  -0.0069 71  VAL A CG2 
524  N N   . TRP A 72  ? 0.1081 0.3851 0.1851 0.0456  0.0138  -0.0097 72  TRP A N   
525  C CA  . TRP A 72  ? 0.1902 0.4697 0.2657 0.0530  0.0118  -0.0111 72  TRP A CA  
526  C C   . TRP A 72  ? 0.1123 0.3806 0.1841 0.0577  0.0120  -0.0107 72  TRP A C   
527  O O   . TRP A 72  ? 0.1462 0.4087 0.2162 0.0633  0.0106  -0.0108 72  TRP A O   
528  C CB  . TRP A 72  ? 0.1179 0.4152 0.1967 0.0541  0.0113  -0.0139 72  TRP A CB  
529  C CG  . TRP A 72  ? 0.1188 0.4290 0.2017 0.0488  0.0114  -0.0151 72  TRP A CG  
530  C CD1 . TRP A 72  ? 0.1202 0.4420 0.2069 0.0426  0.0134  -0.0159 72  TRP A CD1 
531  C CD2 . TRP A 72  ? 0.1194 0.4339 0.2027 0.0488  0.0094  -0.0158 72  TRP A CD2 
532  N NE1 . TRP A 72  ? 0.1218 0.4548 0.2118 0.0385  0.0129  -0.0176 72  TRP A NE1 
533  C CE2 . TRP A 72  ? 0.1211 0.4500 0.2090 0.0424  0.0103  -0.0176 72  TRP A CE2 
534  C CE3 . TRP A 72  ? 0.1195 0.4278 0.1997 0.0536  0.0071  -0.0151 72  TRP A CE3 
535  C CZ2 . TRP A 72  ? 0.1224 0.4591 0.2120 0.0406  0.0087  -0.0193 72  TRP A CZ2 
536  C CZ3 . TRP A 72  ? 0.1209 0.4377 0.2021 0.0523  0.0055  -0.0164 72  TRP A CZ3 
537  C CH2 . TRP A 72  ? 0.1222 0.4530 0.2081 0.0459  0.0061  -0.0187 72  TRP A CH2 
538  N N   . THR A 73  ? 0.1107 0.3758 0.1816 0.0553  0.0139  -0.0102 73  THR A N   
539  C CA  . THR A 73  ? 0.1829 0.4394 0.2508 0.0594  0.0141  -0.0106 73  THR A CA  
540  C C   . THR A 73  ? 0.1605 0.4012 0.2255 0.0577  0.0150  -0.0092 73  THR A C   
541  O O   . THR A 73  ? 0.1322 0.3662 0.1950 0.0600  0.0155  -0.0099 73  THR A O   
542  C CB  . THR A 73  ? 0.1637 0.4297 0.2323 0.0593  0.0153  -0.0119 73  THR A CB  
543  O OG1 . THR A 73  ? 0.1123 0.3822 0.1822 0.0528  0.0173  -0.0103 73  THR A OG1 
544  C CG2 . THR A 73  ? 0.1202 0.4016 0.1916 0.0623  0.0141  -0.0144 73  THR A CG2 
545  N N   . MET A 74  ? 0.2229 0.3237 0.1910 0.0100  0.0654  0.0087  74  MET A N   
546  C CA  . MET A 74  ? 0.2624 0.3515 0.2412 0.0089  0.0613  0.0143  74  MET A CA  
547  C C   . MET A 74  ? 0.2409 0.3209 0.2321 0.0117  0.0593  0.0065  74  MET A C   
548  O O   . MET A 74  ? 0.2854 0.3563 0.2762 0.0152  0.0624  0.0018  74  MET A O   
549  C CB  . MET A 74  ? 0.2174 0.2963 0.2001 0.0069  0.0653  0.0258  74  MET A CB  
550  C CG  . MET A 74  ? 0.2217 0.3020 0.1856 0.0022  0.0658  0.0344  74  MET A CG  
551  S SD  . MET A 74  ? 0.2716 0.3500 0.2226 0.0017  0.0549  0.0362  74  MET A SD  
552  C CE  . MET A 74  ? 0.2828 0.3511 0.2528 0.0073  0.0509  0.0407  74  MET A CE  
553  N N   . MET A 75  ? 0.3202 0.4012 0.3187 0.0099  0.0536  0.0039  75  MET A N   
554  C CA  . MET A 75  ? 0.3909 0.4632 0.3973 0.0085  0.0520  -0.0047 75  MET A CA  
555  C C   . MET A 75  ? 0.4382 0.4932 0.4522 0.0049  0.0576  -0.0032 75  MET A C   
556  O O   . MET A 75  ? 0.4997 0.5381 0.5095 0.0029  0.0584  -0.0102 75  MET A O   
557  C CB  . MET A 75  ? 0.4336 0.5160 0.4482 0.0057  0.0453  -0.0085 75  MET A CB  
558  C CG  . MET A 75  ? 0.5200 0.6151 0.5252 0.0084  0.0388  -0.0128 75  MET A CG  
559  S SD  . MET A 75  ? 0.7450 0.8362 0.7399 0.0112  0.0378  -0.0240 75  MET A SD  
560  C CE  . MET A 75  ? 0.5840 0.6562 0.5858 0.0052  0.0387  -0.0314 75  MET A CE  
561  N N   . GLY A 76  ? 0.3270 0.3825 0.3489 0.0034  0.0612  0.0056  76  GLY A N   
562  C CA  . GLY A 76  ? 0.3646 0.4048 0.3935 -0.0013 0.0671  0.0070  76  GLY A CA  
563  C C   . GLY A 76  ? 0.3204 0.3656 0.3641 -0.0094 0.0662  0.0022  76  GLY A C   
564  O O   . GLY A 76  ? 0.3334 0.3950 0.3830 -0.0098 0.0601  -0.0030 76  GLY A O   
565  N N   . LEU A 77  ? 0.2772 0.3098 0.3261 -0.0165 0.0725  0.0024  77  LEU A N   
566  C CA  . LEU A 77  ? 0.3021 0.3446 0.3663 -0.0267 0.0735  -0.0041 77  LEU A CA  
567  C C   . LEU A 77  ? 0.4457 0.4900 0.5074 -0.0349 0.0706  -0.0168 77  LEU A C   
568  O O   . LEU A 77  ? 0.4375 0.4573 0.4823 -0.0397 0.0724  -0.0210 77  LEU A O   
569  C CB  . LEU A 77  ? 0.3165 0.3416 0.3819 -0.0354 0.0821  -0.0022 77  LEU A CB  
570  C CG  . LEU A 77  ? 0.3607 0.4024 0.4452 -0.0449 0.0851  -0.0068 77  LEU A CG  
571  C CD1 . LEU A 77  ? 0.3615 0.4318 0.4614 -0.0337 0.0787  -0.0033 77  LEU A CD1 
572  C CD2 . LEU A 77  ? 0.3881 0.4083 0.4693 -0.0517 0.0942  -0.0017 77  LEU A CD2 
573  N N   . GLY A 78  ? 0.4629 0.5346 0.5384 -0.0351 0.0648  -0.0234 78  GLY A N   
574  C CA  . GLY A 78  ? 0.5421 0.6201 0.6171 -0.0437 0.0622  -0.0363 78  GLY A CA  
575  C C   . GLY A 78  ? 0.5904 0.6588 0.6491 -0.0380 0.0571  -0.0376 78  GLY A C   
576  O O   . GLY A 78  ? 0.6653 0.7295 0.7181 -0.0467 0.0562  -0.0478 78  GLY A O   
577  N N   . GLY A 79  ? 0.5070 0.5732 0.5575 -0.0248 0.0541  -0.0284 79  GLY A N   
578  C CA  . GLY A 79  ? 0.4925 0.5544 0.5286 -0.0189 0.0494  -0.0310 79  GLY A CA  
579  C C   . GLY A 79  ? 0.4650 0.5501 0.5071 -0.0167 0.0415  -0.0368 79  GLY A C   
580  O O   . GLY A 79  ? 0.5027 0.6080 0.5571 -0.0137 0.0375  -0.0354 79  GLY A O   
581  N N   . VAL A 80  ? 0.4339 0.5144 0.4654 -0.0168 0.0379  -0.0437 80  VAL A N   
582  C CA  . VAL A 80  ? 0.4266 0.5274 0.4618 -0.0145 0.0301  -0.0496 80  VAL A CA  
583  C C   . VAL A 80  ? 0.4704 0.5710 0.4909 -0.0055 0.0260  -0.0479 80  VAL A C   
584  O O   . VAL A 80  ? 0.4462 0.5304 0.4531 -0.0039 0.0274  -0.0507 80  VAL A O   
585  C CB  . VAL A 80  ? 0.5212 0.6219 0.5589 -0.0261 0.0297  -0.0627 80  VAL A CB  
586  C CG1 . VAL A 80  ? 0.4693 0.5878 0.5074 -0.0224 0.0214  -0.0691 80  VAL A CG1 
587  C CG2 . VAL A 80  ? 0.4640 0.5774 0.5194 -0.0369 0.0334  -0.0679 80  VAL A CG2 
588  N N   . ARG A 81  ? 0.5777 0.6956 0.5983 0.0007  0.0201  -0.0444 81  ARG A N   
589  C CA  . ARG A 81  ? 0.6333 0.7552 0.6392 0.0064  0.0168  -0.0438 81  ARG A CA  
590  C C   . ARG A 81  ? 0.5634 0.6830 0.5640 0.0055  0.0137  -0.0546 81  ARG A C   
591  O O   . ARG A 81  ? 0.5491 0.6709 0.5572 0.0000  0.0113  -0.0622 81  ARG A O   
592  C CB  . ARG A 81  ? 0.7496 0.8855 0.7517 0.0102  0.0099  -0.0397 81  ARG A CB  
593  C CG  . ARG A 81  ? 0.8234 0.9561 0.8214 0.0125  0.0113  -0.0283 81  ARG A CG  
594  C CD  . ARG A 81  ? 0.8958 1.0228 0.8790 0.0121  0.0176  -0.0221 81  ARG A CD  
595  N NE  . ARG A 81  ? 0.9598 1.0802 0.9372 0.0121  0.0203  -0.0110 81  ARG A NE  
596  C CZ  . ARG A 81  ? 1.0061 1.1238 0.9643 0.0121  0.0163  -0.0043 81  ARG A CZ  
597  N NH1 . ARG A 81  ? 1.0309 1.1532 0.9747 0.0120  0.0096  -0.0074 81  ARG A NH1 
598  N NH2 . ARG A 81  ? 1.0126 1.1199 0.9627 0.0115  0.0188  0.0056  81  ARG A NH2 
599  N N   . PRO A 82  ? 0.4738 0.5907 0.4606 0.0107  0.0138  -0.0567 82  PRO A N   
600  C CA  . PRO A 82  ? 0.4935 0.6081 0.4724 0.0121  0.0093  -0.0674 82  PRO A CA  
601  C C   . PRO A 82  ? 0.4560 0.5888 0.4382 0.0111  0.0025  -0.0703 82  PRO A C   
602  O O   . PRO A 82  ? 0.4333 0.5786 0.4180 0.0117  0.0005  -0.0638 82  PRO A O   
603  C CB  . PRO A 82  ? 0.4590 0.5752 0.4240 0.0205  0.0100  -0.0698 82  PRO A CB  
604  C CG  . PRO A 82  ? 0.4769 0.6039 0.4427 0.0207  0.0146  -0.0599 82  PRO A CG  
605  C CD  . PRO A 82  ? 0.3948 0.5131 0.3728 0.0155  0.0179  -0.0514 82  PRO A CD  
606  N N   . LYS A 83  ? 0.5287 0.6593 0.5076 0.0100  -0.0016 -0.0801 83  LYS A N   
607  C CA  . LYS A 83  ? 0.5476 0.6945 0.5310 0.0086  -0.0083 -0.0842 83  LYS A CA  
608  C C   . LYS A 83  ? 0.5592 0.7211 0.5326 0.0141  -0.0121 -0.0815 83  LYS A C   
609  O O   . LYS A 83  ? 0.5474 0.7213 0.5217 0.0142  -0.0178 -0.0806 83  LYS A O   
610  C CB  . LYS A 83  ? 0.6193 0.7581 0.5993 0.0048  -0.0111 -0.0957 83  LYS A CB  
611  C CG  . LYS A 83  ? 0.7016 0.8581 0.6891 0.0022  -0.0176 -0.1016 83  LYS A CG  
612  C CD  . LYS A 83  ? 0.7127 0.8586 0.6948 -0.0041 -0.0193 -0.1131 83  LYS A CD  
613  C CE  . LYS A 83  ? 0.7011 0.8673 0.6945 -0.0086 -0.0246 -0.1203 83  LYS A CE  
614  N NZ  . LYS A 83  ? 0.7276 0.8823 0.7155 -0.0190 -0.0245 -0.1319 83  LYS A NZ  
615  N N   . ASP A 84  ? 0.4425 0.6039 0.4044 0.0182  -0.0091 -0.0815 84  ASP A N   
616  C CA  . ASP A 84  ? 0.4791 0.6567 0.4288 0.0197  -0.0111 -0.0815 84  ASP A CA  
617  C C   . ASP A 84  ? 0.3949 0.5763 0.3375 0.0168  -0.0078 -0.0705 84  ASP A C   
618  O O   . ASP A 84  ? 0.3703 0.5626 0.2977 0.0143  -0.0080 -0.0701 84  ASP A O   
619  C CB  . ASP A 84  ? 0.5130 0.6952 0.4531 0.0253  -0.0102 -0.0911 84  ASP A CB  
620  C CG  . ASP A 84  ? 0.5337 0.7103 0.4720 0.0290  -0.0039 -0.0898 84  ASP A CG  
621  O OD1 . ASP A 84  ? 0.5308 0.6956 0.4763 0.0263  0.0004  -0.0810 84  ASP A OD1 
622  O OD2 . ASP A 84  ? 0.5615 0.7478 0.4913 0.0357  -0.0038 -0.0991 84  ASP A OD2 
623  N N   . ASP A 85  ? 0.3888 0.5600 0.3395 0.0156  -0.0048 -0.0622 85  ASP A N   
624  C CA  . ASP A 85  ? 0.4093 0.5783 0.3503 0.0129  -0.0038 -0.0511 85  ASP A CA  
625  C C   . ASP A 85  ? 0.3392 0.5088 0.2732 0.0133  -0.0129 -0.0492 85  ASP A C   
626  O O   . ASP A 85  ? 0.3425 0.5118 0.2907 0.0164  -0.0181 -0.0517 85  ASP A O   
627  C CB  . ASP A 85  ? 0.3608 0.5186 0.3131 0.0132  0.0009  -0.0437 85  ASP A CB  
628  C CG  . ASP A 85  ? 0.4204 0.5719 0.3584 0.0108  0.0023  -0.0322 85  ASP A CG  
629  O OD1 . ASP A 85  ? 0.5069 0.6573 0.4251 0.0088  -0.0027 -0.0291 85  ASP A OD1 
630  O OD2 . ASP A 85  ? 0.5750 0.7192 0.5184 0.0104  0.0083  -0.0262 85  ASP A OD2 
631  N N   . PRO A 86  ? 0.2474 0.6648 0.3075 0.0045  -0.0016 -0.0305 86  PRO A N   
632  C CA  . PRO A 86  ? 0.3042 0.7191 0.3624 0.0024  -0.0069 -0.0322 86  PRO A CA  
633  C C   . PRO A 86  ? 0.3049 0.7111 0.3746 -0.0072 -0.0123 -0.0334 86  PRO A C   
634  O O   . PRO A 86  ? 0.3697 0.7713 0.4390 -0.0070 -0.0179 -0.0377 86  PRO A O   
635  C CB  . PRO A 86  ? 0.2712 0.7050 0.3255 0.0050  -0.0041 -0.0200 86  PRO A CB  
636  C CG  . PRO A 86  ? 0.2534 0.7023 0.3203 0.0007  -0.0008 -0.0117 86  PRO A CG  
637  C CD  . PRO A 86  ? 0.2334 0.6742 0.2971 0.0061  0.0012  -0.0193 86  PRO A CD  
638  N N   . LEU A 87  ? 0.3397 0.7430 0.4169 -0.0129 -0.0117 -0.0302 87  LEU A N   
639  C CA  . LEU A 87  ? 0.3309 0.7229 0.4147 -0.0186 -0.0154 -0.0310 87  LEU A CA  
640  C C   . LEU A 87  ? 0.2576 0.6395 0.3479 -0.0170 -0.0150 -0.0397 87  LEU A C   
641  O O   . LEU A 87  ? 0.2312 0.6112 0.3273 -0.0185 -0.0195 -0.0407 87  LEU A O   
642  C CB  . LEU A 87  ? 0.4199 0.8046 0.5040 -0.0208 -0.0151 -0.0293 87  LEU A CB  
643  C CG  . LEU A 87  ? 0.4242 0.7923 0.5091 -0.0226 -0.0172 -0.0305 87  LEU A CG  
644  C CD1 . LEU A 87  ? 0.4445 0.8116 0.5290 -0.0288 -0.0240 -0.0247 87  LEU A CD1 
645  C CD2 . LEU A 87  ? 0.4505 0.8052 0.5277 -0.0187 -0.0154 -0.0320 87  LEU A CD2 
646  N N   . GLY A 88  ? 0.2898 0.6654 0.3813 -0.0140 -0.0092 -0.0451 88  GLY A N   
647  C CA  . GLY A 88  ? 0.3125 0.6797 0.4174 -0.0152 -0.0076 -0.0526 88  GLY A CA  
648  C C   . GLY A 88  ? 0.2432 0.6170 0.3540 -0.0160 -0.0176 -0.0590 88  GLY A C   
649  O O   . GLY A 88  ? 0.2195 0.5958 0.3450 -0.0183 -0.0219 -0.0606 88  GLY A O   
650  N N   . PRO A 89  ? 0.2367 0.6132 0.3340 -0.0113 -0.0220 -0.0629 89  PRO A N   
651  C CA  . PRO A 89  ? 0.2435 0.6234 0.3396 -0.0086 -0.0341 -0.0710 89  PRO A CA  
652  C C   . PRO A 89  ? 0.2433 0.6322 0.3378 -0.0073 -0.0409 -0.0655 89  PRO A C   
653  O O   . PRO A 89  ? 0.2995 0.6916 0.4031 -0.0062 -0.0514 -0.0723 89  PRO A O   
654  C CB  . PRO A 89  ? 0.2916 0.6703 0.3623 0.0007  -0.0345 -0.0725 89  PRO A CB  
655  C CG  . PRO A 89  ? 0.3077 0.6797 0.3760 0.0009  -0.0231 -0.0702 89  PRO A CG  
656  C CD  . PRO A 89  ? 0.2393 0.6141 0.3201 -0.0055 -0.0159 -0.0613 89  PRO A CD  
657  N N   . ILE A 90  ? 0.2634 0.6557 0.3479 -0.0076 -0.0355 -0.0533 90  ILE A N   
658  C CA  . ILE A 90  ? 0.3060 0.7015 0.3842 -0.0056 -0.0400 -0.0461 90  ILE A CA  
659  C C   . ILE A 90  ? 0.3170 0.7088 0.4117 -0.0092 -0.0424 -0.0468 90  ILE A C   
660  O O   . ILE A 90  ? 0.2650 0.6588 0.3589 -0.0044 -0.0501 -0.0472 90  ILE A O   
661  C CB  . ILE A 90  ? 0.3076 0.7062 0.3748 -0.0075 -0.0330 -0.0320 90  ILE A CB  
662  C CG1 . ILE A 90  ? 0.3766 0.7760 0.4293 -0.0019 -0.0355 -0.0236 90  ILE A CG1 
663  C CG2 . ILE A 90  ? 0.4351 0.8279 0.5124 -0.0163 -0.0291 -0.0271 90  ILE A CG2 
664  C CD1 . ILE A 90  ? 0.3439 0.7477 0.3765 0.0108  -0.0378 -0.0261 90  ILE A CD1 
665  N N   . ILE A 91  ? 0.2212 0.6072 0.3283 -0.0144 -0.0353 -0.0467 91  ILE A N   
666  C CA  . ILE A 91  ? 0.2188 0.6012 0.3401 -0.0145 -0.0348 -0.0466 91  ILE A CA  
667  C C   . ILE A 91  ? 0.2196 0.6115 0.3631 -0.0132 -0.0407 -0.0561 91  ILE A C   
668  O O   . ILE A 91  ? 0.2642 0.6622 0.4172 -0.0091 -0.0468 -0.0565 91  ILE A O   
669  C CB  . ILE A 91  ? 0.2140 0.5856 0.3389 -0.0168 -0.0241 -0.0441 91  ILE A CB  
670  C CG1 . ILE A 91  ? 0.2716 0.6347 0.3781 -0.0188 -0.0230 -0.0368 91  ILE A CG1 
671  C CG2 . ILE A 91  ? 0.2156 0.5842 0.3547 -0.0134 -0.0208 -0.0436 91  ILE A CG2 
672  C CD1 . ILE A 91  ? 0.3135 0.6687 0.4110 -0.0184 -0.0280 -0.0308 91  ILE A CD1 
673  N N   . LYS A 92  ? 0.2194 0.6121 0.3723 -0.0166 -0.0396 -0.0640 92  LYS A N   
674  C CA  . LYS A 92  ? 0.2408 0.6418 0.4200 -0.0188 -0.0470 -0.0749 92  LYS A CA  
675  C C   . LYS A 92  ? 0.2631 0.6745 0.4367 -0.0124 -0.0649 -0.0812 92  LYS A C   
676  O O   . LYS A 92  ? 0.3009 0.7249 0.4987 -0.0116 -0.0743 -0.0869 92  LYS A O   
677  C CB  . LYS A 92  ? 0.3087 0.7013 0.4908 -0.0237 -0.0438 -0.0824 92  LYS A CB  
678  C CG  . LYS A 92  ? 0.3902 0.7879 0.6005 -0.0290 -0.0546 -0.0960 92  LYS A CG  
679  C CD  . LYS A 92  ? 0.4350 0.8356 0.6854 -0.0374 -0.0434 -0.0941 92  LYS A CD  
680  C CE  . LYS A 92  ? 0.4616 0.8643 0.7453 -0.0470 -0.0528 -0.1077 92  LYS A CE  
681  N NZ  . LYS A 92  ? 0.4760 0.8953 0.7678 -0.0444 -0.0778 -0.1200 92  LYS A NZ  
682  N N   . LEU A 93  ? 0.2448 0.6519 0.3862 -0.0061 -0.0689 -0.0795 93  LEU A N   
683  C CA  . LEU A 93  ? 0.2841 0.6967 0.4096 0.0045  -0.0843 -0.0836 93  LEU A CA  
684  C C   . LEU A 93  ? 0.3157 0.7349 0.4457 0.0099  -0.0880 -0.0772 93  LEU A C   
685  O O   . LEU A 93  ? 0.3186 0.7489 0.4598 0.0162  -0.1028 -0.0851 93  LEU A O   
686  C CB  . LEU A 93  ? 0.3218 0.7274 0.4093 0.0124  -0.0812 -0.0770 93  LEU A CB  
687  C CG  . LEU A 93  ? 0.3322 0.7390 0.3927 0.0274  -0.0926 -0.0767 93  LEU A CG  
688  C CD1 . LEU A 93  ? 0.3208 0.7295 0.3811 0.0343  -0.1119 -0.0953 93  LEU A CD1 
689  C CD2 . LEU A 93  ? 0.3112 0.7121 0.3380 0.0346  -0.0819 -0.0638 93  LEU A CD2 
690  N N   . PHE A 94  ? 0.2546 0.6658 0.3757 0.0083  -0.0760 -0.0637 94  PHE A N   
691  C CA  . PHE A 94  ? 0.2613 0.6715 0.3781 0.0155  -0.0784 -0.0563 94  PHE A CA  
692  C C   . PHE A 94  ? 0.2998 0.7191 0.4485 0.0150  -0.0782 -0.0591 94  PHE A C   
693  O O   . PHE A 94  ? 0.2769 0.7025 0.4282 0.0250  -0.0856 -0.0580 94  PHE A O   
694  C CB  . PHE A 94  ? 0.2786 0.6723 0.3735 0.0131  -0.0672 -0.0419 94  PHE A CB  
695  C CG  . PHE A 94  ? 0.2789 0.6677 0.3447 0.0180  -0.0672 -0.0345 94  PHE A CG  
696  C CD1 . PHE A 94  ? 0.3018 0.6886 0.3484 0.0313  -0.0746 -0.0309 94  PHE A CD1 
697  C CD2 . PHE A 94  ? 0.2745 0.6619 0.3317 0.0118  -0.0588 -0.0301 94  PHE A CD2 
698  C CE1 . PHE A 94  ? 0.3217 0.7028 0.3396 0.0381  -0.0712 -0.0217 94  PHE A CE1 
699  C CE2 . PHE A 94  ? 0.2916 0.6775 0.3248 0.0177  -0.0556 -0.0209 94  PHE A CE2 
700  C CZ  . PHE A 94  ? 0.3161 0.6976 0.3288 0.0308  -0.0606 -0.0160 94  PHE A CZ  
701  N N   . ASP A 95  ? 0.2613 0.6816 0.4334 0.0057  -0.0683 -0.0613 95  ASP A N   
702  C CA  . ASP A 95  ? 0.3236 0.7554 0.5301 0.0060  -0.0645 -0.0623 95  ASP A CA  
703  C C   . ASP A 95  ? 0.3865 0.8423 0.6221 0.0085  -0.0809 -0.0736 95  ASP A C   
704  O O   . ASP A 95  ? 0.3842 0.8553 0.6394 0.0163  -0.0856 -0.0727 95  ASP A O   
705  C CB  . ASP A 95  ? 0.3323 0.7591 0.5565 -0.0031 -0.0488 -0.0615 95  ASP A CB  
706  C CG  . ASP A 95  ? 0.3033 0.7097 0.5060 -0.0012 -0.0343 -0.0509 95  ASP A CG  
707  O OD1 . ASP A 95  ? 0.2607 0.6581 0.4436 0.0061  -0.0363 -0.0446 95  ASP A OD1 
708  O OD2 . ASP A 95  ? 0.3457 0.7427 0.5494 -0.0059 -0.0220 -0.0494 95  ASP A OD2 
709  N N   . ASP A 96  ? 0.4293 0.8877 0.6669 0.0029  -0.0908 -0.0849 96  ASP A N   
710  C CA  . ASP A 96  ? 0.4645 0.9431 0.7298 0.0033  -0.1107 -0.0993 96  ASP A CA  
711  C C   . ASP A 96  ? 0.4774 0.9646 0.7240 0.0196  -0.1288 -0.1010 96  ASP A C   
712  O O   . ASP A 96  ? 0.4620 0.9722 0.7377 0.0241  -0.1453 -0.1098 96  ASP A O   
713  C CB  . ASP A 96  ? 0.5057 0.9761 0.7660 -0.0041 -0.1189 -0.1123 96  ASP A CB  
714  C CG  . ASP A 96  ? 0.5348 0.9973 0.8192 -0.0192 -0.1028 -0.1121 96  ASP A CG  
715  O OD1 . ASP A 96  ? 0.5107 0.9812 0.8277 -0.0244 -0.0887 -0.1047 96  ASP A OD1 
716  O OD2 . ASP A 96  ? 0.5726 1.0190 0.8405 -0.0236 -0.1029 -0.1183 96  ASP A OD2 
717  N N   . ALA A 97  ? 0.4464 0.7870 0.6154 0.1496  -0.1386 -0.0879 97  ALA A N   
718  C CA  . ALA A 97  ? 0.4030 0.7386 0.5524 0.1576  -0.1513 -0.0853 97  ALA A CA  
719  C C   . ALA A 97  ? 0.3931 0.7229 0.5516 0.1590  -0.1531 -0.0796 97  ALA A C   
720  O O   . ALA A 97  ? 0.4670 0.7903 0.6103 0.1656  -0.1638 -0.0754 97  ALA A O   
721  C CB  . ALA A 97  ? 0.4307 0.7658 0.5431 0.1599  -0.1511 -0.0763 97  ALA A CB  
722  N N   . GLY A 98  ? 0.4210 0.7526 0.6034 0.1530  -0.1425 -0.0791 98  GLY A N   
723  C CA  . GLY A 98  ? 0.4265 0.7541 0.6214 0.1544  -0.1433 -0.0762 98  GLY A CA  
724  C C   . GLY A 98  ? 0.4512 0.7750 0.6321 0.1531  -0.1365 -0.0642 98  GLY A C   
725  O O   . GLY A 98  ? 0.4403 0.7606 0.6321 0.1545  -0.1365 -0.0622 98  GLY A O   
726  N N   . TYR A 99  ? 0.3939 0.7189 0.5514 0.1508  -0.1308 -0.0569 99  TYR A N   
727  C CA  . TYR A 99  ? 0.3590 0.6814 0.5029 0.1492  -0.1240 -0.0458 99  TYR A CA  
728  C C   . TYR A 99  ? 0.4061 0.7340 0.5675 0.1416  -0.1084 -0.0465 99  TYR A C   
729  O O   . TYR A 99  ? 0.3569 0.6886 0.5064 0.1371  -0.0987 -0.0417 99  TYR A O   
730  C CB  . TYR A 99  ? 0.3257 0.6480 0.4355 0.1497  -0.1243 -0.0371 99  TYR A CB  
731  C CG  . TYR A 99  ? 0.3579 0.6732 0.4451 0.1569  -0.1387 -0.0341 99  TYR A CG  
732  C CD1 . TYR A 99  ? 0.3255 0.6302 0.3987 0.1612  -0.1462 -0.0239 99  TYR A CD1 
733  C CD2 . TYR A 99  ? 0.3637 0.6822 0.4428 0.1595  -0.1450 -0.0410 99  TYR A CD2 
734  C CE1 . TYR A 99  ? 0.3958 0.6921 0.4459 0.1674  -0.1591 -0.0194 99  TYR A CE1 
735  C CE2 . TYR A 99  ? 0.3804 0.6923 0.4365 0.1661  -0.1576 -0.0379 99  TYR A CE2 
736  C CZ  . TYR A 99  ? 0.4084 0.7089 0.4493 0.1697  -0.1643 -0.0263 99  TYR A CZ  
737  O OH  . TYR A 99  ? 0.4919 0.7842 0.5078 0.1759  -0.1766 -0.0215 99  TYR A OH  
738  N N   . ILE A 100 ? 0.4142 0.7428 0.6030 0.1404  -0.1056 -0.0521 100 ILE A N   
739  C CA  . ILE A 100 ? 0.4284 0.7624 0.6358 0.1330  -0.0909 -0.0540 100 ILE A CA  
740  C C   . ILE A 100 ? 0.3667 0.7005 0.5669 0.1302  -0.0804 -0.0467 100 ILE A C   
741  O O   . ILE A 100 ? 0.3825 0.7200 0.5865 0.1239  -0.0676 -0.0455 100 ILE A O   
742  C CB  . ILE A 100 ? 0.3841 0.7204 0.6227 0.1324  -0.0905 -0.0622 100 ILE A CB  
743  C CG1 . ILE A 100 ? 0.4143 0.7464 0.6584 0.1378  -0.0962 -0.0621 100 ILE A CG1 
744  C CG2 . ILE A 100 ? 0.4060 0.7437 0.6539 0.1344  -0.1002 -0.0706 100 ILE A CG2 
745  C CD1 . ILE A 100 ? 0.4013 0.7369 0.6751 0.1380  -0.0962 -0.0709 100 ILE A CD1 
746  N N   . GLY A 101 ? 0.2892 0.6179 0.4790 0.1352  -0.0864 -0.0417 101 GLY A N   
747  C CA  . GLY A 101 ? 0.2819 0.6104 0.4653 0.1335  -0.0779 -0.0356 101 GLY A CA  
748  C C   . GLY A 101 ? 0.3288 0.6595 0.4870 0.1306  -0.0733 -0.0273 101 GLY A C   
749  O O   . GLY A 101 ? 0.2722 0.6031 0.4136 0.1318  -0.0791 -0.0250 101 GLY A O   
750  N N   . VAL A 102 ? 0.2753 0.6084 0.4307 0.1267  -0.0625 -0.0234 102 VAL A N   
751  C CA  . VAL A 102 ? 0.2192 0.5556 0.3530 0.1234  -0.0571 -0.0156 102 VAL A CA  
752  C C   . VAL A 102 ? 0.2740 0.6063 0.4035 0.1209  -0.0506 -0.0107 102 VAL A C   
753  O O   . VAL A 102 ? 0.2566 0.5911 0.4027 0.1211  -0.0452 -0.0154 102 VAL A O   
754  C CB  . VAL A 102 ? 0.1872 0.5282 0.3204 0.1169  -0.0470 -0.0178 102 VAL A CB  
755  C CG1 . VAL A 102 ? 0.2186 0.5598 0.3672 0.1122  -0.0352 -0.0211 102 VAL A CG1 
756  C CG2 . VAL A 102 ? 0.1854 0.5307 0.2962 0.1140  -0.0429 -0.0107 102 VAL A CG2 
757  N N   . VAL A 103 ? 0.2290 0.5529 0.3355 0.1175  -0.0506 -0.0019 103 VAL A N   
758  C CA  . VAL A 103 ? 0.2428 0.5607 0.3427 0.1125  -0.0432 0.0024  103 VAL A CA  
759  C C   . VAL A 103 ? 0.2477 0.5650 0.3252 0.1065  -0.0391 0.0101  103 VAL A C   
760  O O   . VAL A 103 ? 0.2224 0.5384 0.2850 0.1071  -0.0445 0.0147  103 VAL A O   
761  C CB  . VAL A 103 ? 0.2641 0.5678 0.3655 0.1151  -0.0500 0.0052  103 VAL A CB  
762  C CG1 . VAL A 103 ? 0.3318 0.6381 0.4579 0.1202  -0.0507 -0.0041 103 VAL A CG1 
763  C CG2 . VAL A 103 ? 0.2769 0.5704 0.3648 0.1187  -0.0624 0.0121  103 VAL A CG2 
764  N N   . ALA A 104 ? 0.2003 0.5200 0.2755 0.1011  -0.0293 0.0106  104 ALA A N   
765  C CA  . ALA A 104 ? 0.2033 0.5232 0.2605 0.0950  -0.0250 0.0169  104 ALA A CA  
766  C C   . ALA A 104 ? 0.2540 0.5599 0.3020 0.0924  -0.0287 0.0247  104 ALA A C   
767  O O   . ALA A 104 ? 0.2627 0.5598 0.3205 0.0939  -0.0309 0.0232  104 ALA A O   
768  C CB  . ALA A 104 ? 0.1893 0.5172 0.2489 0.0909  -0.0147 0.0138  104 ALA A CB  
769  N N   . THR A 105 ? 0.2322 0.5359 0.2620 0.0885  -0.0291 0.0328  105 THR A N   
770  C CA  . THR A 105 ? 0.2519 0.5408 0.2725 0.0850  -0.0323 0.0421  105 THR A CA  
771  C C   . THR A 105 ? 0.2537 0.5440 0.2653 0.0758  -0.0240 0.0471  105 THR A C   
772  O O   . THR A 105 ? 0.3149 0.5933 0.3275 0.0715  -0.0242 0.0519  105 THR A O   
773  C CB  . THR A 105 ? 0.3017 0.5832 0.3069 0.0881  -0.0412 0.0502  105 THR A CB  
774  O OG1 . THR A 105 ? 0.3210 0.6143 0.3106 0.0858  -0.0374 0.0522  105 THR A OG1 
775  C CG2 . THR A 105 ? 0.2732 0.5532 0.2892 0.0978  -0.0514 0.0445  105 THR A CG2 
776  N N   . ASN A 106 ? 0.2491 0.5541 0.2540 0.0730  -0.0173 0.0453  106 ASN A N   
777  C CA  . ASN A 106 ? 0.2866 0.5966 0.2841 0.0644  -0.0094 0.0489  106 ASN A CA  
778  C C   . ASN A 106 ? 0.3360 0.6632 0.3373 0.0640  -0.0024 0.0410  106 ASN A C   
779  O O   . ASN A 106 ? 0.3313 0.6676 0.3326 0.0689  -0.0034 0.0362  106 ASN A O   
780  C CB  . ASN A 106 ? 0.3090 0.6184 0.2872 0.0605  -0.0091 0.0589  106 ASN A CB  
781  C CG  . ASN A 106 ? 0.3635 0.6542 0.3342 0.0610  -0.0166 0.0692  106 ASN A CG  
782  O OD1 . ASN A 106 ? 0.3116 0.5972 0.2794 0.0685  -0.0254 0.0696  106 ASN A OD1 
783  N ND2 . ASN A 106 ? 0.4417 0.7217 0.4102 0.0531  -0.0139 0.0776  106 ASN A ND2 
784  N N   . CYS A 107 ? 0.2406 0.5716 0.2457 0.0582  0.0039  0.0395  107 CYS A N   
785  C CA  . CYS A 107 ? 0.2252 0.5717 0.2332 0.0579  0.0097  0.0325  107 CYS A CA  
786  C C   . CYS A 107 ? 0.2978 0.6501 0.3030 0.0497  0.0157  0.0346  107 CYS A C   
787  O O   . CYS A 107 ? 0.3470 0.6935 0.3591 0.0453  0.0168  0.0345  107 CYS A O   
788  C CB  . CYS A 107 ? 0.2584 0.6056 0.2791 0.0620  0.0102  0.0248  107 CYS A CB  
789  S SG  . CYS A 107 ? 0.4609 0.8244 0.4839 0.0628  0.0159  0.0175  107 CYS A SG  
790  N N   . GLU A 108 ? 0.2167 0.5813 0.2133 0.0475  0.0195  0.0354  108 GLU A N   
791  C CA  . GLU A 108 ? 0.3209 0.6941 0.3167 0.0394  0.0260  0.0367  108 GLU A CA  
792  C C   . GLU A 108 ? 0.2296 0.6213 0.2295 0.0411  0.0301  0.0278  108 GLU A C   
793  O O   . GLU A 108 ? 0.3091 0.7105 0.3032 0.0452  0.0301  0.0253  108 GLU A O   
794  C CB  . GLU A 108 ? 0.4342 0.8070 0.4158 0.0341  0.0283  0.0464  108 GLU A CB  
795  C CG  . GLU A 108 ? 0.5595 0.9442 0.5412 0.0249  0.0367  0.0478  108 GLU A CG  
796  C CD  . GLU A 108 ? 0.6596 1.0433 0.6254 0.0189  0.0404  0.0591  108 GLU A CD  
797  O OE1 . GLU A 108 ? 0.6809 1.0544 0.6335 0.0232  0.0351  0.0656  108 GLU A OE1 
798  O OE2 . GLU A 108 ? 0.7060 1.0996 0.6725 0.0099  0.0486  0.0614  108 GLU A OE2 
799  N N   . GLN A 109 ? 0.1922 0.5888 0.2023 0.0385  0.0325  0.0225  109 GLN A N   
800  C CA  . GLN A 109 ? 0.1801 0.5933 0.1946 0.0410  0.0350  0.0140  109 GLN A CA  
801  C C   . GLN A 109 ? 0.2478 0.6706 0.2653 0.0330  0.0397  0.0127  109 GLN A C   
802  O O   . GLN A 109 ? 0.1943 0.6159 0.2176 0.0259  0.0426  0.0155  109 GLN A O   
803  C CB  . GLN A 109 ? 0.1702 0.5771 0.1923 0.0456  0.0311  0.0073  109 GLN A CB  
804  C CG  . GLN A 109 ? 0.1859 0.5840 0.2074 0.0529  0.0275  0.0078  109 GLN A CG  
805  C CD  . GLN A 109 ? 0.2045 0.5935 0.2285 0.0568  0.0242  0.0022  109 GLN A CD  
806  O OE1 . GLN A 109 ? 0.1764 0.5668 0.2039 0.0551  0.0246  -0.0018 109 GLN A OE1 
807  N NE2 . GLN A 109 ? 0.2000 0.5808 0.2221 0.0621  0.0214  0.0019  109 GLN A NE2 
808  N N   . THR A 110 ? 0.1865 0.6124 0.2012 0.0337  0.0383  0.0077  110 THR A N   
809  C CA  . THR A 110 ? 0.2016 0.6372 0.2210 0.0270  0.0424  0.0045  110 THR A CA  
810  C C   . THR A 110 ? 0.2410 0.6767 0.2662 0.0312  0.0375  -0.0059 110 THR A C   
811  O O   . THR A 110 ? 0.1798 0.6109 0.2010 0.0384  0.0321  -0.0096 110 THR A O   
812  C CB  . THR A 110 ? 0.2035 0.6458 0.2139 0.0238  0.0463  0.0079  110 THR A CB  
813  O OG1 . THR A 110 ? 0.2146 0.6556 0.2165 0.0191  0.0512  0.0195  110 THR A OG1 
814  C CG2 . THR A 110 ? 0.3013 0.7547 0.3184 0.0171  0.0511  0.0035  110 THR A CG2 
815  N N   . TYR A 111 ? 0.2337 0.6755 0.2690 0.0269  0.0393  -0.0104 111 TYR A N   
816  C CA  . TYR A 111 ? 0.1809 0.6242 0.2211 0.0312  0.0345  -0.0200 111 TYR A CA  
817  C C   . TYR A 111 ? 0.2355 0.6922 0.2822 0.0264  0.0378  -0.0255 111 TYR A C   
818  O O   . TYR A 111 ? 0.2247 0.6903 0.2814 0.0183  0.0431  -0.0258 111 TYR A O   
819  C CB  . TYR A 111 ? 0.1745 0.6159 0.2220 0.0320  0.0323  -0.0232 111 TYR A CB  
820  C CG  . TYR A 111 ? 0.1712 0.6022 0.2149 0.0348  0.0314  -0.0176 111 TYR A CG  
821  C CD1 . TYR A 111 ? 0.1888 0.6082 0.2237 0.0426  0.0269  -0.0163 111 TYR A CD1 
822  C CD2 . TYR A 111 ? 0.1728 0.6070 0.2238 0.0294  0.0354  -0.0140 111 TYR A CD2 
823  C CE1 . TYR A 111 ? 0.1858 0.5969 0.2191 0.0452  0.0265  -0.0120 111 TYR A CE1 
824  C CE2 . TYR A 111 ? 0.2380 0.6645 0.2874 0.0329  0.0344  -0.0100 111 TYR A CE2 
825  C CZ  . TYR A 111 ? 0.1848 0.5996 0.2249 0.0409  0.0300  -0.0093 111 TYR A CZ  
826  O OH  . TYR A 111 ? 0.1639 0.5720 0.2041 0.0445  0.0294  -0.0063 111 TYR A OH  
827  N N   . HIS A 112 ? 0.2180 0.6770 0.2611 0.0311  0.0349  -0.0303 112 HIS A N   
828  C CA  . HIS A 112 ? 0.1932 0.6661 0.2428 0.0274  0.0382  -0.0365 112 HIS A CA  
829  C C   . HIS A 112 ? 0.1891 0.6683 0.2503 0.0280  0.0357  -0.0456 112 HIS A C   
830  O O   . HIS A 112 ? 0.2648 0.7567 0.3370 0.0214  0.0405  -0.0496 112 HIS A O   
831  C CB  . HIS A 112 ? 0.1929 0.6676 0.2362 0.0334  0.0352  -0.0402 112 HIS A CB  
832  C CG  . HIS A 112 ? 0.2759 0.7495 0.3093 0.0322  0.0383  -0.0333 112 HIS A CG  
833  N ND1 . HIS A 112 ? 0.3888 0.8685 0.4203 0.0236  0.0467  -0.0266 112 HIS A ND1 
834  C CD2 . HIS A 112 ? 0.3136 0.7817 0.3384 0.0387  0.0340  -0.0321 112 HIS A CD2 
835  C CE1 . HIS A 112 ? 0.3837 0.8615 0.4040 0.0255  0.0470  -0.0215 112 HIS A CE1 
836  N NE2 . HIS A 112 ? 0.3308 0.8024 0.3482 0.0348  0.0391  -0.0255 112 HIS A NE2 
837  N N   . ARG A 113 ? 0.1824 0.6534 0.2412 0.0359  0.0284  -0.0487 113 ARG A N   
838  C CA  . ARG A 113 ? 0.2033 0.6798 0.2711 0.0379  0.0248  -0.0571 113 ARG A CA  
839  C C   . ARG A 113 ? 0.1764 0.6415 0.2380 0.0450  0.0189  -0.0559 113 ARG A C   
840  O O   . ARG A 113 ? 0.1728 0.6256 0.2239 0.0488  0.0174  -0.0494 113 ARG A O   
841  C CB  . ARG A 113 ? 0.1839 0.6687 0.2551 0.0429  0.0213  -0.0665 113 ARG A CB  
842  C CG  . ARG A 113 ? 0.1816 0.6570 0.2422 0.0529  0.0152  -0.0667 113 ARG A CG  
843  C CD  . ARG A 113 ? 0.1851 0.6687 0.2512 0.0590  0.0106  -0.0774 113 ARG A CD  
844  N NE  . ARG A 113 ? 0.1851 0.6613 0.2437 0.0681  0.0057  -0.0783 113 ARG A NE  
845  C CZ  . ARG A 113 ? 0.2454 0.7127 0.2988 0.0765  0.0000  -0.0781 113 ARG A CZ  
846  N NH1 . ARG A 113 ? 0.2566 0.7216 0.3095 0.0776  -0.0019 -0.0773 113 ARG A NH1 
847  N NH2 . ARG A 113 ? 0.1994 0.6603 0.2483 0.0840  -0.0034 -0.0788 113 ARG A NH2 
848  N N   . TYR A 114 ? 0.1761 0.6463 0.2445 0.0469  0.0155  -0.0627 114 TYR A N   
849  C CA  . TYR A 114 ? 0.2479 0.7099 0.3091 0.0550  0.0097  -0.0629 114 TYR A CA  
850  C C   . TYR A 114 ? 0.1750 0.6331 0.2280 0.0647  0.0042  -0.0653 114 TYR A C   
851  O O   . TYR A 114 ? 0.2467 0.7124 0.3042 0.0662  0.0029  -0.0714 114 TYR A O   
852  C CB  . TYR A 114 ? 0.1852 0.6558 0.2560 0.0546  0.0072  -0.0705 114 TYR A CB  
853  C CG  . TYR A 114 ? 0.2139 0.6860 0.2930 0.0469  0.0113  -0.0680 114 TYR A CG  
854  C CD1 . TYR A 114 ? 0.2609 0.7383 0.3492 0.0364  0.0186  -0.0644 114 TYR A CD1 
855  C CD2 . TYR A 114 ? 0.1734 0.6428 0.2515 0.0504  0.0082  -0.0697 114 TYR A CD2 
856  C CE1 . TYR A 114 ? 0.2678 0.7472 0.3655 0.0292  0.0225  -0.0616 114 TYR A CE1 
857  C CE2 . TYR A 114 ? 0.1725 0.6442 0.2607 0.0439  0.0113  -0.0687 114 TYR A CE2 
858  C CZ  . TYR A 114 ? 0.1731 0.6497 0.2720 0.0331  0.0183  -0.0645 114 TYR A CZ  
859  O OH  . TYR A 114 ? 0.1730 0.6527 0.2840 0.0261  0.0215  -0.0629 114 TYR A OH  
860  N N   . LEU A 115 ? 0.1736 0.6208 0.2160 0.0714  0.0015  -0.0605 115 LEU A N   
861  C CA  . LEU A 115 ? 0.1985 0.6411 0.2335 0.0808  -0.0029 -0.0609 115 LEU A CA  
862  C C   . LEU A 115 ? 0.1810 0.6275 0.2140 0.0887  -0.0081 -0.0659 115 LEU A C   
863  O O   . LEU A 115 ? 0.1814 0.6310 0.2153 0.0879  -0.0086 -0.0675 115 LEU A O   
864  C CB  . LEU A 115 ? 0.1857 0.6146 0.2112 0.0833  -0.0018 -0.0516 115 LEU A CB  
865  C CG  . LEU A 115 ? 0.1695 0.5936 0.1954 0.0773  0.0022  -0.0466 115 LEU A CG  
866  C CD1 . LEU A 115 ? 0.2481 0.6599 0.2671 0.0812  0.0021  -0.0395 115 LEU A CD1 
867  C CD2 . LEU A 115 ? 0.2211 0.6535 0.2520 0.0760  0.0023  -0.0522 115 LEU A CD2 
868  N N   . LEU A 116 ? 0.2013 0.6476 0.2317 0.0971  -0.0124 -0.0687 116 LEU A N   
869  C CA  . LEU A 116 ? 0.2125 0.6624 0.2398 0.1062  -0.0181 -0.0732 116 LEU A CA  
870  C C   . LEU A 116 ? 0.1978 0.6377 0.2133 0.1154  -0.0195 -0.0653 116 LEU A C   
871  O O   . LEU A 116 ? 0.1961 0.6284 0.2104 0.1162  -0.0180 -0.0602 116 LEU A O   
872  C CB  . LEU A 116 ? 0.2646 0.7234 0.3009 0.1096  -0.0229 -0.0836 116 LEU A CB  
873  C CG  . LEU A 116 ? 0.2903 0.7613 0.3410 0.1006  -0.0208 -0.0918 116 LEU A CG  
874  C CD1 . LEU A 116 ? 0.3359 0.8146 0.3957 0.1043  -0.0245 -0.1011 116 LEU A CD1 
875  C CD2 . LEU A 116 ? 0.2658 0.7449 0.3224 0.0977  -0.0221 -0.0972 116 LEU A CD2 
876  N N   . PRO A 117 ? 0.2043 0.6450 0.2119 0.1224  -0.0223 -0.0643 117 PRO A N   
877  C CA  . PRO A 117 ? 0.2119 0.6451 0.2091 0.1324  -0.0241 -0.0563 117 PRO A CA  
878  C C   . PRO A 117 ? 0.2387 0.6671 0.2393 0.1382  -0.0283 -0.0568 117 PRO A C   
879  O O   . PRO A 117 ? 0.2659 0.6998 0.2739 0.1398  -0.0331 -0.0660 117 PRO A O   
880  C CB  . PRO A 117 ? 0.2230 0.6608 0.2126 0.1399  -0.0289 -0.0594 117 PRO A CB  
881  C CG  . PRO A 117 ? 0.2459 0.6919 0.2406 0.1319  -0.0263 -0.0654 117 PRO A CG  
882  C CD  . PRO A 117 ? 0.2295 0.6784 0.2379 0.1214  -0.0239 -0.0702 117 PRO A CD  
883  N N   . GLY A 118 ? 0.2183 0.6371 0.2156 0.1411  -0.0269 -0.0476 118 GLY A N   
884  C CA  . GLY A 118 ? 0.2243 0.6374 0.2267 0.1465  -0.0315 -0.0481 118 GLY A CA  
885  C C   . GLY A 118 ? 0.2144 0.6258 0.2262 0.1395  -0.0276 -0.0501 118 GLY A C   
886  O O   . GLY A 118 ? 0.2276 0.6318 0.2434 0.1435  -0.0298 -0.0477 118 GLY A O   
887  N N   . GLU A 119 ? 0.2281 0.6452 0.2431 0.1293  -0.0226 -0.0542 119 GLU A N   
888  C CA  . GLU A 119 ? 0.2434 0.6588 0.2642 0.1227  -0.0191 -0.0554 119 GLU A CA  
889  C C   . GLU A 119 ? 0.3585 0.7637 0.3760 0.1213  -0.0153 -0.0457 119 GLU A C   
890  O O   . GLU A 119 ? 0.2924 0.6949 0.3035 0.1201  -0.0123 -0.0388 119 GLU A O   
891  C CB  . GLU A 119 ? 0.2440 0.6677 0.2680 0.1124  -0.0153 -0.0600 119 GLU A CB  
892  C CG  . GLU A 119 ? 0.2802 0.7159 0.3117 0.1127  -0.0184 -0.0707 119 GLU A CG  
893  C CD  . GLU A 119 ? 0.3129 0.7578 0.3507 0.1023  -0.0140 -0.0747 119 GLU A CD  
894  O OE1 . GLU A 119 ? 0.2525 0.6989 0.2895 0.0958  -0.0109 -0.0717 119 GLU A OE1 
895  O OE2 . GLU A 119 ? 0.2842 0.7356 0.3288 0.1008  -0.0137 -0.0807 119 GLU A OE2 
896  N N   . GLN A 120 ? 0.2463 0.6465 0.2691 0.1221  -0.0156 -0.0461 120 GLN A N   
897  C CA  . GLN A 120 ? 0.2735 0.6646 0.2960 0.1208  -0.0125 -0.0382 120 GLN A CA  
898  C C   . GLN A 120 ? 0.1853 0.5764 0.2103 0.1132  -0.0093 -0.0409 120 GLN A C   
899  O O   . GLN A 120 ? 0.1867 0.5825 0.2162 0.1128  -0.0109 -0.0485 120 GLN A O   
900  C CB  . GLN A 120 ? 0.3634 0.7475 0.3916 0.1293  -0.0165 -0.0350 120 GLN A CB  
901  C CG  . GLN A 120 ? 0.3613 0.7374 0.3912 0.1287  -0.0130 -0.0257 120 GLN A CG  
902  C CD  . GLN A 120 ? 0.3397 0.7102 0.3737 0.1382  -0.0168 -0.0183 120 GLN A CD  
903  O OE1 . GLN A 120 ? 0.4573 0.8272 0.4923 0.1458  -0.0236 -0.0204 120 GLN A OE1 
904  N NE2 . GLN A 120 ? 0.4058 0.7719 0.4426 0.1381  -0.0130 -0.0090 120 GLN A NE2 
905  N N   . VAL A 121 ? 0.1918 0.5781 0.2132 0.1079  -0.0052 -0.0344 121 VAL A N   
906  C CA  . VAL A 121 ? 0.1721 0.5586 0.1932 0.1008  -0.0025 -0.0350 121 VAL A CA  
907  C C   . VAL A 121 ? 0.1715 0.5511 0.1972 0.1024  -0.0024 -0.0334 121 VAL A C   
908  O O   . VAL A 121 ? 0.1727 0.5457 0.2020 0.1065  -0.0026 -0.0284 121 VAL A O   
909  C CB  . VAL A 121 ? 0.3106 0.6955 0.3267 0.0947  0.0008  -0.0295 121 VAL A CB  
910  C CG1 . VAL A 121 ? 0.3458 0.7303 0.3618 0.0887  0.0030  -0.0284 121 VAL A CG1 
911  C CG2 . VAL A 121 ? 0.3100 0.7029 0.3246 0.0929  0.0002  -0.0326 121 VAL A CG2 
912  N N   . SER A 122 ? 0.1706 0.5535 0.1970 0.0994  -0.0023 -0.0376 122 SER A N   
913  C CA  . SER A 122 ? 0.1698 0.5478 0.2007 0.1003  -0.0025 -0.0373 122 SER A CA  
914  C C   . SER A 122 ? 0.1665 0.5465 0.1921 0.0944  0.0000  -0.0350 122 SER A C   
915  O O   . SER A 122 ? 0.2291 0.6162 0.2493 0.0900  0.0014  -0.0351 122 SER A O   
916  C CB  . SER A 122 ? 0.2472 0.6289 0.2841 0.1047  -0.0062 -0.0462 122 SER A CB  
917  O OG  . SER A 122 ? 0.3133 0.7063 0.3450 0.1016  -0.0056 -0.0521 122 SER A OG  
918  N N   . ILE A 123 ? 0.1748 0.5494 0.2038 0.0947  0.0002  -0.0328 123 ILE A N   
919  C CA  . ILE A 123 ? 0.1632 0.5403 0.1879 0.0909  0.0016  -0.0307 123 ILE A CA  
920  C C   . ILE A 123 ? 0.1828 0.5634 0.2107 0.0936  -0.0010 -0.0363 123 ILE A C   
921  O O   . ILE A 123 ? 0.1779 0.5527 0.2154 0.0973  -0.0034 -0.0389 123 ILE A O   
922  C CB  . ILE A 123 ? 0.1593 0.5279 0.1853 0.0887  0.0040  -0.0229 123 ILE A CB  
923  C CG1 . ILE A 123 ? 0.1596 0.5311 0.1825 0.0860  0.0047  -0.0208 123 ILE A CG1 
924  C CG2 . ILE A 123 ? 0.1733 0.5335 0.2097 0.0919  0.0036  -0.0213 123 ILE A CG2 
925  C CD1 . ILE A 123 ? 0.1552 0.5191 0.1805 0.0841  0.0070  -0.0145 123 ILE A CD1 
926  N N   . SER A 124 ? 0.1679 0.5593 0.1886 0.0921  -0.0008 -0.0382 124 SER A N   
927  C CA  . SER A 124 ? 0.1714 0.5690 0.1924 0.0952  -0.0035 -0.0434 124 SER A CA  
928  C C   . SER A 124 ? 0.1711 0.5741 0.1857 0.0931  -0.0022 -0.0380 124 SER A C   
929  O O   . SER A 124 ? 0.1825 0.5910 0.1907 0.0889  0.0008  -0.0325 124 SER A O   
930  C CB  . SER A 124 ? 0.2563 0.6672 0.2738 0.0978  -0.0052 -0.0525 124 SER A CB  
931  O OG  . SER A 124 ? 0.3171 0.7340 0.3354 0.1025  -0.0087 -0.0597 124 SER A OG  
932  N N   . ALA A 125 ? 0.1723 0.5743 0.1907 0.0964  -0.0051 -0.0399 125 ALA A N   
933  C CA  . ALA A 125 ? 0.1730 0.5803 0.1870 0.0962  -0.0051 -0.0349 125 ALA A CA  
934  C C   . ALA A 125 ? 0.1893 0.6107 0.1983 0.1015  -0.0090 -0.0412 125 ALA A C   
935  O O   . ALA A 125 ? 0.1850 0.6050 0.1995 0.1057  -0.0133 -0.0503 125 ALA A O   
936  C CB  . ALA A 125 ? 0.1867 0.5795 0.2111 0.0956  -0.0061 -0.0308 125 ALA A CB  
937  N N   . GLU A 126 ? 0.2032 0.6393 0.2024 0.1018  -0.0078 -0.0363 126 GLU A N   
938  C CA  . GLU A 126 ? 0.1935 0.6457 0.1849 0.1079  -0.0122 -0.0410 126 GLU A CA  
939  C C   . GLU A 126 ? 0.2011 0.6480 0.1840 0.1071  -0.0157 -0.0320 126 GLU A C   
940  O O   . GLU A 126 ? 0.1999 0.6387 0.1799 0.1015  -0.0114 -0.0220 126 GLU A O   
941  C CB  . GLU A 126 ? 0.2006 0.6723 0.1799 0.1074  -0.0076 -0.0434 126 GLU A CB  
942  C CG  . GLU A 126 ? 0.3452 0.8263 0.3187 0.1134  -0.0119 -0.0527 126 GLU A CG  
943  C CD  . GLU A 126 ? 0.4200 0.9104 0.3902 0.1100  -0.0079 -0.0545 126 GLU A CD  
944  O OE1 . GLU A 126 ? 0.4772 0.9756 0.4400 0.1138  -0.0095 -0.0602 126 GLU A OE1 
945  O OE2 . GLU A 126 ? 0.4061 0.8941 0.3804 0.1032  -0.0037 -0.0506 126 GLU A OE2 
946  N N   . LEU A 127 ? 0.2126 0.6581 0.1905 0.1123  -0.0236 -0.0363 127 LEU A N   
947  C CA  . LEU A 127 ? 0.2810 0.7171 0.2477 0.1121  -0.0281 -0.0281 127 LEU A CA  
948  C C   . LEU A 127 ? 0.3031 0.7424 0.2456 0.1082  -0.0229 -0.0199 127 LEU A C   
949  O O   . LEU A 127 ? 0.2873 0.7365 0.2223 0.1090  -0.0197 -0.0250 127 LEU A O   
950  C CB  . LEU A 127 ? 0.2742 0.7041 0.2454 0.1186  -0.0380 -0.0364 127 LEU A CB  
951  C CG  . LEU A 127 ? 0.3369 0.7534 0.3086 0.1200  -0.0455 -0.0310 127 LEU A CG  
952  C CD1 . LEU A 127 ? 0.3597 0.7665 0.3530 0.1172  -0.0441 -0.0284 127 LEU A CD1 
953  C CD2 . LEU A 127 ? 0.3279 0.7416 0.3012 0.1268  -0.0554 -0.0414 127 LEU A CD2 
954  N N   . GLY A 128 ? 0.3227 0.7523 0.2560 0.1035  -0.0215 -0.0070 128 GLY A N   
955  C CA  . GLY A 128 ? 0.3114 0.7390 0.2242 0.0982  -0.0161 0.0030  128 GLY A CA  
956  C C   . GLY A 128 ? 0.3439 0.7606 0.2421 0.1021  -0.0248 0.0082  128 GLY A C   
957  O O   . GLY A 128 ? 0.3315 0.7472 0.2343 0.1098  -0.0340 -0.0005 128 GLY A O   
958  N N   . ASP A 129 ? 0.3507 0.7579 0.2320 0.0970  -0.0227 0.0222  129 ASP A N   
959  C CA  . ASP A 129 ? 0.3361 0.7306 0.2016 0.1012  -0.0320 0.0289  129 ASP A CA  
960  C C   . ASP A 129 ? 0.3344 0.7189 0.2138 0.1079  -0.0442 0.0264  129 ASP A C   
961  O O   . ASP A 129 ? 0.3096 0.6913 0.2046 0.1062  -0.0441 0.0284  129 ASP A O   
962  C CB  . ASP A 129 ? 0.4045 0.7888 0.2502 0.0938  -0.0273 0.0464  129 ASP A CB  
963  C CG  . ASP A 129 ? 0.5225 0.9146 0.3523 0.0877  -0.0168 0.0493  129 ASP A CG  
964  O OD1 . ASP A 129 ? 0.5128 0.9168 0.3425 0.0917  -0.0163 0.0381  129 ASP A OD1 
965  O OD2 . ASP A 129 ? 0.6311 1.0180 0.4501 0.0789  -0.0092 0.0627  129 ASP A OD2 
966  N N   . VAL A 130 ? 0.3417 0.7216 0.2169 0.1155  -0.0548 0.0212  130 VAL A N   
967  C CA  . VAL A 130 ? 0.3386 0.7079 0.2277 0.1216  -0.0669 0.0189  130 VAL A CA  
968  C C   . VAL A 130 ? 0.3703 0.7251 0.2382 0.1248  -0.0759 0.0288  130 VAL A C   
969  O O   . VAL A 130 ? 0.3931 0.7482 0.2428 0.1281  -0.0792 0.0271  130 VAL A O   
970  C CB  . VAL A 130 ? 0.3260 0.7012 0.2351 0.1280  -0.0731 0.0019  130 VAL A CB  
971  C CG1 . VAL A 130 ? 0.3300 0.6940 0.2556 0.1334  -0.0850 -0.0010 130 VAL A CG1 
972  C CG2 . VAL A 130 ? 0.2975 0.6841 0.2269 0.1247  -0.0647 -0.0060 130 VAL A CG2 
973  N N   . VAL A 131 ? 0.4555 0.7974 0.3256 0.1243  -0.0802 0.0393  131 VAL A N   
974  C CA  . VAL A 131 ? 0.4648 0.7905 0.3126 0.1263  -0.0880 0.0522  131 VAL A CA  
975  C C   . VAL A 131 ? 0.4822 0.7956 0.3446 0.1343  -0.1028 0.0500  131 VAL A C   
976  O O   . VAL A 131 ? 0.4471 0.7595 0.3331 0.1344  -0.1034 0.0482  131 VAL A O   
977  C CB  . VAL A 131 ? 0.5089 0.8279 0.3419 0.1178  -0.0796 0.0701  131 VAL A CB  
978  C CG1 . VAL A 131 ? 0.5944 0.8934 0.4049 0.1200  -0.0885 0.0853  131 VAL A CG1 
979  C CG2 . VAL A 131 ? 0.5312 0.8628 0.3512 0.1093  -0.0644 0.0716  131 VAL A CG2 
980  N N   . GLY A 132 ? 0.4355 0.7398 0.2847 0.1410  -0.1146 0.0497  132 GLY A N   
981  C CA  . GLY A 132 ? 0.4401 0.7329 0.3044 0.1488  -0.1295 0.0462  132 GLY A CA  
982  C C   . GLY A 132 ? 0.5081 0.7960 0.3605 0.1565  -0.1425 0.0410  132 GLY A C   
983  O O   . GLY A 132 ? 0.5395 0.8332 0.3703 0.1562  -0.1398 0.0399  132 GLY A O   
984  N N   . PRO A 133 ? 0.5134 0.7914 0.3807 0.1637  -0.1567 0.0371  133 PRO A N   
985  C CA  . PRO A 133 ? 0.5361 0.8073 0.4299 0.1649  -0.1601 0.0375  133 PRO A CA  
986  C C   . PRO A 133 ? 0.5977 0.8515 0.4747 0.1640  -0.1626 0.0565  133 PRO A C   
987  O O   . PRO A 133 ? 0.6507 0.8923 0.4974 0.1652  -0.1680 0.0687  133 PRO A O   
988  C CB  . PRO A 133 ? 0.5050 0.7731 0.4181 0.1732  -0.1748 0.0253  133 PRO A CB  
989  C CG  . PRO A 133 ? 0.5779 0.8419 0.4620 0.1775  -0.1834 0.0276  133 PRO A CG  
990  C CD  . PRO A 133 ? 0.5659 0.8403 0.4264 0.1716  -0.1706 0.0303  133 PRO A CD  
991  N N   . LYS A 134 ? 0.6041 0.8561 0.5005 0.1621  -0.1585 0.0592  134 LYS A N   
992  C CA  . LYS A 134 ? 0.6467 0.8815 0.5315 0.1618  -0.1613 0.0766  134 LYS A CA  
993  C C   . LYS A 134 ? 0.6651 0.8917 0.5801 0.1682  -0.1703 0.0717  134 LYS A C   
994  O O   . LYS A 134 ? 0.6602 0.8986 0.6073 0.1691  -0.1679 0.0562  134 LYS A O   
995  C CB  . LYS A 134 ? 0.6695 0.9070 0.5460 0.1499  -0.1437 0.0865  134 LYS A CB  
996  C CG  . LYS A 134 ? 0.7174 0.9575 0.5565 0.1447  -0.1371 0.0988  134 LYS A CG  
997  C CD  . LYS A 134 ? 0.7177 0.9579 0.5544 0.1303  -0.1184 0.1069  134 LYS A CD  
998  C CE  . LYS A 134 ? 0.7211 0.9614 0.5203 0.1246  -0.1117 0.1219  134 LYS A CE  
999  N NZ  . LYS A 134 ? 0.8117 1.0298 0.5849 0.1287  -0.1230 0.1395  134 LYS A NZ  
1000 N N   . GLN A 135 ? 0.6710 0.8757 0.5763 0.1718  -0.1799 0.0848  135 GLN A N   
1001 C CA  . GLN A 135 ? 0.6357 0.8292 0.5699 0.1774  -0.1885 0.0796  135 GLN A CA  
1002 C C   . GLN A 135 ? 0.6268 0.8123 0.5748 0.1669  -0.1746 0.0831  135 GLN A C   
1003 O O   . GLN A 135 ? 0.6423 0.8134 0.5704 0.1588  -0.1684 0.0988  135 GLN A O   
1004 C CB  . GLN A 135 ? 0.6762 0.8467 0.5957 0.1866  -0.2071 0.0901  135 GLN A CB  
1005 C CG  . GLN A 135 ? 0.7261 0.8964 0.6241 0.1887  -0.2148 0.0900  135 GLN A CG  
1006 C CD  . GLN A 135 ? 0.7431 0.9317 0.6669 0.1915  -0.2165 0.0683  135 GLN A CD  
1007 O OE1 . GLN A 135 ? 0.7436 0.9349 0.7014 0.1958  -0.2210 0.0557  135 GLN A OE1 
1008 N NE2 . GLN A 135 ? 0.7276 0.9287 0.6360 0.1888  -0.2121 0.0636  135 GLN A NE2 
1009 N N   . THR A 136 ? 0.6330 0.8291 0.6155 0.1667  -0.1695 0.0681  136 THR A N   
1010 C CA  . THR A 136 ? 0.5869 0.7791 0.5841 0.1576  -0.1563 0.0681  136 THR A CA  
1011 C C   . THR A 136 ? 0.5776 0.7656 0.6076 0.1641  -0.1623 0.0573  136 THR A C   
1012 O O   . THR A 136 ? 0.5890 0.7819 0.6349 0.1748  -0.1745 0.0475  136 THR A O   
1013 C CB  . THR A 136 ? 0.4967 0.7101 0.5011 0.1486  -0.1385 0.0600  136 THR A CB  
1014 O OG1 . THR A 136 ? 0.4328 0.6629 0.4665 0.1536  -0.1385 0.0428  136 THR A OG1 
1015 C CG2 . THR A 136 ? 0.4872 0.7107 0.4646 0.1447  -0.1337 0.0654  136 THR A CG2 
1016 N N   . ALA A 137 ? 0.6029 0.7838 0.6445 0.1578  -0.1535 0.0577  137 ALA A N   
1017 C CA  . ALA A 137 ? 0.5724 0.7501 0.6448 0.1636  -0.1575 0.0465  137 ALA A CA  
1018 C C   . ALA A 137 ? 0.5408 0.7422 0.6410 0.1684  -0.1550 0.0280  137 ALA A C   
1019 O O   . ALA A 137 ? 0.5617 0.7642 0.6873 0.1772  -0.1632 0.0173  137 ALA A O   
1020 C CB  . ALA A 137 ? 0.5354 0.7059 0.6143 0.1550  -0.1462 0.0478  137 ALA A CB  
1021 N N   . LEU A 138 ? 0.4614 0.6817 0.5577 0.1625  -0.1436 0.0244  138 LEU A N   
1022 C CA  . LEU A 138 ? 0.4068 0.6490 0.5289 0.1650  -0.1391 0.0087  138 LEU A CA  
1023 C C   . LEU A 138 ? 0.4660 0.7165 0.5889 0.1729  -0.1513 0.0040  138 LEU A C   
1024 O O   . LEU A 138 ? 0.4878 0.7535 0.6329 0.1735  -0.1481 -0.0088 138 LEU A O   
1025 C CB  . LEU A 138 ? 0.3950 0.6520 0.5148 0.1547  -0.1209 0.0068  138 LEU A CB  
1026 C CG  . LEU A 138 ? 0.4411 0.6906 0.5538 0.1460  -0.1092 0.0126  138 LEU A CG  
1027 C CD1 . LEU A 138 ? 0.3433 0.6079 0.4521 0.1373  -0.0934 0.0108  138 LEU A CD1 
1028 C CD2 . LEU A 138 ? 0.4532 0.6987 0.5895 0.1493  -0.1092 0.0046  138 LEU A CD2 
1029 N N   . GLY A 139 ? 0.6013 0.7465 0.6758 0.2694  -0.1619 -0.0602 139 GLY A N   
1030 C CA  . GLY A 139 ? 0.5825 0.7404 0.6764 0.2598  -0.1647 -0.0509 139 GLY A CA  
1031 C C   . GLY A 139 ? 0.5683 0.7141 0.6494 0.2415  -0.1682 -0.0404 139 GLY A C   
1032 O O   . GLY A 139 ? 0.5956 0.7246 0.6543 0.2350  -0.1677 -0.0370 139 GLY A O   
1033 N N   . GLU A 140 ? 0.5617 0.7173 0.6563 0.2347  -0.1731 -0.0355 140 GLU A N   
1034 C CA  . GLU A 140 ? 0.5275 0.6756 0.6059 0.2215  -0.1769 -0.0291 140 GLU A CA  
1035 C C   . GLU A 140 ? 0.4621 0.6299 0.5476 0.2122  -0.1610 -0.0282 140 GLU A C   
1036 O O   . GLU A 140 ? 0.3670 0.5622 0.4837 0.2115  -0.1496 -0.0282 140 GLU A O   
1037 C CB  . GLU A 140 ? 0.5570 0.7093 0.6464 0.2197  -0.1888 -0.0288 140 GLU A CB  
1038 C CG  . GLU A 140 ? 0.6321 0.7767 0.6972 0.2115  -0.1947 -0.0262 140 GLU A CG  
1039 C CD  . GLU A 140 ? 0.7088 0.8553 0.7826 0.2124  -0.2090 -0.0300 140 GLU A CD  
1040 O OE1 . GLU A 140 ? 0.7115 0.8768 0.8214 0.2096  -0.2091 -0.0335 140 GLU A OE1 
1041 O OE2 . GLU A 140 ? 0.7658 0.8960 0.8115 0.2156  -0.2214 -0.0271 140 GLU A OE2 
1042 N N   . GLY A 141 ? 0.4836 0.6407 0.5421 0.2047  -0.1602 -0.0244 141 GLY A N   
1043 C CA  . GLY A 141 ? 0.4482 0.6210 0.5110 0.1970  -0.1463 -0.0247 141 GLY A CA  
1044 C C   . GLY A 141 ? 0.4577 0.6241 0.4911 0.1902  -0.1470 -0.0212 141 GLY A C   
1045 O O   . GLY A 141 ? 0.4456 0.5985 0.4527 0.1907  -0.1570 -0.0151 141 GLY A O   
1046 N N   . TRP A 142 ? 0.4056 0.5855 0.4440 0.1841  -0.1357 -0.0231 142 TRP A N   
1047 C CA  . TRP A 142 ? 0.3367 0.5175 0.3489 0.1797  -0.1332 -0.0216 142 TRP A CA  
1048 C C   . TRP A 142 ? 0.3719 0.5582 0.3785 0.1757  -0.1196 -0.0178 142 TRP A C   
1049 O O   . TRP A 142 ? 0.3238 0.5200 0.3526 0.1744  -0.1098 -0.0209 142 TRP A O   
1050 C CB  . TRP A 142 ? 0.3329 0.5213 0.3561 0.1778  -0.1371 -0.0311 142 TRP A CB  
1051 C CG  . TRP A 142 ? 0.3910 0.5718 0.4139 0.1827  -0.1539 -0.0369 142 TRP A CG  
1052 C CD1 . TRP A 142 ? 0.3903 0.5686 0.4376 0.1845  -0.1633 -0.0371 142 TRP A CD1 
1053 C CD2 . TRP A 142 ? 0.4252 0.6026 0.4217 0.1885  -0.1630 -0.0447 142 TRP A CD2 
1054 N NE1 . TRP A 142 ? 0.4499 0.6202 0.4877 0.1895  -0.1795 -0.0443 142 TRP A NE1 
1055 C CE2 . TRP A 142 ? 0.4609 0.6300 0.4658 0.1933  -0.1796 -0.0502 142 TRP A CE2 
1056 C CE3 . TRP A 142 ? 0.3893 0.5730 0.3549 0.1925  -0.1580 -0.0484 142 TRP A CE3 
1057 C CZ2 . TRP A 142 ? 0.5283 0.6921 0.5089 0.2030  -0.1924 -0.0608 142 TRP A CZ2 
1058 C CZ3 . TRP A 142 ? 0.4281 0.6105 0.3702 0.2039  -0.1686 -0.0589 142 TRP A CZ3 
1059 C CH2 . TRP A 142 ? 0.4964 0.6674 0.4445 0.2096  -0.1862 -0.0658 142 TRP A CH2 
1060 N N   . PHE A 143 ? 0.3352 0.5183 0.3135 0.1726  -0.1188 -0.0082 143 PHE A N   
1061 C CA  . PHE A 143 ? 0.3287 0.5178 0.3017 0.1674  -0.1080 -0.0037 143 PHE A CA  
1062 C C   . PHE A 143 ? 0.3448 0.5514 0.3135 0.1638  -0.0987 -0.0083 143 PHE A C   
1063 O O   . PHE A 143 ? 0.3218 0.5354 0.2716 0.1650  -0.1004 -0.0074 143 PHE A O   
1064 C CB  . PHE A 143 ? 0.3665 0.5436 0.3182 0.1618  -0.1138 0.0136  143 PHE A CB  
1065 C CG  . PHE A 143 ? 0.4092 0.5590 0.3667 0.1659  -0.1266 0.0149  143 PHE A CG  
1066 C CD1 . PHE A 143 ? 0.4474 0.5841 0.4001 0.1709  -0.1425 0.0204  143 PHE A CD1 
1067 C CD2 . PHE A 143 ? 0.3667 0.5030 0.3331 0.1675  -0.1249 0.0081  143 PHE A CD2 
1068 C CE1 . PHE A 143 ? 0.4549 0.5634 0.4138 0.1773  -0.1575 0.0190  143 PHE A CE1 
1069 C CE2 . PHE A 143 ? 0.3832 0.4929 0.3527 0.1772  -0.1409 0.0042  143 PHE A CE2 
1070 C CZ  . PHE A 143 ? 0.4390 0.5339 0.4060 0.1826  -0.1582 0.0094  143 PHE A CZ  
1071 N N   . ILE A 144 ? 0.2806 0.4947 0.2663 0.1614  -0.0891 -0.0138 144 ILE A N   
1072 C CA  . ILE A 144 ? 0.2699 0.4954 0.2566 0.1590  -0.0832 -0.0201 144 ILE A CA  
1073 C C   . ILE A 144 ? 0.2580 0.4924 0.2371 0.1538  -0.0721 -0.0144 144 ILE A C   
1074 O O   . ILE A 144 ? 0.2480 0.4773 0.2377 0.1504  -0.0652 -0.0128 144 ILE A O   
1075 C CB  . ILE A 144 ? 0.2571 0.4831 0.2764 0.1573  -0.0846 -0.0277 144 ILE A CB  
1076 C CG1 . ILE A 144 ? 0.2710 0.4893 0.3027 0.1607  -0.0991 -0.0326 144 ILE A CG1 
1077 C CG2 . ILE A 144 ? 0.2503 0.4812 0.2726 0.1546  -0.0827 -0.0337 144 ILE A CG2 
1078 C CD1 . ILE A 144 ? 0.2829 0.5065 0.3569 0.1561  -0.1008 -0.0298 144 ILE A CD1 
1079 N N   . ASN A 145 ? 0.2638 0.5101 0.2236 0.1528  -0.0684 -0.0122 145 ASN A N   
1080 C CA  . ASN A 145 ? 0.2562 0.5119 0.2116 0.1455  -0.0575 -0.0065 145 ASN A CA  
1081 C C   . ASN A 145 ? 0.2469 0.5118 0.2115 0.1488  -0.0542 -0.0187 145 ASN A C   
1082 O O   . ASN A 145 ? 0.2584 0.5237 0.2202 0.1561  -0.0599 -0.0304 145 ASN A O   
1083 C CB  . ASN A 145 ? 0.3526 0.6250 0.2856 0.1418  -0.0545 0.0092  145 ASN A CB  
1084 C CG  . ASN A 145 ? 0.4208 0.6792 0.3478 0.1350  -0.0616 0.0262  145 ASN A CG  
1085 O OD1 . ASN A 145 ? 0.4932 0.7321 0.4278 0.1247  -0.0637 0.0342  145 ASN A OD1 
1086 N ND2 . ASN A 145 ? 0.5037 0.7676 0.4169 0.1415  -0.0681 0.0307  145 ASN A ND2 
1087 N N   . GLN A 146 ? 0.2484 0.5128 0.2228 0.1422  -0.0458 -0.0170 146 GLN A N   
1088 C CA  . GLN A 146 ? 0.2555 0.5262 0.2388 0.1438  -0.0439 -0.0254 146 GLN A CA  
1089 C C   . GLN A 146 ? 0.2730 0.5563 0.2461 0.1388  -0.0343 -0.0193 146 GLN A C   
1090 O O   . GLN A 146 ? 0.2523 0.5296 0.2223 0.1293  -0.0290 -0.0091 146 GLN A O   
1091 C CB  . GLN A 146 ? 0.2860 0.5462 0.2954 0.1397  -0.0434 -0.0262 146 GLN A CB  
1092 C CG  . GLN A 146 ? 0.4439 0.7022 0.4657 0.1379  -0.0456 -0.0315 146 GLN A CG  
1093 C CD  . GLN A 146 ? 0.5172 0.7709 0.5711 0.1327  -0.0488 -0.0252 146 GLN A CD  
1094 O OE1 . GLN A 146 ? 0.5405 0.8004 0.6029 0.1281  -0.0393 -0.0161 146 GLN A OE1 
1095 N NE2 . GLN A 146 ? 0.5720 0.8186 0.6457 0.1335  -0.0630 -0.0277 146 GLN A NE2 
1096 N N   . HIS A 147 ? 0.2195 0.5155 0.1881 0.1448  -0.0340 -0.0273 147 HIS A N   
1097 C CA  . HIS A 147 ? 0.2458 0.5620 0.2080 0.1419  -0.0256 -0.0210 147 HIS A CA  
1098 C C   . HIS A 147 ? 0.2349 0.5434 0.2086 0.1414  -0.0248 -0.0298 147 HIS A C   
1099 O O   . HIS A 147 ? 0.2377 0.5370 0.2137 0.1490  -0.0326 -0.0437 147 HIS A O   
1100 C CB  . HIS A 147 ? 0.2329 0.5758 0.1769 0.1509  -0.0220 -0.0203 147 HIS A CB  
1101 C CG  . HIS A 147 ? 0.3207 0.6934 0.2640 0.1496  -0.0123 -0.0130 147 HIS A CG  
1102 N ND1 . HIS A 147 ? 0.3959 0.7805 0.3379 0.1628  -0.0112 -0.0284 147 HIS A ND1 
1103 C CD2 . HIS A 147 ? 0.3143 0.7063 0.2596 0.1363  -0.0057 0.0087  147 HIS A CD2 
1104 C CE1 . HIS A 147 ? 0.4105 0.8221 0.3588 0.1573  -0.0049 -0.0152 147 HIS A CE1 
1105 N NE2 . HIS A 147 ? 0.3520 0.7737 0.3031 0.1415  0.0006  0.0075  147 HIS A NE2 
1106 N N   . ILE A 148 ? 0.1956 0.5046 0.1762 0.1327  -0.0188 -0.0218 148 ILE A N   
1107 C CA  . ILE A 148 ? 0.2106 0.5100 0.2006 0.1302  -0.0180 -0.0260 148 ILE A CA  
1108 C C   . ILE A 148 ? 0.1989 0.5160 0.1832 0.1289  -0.0130 -0.0240 148 ILE A C   
1109 O O   . ILE A 148 ? 0.2460 0.5788 0.2280 0.1228  -0.0086 -0.0129 148 ILE A O   
1110 C CB  . ILE A 148 ? 0.1957 0.4833 0.1952 0.1243  -0.0146 -0.0192 148 ILE A CB  
1111 C CG1 . ILE A 148 ? 0.2243 0.5013 0.2326 0.1256  -0.0171 -0.0179 148 ILE A CG1 
1112 C CG2 . ILE A 148 ? 0.2322 0.5156 0.2391 0.1222  -0.0136 -0.0192 148 ILE A CG2 
1113 C CD1 . ILE A 148 ? 0.2692 0.5394 0.2882 0.1286  -0.0266 -0.0241 148 ILE A CD1 
1114 N N   . VAL A 149 ? 0.1884 0.5022 0.1739 0.1336  -0.0165 -0.0333 149 VAL A N   
1115 C CA  . VAL A 149 ? 0.1890 0.5194 0.1712 0.1327  -0.0127 -0.0316 149 VAL A CA  
1116 C C   . VAL A 149 ? 0.1844 0.4983 0.1774 0.1300  -0.0156 -0.0338 149 VAL A C   
1117 O O   . VAL A 149 ? 0.1997 0.4956 0.2028 0.1339  -0.0239 -0.0402 149 VAL A O   
1118 C CB  . VAL A 149 ? 0.2065 0.5570 0.1751 0.1461  -0.0152 -0.0412 149 VAL A CB  
1119 C CG1 . VAL A 149 ? 0.2380 0.6058 0.2066 0.1460  -0.0127 -0.0394 149 VAL A CG1 
1120 C CG2 . VAL A 149 ? 0.2291 0.6068 0.1852 0.1493  -0.0109 -0.0326 149 VAL A CG2 
1121 N N   . TRP A 150 ? 0.1779 0.5001 0.1725 0.1233  -0.0111 -0.0263 150 TRP A N   
1122 C CA  . TRP A 150 ? 0.1763 0.4893 0.1778 0.1227  -0.0137 -0.0272 150 TRP A CA  
1123 C C   . TRP A 150 ? 0.1824 0.5104 0.1828 0.1262  -0.0146 -0.0314 150 TRP A C   
1124 O O   . TRP A 150 ? 0.1827 0.5349 0.1806 0.1231  -0.0098 -0.0256 150 TRP A O   
1125 C CB  . TRP A 150 ? 0.1697 0.4806 0.1718 0.1168  -0.0110 -0.0187 150 TRP A CB  
1126 C CG  . TRP A 150 ? 0.1681 0.4664 0.1703 0.1175  -0.0096 -0.0149 150 TRP A CG  
1127 C CD1 . TRP A 150 ? 0.1694 0.4595 0.1786 0.1196  -0.0101 -0.0104 150 TRP A CD1 
1128 C CD2 . TRP A 150 ? 0.1696 0.4631 0.1654 0.1154  -0.0074 -0.0126 150 TRP A CD2 
1129 N NE1 . TRP A 150 ? 0.1696 0.4575 0.1777 0.1208  -0.0059 -0.0054 150 TRP A NE1 
1130 C CE2 . TRP A 150 ? 0.1710 0.4564 0.1685 0.1190  -0.0050 -0.0093 150 TRP A CE2 
1131 C CE3 . TRP A 150 ? 0.1927 0.4873 0.1824 0.1098  -0.0084 -0.0103 150 TRP A CE3 
1132 C CZ2 . TRP A 150 ? 0.1761 0.4543 0.1675 0.1206  -0.0034 -0.0086 150 TRP A CZ2 
1133 C CZ3 . TRP A 150 ? 0.1810 0.4609 0.1647 0.1094  -0.0096 -0.0089 150 TRP A CZ3 
1134 C CH2 . TRP A 150 ? 0.2219 0.4937 0.2054 0.1164  -0.0070 -0.0105 150 TRP A CH2 
1135 N N   . GLN A 151 ? 0.1888 0.5051 0.1954 0.1325  -0.0219 -0.0389 151 GLN A N   
1136 C CA  . GLN A 151 ? 0.1981 0.5268 0.2042 0.1390  -0.0244 -0.0456 151 GLN A CA  
1137 C C   . GLN A 151 ? 0.2099 0.5277 0.2257 0.1374  -0.0295 -0.0430 151 GLN A C   
1138 O O   . GLN A 151 ? 0.2231 0.5225 0.2468 0.1353  -0.0343 -0.0376 151 GLN A O   
1139 C CB  . GLN A 151 ? 0.2173 0.5429 0.2195 0.1547  -0.0337 -0.0624 151 GLN A CB  
1140 C CG  . GLN A 151 ? 0.2881 0.6271 0.2757 0.1607  -0.0308 -0.0665 151 GLN A CG  
1141 C CD  . GLN A 151 ? 0.3951 0.7291 0.3746 0.1810  -0.0440 -0.0882 151 GLN A CD  
1142 O OE1 . GLN A 151 ? 0.3970 0.7437 0.3697 0.1940  -0.0486 -0.0994 151 GLN A OE1 
1143 N NE2 . GLN A 151 ? 0.4825 0.7973 0.4632 0.1853  -0.0528 -0.0959 151 GLN A NE2 
1144 N N   . VAL A 152 ? 0.2001 0.5340 0.2166 0.1387  -0.0287 -0.0439 152 VAL A N   
1145 C CA  . VAL A 152 ? 0.2501 0.5740 0.2748 0.1415  -0.0368 -0.0449 152 VAL A CA  
1146 C C   . VAL A 152 ? 0.2955 0.6221 0.3215 0.1558  -0.0447 -0.0598 152 VAL A C   
1147 O O   . VAL A 152 ? 0.2923 0.6457 0.3138 0.1605  -0.0399 -0.0636 152 VAL A O   
1148 C CB  . VAL A 152 ? 0.2633 0.6014 0.2899 0.1343  -0.0339 -0.0371 152 VAL A CB  
1149 C CG1 . VAL A 152 ? 0.2991 0.6274 0.3321 0.1395  -0.0438 -0.0390 152 VAL A CG1 
1150 C CG2 . VAL A 152 ? 0.3211 0.6546 0.3428 0.1249  -0.0307 -0.0271 152 VAL A CG2 
1151 N N   . GLY A 153 ? 0.2185 0.5905 0.3036 0.1415  -0.0315 -0.0345 153 GLY A N   
1152 C CA  . GLY A 153 ? 0.2726 0.6418 0.3658 0.1527  -0.0397 -0.0473 153 GLY A CA  
1153 C C   . GLY A 153 ? 0.2427 0.6158 0.3204 0.1587  -0.0383 -0.0601 153 GLY A C   
1154 O O   . GLY A 153 ? 0.2870 0.6523 0.3635 0.1578  -0.0406 -0.0611 153 GLY A O   
1155 N N   . ASP A 154 ? 0.3073 0.6954 0.3727 0.1654  -0.0346 -0.0687 154 ASP A N   
1156 C CA  . ASP A 154 ? 0.3754 0.7734 0.4231 0.1737  -0.0330 -0.0792 154 ASP A CA  
1157 C C   . ASP A 154 ? 0.3481 0.7641 0.3781 0.1663  -0.0197 -0.0689 154 ASP A C   
1158 O O   . ASP A 154 ? 0.3321 0.7618 0.3465 0.1725  -0.0166 -0.0719 154 ASP A O   
1159 C CB  . ASP A 154 ? 0.4727 0.8783 0.5191 0.1889  -0.0393 -0.0956 154 ASP A CB  
1160 C CG  . ASP A 154 ? 0.5226 0.9071 0.5891 0.1979  -0.0561 -0.1089 154 ASP A CG  
1161 O OD1 . ASP A 154 ? 0.5572 0.9258 0.6311 0.1965  -0.0633 -0.1103 154 ASP A OD1 
1162 O OD2 . ASP A 154 ? 0.5941 0.9773 0.6720 0.2059  -0.0631 -0.1176 154 ASP A OD2 
1163 N N   . GLU A 155 ? 0.2421 0.6586 0.2765 0.1535  -0.0134 -0.0559 155 GLU A N   
1164 C CA  . GLU A 155 ? 0.2300 0.6596 0.2563 0.1444  -0.0033 -0.0454 155 GLU A CA  
1165 C C   . GLU A 155 ? 0.3057 0.7275 0.3280 0.1370  -0.0008 -0.0386 155 GLU A C   
1166 O O   . GLU A 155 ? 0.2194 0.6283 0.2483 0.1307  -0.0030 -0.0351 155 GLU A O   
1167 C CB  . GLU A 155 ? 0.2128 0.6474 0.2483 0.1356  -0.0001 -0.0386 155 GLU A CB  
1168 C CG  . GLU A 155 ? 0.2199 0.6650 0.2558 0.1250  0.0079  -0.0284 155 GLU A CG  
1169 C CD  . GLU A 155 ? 0.2005 0.6484 0.2478 0.1165  0.0081  -0.0247 155 GLU A CD  
1170 O OE1 . GLU A 155 ? 0.2946 0.7364 0.3459 0.1188  0.0026  -0.0279 155 GLU A OE1 
1171 O OE2 . GLU A 155 ? 0.2612 0.7187 0.3156 0.1080  0.0130  -0.0183 155 GLU A OE2 
1172 N N   . ASP A 156 ? 0.2982 0.7295 0.3099 0.1388  0.0036  -0.0356 156 ASP A N   
1173 C CA  . ASP A 156 ? 0.2529 0.6796 0.2616 0.1322  0.0069  -0.0280 156 ASP A CA  
1174 C C   . ASP A 156 ? 0.2672 0.6941 0.2859 0.1186  0.0120  -0.0183 156 ASP A C   
1175 O O   . ASP A 156 ? 0.2026 0.6431 0.2264 0.1143  0.0177  -0.0119 156 ASP A O   
1176 C CB  . ASP A 156 ? 0.2575 0.6985 0.2535 0.1389  0.0110  -0.0243 156 ASP A CB  
1177 C CG  . ASP A 156 ? 0.3134 0.7512 0.3078 0.1329  0.0150  -0.0147 156 ASP A CG  
1178 O OD1 . ASP A 156 ? 0.2434 0.6672 0.2455 0.1251  0.0135  -0.0141 156 ASP A OD1 
1179 O OD2 . ASP A 156 ? 0.2302 0.6807 0.2158 0.1370  0.0197  -0.0071 156 ASP A OD2 
1180 N N   . VAL A 157 ? 0.1903 0.6040 0.2140 0.1126  0.0094  -0.0178 157 VAL A N   
1181 C CA  . VAL A 157 ? 0.1831 0.5988 0.2159 0.1024  0.0119  -0.0129 157 VAL A CA  
1182 C C   . VAL A 157 ? 0.2529 0.6651 0.2881 0.0969  0.0141  -0.0087 157 VAL A C   
1183 O O   . VAL A 157 ? 0.2052 0.6233 0.2516 0.0898  0.0158  -0.0062 157 VAL A O   
1184 C CB  . VAL A 157 ? 0.2180 0.6272 0.2547 0.1011  0.0070  -0.0160 157 VAL A CB  
1185 C CG1 . VAL A 157 ? 0.1826 0.5969 0.2213 0.1059  0.0049  -0.0191 157 VAL A CG1 
1186 C CG2 . VAL A 157 ? 0.1756 0.5711 0.2097 0.1036  0.0032  -0.0167 157 VAL A CG2 
1187 N N   . ALA A 158 ? 0.1798 0.5839 0.2077 0.1012  0.0128  -0.0094 158 ALA A N   
1188 C CA  . ALA A 158 ? 0.1768 0.5781 0.2077 0.0977  0.0145  -0.0058 158 ALA A CA  
1189 C C   . ALA A 158 ? 0.1910 0.5871 0.2131 0.1048  0.0128  -0.0067 158 ALA A C   
1190 O O   . ALA A 158 ? 0.1838 0.5756 0.2001 0.1122  0.0081  -0.0128 158 ALA A O   
1191 C CB  . ALA A 158 ? 0.1699 0.5633 0.2066 0.0934  0.0111  -0.0091 158 ALA A CB  
1192 N N   . GLU A 159 ? 0.2236 0.6136 0.2449 0.1015  0.0141  -0.0013 159 GLU A N   
1193 C CA  . GLU A 159 ? 0.1936 0.5749 0.2055 0.1076  0.0104  -0.0025 159 GLU A CA  
1194 C C   . GLU A 159 ? 0.2143 0.5812 0.2293 0.1020  0.0090  0.0010  159 GLU A C   
1195 O O   . GLU A 159 ? 0.1900 0.5541 0.2142 0.0940  0.0109  0.0047  159 GLU A O   
1196 C CB  . GLU A 159 ? 0.3046 0.6993 0.3046 0.1155  0.0136  0.0017  159 GLU A CB  
1197 C CG  . GLU A 159 ? 0.2284 0.6309 0.2313 0.1092  0.0211  0.0164  159 GLU A CG  
1198 C CD  . GLU A 159 ? 0.3600 0.7747 0.3477 0.1185  0.0239  0.0240  159 GLU A CD  
1199 O OE1 . GLU A 159 ? 0.2472 0.6839 0.2268 0.1274  0.0283  0.0236  159 GLU A OE1 
1200 O OE2 . GLU A 159 ? 0.3219 0.7258 0.3056 0.1183  0.0214  0.0296  159 GLU A OE2 
1201 N N   . MET A 160 ? 0.1981 0.5557 0.2080 0.1071  0.0040  -0.0019 160 MET A N   
1202 C CA  . MET A 160 ? 0.1999 0.5445 0.2132 0.1039  0.0018  0.0004  160 MET A CA  
1203 C C   . MET A 160 ? 0.2474 0.5897 0.2506 0.1114  -0.0021 0.0020  160 MET A C   
1204 O O   . MET A 160 ? 0.2469 0.5918 0.2445 0.1196  -0.0072 -0.0051 160 MET A O   
1205 C CB  . MET A 160 ? 0.1993 0.5366 0.2214 0.1025  -0.0013 -0.0059 160 MET A CB  
1206 C CG  . MET A 160 ? 0.1932 0.5194 0.2191 0.1023  -0.0043 -0.0056 160 MET A CG  
1207 S SD  . MET A 160 ? 0.2494 0.5753 0.2864 0.1013  -0.0045 -0.0106 160 MET A SD  
1208 C CE  . MET A 160 ? 0.3157 0.6460 0.3581 0.1053  -0.0077 -0.0115 160 MET A CE  
1209 N N   . ASN A 161 ? 0.2172 0.5553 0.2191 0.1094  -0.0009 0.0112  161 ASN A N   
1210 C CA  . ASN A 161 ? 0.2288 0.5638 0.2210 0.1171  -0.0060 0.0129  161 ASN A CA  
1211 C C   . ASN A 161 ? 0.2621 0.5813 0.2647 0.1136  -0.0102 0.0119  161 ASN A C   
1212 O O   . ASN A 161 ? 0.2813 0.5935 0.2936 0.1067  -0.0080 0.0178  161 ASN A O   
1213 C CB  . ASN A 161 ? 0.3482 0.6943 0.3292 0.1205  -0.0015 0.0273  161 ASN A CB  
1214 C CG  . ASN A 161 ? 0.3830 0.7336 0.3468 0.1336  -0.0077 0.0258  161 ASN A CG  
1215 O OD1 . ASN A 161 ? 0.5556 0.8945 0.5207 0.1353  -0.0142 0.0260  161 ASN A OD1 
1216 N ND2 . ASN A 161 ? 0.5185 0.8876 0.4663 0.1445  -0.0070 0.0224  161 ASN A ND2 
1217 N N   . TRP A 162 ? 0.2298 0.5437 0.2346 0.1185  -0.0172 0.0032  162 TRP A N   
1218 C CA  . TRP A 162 ? 0.2425 0.5449 0.2581 0.1164  -0.0204 0.0025  162 TRP A CA  
1219 C C   . TRP A 162 ? 0.2304 0.5291 0.2425 0.1244  -0.0290 0.0010  162 TRP A C   
1220 O O   . TRP A 162 ? 0.2369 0.5417 0.2394 0.1324  -0.0345 -0.0032 162 TRP A O   
1221 C CB  . TRP A 162 ? 0.3155 0.6175 0.3449 0.1126  -0.0192 -0.0049 162 TRP A CB  
1222 C CG  . TRP A 162 ? 0.3322 0.6375 0.3681 0.1161  -0.0237 -0.0111 162 TRP A CG  
1223 C CD1 . TRP A 162 ? 0.4319 0.7427 0.4649 0.1192  -0.0262 -0.0146 162 TRP A CD1 
1224 C CD2 . TRP A 162 ? 0.4239 0.7279 0.4757 0.1168  -0.0270 -0.0139 162 TRP A CD2 
1225 N NE1 . TRP A 162 ? 0.4961 0.8063 0.5452 0.1208  -0.0324 -0.0191 162 TRP A NE1 
1226 C CE2 . TRP A 162 ? 0.4708 0.7784 0.5320 0.1188  -0.0320 -0.0173 162 TRP A CE2 
1227 C CE3 . TRP A 162 ? 0.4698 0.7715 0.5315 0.1165  -0.0265 -0.0138 162 TRP A CE3 
1228 C CZ2 . TRP A 162 ? 0.5094 0.8188 0.5925 0.1188  -0.0359 -0.0176 162 TRP A CZ2 
1229 C CZ3 . TRP A 162 ? 0.4864 0.7928 0.5662 0.1178  -0.0288 -0.0150 162 TRP A CZ3 
1230 C CH2 . TRP A 162 ? 0.4972 0.8077 0.5889 0.1181  -0.0332 -0.0155 162 TRP A CH2 
1231 N N   . ARG A 163 ? 0.2337 0.5228 0.2540 0.1235  -0.0315 0.0034  163 ARG A N   
1232 C CA  . ARG A 163 ? 0.2459 0.5314 0.2625 0.1312  -0.0399 0.0045  163 ARG A CA  
1233 C C   . ARG A 163 ? 0.2393 0.5183 0.2740 0.1312  -0.0444 -0.0019 163 ARG A C   
1234 O O   . ARG A 163 ? 0.2329 0.5079 0.2793 0.1262  -0.0400 -0.0028 163 ARG A O   
1235 C CB  . ARG A 163 ? 0.2728 0.5550 0.2807 0.1321  -0.0387 0.0191  163 ARG A CB  
1236 C CG  . ARG A 163 ? 0.2799 0.5607 0.2799 0.1420  -0.0478 0.0228  163 ARG A CG  
1237 C CD  . ARG A 163 ? 0.3455 0.6253 0.3380 0.1425  -0.0452 0.0427  163 ARG A CD  
1238 N NE  . ARG A 163 ? 0.3866 0.6808 0.3656 0.1415  -0.0364 0.0530  163 ARG A NE  
1239 C CZ  . ARG A 163 ? 0.4139 0.7090 0.3969 0.1356  -0.0295 0.0724  163 ARG A CZ  
1240 N NH1 . ARG A 163 ? 0.4801 0.7592 0.4810 0.1302  -0.0319 0.0823  163 ARG A NH1 
1241 N NH2 . ARG A 163 ? 0.4471 0.7598 0.4199 0.1353  -0.0206 0.0820  163 ARG A NH2 
1242 N N   . ILE A 164 ? 0.2420 0.5223 0.2804 0.1378  -0.0537 -0.0078 164 ILE A N   
1243 C CA  . ILE A 164 ? 0.2378 0.5152 0.2957 0.1387  -0.0580 -0.0120 164 ILE A CA  
1244 C C   . ILE A 164 ? 0.2535 0.5268 0.3073 0.1472  -0.0688 -0.0107 164 ILE A C   
1245 O O   . ILE A 164 ? 0.2668 0.5432 0.3027 0.1540  -0.0744 -0.0092 164 ILE A O   
1246 C CB  . ILE A 164 ? 0.2250 0.5098 0.3020 0.1375  -0.0602 -0.0194 164 ILE A CB  
1247 C CG1 . ILE A 164 ? 0.2492 0.5365 0.3230 0.1434  -0.0711 -0.0257 164 ILE A CG1 
1248 C CG2 . ILE A 164 ? 0.2113 0.5019 0.2919 0.1301  -0.0494 -0.0184 164 ILE A CG2 
1249 C CD1 . ILE A 164 ? 0.2237 0.5137 0.3244 0.1409  -0.0765 -0.0315 164 ILE A CD1 
1250 N N   . LEU A 165 ? 0.2533 0.5225 0.3232 0.1484  -0.0717 -0.0117 165 LEU A N   
1251 C CA  . LEU A 165 ? 0.2669 0.5331 0.3386 0.1570  -0.0835 -0.0118 165 LEU A CA  
1252 C C   . LEU A 165 ? 0.2610 0.5342 0.3573 0.1587  -0.0906 -0.0216 165 LEU A C   
1253 O O   . LEU A 165 ? 0.2454 0.5228 0.3629 0.1546  -0.0849 -0.0235 165 LEU A O   
1254 C CB  . LEU A 165 ? 0.2759 0.5317 0.3518 0.1579  -0.0829 -0.0050 165 LEU A CB  
1255 C CG  . LEU A 165 ? 0.2898 0.5425 0.3715 0.1672  -0.0954 -0.0046 165 LEU A CG  
1256 C CD1 . LEU A 165 ? 0.3096 0.5641 0.3670 0.1755  -0.1035 0.0022  165 LEU A CD1 
1257 C CD2 . LEU A 165 ? 0.2972 0.5384 0.3905 0.1680  -0.0952 -0.0001 165 LEU A CD2 
1258 N N   . LYS A 166 ? 0.2682 0.5404 0.3617 0.1628  -0.1017 -0.0275 166 LYS A N   
1259 C CA  . LYS A 166 ? 0.2673 0.5381 0.3868 0.1604  -0.1091 -0.0348 166 LYS A CA  
1260 C C   . LYS A 166 ? 0.2838 0.5491 0.4029 0.1675  -0.1191 -0.0345 166 LYS A C   
1261 O O   . LYS A 166 ? 0.3031 0.5645 0.3981 0.1751  -0.1262 -0.0334 166 LYS A O   
1262 C CB  . LYS A 166 ? 0.2717 0.5412 0.3939 0.1591  -0.1169 -0.0436 166 LYS A CB  
1263 C CG  . LYS A 166 ? 0.2706 0.5447 0.3977 0.1522  -0.1085 -0.0433 166 LYS A CG  
1264 C CD  . LYS A 166 ? 0.2398 0.5205 0.4023 0.1436  -0.1026 -0.0394 166 LYS A CD  
1265 C CE  . LYS A 166 ? 0.2777 0.5564 0.4709 0.1418  -0.1149 -0.0441 166 LYS A CE  
1266 N NZ  . LYS A 166 ? 0.2782 0.5679 0.5069 0.1357  -0.1085 -0.0359 166 LYS A NZ  
1267 N N   . PHE A 167 ? 0.2783 0.5451 0.4229 0.1658  -0.1188 -0.0345 167 PHE A N   
1268 C CA  . PHE A 167 ? 0.3725 0.6340 0.5183 0.1728  -0.1271 -0.0331 167 PHE A CA  
1269 C C   . PHE A 167 ? 0.3947 0.6597 0.5724 0.1709  -0.1325 -0.0377 167 PHE A C   
1270 O O   . PHE A 167 ? 0.3173 0.5911 0.5208 0.1635  -0.1273 -0.0390 167 PHE A O   
1271 C CB  . PHE A 167 ? 0.3931 0.6522 0.5347 0.1761  -0.1205 -0.0257 167 PHE A CB  
1272 C CG  . PHE A 167 ? 0.4136 0.6804 0.5768 0.1712  -0.1088 -0.0277 167 PHE A CG  
1273 C CD1 . PHE A 167 ? 0.3854 0.6588 0.5443 0.1656  -0.0972 -0.0272 167 PHE A CD1 
1274 C CD2 . PHE A 167 ? 0.3917 0.6614 0.5781 0.1732  -0.1089 -0.0302 167 PHE A CD2 
1275 C CE1 . PHE A 167 ? 0.3890 0.6722 0.5637 0.1625  -0.0859 -0.0292 167 PHE A CE1 
1276 C CE2 . PHE A 167 ? 0.4053 0.6858 0.6080 0.1707  -0.0969 -0.0325 167 PHE A CE2 
1277 C CZ  . PHE A 167 ? 0.3889 0.6764 0.5844 0.1656  -0.0854 -0.0321 167 PHE A CZ  
1278 N N   . LYS A 168 ? 0.4152 0.6750 0.5917 0.1778  -0.1430 -0.0380 168 LYS A N   
1279 C CA  . LYS A 168 ? 0.4708 0.7351 0.6772 0.1776  -0.1482 -0.0409 168 LYS A CA  
1280 C C   . LYS A 168 ? 0.4344 0.7004 0.6523 0.1804  -0.1412 -0.0368 168 LYS A C   
1281 O O   . LYS A 168 ? 0.4308 0.6876 0.6334 0.1879  -0.1449 -0.0328 168 LYS A O   
1282 C CB  . LYS A 168 ? 0.4800 0.7385 0.6786 0.1847  -0.1646 -0.0452 168 LYS A CB  
1283 C CG  . LYS A 168 ? 0.5415 0.7989 0.7327 0.1842  -0.1742 -0.0543 168 LYS A CG  
1284 C CD  . LYS A 168 ? 0.5757 0.8290 0.7543 0.1940  -0.1907 -0.0604 168 LYS A CD  
1285 C CE  . LYS A 168 ? 0.5744 0.8263 0.7421 0.1965  -0.2013 -0.0735 168 LYS A CE  
1286 N NZ  . LYS A 168 ? 0.6240 0.8741 0.7718 0.2089  -0.2165 -0.0802 168 LYS A NZ  
1287 N N   . PRO A 169 ? 0.4243 0.7032 0.6700 0.1753  -0.1310 -0.0371 169 PRO A N   
1288 C CA  . PRO A 169 ? 0.4623 0.7461 0.7210 0.1793  -0.1237 -0.0366 169 PRO A CA  
1289 C C   . PRO A 169 ? 0.4871 0.7715 0.7631 0.1850  -0.1328 -0.0381 169 PRO A C   
1290 O O   . PRO A 169 ? 0.5189 0.7899 0.7801 0.1922  -0.1434 -0.0374 169 PRO A O   
1291 C CB  . PRO A 169 ? 0.4194 0.7220 0.6993 0.1725  -0.1090 -0.0352 169 PRO A CB  
1292 C CG  . PRO A 169 ? 0.4399 0.7482 0.7342 0.1649  -0.1136 -0.0333 169 PRO A CG  
1293 C CD  . PRO A 169 ? 0.4401 0.7315 0.7068 0.1662  -0.1255 -0.0367 169 PRO A CD  
1294 N N   . THR B 2   ? 0.8147 0.9930 0.7008 -0.4674 0.2311  -0.0456 2   THR B N   
1295 C CA  . THR B 2   ? 0.8300 0.9507 0.6888 -0.4696 0.2193  -0.0339 2   THR B CA  
1296 C C   . THR B 2   ? 0.8782 0.9624 0.6940 -0.4802 0.2299  -0.0237 2   THR B C   
1297 O O   . THR B 2   ? 0.8980 0.9990 0.7030 -0.4851 0.2459  -0.0263 2   THR B O   
1298 C CB  . THR B 2   ? 0.8040 0.9049 0.6595 -0.4563 0.2030  -0.0308 2   THR B CB  
1299 O OG1 . THR B 2   ? 0.8155 0.8666 0.6534 -0.4554 0.1906  -0.0185 2   THR B OG1 
1300 C CG2 . THR B 2   ? 0.8158 0.9110 0.6432 -0.4545 0.2093  -0.0287 2   THR B CG2 
1301 N N   . VAL B 3   ? 0.8992 0.9331 0.6900 -0.4822 0.2216  -0.0115 3   VAL B N   
1302 C CA  . VAL B 3   ? 0.9478 0.9435 0.6963 -0.4912 0.2298  -0.0005 3   VAL B CA  
1303 C C   . VAL B 3   ? 0.9584 0.9084 0.6754 -0.4840 0.2169  0.0141  3   VAL B C   
1304 O O   . VAL B 3   ? 0.9321 0.8715 0.6607 -0.4732 0.2008  0.0180  3   VAL B O   
1305 C CB  . VAL B 3   ? 0.9782 0.9533 0.7199 -0.5025 0.2350  0.0032  3   VAL B CB  
1306 C CG1 . VAL B 3   ? 0.9709 0.9911 0.7431 -0.5117 0.2450  -0.0095 3   VAL B CG1 
1307 C CG2 . VAL B 3   ? 0.9730 0.9116 0.7142 -0.4952 0.2206  0.0119  3   VAL B CG2 
1308 N N   . VAL B 4   ? 0.9992 0.9225 0.6758 -0.4897 0.2235  0.0229  4   VAL B N   
1309 C CA  . VAL B 4   ? 1.0182 0.8965 0.6609 -0.4841 0.2102  0.0397  4   VAL B CA  
1310 C C   . VAL B 4   ? 1.0251 0.8705 0.6693 -0.4803 0.2009  0.0513  4   VAL B C   
1311 O O   . VAL B 4   ? 1.0503 0.8844 0.6902 -0.4883 0.2106  0.0518  4   VAL B O   
1312 C CB  . VAL B 4   ? 1.0677 0.9218 0.6639 -0.4917 0.2193  0.0471  4   VAL B CB  
1313 C CG1 . VAL B 4   ? 1.0916 0.8995 0.6526 -0.4860 0.2030  0.0670  4   VAL B CG1 
1314 C CG2 . VAL B 4   ? 1.0643 0.9459 0.6546 -0.4924 0.2297  0.0364  4   VAL B CG2 
1315 N N   . GLY B 5   ? 1.0040 0.8344 0.6544 -0.4678 0.1829  0.0604  5   GLY B N   
1316 C CA  . GLY B 5   ? 1.0104 0.8096 0.6633 -0.4606 0.1753  0.0725  5   GLY B CA  
1317 C C   . GLY B 5   ? 0.9697 0.7869 0.6631 -0.4532 0.1702  0.0632  5   GLY B C   
1318 O O   . GLY B 5   ? 0.9702 0.7621 0.6684 -0.4442 0.1636  0.0726  5   GLY B O   
1319 N N   . ALA B 6   ? 0.9370 0.7974 0.6587 -0.4560 0.1739  0.0452  6   ALA B N   
1320 C CA  . ALA B 6   ? 0.8956 0.7765 0.6555 -0.4477 0.1665  0.0355  6   ALA B CA  
1321 C C   . ALA B 6   ? 0.8700 0.7371 0.6372 -0.4321 0.1482  0.0439  6   ALA B C   
1322 O O   . ALA B 6   ? 0.8648 0.7331 0.6206 -0.4294 0.1405  0.0480  6   ALA B O   
1323 C CB  . ALA B 6   ? 0.8663 0.7990 0.6536 -0.4514 0.1723  0.0167  6   ALA B CB  
1324 N N   . VAL B 7   ? 0.8622 0.7151 0.6465 -0.4224 0.1416  0.0467  7   VAL B N   
1325 C CA  . VAL B 7   ? 0.9271 0.7676 0.7220 -0.4067 0.1250  0.0551  7   VAL B CA  
1326 C C   . VAL B 7   ? 0.8561 0.7278 0.6878 -0.3986 0.1176  0.0395  7   VAL B C   
1327 O O   . VAL B 7   ? 0.8500 0.7358 0.7005 -0.4004 0.1232  0.0282  7   VAL B O   
1328 C CB  . VAL B 7   ? 0.9668 0.7658 0.7541 -0.3979 0.1235  0.0717  7   VAL B CB  
1329 C CG1 . VAL B 7   ? 0.9269 0.7185 0.7326 -0.3806 0.1077  0.0791  7   VAL B CG1 
1330 C CG2 . VAL B 7   ? 0.9681 0.7352 0.7184 -0.4023 0.1277  0.0898  7   VAL B CG2 
1331 N N   . LEU B 8   ? 0.8136 0.6953 0.6534 -0.3902 0.1041  0.0390  8   LEU B N   
1332 C CA  . LEU B 8   ? 0.7504 0.6591 0.6234 -0.3803 0.0958  0.0245  8   LEU B CA  
1333 C C   . LEU B 8   ? 0.7126 0.6000 0.6019 -0.3667 0.0885  0.0300  8   LEU B C   
1334 O O   . LEU B 8   ? 0.7518 0.6045 0.6272 -0.3623 0.0868  0.0473  8   LEU B O   
1335 C CB  . LEU B 8   ? 0.6933 0.6157 0.5664 -0.3760 0.0836  0.0219  8   LEU B CB  
1336 C CG  . LEU B 8   ? 0.8031 0.7374 0.6523 -0.3822 0.0877  0.0197  8   LEU B CG  
1337 C CD1 . LEU B 8   ? 0.7651 0.7186 0.6224 -0.3641 0.0735  0.0098  8   LEU B CD1 
1338 C CD2 . LEU B 8   ? 0.8213 0.7804 0.6697 -0.3987 0.1085  0.0087  8   LEU B CD2 
1339 N N   . PRO B 9   ? 0.7175 0.6253 0.6355 -0.3590 0.0848  0.0162  9   PRO B N   
1340 C CA  . PRO B 9   ? 0.7228 0.6092 0.6548 -0.3448 0.0780  0.0212  9   PRO B CA  
1341 C C   . PRO B 9   ? 0.7301 0.6030 0.6634 -0.3323 0.0635  0.0320  9   PRO B C   
1342 O O   . PRO B 9   ? 0.6766 0.5674 0.6099 -0.3320 0.0544  0.0279  9   PRO B O   
1343 C CB  . PRO B 9   ? 0.6995 0.6146 0.6588 -0.3400 0.0757  0.0033  9   PRO B CB  
1344 C CG  . PRO B 9   ? 0.7382 0.6927 0.7022 -0.3466 0.0769  -0.0097 9   PRO B CG  
1345 C CD  . PRO B 9   ? 0.7103 0.6603 0.6481 -0.3621 0.0878  -0.0030 9   PRO B CD  
1346 N N   . GLU B 10  ? 0.7574 0.5987 0.6905 -0.3226 0.0618  0.0466  10  GLU B N   
1347 C CA  . GLU B 10  ? 0.8125 0.6413 0.7495 -0.3102 0.0482  0.0598  10  GLU B CA  
1348 C C   . GLU B 10  ? 0.7836 0.6342 0.7467 -0.2987 0.0359  0.0462  10  GLU B C   
1349 O O   . GLU B 10  ? 0.7638 0.6299 0.7446 -0.2959 0.0391  0.0299  10  GLU B O   
1350 C CB  . GLU B 10  ? 0.8706 0.6632 0.8058 -0.3003 0.0530  0.0777  10  GLU B CB  
1351 C CG  . GLU B 10  ? 0.9552 0.7343 0.8938 -0.2873 0.0405  0.0967  10  GLU B CG  
1352 C CD  . GLU B 10  ? 1.0233 0.7690 0.9647 -0.2743 0.0488  0.1131  10  GLU B CD  
1353 O OE1 . GLU B 10  ? 1.0112 0.7540 0.9746 -0.2623 0.0495  0.1074  10  GLU B OE1 
1354 O OE2 . GLU B 10  ? 1.0619 0.7840 0.9829 -0.2749 0.0553  0.1319  10  GLU B OE2 
1355 N N   . LEU B 11  ? 0.6636 0.4694 0.6005 -0.1665 0.0284  0.0329  11  LEU B N   
1356 C CA  . LEU B 11  ? 0.5891 0.4049 0.5387 -0.1461 0.0192  0.0172  11  LEU B CA  
1357 C C   . LEU B 11  ? 0.5558 0.3443 0.4955 -0.1270 0.0120  0.0254  11  LEU B C   
1358 O O   . LEU B 11  ? 0.5592 0.3516 0.4868 -0.1207 0.0104  0.0359  11  LEU B O   
1359 C CB  . LEU B 11  ? 0.5126 0.3759 0.4775 -0.1398 0.0192  0.0035  11  LEU B CB  
1360 C CG  . LEU B 11  ? 0.4719 0.3409 0.4496 -0.1196 0.0065  -0.0067 11  LEU B CG  
1361 C CD1 . LEU B 11  ? 0.4635 0.3242 0.4493 -0.1243 -0.0016 -0.0132 11  LEU B CD1 
1362 C CD2 . LEU B 11  ? 0.4150 0.3245 0.4161 -0.1108 0.0049  -0.0198 11  LEU B CD2 
1363 N N   . LYS B 12  ? 0.5366 0.3007 0.4818 -0.1200 0.0082  0.0186  12  LYS B N   
1364 C CA  . LYS B 12  ? 0.5502 0.2945 0.4950 -0.1021 0.0034  0.0217  12  LYS B CA  
1365 C C   . LYS B 12  ? 0.5434 0.3061 0.4920 -0.0905 -0.0014 0.0086  12  LYS B C   
1366 O O   . LYS B 12  ? 0.5121 0.2840 0.4628 -0.0973 -0.0027 -0.0027 12  LYS B O   
1367 C CB  . LYS B 12  ? 0.6172 0.3209 0.5706 -0.1032 0.0059  0.0203  12  LYS B CB  
1368 C CG  . LYS B 12  ? 0.6912 0.3752 0.6506 -0.1095 0.0066  0.0381  12  LYS B CG  
1369 C CD  . LYS B 12  ? 0.7286 0.3918 0.7194 -0.1039 0.0088  0.0298  12  LYS B CD  
1370 C CE  . LYS B 12  ? 0.7211 0.3774 0.7328 -0.0835 0.0054  0.0223  12  LYS B CE  
1371 N NZ  . LYS B 12  ? 0.7742 0.4042 0.7913 -0.0831 -0.0012 0.0079  12  LYS B NZ  
1372 N N   . LEU B 13  ? 0.4990 0.2673 0.4477 -0.0752 -0.0060 0.0120  13  LEU B N   
1373 C CA  . LEU B 13  ? 0.5069 0.2890 0.4601 -0.0657 -0.0110 0.0030  13  LEU B CA  
1374 C C   . LEU B 13  ? 0.4866 0.2531 0.4439 -0.0539 -0.0113 0.0025  13  LEU B C   
1375 O O   . LEU B 13  ? 0.4228 0.1844 0.3834 -0.0450 -0.0141 0.0110  13  LEU B O   
1376 C CB  . LEU B 13  ? 0.4578 0.2695 0.4160 -0.0599 -0.0156 0.0019  13  LEU B CB  
1377 C CG  . LEU B 13  ? 0.4970 0.3335 0.4637 -0.0697 -0.0144 -0.0036 13  LEU B CG  
1378 C CD1 . LEU B 13  ? 0.5845 0.4508 0.5642 -0.0625 -0.0158 -0.0110 13  LEU B CD1 
1379 C CD2 . LEU B 13  ? 0.5628 0.4015 0.5375 -0.0757 -0.0210 -0.0098 13  LEU B CD2 
1380 N N   . TYR B 14  ? 0.4036 0.1654 0.3607 -0.0561 -0.0089 -0.0079 14  TYR B N   
1381 C CA  . TYR B 14  ? 0.3974 0.1505 0.3633 -0.0477 -0.0053 -0.0131 14  TYR B CA  
1382 C C   . TYR B 14  ? 0.4755 0.2462 0.4437 -0.0396 -0.0122 -0.0115 14  TYR B C   
1383 O O   . TYR B 14  ? 0.4347 0.2159 0.3958 -0.0453 -0.0170 -0.0126 14  TYR B O   
1384 C CB  . TYR B 14  ? 0.4072 0.1502 0.3684 -0.0592 0.0050  -0.0283 14  TYR B CB  
1385 C CG  . TYR B 14  ? 0.4788 0.2182 0.4550 -0.0532 0.0139  -0.0395 14  TYR B CG  
1386 C CD1 . TYR B 14  ? 0.5245 0.2562 0.5286 -0.0388 0.0143  -0.0389 14  TYR B CD1 
1387 C CD2 . TYR B 14  ? 0.5153 0.2633 0.4791 -0.0634 0.0202  -0.0494 14  TYR B CD2 
1388 C CE1 . TYR B 14  ? 0.5272 0.2638 0.5526 -0.0322 0.0223  -0.0517 14  TYR B CE1 
1389 C CE2 . TYR B 14  ? 0.4937 0.2437 0.4739 -0.0611 0.0325  -0.0631 14  TYR B CE2 
1390 C CZ  . TYR B 14  ? 0.5571 0.3049 0.5727 -0.0438 0.0338  -0.0658 14  TYR B CZ  
1391 O OH  . TYR B 14  ? 0.5346 0.2916 0.5746 -0.0408 0.0463  -0.0818 14  TYR B OH  
1392 N N   . GLY B 15  ? 0.4313 0.2040 0.4120 -0.0271 -0.0152 -0.0079 15  GLY B N   
1393 C CA  . GLY B 15  ? 0.4030 0.1908 0.3894 -0.0204 -0.0215 -0.0087 15  GLY B CA  
1394 C C   . GLY B 15  ? 0.3306 0.1172 0.3251 -0.0216 -0.0160 -0.0166 15  GLY B C   
1395 O O   . GLY B 15  ? 0.3445 0.1359 0.3562 -0.0129 -0.0171 -0.0186 15  GLY B O   
1396 N N   . ASP B 16  ? 0.3224 0.1054 0.3032 -0.0351 -0.0105 -0.0211 16  ASP B N   
1397 C CA  . ASP B 16  ? 0.3642 0.1493 0.3454 -0.0426 -0.0030 -0.0278 16  ASP B CA  
1398 C C   . ASP B 16  ? 0.3307 0.1249 0.3176 -0.0394 -0.0140 -0.0208 16  ASP B C   
1399 O O   . ASP B 16  ? 0.3165 0.1152 0.3056 -0.0330 -0.0264 -0.0142 16  ASP B O   
1400 C CB  . ASP B 16  ? 0.4651 0.2457 0.4199 -0.0634 0.0038  -0.0321 16  ASP B CB  
1401 C CG  . ASP B 16  ? 0.5443 0.3261 0.4818 -0.0698 -0.0111 -0.0204 16  ASP B CG  
1402 O OD1 . ASP B 16  ? 0.5025 0.2883 0.4373 -0.0726 -0.0238 -0.0098 16  ASP B OD1 
1403 O OD2 . ASP B 16  ? 0.6660 0.4446 0.5990 -0.0714 -0.0115 -0.0218 16  ASP B OD2 
1404 N N   . PRO B 17  ? 0.1763 0.1501 0.3177 0.0233  -0.0083 0.0037  17  PRO B N   
1405 C CA  . PRO B 17  ? 0.1282 0.1163 0.2672 0.0228  -0.0069 0.0049  17  PRO B CA  
1406 C C   . PRO B 17  ? 0.0994 0.0915 0.2293 0.0164  -0.0041 0.0068  17  PRO B C   
1407 O O   . PRO B 17  ? 0.1318 0.1298 0.2583 0.0154  -0.0044 0.0113  17  PRO B O   
1408 C CB  . PRO B 17  ? 0.1516 0.1479 0.2990 0.0259  -0.0032 -0.0046 17  PRO B CB  
1409 C CG  . PRO B 17  ? 0.1249 0.1146 0.2759 0.0317  -0.0071 -0.0078 17  PRO B CG  
1410 C CD  . PRO B 17  ? 0.1433 0.1166 0.2906 0.0289  -0.0082 -0.0047 17  PRO B CD  
1411 N N   . THR B 18  ? 0.1086 0.0985 0.2345 0.0140  -0.0027 0.0022  18  THR B N   
1412 C CA  . THR B 18  ? 0.0888 0.0840 0.2054 0.0116  -0.0021 0.0031  18  THR B CA  
1413 C C   . THR B 18  ? 0.1645 0.1619 0.2829 0.0079  -0.0049 0.0090  18  THR B C   
1414 O O   . THR B 18  ? 0.1119 0.1160 0.2258 0.0078  -0.0046 0.0121  18  THR B O   
1415 C CB  . THR B 18  ? 0.1316 0.1269 0.2424 0.0123  -0.0028 -0.0049 18  THR B CB  
1416 O OG1 . THR B 18  ? 0.1285 0.1227 0.2339 0.0162  0.0024  -0.0096 18  THR B OG1 
1417 C CG2 . THR B 18  ? 0.1918 0.1943 0.2926 0.0132  -0.0050 -0.0042 18  THR B CG2 
1418 N N   . PHE B 19  ? 0.1378 0.1278 0.2631 0.0048  -0.0060 0.0108  19  PHE B N   
1419 C CA  . PHE B 19  ? 0.1366 0.1284 0.2636 0.0000  -0.0051 0.0170  19  PHE B CA  
1420 C C   . PHE B 19  ? 0.1194 0.1150 0.2402 0.0034  -0.0047 0.0249  19  PHE B C   
1421 O O   . PHE B 19  ? 0.1205 0.1254 0.2385 0.0018  -0.0036 0.0273  19  PHE B O   
1422 C CB  . PHE B 19  ? 0.1785 0.1561 0.3130 -0.0049 -0.0031 0.0192  19  PHE B CB  
1423 C CG  . PHE B 19  ? 0.1625 0.1398 0.2976 -0.0109 0.0016  0.0277  19  PHE B CG  
1424 C CD1 . PHE B 19  ? 0.2209 0.2088 0.3656 -0.0193 0.0042  0.0227  19  PHE B CD1 
1425 C CD2 . PHE B 19  ? 0.2253 0.1937 0.3509 -0.0071 0.0038  0.0399  19  PHE B CD2 
1426 C CE1 . PHE B 19  ? 0.2727 0.2625 0.4197 -0.0259 0.0113  0.0297  19  PHE B CE1 
1427 C CE2 . PHE B 19  ? 0.1874 0.1553 0.3098 -0.0124 0.0107  0.0486  19  PHE B CE2 
1428 C CZ  . PHE B 19  ? 0.1838 0.1623 0.3179 -0.0228 0.0157  0.0436  19  PHE B CZ  
1429 N N   . ILE B 20  ? 0.0899 0.0803 0.2097 0.0091  -0.0064 0.0270  20  ILE B N   
1430 C CA  . ILE B 20  ? 0.0848 0.0817 0.1992 0.0139  -0.0082 0.0314  20  ILE B CA  
1431 C C   . ILE B 20  ? 0.0951 0.1043 0.2091 0.0136  -0.0076 0.0264  20  ILE B C   
1432 O O   . ILE B 20  ? 0.0960 0.1125 0.2054 0.0137  -0.0075 0.0285  20  ILE B O   
1433 C CB  . ILE B 20  ? 0.1280 0.1217 0.2444 0.0223  -0.0126 0.0309  20  ILE B CB  
1434 C CG1 . ILE B 20  ? 0.1673 0.1429 0.2800 0.0246  -0.0128 0.0391  20  ILE B CG1 
1435 C CG2 . ILE B 20  ? 0.1574 0.1635 0.2697 0.0284  -0.0168 0.0306  20  ILE B CG2 
1436 C CD1 . ILE B 20  ? 0.2467 0.2180 0.3584 0.0363  -0.0187 0.0389  20  ILE B CD1 
1437 N N   . VAL B 21  ? 0.0662 0.0759 0.1841 0.0134  -0.0058 0.0200  21  VAL B N   
1438 C CA  . VAL B 21  ? 0.0604 0.0751 0.1773 0.0129  -0.0028 0.0167  21  VAL B CA  
1439 C C   . VAL B 21  ? 0.0974 0.1136 0.2074 0.0115  -0.0019 0.0189  21  VAL B C   
1440 O O   . VAL B 21  ? 0.0575 0.0778 0.1657 0.0125  -0.0013 0.0186  21  VAL B O   
1441 C CB  . VAL B 21  ? 0.0620 0.0731 0.1814 0.0126  0.0023  0.0116  21  VAL B CB  
1442 C CG1 . VAL B 21  ? 0.1296 0.1385 0.2450 0.0115  0.0081  0.0109  21  VAL B CG1 
1443 C CG2 . VAL B 21  ? 0.0619 0.0776 0.1937 0.0146  0.0017  0.0062  21  VAL B CG2 
1444 N N   . SER B 22  ? 0.0975 0.1119 0.2054 0.0103  -0.0026 0.0187  22  SER B N   
1445 C CA  . SER B 22  ? 0.0750 0.0948 0.1788 0.0114  -0.0036 0.0181  22  SER B CA  
1446 C C   . SER B 22  ? 0.0790 0.1081 0.1868 0.0093  -0.0042 0.0204  22  SER B C   
1447 O O   . SER B 22  ? 0.0891 0.1249 0.1951 0.0122  -0.0043 0.0194  22  SER B O   
1448 C CB  . SER B 22  ? 0.1107 0.1316 0.2139 0.0114  -0.0063 0.0137  22  SER B CB  
1449 O OG  . SER B 22  ? 0.1047 0.1261 0.2178 0.0055  -0.0073 0.0124  22  SER B OG  
1450 N N   . THR B 23  ? 0.0735 0.1015 0.1851 0.0053  -0.0034 0.0240  23  THR B N   
1451 C CA  . THR B 23  ? 0.0978 0.1341 0.2099 0.0031  -0.0009 0.0275  23  THR B CA  
1452 C C   . THR B 23  ? 0.0904 0.1307 0.1960 0.0079  -0.0011 0.0281  23  THR B C   
1453 O O   . THR B 23  ? 0.0723 0.1227 0.1772 0.0091  0.0004  0.0266  23  THR B O   
1454 C CB  . THR B 23  ? 0.0780 0.1074 0.1917 -0.0022 0.0026  0.0339  23  THR B CB  
1455 O OG1 . THR B 23  ? 0.0967 0.1142 0.2049 0.0019  0.0005  0.0379  23  THR B OG1 
1456 C CG2 . THR B 23  ? 0.1013 0.1288 0.2265 -0.0090 0.0036  0.0296  23  THR B CG2 
1457 N N   . ALA B 24  ? 0.0682 0.1030 0.1714 0.0110  -0.0033 0.0279  24  ALA B N   
1458 C CA  . ALA B 24  ? 0.0644 0.1060 0.1646 0.0151  -0.0047 0.0246  24  ALA B CA  
1459 C C   . ALA B 24  ? 0.0686 0.1122 0.1712 0.0162  -0.0032 0.0186  24  ALA B C   
1460 O O   . ALA B 24  ? 0.0598 0.1111 0.1604 0.0186  -0.0028 0.0156  24  ALA B O   
1461 C CB  . ALA B 24  ? 0.0820 0.1218 0.1850 0.0183  -0.0084 0.0213  24  ALA B CB  
1462 N N   . LEU B 25  ? 0.0634 0.0983 0.1680 0.0158  -0.0019 0.0173  25  LEU B N   
1463 C CA  . LEU B 25  ? 0.0930 0.1235 0.1966 0.0188  0.0004  0.0140  25  LEU B CA  
1464 C C   . LEU B 25  ? 0.0903 0.1276 0.1914 0.0222  -0.0007 0.0146  25  LEU B C   
1465 O O   . LEU B 25  ? 0.0906 0.1276 0.1910 0.0269  0.0001  0.0114  25  LEU B O   
1466 C CB  . LEU B 25  ? 0.1002 0.1166 0.2018 0.0186  0.0043  0.0145  25  LEU B CB  
1467 C CG  . LEU B 25  ? 0.0980 0.1090 0.2074 0.0156  0.0087  0.0092  25  LEU B CG  
1468 C CD1 . LEU B 25  ? 0.1107 0.1317 0.2285 0.0133  0.0050  0.0063  25  LEU B CD1 
1469 C CD2 . LEU B 25  ? 0.0826 0.0775 0.1885 0.0145  0.0170  0.0110  25  LEU B CD2 
1470 N N   . ALA B 26  ? 0.0828 0.1272 0.1856 0.0200  -0.0024 0.0169  26  ALA B N   
1471 C CA  . ALA B 26  ? 0.0947 0.1526 0.2013 0.0224  -0.0035 0.0144  26  ALA B CA  
1472 C C   . ALA B 26  ? 0.1064 0.1774 0.2159 0.0216  -0.0007 0.0131  26  ALA B C   
1473 O O   . ALA B 26  ? 0.0907 0.1745 0.2048 0.0254  -0.0005 0.0088  26  ALA B O   
1474 C CB  . ALA B 26  ? 0.0848 0.1498 0.1981 0.0179  -0.0052 0.0137  26  ALA B CB  
1475 N N   . THR B 27  ? 0.0643 0.1336 0.1696 0.0184  0.0012  0.0161  27  THR B N   
1476 C CA  . THR B 27  ? 0.0690 0.1501 0.1709 0.0196  0.0042  0.0148  27  THR B CA  
1477 C C   . THR B 27  ? 0.1099 0.1885 0.2087 0.0254  0.0022  0.0078  27  THR B C   
1478 O O   . THR B 27  ? 0.1056 0.1940 0.1995 0.0279  0.0033  0.0041  27  THR B O   
1479 C CB  . THR B 27  ? 0.1374 0.2186 0.2317 0.0157  0.0072  0.0225  27  THR B CB  
1480 O OG1 . THR B 27  ? 0.1688 0.2392 0.2580 0.0176  0.0026  0.0239  27  THR B OG1 
1481 C CG2 . THR B 27  ? 0.0949 0.1749 0.1953 0.0080  0.0114  0.0284  27  THR B CG2 
1482 N N   . ARG B 28  ? 0.0999 0.1676 0.1966 0.0576  -0.0056 0.0051  28  ARG B N   
1483 C CA  A ARG B 28  ? 0.0851 0.1494 0.1806 0.0583  -0.0050 0.0051  28  ARG B CA  
1484 C CA  B ARG B 28  ? 0.0809 0.1451 0.1763 0.0582  -0.0050 0.0051  28  ARG B CA  
1485 C C   . ARG B 28  ? 0.1659 0.2302 0.2640 0.0586  -0.0064 0.0043  28  ARG B C   
1486 O O   . ARG B 28  ? 0.1187 0.1826 0.2199 0.0597  -0.0075 0.0013  28  ARG B O   
1487 C CB  A ARG B 28  ? 0.1205 0.1849 0.2181 0.0598  -0.0033 0.0054  28  ARG B CB  
1488 C CB  B ARG B 28  ? 0.1346 0.1985 0.2316 0.0599  -0.0033 0.0053  28  ARG B CB  
1489 C CG  A ARG B 28  ? 0.1348 0.2003 0.2333 0.0598  -0.0020 0.0072  28  ARG B CG  
1490 C CG  B ARG B 28  ? 0.1688 0.2320 0.2647 0.0605  -0.0019 0.0073  28  ARG B CG  
1491 C CD  A ARG B 28  ? 0.1801 0.2433 0.2836 0.0615  -0.0005 0.0067  28  ARG B CD  
1492 C CD  B ARG B 28  ? 0.2184 0.2780 0.3173 0.0630  0.0002  0.0077  28  ARG B CD  
1493 N NE  A ARG B 28  ? 0.1597 0.2172 0.2585 0.0656  0.0005  0.0055  28  ARG B NE  
1494 N NE  B ARG B 28  ? 0.1718 0.2266 0.2671 0.0674  -0.0001 0.0040  28  ARG B NE  
1495 C CZ  A ARG B 28  ? 0.1372 0.1922 0.2386 0.0691  0.0006  0.0017  28  ARG B CZ  
1496 C CZ  B ARG B 28  ? 0.1951 0.2458 0.2900 0.0695  -0.0012 0.0017  28  ARG B CZ  
1497 N NH1 A ARG B 28  ? 0.1256 0.1847 0.2308 0.0698  0.0003  -0.0004 28  ARG B NH1 
1498 N NH1 B ARG B 28  ? 0.0989 0.1510 0.1895 0.0693  -0.0033 0.0009  28  ARG B NH1 
1499 N NH2 A ARG B 28  ? 0.2442 0.2922 0.3464 0.0724  0.0003  -0.0022 28  ARG B NH2 
1500 N NH2 B ARG B 28  ? 0.2099 0.2533 0.3152 0.0695  -0.0006 -0.0013 28  ARG B NH2 
1501 N N   . ASP B 29  ? 0.0882 0.1528 0.1852 0.0580  -0.0073 0.0052  29  ASP B N   
1502 C CA  . ASP B 29  ? 0.0823 0.1485 0.1822 0.0591  -0.0090 0.0054  29  ASP B CA  
1503 C C   . ASP B 29  ? 0.1160 0.1821 0.2169 0.0577  -0.0100 0.0037  29  ASP B C   
1504 O O   . ASP B 29  ? 0.0921 0.1571 0.1904 0.0578  -0.0091 0.0052  29  ASP B O   
1505 C CB  . ASP B 29  ? 0.0857 0.1514 0.1843 0.0607  -0.0083 0.0090  29  ASP B CB  
1506 C CG  . ASP B 29  ? 0.1923 0.2588 0.2971 0.0626  -0.0115 0.0092  29  ASP B CG  
1507 O OD1 . ASP B 29  ? 0.1073 0.1784 0.2123 0.0631  -0.0143 0.0060  29  ASP B OD1 
1508 O OD2 . ASP B 29  ? 0.1078 0.1721 0.2147 0.0659  -0.0137 0.0086  29  ASP B OD2 
1509 N N   . PHE B 30  ? 0.0810 0.1487 0.1880 0.0567  -0.0119 -0.0005 30  PHE B N   
1510 C CA  . PHE B 30  ? 0.0805 0.1498 0.1934 0.0553  -0.0117 -0.0018 30  PHE B CA  
1511 C C   . PHE B 30  ? 0.0822 0.1586 0.2013 0.0557  -0.0151 -0.0041 30  PHE B C   
1512 O O   . PHE B 30  ? 0.0824 0.1633 0.2117 0.0542  -0.0153 -0.0064 30  PHE B O   
1513 C CB  . PHE B 30  ? 0.0823 0.1490 0.2047 0.0538  -0.0107 -0.0050 30  PHE B CB  
1514 C CG  . PHE B 30  ? 0.0827 0.1440 0.1982 0.0554  -0.0071 -0.0016 30  PHE B CG  
1515 C CD1 . PHE B 30  ? 0.1206 0.1817 0.2336 0.0571  -0.0044 0.0013  30  PHE B CD1 
1516 C CD2 . PHE B 30  ? 0.1175 0.1761 0.2284 0.0568  -0.0070 -0.0018 30  PHE B CD2 
1517 C CE1 . PHE B 30  ? 0.1061 0.1646 0.2118 0.0607  -0.0031 0.0027  30  PHE B CE1 
1518 C CE2 . PHE B 30  ? 0.2181 0.2743 0.3223 0.0597  -0.0047 0.0008  30  PHE B CE2 
1519 C CZ  . PHE B 30  ? 0.1568 0.2133 0.2580 0.0620  -0.0035 0.0023  30  PHE B CZ  
1520 N N   . GLN B 31  ? 0.0964 0.1748 0.2111 0.0585  -0.0175 -0.0030 31  GLN B N   
1521 C CA  . GLN B 31  ? 0.0992 0.1856 0.2178 0.0608  -0.0216 -0.0050 31  GLN B CA  
1522 C C   . GLN B 31  ? 0.0870 0.1746 0.2077 0.0606  -0.0188 -0.0009 31  GLN B C   
1523 O O   . GLN B 31  ? 0.0853 0.1665 0.1996 0.0613  -0.0147 0.0045  31  GLN B O   
1524 C CB  . GLN B 31  ? 0.1553 0.2419 0.2669 0.0661  -0.0237 -0.0023 31  GLN B CB  
1525 C CG  . GLN B 31  ? 0.3233 0.4117 0.4286 0.0699  -0.0264 -0.0059 31  GLN B CG  
1526 C CD  . GLN B 31  ? 0.3260 0.4167 0.4216 0.0778  -0.0279 -0.0023 31  GLN B CD  
1527 O OE1 . GLN B 31  ? 0.5346 0.6271 0.6302 0.0805  -0.0291 0.0001  31  GLN B OE1 
1528 N NE2 . GLN B 31  ? 0.2093 0.3004 0.2954 0.0830  -0.0270 -0.0012 31  GLN B NE2 
1529 N N   . ASP B 32  ? 0.0999 0.1971 0.2306 0.0603  -0.0215 -0.0048 32  ASP B N   
1530 C CA  . ASP B 32  ? 0.1053 0.2050 0.2384 0.0610  -0.0178 -0.0007 32  ASP B CA  
1531 C C   . ASP B 32  ? 0.1510 0.2460 0.2777 0.0653  -0.0166 0.0056  32  ASP B C   
1532 O O   . ASP B 32  ? 0.1674 0.2591 0.2918 0.0660  -0.0127 0.0087  32  ASP B O   
1533 C CB  . ASP B 32  ? 0.2153 0.3287 0.3648 0.0595  -0.0201 -0.0059 32  ASP B CB  
1534 C CG  . ASP B 32  ? 0.3913 0.5142 0.5463 0.0607  -0.0279 -0.0131 32  ASP B CG  
1535 O OD1 . ASP B 32  ? 0.3809 0.5008 0.5242 0.0655  -0.0308 -0.0112 32  ASP B OD1 
1536 O OD2 . ASP B 32  ? 0.3629 0.4970 0.5351 0.0572  -0.0313 -0.0215 32  ASP B OD2 
1537 N N   . VAL B 33  ? 0.0960 0.1887 0.2197 0.0681  -0.0202 0.0060  33  VAL B N   
1538 C CA  . VAL B 33  ? 0.1503 0.2358 0.2724 0.0721  -0.0198 0.0101  33  VAL B CA  
1539 C C   . VAL B 33  ? 0.1976 0.2691 0.3143 0.0699  -0.0150 0.0130  33  VAL B C   
1540 O O   . VAL B 33  ? 0.1777 0.2418 0.2954 0.0726  -0.0150 0.0137  33  VAL B O   
1541 C CB  . VAL B 33  ? 0.1516 0.2374 0.2670 0.0781  -0.0246 0.0094  33  VAL B CB  
1542 C CG1 . VAL B 33  ? 0.1599 0.2612 0.2760 0.0823  -0.0304 0.0048  33  VAL B CG1 
1543 C CG2 . VAL B 33  ? 0.1771 0.2598 0.2866 0.0772  -0.0245 0.0090  33  VAL B CG2 
1544 N N   . HIS B 34  ? 0.1240 0.1934 0.2340 0.0667  -0.0118 0.0130  34  HIS B N   
1545 C CA  . HIS B 34  ? 0.0970 0.1589 0.1979 0.0680  -0.0088 0.0130  34  HIS B CA  
1546 C C   . HIS B 34  ? 0.0988 0.1615 0.1990 0.0671  -0.0074 0.0104  34  HIS B C   
1547 O O   . HIS B 34  ? 0.1411 0.1984 0.2393 0.0681  -0.0069 0.0084  34  HIS B O   
1548 C CB  . HIS B 34  ? 0.0952 0.1548 0.1906 0.0672  -0.0093 0.0110  34  HIS B CB  
1549 C CG  . HIS B 34  ? 0.0972 0.1572 0.1978 0.0670  -0.0096 0.0154  34  HIS B CG  
1550 N ND1 . HIS B 34  ? 0.1057 0.1571 0.2148 0.0698  -0.0181 0.0088  34  HIS B ND1 
1551 C CD2 . HIS B 34  ? 0.0982 0.1612 0.2040 0.0645  -0.0122 0.0134  34  HIS B CD2 
1552 C CE1 . HIS B 34  ? 0.1088 0.1660 0.2156 0.0744  -0.0184 0.0122  34  HIS B CE1 
1553 N NE2 . HIS B 34  ? 0.1061 0.1689 0.2145 0.0696  -0.0172 0.0115  34  HIS B NE2 
1554 N N   . HIS B 35  ? 0.0996 0.1696 0.2044 0.0658  -0.0068 0.0105  35  HIS B N   
1555 C CA  . HIS B 35  ? 0.1080 0.1791 0.2133 0.0661  -0.0039 0.0104  35  HIS B CA  
1556 C C   . HIS B 35  ? 0.1228 0.2021 0.2359 0.0673  -0.0021 0.0119  35  HIS B C   
1557 O O   . HIS B 35  ? 0.2000 0.2764 0.3240 0.0656  0.0006  0.0121  35  HIS B O   
1558 C CB  . HIS B 35  ? 0.0942 0.1665 0.1949 0.0648  -0.0034 0.0084  35  HIS B CB  
1559 C CG  . HIS B 35  ? 0.0911 0.1705 0.1976 0.0635  -0.0053 0.0051  35  HIS B CG  
1560 N ND1 . HIS B 35  ? 0.0896 0.1677 0.1989 0.0610  -0.0072 0.0046  35  HIS B ND1 
1561 C CD2 . HIS B 35  ? 0.1107 0.1991 0.2286 0.0639  -0.0047 0.0027  35  HIS B CD2 
1562 C CE1 . HIS B 35  ? 0.0869 0.1701 0.2080 0.0586  -0.0080 0.0018  35  HIS B CE1 
1563 N NE2 . HIS B 35  ? 0.0883 0.1780 0.2174 0.0595  -0.0058 0.0015  35  HIS B NE2 
1564 N N   . ASP B 36  ? 0.0952 0.1821 0.2147 0.0677  -0.0045 0.0117  36  ASP B N   
1565 C CA  . ASP B 36  ? 0.0970 0.1964 0.2262 0.0693  -0.0033 0.0119  36  ASP B CA  
1566 C C   . ASP B 36  ? 0.1431 0.2408 0.2833 0.0706  -0.0065 0.0121  36  ASP B C   
1567 O O   . ASP B 36  ? 0.1273 0.2300 0.2697 0.0720  -0.0112 0.0110  36  ASP B O   
1568 C CB  . ASP B 36  ? 0.1072 0.2207 0.2457 0.0677  -0.0062 0.0063  36  ASP B CB  
1569 C CG  . ASP B 36  ? 0.1004 0.2316 0.2554 0.0685  -0.0054 0.0044  36  ASP B CG  
1570 O OD1 . ASP B 36  ? 0.1269 0.2609 0.2812 0.0720  -0.0033 0.0083  36  ASP B OD1 
1571 O OD2 . ASP B 36  ? 0.1603 0.2997 0.3331 0.0634  -0.0057 -0.0001 36  ASP B OD2 
1572 N N   . ARG B 37  ? 0.1288 0.2283 0.2592 0.0930  -0.0179 0.0074  37  ARG B N   
1573 C CA  . ARG B 37  ? 0.1338 0.2331 0.2649 0.0961  -0.0198 0.0073  37  ARG B CA  
1574 C C   . ARG B 37  ? 0.1362 0.2426 0.2769 0.0976  -0.0228 0.0079  37  ARG B C   
1575 O O   . ARG B 37  ? 0.1412 0.2481 0.2798 0.1001  -0.0269 0.0088  37  ARG B O   
1576 C CB  . ARG B 37  ? 0.1350 0.2363 0.2695 0.0978  -0.0162 0.0055  37  ARG B CB  
1577 C CG  . ARG B 37  ? 0.1580 0.2609 0.3006 0.1015  -0.0173 0.0058  37  ARG B CG  
1578 C CD  . ARG B 37  ? 0.1426 0.2488 0.2901 0.1039  -0.0124 0.0025  37  ARG B CD  
1579 N NE  . ARG B 37  ? 0.2279 0.3277 0.3685 0.1049  -0.0107 0.0009  37  ARG B NE  
1580 C CZ  . ARG B 37  ? 0.2241 0.3279 0.3655 0.1069  -0.0059 -0.0040 37  ARG B CZ  
1581 N NH1 . ARG B 37  ? 0.2023 0.3172 0.3498 0.1081  -0.0023 -0.0073 37  ARG B NH1 
1582 N NH2 . ARG B 37  ? 0.1868 0.2852 0.3235 0.1080  -0.0045 -0.0060 37  ARG B NH2 
1583 N N   . ASP B 38  ? 0.1334 0.2470 0.2857 0.0966  -0.0211 0.0080  38  ASP B N   
1584 C CA  . ASP B 38  ? 0.1812 0.3042 0.3441 0.0983  -0.0236 0.0084  38  ASP B CA  
1585 C C   . ASP B 38  ? 0.1614 0.2870 0.3196 0.0992  -0.0287 0.0066  38  ASP B C   
1586 O O   . ASP B 38  ? 0.1441 0.2763 0.3035 0.1018  -0.0338 0.0053  38  ASP B O   
1587 C CB  . ASP B 38  ? 0.1425 0.2737 0.3209 0.0969  -0.0200 0.0098  38  ASP B CB  
1588 C CG  . ASP B 38  ? 0.1316 0.2646 0.3148 0.0970  -0.0162 0.0087  38  ASP B CG  
1589 O OD1 . ASP B 38  ? 0.1770 0.3071 0.3547 0.0996  -0.0160 0.0073  38  ASP B OD1 
1590 O OD2 . ASP B 38  ? 0.1360 0.2739 0.3273 0.0946  -0.0135 0.0079  38  ASP B OD2 
1591 N N   . LYS B 39  ? 0.1405 0.2623 0.2938 0.0974  -0.0278 0.0054  39  LYS B N   
1592 C CA  . LYS B 39  ? 0.1446 0.2704 0.2928 0.0990  -0.0330 0.0005  39  LYS B CA  
1593 C C   . LYS B 39  ? 0.1974 0.3200 0.3310 0.1014  -0.0372 0.0006  39  LYS B C   
1594 O O   . LYS B 39  ? 0.1690 0.3006 0.2996 0.1043  -0.0434 -0.0032 39  LYS B O   
1595 C CB  . LYS B 39  ? 0.1416 0.2642 0.2902 0.0974  -0.0302 -0.0012 39  LYS B CB  
1596 C CG  . LYS B 39  ? 0.1922 0.3216 0.3579 0.0965  -0.0271 -0.0013 39  LYS B CG  
1597 C CD  . LYS B 39  ? 0.3094 0.4507 0.4852 0.0980  -0.0334 -0.0115 39  LYS B CD  
1598 C CE  . LYS B 39  ? 0.2940 0.4398 0.4886 0.0964  -0.0302 -0.0134 39  LYS B CE  
1599 N NZ  . LYS B 39  ? 0.3716 0.5285 0.5832 0.0956  -0.0370 -0.0265 39  LYS B NZ  
1600 N N   . ALA B 40  ? 0.1461 0.2584 0.2720 0.1004  -0.0342 0.0047  40  ALA B N   
1601 C CA  . ALA B 40  ? 0.1496 0.2589 0.2650 0.1027  -0.0373 0.0070  40  ALA B CA  
1602 C C   . ALA B 40  ? 0.1868 0.3028 0.3086 0.1061  -0.0415 0.0095  40  ALA B C   
1603 O O   . ALA B 40  ? 0.1849 0.3073 0.3021 0.1092  -0.0469 0.0108  40  ALA B O   
1604 C CB  . ALA B 40  ? 0.1759 0.2736 0.2858 0.1009  -0.0332 0.0099  40  ALA B CB  
1605 N N   . VAL B 41  ? 0.1539 0.2701 0.2872 0.1058  -0.0389 0.0105  41  VAL B N   
1606 C CA  . VAL B 41  ? 0.1844 0.3072 0.3273 0.1092  -0.0422 0.0134  41  VAL B CA  
1607 C C   . VAL B 41  ? 0.1725 0.3099 0.3186 0.1108  -0.0483 0.0108  41  VAL B C   
1608 O O   . VAL B 41  ? 0.2290 0.3744 0.3760 0.1142  -0.0543 0.0136  41  VAL B O   
1609 C CB  . VAL B 41  ? 0.1956 0.3170 0.3508 0.1090  -0.0371 0.0138  41  VAL B CB  
1610 C CG1 . VAL B 41  ? 0.1639 0.2941 0.3324 0.1127  -0.0403 0.0165  41  VAL B CG1 
1611 C CG2 . VAL B 41  ? 0.1631 0.2734 0.3157 0.1087  -0.0324 0.0144  41  VAL B CG2 
1612 N N   . ALA B 42  ? 0.1643 0.3067 0.3138 0.1086  -0.0473 0.0053  42  ALA B N   
1613 C CA  . ALA B 42  ? 0.1684 0.3266 0.3234 0.1098  -0.0535 -0.0004 42  ALA B CA  
1614 C C   . ALA B 42  ? 0.3178 0.4836 0.4608 0.1123  -0.0602 -0.0036 42  ALA B C   
1615 O O   . ALA B 42  ? 0.3224 0.5047 0.4681 0.1145  -0.0674 -0.0071 42  ALA B O   
1616 C CB  . ALA B 42  ? 0.1629 0.3236 0.3264 0.1068  -0.0508 -0.0065 42  ALA B CB  
1617 N N   . GLN B 43  ? 0.2080 0.3641 0.3377 0.1120  -0.0579 -0.0024 43  GLN B N   
1618 C CA  . GLN B 43  ? 0.2167 0.3817 0.3336 0.1148  -0.0632 -0.0051 43  GLN B CA  
1619 C C   . GLN B 43  ? 0.2820 0.4455 0.3918 0.1176  -0.0651 0.0052  43  GLN B C   
1620 O O   . GLN B 43  ? 0.3974 0.5666 0.4945 0.1199  -0.0678 0.0066  43  GLN B O   
1621 C CB  . GLN B 43  ? 0.2703 0.4279 0.3783 0.1134  -0.0596 -0.0097 43  GLN B CB  
1622 C CG  . GLN B 43  ? 0.3092 0.4697 0.4280 0.1112  -0.0586 -0.0202 43  GLN B CG  
1623 C CD  . GLN B 43  ? 0.4350 0.5869 0.5479 0.1101  -0.0545 -0.0232 43  GLN B CD  
1624 O OE1 . GLN B 43  ? 0.5224 0.6783 0.6224 0.1128  -0.0566 -0.0252 43  GLN B OE1 
1625 N NE2 . GLN B 43  ? 0.3490 0.4907 0.4717 0.1064  -0.0483 -0.0221 43  GLN B NE2 
1626 N N   . GLY B 44  ? 0.2749 0.4318 0.3947 0.1177  -0.0636 0.0124  44  GLY B N   
1627 C CA  . GLY B 44  ? 0.3089 0.4652 0.4287 0.1208  -0.0666 0.0222  44  GLY B CA  
1628 C C   . GLY B 44  ? 0.3441 0.4832 0.4608 0.1202  -0.0622 0.0281  44  GLY B C   
1629 O O   . GLY B 44  ? 0.3241 0.4619 0.4428 0.1231  -0.0651 0.0361  44  GLY B O   
1630 N N   . SER B 45  ? 0.2028 0.3296 0.3160 0.1164  -0.0557 0.0241  45  SER B N   
1631 C CA  . SER B 45  ? 0.2099 0.3219 0.3217 0.1152  -0.0516 0.0277  45  SER B CA  
1632 C C   . SER B 45  ? 0.2151 0.3194 0.3421 0.1147  -0.0480 0.0277  45  SER B C   
1633 O O   . SER B 45  ? 0.2885 0.3974 0.4240 0.1141  -0.0465 0.0246  45  SER B O   
1634 C CB  . SER B 45  ? 0.1948 0.3000 0.2953 0.1116  -0.0469 0.0233  45  SER B CB  
1635 O OG  . SER B 45  ? 0.3340 0.4463 0.4212 0.1131  -0.0496 0.0231  45  SER B OG  
1636 N N   . LYS B 46  ? 0.2259 0.3200 0.3574 0.1155  -0.0464 0.0306  46  LYS B N   
1637 C CA  A LYS B 46  ? 0.2364 0.3247 0.3834 0.1161  -0.0423 0.0288  46  LYS B CA  
1638 C CA  B LYS B 46  ? 0.2377 0.3260 0.3847 0.1161  -0.0423 0.0288  46  LYS B CA  
1639 C C   . LYS B 46  ? 0.2581 0.3440 0.4010 0.1122  -0.0349 0.0226  46  LYS B C   
1640 O O   . LYS B 46  ? 0.2283 0.3174 0.3803 0.1126  -0.0312 0.0198  46  LYS B O   
1641 C CB  . LYS B 46  ? 0.2656 0.3438 0.4199 0.1187  -0.0432 0.0312  46  LYS B CB  
1642 C CG  . LYS B 46  ? 0.3882 0.4608 0.5561 0.1188  -0.0370 0.0269  46  LYS B CG  
1643 C CD  . LYS B 46  ? 0.4264 0.4884 0.5947 0.1183  -0.0338 0.0243  46  LYS B CD  
1644 C CE  . LYS B 46  ? 0.4757 0.5356 0.6589 0.1191  -0.0242 0.0216  46  LYS B CE  
1645 N NZ  . LYS B 46  ? 0.4817 0.5347 0.6644 0.1191  -0.0167 0.0212  46  LYS B NZ  
1646 N N   . ASP B 47  ? 0.2084 0.2900 0.3376 0.1091  -0.0332 0.0208  47  ASP B N   
1647 C CA  . ASP B 47  ? 0.1664 0.2461 0.2908 0.1057  -0.0276 0.0158  47  ASP B CA  
1648 C C   . ASP B 47  ? 0.1571 0.2354 0.2669 0.1025  -0.0281 0.0152  47  ASP B C   
1649 O O   . ASP B 47  ? 0.1564 0.2362 0.2596 0.1034  -0.0320 0.0178  47  ASP B O   
1650 C CB  . ASP B 47  ? 0.1715 0.2454 0.3009 0.1068  -0.0232 0.0140  47  ASP B CB  
1651 C CG  . ASP B 47  ? 0.2677 0.3455 0.3968 0.1055  -0.0176 0.0084  47  ASP B CG  
1652 O OD1 . ASP B 47  ? 0.1843 0.2670 0.3084 0.1027  -0.0174 0.0070  47  ASP B OD1 
1653 O OD2 . ASP B 47  ? 0.2721 0.3492 0.4074 0.1081  -0.0133 0.0053  47  ASP B OD2 
1654 N N   . ILE B 48  ? 0.1448 0.2218 0.2502 0.0995  -0.0242 0.0121  48  ILE B N   
1655 C CA  . ILE B 48  ? 0.1419 0.2164 0.2360 0.0970  -0.0240 0.0123  48  ILE B CA  
1656 C C   . ILE B 48  ? 0.1685 0.2370 0.2568 0.0981  -0.0248 0.0151  48  ILE B C   
1657 O O   . ILE B 48  ? 0.1560 0.2212 0.2512 0.1002  -0.0243 0.0159  48  ILE B O   
1658 C CB  . ILE B 48  ? 0.1354 0.2107 0.2279 0.0941  -0.0200 0.0099  48  ILE B CB  
1659 C CG1 . ILE B 48  ? 0.1504 0.2251 0.2443 0.0951  -0.0168 0.0082  48  ILE B CG1 
1660 C CG2 . ILE B 48  ? 0.1322 0.2140 0.2330 0.0931  -0.0194 0.0087  48  ILE B CG2 
1661 C CD1 . ILE B 48  ? 0.1311 0.2096 0.2204 0.0931  -0.0135 0.0069  48  ILE B CD1 
1662 N N   . PHE B 49  ? 0.1459 0.2137 0.2241 0.0973  -0.0257 0.0165  49  PHE B N   
1663 C CA  . PHE B 49  ? 0.1599 0.2232 0.2330 0.0985  -0.0265 0.0203  49  PHE B CA  
1664 C C   . PHE B 49  ? 0.1696 0.2317 0.2321 0.0963  -0.0245 0.0201  49  PHE B C   
1665 O O   . PHE B 49  ? 0.1486 0.2138 0.2079 0.0948  -0.0236 0.0175  49  PHE B O   
1666 C CB  . PHE B 49  ? 0.1593 0.2260 0.2319 0.1021  -0.0311 0.0251  49  PHE B CB  
1667 C CG  . PHE B 49  ? 0.1839 0.2597 0.2500 0.1033  -0.0337 0.0238  49  PHE B CG  
1668 C CD1 . PHE B 49  ? 0.1621 0.2416 0.2167 0.1040  -0.0335 0.0238  49  PHE B CD1 
1669 C CD2 . PHE B 49  ? 0.1934 0.2761 0.2661 0.1046  -0.0362 0.0217  49  PHE B CD2 
1670 C CE1 . PHE B 49  ? 0.1648 0.2555 0.2147 0.1066  -0.0362 0.0203  49  PHE B CE1 
1671 C CE2 . PHE B 49  ? 0.1639 0.2574 0.2321 0.1066  -0.0393 0.0187  49  PHE B CE2 
1672 C CZ  . PHE B 49  ? 0.1874 0.2854 0.2443 0.1079  -0.0394 0.0172  49  PHE B CZ  
1673 N N   . VAL B 50  ? 0.1495 0.2073 0.2092 0.0966  -0.0236 0.0229  50  VAL B N   
1674 C CA  . VAL B 50  ? 0.1517 0.2088 0.2025 0.0950  -0.0214 0.0235  50  VAL B CA  
1675 C C   . VAL B 50  ? 0.1499 0.2121 0.1920 0.0965  -0.0226 0.0247  50  VAL B C   
1676 O O   . VAL B 50  ? 0.1646 0.2308 0.2049 0.0998  -0.0256 0.0279  50  VAL B O   
1677 C CB  . VAL B 50  ? 0.2176 0.2699 0.2692 0.0958  -0.0207 0.0270  50  VAL B CB  
1678 C CG1 . VAL B 50  ? 0.2068 0.2597 0.2498 0.0944  -0.0184 0.0286  50  VAL B CG1 
1679 C CG2 . VAL B 50  ? 0.1996 0.2496 0.2609 0.0959  -0.0191 0.0235  50  VAL B CG2 
1680 N N   . ASN B 51  ? 0.1453 0.2092 0.1833 0.0949  -0.0204 0.0222  51  ASN B N   
1681 C CA  . ASN B 51  ? 0.1846 0.2553 0.2163 0.0978  -0.0212 0.0209  51  ASN B CA  
1682 C C   . ASN B 51  ? 0.2747 0.3474 0.2974 0.0999  -0.0200 0.0254  51  ASN B C   
1683 O O   . ASN B 51  ? 0.1699 0.2372 0.1926 0.0982  -0.0184 0.0296  51  ASN B O   
1684 C CB  . ASN B 51  ? 0.1429 0.2148 0.1791 0.0962  -0.0195 0.0159  51  ASN B CB  
1685 C CG  . ASN B 51  ? 0.1726 0.2412 0.2075 0.0937  -0.0158 0.0173  51  ASN B CG  
1686 O OD1 . ASN B 51  ? 0.1885 0.2532 0.2207 0.0918  -0.0143 0.0207  51  ASN B OD1 
1687 N ND2 . ASN B 51  ? 0.1847 0.2558 0.2238 0.0942  -0.0145 0.0143  51  ASN B ND2 
1688 N N   . ILE B 52  ? 0.2483 0.2049 0.1536 -0.0535 0.0397  0.0606  52  ILE B N   
1689 C CA  . ILE B 52  ? 0.2376 0.2089 0.1450 -0.0657 0.0391  0.0642  52  ILE B CA  
1690 C C   . ILE B 52  ? 0.2394 0.2352 0.1486 -0.0738 0.0411  0.0570  52  ILE B C   
1691 O O   . ILE B 52  ? 0.2665 0.2673 0.1753 -0.0887 0.0403  0.0580  52  ILE B O   
1692 C CB  . ILE B 52  ? 0.2443 0.2292 0.1555 -0.0599 0.0399  0.0670  52  ILE B CB  
1693 C CG1 . ILE B 52  ? 0.3240 0.2867 0.2340 -0.0546 0.0368  0.0753  52  ILE B CG1 
1694 C CG2 . ILE B 52  ? 0.3184 0.3213 0.2303 -0.0734 0.0400  0.0678  52  ILE B CG2 
1695 C CD1 . ILE B 52  ? 0.3167 0.2892 0.2273 -0.0460 0.0384  0.0754  52  ILE B CD1 
1696 N N   . LEU B 53  ? 0.2232 0.2346 0.1355 -0.0640 0.0432  0.0496  53  LEU B N   
1697 C CA  A LEU B 53  ? 0.2436 0.2819 0.1611 -0.0700 0.0438  0.0430  53  LEU B CA  
1698 C CA  B LEU B 53  ? 0.2304 0.2686 0.1479 -0.0697 0.0438  0.0429  53  LEU B CA  
1699 C C   . LEU B 53  ? 0.2391 0.2677 0.1507 -0.0820 0.0418  0.0406  53  LEU B C   
1700 O O   . LEU B 53  ? 0.2233 0.2720 0.1401 -0.0929 0.0411  0.0367  53  LEU B O   
1701 C CB  A LEU B 53  ? 0.1842 0.2394 0.1086 -0.0547 0.0449  0.0364  53  LEU B CB  
1702 C CB  B LEU B 53  ? 0.1844 0.2374 0.1078 -0.0541 0.0448  0.0365  53  LEU B CB  
1703 C CG  A LEU B 53  ? 0.1822 0.2595 0.1205 -0.0483 0.0468  0.0333  53  LEU B CG  
1704 C CG  B LEU B 53  ? 0.2029 0.2667 0.1369 -0.0426 0.0470  0.0348  53  LEU B CG  
1705 C CD1 A LEU B 53  ? 0.1862 0.2743 0.1333 -0.0329 0.0473  0.0272  53  LEU B CD1 
1706 C CD1 B LEU B 53  ? 0.1989 0.2717 0.1402 -0.0278 0.0474  0.0284  53  LEU B CD1 
1707 C CD2 A LEU B 53  ? 0.2287 0.3310 0.1750 -0.0628 0.0470  0.0311  53  LEU B CD2 
1708 C CD2 B LEU B 53  ? 0.2240 0.3110 0.1671 -0.0535 0.0476  0.0334  53  LEU B CD2 
1709 N N   . THR B 54  ? 0.2291 0.2266 0.1343 -0.0778 0.0399  0.0399  54  THR B N   
1710 C CA  . THR B 54  ? 0.2454 0.2297 0.1483 -0.0875 0.0374  0.0345  54  THR B CA  
1711 C C   . THR B 54  ? 0.2774 0.2515 0.1790 -0.1056 0.0378  0.0408  54  THR B C   
1712 O O   . THR B 54  ? 0.2776 0.2585 0.1805 -0.1193 0.0372  0.0364  54  THR B O   
1713 C CB  . THR B 54  ? 0.2506 0.2045 0.1486 -0.0789 0.0368  0.0298  54  THR B CB  
1714 O OG1 . THR B 54  ? 0.2338 0.1978 0.1309 -0.0644 0.0365  0.0241  54  THR B OG1 
1715 C CG2 . THR B 54  ? 0.2700 0.2089 0.1661 -0.0908 0.0356  0.0226  54  THR B CG2 
1716 N N   . ASP B 55  ? 0.2799 0.2381 0.1783 -0.1066 0.0386  0.0517  55  ASP B N   
1717 C CA  . ASP B 55  ? 0.3376 0.2887 0.2371 -0.1201 0.0371  0.0582  55  ASP B CA  
1718 C C   . ASP B 55  ? 0.3151 0.2990 0.2181 -0.1315 0.0385  0.0549  55  ASP B C   
1719 O O   . ASP B 55  ? 0.3250 0.3075 0.2279 -0.1464 0.0384  0.0533  55  ASP B O   
1720 C CB  . ASP B 55  ? 0.3796 0.3206 0.2807 -0.1126 0.0347  0.0686  55  ASP B CB  
1721 C CG  . ASP B 55  ? 0.4732 0.3790 0.3759 -0.1044 0.0318  0.0727  55  ASP B CG  
1722 O OD1 . ASP B 55  ? 0.3854 0.2690 0.2889 -0.1081 0.0317  0.0677  55  ASP B OD1 
1723 O OD2 . ASP B 55  ? 0.4871 0.3893 0.3925 -0.0942 0.0299  0.0796  55  ASP B OD2 
1724 N N   . THR B 56  ? 0.2819 0.2953 0.1900 -0.1240 0.0400  0.0526  56  THR B N   
1725 C CA  . THR B 56  ? 0.2801 0.3260 0.1950 -0.1330 0.0416  0.0475  56  THR B CA  
1726 C C   . THR B 56  ? 0.2750 0.3362 0.1935 -0.1430 0.0419  0.0389  56  THR B C   
1727 O O   . THR B 56  ? 0.3398 0.4134 0.2612 -0.1574 0.0422  0.0354  56  THR B O   
1728 C CB  . THR B 56  ? 0.3350 0.4077 0.2589 -0.1207 0.0434  0.0439  56  THR B CB  
1729 O OG1 . THR B 56  ? 0.2951 0.3538 0.2155 -0.1119 0.0430  0.0506  56  THR B OG1 
1730 C CG2 . THR B 56  ? 0.2753 0.3793 0.2080 -0.1301 0.0451  0.0376  56  THR B CG2 
1731 N N   . GLY B 57  ? 0.2587 0.3184 0.1769 -0.1339 0.0409  0.0345  57  GLY B N   
1732 C CA  . GLY B 57  ? 0.2584 0.3332 0.1825 -0.1367 0.0373  0.0241  57  GLY B CA  
1733 C C   . GLY B 57  ? 0.3326 0.3872 0.2511 -0.1526 0.0365  0.0219  57  GLY B C   
1734 O O   . GLY B 57  ? 0.3369 0.4104 0.2607 -0.1644 0.0353  0.0146  57  GLY B O   
1735 N N   . LEU B 58  ? 0.2983 0.3147 0.2081 -0.1529 0.0373  0.0274  58  LEU B N   
1736 C CA  . LEU B 58  ? 0.3390 0.3321 0.2455 -0.1680 0.0376  0.0247  58  LEU B CA  
1737 C C   . LEU B 58  ? 0.3706 0.3672 0.2776 -0.1856 0.0398  0.0295  58  LEU B C   
1738 O O   . LEU B 58  ? 0.3771 0.3737 0.2856 -0.1992 0.0401  0.0231  58  LEU B O   
1739 C CB  . LEU B 58  ? 0.3646 0.3155 0.2663 -0.1614 0.0376  0.0284  58  LEU B CB  
1740 C CG  . LEU B 58  ? 0.4021 0.3447 0.3024 -0.1448 0.0360  0.0206  58  LEU B CG  
1741 C CD1 . LEU B 58  ? 0.3714 0.2743 0.2707 -0.1388 0.0370  0.0239  58  LEU B CD1 
1742 C CD2 . LEU B 58  ? 0.3855 0.3377 0.2854 -0.1516 0.0345  0.0070  58  LEU B CD2 
1743 N N   . VAL B 59  ? 0.3366 0.3368 0.2433 -0.1804 0.0399  0.0386  59  VAL B N   
1744 C CA  . VAL B 59  ? 0.3544 0.3588 0.2607 -0.1919 0.0406  0.0419  59  VAL B CA  
1745 C C   . VAL B 59  ? 0.4178 0.4596 0.3307 -0.2022 0.0422  0.0315  59  VAL B C   
1746 O O   . VAL B 59  ? 0.4033 0.4458 0.3161 -0.2165 0.0433  0.0277  59  VAL B O   
1747 C CB  . VAL B 59  ? 0.3527 0.3578 0.2564 -0.1851 0.0402  0.0520  59  VAL B CB  
1748 C CG1 . VAL B 59  ? 0.3702 0.3874 0.2721 -0.1989 0.0417  0.0531  59  VAL B CG1 
1749 C CG2 . VAL B 59  ? 0.3977 0.3662 0.2975 -0.1767 0.0375  0.0626  59  VAL B CG2 
1750 N N   . GLN B 60  ? 0.3234 0.3965 0.2441 -0.1938 0.0423  0.0264  60  GLN B N   
1751 C CA  . GLN B 60  ? 0.3152 0.4275 0.2475 -0.2003 0.0426  0.0154  60  GLN B CA  
1752 C C   . GLN B 60  ? 0.3244 0.4381 0.2586 -0.2112 0.0407  0.0065  60  GLN B C   
1753 O O   . GLN B 60  ? 0.3360 0.4659 0.2746 -0.2235 0.0413  -0.0005 60  GLN B O   
1754 C CB  . GLN B 60  ? 0.3633 0.5055 0.3071 -0.1860 0.0419  0.0119  60  GLN B CB  
1755 C CG  . GLN B 60  ? 0.3630 0.5475 0.3240 -0.1893 0.0405  0.0005  60  GLN B CG  
1756 C CD  . GLN B 60  ? 0.3367 0.5488 0.3124 -0.1729 0.0388  -0.0024 60  GLN B CD  
1757 O OE1 . GLN B 60  ? 0.4517 0.6767 0.4346 -0.1641 0.0412  -0.0027 60  GLN B OE1 
1758 N NE2 . GLN B 60  ? 0.3556 0.5685 0.3336 -0.1628 0.0319  -0.0058 60  GLN B NE2 
1759 N N   . ARG B 61  ? 0.3236 0.4202 0.2537 -0.2069 0.0387  0.0057  61  ARG B N   
1760 C CA  . ARG B 61  ? 0.4035 0.4971 0.3334 -0.2151 0.0358  -0.0043 61  ARG B CA  
1761 C C   . ARG B 61  ? 0.4323 0.5021 0.3565 -0.2304 0.0387  -0.0051 61  ARG B C   
1762 O O   . ARG B 61  ? 0.4776 0.5619 0.4054 -0.2419 0.0382  -0.0146 61  ARG B O   
1763 C CB  . ARG B 61  ? 0.3312 0.4007 0.2538 -0.1997 0.0321  -0.0060 61  ARG B CB  
1764 C CG  . ARG B 61  ? 0.3519 0.4163 0.2717 -0.2091 0.0296  -0.0176 61  ARG B CG  
1765 C CD  . ARG B 61  ? 0.4140 0.4486 0.3245 -0.1975 0.0285  -0.0198 61  ARG B CD  
1766 N NE  . ARG B 61  ? 0.4186 0.4344 0.3250 -0.2118 0.0303  -0.0298 61  ARG B NE  
1767 C CZ  . ARG B 61  ? 0.4471 0.4334 0.3468 -0.2075 0.0319  -0.0347 61  ARG B CZ  
1768 N NH1 . ARG B 61  ? 0.4098 0.3820 0.3058 -0.1892 0.0315  -0.0300 61  ARG B NH1 
1769 N NH2 . ARG B 61  ? 0.4067 0.3784 0.3046 -0.2224 0.0347  -0.0459 61  ARG B NH2 
1770 N N   . TYR B 62  ? 0.4187 0.4524 0.3352 -0.2279 0.0409  0.0051  62  TYR B N   
1771 C CA  . TYR B 62  ? 0.5521 0.5589 0.4652 -0.2385 0.0431  0.0066  62  TYR B CA  
1772 C C   . TYR B 62  ? 0.5346 0.5629 0.4499 -0.2516 0.0453  0.0044  62  TYR B C   
1773 O O   . TYR B 62  ? 0.4481 0.4714 0.3638 -0.2641 0.0471  -0.0018 62  TYR B O   
1774 C CB  . TYR B 62  ? 0.5280 0.4981 0.4365 -0.2307 0.0431  0.0202  62  TYR B CB  
1775 C CG  . TYR B 62  ? 0.5785 0.5198 0.4872 -0.2399 0.0446  0.0237  62  TYR B CG  
1776 C CD1 . TYR B 62  ? 0.5980 0.5183 0.5100 -0.2441 0.0457  0.0153  62  TYR B CD1 
1777 C CD2 . TYR B 62  ? 0.6163 0.5518 0.5223 -0.2446 0.0451  0.0349  62  TYR B CD2 
1778 C CE1 . TYR B 62  ? 0.5821 0.4765 0.4977 -0.2518 0.0474  0.0183  62  TYR B CE1 
1779 C CE2 . TYR B 62  ? 0.6283 0.5371 0.5358 -0.2531 0.0463  0.0394  62  TYR B CE2 
1780 C CZ  . TYR B 62  ? 0.6461 0.5343 0.5598 -0.2563 0.0475  0.0311  62  TYR B CZ  
1781 O OH  . TYR B 62  ? 0.6721 0.5341 0.5908 -0.2642 0.0490  0.0353  62  TYR B OH  
1782 N N   . VAL B 63  ? 0.4778 0.5306 0.3950 -0.2489 0.0458  0.0083  63  VAL B N   
1783 C CA  . VAL B 63  ? 0.4526 0.5263 0.3714 -0.2610 0.0487  0.0053  63  VAL B CA  
1784 C C   . VAL B 63  ? 0.4788 0.5904 0.4081 -0.2667 0.0481  -0.0094 63  VAL B C   
1785 O O   . VAL B 63  ? 0.5337 0.6534 0.4640 -0.2801 0.0506  -0.0158 63  VAL B O   
1786 C CB  . VAL B 63  ? 0.4555 0.5417 0.3727 -0.2561 0.0498  0.0125  63  VAL B CB  
1787 C CG1 . VAL B 63  ? 0.4912 0.6011 0.4099 -0.2692 0.0535  0.0070  63  VAL B CG1 
1788 C CG2 . VAL B 63  ? 0.4740 0.5243 0.3810 -0.2518 0.0491  0.0273  63  VAL B CG2 
1789 N N   . THR B 64  ? 0.3897 0.5249 0.3279 -0.2563 0.0444  -0.0146 64  THR B N   
1790 C CA  . THR B 64  ? 0.4256 0.5982 0.3763 -0.2598 0.0416  -0.0276 64  THR B CA  
1791 C C   . THR B 64  ? 0.5004 0.6623 0.4480 -0.2680 0.0395  -0.0354 64  THR B C   
1792 O O   . THR B 64  ? 0.4681 0.6549 0.4230 -0.2755 0.0381  -0.0459 64  THR B O   
1793 C CB  . THR B 64  ? 0.4384 0.6427 0.4025 -0.2451 0.0366  -0.0302 64  THR B CB  
1794 O OG1 . THR B 64  ? 0.3412 0.5273 0.2999 -0.2364 0.0331  -0.0265 64  THR B OG1 
1795 C CG2 . THR B 64  ? 0.3391 0.5559 0.3081 -0.2368 0.0398  -0.0252 64  THR B CG2 
1796 N N   . ASP B 65  ? 0.4816 0.6065 0.4190 -0.2661 0.0396  -0.0313 65  ASP B N   
1797 C CA  . ASP B 65  ? 0.5428 0.6526 0.4762 -0.2749 0.0394  -0.0400 65  ASP B CA  
1798 C C   . ASP B 65  ? 0.5605 0.6674 0.4933 -0.2903 0.0444  -0.0436 65  ASP B C   
1799 O O   . ASP B 65  ? 0.5362 0.6562 0.4716 -0.2994 0.0440  -0.0549 65  ASP B O   
1800 C CB  . ASP B 65  ? 0.4783 0.5440 0.4027 -0.2700 0.0407  -0.0354 65  ASP B CB  
1801 C CG  . ASP B 65  ? 0.4853 0.5538 0.4083 -0.2590 0.0358  -0.0382 65  ASP B CG  
1802 O OD1 . ASP B 65  ? 0.4512 0.5562 0.3808 -0.2549 0.0302  -0.0422 65  ASP B OD1 
1803 O OD2 . ASP B 65  ? 0.5691 0.6031 0.4856 -0.2539 0.0372  -0.0365 65  ASP B OD2 
1804 N N   . TRP B 66  ? 0.5559 0.6462 0.4846 -0.2933 0.0487  -0.0338 66  TRP B N   
1805 C CA  . TRP B 66  ? 0.5490 0.6337 0.4757 -0.3085 0.0538  -0.0352 66  TRP B CA  
1806 C C   . TRP B 66  ? 0.5833 0.7090 0.5170 -0.3151 0.0550  -0.0419 66  TRP B C   
1807 O O   . TRP B 66  ? 0.5922 0.7313 0.5289 -0.3271 0.0571  -0.0520 66  TRP B O   
1808 C CB  . TRP B 66  ? 0.6148 0.6641 0.5337 -0.3089 0.0566  -0.0205 66  TRP B CB  
1809 C CG  . TRP B 66  ? 0.6657 0.7173 0.5816 -0.3233 0.0613  -0.0187 66  TRP B CG  
1810 C CD1 . TRP B 66  ? 0.7238 0.7607 0.6385 -0.3375 0.0653  -0.0224 66  TRP B CD1 
1811 C CD2 . TRP B 66  ? 0.6545 0.7241 0.5678 -0.3256 0.0630  -0.0137 66  TRP B CD2 
1812 N NE1 . TRP B 66  ? 0.7375 0.7817 0.6481 -0.3490 0.0692  -0.0193 66  TRP B NE1 
1813 C CE2 . TRP B 66  ? 0.6918 0.7563 0.6009 -0.3422 0.0679  -0.0143 66  TRP B CE2 
1814 C CE3 . TRP B 66  ? 0.5992 0.6889 0.5135 -0.3156 0.0614  -0.0096 66  TRP B CE3 
1815 C CZ2 . TRP B 66  ? 0.7072 0.7858 0.6113 -0.3497 0.0711  -0.0112 66  TRP B CZ2 
1816 C CZ3 . TRP B 66  ? 0.6130 0.7172 0.5237 -0.3225 0.0648  -0.0074 66  TRP B CZ3 
1817 C CH2 . TRP B 66  ? 0.6841 0.7826 0.5889 -0.3398 0.0695  -0.0083 66  TRP B CH2 
1818 N N   . ALA B 67  ? 0.5159 0.6618 0.4532 -0.3068 0.0541  -0.0375 67  ALA B N   
1819 C CA  . ALA B 67  ? 0.5187 0.7019 0.4646 -0.3117 0.0562  -0.0444 67  ALA B CA  
1820 C C   . ALA B 67  ? 0.5148 0.7375 0.4761 -0.3088 0.0518  -0.0577 67  ALA B C   
1821 O O   . ALA B 67  ? 0.5678 0.8184 0.5377 -0.3166 0.0538  -0.0671 67  ALA B O   
1822 C CB  . ALA B 67  ? 0.4952 0.6875 0.4417 -0.3028 0.0571  -0.0370 67  ALA B CB  
1823 N N   . GLY B 68  ? 0.5026 0.7362 0.3874 -0.2954 0.0330  -0.0283 68  GLY B N   
1824 C CA  . GLY B 68  ? 0.4779 0.7570 0.3660 -0.2971 0.0277  -0.0348 68  GLY B CA  
1825 C C   . GLY B 68  ? 0.4266 0.7472 0.3308 -0.2828 0.0199  -0.0310 68  GLY B C   
1826 O O   . GLY B 68  ? 0.4208 0.7346 0.3319 -0.2731 0.0200  -0.0248 68  GLY B O   
1827 N N   . PRO B 69  ? 0.4173 0.7829 0.3288 -0.2800 0.0129  -0.0347 69  PRO B N   
1828 C CA  . PRO B 69  ? 0.3856 0.7923 0.3158 -0.2619 0.0029  -0.0315 69  PRO B CA  
1829 C C   . PRO B 69  ? 0.4729 0.9186 0.4198 -0.2531 0.0030  -0.0330 69  PRO B C   
1830 O O   . PRO B 69  ? 0.3920 0.8546 0.3543 -0.2351 -0.0029 -0.0295 69  PRO B O   
1831 C CB  . PRO B 69  ? 0.4233 0.8714 0.3552 -0.2606 -0.0058 -0.0361 69  PRO B CB  
1832 C CG  . PRO B 69  ? 0.4338 0.8520 0.3463 -0.2804 0.0018  -0.0408 69  PRO B CG  
1833 C CD  . PRO B 69  ? 0.4148 0.7963 0.3175 -0.2928 0.0134  -0.0428 69  PRO B CD  
1834 N N   . SER B 70  ? 0.4661 0.9256 0.4093 -0.2653 0.0094  -0.0396 70  SER B N   
1835 C CA  . SER B 70  ? 0.4861 0.9864 0.4439 -0.2585 0.0102  -0.0438 70  SER B CA  
1836 C C   . SER B 70  ? 0.4799 0.9493 0.4354 -0.2568 0.0158  -0.0386 70  SER B C   
1837 O O   . SER B 70  ? 0.4511 0.9498 0.4187 -0.2495 0.0169  -0.0419 70  SER B O   
1838 C CB  . SER B 70  ? 0.5335 1.0644 0.4865 -0.2739 0.0147  -0.0545 70  SER B CB  
1839 O OG  . SER B 70  ? 0.5952 1.0830 0.5274 -0.2938 0.0232  -0.0551 70  SER B OG  
1840 N N   . ALA B 71  ? 0.4807 0.8916 0.4211 -0.2622 0.0191  -0.0309 71  ALA B N   
1841 C CA  . ALA B 71  ? 0.4504 0.8295 0.3872 -0.2592 0.0232  -0.0242 71  ALA B CA  
1842 C C   . ALA B 71  ? 0.3981 0.7927 0.3508 -0.2405 0.0212  -0.0211 71  ALA B C   
1843 O O   . ALA B 71  ? 0.3566 0.7569 0.3178 -0.2299 0.0171  -0.0191 71  ALA B O   
1844 C CB  . ALA B 71  ? 0.5088 0.8251 0.4299 -0.2639 0.0259  -0.0164 71  ALA B CB  
1845 N N   . LEU B 72  ? 0.4182 0.8206 0.3747 -0.2371 0.0246  -0.0215 72  LEU B N   
1846 C CA  . LEU B 72  ? 0.4560 0.8699 0.4265 -0.2200 0.0256  -0.0205 72  LEU B CA  
1847 C C   . LEU B 72  ? 0.4711 0.8388 0.4291 -0.2202 0.0292  -0.0122 72  LEU B C   
1848 O O   . LEU B 72  ? 0.4409 0.8011 0.3905 -0.2288 0.0312  -0.0114 72  LEU B O   
1849 C CB  . LEU B 72  ? 0.4282 0.8934 0.4151 -0.2136 0.0269  -0.0305 72  LEU B CB  
1850 C CG  . LEU B 72  ? 0.4107 0.9300 0.4156 -0.2066 0.0218  -0.0393 72  LEU B CG  
1851 C CD1 . LEU B 72  ? 0.4368 0.9972 0.4517 -0.2058 0.0248  -0.0504 72  LEU B CD1 
1852 C CD2 . LEU B 72  ? 0.3777 0.9135 0.4019 -0.1836 0.0169  -0.0377 72  LEU B CD2 
1853 N N   . ILE B 73  ? 0.2935 0.6316 0.2497 -0.2108 0.0297  -0.0058 73  ILE B N   
1854 C CA  . ILE B 73  ? 0.2959 0.5916 0.2411 -0.2088 0.0319  0.0018  73  ILE B CA  
1855 C C   . ILE B 73  ? 0.3176 0.6319 0.2702 -0.2003 0.0356  -0.0015 73  ILE B C   
1856 O O   . ILE B 73  ? 0.2806 0.6155 0.2453 -0.1872 0.0390  -0.0065 73  ILE B O   
1857 C CB  . ILE B 73  ? 0.2900 0.5479 0.2295 -0.2012 0.0320  0.0075  73  ILE B CB  
1858 C CG1 . ILE B 73  ? 0.3007 0.5373 0.2321 -0.2102 0.0288  0.0087  73  ILE B CG1 
1859 C CG2 . ILE B 73  ? 0.3337 0.5554 0.2654 -0.1965 0.0335  0.0139  73  ILE B CG2 
1860 C CD1 . ILE B 73  ? 0.3204 0.5328 0.2417 -0.2219 0.0285  0.0114  73  ILE B CD1 
1861 N N   . LYS B 74  ? 0.3252 0.6319 0.2699 -0.2075 0.0359  0.0010  74  LYS B N   
1862 C CA  . LYS B 74  ? 0.3011 0.6271 0.2508 -0.2026 0.0392  -0.0038 74  LYS B CA  
1863 C C   . LYS B 74  ? 0.3248 0.6215 0.2684 -0.1956 0.0403  0.0021  74  LYS B C   
1864 O O   . LYS B 74  ? 0.3043 0.6129 0.2548 -0.1861 0.0447  -0.0043 74  LYS B O   
1865 C CB  . LYS B 74  ? 0.3791 0.7210 0.3227 -0.2164 0.0388  -0.0054 74  LYS B CB  
1866 C CG  . LYS B 74  ? 0.3303 0.7047 0.2790 -0.2244 0.0384  -0.0135 74  LYS B CG  
1867 C CD  . LYS B 74  ? 0.3280 0.7443 0.2976 -0.2112 0.0405  -0.0252 74  LYS B CD  
1868 C CE  . LYS B 74  ? 0.3903 0.8473 0.3667 -0.2185 0.0399  -0.0350 74  LYS B CE  
1869 N NZ  . LYS B 74  ? 0.3991 0.9022 0.4003 -0.2023 0.0412  -0.0466 74  LYS B NZ  
1870 N N   . SER B 75  ? 0.3349 0.5948 0.2668 -0.1998 0.0371  0.0130  75  SER B N   
1871 C CA  . SER B 75  ? 0.3478 0.5838 0.2748 -0.1936 0.0371  0.0189  75  SER B CA  
1872 C C   . SER B 75  ? 0.3252 0.5209 0.2445 -0.1940 0.0342  0.0294  75  SER B C   
1873 O O   . SER B 75  ? 0.3692 0.5528 0.2840 -0.2027 0.0323  0.0340  75  SER B O   
1874 C CB  . SER B 75  ? 0.3746 0.6233 0.2970 -0.1996 0.0365  0.0209  75  SER B CB  
1875 O OG  . SER B 75  ? 0.4238 0.6563 0.3362 -0.2104 0.0332  0.0320  75  SER B OG  
1876 N N   . ILE B 76  ? 0.2954 0.4706 0.2141 -0.1845 0.0349  0.0313  76  ILE B N   
1877 C CA  . ILE B 76  ? 0.3020 0.4406 0.2158 -0.1828 0.0329  0.0403  76  ILE B CA  
1878 C C   . ILE B 76  ? 0.3015 0.4351 0.2134 -0.1781 0.0325  0.0455  76  ILE B C   
1879 O O   . ILE B 76  ? 0.2973 0.4377 0.2115 -0.1707 0.0353  0.0388  76  ILE B O   
1880 C CB  . ILE B 76  ? 0.3375 0.4549 0.2521 -0.1765 0.0341  0.0362  76  ILE B CB  
1881 C CG1 . ILE B 76  ? 0.3087 0.4350 0.2243 -0.1828 0.0335  0.0318  76  ILE B CG1 
1882 C CG2 . ILE B 76  ? 0.3726 0.4535 0.2844 -0.1736 0.0329  0.0431  76  ILE B CG2 
1883 C CD1 . ILE B 76  ? 0.2923 0.4002 0.2063 -0.1785 0.0342  0.0280  76  ILE B CD1 
1884 N N   . GLY B 77  ? 0.3467 0.4700 0.2541 -0.1831 0.0297  0.0575  77  GLY B N   
1885 C CA  . GLY B 77  ? 0.4086 0.5323 0.3140 -0.1803 0.0282  0.0650  77  GLY B CA  
1886 C C   . GLY B 77  ? 0.4415 0.5329 0.3467 -0.1762 0.0272  0.0752  77  GLY B C   
1887 O O   . GLY B 77  ? 0.5160 0.5861 0.4200 -0.1801 0.0268  0.0836  77  GLY B O   
1888 N N   . LEU B 78  ? 0.3181 0.4061 0.2254 -0.1687 0.0279  0.0734  78  LEU B N   
1889 C CA  . LEU B 78  ? 0.3247 0.3845 0.2339 -0.1643 0.0275  0.0812  78  LEU B CA  
1890 C C   . LEU B 78  ? 0.4067 0.4767 0.3140 -0.1637 0.0244  0.0937  78  LEU B C   
1891 O O   . LEU B 78  ? 0.3665 0.4641 0.2725 -0.1631 0.0243  0.0885  78  LEU B O   
1892 C CB  . LEU B 78  ? 0.4146 0.4608 0.3272 -0.1574 0.0311  0.0687  78  LEU B CB  
1893 C CG  . LEU B 78  ? 0.3736 0.4099 0.2868 -0.1567 0.0334  0.0572  78  LEU B CG  
1894 C CD1 . LEU B 78  ? 0.3581 0.3756 0.2722 -0.1502 0.0367  0.0479  78  LEU B CD1 
1895 C CD2 . LEU B 78  ? 0.4576 0.4765 0.3714 -0.1616 0.0321  0.0623  78  LEU B CD2 
1896 N N   . ARG B 79  ? 0.3973 0.4459 0.3045 -0.1638 0.0221  0.1102  79  ARG B N   
1897 C CA  . ARG B 79  ? 0.4149 0.4694 0.3217 -0.1609 0.0181  0.1249  79  ARG B CA  
1898 C C   . ARG B 79  ? 0.3622 0.3879 0.2769 -0.1548 0.0199  0.1252  79  ARG B C   
1899 O O   . ARG B 79  ? 0.4185 0.4097 0.3372 -0.1537 0.0219  0.1280  79  ARG B O   
1900 C CB  . ARG B 79  ? 0.4801 0.5316 0.3810 -0.1639 0.0135  0.1468  79  ARG B CB  
1901 C CG  . ARG B 79  ? 0.5722 0.6361 0.4725 -0.1589 0.0070  0.1652  79  ARG B CG  
1902 C CD  . ARG B 79  ? 0.6576 0.7279 0.5489 -0.1616 0.0013  0.1865  79  ARG B CD  
1903 N NE  . ARG B 79  ? 0.7434 0.7707 0.6348 -0.1586 0.0022  0.2027  79  ARG B NE  
1904 C CZ  . ARG B 79  ? 0.7922 0.7979 0.6785 -0.1657 0.0076  0.2012  79  ARG B CZ  
1905 N NH1 . ARG B 79  ? 0.7809 0.8066 0.6628 -0.1756 0.0106  0.1860  79  ARG B NH1 
1906 N NH2 . ARG B 79  ? 0.8208 0.7856 0.7071 -0.1627 0.0108  0.2144  79  ARG B NH2 
1907 N N   . LEU B 80  ? 0.3913 0.4319 0.3091 -0.1512 0.0203  0.1193  80  LEU B N   
1908 C CA  . LEU B 80  ? 0.4073 0.4225 0.3368 -0.1405 0.0222  0.1084  80  LEU B CA  
1909 C C   . LEU B 80  ? 0.4466 0.4478 0.3864 -0.1300 0.0169  0.1235  80  LEU B C   
1910 O O   . LEU B 80  ? 0.4973 0.5230 0.4371 -0.1257 0.0101  0.1372  80  LEU B O   
1911 C CB  . LEU B 80  ? 0.3938 0.4289 0.3255 -0.1358 0.0257  0.0874  80  LEU B CB  
1912 C CG  . LEU B 80  ? 0.4227 0.4699 0.3458 -0.1428 0.0317  0.0725  80  LEU B CG  
1913 C CD1 . LEU B 80  ? 0.4267 0.4888 0.3510 -0.1384 0.0368  0.0530  80  LEU B CD1 
1914 C CD2 . LEU B 80  ? 0.4265 0.4433 0.3480 -0.1458 0.0355  0.0666  80  LEU B CD2 
1915 N N   . GLY B 81  ? 0.4820 0.2217 0.2997 0.1234  -0.0398 0.0646  81  GLY B N   
1916 C CA  . GLY B 81  ? 0.4865 0.2297 0.3103 0.1273  -0.0453 0.0674  81  GLY B CA  
1917 C C   . GLY B 81  ? 0.5367 0.2880 0.3755 0.1284  -0.0507 0.0620  81  GLY B C   
1918 O O   . GLY B 81  ? 0.5051 0.2592 0.3428 0.1296  -0.0554 0.0560  81  GLY B O   
1919 N N   . VAL B 82  ? 0.4795 0.2339 0.3331 0.1280  -0.0496 0.0639  82  VAL B N   
1920 C CA  . VAL B 82  ? 0.4541 0.2160 0.3226 0.1297  -0.0536 0.0599  82  VAL B CA  
1921 C C   . VAL B 82  ? 0.4353 0.2012 0.3142 0.1241  -0.0500 0.0526  82  VAL B C   
1922 O O   . VAL B 82  ? 0.4700 0.2330 0.3483 0.1182  -0.0434 0.0522  82  VAL B O   
1923 C CB  . VAL B 82  ? 0.4555 0.2175 0.3368 0.1309  -0.0516 0.0641  82  VAL B CB  
1924 C CG1 . VAL B 82  ? 0.4754 0.2352 0.3488 0.1369  -0.0554 0.0727  82  VAL B CG1 
1925 C CG2 . VAL B 82  ? 0.5064 0.2633 0.3938 0.1244  -0.0430 0.0640  82  VAL B CG2 
1926 N N   . PRO B 83  ? 0.4444 0.2181 0.3339 0.1258  -0.0542 0.0476  83  PRO B N   
1927 C CA  . PRO B 83  ? 0.4508 0.2298 0.3513 0.1208  -0.0507 0.0412  83  PRO B CA  
1928 C C   . PRO B 83  ? 0.4714 0.2497 0.3825 0.1156  -0.0435 0.0411  83  PRO B C   
1929 O O   . PRO B 83  ? 0.4427 0.2178 0.3578 0.1171  -0.0422 0.0443  83  PRO B O   
1930 C CB  . PRO B 83  ? 0.4658 0.2539 0.3770 0.1248  -0.0571 0.0372  83  PRO B CB  
1931 C CG  . PRO B 83  ? 0.4852 0.2722 0.3859 0.1316  -0.0661 0.0408  83  PRO B CG  
1932 C CD  . PRO B 83  ? 0.5076 0.2869 0.3995 0.1325  -0.0631 0.0482  83  PRO B CD  
1933 N N   . TRP B 84  ? 0.3868 0.1674 0.3021 0.1097  -0.0390 0.0378  84  TRP B N   
1934 C CA  . TRP B 84  ? 0.3784 0.1585 0.3024 0.1045  -0.0336 0.0366  84  TRP B CA  
1935 C C   . TRP B 84  ? 0.3689 0.1577 0.3055 0.1044  -0.0340 0.0311  84  TRP B C   
1936 O O   . TRP B 84  ? 0.3805 0.1749 0.3209 0.1012  -0.0327 0.0283  84  TRP B O   
1937 C CB  . TRP B 84  ? 0.3740 0.1511 0.2941 0.0978  -0.0288 0.0384  84  TRP B CB  
1938 C CG  . TRP B 84  ? 0.3685 0.1435 0.2946 0.0922  -0.0246 0.0376  84  TRP B CG  
1939 C CD1 . TRP B 84  ? 0.3687 0.1422 0.3012 0.0928  -0.0239 0.0347  84  TRP B CD1 
1940 C CD2 . TRP B 84  ? 0.3646 0.1374 0.2895 0.0854  -0.0207 0.0401  84  TRP B CD2 
1941 N NE1 . TRP B 84  ? 0.3670 0.1357 0.2994 0.0867  -0.0203 0.0344  84  TRP B NE1 
1942 C CE2 . TRP B 84  ? 0.3641 0.1329 0.2926 0.0820  -0.0188 0.0382  84  TRP B CE2 
1943 C CE3 . TRP B 84  ? 0.3749 0.1481 0.2960 0.0819  -0.0185 0.0442  84  TRP B CE3 
1944 C CZ2 . TRP B 84  ? 0.3622 0.1276 0.2899 0.0749  -0.0161 0.0405  84  TRP B CZ2 
1945 C CZ3 . TRP B 84  ? 0.3953 0.1673 0.3189 0.0749  -0.0151 0.0472  84  TRP B CZ3 
1946 C CH2 . TRP B 84  ? 0.4088 0.1769 0.3352 0.0713  -0.0145 0.0455  84  TRP B CH2 
1947 N N   . TYR B 85  ? 0.3908 0.1809 0.3352 0.1082  -0.0351 0.0303  85  TYR B N   
1948 C CA  . TYR B 85  ? 0.3646 0.1637 0.3222 0.1092  -0.0352 0.0259  85  TYR B CA  
1949 C C   . TYR B 85  ? 0.3733 0.1705 0.3358 0.1046  -0.0294 0.0233  85  TYR B C   
1950 O O   . TYR B 85  ? 0.3776 0.1651 0.3338 0.1015  -0.0262 0.0249  85  TYR B O   
1951 C CB  . TYR B 85  ? 0.3715 0.1728 0.3364 0.1157  -0.0382 0.0273  85  TYR B CB  
1952 C CG  . TYR B 85  ? 0.3774 0.1832 0.3396 0.1210  -0.0460 0.0291  85  TYR B CG  
1953 C CD1 . TYR B 85  ? 0.3702 0.1838 0.3341 0.1211  -0.0503 0.0253  85  TYR B CD1 
1954 C CD2 . TYR B 85  ? 0.4534 0.2553 0.4117 0.1263  -0.0496 0.0346  85  TYR B CD2 
1955 C CE1 . TYR B 85  ? 0.4825 0.2986 0.4421 0.1261  -0.0591 0.0261  85  TYR B CE1 
1956 C CE2 . TYR B 85  ? 0.5317 0.3376 0.4860 0.1314  -0.0582 0.0366  85  TYR B CE2 
1957 C CZ  . TYR B 85  ? 0.4810 0.2934 0.4351 0.1313  -0.0635 0.0319  85  TYR B CZ  
1958 O OH  . TYR B 85  ? 0.4722 0.2872 0.4205 0.1363  -0.0737 0.0333  85  TYR B OH  
1959 N N   . ALA B 86  ? 0.3539 0.1600 0.3270 0.1042  -0.0283 0.0193  86  ALA B N   
1960 C CA  . ALA B 86  ? 0.3372 0.1413 0.3141 0.1010  -0.0234 0.0166  86  ALA B CA  
1961 C C   . ALA B 86  ? 0.3666 0.1595 0.3409 0.1024  -0.0207 0.0170  86  ALA B C   
1962 O O   . ALA B 86  ? 0.4197 0.2121 0.3983 0.1076  -0.0220 0.0189  86  ALA B O   
1963 C CB  . ALA B 86  ? 0.3261 0.1417 0.3166 0.1025  -0.0226 0.0131  86  ALA B CB  
1964 N N   . TYR B 87  ? 0.3682 0.1514 0.3352 0.0975  -0.0171 0.0157  87  TYR B N   
1965 C CA  . TYR B 87  ? 0.4105 0.1803 0.3734 0.0974  -0.0134 0.0145  87  TYR B CA  
1966 C C   . TYR B 87  ? 0.5180 0.2783 0.4744 0.0981  -0.0140 0.0189  87  TYR B C   
1967 O O   . TYR B 87  ? 0.5483 0.2969 0.5025 0.0984  -0.0107 0.0181  87  TYR B O   
1968 C CB  . TYR B 87  ? 0.3707 0.1429 0.3446 0.1025  -0.0111 0.0117  87  TYR B CB  
1969 C CG  . TYR B 87  ? 0.3890 0.1707 0.3706 0.1022  -0.0098 0.0078  87  TYR B CG  
1970 C CD1 . TYR B 87  ? 0.4236 0.1993 0.3981 0.0978  -0.0064 0.0040  87  TYR B CD1 
1971 C CD2 . TYR B 87  ? 0.3694 0.1657 0.3650 0.1063  -0.0119 0.0084  87  TYR B CD2 
1972 C CE1 . TYR B 87  ? 0.3506 0.1353 0.3323 0.0981  -0.0049 0.0011  87  TYR B CE1 
1973 C CE2 . TYR B 87  ? 0.3484 0.1542 0.3529 0.1061  -0.0101 0.0054  87  TYR B CE2 
1974 C CZ  . TYR B 87  ? 0.3384 0.1387 0.3363 0.1023  -0.0065 0.0018  87  TYR B CZ  
1975 O OH  . TYR B 87  ? 0.3747 0.1848 0.3818 0.1027  -0.0045 -0.0005 87  TYR B OH  
1976 N N   . ASP B 88  ? 0.4731 0.2376 0.4263 0.0987  -0.0177 0.0233  88  ASP B N   
1977 C CA  . ASP B 88  ? 0.4967 0.2522 0.4430 0.0989  -0.0177 0.0281  88  ASP B CA  
1978 C C   . ASP B 88  ? 0.4780 0.2269 0.4151 0.0916  -0.0160 0.0293  88  ASP B C   
1979 O O   . ASP B 88  ? 0.4357 0.1897 0.3721 0.0873  -0.0161 0.0279  88  ASP B O   
1980 C CB  . ASP B 88  ? 0.4248 0.1866 0.3704 0.1038  -0.0224 0.0327  88  ASP B CB  
1981 C CG  . ASP B 88  ? 0.5527 0.3061 0.4951 0.1068  -0.0223 0.0381  88  ASP B CG  
1982 O OD1 . ASP B 88  ? 0.5640 0.3065 0.5034 0.1036  -0.0185 0.0388  88  ASP B OD1 
1983 O OD2 . ASP B 88  ? 0.5161 0.2737 0.4590 0.1124  -0.0262 0.0420  88  ASP B OD2 
1984 N N   . THR B 89  ? 0.5845 0.2191 0.4360 -0.0898 -0.0193 0.0228  89  THR B N   
1985 C CA  . THR B 89  ? 0.5900 0.2312 0.4455 -0.1002 -0.0122 0.0209  89  THR B CA  
1986 C C   . THR B 89  ? 0.6982 0.3277 0.5339 -0.1080 -0.0087 0.0310  89  THR B C   
1987 O O   . THR B 89  ? 0.6596 0.2701 0.4835 -0.1065 -0.0082 0.0426  89  THR B O   
1988 C CB  . THR B 89  ? 0.5997 0.2370 0.4695 -0.1038 -0.0071 0.0178  89  THR B CB  
1989 O OG1 . THR B 89  ? 0.5860 0.2363 0.4720 -0.0996 -0.0095 0.0073  89  THR B OG1 
1990 C CG2 . THR B 89  ? 0.5646 0.2067 0.4340 -0.1186 -0.0002 0.0156  89  THR B CG2 
1991 N N   . VAL B 90  ? 0.5618 0.2015 0.3927 -0.1159 -0.0049 0.0282  90  VAL B N   
1992 C CA  . VAL B 90  ? 0.5871 0.2183 0.3997 -0.1259 0.0006  0.0367  90  VAL B CA  
1993 C C   . VAL B 90  ? 0.6389 0.2740 0.4588 -0.1380 0.0091  0.0358  90  VAL B C   
1994 O O   . VAL B 90  ? 0.6431 0.2939 0.4759 -0.1435 0.0113  0.0270  90  VAL B O   
1995 C CB  . VAL B 90  ? 0.5610 0.1977 0.3611 -0.1300 0.0029  0.0340  90  VAL B CB  
1996 C CG1 . VAL B 90  ? 0.5781 0.2179 0.3666 -0.1421 0.0122  0.0394  90  VAL B CG1 
1997 C CG2 . VAL B 90  ? 0.5662 0.2001 0.3530 -0.1230 -0.0036 0.0356  90  VAL B CG2 
1998 N N   . THR B 91  ? 0.6542 0.2739 0.4640 -0.1433 0.0145  0.0459  91  THR B N   
1999 C CA  . THR B 91  ? 0.7081 0.3300 0.5222 -0.1582 0.0247  0.0444  91  THR B CA  
2000 C C   . THR B 91  ? 0.7238 0.3496 0.5211 -0.1695 0.0316  0.0502  91  THR B C   
2001 O O   . THR B 91  ? 0.7239 0.3363 0.5011 -0.1675 0.0322  0.0627  91  THR B O   
2002 C CB  . THR B 91  ? 0.7656 0.3655 0.5824 -0.1579 0.0303  0.0510  91  THR B CB  
2003 O OG1 . THR B 91  ? 0.7500 0.3462 0.5825 -0.1473 0.0253  0.0452  91  THR B OG1 
2004 C CG2 . THR B 91  ? 0.7256 0.3285 0.5482 -0.1762 0.0420  0.0456  91  THR B CG2 
2005 N N   . PHE B 92  ? 0.6536 0.2997 0.4579 -0.1822 0.0375  0.0421  92  PHE B N   
2006 C CA  . PHE B 92  ? 0.6867 0.3399 0.4781 -0.1948 0.0471  0.0465  92  PHE B CA  
2007 C C   . PHE B 92  ? 0.6962 0.3469 0.4883 -0.2095 0.0577  0.0487  92  PHE B C   
2008 O O   . PHE B 92  ? 0.7268 0.3870 0.5351 -0.2188 0.0608  0.0392  92  PHE B O   
2009 C CB  . PHE B 92  ? 0.6143 0.3041 0.4203 -0.1942 0.0496  0.0367  92  PHE B CB  
2010 C CG  . PHE B 92  ? 0.6293 0.3264 0.4362 -0.1762 0.0436  0.0338  92  PHE B CG  
2011 C CD1 . PHE B 92  ? 0.6227 0.3226 0.4430 -0.1646 0.0359  0.0279  92  PHE B CD1 
2012 C CD2 . PHE B 92  ? 0.6167 0.3175 0.4099 -0.1729 0.0477  0.0358  92  PHE B CD2 
2013 C CE1 . PHE B 92  ? 0.5712 0.2738 0.3921 -0.1502 0.0336  0.0243  92  PHE B CE1 
2014 C CE2 . PHE B 92  ? 0.6351 0.3402 0.4290 -0.1597 0.0455  0.0297  92  PHE B CE2 
2015 C CZ  . PHE B 92  ? 0.6190 0.3231 0.4271 -0.1486 0.0390  0.0242  92  PHE B CZ  
2016 N N   . SER B 93  ? 0.7384 0.3768 0.5114 -0.2130 0.0640  0.0609  93  SER B N   
2017 C CA  . SER B 93  ? 0.8562 0.4921 0.6280 -0.2284 0.0768  0.0636  93  SER B CA  
2018 C C   . SER B 93  ? 0.8573 0.5108 0.6161 -0.2401 0.0858  0.0664  93  SER B C   
2019 O O   . SER B 93  ? 0.8551 0.5104 0.5978 -0.2339 0.0830  0.0717  93  SER B O   
2020 C CB  . SER B 93  ? 0.8794 0.4819 0.6409 -0.2213 0.0790  0.0784  93  SER B CB  
2021 O OG  . SER B 93  ? 0.9525 0.5440 0.6910 -0.2096 0.0736  0.0943  93  SER B OG  
2022 N N   . GLY B 94  ? 0.8250 0.4944 0.5912 -0.2584 0.0980  0.0610  94  GLY B N   
2023 C CA  . GLY B 94  ? 0.7962 0.4893 0.5549 -0.2705 0.1087  0.0613  94  GLY B CA  
2024 C C   . GLY B 94  ? 0.9122 0.5992 0.6633 -0.2847 0.1219  0.0670  94  GLY B C   
2025 O O   . GLY B 94  ? 0.8772 0.5484 0.6360 -0.2905 0.1258  0.0654  94  GLY B O   
2026 N N   . GLU B 95  ? 0.9141 0.6132 0.6496 -0.2907 0.1304  0.0728  95  GLU B N   
2027 C CA  . GLU B 95  ? 0.9476 0.6446 0.6748 -0.3051 0.1443  0.0784  95  GLU B CA  
2028 C C   . GLU B 95  ? 0.8922 0.6250 0.6150 -0.3148 0.1544  0.0744  95  GLU B C   
2029 O O   . GLU B 95  ? 0.8074 0.5468 0.5157 -0.3063 0.1518  0.0776  95  GLU B O   
2030 C CB  . GLU B 95  ? 1.0487 0.7068 0.7515 -0.2956 0.1438  0.0996  95  GLU B CB  
2031 C CG  . GLU B 95  ? 1.1357 0.7866 0.8273 -0.3091 0.1594  0.1091  95  GLU B CG  
2032 C CD  . GLU B 95  ? 1.2199 0.8454 0.8824 -0.2976 0.1590  0.1344  95  GLU B CD  
2033 O OE1 . GLU B 95  ? 1.2315 0.8468 0.8833 -0.2797 0.1459  0.1434  95  GLU B OE1 
2034 O OE2 . GLU B 95  ? 1.2785 0.8974 0.9285 -0.3066 0.1719  0.1460  95  GLU B OE2 
2035 N N   . VAL B 96  ? 0.8244 0.5832 0.5608 -0.3331 0.1670  0.0653  96  VAL B N   
2036 C CA  . VAL B 96  ? 0.8251 0.6202 0.5596 -0.3419 0.1789  0.0614  96  VAL B CA  
2037 C C   . VAL B 96  ? 0.8656 0.6399 0.5700 -0.3435 0.1855  0.0770  96  VAL B C   
2038 O O   . VAL B 96  ? 0.9004 0.6461 0.5967 -0.3487 0.1895  0.0869  96  VAL B O   
2039 C CB  . VAL B 96  ? 0.8211 0.6583 0.5820 -0.3608 0.1901  0.0463  96  VAL B CB  
2040 C CG1 . VAL B 96  ? 0.8305 0.7021 0.5882 -0.3691 0.2044  0.0441  96  VAL B CG1 
2041 C CG2 . VAL B 96  ? 0.7795 0.6519 0.5703 -0.3583 0.1843  0.0327  96  VAL B CG2 
2042 N N   . THR B 97  ? 0.8911 0.6802 0.5786 -0.3386 0.1880  0.0792  97  THR B N   
2043 C CA  . THR B 97  ? 0.9316 0.7076 0.5876 -0.3392 0.1928  0.0947  97  THR B CA  
2044 C C   . THR B 97  ? 0.9801 0.7909 0.6348 -0.3530 0.2089  0.0881  97  THR B C   
2045 O O   . THR B 97  ? 1.0225 0.8247 0.6564 -0.3594 0.2165  0.1003  97  THR B O   
2046 C CB  . THR B 97  ? 0.9202 0.6876 0.5509 -0.3240 0.1826  0.1024  97  THR B CB  
2047 O OG1 . THR B 97  ? 0.8701 0.6692 0.5089 -0.3220 0.1856  0.0856  97  THR B OG1 
2048 C CG2 . THR B 97  ? 0.8917 0.6253 0.5224 -0.3093 0.1664  0.1108  97  THR B CG2 
2049 N N   . ALA B 98  ? 0.8848 0.7365 0.5627 -0.3560 0.2153  0.0698  98  ALA B N   
2050 C CA  . ALA B 98  ? 0.8950 0.7844 0.5752 -0.3663 0.2313  0.0616  98  ALA B CA  
2051 C C   . ALA B 98  ? 0.8676 0.8037 0.5864 -0.3726 0.2398  0.0437  98  ALA B C   
2052 O O   . ALA B 98  ? 0.8324 0.7816 0.5739 -0.3642 0.2341  0.0357  98  ALA B O   
2053 C CB  . ALA B 98  ? 0.8949 0.7955 0.5546 -0.3575 0.2341  0.0591  98  ALA B CB  
2054 N N   . VAL B 99  ? 0.8859 0.8503 0.6124 -0.3871 0.2535  0.0385  99  VAL B N   
2055 C CA  . VAL B 99  ? 0.8636 0.8849 0.6270 -0.3919 0.2633  0.0219  99  VAL B CA  
2056 C C   . VAL B 99  ? 0.9702 1.0232 0.7304 -0.3981 0.2797  0.0166  99  VAL B C   
2057 O O   . VAL B 99  ? 0.9214 0.9614 0.6642 -0.4127 0.2860  0.0231  99  VAL B O   
2058 C CB  . VAL B 99  ? 0.8657 0.8982 0.6521 -0.4080 0.2623  0.0167  99  VAL B CB  
2059 C CG1 . VAL B 99  ? 0.8399 0.9428 0.6670 -0.4097 0.2698  0.0004  99  VAL B CG1 
2060 C CG2 . VAL B 99  ? 0.8735 0.8698 0.6604 -0.4038 0.2470  0.0210  99  VAL B CG2 
2061 N N   . ASN B 100 ? 1.0394 1.1322 0.8167 -0.3860 0.2885  0.0050  100 ASN B N   
2062 C CA  . ASN B 100 ? 1.1082 1.2318 0.8841 -0.3894 0.3050  -0.0023 100 ASN B CA  
2063 C C   . ASN B 100 ? 1.1146 1.2920 0.9254 -0.3737 0.3172  -0.0177 100 ASN B C   
2064 O O   . ASN B 100 ? 1.1146 1.2884 0.9302 -0.3547 0.3165  -0.0215 100 ASN B O   
2065 C CB  . ASN B 100 ? 1.1338 1.2240 0.8674 -0.3876 0.3056  0.0051  100 ASN B CB  
2066 N N   . ASP B 101 ? 1.0203 1.2836 0.9077 -0.3753 0.2658  0.0318  101 ASP B N   
2067 C CA  . ASP B 101 ? 0.9607 1.2847 0.8712 -0.3658 0.2664  0.0151  101 ASP B CA  
2068 C C   . ASP B 101 ? 0.9019 1.2513 0.8333 -0.3580 0.2496  -0.0004 101 ASP B C   
2069 O O   . ASP B 101 ? 0.8231 1.2098 0.7628 -0.3406 0.2449  -0.0103 101 ASP B O   
2070 C CB  . ASP B 101 ? 0.9335 1.2579 0.8176 -0.3449 0.2695  0.0217  101 ASP B CB  
2071 N N   . GLY B 102 ? 0.9271 1.2563 0.8669 -0.3700 0.2410  -0.0026 102 GLY B N   
2072 C CA  . GLY B 102 ? 0.9163 1.2662 0.8733 -0.3635 0.2251  -0.0160 102 GLY B CA  
2073 C C   . GLY B 102 ? 0.8768 1.1941 0.8054 -0.3434 0.2116  -0.0074 102 GLY B C   
2074 O O   . GLY B 102 ? 0.8589 1.1987 0.7979 -0.3321 0.1998  -0.0171 102 GLY B O   
2075 N N   . LEU B 103 ? 0.7815 1.0475 0.6745 -0.3380 0.2133  0.0108  103 LEU B N   
2076 C CA  . LEU B 103 ? 0.7111 0.9410 0.5766 -0.3203 0.2000  0.0195  103 LEU B CA  
2077 C C   . LEU B 103 ? 0.7319 0.9041 0.5810 -0.3280 0.1942  0.0315  103 LEU B C   
2078 O O   . LEU B 103 ? 0.7225 0.8619 0.5558 -0.3347 0.2021  0.0446  103 LEU B O   
2079 C CB  . LEU B 103 ? 0.6510 0.8716 0.4888 -0.3027 0.2032  0.0287  103 LEU B CB  
2080 N N   . ILE B 104 ? 0.6402 0.8011 0.4935 -0.3256 0.1809  0.0270  104 ILE B N   
2081 C CA  . ILE B 104 ? 0.6554 0.7643 0.4973 -0.3313 0.1745  0.0355  104 ILE B CA  
2082 C C   . ILE B 104 ? 0.6662 0.7328 0.4774 -0.3121 0.1633  0.0486  104 ILE B C   
2083 O O   . ILE B 104 ? 0.6217 0.7010 0.4281 -0.2966 0.1550  0.0452  104 ILE B O   
2084 C CB  . ILE B 104 ? 0.6524 0.7726 0.5184 -0.3413 0.1665  0.0213  104 ILE B CB  
2085 C CG1 . ILE B 104 ? 0.6921 0.8652 0.5933 -0.3579 0.1745  0.0043  104 ILE B CG1 
2086 C CG2 . ILE B 104 ? 0.6607 0.7269 0.5170 -0.3477 0.1622  0.0286  104 ILE B CG2 
2087 C CD1 . ILE B 104 ? 0.6564 0.8912 0.5789 -0.3484 0.1704  -0.0106 104 ILE B CD1 
2088 N N   . THR B 105 ? 0.6776 0.6957 0.4696 -0.3122 0.1629  0.0630  105 THR B N   
2089 C CA  . THR B 105 ? 0.7263 0.7061 0.4931 -0.2939 0.1509  0.0742  105 THR B CA  
2090 C C   . THR B 105 ? 0.7612 0.7016 0.5281 -0.2963 0.1428  0.0772  105 THR B C   
2091 O O   . THR B 105 ? 0.7904 0.7105 0.5610 -0.3087 0.1496  0.0813  105 THR B O   
2092 C CB  . THR B 105 ? 0.7230 0.6828 0.4638 -0.2853 0.1558  0.0898  105 THR B CB  
2093 O OG1 . THR B 105 ? 0.6967 0.6931 0.4370 -0.2824 0.1641  0.0856  105 THR B OG1 
2094 C CG2 . THR B 105 ? 0.7100 0.6375 0.4283 -0.2655 0.1417  0.0990  105 THR B CG2 
2095 N N   . VAL B 106 ? 0.6554 0.5853 0.4191 -0.2840 0.1291  0.0747  106 VAL B N   
2096 C CA  . VAL B 106 ? 0.6603 0.5546 0.4246 -0.2836 0.1210  0.0760  106 VAL B CA  
2097 C C   . VAL B 106 ? 0.6614 0.5214 0.4045 -0.2635 0.1101  0.0880  106 VAL B C   
2098 O O   . VAL B 106 ? 0.6750 0.5443 0.4091 -0.2491 0.1031  0.0882  106 VAL B O   
2099 C CB  . VAL B 106 ? 0.6789 0.5914 0.4619 -0.2882 0.1143  0.0607  106 VAL B CB  
2100 C CG1 . VAL B 106 ? 0.7210 0.5968 0.5053 -0.2887 0.1075  0.0605  106 VAL B CG1 
2101 C CG2 . VAL B 106 ? 0.6758 0.6325 0.4834 -0.3067 0.1234  0.0466  106 VAL B CG2 
2102 N N   . LYS B 107 ? 0.6999 0.5223 0.4364 -0.2621 0.1090  0.0973  107 LYS B N   
2103 C CA  . LYS B 107 ? 0.7838 0.5771 0.5059 -0.2432 0.0975  0.1065  107 LYS B CA  
2104 C C   . LYS B 107 ? 0.8056 0.5860 0.5383 -0.2401 0.0881  0.0986  107 LYS B C   
2105 O O   . LYS B 107 ? 0.8623 0.6300 0.6062 -0.2510 0.0914  0.0941  107 LYS B O   
2106 C CB  . LYS B 107 ? 0.8762 0.6379 0.5848 -0.2405 0.1013  0.1222  107 LYS B CB  
2107 C CG  . LYS B 107 ? 0.9248 0.6613 0.6208 -0.2206 0.0890  0.1311  107 LYS B CG  
2108 C CD  . LYS B 107 ? 1.0094 0.7109 0.6987 -0.2191 0.0918  0.1445  107 LYS B CD  
2109 C CE  . LYS B 107 ? 1.0345 0.7173 0.7112 -0.1985 0.0799  0.1541  107 LYS B CE  
2110 N NZ  . LYS B 107 ? 1.0606 0.7553 0.7179 -0.1887 0.0778  0.1622  107 LYS B NZ  
2111 N N   . VAL B 108 ? 0.7333 0.5169 0.4627 -0.2254 0.0770  0.0962  108 VAL B N   
2112 C CA  . VAL B 108 ? 0.6414 0.4132 0.3792 -0.2203 0.0683  0.0894  108 VAL B CA  
2113 C C   . VAL B 108 ? 0.6711 0.4162 0.3996 -0.2018 0.0587  0.0984  108 VAL B C   
2114 O O   . VAL B 108 ? 0.7021 0.4500 0.4189 -0.1901 0.0545  0.1052  108 VAL B O   
2115 C CB  . VAL B 108 ? 0.5946 0.3938 0.3389 -0.2191 0.0641  0.0786  108 VAL B CB  
2116 C CG1 . VAL B 108 ? 0.5778 0.3633 0.3284 -0.2132 0.0556  0.0723  108 VAL B CG1 
2117 C CG2 . VAL B 108 ? 0.5880 0.4204 0.3439 -0.2372 0.0735  0.0691  108 VAL B CG2 
2118 N N   . VAL B 109 ? 0.6479 0.3691 0.3826 -0.1996 0.0556  0.0974  109 VAL B N   
2119 C CA  . VAL B 109 ? 0.6345 0.3354 0.3651 -0.1819 0.0462  0.1035  109 VAL B CA  
2120 C C   . VAL B 109 ? 0.6581 0.3553 0.3999 -0.1776 0.0401  0.0932  109 VAL B C   
2121 O O   . VAL B 109 ? 0.6215 0.3136 0.3726 -0.1881 0.0439  0.0849  109 VAL B O   
2122 C CB  . VAL B 109 ? 0.7251 0.3966 0.4507 -0.1793 0.0488  0.1151  109 VAL B CB  
2123 C CG1 . VAL B 109 ? 0.7161 0.3722 0.4384 -0.1602 0.0386  0.1213  109 VAL B CG1 
2124 C CG2 . VAL B 109 ? 0.6943 0.3677 0.4071 -0.1849 0.0567  0.1261  109 VAL B CG2 
2125 N N   . GLY B 110 ? 0.6664 0.3670 0.4071 -0.1629 0.0312  0.0931  110 GLY B N   
2126 C CA  . GLY B 110 ? 0.6445 0.3390 0.3942 -0.1559 0.0257  0.0856  110 GLY B CA  
2127 C C   . GLY B 110 ? 0.6639 0.3365 0.4142 -0.1416 0.0203  0.0925  110 GLY B C   
2128 O O   . GLY B 110 ? 0.6167 0.2902 0.3608 -0.1306 0.0148  0.1002  110 GLY B O   
2129 N N   . ARG B 111 ? 0.6913 0.3447 0.4489 -0.1423 0.0219  0.0892  111 ARG B N   
2130 C CA  . ARG B 111 ? 0.6726 0.3042 0.4322 -0.1292 0.0179  0.0957  111 ARG B CA  
2131 C C   . ARG B 111 ? 0.6552 0.2833 0.4251 -0.1209 0.0140  0.0869  111 ARG B C   
2132 O O   . ARG B 111 ? 0.6476 0.2777 0.4227 -0.1287 0.0170  0.0756  111 ARG B O   
2133 C CB  . ARG B 111 ? 0.7205 0.3274 0.4795 -0.1352 0.0244  0.1010  111 ARG B CB  
2134 C CG  . ARG B 111 ? 0.7357 0.3443 0.4852 -0.1466 0.0313  0.1088  111 ARG B CG  
2135 C CD  . ARG B 111 ? 0.7915 0.3714 0.5402 -0.1503 0.0377  0.1165  111 ARG B CD  
2136 N NE  . ARG B 111 ? 0.8272 0.4022 0.5620 -0.1495 0.0406  0.1321  111 ARG B NE  
2137 C CZ  . ARG B 111 ? 0.8395 0.4214 0.5686 -0.1638 0.0493  0.1349  111 ARG B CZ  
2138 N NH1 . ARG B 111 ? 0.8549 0.4501 0.5927 -0.1806 0.0555  0.1225  111 ARG B NH1 
2139 N NH2 . ARG B 111 ? 0.8672 0.4438 0.5816 -0.1614 0.0521  0.1500  111 ARG B NH2 
2140 N N   . ASN B 112 ? 0.5995 0.2229 0.3718 -0.1057 0.0074  0.0916  112 ASN B N   
2141 C CA  . ASN B 112 ? 0.7038 0.3202 0.4866 -0.0973 0.0054  0.0843  112 ASN B CA  
2142 C C   . ASN B 112 ? 0.7209 0.3155 0.5068 -0.0847 0.0026  0.0923  112 ASN B C   
2143 O O   . ASN B 112 ? 0.7313 0.3128 0.5102 -0.0846 0.0035  0.1030  112 ASN B O   
2144 C CB  . ASN B 112 ? 0.5912 0.2270 0.3776 -0.0911 0.0009  0.0795  112 ASN B CB  
2145 C CG  . ASN B 112 ? 0.6280 0.2717 0.4109 -0.0818 -0.0061 0.0883  112 ASN B CG  
2146 O OD1 . ASN B 112 ? 0.6862 0.3180 0.4656 -0.0746 -0.0099 0.0979  112 ASN B OD1 
2147 N ND2 . ASN B 112 ? 0.5321 0.1948 0.3147 -0.0819 -0.0082 0.0848  112 ASN B ND2 
2148 N N   . THR B 113 ? 0.7311 0.3211 0.5265 -0.0737 -0.0003 0.0879  113 THR B N   
2149 C CA  . THR B 113 ? 0.7717 0.3404 0.5714 -0.0607 -0.0029 0.0945  113 THR B CA  
2150 C C   . THR B 113 ? 0.8142 0.3843 0.6065 -0.0507 -0.0106 0.1085  113 THR B C   
2151 O O   . THR B 113 ? 0.7879 0.3390 0.5769 -0.0429 -0.0120 0.1188  113 THR B O   
2152 C CB  . THR B 113 ? 0.7713 0.3368 0.5836 -0.0501 -0.0040 0.0861  113 THR B CB  
2153 O OG1 . THR B 113 ? 0.8166 0.4008 0.6317 -0.0439 -0.0098 0.0859  113 THR B OG1 
2154 C CG2 . THR B 113 ? 0.6872 0.2511 0.5029 -0.0592 0.0030  0.0716  113 THR B CG2 
2155 N N   . LEU B 114 ? 0.7398 0.3314 0.5283 -0.0508 -0.0158 0.1089  114 LEU B N   
2156 C CA  . LEU B 114 ? 0.7532 0.3481 0.5321 -0.0422 -0.0248 0.1204  114 LEU B CA  
2157 C C   . LEU B 114 ? 0.7589 0.3514 0.5210 -0.0487 -0.0226 0.1307  114 LEU B C   
2158 O O   . LEU B 114 ? 0.7987 0.3906 0.5489 -0.0409 -0.0298 0.1418  114 LEU B O   
2159 C CB  . LEU B 114 ? 0.7088 0.3256 0.4890 -0.0416 -0.0310 0.1158  114 LEU B CB  
2160 C CG  . LEU B 114 ? 0.6929 0.3114 0.4881 -0.0321 -0.0354 0.1096  114 LEU B CG  
2161 C CD1 . LEU B 114 ? 0.6695 0.3073 0.4649 -0.0346 -0.0403 0.1058  114 LEU B CD1 
2162 C CD2 . LEU B 114 ? 0.7461 0.3497 0.5442 -0.0156 -0.0441 0.1179  114 LEU B CD2 
2163 N N   . GLY B 115 ? 0.8005 0.3921 0.5609 -0.0629 -0.0130 0.1270  115 GLY B N   
2164 C CA  . GLY B 115 ? 0.8196 0.4084 0.5654 -0.0708 -0.0086 0.1362  115 GLY B CA  
2165 C C   . GLY B 115 ? 0.7755 0.3845 0.5174 -0.0857 -0.0032 0.1296  115 GLY B C   
2166 O O   . GLY B 115 ? 0.7582 0.3755 0.5096 -0.0939 0.0008  0.1176  115 GLY B O   
2167 N N   . ASP B 116 ? 0.7138 0.3310 0.4407 -0.0885 -0.0031 0.1375  116 ASP B N   
2168 C CA  . ASP B 116 ? 0.6643 0.3015 0.3871 -0.1014 0.0023  0.1320  116 ASP B CA  
2169 C C   . ASP B 116 ? 0.6095 0.2692 0.3342 -0.0982 -0.0039 0.1243  116 ASP B C   
2170 O O   . ASP B 116 ? 0.6095 0.2756 0.3249 -0.0905 -0.0111 0.1291  116 ASP B O   
2171 C CB  . ASP B 116 ? 0.7638 0.4006 0.4692 -0.1058 0.0065  0.1432  116 ASP B CB  
2172 C CG  . ASP B 116 ? 0.8332 0.4480 0.5369 -0.1129 0.0157  0.1505  116 ASP B CG  
2173 O OD1 . ASP B 116 ? 0.8735 0.4744 0.5899 -0.1164 0.0190  0.1449  116 ASP B OD1 
2174 O OD2 . ASP B 116 ? 0.8596 0.4707 0.5486 -0.1156 0.0202  0.1617  116 ASP B OD2 
2175 N N   . HIS B 117 ? 0.6147 0.2855 0.3505 -0.1043 -0.0011 0.1125  117 HIS B N   
2176 C CA  . HIS B 117 ? 0.5568 0.2457 0.2960 -0.1009 -0.0055 0.1053  117 HIS B CA  
2177 C C   . HIS B 117 ? 0.5505 0.2583 0.2794 -0.1074 -0.0030 0.1049  117 HIS B C   
2178 O O   . HIS B 117 ? 0.5390 0.2577 0.2636 -0.1024 -0.0080 0.1037  117 HIS B O   
2179 C CB  . HIS B 117 ? 0.5375 0.2297 0.2902 -0.1034 -0.0029 0.0943  117 HIS B CB  
2180 C CG  . HIS B 117 ? 0.5125 0.2234 0.2668 -0.1033 -0.0038 0.0875  117 HIS B CG  
2181 N ND1 . HIS B 117 ? 0.5013 0.2168 0.2566 -0.0943 -0.0100 0.0877  117 HIS B ND1 
2182 C CD2 . HIS B 117 ? 0.5000 0.2248 0.2543 -0.1111 0.0011  0.0809  117 HIS B CD2 
2183 C CE1 . HIS B 117 ? 0.5005 0.2301 0.2566 -0.0960 -0.0079 0.0816  117 HIS B CE1 
2184 N NE2 . HIS B 117 ? 0.5111 0.2470 0.2661 -0.1051 -0.0015 0.0780  117 HIS B NE2 
2185 N N   . VAL B 118 ? 0.5873 0.2985 0.3125 -0.1191 0.0053  0.1051  118 VAL B N   
2186 C CA  . VAL B 118 ? 0.5879 0.3183 0.3042 -0.1258 0.0096  0.1042  118 VAL B CA  
2187 C C   . VAL B 118 ? 0.6476 0.3763 0.3583 -0.1379 0.0190  0.1088  118 VAL B C   
2188 O O   . VAL B 118 ? 0.6222 0.3410 0.3404 -0.1461 0.0241  0.1071  118 VAL B O   
2189 C CB  . VAL B 118 ? 0.6111 0.3599 0.3348 -0.1296 0.0116  0.0936  118 VAL B CB  
2190 C CG1 . VAL B 118 ? 0.5558 0.3028 0.2892 -0.1398 0.0171  0.0876  118 VAL B CG1 
2191 C CG2 . VAL B 118 ? 0.6638 0.4336 0.3783 -0.1339 0.0161  0.0926  118 VAL B CG2 
2192 N N   . THR B 119 ? 0.6255 0.3633 0.3227 -0.1393 0.0219  0.1143  119 THR B N   
2193 C CA  . THR B 119 ? 0.6789 0.4188 0.3710 -0.1518 0.0328  0.1184  119 THR B CA  
2194 C C   . THR B 119 ? 0.6859 0.4536 0.3758 -0.1584 0.0385  0.1122  119 THR B C   
2195 O O   . THR B 119 ? 0.7101 0.4898 0.3915 -0.1505 0.0345  0.1113  119 THR B O   
2196 C CB  . THR B 119 ? 0.6887 0.4142 0.3648 -0.1476 0.0337  0.1323  119 THR B CB  
2197 O OG1 . THR B 119 ? 0.6866 0.3876 0.3645 -0.1385 0.0273  0.1385  119 THR B OG1 
2198 C CG2 . THR B 119 ? 0.7687 0.4929 0.4416 -0.1618 0.0468  0.1371  119 THR B CG2 
2199 N N   . ALA B 120 ? 0.5998 0.3788 0.2979 -0.1729 0.0480  0.1072  120 ALA B N   
2200 C CA  . ALA B 120 ? 0.6180 0.4274 0.3176 -0.1786 0.0537  0.0998  120 ALA B CA  
2201 C C   . ALA B 120 ? 0.6441 0.4668 0.3434 -0.1935 0.0669  0.1012  120 ALA B C   
2202 O O   . ALA B 120 ? 0.6622 0.4735 0.3675 -0.2051 0.0731  0.1034  120 ALA B O   
2203 C CB  . ALA B 120 ? 0.5975 0.4192 0.3110 -0.1811 0.0517  0.0889  120 ALA B CB  
2204 N N   . THR B 121 ? 0.6015 0.4489 0.2947 -0.1929 0.0720  0.0991  121 THR B N   
2205 C CA  . THR B 121 ? 0.6160 0.4834 0.3120 -0.2068 0.0857  0.0983  121 THR B CA  
2206 C C   . THR B 121 ? 0.6111 0.5151 0.3196 -0.2104 0.0894  0.0857  121 THR B C   
2207 O O   . THR B 121 ? 0.6137 0.5312 0.3169 -0.1983 0.0854  0.0815  121 THR B O   
2208 C CB  . THR B 121 ? 0.6396 0.5074 0.3168 -0.2026 0.0909  0.1071  121 THR B CB  
2209 O OG1 . THR B 121 ? 0.6640 0.4995 0.3285 -0.1974 0.0868  0.1199  121 THR B OG1 
2210 C CG2 . THR B 121 ? 0.6565 0.5455 0.3385 -0.2176 0.1067  0.1062  121 THR B CG2 
2211 N N   . VAL B 122 ? 0.5907 0.5117 0.3166 -0.2265 0.0970  0.0789  122 VAL B N   
2212 C CA  . VAL B 122 ? 0.5683 0.5302 0.3090 -0.2301 0.1009  0.0665  122 VAL B CA  
2213 C C   . VAL B 122 ? 0.5799 0.5751 0.3317 -0.2439 0.1153  0.0622  122 VAL B C   
2214 O O   . VAL B 122 ? 0.6014 0.5894 0.3603 -0.2593 0.1225  0.0643  122 VAL B O   
2215 C CB  . VAL B 122 ? 0.5511 0.5160 0.3114 -0.2332 0.0940  0.0571  122 VAL B CB  
2216 C CG1 . VAL B 122 ? 0.5266 0.5383 0.3100 -0.2263 0.0927  0.0417  122 VAL B CG1 
2217 C CG2 . VAL B 122 ? 0.5402 0.4740 0.2923 -0.2177 0.0804  0.0605  122 VAL B CG2 
2218 N N   . GLU B 123 ? 0.5675 0.5986 0.3215 -0.2370 0.1199  0.0555  123 GLU B N   
2219 C CA  . GLU B 123 ? 0.6233 0.6951 0.3929 -0.2476 0.1336  0.0484  123 GLU B CA  
2220 C C   . GLU B 123 ? 0.6308 0.7480 0.4300 -0.2435 0.1306  0.0318  123 GLU B C   
2221 O O   . GLU B 123 ? 0.5237 0.6480 0.3259 -0.2218 0.1195  0.0256  123 GLU B O   
2222 C CB  . GLU B 123 ? 0.5957 0.6763 0.3502 -0.2368 0.1396  0.0513  123 GLU B CB  
2223 C CG  . GLU B 123 ? 0.6942 0.7350 0.4236 -0.2342 0.1391  0.0661  123 GLU B CG  
2224 C CD  . GLU B 123 ? 0.7586 0.8097 0.4713 -0.2232 0.1446  0.0675  123 GLU B CD  
2225 O OE1 . GLU B 123 ? 0.7359 0.8045 0.4467 -0.2088 0.1411  0.0592  123 GLU B OE1 
2226 O OE2 . GLU B 123 ? 0.7741 0.8145 0.4744 -0.2284 0.1529  0.0768  123 GLU B OE2 
2227 N N   . LEU B 124 ? 0.5514 0.6985 0.3745 -0.2621 0.1392  0.0238  124 LEU B N   
2228 C CA  . LEU B 124 ? 0.5285 0.7234 0.3833 -0.2563 0.1342  0.0067  124 LEU B CA  
2229 C C   . LEU B 124 ? 0.5378 0.7804 0.4177 -0.2753 0.1489  -0.0024 124 LEU B C   
2230 O O   . LEU B 124 ? 0.5643 0.7967 0.4388 -0.2970 0.1633  0.0047  124 LEU B O   
2231 C CB  . LEU B 124 ? 0.5172 0.6998 0.3833 -0.2574 0.1208  0.0011  124 LEU B CB  
2232 C CG  . LEU B 124 ? 0.5376 0.7053 0.4115 -0.2855 0.1268  0.0012  124 LEU B CG  
2233 C CD1 . LEU B 124 ? 0.5236 0.7091 0.4207 -0.2867 0.1154  -0.0137 124 LEU B CD1 
2234 C CD2 . LEU B 124 ? 0.5583 0.6649 0.4040 -0.2912 0.1273  0.0178  124 LEU B CD2 
2235 N N   . SER B 125 ? 0.5892 0.8833 0.4967 -0.2652 0.1449  -0.0178 125 SER B N   
2236 C CA  . SER B 125 ? 0.6100 0.9579 0.5506 -0.2827 0.1551  -0.0308 125 SER B CA  
2237 C C   . SER B 125 ? 0.6625 1.0198 0.6262 -0.2958 0.1461  -0.0418 125 SER B C   
2238 O O   . SER B 125 ? 0.6001 0.9218 0.5525 -0.2894 0.1326  -0.0391 125 SER B O   
2239 C CB  . SER B 125 ? 0.5473 0.9510 0.5070 -0.2623 0.1547  -0.0426 125 SER B CB  
2240 O OG  . SER B 125 ? 0.5295 0.9370 0.4749 -0.2581 0.1686  -0.0366 125 SER B OG  
2241 N N   . MET B 126 ? 0.6875 1.0954 0.6843 -0.3135 0.1535  -0.0558 126 MET B N   
2242 C CA  . MET B 126 ? 0.7063 1.1286 0.7275 -0.3300 0.1464  -0.0693 126 MET B CA  
2243 C C   . MET B 126 ? 0.7032 1.1346 0.7285 -0.3053 0.1243  -0.0780 126 MET B C   
2244 O O   . MET B 126 ? 0.7151 1.1261 0.7403 -0.3121 0.1144  -0.0822 126 MET B O   
2245 C CB  . MET B 126 ? 0.6864 1.1694 0.7456 -0.3491 0.1566  -0.0853 126 MET B CB  
2246 C CG  . MET B 126 ? 0.7383 1.2305 0.8206 -0.3669 0.1488  -0.1007 126 MET B CG  
2247 S SD  . MET B 126 ? 0.8964 1.4369 1.0154 -0.3856 0.1587  -0.1171 126 MET B SD  
2248 C CE  . MET B 126 ? 0.6553 1.1436 0.7498 -0.4006 0.1807  -0.0971 126 MET B CE  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   GLY 3   3   3   GLY GLY A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   ILE 7   7   7   ILE ILE A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   GLU 9   9   9   GLU GLU A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  ILE 14  14  14  ILE ILE A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  LYS 21  21  21  LYS LYS A . n 
A 1 22  PRO 22  22  22  PRO PRO A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  ASN 30  30  30  ASN ASN A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  PRO 32  32  32  PRO PRO A . n 
A 1 33  MET 33  33  33  MET MET A . n 
A 1 34  ILE 34  34  34  ILE ILE A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  TRP 37  37  37  TRP TRP A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  ASP 43  43  43  ASP ASP A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  ASN 45  45  45  ASN ASN A . n 
A 1 46  PRO 46  46  46  PRO PRO A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  VAL 49  49  49  VAL VAL A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  ALA 52  52  52  ALA ALA A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  HIS 59  59  59  HIS HIS A . n 
A 1 60  PRO 60  60  60  PRO PRO A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  MET 74  74  74  MET MET A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  GLY 78  78  78  GLY GLY A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  ASP 84  84  84  ASP ASP A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  TYR 99  99  99  TYR TYR A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 GLN 109 109 109 GLN GLN A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 HIS 112 112 112 HIS HIS A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 PRO 117 117 117 PRO PRO A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 GLN 120 120 120 GLN GLN A . n 
A 1 121 VAL 121 121 121 VAL VAL A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 LYS 134 134 134 LYS LYS A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 TRP 142 142 142 TRP TRP A . n 
A 1 143 PHE 143 143 143 PHE PHE A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 GLN 146 146 146 GLN GLN A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 TRP 150 150 150 TRP TRP A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 ARG 163 163 163 ARG ARG A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 PHE 167 167 167 PHE PHE A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 ALA 170 170 ?   ?   ?   A . n 
A 1 171 GLY 171 171 ?   ?   ?   A . n 
A 1 172 SER 172 172 ?   ?   ?   A . n 
A 1 173 PRO 173 173 ?   ?   ?   A . n 
A 1 174 SER 174 174 ?   ?   ?   A . n 
A 1 175 SER 175 175 ?   ?   ?   A . n 
A 1 176 VAL 176 176 ?   ?   ?   A . n 
A 1 177 PRO 177 177 ?   ?   ?   A . n 
A 1 178 ASP 178 178 ?   ?   ?   A . n 
A 1 179 ASP 179 179 ?   ?   ?   A . n 
A 1 180 LEU 180 180 ?   ?   ?   A . n 
A 1 181 ASP 181 181 ?   ?   ?   A . n 
A 1 182 PRO 182 182 ?   ?   ?   A . n 
A 1 183 ASP 183 183 ?   ?   ?   A . n 
A 1 184 ALA 184 184 ?   ?   ?   A . n 
A 1 185 MET 185 185 ?   ?   ?   A . n 
A 1 186 MET 186 186 ?   ?   ?   A . n 
A 1 187 ARG 187 187 ?   ?   ?   A . n 
B 2 1   MET 1   1   ?   ?   ?   B . n 
B 2 2   THR 2   2   2   THR THR B . n 
B 2 3   VAL 3   3   3   VAL VAL B . n 
B 2 4   VAL 4   4   4   VAL VAL B . n 
B 2 5   GLY 5   5   5   GLY GLY B . n 
B 2 6   ALA 6   6   6   ALA ALA B . n 
B 2 7   VAL 7   7   7   VAL VAL B . n 
B 2 8   LEU 8   8   8   LEU LEU B . n 
B 2 9   PRO 9   9   9   PRO PRO B . n 
B 2 10  GLU 10  10  10  GLU GLU B . n 
B 2 11  LEU 11  11  11  LEU LEU B . n 
B 2 12  LYS 12  12  12  LYS LYS B . n 
B 2 13  LEU 13  13  13  LEU LEU B . n 
B 2 14  TYR 14  14  14  TYR TYR B . n 
B 2 15  GLY 15  15  15  GLY GLY B . n 
B 2 16  ASP 16  16  16  ASP ASP B . n 
B 2 17  PRO 17  17  17  PRO PRO B . n 
B 2 18  THR 18  18  18  THR THR B . n 
B 2 19  PHE 19  19  19  PHE PHE B . n 
B 2 20  ILE 20  20  20  ILE ILE B . n 
B 2 21  VAL 21  21  21  VAL VAL B . n 
B 2 22  SER 22  22  22  SER SER B . n 
B 2 23  THR 23  23  23  THR THR B . n 
B 2 24  ALA 24  24  24  ALA ALA B . n 
B 2 25  LEU 25  25  25  LEU LEU B . n 
B 2 26  ALA 26  26  26  ALA ALA B . n 
B 2 27  THR 27  27  27  THR THR B . n 
B 2 28  ARG 28  28  28  ARG ARG B . n 
B 2 29  ASP 29  29  29  ASP ASP B . n 
B 2 30  PHE 30  30  30  PHE PHE B . n 
B 2 31  GLN 31  31  31  GLN GLN B . n 
B 2 32  ASP 32  32  32  ASP ASP B . n 
B 2 33  VAL 33  33  33  VAL VAL B . n 
B 2 34  HIS 34  34  34  HIS HIS B . n 
B 2 35  HIS 35  35  35  HIS HIS B . n 
B 2 36  ASP 36  36  36  ASP ASP B . n 
B 2 37  ARG 37  37  37  ARG ARG B . n 
B 2 38  ASP 38  38  38  ASP ASP B . n 
B 2 39  LYS 39  39  39  LYS LYS B . n 
B 2 40  ALA 40  40  40  ALA ALA B . n 
B 2 41  VAL 41  41  41  VAL VAL B . n 
B 2 42  ALA 42  42  42  ALA ALA B . n 
B 2 43  GLN 43  43  43  GLN GLN B . n 
B 2 44  GLY 44  44  44  GLY GLY B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  ASP 47  47  47  ASP ASP B . n 
B 2 48  ILE 48  48  48  ILE ILE B . n 
B 2 49  PHE 49  49  49  PHE PHE B . n 
B 2 50  VAL 50  50  50  VAL VAL B . n 
B 2 51  ASN 51  51  51  ASN ASN B . n 
B 2 52  ILE 52  52  52  ILE ILE B . n 
B 2 53  LEU 53  53  53  LEU LEU B . n 
B 2 54  THR 54  54  54  THR THR B . n 
B 2 55  ASP 55  55  55  ASP ASP B . n 
B 2 56  THR 56  56  56  THR THR B . n 
B 2 57  GLY 57  57  57  GLY GLY B . n 
B 2 58  LEU 58  58  58  LEU LEU B . n 
B 2 59  VAL 59  59  59  VAL VAL B . n 
B 2 60  GLN 60  60  60  GLN GLN B . n 
B 2 61  ARG 61  61  61  ARG ARG B . n 
B 2 62  TYR 62  62  62  TYR TYR B . n 
B 2 63  VAL 63  63  63  VAL VAL B . n 
B 2 64  THR 64  64  64  THR THR B . n 
B 2 65  ASP 65  65  65  ASP ASP B . n 
B 2 66  TRP 66  66  66  TRP TRP B . n 
B 2 67  ALA 67  67  67  ALA ALA B . n 
B 2 68  GLY 68  68  68  GLY GLY B . n 
B 2 69  PRO 69  69  69  PRO PRO B . n 
B 2 70  SER 70  70  70  SER SER B . n 
B 2 71  ALA 71  71  71  ALA ALA B . n 
B 2 72  LEU 72  72  72  LEU LEU B . n 
B 2 73  ILE 73  73  73  ILE ILE B . n 
B 2 74  LYS 74  74  74  LYS LYS B . n 
B 2 75  SER 75  75  75  SER SER B . n 
B 2 76  ILE 76  76  76  ILE ILE B . n 
B 2 77  GLY 77  77  77  GLY GLY B . n 
B 2 78  LEU 78  78  78  LEU LEU B . n 
B 2 79  ARG 79  79  79  ARG ARG B . n 
B 2 80  LEU 80  80  80  LEU LEU B . n 
B 2 81  GLY 81  81  81  GLY GLY B . n 
B 2 82  VAL 82  82  82  VAL VAL B . n 
B 2 83  PRO 83  83  83  PRO PRO B . n 
B 2 84  TRP 84  84  84  TRP TRP B . n 
B 2 85  TYR 85  85  85  TYR TYR B . n 
B 2 86  ALA 86  86  86  ALA ALA B . n 
B 2 87  TYR 87  87  87  TYR TYR B . n 
B 2 88  ASP 88  88  88  ASP ASP B . n 
B 2 89  THR 89  89  89  THR THR B . n 
B 2 90  VAL 90  90  90  VAL VAL B . n 
B 2 91  THR 91  91  91  THR THR B . n 
B 2 92  PHE 92  92  92  PHE PHE B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  GLY 94  94  94  GLY GLY B . n 
B 2 95  GLU 95  95  95  GLU GLU B . n 
B 2 96  VAL 96  96  96  VAL VAL B . n 
B 2 97  THR 97  97  97  THR THR B . n 
B 2 98  ALA 98  98  98  ALA ALA B . n 
B 2 99  VAL 99  99  99  VAL VAL B . n 
B 2 100 ASN 100 100 100 ASN ASN B . n 
B 2 101 ASP 101 101 101 ASP ASP B . n 
B 2 102 GLY 102 102 102 GLY GLY B . n 
B 2 103 LEU 103 103 103 LEU LEU B . n 
B 2 104 ILE 104 104 104 ILE ILE B . n 
B 2 105 THR 105 105 105 THR THR B . n 
B 2 106 VAL 106 106 106 VAL VAL B . n 
B 2 107 LYS 107 107 107 LYS LYS B . n 
B 2 108 VAL 108 108 108 VAL VAL B . n 
B 2 109 VAL 109 109 109 VAL VAL B . n 
B 2 110 GLY 110 110 110 GLY GLY B . n 
B 2 111 ARG 111 111 111 ARG ARG B . n 
B 2 112 ASN 112 112 112 ASN ASN B . n 
B 2 113 THR 113 113 113 THR THR B . n 
B 2 114 LEU 114 114 114 LEU LEU B . n 
B 2 115 GLY 115 115 115 GLY GLY B . n 
B 2 116 ASP 116 116 116 ASP ASP B . n 
B 2 117 HIS 117 117 117 HIS HIS B . n 
B 2 118 VAL 118 118 118 VAL VAL B . n 
B 2 119 THR 119 119 119 THR THR B . n 
B 2 120 ALA 120 120 120 ALA ALA B . n 
B 2 121 THR 121 121 121 THR THR B . n 
B 2 122 VAL 122 122 122 VAL VAL B . n 
B 2 123 GLU 123 123 123 GLU GLU B . n 
B 2 124 LEU 124 124 124 LEU LEU B . n 
B 2 125 SER 125 125 125 SER SER B . n 
B 2 126 MET 126 126 126 MET MET B . n 
B 2 127 ARG 127 127 ?   ?   ?   B . n 
B 2 128 ASP 128 128 ?   ?   ?   B . n 
B 2 129 SER 129 129 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CD  1   201 170 CD  CD  A . 
D 4 CA  1   202 171 CA  CA  A . 
E 5 4BN 1   203 172 4BN 4BN A . 
F 3 CD  1   201 127 CD  CD  B . 
G 6 HOH 1   301 174 HOH HOH A . 
G 6 HOH 2   302 313 HOH HOH A . 
G 6 HOH 3   303 254 HOH HOH A . 
G 6 HOH 4   304 224 HOH HOH A . 
G 6 HOH 5   305 173 HOH HOH A . 
G 6 HOH 6   306 212 HOH HOH A . 
G 6 HOH 7   307 310 HOH HOH A . 
G 6 HOH 8   308 309 HOH HOH A . 
G 6 HOH 9   309 200 HOH HOH A . 
G 6 HOH 10  310 214 HOH HOH A . 
G 6 HOH 11  311 209 HOH HOH A . 
G 6 HOH 12  312 274 HOH HOH A . 
G 6 HOH 13  313 232 HOH HOH A . 
G 6 HOH 14  314 265 HOH HOH A . 
G 6 HOH 15  315 299 HOH HOH A . 
G 6 HOH 16  316 292 HOH HOH A . 
G 6 HOH 17  317 271 HOH HOH A . 
G 6 HOH 18  318 325 HOH HOH A . 
G 6 HOH 19  319 279 HOH HOH A . 
G 6 HOH 20  320 306 HOH HOH A . 
G 6 HOH 21  321 282 HOH HOH A . 
G 6 HOH 22  322 321 HOH HOH A . 
G 6 HOH 23  323 302 HOH HOH A . 
G 6 HOH 24  324 244 HOH HOH A . 
G 6 HOH 25  325 275 HOH HOH A . 
G 6 HOH 26  326 239 HOH HOH A . 
G 6 HOH 27  327 177 HOH HOH A . 
G 6 HOH 28  328 277 HOH HOH A . 
G 6 HOH 29  329 272 HOH HOH A . 
G 6 HOH 30  330 268 HOH HOH A . 
G 6 HOH 31  331 197 HOH HOH A . 
G 6 HOH 32  332 187 HOH HOH A . 
G 6 HOH 33  333 263 HOH HOH A . 
G 6 HOH 34  334 250 HOH HOH A . 
G 6 HOH 35  335 215 HOH HOH A . 
G 6 HOH 36  336 227 HOH HOH A . 
G 6 HOH 37  337 234 HOH HOH A . 
G 6 HOH 38  338 323 HOH HOH A . 
G 6 HOH 39  339 260 HOH HOH A . 
G 6 HOH 40  340 246 HOH HOH A . 
G 6 HOH 41  341 258 HOH HOH A . 
G 6 HOH 42  342 167 HOH HOH A . 
G 6 HOH 43  343 183 HOH HOH A . 
G 6 HOH 44  344 326 HOH HOH A . 
G 6 HOH 45  345 278 HOH HOH A . 
G 6 HOH 46  346 319 HOH HOH A . 
G 6 HOH 47  347 175 HOH HOH A . 
G 6 HOH 48  348 176 HOH HOH A . 
G 6 HOH 49  349 178 HOH HOH A . 
G 6 HOH 50  350 179 HOH HOH A . 
G 6 HOH 51  351 180 HOH HOH A . 
G 6 HOH 52  352 181 HOH HOH A . 
G 6 HOH 53  353 182 HOH HOH A . 
G 6 HOH 54  354 184 HOH HOH A . 
G 6 HOH 55  355 185 HOH HOH A . 
G 6 HOH 56  356 186 HOH HOH A . 
G 6 HOH 57  357 188 HOH HOH A . 
G 6 HOH 58  358 189 HOH HOH A . 
G 6 HOH 59  359 190 HOH HOH A . 
G 6 HOH 60  360 191 HOH HOH A . 
G 6 HOH 61  361 192 HOH HOH A . 
G 6 HOH 62  362 193 HOH HOH A . 
G 6 HOH 63  363 194 HOH HOH A . 
G 6 HOH 64  364 195 HOH HOH A . 
G 6 HOH 65  365 196 HOH HOH A . 
G 6 HOH 66  366 198 HOH HOH A . 
G 6 HOH 67  367 199 HOH HOH A . 
G 6 HOH 68  368 201 HOH HOH A . 
G 6 HOH 69  369 202 HOH HOH A . 
G 6 HOH 70  370 203 HOH HOH A . 
G 6 HOH 71  371 204 HOH HOH A . 
G 6 HOH 72  372 205 HOH HOH A . 
G 6 HOH 73  373 206 HOH HOH A . 
G 6 HOH 74  374 207 HOH HOH A . 
G 6 HOH 75  375 208 HOH HOH A . 
G 6 HOH 76  376 210 HOH HOH A . 
G 6 HOH 77  377 211 HOH HOH A . 
G 6 HOH 78  378 213 HOH HOH A . 
G 6 HOH 79  379 216 HOH HOH A . 
G 6 HOH 80  380 217 HOH HOH A . 
G 6 HOH 81  381 218 HOH HOH A . 
G 6 HOH 82  382 219 HOH HOH A . 
G 6 HOH 83  383 220 HOH HOH A . 
G 6 HOH 84  384 221 HOH HOH A . 
G 6 HOH 85  385 222 HOH HOH A . 
G 6 HOH 86  386 223 HOH HOH A . 
G 6 HOH 87  387 225 HOH HOH A . 
G 6 HOH 88  388 226 HOH HOH A . 
G 6 HOH 89  389 228 HOH HOH A . 
G 6 HOH 90  390 229 HOH HOH A . 
G 6 HOH 91  391 230 HOH HOH A . 
G 6 HOH 92  392 231 HOH HOH A . 
G 6 HOH 93  393 233 HOH HOH A . 
G 6 HOH 94  394 235 HOH HOH A . 
G 6 HOH 95  395 236 HOH HOH A . 
G 6 HOH 96  396 237 HOH HOH A . 
G 6 HOH 97  397 238 HOH HOH A . 
G 6 HOH 98  398 240 HOH HOH A . 
G 6 HOH 99  399 241 HOH HOH A . 
G 6 HOH 100 400 242 HOH HOH A . 
G 6 HOH 101 401 243 HOH HOH A . 
G 6 HOH 102 402 245 HOH HOH A . 
G 6 HOH 103 403 247 HOH HOH A . 
G 6 HOH 104 404 248 HOH HOH A . 
G 6 HOH 105 405 249 HOH HOH A . 
G 6 HOH 106 406 251 HOH HOH A . 
G 6 HOH 107 407 252 HOH HOH A . 
G 6 HOH 108 408 253 HOH HOH A . 
G 6 HOH 109 409 255 HOH HOH A . 
G 6 HOH 110 410 256 HOH HOH A . 
G 6 HOH 111 411 257 HOH HOH A . 
G 6 HOH 112 412 259 HOH HOH A . 
G 6 HOH 113 413 261 HOH HOH A . 
G 6 HOH 114 414 262 HOH HOH A . 
G 6 HOH 115 415 264 HOH HOH A . 
G 6 HOH 116 416 266 HOH HOH A . 
G 6 HOH 117 417 269 HOH HOH A . 
G 6 HOH 118 418 270 HOH HOH A . 
G 6 HOH 119 419 273 HOH HOH A . 
G 6 HOH 120 420 276 HOH HOH A . 
G 6 HOH 121 421 280 HOH HOH A . 
G 6 HOH 122 422 281 HOH HOH A . 
G 6 HOH 123 423 283 HOH HOH A . 
G 6 HOH 124 424 284 HOH HOH A . 
G 6 HOH 125 425 285 HOH HOH A . 
G 6 HOH 126 426 286 HOH HOH A . 
G 6 HOH 127 427 287 HOH HOH A . 
G 6 HOH 128 428 288 HOH HOH A . 
G 6 HOH 129 429 289 HOH HOH A . 
G 6 HOH 130 430 290 HOH HOH A . 
G 6 HOH 131 431 291 HOH HOH A . 
G 6 HOH 132 432 293 HOH HOH A . 
G 6 HOH 133 433 294 HOH HOH A . 
G 6 HOH 134 434 295 HOH HOH A . 
G 6 HOH 135 435 296 HOH HOH A . 
G 6 HOH 136 436 297 HOH HOH A . 
G 6 HOH 137 437 298 HOH HOH A . 
G 6 HOH 138 438 300 HOH HOH A . 
G 6 HOH 139 439 301 HOH HOH A . 
G 6 HOH 140 440 303 HOH HOH A . 
G 6 HOH 141 441 304 HOH HOH A . 
G 6 HOH 142 442 305 HOH HOH A . 
G 6 HOH 143 443 307 HOH HOH A . 
G 6 HOH 144 444 308 HOH HOH A . 
G 6 HOH 145 445 311 HOH HOH A . 
G 6 HOH 146 446 312 HOH HOH A . 
G 6 HOH 147 447 314 HOH HOH A . 
G 6 HOH 148 448 315 HOH HOH A . 
G 6 HOH 149 449 316 HOH HOH A . 
G 6 HOH 150 450 317 HOH HOH A . 
G 6 HOH 151 451 318 HOH HOH A . 
G 6 HOH 152 452 320 HOH HOH A . 
G 6 HOH 153 453 322 HOH HOH A . 
G 6 HOH 154 454 324 HOH HOH A . 
G 6 HOH 155 455 327 HOH HOH A . 
G 6 HOH 156 456 328 HOH HOH A . 
G 6 HOH 157 457 199 HOH HOH A . 
G 6 HOH 158 458 202 HOH HOH A . 
G 6 HOH 159 459 209 HOH HOH A . 
H 6 HOH 1   301 225 HOH HOH B . 
H 6 HOH 2   302 129 HOH HOH B . 
H 6 HOH 3   303 203 HOH HOH B . 
H 6 HOH 4   304 148 HOH HOH B . 
H 6 HOH 5   305 139 HOH HOH B . 
H 6 HOH 6   306 146 HOH HOH B . 
H 6 HOH 7   307 174 HOH HOH B . 
H 6 HOH 8   308 163 HOH HOH B . 
H 6 HOH 9   309 136 HOH HOH B . 
H 6 HOH 10  310 179 HOH HOH B . 
H 6 HOH 11  311 142 HOH HOH B . 
H 6 HOH 12  312 140 HOH HOH B . 
H 6 HOH 13  313 166 HOH HOH B . 
H 6 HOH 14  314 185 HOH HOH B . 
H 6 HOH 15  315 131 HOH HOH B . 
H 6 HOH 16  316 224 HOH HOH B . 
H 6 HOH 17  317 155 HOH HOH B . 
H 6 HOH 18  318 144 HOH HOH B . 
H 6 HOH 19  319 218 HOH HOH B . 
H 6 HOH 20  320 162 HOH HOH B . 
H 6 HOH 21  321 145 HOH HOH B . 
H 6 HOH 22  322 228 HOH HOH B . 
H 6 HOH 23  323 193 HOH HOH B . 
H 6 HOH 24  324 231 HOH HOH B . 
H 6 HOH 25  325 236 HOH HOH B . 
H 6 HOH 26  326 168 HOH HOH B . 
H 6 HOH 27  327 187 HOH HOH B . 
H 6 HOH 28  328 267 HOH HOH B . 
H 6 HOH 29  329 128 HOH HOH B . 
H 6 HOH 30  330 130 HOH HOH B . 
H 6 HOH 31  331 132 HOH HOH B . 
H 6 HOH 32  332 133 HOH HOH B . 
H 6 HOH 33  333 134 HOH HOH B . 
H 6 HOH 34  334 135 HOH HOH B . 
H 6 HOH 35  335 137 HOH HOH B . 
H 6 HOH 36  336 138 HOH HOH B . 
H 6 HOH 37  337 141 HOH HOH B . 
H 6 HOH 38  338 143 HOH HOH B . 
H 6 HOH 39  339 147 HOH HOH B . 
H 6 HOH 40  340 149 HOH HOH B . 
H 6 HOH 41  341 150 HOH HOH B . 
H 6 HOH 42  342 151 HOH HOH B . 
H 6 HOH 43  343 152 HOH HOH B . 
H 6 HOH 44  344 153 HOH HOH B . 
H 6 HOH 45  345 154 HOH HOH B . 
H 6 HOH 46  346 156 HOH HOH B . 
H 6 HOH 47  347 157 HOH HOH B . 
H 6 HOH 48  348 158 HOH HOH B . 
H 6 HOH 49  349 159 HOH HOH B . 
H 6 HOH 50  350 160 HOH HOH B . 
H 6 HOH 51  351 161 HOH HOH B . 
H 6 HOH 52  352 164 HOH HOH B . 
H 6 HOH 53  353 165 HOH HOH B . 
H 6 HOH 54  354 169 HOH HOH B . 
H 6 HOH 55  355 170 HOH HOH B . 
H 6 HOH 56  356 171 HOH HOH B . 
H 6 HOH 57  357 172 HOH HOH B . 
H 6 HOH 58  358 173 HOH HOH B . 
H 6 HOH 59  359 175 HOH HOH B . 
H 6 HOH 60  360 176 HOH HOH B . 
H 6 HOH 61  361 177 HOH HOH B . 
H 6 HOH 62  362 178 HOH HOH B . 
H 6 HOH 63  363 180 HOH HOH B . 
H 6 HOH 64  364 181 HOH HOH B . 
H 6 HOH 65  365 182 HOH HOH B . 
H 6 HOH 66  366 183 HOH HOH B . 
H 6 HOH 67  367 184 HOH HOH B . 
H 6 HOH 68  368 186 HOH HOH B . 
H 6 HOH 69  369 188 HOH HOH B . 
H 6 HOH 70  370 189 HOH HOH B . 
H 6 HOH 71  371 190 HOH HOH B . 
H 6 HOH 72  372 191 HOH HOH B . 
H 6 HOH 73  373 192 HOH HOH B . 
H 6 HOH 74  374 194 HOH HOH B . 
H 6 HOH 75  375 195 HOH HOH B . 
H 6 HOH 76  376 196 HOH HOH B . 
H 6 HOH 77  377 197 HOH HOH B . 
H 6 HOH 78  378 198 HOH HOH B . 
H 6 HOH 79  379 200 HOH HOH B . 
H 6 HOH 80  380 201 HOH HOH B . 
H 6 HOH 81  381 204 HOH HOH B . 
H 6 HOH 82  382 205 HOH HOH B . 
H 6 HOH 83  383 206 HOH HOH B . 
H 6 HOH 84  384 207 HOH HOH B . 
H 6 HOH 85  385 208 HOH HOH B . 
H 6 HOH 86  386 210 HOH HOH B . 
H 6 HOH 87  387 211 HOH HOH B . 
H 6 HOH 88  388 212 HOH HOH B . 
H 6 HOH 89  389 213 HOH HOH B . 
H 6 HOH 90  390 214 HOH HOH B . 
H 6 HOH 91  391 215 HOH HOH B . 
H 6 HOH 92  392 216 HOH HOH B . 
H 6 HOH 93  393 217 HOH HOH B . 
H 6 HOH 94  394 219 HOH HOH B . 
H 6 HOH 95  395 220 HOH HOH B . 
H 6 HOH 96  396 221 HOH HOH B . 
H 6 HOH 97  397 222 HOH HOH B . 
H 6 HOH 98  398 223 HOH HOH B . 
H 6 HOH 99  399 226 HOH HOH B . 
H 6 HOH 100 400 227 HOH HOH B . 
H 6 HOH 101 401 229 HOH HOH B . 
H 6 HOH 102 402 230 HOH HOH B . 
H 6 HOH 103 403 232 HOH HOH B . 
H 6 HOH 104 404 233 HOH HOH B . 
H 6 HOH 105 405 234 HOH HOH B . 
H 6 HOH 106 406 235 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9080  ? 
1 MORE         -80   ? 
1 'SSA (A^2)'  24800 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 10_664 -y+1,-x+1,-z-1/6 0.5000000000 -0.8660254038 0.0000000000 25.9410000000 -0.8660254038 
-0.5000000000 0.0000000000 44.9311299991 0.0000000000 0.0000000000 -1.0000000000 -72.7058333333 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 346 ? G HOH . 
2 1 B HOH 314 ? H HOH . 
3 1 B HOH 318 ? H HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 147 ? A HIS 147 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OE1 ? A GLU 159 ? A GLU 159 ? 1_555 93.9  ? 
2  NE2 ? A HIS 147 ? A HIS 147 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 92.3  ? 
3  OE1 ? A GLU 159 ? A GLU 159 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OE2 ? A GLU 159 ? A GLU 159 ? 1_555 52.0  ? 
4  NE2 ? A HIS 147 ? A HIS 147 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OD2 ? A ASP 6   ? A ASP 6   ? 1_555 54.5  ? 
5  OE1 ? A GLU 159 ? A GLU 159 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OD2 ? A ASP 6   ? A ASP 6   ? 1_555 147.4 ? 
6  OE2 ? A GLU 159 ? A GLU 159 ? 1_555 CD ? C CD . ? A CD 201 ? 1_555 OD2 ? A ASP 6   ? A ASP 6   ? 1_555 115.0 ? 
7  OD2 ? A ASP 156 ? A ASP 156 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE1 ? A GLU 9   ? A GLU 9   ? 1_555 93.4  ? 
8  OD2 ? A ASP 156 ? A ASP 156 ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE2 ? A GLU 9   ? A GLU 9   ? 1_555 96.0  ? 
9  OE1 ? A GLU 9   ? A GLU 9   ? 1_555 CA ? D CA . ? A CA 202 ? 1_555 OE2 ? A GLU 9   ? A GLU 9   ? 1_555 3.9   ? 
10 OD2 ? B ASP 29  ? B ASP 29  ? 1_555 CD ? F CD . ? B CD 201 ? 1_555 NE2 ? B GLN 31  ? B GLN 31  ? 1_555 126.7 ? 
11 OD2 ? B ASP 29  ? B ASP 29  ? 1_555 CD ? F CD . ? B CD 201 ? 1_555 NE2 ? B HIS 34  ? B HIS 34  ? 1_555 94.1  ? 
12 NE2 ? B GLN 31  ? B GLN 31  ? 1_555 CD ? F CD . ? B CD 201 ? 1_555 NE2 ? B HIS 34  ? B HIS 34  ? 1_555 126.7 ? 
13 OD2 ? B ASP 29  ? B ASP 29  ? 1_555 CD ? F CD . ? B CD 201 ? 1_555 O   ? H HOH .   ? B HOH 329 ? 1_555 102.1 ? 
14 NE2 ? B GLN 31  ? B GLN 31  ? 1_555 CD ? F CD . ? B CD 201 ? 1_555 O   ? H HOH .   ? B HOH 329 ? 1_555 106.8 ? 
15 NE2 ? B HIS 34  ? B HIS 34  ? 1_555 CD ? F CD . ? B CD 201 ? 1_555 O   ? H HOH .   ? B HOH 329 ? 1_555 94.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-10-29 
2 'Structure model' 1 1 2014-11-26 
3 'Structure model' 1 2 2014-12-03 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Derived calculations'       
5 4 'Structure model' Other                        
6 4 'Structure model' 'Refinement description'     
7 4 'Structure model' 'Source and taxonomy'        
8 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen            
2 4 'Structure model' pdbx_audit_support        
3 4 'Structure model' pdbx_database_status      
4 4 'Structure model' pdbx_struct_assembly      
5 4 'Structure model' pdbx_struct_assembly_gen  
6 4 'Structure model' pdbx_struct_assembly_prop 
7 4 'Structure model' pdbx_struct_oper_list     
8 4 'Structure model' software                  
9 5 'Structure model' pdbx_audit_support        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
2  4 'Structure model' '_pdbx_audit_support.funding_organization'    
3  4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
4  4 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
5  4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
6  4 'Structure model' '_pdbx_struct_assembly_prop.type'             
7  4 'Structure model' '_pdbx_struct_assembly_prop.value'            
8  4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
9  4 'Structure model' '_software.classification'                    
10 5 'Structure model' '_pdbx_audit_support.funding_organization'    
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined 16.5513 27.2839 -8.6166  0.2212 ? 0.1166  ? -0.0098 ? 0.5174 ? -0.0315 ? 0.2097 ? 1.2950 ? 
-0.1813 ? 1.1674  ? 1.5318 ? 0.3298  ? 2.6921 ? -0.0553 ? -0.4022 ? 0.1426  ? 0.3115  ? -0.0123 ? -0.2398 ? -0.1780 ? -0.2013 ? 
0.0523  ? 
2  'X-RAY DIFFRACTION' ? refined 1.0153  16.1166 -31.8694 0.0296 ? 0.0097  ? 0.0198  ? 0.6374 ? -0.0491 ? 0.2526 ? 0.9463 ? 
-0.1393 ? 0.0116  ? 0.4017 ? 0.5950  ? 0.9343 ? -0.0058 ? 0.0409  ? -0.1280 ? -0.0021 ? -0.1424 ? 0.2393  ? 0.0576  ? -0.6555 ? 
0.1004  ? 
3  'X-RAY DIFFRACTION' ? refined 18.6172 29.1895 -19.4162 0.2630 ? 0.0071  ? 0.0264  ? 0.3706 ? -0.0329 ? 0.2680 ? 0.1113 ? 0.2846 
? 0.6012  ? 0.8426 ? 1.7695  ? 3.7347 ? -0.0277 ? -0.3884 ? 0.1539  ? 0.1191  ? 0.0705  ? -0.2764 ? -0.1747 ? 0.0815  ? -0.0591 ? 
4  'X-RAY DIFFRACTION' ? refined 26.0291 23.9472 -7.9020  0.2288 ? -0.0104 ? -0.0477 ? 0.6237 ? -0.0599 ? 0.3514 ? 1.9816 ? 
-2.0873 ? -0.1350 ? 3.6111 ? -0.4448 ? 3.1255 ? -0.0740 ? -0.3734 ? 0.1616  ? 0.2531  ? 0.1759  ? -0.4506 ? 0.0036  ? 0.1038  ? 
-0.0946 ? 
5  'X-RAY DIFFRACTION' ? refined 13.1423 17.1053 -13.1480 0.1792 ? 0.0759  ? 0.0070  ? 0.5669 ? 0.0136  ? 0.1810 ? 1.8858 ? 
-0.3397 ? 0.3864  ? 1.5157 ? 0.6149  ? 1.0285 ? -0.0140 ? -0.2983 ? -0.0917 ? 0.2439  ? 0.0111  ? -0.1193 ? 0.1909  ? -0.1851 ? 
-0.0133 ? 
6  'X-RAY DIFFRACTION' ? refined 14.9344 18.4708 -9.5003  0.2169 ? 0.1402  ? -0.0428 ? 0.4789 ? -0.0186 ? 0.2015 ? 5.4289 ? 
-2.1670 ? 3.4728  ? 2.7864 ? -1.2072 ? 3.5564 ? -0.1192 ? -0.4038 ? 0.0878  ? 0.2758  ? 0.1292  ? -0.3001 ? 0.1521  ? -0.2055 ? 
0.0310  ? 
7  'X-RAY DIFFRACTION' ? refined 13.8816 17.7512 -11.9895 0.2123 ? 0.1250  ? -0.0281 ? 0.5255 ? -0.0133 ? 0.2285 ? 4.3079 ? 
-1.4779 ? 1.1860  ? 1.8508 ? -0.2267 ? 1.3253 ? -0.1807 ? -0.3393 ? 0.0171  ? 0.2901  ? 0.1587  ? -0.2061 ? 0.0789  ? -0.1567 ? 
0.0294  ? 
8  'X-RAY DIFFRACTION' ? refined 0.7176  -6.5872 -22.9742 0.8113 ? -0.4449 ? 0.1420  ? 0.7037 ? 0.0353  ? 0.6153 ? 0.3016 ? 0.5169 
? -0.8328 ? 1.8596 ? -0.8510 ? 2.9962 ? -0.1127 ? -0.4415 ? -0.3496 ? 0.6797  ? -0.2510 ? 0.1938  ? 0.6696  ? -0.6733 ? 0.3609  ? 
9  'X-RAY DIFFRACTION' ? refined 16.1995 1.0650  -34.3743 0.3574 ? -0.0559 ? -0.0093 ? 0.1195 ? -0.0050 ? 0.3148 ? 6.1340 ? 2.6880 
? 0.7163  ? 4.5960 ? 1.2331  ? 2.7441 ? -0.1967 ? -0.0384 ? -0.4574 ? -0.0702 ? 0.1203  ? -0.1493 ? 0.4420  ? -0.2320 ? 0.0601  ? 
10 'X-RAY DIFFRACTION' ? refined 17.7849 13.2767 -33.7928 0.0625 ? 0.0083  ? -0.0041 ? 0.0818 ? 0.0246  ? 0.1728 ? 2.9855 ? 
-1.0195 ? -0.5968 ? 2.6458 ? 1.4629  ? 2.6175 ? 0.0005  ? -0.1043 ? -0.1801 ? 0.0305  ? 0.0211  ? -0.0087 ? 0.1209  ? -0.1025 ? 
-0.0026 ? 
11 'X-RAY DIFFRACTION' ? refined 22.0869 19.0449 -28.8918 0.0617 ? 0.0732  ? -0.0211 ? 0.1502 ? -0.0047 ? 0.2095 ? 2.8764 ? 
-1.4658 ? -0.4922 ? 1.7336 ? 0.2661  ? 1.8483 ? -0.0176 ? -0.1378 ? 0.0898  ? 0.0738  ? 0.0484  ? -0.1519 ? 0.0285  ? 0.1459  ? 
-0.0288 ? 
12 'X-RAY DIFFRACTION' ? refined 29.4554 11.3571 -27.8575 0.1247 ? 0.1604  ? -0.0491 ? 0.2673 ? 0.0111  ? 0.2542 ? 3.3568 ? 0.0078 
? -0.3065 ? 0.7208 ? -0.1267 ? 0.7607 ? -0.0241 ? -0.2326 ? -0.0922 ? 0.1255  ? 0.0543  ? -0.2683 ? 0.1013  ? 0.2024  ? 0.0142  ? 
13 'X-RAY DIFFRACTION' ? refined 6.7344  6.2935  -26.3948 0.3347 ? -0.2052 ? 0.0429  ? 0.3809 ? 0.0239  ? 0.2499 ? 2.1054 ? 1.1614 
? -0.1543 ? 1.4012 ? 0.6989  ? 1.1118 ? 0.0533  ? -0.1041 ? -0.4336 ? 0.0519  ? -0.1806 ? 0.1576  ? 0.5616  ? -0.6918 ? 0.0900  ? 
14 'X-RAY DIFFRACTION' ? refined 3.0886  7.7284  -20.2205 0.3097 ? -0.2319 ? 0.0436  ? 0.4797 ? 0.0413  ? 0.2219 ? 2.4966 ? 0.9787 
? -1.0257 ? 1.1582 ? 0.8021  ? 2.7436 ? 0.0487  ? -0.3730 ? -0.2236 ? 0.0213  ? -0.1595 ? 0.1074  ? 0.3709  ? -0.7510 ? 0.0977  ? 
15 'X-RAY DIFFRACTION' ? refined 23.4735 3.4195  -28.0881 0.3975 ? 0.1288  ? -0.0402 ? 0.1353 ? 0.0363  ? 0.3162 ? 1.1658 ? 0.1282 
? -0.5007 ? 1.1889 ? -0.6449 ? 0.5109 ? -0.0806 ? -0.1620 ? -0.1847 ? 0.1750  ? 0.0821  ? -0.1893 ? 0.2827  ? 0.1249  ? 0.0028  ? 
16 'X-RAY DIFFRACTION' ? refined 6.2612  -2.8533 -21.3239 0.7317 ? -0.2636 ? 0.1092  ? 0.4331 ? 0.0674  ? 0.4706 ? 3.7001 ? 0.4791 
? -2.2067 ? 1.1629 ? 0.2680  ? 3.6567 ? -0.0458 ? -0.4084 ? -0.4482 ? 0.5164  ? -0.1466 ? 0.2645  ? 0.6649  ? -0.6074 ? 0.2159  ? 
17 'X-RAY DIFFRACTION' ? refined 7.6693  1.0326  -19.5583 0.6175 ? -0.2340 ? 0.0767  ? 0.4085 ? 0.0978  ? 0.3278 ? 2.1259 ? 
-0.3799 ? -0.5853 ? 1.7482 ? 0.5709  ? 2.3761 ? -0.0706 ? -0.2918 ? -0.5514 ? 0.4377  ? -0.1224 ? 0.2469  ? 0.6336  ? -0.6159 ? 
0.1762  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 1 through 30 )
;
2  'X-RAY DIFFRACTION' 2  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 31 through 73 )
;
3  'X-RAY DIFFRACTION' 3  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 74 through 85 )
;
4  'X-RAY DIFFRACTION' 4  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 86 through 96 )
;
5  'X-RAY DIFFRACTION' 5  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 97 through 138 )
;
6  'X-RAY DIFFRACTION' 6  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 139 through 152 )
;
7  'X-RAY DIFFRACTION' 7  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 153 through 169 )
;
8  'X-RAY DIFFRACTION' 8  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 2 through 10 )
;
9  'X-RAY DIFFRACTION' 9  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 11 through 16 )
;
10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 17 through 27 )
;
11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 28 through 36 )
;
12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 37 through 51 )
;
13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 52 through 67 )
;
14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 68 through 80 )
;
15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 81 through 88 )
;
16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 89 through 100 )
;
17 'X-RAY DIFFRACTION' 17 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 101 through 126 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? autoPROC                    2 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O B HOH 307 ? ? 1_555 O B HOH 320 ? ? 10_664 1.93 
2 1 O B HOH 302 ? ? 1_555 O B HOH 313 ? ? 10_664 2.09 
3 1 O B HOH 302 ? ? 1_555 O B HOH 305 ? ? 10_664 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 54  ? ? -77.64  35.18   
2 1 ARG A 55  ? ? -141.43 -28.99  
3 1 ALA A 67  ? ? -69.73  0.19    
4 1 HIS B 35  ? ? -145.65 -6.93   
5 1 ASN B 112 ? ? -129.09 -163.49 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       404 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   7.61 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 13  ? CD  ? A GLN 13  CD  
2  1 Y 1 A GLN 13  ? OE1 ? A GLN 13  OE1 
3  1 Y 1 A GLN 13  ? NE2 ? A GLN 13  NE2 
4  1 Y 1 B ASN 100 ? CG  ? B ASN 100 CG  
5  1 Y 1 B ASN 100 ? OD1 ? B ASN 100 OD1 
6  1 Y 1 B ASN 100 ? ND2 ? B ASN 100 ND2 
7  1 Y 1 B ASP 101 ? CG  ? B ASP 101 CG  
8  1 Y 1 B ASP 101 ? OD1 ? B ASP 101 OD1 
9  1 Y 1 B ASP 101 ? OD2 ? B ASP 101 OD2 
10 1 Y 1 B LEU 103 ? CG  ? B LEU 103 CG  
11 1 Y 1 B LEU 103 ? CD1 ? B LEU 103 CD1 
12 1 Y 1 B LEU 103 ? CD2 ? B LEU 103 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 170 ? A ALA 170 
2  1 Y 1 A GLY 171 ? A GLY 171 
3  1 Y 1 A SER 172 ? A SER 172 
4  1 Y 1 A PRO 173 ? A PRO 173 
5  1 Y 1 A SER 174 ? A SER 174 
6  1 Y 1 A SER 175 ? A SER 175 
7  1 Y 1 A VAL 176 ? A VAL 176 
8  1 Y 1 A PRO 177 ? A PRO 177 
9  1 Y 1 A ASP 178 ? A ASP 178 
10 1 Y 1 A ASP 179 ? A ASP 179 
11 1 Y 1 A LEU 180 ? A LEU 180 
12 1 Y 1 A ASP 181 ? A ASP 181 
13 1 Y 1 A PRO 182 ? A PRO 182 
14 1 Y 1 A ASP 183 ? A ASP 183 
15 1 Y 1 A ALA 184 ? A ALA 184 
16 1 Y 1 A MET 185 ? A MET 185 
17 1 Y 1 A MET 186 ? A MET 186 
18 1 Y 1 A ARG 187 ? A ARG 187 
19 1 Y 1 B MET 1   ? B MET 1   
20 1 Y 1 B ARG 127 ? B ARG 127 
21 1 Y 1 B ASP 128 ? B ASP 128 
22 1 Y 1 B SER 129 ? B SER 129 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01-GM100021 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CADMIUM ION'                             CD  
4 'CALCIUM ION'                             CA  
5 '3-oxo-4-pregnene-20-carboxyl-Coenzyme A' 4BN 
6 water                                     HOH 
#