data_4X2Q
# 
_entry.id   4X2Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X2Q         
WWPDB D_1000204935 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X2Q 
_pdbx_database_status.recvd_initial_deposition_date   2014-11-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stenkamp, R.E.'  1 
'Le Trong, I.'    2 
'Amory, J.K.'     3 
'Paik, J.'        4 
'Goldstein, A.S.' 5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Synthesis and In Vitro Testing of Bisdichloroacetyldiamine Analogs for Use as a Reversible Male Contraceptive' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Goldstein, A.S.'    1  ? 
primary 'Paik, J.'           2  ? 
primary 'Moreb, J.'          3  ? 
primary 'Haenisch, M.'       4  ? 
primary 'Le Trong, I.'       5  ? 
primary 'Stenkamp, R.E.'     6  ? 
primary 'Petrie, A.G.'       7  ? 
primary 'Smith, N.'          8  ? 
primary 'Mallochowski, W.P.' 9  ? 
primary 'Amory, J.K.'        10 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4X2Q 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     84.597 
_cell.length_a_esd                 ? 
_cell.length_b                     140.508 
_cell.length_b_esd                 ? 
_cell.length_c                     164.452 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4X2Q 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Retinal dehydrogenase 2'         55522.102 4 1.2.1.36 ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425   4 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'RalDH2,Aldehyde dehydrogenase family 1 member A2,Retinaldehyde-specific dehydrogenase type 2,RALDH(II)' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HHHHHHASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVW
RRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRH
EPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHI
GIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYE
EFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIA
KEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGRE
MGEFGLREYSEVKTVTVKIPQKNS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HHHHHHASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVW
RRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRH
EPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHI
GIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYE
EFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIA
KEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGRE
MGEFGLREYSEVKTVTVKIPQKNS
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   ALA n 
1 8   SER n 
1 9   LEU n 
1 10  HIS n 
1 11  LEU n 
1 12  LEU n 
1 13  PRO n 
1 14  SER n 
1 15  PRO n 
1 16  THR n 
1 17  PRO n 
1 18  ASN n 
1 19  LEU n 
1 20  GLU n 
1 21  ILE n 
1 22  LYS n 
1 23  TYR n 
1 24  THR n 
1 25  LYS n 
1 26  ILE n 
1 27  PHE n 
1 28  ILE n 
1 29  ASN n 
1 30  ASN n 
1 31  GLU n 
1 32  TRP n 
1 33  GLN n 
1 34  ASN n 
1 35  SER n 
1 36  GLU n 
1 37  SER n 
1 38  GLY n 
1 39  ARG n 
1 40  VAL n 
1 41  PHE n 
1 42  PRO n 
1 43  VAL n 
1 44  TYR n 
1 45  ASN n 
1 46  PRO n 
1 47  ALA n 
1 48  THR n 
1 49  GLY n 
1 50  GLU n 
1 51  GLN n 
1 52  VAL n 
1 53  CYS n 
1 54  GLU n 
1 55  VAL n 
1 56  GLN n 
1 57  GLU n 
1 58  ALA n 
1 59  ASP n 
1 60  LYS n 
1 61  ALA n 
1 62  ASP n 
1 63  ILE n 
1 64  ASP n 
1 65  LYS n 
1 66  ALA n 
1 67  VAL n 
1 68  GLN n 
1 69  ALA n 
1 70  ALA n 
1 71  ARG n 
1 72  LEU n 
1 73  ALA n 
1 74  PHE n 
1 75  SER n 
1 76  LEU n 
1 77  GLY n 
1 78  SER n 
1 79  VAL n 
1 80  TRP n 
1 81  ARG n 
1 82  ARG n 
1 83  MET n 
1 84  ASP n 
1 85  ALA n 
1 86  SER n 
1 87  GLU n 
1 88  ARG n 
1 89  GLY n 
1 90  ARG n 
1 91  LEU n 
1 92  LEU n 
1 93  ASP n 
1 94  LYS n 
1 95  LEU n 
1 96  ALA n 
1 97  ASP n 
1 98  LEU n 
1 99  VAL n 
1 100 GLU n 
1 101 ARG n 
1 102 ASP n 
1 103 ARG n 
1 104 ALA n 
1 105 VAL n 
1 106 LEU n 
1 107 ALA n 
1 108 THR n 
1 109 MET n 
1 110 GLU n 
1 111 SER n 
1 112 LEU n 
1 113 ASN n 
1 114 GLY n 
1 115 GLY n 
1 116 LYS n 
1 117 PRO n 
1 118 PHE n 
1 119 LEU n 
1 120 GLN n 
1 121 ALA n 
1 122 PHE n 
1 123 TYR n 
1 124 VAL n 
1 125 ASP n 
1 126 LEU n 
1 127 GLN n 
1 128 GLY n 
1 129 VAL n 
1 130 ILE n 
1 131 LYS n 
1 132 THR n 
1 133 PHE n 
1 134 ARG n 
1 135 TYR n 
1 136 TYR n 
1 137 ALA n 
1 138 GLY n 
1 139 TRP n 
1 140 ALA n 
1 141 ASP n 
1 142 LYS n 
1 143 ILE n 
1 144 HIS n 
1 145 GLY n 
1 146 MET n 
1 147 THR n 
1 148 ILE n 
1 149 PRO n 
1 150 VAL n 
1 151 ASP n 
1 152 GLY n 
1 153 ASP n 
1 154 TYR n 
1 155 PHE n 
1 156 THR n 
1 157 PHE n 
1 158 THR n 
1 159 ARG n 
1 160 HIS n 
1 161 GLU n 
1 162 PRO n 
1 163 ILE n 
1 164 GLY n 
1 165 VAL n 
1 166 CYS n 
1 167 GLY n 
1 168 GLN n 
1 169 ILE n 
1 170 ILE n 
1 171 PRO n 
1 172 TRP n 
1 173 ASN n 
1 174 PHE n 
1 175 PRO n 
1 176 LEU n 
1 177 LEU n 
1 178 MET n 
1 179 PHE n 
1 180 ALA n 
1 181 TRP n 
1 182 LYS n 
1 183 ILE n 
1 184 ALA n 
1 185 PRO n 
1 186 ALA n 
1 187 LEU n 
1 188 CYS n 
1 189 CYS n 
1 190 GLY n 
1 191 ASN n 
1 192 THR n 
1 193 VAL n 
1 194 VAL n 
1 195 ILE n 
1 196 LYS n 
1 197 PRO n 
1 198 ALA n 
1 199 GLU n 
1 200 GLN n 
1 201 THR n 
1 202 PRO n 
1 203 LEU n 
1 204 SER n 
1 205 ALA n 
1 206 LEU n 
1 207 TYR n 
1 208 MET n 
1 209 GLY n 
1 210 ALA n 
1 211 LEU n 
1 212 ILE n 
1 213 LYS n 
1 214 GLU n 
1 215 ALA n 
1 216 GLY n 
1 217 PHE n 
1 218 PRO n 
1 219 PRO n 
1 220 GLY n 
1 221 VAL n 
1 222 ILE n 
1 223 ASN n 
1 224 ILE n 
1 225 LEU n 
1 226 PRO n 
1 227 GLY n 
1 228 TYR n 
1 229 GLY n 
1 230 PRO n 
1 231 THR n 
1 232 ALA n 
1 233 GLY n 
1 234 ALA n 
1 235 ALA n 
1 236 ILE n 
1 237 ALA n 
1 238 SER n 
1 239 HIS n 
1 240 ILE n 
1 241 GLY n 
1 242 ILE n 
1 243 ASP n 
1 244 LYS n 
1 245 ILE n 
1 246 ALA n 
1 247 PHE n 
1 248 THR n 
1 249 GLY n 
1 250 SER n 
1 251 THR n 
1 252 GLU n 
1 253 VAL n 
1 254 GLY n 
1 255 LYS n 
1 256 LEU n 
1 257 ILE n 
1 258 GLN n 
1 259 GLU n 
1 260 ALA n 
1 261 ALA n 
1 262 GLY n 
1 263 ARG n 
1 264 SER n 
1 265 ASN n 
1 266 LEU n 
1 267 LYS n 
1 268 ARG n 
1 269 VAL n 
1 270 THR n 
1 271 LEU n 
1 272 GLU n 
1 273 LEU n 
1 274 GLY n 
1 275 GLY n 
1 276 LYS n 
1 277 SER n 
1 278 PRO n 
1 279 ASN n 
1 280 ILE n 
1 281 ILE n 
1 282 PHE n 
1 283 ALA n 
1 284 ASP n 
1 285 ALA n 
1 286 ASP n 
1 287 LEU n 
1 288 ASP n 
1 289 TYR n 
1 290 ALA n 
1 291 VAL n 
1 292 GLU n 
1 293 GLN n 
1 294 ALA n 
1 295 HIS n 
1 296 GLN n 
1 297 GLY n 
1 298 VAL n 
1 299 PHE n 
1 300 PHE n 
1 301 ASN n 
1 302 GLN n 
1 303 GLY n 
1 304 GLN n 
1 305 CYS n 
1 306 CYS n 
1 307 THR n 
1 308 ALA n 
1 309 GLY n 
1 310 SER n 
1 311 ARG n 
1 312 ILE n 
1 313 PHE n 
1 314 VAL n 
1 315 GLU n 
1 316 GLU n 
1 317 SER n 
1 318 ILE n 
1 319 TYR n 
1 320 GLU n 
1 321 GLU n 
1 322 PHE n 
1 323 VAL n 
1 324 ARG n 
1 325 ARG n 
1 326 SER n 
1 327 VAL n 
1 328 GLU n 
1 329 ARG n 
1 330 ALA n 
1 331 LYS n 
1 332 ARG n 
1 333 ARG n 
1 334 VAL n 
1 335 VAL n 
1 336 GLY n 
1 337 SER n 
1 338 PRO n 
1 339 PHE n 
1 340 ASP n 
1 341 PRO n 
1 342 THR n 
1 343 THR n 
1 344 GLU n 
1 345 GLN n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 ILE n 
1 350 ASP n 
1 351 LYS n 
1 352 LYS n 
1 353 GLN n 
1 354 TYR n 
1 355 ASN n 
1 356 LYS n 
1 357 ILE n 
1 358 LEU n 
1 359 GLU n 
1 360 LEU n 
1 361 ILE n 
1 362 GLN n 
1 363 SER n 
1 364 GLY n 
1 365 VAL n 
1 366 ALA n 
1 367 GLU n 
1 368 GLY n 
1 369 ALA n 
1 370 LYS n 
1 371 LEU n 
1 372 GLU n 
1 373 CYS n 
1 374 GLY n 
1 375 GLY n 
1 376 LYS n 
1 377 GLY n 
1 378 LEU n 
1 379 GLY n 
1 380 ARG n 
1 381 LYS n 
1 382 GLY n 
1 383 PHE n 
1 384 PHE n 
1 385 ILE n 
1 386 GLU n 
1 387 PRO n 
1 388 THR n 
1 389 VAL n 
1 390 PHE n 
1 391 SER n 
1 392 ASN n 
1 393 VAL n 
1 394 THR n 
1 395 ASP n 
1 396 ASP n 
1 397 MET n 
1 398 ARG n 
1 399 ILE n 
1 400 ALA n 
1 401 LYS n 
1 402 GLU n 
1 403 GLU n 
1 404 ILE n 
1 405 PHE n 
1 406 GLY n 
1 407 PRO n 
1 408 VAL n 
1 409 GLN n 
1 410 GLU n 
1 411 ILE n 
1 412 LEU n 
1 413 ARG n 
1 414 PHE n 
1 415 LYS n 
1 416 THR n 
1 417 MET n 
1 418 ASP n 
1 419 GLU n 
1 420 VAL n 
1 421 ILE n 
1 422 GLU n 
1 423 ARG n 
1 424 ALA n 
1 425 ASN n 
1 426 ASN n 
1 427 SER n 
1 428 ASP n 
1 429 PHE n 
1 430 GLY n 
1 431 LEU n 
1 432 VAL n 
1 433 ALA n 
1 434 ALA n 
1 435 VAL n 
1 436 PHE n 
1 437 THR n 
1 438 ASN n 
1 439 ASP n 
1 440 ILE n 
1 441 ASN n 
1 442 LYS n 
1 443 ALA n 
1 444 LEU n 
1 445 THR n 
1 446 VAL n 
1 447 SER n 
1 448 SER n 
1 449 ALA n 
1 450 MET n 
1 451 GLN n 
1 452 ALA n 
1 453 GLY n 
1 454 THR n 
1 455 VAL n 
1 456 TRP n 
1 457 ILE n 
1 458 ASN n 
1 459 CYS n 
1 460 TYR n 
1 461 ASN n 
1 462 ALA n 
1 463 LEU n 
1 464 ASN n 
1 465 ALA n 
1 466 GLN n 
1 467 SER n 
1 468 PRO n 
1 469 PHE n 
1 470 GLY n 
1 471 GLY n 
1 472 PHE n 
1 473 LYS n 
1 474 MET n 
1 475 SER n 
1 476 GLY n 
1 477 ASN n 
1 478 GLY n 
1 479 ARG n 
1 480 GLU n 
1 481 MET n 
1 482 GLY n 
1 483 GLU n 
1 484 PHE n 
1 485 GLY n 
1 486 LEU n 
1 487 ARG n 
1 488 GLU n 
1 489 TYR n 
1 490 SER n 
1 491 GLU n 
1 492 VAL n 
1 493 LYS n 
1 494 THR n 
1 495 VAL n 
1 496 THR n 
1 497 VAL n 
1 498 LYS n 
1 499 ILE n 
1 500 PRO n 
1 501 GLN n 
1 502 LYS n 
1 503 ASN n 
1 504 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   504 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ALDH1A2, RALDH2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21deltaE3 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pETite 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AL1A2_HUMAN 
_struct_ref.pdbx_db_accession          O94788 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDAS
ERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIA
FTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRS
VERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGL
REYSEVKTVTVKIPQKNS
;
_struct_ref.pdbx_align_begin           21 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4X2Q A 7 ? 504 ? O94788 21 ? 518 ? 3 500 
2 1 4X2Q B 7 ? 504 ? O94788 21 ? 518 ? 3 500 
3 1 4X2Q C 7 ? 504 ? O94788 21 ? 518 ? 3 500 
4 1 4X2Q D 7 ? 504 ? O94788 21 ? 518 ? 3 500 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X2Q HIS A 1 ? UNP O94788 ? ? 'expression tag' -3 1  
1 4X2Q HIS A 2 ? UNP O94788 ? ? 'expression tag' -2 2  
1 4X2Q HIS A 3 ? UNP O94788 ? ? 'expression tag' -1 3  
1 4X2Q HIS A 4 ? UNP O94788 ? ? 'expression tag' 0  4  
1 4X2Q HIS A 5 ? UNP O94788 ? ? 'expression tag' 1  5  
1 4X2Q HIS A 6 ? UNP O94788 ? ? 'expression tag' 2  6  
2 4X2Q HIS B 1 ? UNP O94788 ? ? 'expression tag' -3 7  
2 4X2Q HIS B 2 ? UNP O94788 ? ? 'expression tag' -2 8  
2 4X2Q HIS B 3 ? UNP O94788 ? ? 'expression tag' -1 9  
2 4X2Q HIS B 4 ? UNP O94788 ? ? 'expression tag' 0  10 
2 4X2Q HIS B 5 ? UNP O94788 ? ? 'expression tag' 1  11 
2 4X2Q HIS B 6 ? UNP O94788 ? ? 'expression tag' 2  12 
3 4X2Q HIS C 1 ? UNP O94788 ? ? 'expression tag' -3 13 
3 4X2Q HIS C 2 ? UNP O94788 ? ? 'expression tag' -2 14 
3 4X2Q HIS C 3 ? UNP O94788 ? ? 'expression tag' -1 15 
3 4X2Q HIS C 4 ? UNP O94788 ? ? 'expression tag' 0  16 
3 4X2Q HIS C 5 ? UNP O94788 ? ? 'expression tag' 1  17 
3 4X2Q HIS C 6 ? UNP O94788 ? ? 'expression tag' 2  18 
4 4X2Q HIS D 1 ? UNP O94788 ? ? 'expression tag' -3 19 
4 4X2Q HIS D 2 ? UNP O94788 ? ? 'expression tag' -2 20 
4 4X2Q HIS D 3 ? UNP O94788 ? ? 'expression tag' -1 21 
4 4X2Q HIS D 4 ? UNP O94788 ? ? 'expression tag' 0  22 
4 4X2Q HIS D 5 ? UNP O94788 ? ? 'expression tag' 1  23 
4 4X2Q HIS D 6 ? UNP O94788 ? ? 'expression tag' 2  24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X2Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.26 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.46 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298. 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'TCEP, HEPES, KCl, EDTA, PEG8000, imidazole' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100. 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV++' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-09-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4X2Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.940 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37839 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             89.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.400 
_reflns.pdbx_Rmerge_I_obs                0.183 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         7.192 
_reflns.pdbx_netI_over_sigmaI            7.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.257 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.950 3.060  ? 1.4 ? ? ? 3773 ? 91.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 6.600 ? 1.431 ? ? ? ? 0 1  1 ? ? 
3.060 3.180  ? ?   ? ? ? 3759 ? 90.700 ? ? ? ? ?     ? ? ? ? ? ? ? ? 6.600 ? 1.461 ? ? ? ? 0 2  1 ? ? 
3.180 3.320  ? ?   ? ? ? 3741 ? 89.900 ? ? ? ? 0.846 ? ? ? ? ? ? ? ? 6.500 ? 1.473 ? ? ? ? 0 3  1 ? ? 
3.320 3.500  ? ?   ? ? ? 3677 ? 87.800 ? ? ? ? 0.595 ? ? ? ? ? ? ? ? 6.600 ? 1.460 ? ? ? ? 0 4  1 ? ? 
3.500 3.720  ? ?   ? ? ? 3633 ? 86.800 ? ? ? ? 0.413 ? ? ? ? ? ? ? ? 6.700 ? 1.368 ? ? ? ? 0 5  1 ? ? 
3.720 4.000  ? ?   ? ? ? 3567 ? 84.900 ? ? ? ? 0.307 ? ? ? ? ? ? ? ? 7.000 ? 1.304 ? ? ? ? 0 6  1 ? ? 
4.000 4.410  ? ?   ? ? ? 3485 ? 82.800 ? ? ? ? 0.207 ? ? ? ? ? ? ? ? 7.200 ? 1.181 ? ? ? ? 0 7  1 ? ? 
4.410 5.040  ? ?   ? ? ? 3596 ? 85.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 7.700 ? 1.101 ? ? ? ? 0 8  1 ? ? 
5.040 6.350  ? ?   ? ? ? 4125 ? 96.400 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 8.200 ? 1.082 ? ? ? ? 0 9  1 ? ? 
6.350 50.000 ? ?   ? ? ? 4483 ? 99.900 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 9.900 ? 1.024 ? ? ? ? 0 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            -2.2600 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.9600 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            1.3000 
_refine.B_iso_max                                203.260 
_refine.B_iso_mean                               71.4300 
_refine.B_iso_min                                27.540 
_refine.correlation_coeff_Fo_to_Fc               0.9150 
_refine.correlation_coeff_Fo_to_Fc_free          0.8800 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4X2Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9400 
_refine.ls_d_res_low                             50.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     35882 
_refine.ls_number_reflns_R_free                  1911 
_refine.ls_number_reflns_R_work                  35882 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.0000 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2684 
_refine.ls_R_factor_R_free                       0.3128 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2661 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1B19 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.6240 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             66.2230 
_refine.overall_SU_ML                            0.5380 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.9400 
_refine_hist.d_res_low                        50.0 
_refine_hist.pdbx_number_atoms_ligand         108 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               14765 
_refine_hist.pdbx_number_residues_total       1892 
_refine_hist.pdbx_B_iso_mean_ligand           57.19 
_refine_hist.pdbx_number_atoms_protein        14657 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  0.022  15081 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.922  1.967  20446 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 4.383  5.000  1884  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 34.853 24.362 674   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 17.129 15.000 2522  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 16.346 15.000 92    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.062  0.200  2252  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.021  11460 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.115  1.500  9383  ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 0.218  2.000  15112 ? r_mcangle_it           ? ? 
'X-RAY DIFFRACTION' ? 0.277  3.000  5698  ? r_scbond_it            ? ? 
'X-RAY DIFFRACTION' ? 0.497  4.500  5334  ? r_scangle_it           ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 3657 0.300 0.500 ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 'MEDIUM POSITIONAL' B 3657 0.280 0.500 ? ? ? 
3 'X-RAY DIFFRACTION' 1 3 'MEDIUM POSITIONAL' C 3657 0.310 0.500 ? ? ? 
4 'X-RAY DIFFRACTION' 1 4 'MEDIUM POSITIONAL' D 3657 0.310 0.500 ? ? ? 
5 'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 3657 0.090 2.000 ? ? ? 
6 'X-RAY DIFFRACTION' 1 2 'MEDIUM THERMAL'    B 3657 0.100 2.000 ? ? ? 
7 'X-RAY DIFFRACTION' 1 3 'MEDIUM THERMAL'    C 3657 0.080 2.000 ? ? ? 
8 'X-RAY DIFFRACTION' 1 4 'MEDIUM THERMAL'    D 3657 0.100 2.000 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.9400 
_refine_ls_shell.d_res_low                        3.0160 
_refine_ls_shell.number_reflns_all                2566 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             142 
_refine_ls_shell.number_reflns_R_work             2424 
_refine_ls_shell.percent_reflns_obs               82.7200 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.4160 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.3920 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 C 
1 4 D 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 4 A 2 A 500 ? ? ? ? ? ? ? ? ? 
1 2 1 4 B 2 B 500 ? ? ? ? ? ? ? ? ? 
1 3 1 4 C 2 C 500 ? ? ? ? ? ? ? ? ? 
1 4 1 4 D 2 D 500 ? ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     4X2Q 
_struct.title                        'Crystal Structure of Human Aldehyde Dehydrogenase, ALDH1a2' 
_struct.pdbx_descriptor              'Aldehyde dehydrogenase, ALDH1a2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X2Q 
_struct_keywords.text            'dehydrogenase, isozyme, testis, spermatogenesis, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 59  ? ALA A 73  ? ASP A 55  ALA A 69  1 ? 15 
HELX_P HELX_P2  AA2 SER A 78  ? MET A 83  ? SER A 74  MET A 79  1 ? 6  
HELX_P HELX_P3  AA3 ASP A 84  ? ASP A 102 ? ASP A 80  ASP A 98  1 ? 19 
HELX_P HELX_P4  AA4 ASP A 102 ? GLY A 115 ? ASP A 98  GLY A 111 1 ? 14 
HELX_P HELX_P5  AA5 PRO A 117 ? VAL A 124 ? PRO A 113 VAL A 120 1 ? 8  
HELX_P HELX_P6  AA6 VAL A 124 ? ALA A 140 ? VAL A 120 ALA A 136 1 ? 17 
HELX_P HELX_P7  AA7 PHE A 174 ? CYS A 189 ? PHE A 170 CYS A 185 1 ? 16 
HELX_P HELX_P8  AA8 PRO A 202 ? GLY A 216 ? PRO A 198 GLY A 212 1 ? 15 
HELX_P HELX_P9  AA9 THR A 231 ? SER A 238 ? THR A 227 SER A 234 1 ? 8  
HELX_P HELX_P10 AB1 SER A 250 ? ALA A 261 ? SER A 246 ALA A 257 1 ? 12 
HELX_P HELX_P11 AB2 ASP A 286 ? GLN A 296 ? ASP A 282 GLN A 292 1 ? 11 
HELX_P HELX_P12 AB3 PHE A 299 ? GLN A 304 ? PHE A 295 GLN A 300 5 ? 6  
HELX_P HELX_P13 AB4 ILE A 318 ? LYS A 331 ? ILE A 314 LYS A 327 1 ? 14 
HELX_P HELX_P14 AB5 ASP A 350 ? ALA A 366 ? ASP A 346 ALA A 362 1 ? 17 
HELX_P HELX_P15 AB6 MET A 397 ? GLU A 402 ? MET A 393 GLU A 398 1 ? 6  
HELX_P HELX_P16 AB7 THR A 416 ? ASN A 426 ? THR A 412 ASN A 422 1 ? 11 
HELX_P HELX_P17 AB8 ASP A 439 ? MET A 450 ? ASP A 435 MET A 446 1 ? 12 
HELX_P HELX_P18 AB9 GLY A 485 ? GLU A 488 ? GLY A 481 GLU A 484 5 ? 4  
HELX_P HELX_P19 AC1 ASP B 59  ? ALA B 73  ? ASP B 55  ALA B 69  1 ? 15 
HELX_P HELX_P20 AC2 SER B 78  ? MET B 83  ? SER B 74  MET B 79  1 ? 6  
HELX_P HELX_P21 AC3 ASP B 84  ? ASP B 102 ? ASP B 80  ASP B 98  1 ? 19 
HELX_P HELX_P22 AC4 ASP B 102 ? GLY B 115 ? ASP B 98  GLY B 111 1 ? 14 
HELX_P HELX_P23 AC5 PRO B 117 ? VAL B 124 ? PRO B 113 VAL B 120 1 ? 8  
HELX_P HELX_P24 AC6 VAL B 124 ? ALA B 140 ? VAL B 120 ALA B 136 1 ? 17 
HELX_P HELX_P25 AC7 ASP B 141 ? ILE B 143 ? ASP B 137 ILE B 139 5 ? 3  
HELX_P HELX_P26 AC8 PHE B 174 ? GLY B 190 ? PHE B 170 GLY B 186 1 ? 17 
HELX_P HELX_P27 AC9 PRO B 202 ? GLY B 216 ? PRO B 198 GLY B 212 1 ? 15 
HELX_P HELX_P28 AD1 THR B 231 ? HIS B 239 ? THR B 227 HIS B 235 1 ? 9  
HELX_P HELX_P29 AD2 SER B 250 ? ARG B 263 ? SER B 246 ARG B 259 1 ? 14 
HELX_P HELX_P30 AD3 ASP B 286 ? PHE B 300 ? ASP B 282 PHE B 296 1 ? 15 
HELX_P HELX_P31 AD4 ASN B 301 ? GLN B 304 ? ASN B 297 GLN B 300 5 ? 4  
HELX_P HELX_P32 AD5 GLU B 316 ? ARG B 332 ? GLU B 312 ARG B 328 1 ? 17 
HELX_P HELX_P33 AD6 ASP B 350 ? ALA B 366 ? ASP B 346 ALA B 362 1 ? 17 
HELX_P HELX_P34 AD7 MET B 397 ? GLU B 402 ? MET B 393 GLU B 398 1 ? 6  
HELX_P HELX_P35 AD8 THR B 416 ? ASN B 426 ? THR B 412 ASN B 422 1 ? 11 
HELX_P HELX_P36 AD9 ASP B 439 ? MET B 450 ? ASP B 435 MET B 446 1 ? 12 
HELX_P HELX_P37 AE1 GLY B 482 ? GLU B 488 ? GLY B 478 GLU B 484 5 ? 7  
HELX_P HELX_P38 AE2 ASP C 59  ? ALA C 73  ? ASP C 55  ALA C 69  1 ? 15 
HELX_P HELX_P39 AE3 SER C 78  ? MET C 83  ? SER C 74  MET C 79  1 ? 6  
HELX_P HELX_P40 AE4 ASP C 84  ? ASP C 102 ? ASP C 80  ASP C 98  1 ? 19 
HELX_P HELX_P41 AE5 ASP C 102 ? ASN C 113 ? ASP C 98  ASN C 109 1 ? 12 
HELX_P HELX_P42 AE6 PRO C 117 ? VAL C 124 ? PRO C 113 VAL C 120 1 ? 8  
HELX_P HELX_P43 AE7 VAL C 124 ? ALA C 140 ? VAL C 120 ALA C 136 1 ? 17 
HELX_P HELX_P44 AE8 ASP C 141 ? ILE C 143 ? ASP C 137 ILE C 139 5 ? 3  
HELX_P HELX_P45 AE9 PHE C 174 ? CYS C 189 ? PHE C 170 CYS C 185 1 ? 16 
HELX_P HELX_P46 AF1 PRO C 202 ? GLY C 216 ? PRO C 198 GLY C 212 1 ? 15 
HELX_P HELX_P47 AF2 THR C 231 ? SER C 238 ? THR C 227 SER C 234 1 ? 8  
HELX_P HELX_P48 AF3 SER C 250 ? ASN C 265 ? SER C 246 ASN C 261 1 ? 16 
HELX_P HELX_P49 AF4 ASP C 286 ? GLN C 296 ? ASP C 282 GLN C 292 1 ? 11 
HELX_P HELX_P50 AF5 PHE C 299 ? GLN C 304 ? PHE C 295 GLN C 300 5 ? 6  
HELX_P HELX_P51 AF6 ILE C 318 ? LYS C 331 ? ILE C 314 LYS C 327 1 ? 14 
HELX_P HELX_P52 AF7 ASP C 350 ? ALA C 366 ? ASP C 346 ALA C 362 1 ? 17 
HELX_P HELX_P53 AF8 MET C 397 ? GLU C 402 ? MET C 393 GLU C 398 1 ? 6  
HELX_P HELX_P54 AF9 THR C 416 ? ASN C 426 ? THR C 412 ASN C 422 1 ? 11 
HELX_P HELX_P55 AG1 ASP C 439 ? MET C 450 ? ASP C 435 MET C 446 1 ? 12 
HELX_P HELX_P56 AG2 GLY C 482 ? ARG C 487 ? GLY C 478 ARG C 483 5 ? 6  
HELX_P HELX_P57 AG3 ASP D 59  ? ALA D 73  ? ASP D 55  ALA D 69  1 ? 15 
HELX_P HELX_P58 AG4 SER D 78  ? MET D 83  ? SER D 74  MET D 79  1 ? 6  
HELX_P HELX_P59 AG5 ASP D 84  ? ASP D 102 ? ASP D 80  ASP D 98  1 ? 19 
HELX_P HELX_P60 AG6 ASP D 102 ? GLY D 115 ? ASP D 98  GLY D 111 1 ? 14 
HELX_P HELX_P61 AG7 PRO D 117 ? VAL D 124 ? PRO D 113 VAL D 120 1 ? 8  
HELX_P HELX_P62 AG8 VAL D 124 ? ALA D 140 ? VAL D 120 ALA D 136 1 ? 17 
HELX_P HELX_P63 AG9 LEU D 176 ? CYS D 189 ? LEU D 172 CYS D 185 1 ? 14 
HELX_P HELX_P64 AH1 PRO D 202 ? GLY D 216 ? PRO D 198 GLY D 212 1 ? 15 
HELX_P HELX_P65 AH2 THR D 231 ? HIS D 239 ? THR D 227 HIS D 235 1 ? 9  
HELX_P HELX_P66 AH3 SER D 250 ? ARG D 263 ? SER D 246 ARG D 259 1 ? 14 
HELX_P HELX_P67 AH4 ASP D 286 ? PHE D 299 ? ASP D 282 PHE D 295 1 ? 14 
HELX_P HELX_P68 AH5 PHE D 300 ? GLN D 304 ? PHE D 296 GLN D 300 5 ? 5  
HELX_P HELX_P69 AH6 ILE D 318 ? ARG D 332 ? ILE D 314 ARG D 328 1 ? 15 
HELX_P HELX_P70 AH7 ASP D 350 ? ALA D 366 ? ASP D 346 ALA D 362 1 ? 17 
HELX_P HELX_P71 AH8 MET D 397 ? GLU D 402 ? MET D 393 GLU D 398 1 ? 6  
HELX_P HELX_P72 AH9 THR D 416 ? ASN D 426 ? THR D 412 ASN D 422 1 ? 11 
HELX_P HELX_P73 AI1 ASP D 439 ? MET D 450 ? ASP D 435 MET D 446 1 ? 12 
HELX_P HELX_P74 AI2 GLY D 482 ? LEU D 486 ? GLY D 478 LEU D 482 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2  ? 
AA2 ? 2  ? 
AA3 ? 10 ? 
AA4 ? 5  ? 
AA5 ? 10 ? 
AA6 ? 2  ? 
AA7 ? 2  ? 
AA8 ? 5  ? 
AA9 ? 2  ? 
AB1 ? 2  ? 
AB2 ? 10 ? 
AB3 ? 5  ? 
AB4 ? 10 ? 
AB5 ? 2  ? 
AB6 ? 2  ? 
AB7 ? 5  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
AA3 3 4  ? parallel      
AA3 4 5  ? parallel      
AA3 5 6  ? parallel      
AA3 6 7  ? parallel      
AA3 7 8  ? parallel      
AA3 8 9  ? parallel      
AA3 9 10 ? anti-parallel 
AA4 1 2  ? parallel      
AA4 2 3  ? parallel      
AA4 3 4  ? parallel      
AA4 4 5  ? parallel      
AA5 1 2  ? anti-parallel 
AA5 2 3  ? parallel      
AA5 3 4  ? parallel      
AA5 4 5  ? parallel      
AA5 5 6  ? parallel      
AA5 6 7  ? parallel      
AA5 7 8  ? parallel      
AA5 8 9  ? anti-parallel 
AA5 9 10 ? anti-parallel 
AA6 1 2  ? anti-parallel 
AA7 1 2  ? anti-parallel 
AA8 1 2  ? parallel      
AA8 2 3  ? parallel      
AA8 3 4  ? parallel      
AA8 4 5  ? parallel      
AA9 1 2  ? anti-parallel 
AB1 1 2  ? anti-parallel 
AB2 1 2  ? anti-parallel 
AB2 2 3  ? anti-parallel 
AB2 3 4  ? parallel      
AB2 4 5  ? parallel      
AB2 5 6  ? parallel      
AB2 6 7  ? parallel      
AB2 7 8  ? parallel      
AB2 8 9  ? parallel      
AB2 9 10 ? anti-parallel 
AB3 1 2  ? parallel      
AB3 2 3  ? parallel      
AB3 3 4  ? parallel      
AB3 4 5  ? parallel      
AB4 1 2  ? anti-parallel 
AB4 2 3  ? parallel      
AB4 3 4  ? parallel      
AB4 4 5  ? parallel      
AB4 5 6  ? parallel      
AB4 6 7  ? parallel      
AB4 7 8  ? parallel      
AB4 8 9  ? anti-parallel 
AB4 9 10 ? anti-parallel 
AB5 1 2  ? anti-parallel 
AB6 1 2  ? anti-parallel 
AB7 1 2  ? parallel      
AB7 2 3  ? parallel      
AB7 3 4  ? parallel      
AB7 4 5  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ILE A 26  ? ILE A 28  ? ILE A 22  ILE A 24  
AA1 2  GLU A 31  ? GLN A 33  ? GLU A 27  GLN A 29  
AA2 1  VAL A 40  ? TYR A 44  ? VAL A 36  TYR A 40  
AA2 2  GLN A 51  ? GLN A 56  ? GLN A 47  GLN A 52  
AA3 1  THR A 147 ? ILE A 148 ? THR A 143 ILE A 144 
AA3 2  TYR A 154 ? PRO A 162 ? TYR A 150 PRO A 158 
AA3 3  SER A 490 ? LYS A 498 ? SER A 486 LYS A 494 
AA3 4  THR B 454 ? ILE B 457 ? THR B 450 ILE B 453 
AA3 5  VAL B 432 ? PHE B 436 ? VAL B 428 PHE B 432 
AA3 6  ASN B 279 ? ILE B 281 ? ASN B 275 ILE B 277 
AA3 7  ARG B 311 ? GLU B 315 ? ARG B 307 GLU B 311 
AA3 8  VAL B 408 ? PHE B 414 ? VAL B 404 PHE B 410 
AA3 9  THR B 388 ? SER B 391 ? THR B 384 SER B 387 
AA3 10 LYS B 370 ? CYS B 373 ? LYS B 366 CYS B 369 
AA4 1  ILE A 222 ? ILE A 224 ? ILE A 218 ILE A 220 
AA4 2  THR A 192 ? LYS A 196 ? THR A 188 LYS A 192 
AA4 3  VAL A 165 ? ILE A 169 ? VAL A 161 ILE A 165 
AA4 4  LYS A 244 ? THR A 248 ? LYS A 240 THR A 244 
AA4 5  ARG A 268 ? GLU A 272 ? ARG A 264 GLU A 268 
AA5 1  LYS A 370 ? CYS A 373 ? LYS A 366 CYS A 369 
AA5 2  THR A 388 ? VAL A 393 ? THR A 384 VAL A 389 
AA5 3  VAL A 408 ? PHE A 414 ? VAL A 404 PHE A 410 
AA5 4  ARG A 311 ? GLU A 315 ? ARG A 307 GLU A 311 
AA5 5  ASN A 279 ? ILE A 281 ? ASN A 275 ILE A 277 
AA5 6  VAL A 432 ? PHE A 436 ? VAL A 428 PHE A 432 
AA5 7  THR A 454 ? ILE A 457 ? THR A 450 ILE A 453 
AA5 8  SER B 490 ? LYS B 498 ? SER B 486 LYS B 494 
AA5 9  TYR B 154 ? PRO B 162 ? TYR B 150 PRO B 158 
AA5 10 THR B 147 ? ILE B 148 ? THR B 143 ILE B 144 
AA6 1  ILE B 26  ? ILE B 28  ? ILE B 22  ILE B 24  
AA6 2  GLU B 31  ? GLN B 33  ? GLU B 27  GLN B 29  
AA7 1  VAL B 40  ? TYR B 44  ? VAL B 36  TYR B 40  
AA7 2  GLN B 51  ? GLN B 56  ? GLN B 47  GLN B 52  
AA8 1  ILE B 222 ? ILE B 224 ? ILE B 218 ILE B 220 
AA8 2  THR B 192 ? LYS B 196 ? THR B 188 LYS B 192 
AA8 3  VAL B 165 ? ILE B 169 ? VAL B 161 ILE B 165 
AA8 4  LYS B 244 ? THR B 248 ? LYS B 240 THR B 244 
AA8 5  ARG B 268 ? GLU B 272 ? ARG B 264 GLU B 268 
AA9 1  ILE C 26  ? ILE C 28  ? ILE C 22  ILE C 24  
AA9 2  GLU C 31  ? GLN C 33  ? GLU C 27  GLN C 29  
AB1 1  VAL C 40  ? TYR C 44  ? VAL C 36  TYR C 40  
AB1 2  GLN C 51  ? GLN C 56  ? GLN C 47  GLN C 52  
AB2 1  MET C 146 ? ILE C 148 ? MET C 142 ILE C 144 
AB2 2  TYR C 154 ? PRO C 162 ? TYR C 150 PRO C 158 
AB2 3  SER C 490 ? LYS C 498 ? SER C 486 LYS C 494 
AB2 4  THR D 454 ? ILE D 457 ? THR D 450 ILE D 453 
AB2 5  VAL D 432 ? PHE D 436 ? VAL D 428 PHE D 432 
AB2 6  ASN D 279 ? ILE D 281 ? ASN D 275 ILE D 277 
AB2 7  ARG D 311 ? GLU D 315 ? ARG D 307 GLU D 311 
AB2 8  VAL D 408 ? PHE D 414 ? VAL D 404 PHE D 410 
AB2 9  THR D 388 ? SER D 391 ? THR D 384 SER D 387 
AB2 10 LYS D 370 ? CYS D 373 ? LYS D 366 CYS D 369 
AB3 1  ILE C 222 ? ILE C 224 ? ILE C 218 ILE C 220 
AB3 2  THR C 192 ? LYS C 196 ? THR C 188 LYS C 192 
AB3 3  VAL C 165 ? ILE C 169 ? VAL C 161 ILE C 165 
AB3 4  LYS C 244 ? THR C 248 ? LYS C 240 THR C 244 
AB3 5  ARG C 268 ? GLU C 272 ? ARG C 264 GLU C 268 
AB4 1  LYS C 370 ? CYS C 373 ? LYS C 366 CYS C 369 
AB4 2  THR C 388 ? VAL C 393 ? THR C 384 VAL C 389 
AB4 3  VAL C 408 ? PHE C 414 ? VAL C 404 PHE C 410 
AB4 4  ARG C 311 ? GLU C 315 ? ARG C 307 GLU C 311 
AB4 5  ASN C 279 ? ILE C 281 ? ASN C 275 ILE C 277 
AB4 6  VAL C 432 ? PHE C 436 ? VAL C 428 PHE C 432 
AB4 7  THR C 454 ? ILE C 457 ? THR C 450 ILE C 453 
AB4 8  SER D 490 ? LYS D 498 ? SER D 486 LYS D 494 
AB4 9  TYR D 154 ? PRO D 162 ? TYR D 150 PRO D 158 
AB4 10 MET D 146 ? ILE D 148 ? MET D 142 ILE D 144 
AB5 1  ILE D 26  ? ILE D 28  ? ILE D 22  ILE D 24  
AB5 2  GLU D 31  ? GLN D 33  ? GLU D 27  GLN D 29  
AB6 1  VAL D 40  ? TYR D 44  ? VAL D 36  TYR D 40  
AB6 2  GLN D 51  ? GLN D 56  ? GLN D 47  GLN D 52  
AB7 1  ILE D 222 ? ILE D 224 ? ILE D 218 ILE D 220 
AB7 2  THR D 192 ? LYS D 196 ? THR D 188 LYS D 192 
AB7 3  VAL D 165 ? ILE D 169 ? VAL D 161 ILE D 165 
AB7 4  LYS D 244 ? GLY D 249 ? LYS D 240 GLY D 245 
AB7 5  ARG D 268 ? LEU D 273 ? ARG D 264 LEU D 269 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N ILE A 28  ? N ILE A 24  O GLU A 31  ? O GLU A 27  
AA2 1 2  N PHE A 41  ? N PHE A 37  O VAL A 55  ? O VAL A 51  
AA3 1 2  N ILE A 148 ? N ILE A 144 O THR A 156 ? O THR A 152 
AA3 2 3  N PHE A 157 ? N PHE A 153 O VAL A 495 ? O VAL A 491 
AA3 3 4  N THR A 496 ? N THR A 492 O ILE B 457 ? O ILE B 453 
AA3 4 5  O THR B 454 ? O THR B 450 N ALA B 433 ? N ALA B 429 
AA3 5 6  O ALA B 434 ? O ALA B 430 N ILE B 280 ? N ILE B 276 
AA3 6 7  N ASN B 279 ? N ASN B 275 O PHE B 313 ? O PHE B 309 
AA3 7 8  N VAL B 314 ? N VAL B 310 O LEU B 412 ? O LEU B 408 
AA3 8 9  O GLN B 409 ? O GLN B 405 N THR B 388 ? N THR B 384 
AA3 9 10 O VAL B 389 ? O VAL B 385 N GLU B 372 ? N GLU B 368 
AA4 1 2  O ASN A 223 ? O ASN A 219 N VAL A 193 ? N VAL A 189 
AA4 2 3  O THR A 192 ? O THR A 188 N CYS A 166 ? N CYS A 162 
AA4 3 4  N GLY A 167 ? N GLY A 163 O LYS A 244 ? O LYS A 240 
AA4 4 5  N ILE A 245 ? N ILE A 241 O ARG A 268 ? O ARG A 264 
AA5 1 2  N GLU A 372 ? N GLU A 368 O VAL A 389 ? O VAL A 385 
AA5 2 3  N PHE A 390 ? N PHE A 386 O ILE A 411 ? O ILE A 407 
AA5 3 4  O LEU A 412 ? O LEU A 408 N VAL A 314 ? N VAL A 310 
AA5 4 5  O PHE A 313 ? O PHE A 309 N ASN A 279 ? N ASN A 275 
AA5 5 6  N ILE A 280 ? N ILE A 276 O ALA A 434 ? O ALA A 430 
AA5 6 7  N VAL A 435 ? N VAL A 431 O TRP A 456 ? O TRP A 452 
AA5 7 8  N ILE A 457 ? N ILE A 453 O THR B 496 ? O THR B 492 
AA5 8 9  O GLU B 491 ? O GLU B 487 N GLU B 161 ? N GLU B 157 
AA5 9 10 O THR B 156 ? O THR B 152 N ILE B 148 ? N ILE B 144 
AA6 1 2  N ILE B 26  ? N ILE B 22  O GLN B 33  ? O GLN B 29  
AA7 1 2  N VAL B 43  ? N VAL B 39  O VAL B 52  ? O VAL B 48  
AA8 1 2  O ASN B 223 ? O ASN B 219 N ILE B 195 ? N ILE B 191 
AA8 2 3  O THR B 192 ? O THR B 188 N CYS B 166 ? N CYS B 162 
AA8 3 4  N GLY B 167 ? N GLY B 163 O LYS B 244 ? O LYS B 240 
AA8 4 5  N ILE B 245 ? N ILE B 241 O ARG B 268 ? O ARG B 264 
AA9 1 2  N ILE C 26  ? N ILE C 22  O GLN C 33  ? O GLN C 29  
AB1 1 2  N PHE C 41  ? N PHE C 37  O VAL C 55  ? O VAL C 51  
AB2 1 2  N ILE C 148 ? N ILE C 144 O THR C 156 ? O THR C 152 
AB2 2 3  N PHE C 157 ? N PHE C 153 O VAL C 495 ? O VAL C 491 
AB2 3 4  N THR C 496 ? N THR C 492 O ILE D 457 ? O ILE D 453 
AB2 4 5  O TRP D 456 ? O TRP D 452 N ALA D 433 ? N ALA D 429 
AB2 5 6  O ALA D 434 ? O ALA D 430 N ILE D 280 ? N ILE D 276 
AB2 6 7  N ASN D 279 ? N ASN D 275 O PHE D 313 ? O PHE D 309 
AB2 7 8  N ILE D 312 ? N ILE D 308 O LEU D 412 ? O LEU D 408 
AB2 8 9  O GLN D 409 ? O GLN D 405 N THR D 388 ? N THR D 384 
AB2 9 10 O VAL D 389 ? O VAL D 385 N GLU D 372 ? N GLU D 368 
AB3 1 2  O ASN C 223 ? O ASN C 219 N VAL C 193 ? N VAL C 189 
AB3 2 3  O LYS C 196 ? O LYS C 192 N GLN C 168 ? N GLN C 164 
AB3 3 4  N GLY C 167 ? N GLY C 163 O LYS C 244 ? O LYS C 240 
AB3 4 5  N PHE C 247 ? N PHE C 243 O THR C 270 ? O THR C 266 
AB4 1 2  N GLU C 372 ? N GLU C 368 O VAL C 389 ? O VAL C 385 
AB4 2 3  N PHE C 390 ? N PHE C 386 O GLN C 409 ? O GLN C 405 
AB4 3 4  O LEU C 412 ? O LEU C 408 N ILE C 312 ? N ILE C 308 
AB4 4 5  O PHE C 313 ? O PHE C 309 N ASN C 279 ? N ASN C 275 
AB4 5 6  N ILE C 280 ? N ILE C 276 O ALA C 434 ? O ALA C 430 
AB4 6 7  N ALA C 433 ? N ALA C 429 O TRP C 456 ? O TRP C 452 
AB4 7 8  N ILE C 457 ? N ILE C 453 O THR D 496 ? O THR D 492 
AB4 8 9  O VAL D 495 ? O VAL D 491 N PHE D 157 ? N PHE D 153 
AB4 9 10 O THR D 156 ? O THR D 152 N ILE D 148 ? N ILE D 144 
AB5 1 2  N ILE D 26  ? N ILE D 22  O GLN D 33  ? O GLN D 29  
AB6 1 2  N VAL D 43  ? N VAL D 39  O VAL D 52  ? O VAL D 48  
AB7 1 2  O ASN D 223 ? O ASN D 219 N VAL D 193 ? N VAL D 189 
AB7 2 3  O THR D 192 ? O THR D 188 N CYS D 166 ? N CYS D 162 
AB7 3 4  N GLY D 167 ? N GLY D 163 O LYS D 244 ? O LYS D 240 
AB7 4 5  N ILE D 245 ? N ILE D 241 O ARG D 268 ? O ARG D 264 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NAD 5001 ? 14 'binding site for residue NAD A 5001' 
AC2 Software B NAD 601  ? 13 'binding site for residue NAD B 601'  
AC3 Software C NAD 601  ? 14 'binding site for residue NAD C 601'  
AC4 Software D NAD 601  ? 13 'binding site for residue NAD D 601'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 ILE A 169 ? ILE A 165 . ? 1_555 ? 
2  AC1 14 ILE A 170 ? ILE A 166 . ? 1_555 ? 
3  AC1 14 TRP A 172 ? TRP A 168 . ? 1_555 ? 
4  AC1 14 LYS A 196 ? LYS A 192 . ? 1_555 ? 
5  AC1 14 ALA A 198 ? ALA A 194 . ? 1_555 ? 
6  AC1 14 GLU A 199 ? GLU A 195 . ? 1_555 ? 
7  AC1 14 TYR A 228 ? TYR A 224 . ? 1_555 ? 
8  AC1 14 GLY A 229 ? GLY A 225 . ? 1_555 ? 
9  AC1 14 GLY A 233 ? GLY A 229 . ? 1_555 ? 
10 AC1 14 ALA A 234 ? ALA A 230 . ? 1_555 ? 
11 AC1 14 PHE A 247 ? PHE A 243 . ? 1_555 ? 
12 AC1 14 SER A 250 ? SER A 246 . ? 1_555 ? 
13 AC1 14 VAL A 253 ? VAL A 249 . ? 1_555 ? 
14 AC1 14 ILE A 257 ? ILE A 253 . ? 1_555 ? 
15 AC2 13 ILE B 169 ? ILE B 165 . ? 1_555 ? 
16 AC2 13 ILE B 170 ? ILE B 166 . ? 1_555 ? 
17 AC2 13 TRP B 172 ? TRP B 168 . ? 1_555 ? 
18 AC2 13 LYS B 196 ? LYS B 192 . ? 1_555 ? 
19 AC2 13 ALA B 198 ? ALA B 194 . ? 1_555 ? 
20 AC2 13 GLU B 199 ? GLU B 195 . ? 1_555 ? 
21 AC2 13 GLY B 229 ? GLY B 225 . ? 1_555 ? 
22 AC2 13 GLY B 233 ? GLY B 229 . ? 1_555 ? 
23 AC2 13 ALA B 234 ? ALA B 230 . ? 1_555 ? 
24 AC2 13 PHE B 247 ? PHE B 243 . ? 1_555 ? 
25 AC2 13 SER B 250 ? SER B 246 . ? 1_555 ? 
26 AC2 13 VAL B 253 ? VAL B 249 . ? 1_555 ? 
27 AC2 13 ILE B 257 ? ILE B 253 . ? 1_555 ? 
28 AC3 14 ILE C 169 ? ILE C 165 . ? 1_555 ? 
29 AC3 14 ILE C 170 ? ILE C 166 . ? 1_555 ? 
30 AC3 14 TRP C 172 ? TRP C 168 . ? 1_555 ? 
31 AC3 14 LYS C 196 ? LYS C 192 . ? 1_555 ? 
32 AC3 14 ALA C 198 ? ALA C 194 . ? 1_555 ? 
33 AC3 14 GLU C 199 ? GLU C 195 . ? 1_555 ? 
34 AC3 14 GLY C 229 ? GLY C 225 . ? 1_555 ? 
35 AC3 14 PRO C 230 ? PRO C 226 . ? 1_555 ? 
36 AC3 14 GLY C 233 ? GLY C 229 . ? 1_555 ? 
37 AC3 14 ALA C 234 ? ALA C 230 . ? 1_555 ? 
38 AC3 14 PHE C 247 ? PHE C 243 . ? 1_555 ? 
39 AC3 14 SER C 250 ? SER C 246 . ? 1_555 ? 
40 AC3 14 VAL C 253 ? VAL C 249 . ? 1_555 ? 
41 AC3 14 ILE C 257 ? ILE C 253 . ? 1_555 ? 
42 AC4 13 ILE D 169 ? ILE D 165 . ? 1_555 ? 
43 AC4 13 ILE D 170 ? ILE D 166 . ? 1_555 ? 
44 AC4 13 TRP D 172 ? TRP D 168 . ? 1_555 ? 
45 AC4 13 LYS D 196 ? LYS D 192 . ? 1_555 ? 
46 AC4 13 ALA D 198 ? ALA D 194 . ? 1_555 ? 
47 AC4 13 GLU D 199 ? GLU D 195 . ? 1_555 ? 
48 AC4 13 GLY D 229 ? GLY D 225 . ? 1_555 ? 
49 AC4 13 GLY D 233 ? GLY D 229 . ? 1_555 ? 
50 AC4 13 ALA D 234 ? ALA D 230 . ? 1_555 ? 
51 AC4 13 PHE D 247 ? PHE D 243 . ? 1_555 ? 
52 AC4 13 SER D 250 ? SER D 246 . ? 1_555 ? 
53 AC4 13 VAL D 253 ? VAL D 249 . ? 1_555 ? 
54 AC4 13 ILE D 257 ? ILE D 253 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X2Q 
_atom_sites.fract_transf_matrix[1][1]   0.011821 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007117 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006081 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LEU A 1 12  ? 17.195  -20.922 -15.523 1.00 100.64 ? 8    LEU A N   1 
ATOM   2     C CA  . LEU A 1 12  ? 18.196  -21.983 -15.844 1.00 101.18 ? 8    LEU A CA  1 
ATOM   3     C C   . LEU A 1 12  ? 19.542  -21.355 -16.252 1.00 99.18  ? 8    LEU A C   1 
ATOM   4     O O   . LEU A 1 12  ? 19.944  -21.449 -17.417 1.00 101.12 ? 8    LEU A O   1 
ATOM   5     C CB  . LEU A 1 12  ? 17.663  -22.900 -16.957 1.00 105.63 ? 8    LEU A CB  1 
ATOM   6     C CG  . LEU A 1 12  ? 16.183  -23.314 -16.956 1.00 108.77 ? 8    LEU A CG  1 
ATOM   7     C CD1 . LEU A 1 12  ? 15.759  -23.820 -18.331 1.00 113.03 ? 8    LEU A CD1 1 
ATOM   8     C CD2 . LEU A 1 12  ? 15.874  -24.350 -15.879 1.00 108.66 ? 8    LEU A CD2 1 
ATOM   9     N N   . PRO A 1 13  ? 20.248  -20.721 -15.288 1.00 95.47  ? 9    PRO A N   1 
ATOM   10    C CA  . PRO A 1 13  ? 21.459  -19.949 -15.596 1.00 93.59  ? 9    PRO A CA  1 
ATOM   11    C C   . PRO A 1 13  ? 22.697  -20.812 -15.852 1.00 93.78  ? 9    PRO A C   1 
ATOM   12    O O   . PRO A 1 13  ? 22.882  -21.844 -15.200 1.00 93.68  ? 9    PRO A O   1 
ATOM   13    C CB  . PRO A 1 13  ? 21.668  -19.087 -14.340 1.00 89.86  ? 9    PRO A CB  1 
ATOM   14    C CG  . PRO A 1 13  ? 20.570  -19.466 -13.373 1.00 89.85  ? 9    PRO A CG  1 
ATOM   15    C CD  . PRO A 1 13  ? 19.992  -20.757 -13.839 1.00 93.10  ? 9    PRO A CD  1 
ATOM   16    N N   . SER A 1 14  ? 23.534  -20.369 -16.790 1.00 94.22  ? 10   SER A N   1 
ATOM   17    C CA  . SER A 1 14  ? 24.750  -21.088 -17.181 1.00 94.74  ? 10   SER A CA  1 
ATOM   18    C C   . SER A 1 14  ? 26.016  -20.270 -16.906 1.00 92.14  ? 10   SER A C   1 
ATOM   19    O O   . SER A 1 14  ? 25.956  -19.038 -16.860 1.00 90.67  ? 10   SER A O   1 
ATOM   20    C CB  . SER A 1 14  ? 24.693  -21.462 -18.667 1.00 98.27  ? 10   SER A CB  1 
ATOM   21    O OG  . SER A 1 14  ? 23.746  -22.487 -18.908 1.00 101.08 ? 10   SER A OG  1 
ATOM   22    N N   . PRO A 1 15  ? 27.167  -20.951 -16.721 1.00 91.77  ? 11   PRO A N   1 
ATOM   23    C CA  . PRO A 1 15  ? 28.437  -20.238 -16.577 1.00 89.89  ? 11   PRO A CA  1 
ATOM   24    C C   . PRO A 1 15  ? 28.818  -19.518 -17.862 1.00 91.42  ? 11   PRO A C   1 
ATOM   25    O O   . PRO A 1 15  ? 28.556  -20.025 -18.955 1.00 94.34  ? 11   PRO A O   1 
ATOM   26    C CB  . PRO A 1 15  ? 29.449  -21.357 -16.297 1.00 90.15  ? 11   PRO A CB  1 
ATOM   27    C CG  . PRO A 1 15  ? 28.647  -22.541 -15.904 1.00 91.30  ? 11   PRO A CG  1 
ATOM   28    C CD  . PRO A 1 15  ? 27.339  -22.411 -16.600 1.00 93.23  ? 11   PRO A CD  1 
ATOM   29    N N   . THR A 1 16  ? 29.424  -18.342 -17.728 1.00 89.70  ? 12   THR A N   1 
ATOM   30    C CA  . THR A 1 16  ? 29.934  -17.607 -18.885 1.00 91.18  ? 12   THR A CA  1 
ATOM   31    C C   . THR A 1 16  ? 31.124  -18.364 -19.511 1.00 92.71  ? 12   THR A C   1 
ATOM   32    O O   . THR A 1 16  ? 32.140  -18.589 -18.848 1.00 91.21  ? 12   THR A O   1 
ATOM   33    C CB  . THR A 1 16  ? 30.240  -16.109 -18.554 1.00 89.05  ? 12   THR A CB  1 
ATOM   34    O OG1 . THR A 1 16  ? 31.100  -15.547 -19.551 1.00 90.49  ? 12   THR A OG1 1 
ATOM   35    C CG2 . THR A 1 16  ? 30.888  -15.958 -17.193 1.00 86.02  ? 12   THR A CG2 1 
ATOM   36    N N   . PRO A 1 17  ? 30.979  -18.771 -20.789 1.00 95.89  ? 13   PRO A N   1 
ATOM   37    C CA  . PRO A 1 17  ? 31.848  -19.743 -21.472 1.00 98.13  ? 13   PRO A CA  1 
ATOM   38    C C   . PRO A 1 17  ? 33.346  -19.422 -21.457 1.00 97.46  ? 13   PRO A C   1 
ATOM   39    O O   . PRO A 1 17  ? 34.106  -20.086 -20.755 1.00 96.53  ? 13   PRO A O   1 
ATOM   40    C CB  . PRO A 1 17  ? 31.304  -19.763 -22.911 1.00 101.51 ? 13   PRO A CB  1 
ATOM   41    C CG  . PRO A 1 17  ? 30.484  -18.523 -23.040 1.00 100.94 ? 13   PRO A CG  1 
ATOM   42    C CD  . PRO A 1 17  ? 29.919  -18.274 -21.684 1.00 97.82  ? 13   PRO A CD  1 
ATOM   43    N N   . ASN A 1 18  ? 33.763  -18.425 -22.229 1.00 98.19  ? 14   ASN A N   1 
ATOM   44    C CA  . ASN A 1 18  ? 35.174  -18.073 -22.319 1.00 98.04  ? 14   ASN A CA  1 
ATOM   45    C C   . ASN A 1 18  ? 35.516  -16.941 -21.364 1.00 95.11  ? 14   ASN A C   1 
ATOM   46    O O   . ASN A 1 18  ? 35.877  -15.839 -21.785 1.00 95.28  ? 14   ASN A O   1 
ATOM   47    C CB  . ASN A 1 18  ? 35.552  -17.719 -23.761 1.00 100.92 ? 14   ASN A CB  1 
ATOM   48    C CG  . ASN A 1 18  ? 35.238  -18.836 -24.738 1.00 104.18 ? 14   ASN A CG  1 
ATOM   49    O OD1 . ASN A 1 18  ? 34.760  -19.905 -24.352 1.00 104.29 ? 14   ASN A OD1 1 
ATOM   50    N ND2 . ASN A 1 18  ? 35.502  -18.592 -26.015 1.00 107.18 ? 14   ASN A ND2 1 
ATOM   51    N N   . LEU A 1 19  ? 35.388  -17.227 -20.072 1.00 92.67  ? 15   LEU A N   1 
ATOM   52    C CA  . LEU A 1 19  ? 35.690  -16.253 -19.034 1.00 89.88  ? 15   LEU A CA  1 
ATOM   53    C C   . LEU A 1 19  ? 37.194  -16.011 -18.935 1.00 89.88  ? 15   LEU A C   1 
ATOM   54    O O   . LEU A 1 19  ? 37.953  -16.902 -18.545 1.00 90.09  ? 15   LEU A O   1 
ATOM   55    C CB  . LEU A 1 19  ? 35.114  -16.704 -17.686 1.00 87.58  ? 15   LEU A CB  1 
ATOM   56    C CG  . LEU A 1 19  ? 35.374  -15.790 -16.483 1.00 84.65  ? 15   LEU A CG  1 
ATOM   57    C CD1 . LEU A 1 19  ? 34.092  -15.495 -15.737 1.00 82.84  ? 15   LEU A CD1 1 
ATOM   58    C CD2 . LEU A 1 19  ? 36.418  -16.385 -15.549 1.00 83.80  ? 15   LEU A CD2 1 
ATOM   59    N N   . GLU A 1 20  ? 37.615  -14.806 -19.307 1.00 89.90  ? 16   GLU A N   1 
ATOM   60    C CA  . GLU A 1 20  ? 39.010  -14.410 -19.157 1.00 89.95  ? 16   GLU A CA  1 
ATOM   61    C C   . GLU A 1 20  ? 39.169  -13.463 -17.974 1.00 87.19  ? 16   GLU A C   1 
ATOM   62    O O   . GLU A 1 20  ? 38.333  -12.588 -17.750 1.00 85.94  ? 16   GLU A O   1 
ATOM   63    C CB  . GLU A 1 20  ? 39.574  -13.800 -20.450 1.00 92.49  ? 16   GLU A CB  1 
ATOM   64    C CG  . GLU A 1 20  ? 39.000  -12.444 -20.871 1.00 92.53  ? 16   GLU A CG  1 
ATOM   65    C CD  . GLU A 1 20  ? 39.741  -11.841 -22.058 1.00 95.36  ? 16   GLU A CD  1 
ATOM   66    O OE1 . GLU A 1 20  ? 39.809  -12.494 -23.123 1.00 97.94  ? 16   GLU A OE1 1 
ATOM   67    O OE2 . GLU A 1 20  ? 40.253  -10.709 -21.926 1.00 94.90  ? 16   GLU A OE2 1 
ATOM   68    N N   . ILE A 1 21  ? 40.238  -13.660 -17.211 1.00 86.46  ? 17   ILE A N   1 
ATOM   69    C CA  . ILE A 1 21  ? 40.509  -12.820 -16.054 1.00 84.05  ? 17   ILE A CA  1 
ATOM   70    C C   . ILE A 1 21  ? 41.134  -11.512 -16.533 1.00 84.66  ? 17   ILE A C   1 
ATOM   71    O O   . ILE A 1 21  ? 42.299  -11.478 -16.938 1.00 86.26  ? 17   ILE A O   1 
ATOM   72    C CB  . ILE A 1 21  ? 41.440  -13.516 -15.027 1.00 83.41  ? 17   ILE A CB  1 
ATOM   73    C CG1 . ILE A 1 21  ? 41.198  -15.037 -14.972 1.00 84.06  ? 17   ILE A CG1 1 
ATOM   74    C CG2 . ILE A 1 21  ? 41.315  -12.844 -13.658 1.00 80.88  ? 17   ILE A CG2 1 
ATOM   75    C CD1 . ILE A 1 21  ? 39.862  -15.477 -14.373 1.00 82.69  ? 17   ILE A CD1 1 
ATOM   76    N N   . LYS A 1 22  ? 40.340  -10.446 -16.501 1.00 83.51  ? 18   LYS A N   1 
ATOM   77    C CA  . LYS A 1 22  ? 40.782  -9.135  -16.970 1.00 84.15  ? 18   LYS A CA  1 
ATOM   78    C C   . LYS A 1 22  ? 41.557  -8.378  -15.891 1.00 82.65  ? 18   LYS A C   1 
ATOM   79    O O   . LYS A 1 22  ? 42.480  -7.619  -16.198 1.00 83.86  ? 18   LYS A O   1 
ATOM   80    C CB  . LYS A 1 22  ? 39.586  -8.302  -17.446 1.00 83.93  ? 18   LYS A CB  1 
ATOM   81    C CG  . LYS A 1 22  ? 39.970  -7.039  -18.204 1.00 85.35  ? 18   LYS A CG  1 
ATOM   82    C CD  . LYS A 1 22  ? 38.787  -6.106  -18.388 1.00 84.80  ? 18   LYS A CD  1 
ATOM   83    C CE  . LYS A 1 22  ? 39.240  -4.764  -18.945 1.00 86.05  ? 18   LYS A CE  1 
ATOM   84    N NZ  . LYS A 1 22  ? 38.114  -3.800  -19.084 1.00 85.53  ? 18   LYS A NZ  1 
ATOM   85    N N   . TYR A 1 23  ? 41.181  -8.592  -14.633 1.00 80.16  ? 19   TYR A N   1 
ATOM   86    C CA  . TYR A 1 23  ? 41.734  -7.819  -13.524 1.00 78.57  ? 19   TYR A CA  1 
ATOM   87    C C   . TYR A 1 23  ? 42.671  -8.649  -12.656 1.00 78.32  ? 19   TYR A C   1 
ATOM   88    O O   . TYR A 1 23  ? 42.231  -9.401  -11.784 1.00 76.82  ? 19   TYR A O   1 
ATOM   89    C CB  . TYR A 1 23  ? 40.605  -7.188  -12.703 1.00 76.10  ? 19   TYR A CB  1 
ATOM   90    C CG  . TYR A 1 23  ? 39.650  -6.372  -13.546 1.00 76.35  ? 19   TYR A CG  1 
ATOM   91    C CD1 . TYR A 1 23  ? 39.979  -5.079  -13.956 1.00 76.95  ? 19   TYR A CD1 1 
ATOM   92    C CD2 . TYR A 1 23  ? 38.423  -6.897  -13.948 1.00 76.25  ? 19   TYR A CD2 1 
ATOM   93    C CE1 . TYR A 1 23  ? 39.107  -4.325  -14.737 1.00 77.47  ? 19   TYR A CE1 1 
ATOM   94    C CE2 . TYR A 1 23  ? 37.543  -6.152  -14.731 1.00 76.83  ? 19   TYR A CE2 1 
ATOM   95    C CZ  . TYR A 1 23  ? 37.893  -4.868  -15.121 1.00 77.45  ? 19   TYR A CZ  1 
ATOM   96    O OH  . TYR A 1 23  ? 37.030  -4.126  -15.892 1.00 78.35  ? 19   TYR A OH  1 
ATOM   97    N N   . THR A 1 24  ? 43.968  -8.503  -12.917 1.00 80.00  ? 20   THR A N   1 
ATOM   98    C CA  . THR A 1 24  ? 45.001  -9.302  -12.257 1.00 80.43  ? 20   THR A CA  1 
ATOM   99    C C   . THR A 1 24  ? 46.056  -8.442  -11.557 1.00 80.63  ? 20   THR A C   1 
ATOM   100   O O   . THR A 1 24  ? 47.101  -8.951  -11.134 1.00 81.66  ? 20   THR A O   1 
ATOM   101   C CB  . THR A 1 24  ? 45.711  -10.248 -13.259 1.00 83.02  ? 20   THR A CB  1 
ATOM   102   O OG1 . THR A 1 24  ? 46.223  -9.488  -14.361 1.00 85.05  ? 20   THR A OG1 1 
ATOM   103   C CG2 . THR A 1 24  ? 44.755  -11.315 -13.777 1.00 82.85  ? 20   THR A CG2 1 
ATOM   104   N N   . LYS A 1 25  ? 45.779  -7.145  -11.431 1.00 79.80  ? 21   LYS A N   1 
ATOM   105   C CA  . LYS A 1 25  ? 46.724  -6.203  -10.820 1.00 80.09  ? 21   LYS A CA  1 
ATOM   106   C C   . LYS A 1 25  ? 46.305  -5.780  -9.410  1.00 77.46  ? 21   LYS A C   1 
ATOM   107   O O   . LYS A 1 25  ? 45.181  -6.048  -8.982  1.00 75.24  ? 21   LYS A O   1 
ATOM   108   C CB  . LYS A 1 25  ? 46.931  -4.979  -11.723 1.00 81.56  ? 21   LYS A CB  1 
ATOM   109   C CG  . LYS A 1 25  ? 47.643  -5.300  -13.038 1.00 84.81  ? 21   LYS A CG  1 
ATOM   110   C CD  . LYS A 1 25  ? 47.912  -4.055  -13.879 1.00 86.88  ? 21   LYS A CD  1 
ATOM   111   C CE  . LYS A 1 25  ? 49.233  -3.391  -13.511 1.00 88.75  ? 21   LYS A CE  1 
ATOM   112   N NZ  . LYS A 1 25  ? 49.494  -2.159  -14.306 1.00 90.57  ? 21   LYS A NZ  1 
ATOM   113   N N   . ILE A 1 26  ? 47.225  -5.136  -8.694  1.00 77.80  ? 22   ILE A N   1 
ATOM   114   C CA  . ILE A 1 26  ? 46.964  -4.631  -7.347  1.00 75.76  ? 22   ILE A CA  1 
ATOM   115   C C   . ILE A 1 26  ? 46.115  -3.359  -7.422  1.00 74.53  ? 22   ILE A C   1 
ATOM   116   O O   . ILE A 1 26  ? 46.376  -2.479  -8.248  1.00 76.01  ? 22   ILE A O   1 
ATOM   117   C CB  . ILE A 1 26  ? 48.283  -4.368  -6.571  1.00 77.07  ? 22   ILE A CB  1 
ATOM   118   C CG1 . ILE A 1 26  ? 49.120  -5.651  -6.497  1.00 78.48  ? 22   ILE A CG1 1 
ATOM   119   C CG2 . ILE A 1 26  ? 47.998  -3.847  -5.161  1.00 75.21  ? 22   ILE A CG2 1 
ATOM   120   C CD1 . ILE A 1 26  ? 50.579  -5.437  -6.114  1.00 80.83  ? 22   ILE A CD1 1 
ATOM   121   N N   . PHE A 1 27  ? 45.102  -3.276  -6.561  1.00 71.90  ? 23   PHE A N   1 
ATOM   122   C CA  . PHE A 1 27  ? 44.165  -2.156  -6.564  1.00 70.60  ? 23   PHE A CA  1 
ATOM   123   C C   . PHE A 1 27  ? 44.400  -1.197  -5.394  1.00 69.79  ? 23   PHE A C   1 
ATOM   124   O O   . PHE A 1 27  ? 43.876  -1.391  -4.292  1.00 67.89  ? 23   PHE A O   1 
ATOM   125   C CB  . PHE A 1 27  ? 42.723  -2.675  -6.566  1.00 68.70  ? 23   PHE A CB  1 
ATOM   126   C CG  . PHE A 1 27  ? 41.687  -1.611  -6.810  1.00 67.73  ? 23   PHE A CG  1 
ATOM   127   C CD1 . PHE A 1 27  ? 41.487  -1.092  -8.088  1.00 69.05  ? 23   PHE A CD1 1 
ATOM   128   C CD2 . PHE A 1 27  ? 40.893  -1.145  -5.767  1.00 65.42  ? 23   PHE A CD2 1 
ATOM   129   C CE1 . PHE A 1 27  ? 40.522  -0.114  -8.317  1.00 68.22  ? 23   PHE A CE1 1 
ATOM   130   C CE2 . PHE A 1 27  ? 39.926  -0.169  -5.986  1.00 64.60  ? 23   PHE A CE2 1 
ATOM   131   C CZ  . PHE A 1 27  ? 39.739  0.345   -7.263  1.00 66.01  ? 23   PHE A CZ  1 
ATOM   132   N N   . ILE A 1 28  ? 45.196  -0.163  -5.653  1.00 71.39  ? 24   ILE A N   1 
ATOM   133   C CA  . ILE A 1 28  ? 45.476  0.879   -4.669  1.00 71.04  ? 24   ILE A CA  1 
ATOM   134   C C   . ILE A 1 28  ? 44.977  2.218   -5.200  1.00 71.23  ? 24   ILE A C   1 
ATOM   135   O O   . ILE A 1 28  ? 45.168  2.531   -6.377  1.00 72.90  ? 24   ILE A O   1 
ATOM   136   C CB  . ILE A 1 28  ? 46.997  0.975   -4.339  1.00 73.26  ? 24   ILE A CB  1 
ATOM   137   C CG1 . ILE A 1 28  ? 47.507  -0.339  -3.734  1.00 73.23  ? 24   ILE A CG1 1 
ATOM   138   C CG2 . ILE A 1 28  ? 47.288  2.151   -3.396  1.00 73.15  ? 24   ILE A CG2 1 
ATOM   139   C CD1 . ILE A 1 28  ? 49.024  -0.447  -3.638  1.00 75.83  ? 24   ILE A CD1 1 
ATOM   140   N N   . ASN A 1 29  ? 44.324  2.988   -4.330  1.00 69.65  ? 25   ASN A N   1 
ATOM   141   C CA  . ASN A 1 29  ? 43.902  4.358   -4.631  1.00 69.95  ? 25   ASN A CA  1 
ATOM   142   C C   . ASN A 1 29  ? 43.083  4.463   -5.925  1.00 70.32  ? 25   ASN A C   1 
ATOM   143   O O   . ASN A 1 29  ? 43.219  5.424   -6.686  1.00 71.88  ? 25   ASN A O   1 
ATOM   144   C CB  . ASN A 1 29  ? 45.128  5.283   -4.674  1.00 72.33  ? 25   ASN A CB  1 
ATOM   145   C CG  . ASN A 1 29  ? 44.873  6.633   -4.033  1.00 72.01  ? 25   ASN A CG  1 
ATOM   146   O OD1 . ASN A 1 29  ? 43.728  7.043   -3.837  1.00 70.14  ? 25   ASN A OD1 1 
ATOM   147   N ND2 . ASN A 1 29  ? 45.952  7.335   -3.699  1.00 73.94  ? 25   ASN A ND2 1 
ATOM   148   N N   . ASN A 1 30  ? 42.235  3.457   -6.152  1.00 69.12  ? 26   ASN A N   1 
ATOM   149   C CA  . ASN A 1 30  ? 41.405  3.326   -7.360  1.00 69.50  ? 26   ASN A CA  1 
ATOM   150   C C   . ASN A 1 30  ? 42.168  3.095   -8.671  1.00 72.16  ? 26   ASN A C   1 
ATOM   151   O O   . ASN A 1 30  ? 41.575  3.105   -9.752  1.00 73.00  ? 26   ASN A O   1 
ATOM   152   C CB  . ASN A 1 30  ? 40.396  4.480   -7.485  1.00 68.97  ? 26   ASN A CB  1 
ATOM   153   C CG  . ASN A 1 30  ? 39.181  4.298   -6.587  1.00 66.16  ? 26   ASN A CG  1 
ATOM   154   O OD1 . ASN A 1 30  ? 39.198  3.510   -5.642  1.00 64.59  ? 26   ASN A OD1 1 
ATOM   155   N ND2 . ASN A 1 30  ? 38.121  5.038   -6.879  1.00 65.47  ? 26   ASN A ND2 1 
ATOM   156   N N   . GLU A 1 31  ? 43.476  2.878   -8.567  1.00 73.76  ? 27   GLU A N   1 
ATOM   157   C CA  . GLU A 1 31  ? 44.320  2.648   -9.737  1.00 76.55  ? 27   GLU A CA  1 
ATOM   158   C C   . GLU A 1 31  ? 44.886  1.234   -9.739  1.00 76.91  ? 27   GLU A C   1 
ATOM   159   O O   . GLU A 1 31  ? 45.085  0.634   -8.680  1.00 75.72  ? 27   GLU A O   1 
ATOM   160   C CB  . GLU A 1 31  ? 45.466  3.667   -9.790  1.00 78.77  ? 27   GLU A CB  1 
ATOM   161   C CG  . GLU A 1 31  ? 45.039  5.108   -10.081 1.00 79.54  ? 27   GLU A CG  1 
ATOM   162   C CD  . GLU A 1 31  ? 44.499  5.311   -11.496 1.00 81.35  ? 27   GLU A CD  1 
ATOM   163   O OE1 . GLU A 1 31  ? 45.073  4.751   -12.459 1.00 83.41  ? 27   GLU A OE1 1 
ATOM   164   O OE2 . GLU A 1 31  ? 43.499  6.046   -11.642 1.00 80.63  ? 27   GLU A OE2 1 
ATOM   165   N N   . TRP A 1 32  ? 45.137  0.705   -10.933 1.00 78.82  ? 28   TRP A N   1 
ATOM   166   C CA  . TRP A 1 32  ? 45.757  -0.606  -11.078 1.00 79.67  ? 28   TRP A CA  1 
ATOM   167   C C   . TRP A 1 32  ? 47.273  -0.458  -11.151 1.00 82.22  ? 28   TRP A C   1 
ATOM   168   O O   . TRP A 1 32  ? 47.820  -0.018  -12.168 1.00 84.71  ? 28   TRP A O   1 
ATOM   169   C CB  . TRP A 1 32  ? 45.212  -1.342  -12.308 1.00 80.49  ? 28   TRP A CB  1 
ATOM   170   C CG  . TRP A 1 32  ? 43.740  -1.618  -12.230 1.00 78.61  ? 28   TRP A CG  1 
ATOM   171   C CD1 . TRP A 1 32  ? 42.748  -0.987  -12.927 1.00 78.76  ? 28   TRP A CD1 1 
ATOM   172   C CD2 . TRP A 1 32  ? 43.090  -2.586  -11.396 1.00 76.83  ? 28   TRP A CD2 1 
ATOM   173   N NE1 . TRP A 1 32  ? 41.522  -1.506  -12.585 1.00 76.83  ? 28   TRP A NE1 1 
ATOM   174   C CE2 . TRP A 1 32  ? 41.703  -2.489  -11.646 1.00 75.76  ? 28   TRP A CE2 1 
ATOM   175   C CE3 . TRP A 1 32  ? 43.546  -3.528  -10.462 1.00 76.19  ? 28   TRP A CE3 1 
ATOM   176   C CZ2 . TRP A 1 32  ? 40.764  -3.297  -10.993 1.00 74.12  ? 28   TRP A CZ2 1 
ATOM   177   C CZ3 . TRP A 1 32  ? 42.610  -4.334  -9.814  1.00 74.35  ? 28   TRP A CZ3 1 
ATOM   178   C CH2 . TRP A 1 32  ? 41.236  -4.212  -10.085 1.00 73.29  ? 28   TRP A CH2 1 
ATOM   179   N N   . GLN A 1 33  ? 47.939  -0.814  -10.055 1.00 81.80  ? 29   GLN A N   1 
ATOM   180   C CA  . GLN A 1 33  ? 49.395  -0.711  -9.951  1.00 84.28  ? 29   GLN A CA  1 
ATOM   181   C C   . GLN A 1 33  ? 50.064  -2.083  -9.967  1.00 85.17  ? 29   GLN A C   1 
ATOM   182   O O   . GLN A 1 33  ? 49.462  -3.081  -9.564  1.00 83.45  ? 29   GLN A O   1 
ATOM   183   C CB  . GLN A 1 33  ? 49.795  0.053   -8.682  1.00 83.70  ? 29   GLN A CB  1 
ATOM   184   C CG  . GLN A 1 33  ? 49.644  1.570   -8.775  1.00 84.23  ? 29   GLN A CG  1 
ATOM   185   C CD  . GLN A 1 33  ? 50.648  2.212   -9.727  1.00 87.95  ? 29   GLN A CD  1 
ATOM   186   O OE1 . GLN A 1 33  ? 51.861  2.023   -9.600  1.00 89.95  ? 29   GLN A OE1 1 
ATOM   187   N NE2 . GLN A 1 33  ? 50.140  2.983   -10.683 1.00 88.60  ? 29   GLN A NE2 1 
ATOM   188   N N   . ASN A 1 34  ? 51.308  -2.119  -10.442 1.00 88.13  ? 30   ASN A N   1 
ATOM   189   C CA  . ASN A 1 34  ? 52.130  -3.326  -10.398 1.00 89.44  ? 30   ASN A CA  1 
ATOM   190   C C   . ASN A 1 34  ? 52.685  -3.576  -9.000  1.00 88.98  ? 30   ASN A C   1 
ATOM   191   O O   . ASN A 1 34  ? 52.523  -2.749  -8.097  1.00 87.79  ? 30   ASN A O   1 
ATOM   192   C CB  . ASN A 1 34  ? 53.284  -3.234  -11.405 1.00 93.03  ? 30   ASN A CB  1 
ATOM   193   C CG  . ASN A 1 34  ? 52.878  -3.655  -12.804 1.00 93.74  ? 30   ASN A CG  1 
ATOM   194   O OD1 . ASN A 1 34  ? 52.285  -4.716  -13.003 1.00 92.49  ? 30   ASN A OD1 1 
ATOM   195   N ND2 . ASN A 1 34  ? 53.209  -2.827  -13.784 1.00 95.86  ? 30   ASN A ND2 1 
ATOM   196   N N   . SER A 1 35  ? 53.330  -4.725  -8.828  1.00 90.12  ? 31   SER A N   1 
ATOM   197   C CA  . SER A 1 35  ? 54.048  -5.028  -7.596  1.00 90.48  ? 31   SER A CA  1 
ATOM   198   C C   . SER A 1 35  ? 55.350  -4.238  -7.552  1.00 93.62  ? 31   SER A C   1 
ATOM   199   O O   . SER A 1 35  ? 56.034  -4.099  -8.571  1.00 96.31  ? 31   SER A O   1 
ATOM   200   C CB  . SER A 1 35  ? 54.326  -6.528  -7.491  1.00 90.92  ? 31   SER A CB  1 
ATOM   201   O OG  . SER A 1 35  ? 54.771  -7.052  -8.729  1.00 93.01  ? 31   SER A OG  1 
ATOM   202   N N   . GLU A 1 36  ? 55.681  -3.715  -6.372  1.00 93.53  ? 32   GLU A N   1 
ATOM   203   C CA  . GLU A 1 36  ? 56.905  -2.935  -6.182  1.00 96.74  ? 32   GLU A CA  1 
ATOM   204   C C   . GLU A 1 36  ? 58.154  -3.784  -6.397  1.00 100.06 ? 32   GLU A C   1 
ATOM   205   O O   . GLU A 1 36  ? 59.154  -3.304  -6.929  1.00 103.31 ? 32   GLU A O   1 
ATOM   206   C CB  . GLU A 1 36  ? 56.927  -2.282  -4.795  1.00 95.86  ? 32   GLU A CB  1 
ATOM   207   C CG  . GLU A 1 36  ? 56.060  -1.023  -4.674  1.00 93.97  ? 32   GLU A CG  1 
ATOM   208   C CD  . GLU A 1 36  ? 56.597  0.160   -5.474  1.00 96.57  ? 32   GLU A CD  1 
ATOM   209   O OE1 . GLU A 1 36  ? 57.830  0.260   -5.657  1.00 100.29 ? 32   GLU A OE1 1 
ATOM   210   O OE2 . GLU A 1 36  ? 55.783  0.998   -5.918  1.00 95.06  ? 32   GLU A OE2 1 
ATOM   211   N N   . SER A 1 37  ? 58.078  -5.045  -5.985  1.00 99.46  ? 33   SER A N   1 
ATOM   212   C CA  . SER A 1 37  ? 59.139  -6.015  -6.222  1.00 102.54 ? 33   SER A CA  1 
ATOM   213   C C   . SER A 1 37  ? 59.172  -6.447  -7.685  1.00 103.96 ? 33   SER A C   1 
ATOM   214   O O   . SER A 1 37  ? 60.241  -6.727  -8.230  1.00 107.41 ? 33   SER A O   1 
ATOM   215   C CB  . SER A 1 37  ? 58.952  -7.238  -5.322  1.00 101.28 ? 33   SER A CB  1 
ATOM   216   O OG  . SER A 1 37  ? 57.686  -7.842  -5.535  1.00 98.10  ? 33   SER A OG  1 
ATOM   217   N N   . GLY A 1 38  ? 57.999  -6.498  -8.311  1.00 101.61 ? 34   GLY A N   1 
ATOM   218   C CA  . GLY A 1 38  ? 57.874  -6.929  -9.703  1.00 102.93 ? 34   GLY A CA  1 
ATOM   219   C C   . GLY A 1 38  ? 57.427  -8.374  -9.849  1.00 102.19 ? 34   GLY A C   1 
ATOM   220   O O   . GLY A 1 38  ? 57.091  -8.819  -10.950 1.00 102.53 ? 34   GLY A O   1 
ATOM   221   N N   . ARG A 1 39  ? 57.419  -9.102  -8.733  1.00 101.36 ? 35   ARG A N   1 
ATOM   222   C CA  . ARG A 1 39  ? 57.045  -10.517 -8.718  1.00 100.91 ? 35   ARG A CA  1 
ATOM   223   C C   . ARG A 1 39  ? 55.551  -10.755 -8.910  1.00 97.71  ? 35   ARG A C   1 
ATOM   224   O O   . ARG A 1 39  ? 54.716  -9.977  -8.444  1.00 95.26  ? 35   ARG A O   1 
ATOM   225   C CB  . ARG A 1 39  ? 57.518  -11.188 -7.429  1.00 101.11 ? 35   ARG A CB  1 
ATOM   226   C CG  . ARG A 1 39  ? 58.882  -11.838 -7.545  1.00 105.18 ? 35   ARG A CG  1 
ATOM   227   C CD  . ARG A 1 39  ? 59.381  -12.294 -6.190  1.00 106.22 ? 35   ARG A CD  1 
ATOM   228   N NE  . ARG A 1 39  ? 59.808  -11.163 -5.367  1.00 106.95 ? 35   ARG A NE  1 
ATOM   229   C CZ  . ARG A 1 39  ? 60.272  -11.263 -4.124  1.00 107.75 ? 35   ARG A CZ  1 
ATOM   230   N NH1 . ARG A 1 39  ? 60.375  -12.447 -3.533  1.00 108.17 ? 35   ARG A NH1 1 
ATOM   231   N NH2 . ARG A 1 39  ? 60.635  -10.169 -3.468  1.00 108.20 ? 35   ARG A NH2 1 
ATOM   232   N N   . VAL A 1 40  ? 55.238  -11.850 -9.597  1.00 98.11  ? 36   VAL A N   1 
ATOM   233   C CA  . VAL A 1 40  ? 53.872  -12.209 -9.962  1.00 95.82  ? 36   VAL A CA  1 
ATOM   234   C C   . VAL A 1 40  ? 53.627  -13.670 -9.564  1.00 95.53  ? 36   VAL A C   1 
ATOM   235   O O   . VAL A 1 40  ? 54.416  -14.550 -9.916  1.00 97.95  ? 36   VAL A O   1 
ATOM   236   C CB  . VAL A 1 40  ? 53.641  -12.017 -11.491 1.00 97.00  ? 36   VAL A CB  1 
ATOM   237   C CG1 . VAL A 1 40  ? 52.199  -12.283 -11.865 1.00 94.78  ? 36   VAL A CG1 1 
ATOM   238   C CG2 . VAL A 1 40  ? 54.041  -10.611 -11.938 1.00 98.00  ? 36   VAL A CG2 1 
ATOM   239   N N   . PHE A 1 41  ? 52.546  -13.923 -8.825  1.00 92.84  ? 37   PHE A N   1 
ATOM   240   C CA  . PHE A 1 41  ? 52.226  -15.283 -8.364  1.00 92.55  ? 37   PHE A CA  1 
ATOM   241   C C   . PHE A 1 41  ? 51.127  -15.957 -9.199  1.00 91.82  ? 37   PHE A C   1 
ATOM   242   O O   . PHE A 1 41  ? 50.244  -15.273 -9.725  1.00 90.45  ? 37   PHE A O   1 
ATOM   243   C CB  . PHE A 1 41  ? 51.891  -15.305 -6.858  1.00 90.53  ? 37   PHE A CB  1 
ATOM   244   C CG  . PHE A 1 41  ? 50.536  -14.745 -6.514  1.00 87.41  ? 37   PHE A CG  1 
ATOM   245   C CD1 . PHE A 1 41  ? 50.369  -13.384 -6.280  1.00 86.29  ? 37   PHE A CD1 1 
ATOM   246   C CD2 . PHE A 1 41  ? 49.430  -15.582 -6.396  1.00 85.89  ? 37   PHE A CD2 1 
ATOM   247   C CE1 . PHE A 1 41  ? 49.116  -12.861 -5.953  1.00 83.45  ? 37   PHE A CE1 1 
ATOM   248   C CE2 . PHE A 1 41  ? 48.173  -15.068 -6.070  1.00 83.03  ? 37   PHE A CE2 1 
ATOM   249   C CZ  . PHE A 1 41  ? 48.018  -13.706 -5.847  1.00 81.76  ? 37   PHE A CZ  1 
ATOM   250   N N   . PRO A 1 42  ? 51.181  -17.300 -9.325  1.00 92.96  ? 38   PRO A N   1 
ATOM   251   C CA  . PRO A 1 42  ? 50.194  -18.022 -10.127 1.00 92.70  ? 38   PRO A CA  1 
ATOM   252   C C   . PRO A 1 42  ? 48.935  -18.403 -9.346  1.00 90.19  ? 38   PRO A C   1 
ATOM   253   O O   . PRO A 1 42  ? 48.999  -18.633 -8.136  1.00 89.28  ? 38   PRO A O   1 
ATOM   254   C CB  . PRO A 1 42  ? 50.952  -19.281 -10.551 1.00 95.40  ? 38   PRO A CB  1 
ATOM   255   C CG  . PRO A 1 42  ? 51.911  -19.532 -9.435  1.00 96.09  ? 38   PRO A CG  1 
ATOM   256   C CD  . PRO A 1 42  ? 52.212  -18.206 -8.780  1.00 94.90  ? 38   PRO A CD  1 
ATOM   257   N N   . VAL A 1 43  ? 47.805  -18.466 -10.046 1.00 89.38  ? 39   VAL A N   1 
ATOM   258   C CA  . VAL A 1 43  ? 46.539  -18.892 -9.450  1.00 87.36  ? 39   VAL A CA  1 
ATOM   259   C C   . VAL A 1 43  ? 46.098  -20.219 -10.069 1.00 88.67  ? 39   VAL A C   1 
ATOM   260   O O   . VAL A 1 43  ? 46.015  -20.347 -11.293 1.00 90.09  ? 39   VAL A O   1 
ATOM   261   C CB  . VAL A 1 43  ? 45.429  -17.820 -9.606  1.00 85.30  ? 39   VAL A CB  1 
ATOM   262   C CG1 . VAL A 1 43  ? 44.142  -18.281 -8.948  1.00 83.41  ? 39   VAL A CG1 1 
ATOM   263   C CG2 . VAL A 1 43  ? 45.871  -16.497 -9.002  1.00 84.17  ? 39   VAL A CG2 1 
ATOM   264   N N   . TYR A 1 44  ? 45.814  -21.194 -9.208  1.00 88.32  ? 40   TYR A N   1 
ATOM   265   C CA  . TYR A 1 44  ? 45.526  -22.560 -9.636  1.00 89.83  ? 40   TYR A CA  1 
ATOM   266   C C   . TYR A 1 44  ? 44.040  -22.884 -9.651  1.00 88.54  ? 40   TYR A C   1 
ATOM   267   O O   . TYR A 1 44  ? 43.318  -22.603 -8.689  1.00 86.39  ? 40   TYR A O   1 
ATOM   268   C CB  . TYR A 1 44  ? 46.252  -23.565 -8.734  1.00 90.91  ? 40   TYR A CB  1 
ATOM   269   C CG  . TYR A 1 44  ? 47.729  -23.728 -9.025  1.00 93.45  ? 40   TYR A CG  1 
ATOM   270   C CD1 . TYR A 1 44  ? 48.608  -22.649 -8.918  1.00 93.59  ? 40   TYR A CD1 1 
ATOM   271   C CD2 . TYR A 1 44  ? 48.251  -24.966 -9.384  1.00 96.08  ? 40   TYR A CD2 1 
ATOM   272   C CE1 . TYR A 1 44  ? 49.962  -22.796 -9.179  1.00 96.14  ? 40   TYR A CE1 1 
ATOM   273   C CE2 . TYR A 1 44  ? 49.606  -25.124 -9.644  1.00 98.72  ? 40   TYR A CE2 1 
ATOM   274   C CZ  . TYR A 1 44  ? 50.454  -24.035 -9.539  1.00 98.73  ? 40   TYR A CZ  1 
ATOM   275   O OH  . TYR A 1 44  ? 51.797  -24.184 -9.795  1.00 101.78 ? 40   TYR A OH  1 
ATOM   276   N N   . ASN A 1 45  ? 43.603  -23.472 -10.761 1.00 90.01  ? 41   ASN A N   1 
ATOM   277   C CA  . ASN A 1 45  ? 42.284  -24.075 -10.871 1.00 89.67  ? 41   ASN A CA  1 
ATOM   278   C C   . ASN A 1 45  ? 42.310  -25.405 -10.128 1.00 90.47  ? 41   ASN A C   1 
ATOM   279   O O   . ASN A 1 45  ? 42.993  -26.335 -10.555 1.00 92.79  ? 41   ASN A O   1 
ATOM   280   C CB  . ASN A 1 45  ? 41.922  -24.286 -12.348 1.00 91.48  ? 41   ASN A CB  1 
ATOM   281   C CG  . ASN A 1 45  ? 40.543  -24.906 -12.549 1.00 91.54  ? 41   ASN A CG  1 
ATOM   282   O OD1 . ASN A 1 45  ? 39.817  -25.182 -11.595 1.00 90.28  ? 41   ASN A OD1 1 
ATOM   283   N ND2 . ASN A 1 45  ? 40.180  -25.123 -13.807 1.00 93.26  ? 41   ASN A ND2 1 
ATOM   284   N N   . PRO A 1 46  ? 41.574  -25.500 -9.006  1.00 88.75  ? 42   PRO A N   1 
ATOM   285   C CA  . PRO A 1 46  ? 41.561  -26.742 -8.238  1.00 89.62  ? 42   PRO A CA  1 
ATOM   286   C C   . PRO A 1 46  ? 40.751  -27.857 -8.909  1.00 91.42  ? 42   PRO A C   1 
ATOM   287   O O   . PRO A 1 46  ? 40.841  -29.011 -8.488  1.00 92.76  ? 42   PRO A O   1 
ATOM   288   C CB  . PRO A 1 46  ? 40.919  -26.325 -6.913  1.00 87.17  ? 42   PRO A CB  1 
ATOM   289   C CG  . PRO A 1 46  ? 40.046  -25.190 -7.266  1.00 85.40  ? 42   PRO A CG  1 
ATOM   290   C CD  . PRO A 1 46  ? 40.732  -24.462 -8.383  1.00 86.15  ? 42   PRO A CD  1 
ATOM   291   N N   . ALA A 1 47  ? 39.978  -27.512 -9.938  1.00 91.66  ? 43   ALA A N   1 
ATOM   292   C CA  . ALA A 1 47  ? 39.165  -28.486 -10.669 1.00 93.65  ? 43   ALA A CA  1 
ATOM   293   C C   . ALA A 1 47  ? 39.995  -29.383 -11.584 1.00 96.58  ? 43   ALA A C   1 
ATOM   294   O O   . ALA A 1 47  ? 39.651  -30.548 -11.796 1.00 98.57  ? 43   ALA A O   1 
ATOM   295   C CB  . ALA A 1 47  ? 38.074  -27.784 -11.463 1.00 93.16  ? 43   ALA A CB  1 
ATOM   296   N N   . THR A 1 48  ? 41.082  -28.836 -12.121 1.00 97.06  ? 44   THR A N   1 
ATOM   297   C CA  . THR A 1 48  ? 41.923  -29.553 -13.081 1.00 99.94  ? 44   THR A CA  1 
ATOM   298   C C   . THR A 1 48  ? 43.416  -29.497 -12.737 1.00 100.56 ? 44   THR A C   1 
ATOM   299   O O   . THR A 1 48  ? 44.215  -30.252 -13.294 1.00 103.08 ? 44   THR A O   1 
ATOM   300   C CB  . THR A 1 48  ? 41.701  -29.039 -14.526 1.00 101.01 ? 44   THR A CB  1 
ATOM   301   O OG1 . THR A 1 48  ? 41.649  -27.608 -14.526 1.00 98.76  ? 44   THR A OG1 1 
ATOM   302   C CG2 . THR A 1 48  ? 40.399  -29.582 -15.098 1.00 101.92 ? 44   THR A CG2 1 
ATOM   303   N N   . GLY A 1 49  ? 43.784  -28.607 -11.818 1.00 98.49  ? 45   GLY A N   1 
ATOM   304   C CA  . GLY A 1 49  ? 45.182  -28.429 -11.423 1.00 99.17  ? 45   GLY A CA  1 
ATOM   305   C C   . GLY A 1 49  ? 45.928  -27.447 -12.310 1.00 99.77  ? 45   GLY A C   1 
ATOM   306   O O   . GLY A 1 49  ? 47.108  -27.172 -12.086 1.00 100.44 ? 45   GLY A O   1 
ATOM   307   N N   . GLU A 1 50  ? 45.228  -26.917 -13.312 1.00 99.78  ? 46   GLU A N   1 
ATOM   308   C CA  . GLU A 1 50  ? 45.803  -25.999 -14.297 1.00 100.61 ? 46   GLU A CA  1 
ATOM   309   C C   . GLU A 1 50  ? 46.095  -24.616 -13.708 1.00 98.38  ? 46   GLU A C   1 
ATOM   310   O O   . GLU A 1 50  ? 45.565  -24.252 -12.655 1.00 96.05  ? 46   GLU A O   1 
ATOM   311   C CB  . GLU A 1 50  ? 44.858  -25.857 -15.501 1.00 101.36 ? 46   GLU A CB  1 
ATOM   312   C CG  . GLU A 1 50  ? 43.631  -24.973 -15.228 1.00 99.11  ? 46   GLU A CG  1 
ATOM   313   C CD  . GLU A 1 50  ? 42.637  -24.897 -16.379 1.00 100.40 ? 46   GLU A CD  1 
ATOM   314   O OE1 . GLU A 1 50  ? 42.747  -25.691 -17.343 1.00 103.18 ? 46   GLU A OE1 1 
ATOM   315   O OE2 . GLU A 1 50  ? 41.733  -24.033 -16.308 1.00 98.48  ? 46   GLU A OE2 1 
ATOM   316   N N   . GLN A 1 51  ? 46.938  -23.856 -14.402 1.00 99.32  ? 47   GLN A N   1 
ATOM   317   C CA  . GLN A 1 51  ? 47.176  -22.457 -14.073 1.00 97.60  ? 47   GLN A CA  1 
ATOM   318   C C   . GLN A 1 51  ? 46.193  -21.591 -14.856 1.00 96.66  ? 47   GLN A C   1 
ATOM   319   O O   . GLN A 1 51  ? 46.231  -21.553 -16.089 1.00 98.48  ? 47   GLN A O   1 
ATOM   320   C CB  . GLN A 1 51  ? 48.619  -22.060 -14.399 1.00 99.52  ? 47   GLN A CB  1 
ATOM   321   C CG  . GLN A 1 51  ? 49.018  -20.678 -13.892 1.00 98.19  ? 47   GLN A CG  1 
ATOM   322   C CD  . GLN A 1 51  ? 50.325  -20.181 -14.481 1.00 100.65 ? 47   GLN A CD  1 
ATOM   323   O OE1 . GLN A 1 51  ? 50.380  -19.097 -15.058 1.00 100.73 ? 47   GLN A OE1 1 
ATOM   324   N NE2 . GLN A 1 51  ? 51.383  -20.972 -14.341 1.00 102.90 ? 47   GLN A NE2 1 
ATOM   325   N N   . VAL A 1 52  ? 45.309  -20.911 -14.130 1.00 93.94  ? 48   VAL A N   1 
ATOM   326   C CA  . VAL A 1 52  ? 44.312  -20.024 -14.732 1.00 92.94  ? 48   VAL A CA  1 
ATOM   327   C C   . VAL A 1 52  ? 44.985  -18.772 -15.292 1.00 93.34  ? 48   VAL A C   1 
ATOM   328   O O   . VAL A 1 52  ? 44.803  -18.431 -16.464 1.00 94.64  ? 48   VAL A O   1 
ATOM   329   C CB  . VAL A 1 52  ? 43.206  -19.617 -13.711 1.00 90.06  ? 48   VAL A CB  1 
ATOM   330   C CG1 . VAL A 1 52  ? 42.165  -18.709 -14.361 1.00 89.36  ? 48   VAL A CG1 1 
ATOM   331   C CG2 . VAL A 1 52  ? 42.534  -20.846 -13.125 1.00 89.75  ? 48   VAL A CG2 1 
ATOM   332   N N   . CYS A 1 53  ? 45.768  -18.107 -14.442 1.00 92.40  ? 49   CYS A N   1 
ATOM   333   C CA  . CYS A 1 53  ? 46.436  -16.852 -14.779 1.00 92.77  ? 49   CYS A CA  1 
ATOM   334   C C   . CYS A 1 53  ? 47.490  -16.488 -13.732 1.00 92.33  ? 49   CYS A C   1 
ATOM   335   O O   . CYS A 1 53  ? 47.748  -17.251 -12.797 1.00 91.85  ? 49   CYS A O   1 
ATOM   336   C CB  . CYS A 1 53  ? 45.411  -15.722 -14.877 1.00 90.98  ? 49   CYS A CB  1 
ATOM   337   S SG  . CYS A 1 53  ? 44.571  -15.408 -13.314 1.00 87.76  ? 49   CYS A SG  1 
ATOM   338   N N   . GLU A 1 54  ? 48.080  -15.308 -13.895 1.00 92.67  ? 50   GLU A N   1 
ATOM   339   C CA  . GLU A 1 54  ? 49.100  -14.807 -12.980 1.00 92.67  ? 50   GLU A CA  1 
ATOM   340   C C   . GLU A 1 54  ? 48.705  -13.446 -12.403 1.00 90.58  ? 50   GLU A C   1 
ATOM   341   O O   . GLU A 1 54  ? 48.255  -12.559 -13.130 1.00 90.49  ? 50   GLU A O   1 
ATOM   342   C CB  . GLU A 1 54  ? 50.449  -14.721 -13.695 1.00 95.76  ? 50   GLU A CB  1 
ATOM   343   C CG  . GLU A 1 54  ? 51.103  -16.069 -13.949 1.00 98.04  ? 50   GLU A CG  1 
ATOM   344   C CD  . GLU A 1 54  ? 52.367  -15.963 -14.774 1.00 101.62 ? 50   GLU A CD  1 
ATOM   345   O OE1 . GLU A 1 54  ? 52.335  -15.305 -15.836 1.00 102.93 ? 50   GLU A OE1 1 
ATOM   346   O OE2 . GLU A 1 54  ? 53.391  -16.547 -14.363 1.00 103.42 ? 50   GLU A OE2 1 
ATOM   347   N N   . VAL A 1 55  ? 48.879  -13.294 -11.092 1.00 89.06  ? 51   VAL A N   1 
ATOM   348   C CA  . VAL A 1 55  ? 48.457  -12.087 -10.375 1.00 86.98  ? 51   VAL A CA  1 
ATOM   349   C C   . VAL A 1 55  ? 49.636  -11.462 -9.618  1.00 87.77  ? 51   VAL A C   1 
ATOM   350   O O   . VAL A 1 55  ? 50.526  -12.176 -9.150  1.00 89.05  ? 51   VAL A O   1 
ATOM   351   C CB  . VAL A 1 55  ? 47.278  -12.395 -9.408  1.00 84.23  ? 51   VAL A CB  1 
ATOM   352   C CG1 . VAL A 1 55  ? 46.861  -11.159 -8.634  1.00 82.24  ? 51   VAL A CG1 1 
ATOM   353   C CG2 . VAL A 1 55  ? 46.082  -12.954 -10.173 1.00 83.70  ? 51   VAL A CG2 1 
ATOM   354   N N   . GLN A 1 56  ? 49.633  -10.131 -9.510  1.00 87.18  ? 52   GLN A N   1 
ATOM   355   C CA  . GLN A 1 56  ? 50.729  -9.373  -8.889  1.00 88.23  ? 52   GLN A CA  1 
ATOM   356   C C   . GLN A 1 56  ? 50.893  -9.675  -7.396  1.00 87.07  ? 52   GLN A C   1 
ATOM   357   O O   . GLN A 1 56  ? 49.951  -9.517  -6.614  1.00 84.50  ? 52   GLN A O   1 
ATOM   358   C CB  . GLN A 1 56  ? 50.533  -7.864  -9.100  1.00 87.80  ? 52   GLN A CB  1 
ATOM   359   C CG  . GLN A 1 56  ? 50.387  -7.419  -10.559 1.00 89.06  ? 52   GLN A CG  1 
ATOM   360   C CD  . GLN A 1 56  ? 51.707  -7.346  -11.307 1.00 92.06  ? 52   GLN A CD  1 
ATOM   361   O OE1 . GLN A 1 56  ? 52.682  -6.769  -10.826 1.00 93.32  ? 52   GLN A OE1 1 
ATOM   362   N NE2 . GLN A 1 56  ? 51.734  -7.917  -12.503 1.00 93.64  ? 52   GLN A NE2 1 
ATOM   363   N N   . GLU A 1 57  ? 52.096  -10.105 -7.015  1.00 89.18  ? 53   GLU A N   1 
ATOM   364   C CA  . GLU A 1 57  ? 52.402  -10.473 -5.629  1.00 88.75  ? 53   GLU A CA  1 
ATOM   365   C C   . GLU A 1 57  ? 52.776  -9.255  -4.780  1.00 88.50  ? 53   GLU A C   1 
ATOM   366   O O   . GLU A 1 57  ? 53.883  -8.717  -4.895  1.00 90.91  ? 53   GLU A O   1 
ATOM   367   C CB  . GLU A 1 57  ? 53.521  -11.523 -5.583  1.00 91.43  ? 53   GLU A CB  1 
ATOM   368   C CG  . GLU A 1 57  ? 53.713  -12.192 -4.219  1.00 91.34  ? 53   GLU A CG  1 
ATOM   369   C CD  . GLU A 1 57  ? 55.069  -12.868 -4.063  1.00 95.01  ? 53   GLU A CD  1 
ATOM   370   O OE1 . GLU A 1 57  ? 55.612  -13.391 -5.062  1.00 97.26  ? 53   GLU A OE1 1 
ATOM   371   O OE2 . GLU A 1 57  ? 55.594  -12.882 -2.930  1.00 95.75  ? 53   GLU A OE2 1 
ATOM   372   N N   . ALA A 1 58  ? 51.843  -8.836  -3.927  1.00 85.77  ? 54   ALA A N   1 
ATOM   373   C CA  . ALA A 1 58  ? 52.048  -7.697  -3.034  1.00 85.28  ? 54   ALA A CA  1 
ATOM   374   C C   . ALA A 1 58  ? 53.007  -8.043  -1.897  1.00 86.64  ? 54   ALA A C   1 
ATOM   375   O O   . ALA A 1 58  ? 53.117  -9.206  -1.499  1.00 86.93  ? 54   ALA A O   1 
ATOM   376   C CB  . ALA A 1 58  ? 50.712  -7.209  -2.482  1.00 82.06  ? 54   ALA A CB  1 
ATOM   377   N N   . ASP A 1 59  ? 53.701  -7.029  -1.386  1.00 87.72  ? 55   ASP A N   1 
ATOM   378   C CA  . ASP A 1 59  ? 54.639  -7.204  -0.279  1.00 89.38  ? 55   ASP A CA  1 
ATOM   379   C C   . ASP A 1 59  ? 54.583  -5.985  0.645   1.00 88.72  ? 55   ASP A C   1 
ATOM   380   O O   . ASP A 1 59  ? 53.711  -5.131  0.491   1.00 86.64  ? 55   ASP A O   1 
ATOM   381   C CB  . ASP A 1 59  ? 56.059  -7.432  -0.818  1.00 93.22  ? 55   ASP A CB  1 
ATOM   382   C CG  . ASP A 1 59  ? 56.836  -8.465  -0.013  1.00 95.07  ? 55   ASP A CG  1 
ATOM   383   O OD1 . ASP A 1 59  ? 56.978  -8.294  1.216   1.00 95.17  ? 55   ASP A OD1 1 
ATOM   384   O OD2 . ASP A 1 59  ? 57.314  -9.449  -0.618  1.00 96.76  ? 55   ASP A OD2 1 
ATOM   385   N N   . LYS A 1 60  ? 55.511  -5.910  1.598   1.00 90.69  ? 56   LYS A N   1 
ATOM   386   C CA  . LYS A 1 60  ? 55.568  -4.822  2.584   1.00 90.61  ? 56   LYS A CA  1 
ATOM   387   C C   . LYS A 1 60  ? 55.503  -3.424  1.957   1.00 90.73  ? 56   LYS A C   1 
ATOM   388   O O   . LYS A 1 60  ? 54.799  -2.549  2.467   1.00 88.98  ? 56   LYS A O   1 
ATOM   389   C CB  . LYS A 1 60  ? 56.828  -4.958  3.452   1.00 93.76  ? 56   LYS A CB  1 
ATOM   390   C CG  . LYS A 1 60  ? 56.757  -4.266  4.814   1.00 93.41  ? 56   LYS A CG  1 
ATOM   391   C CD  . LYS A 1 60  ? 57.270  -2.831  4.761   1.00 95.00  ? 56   LYS A CD  1 
ATOM   392   C CE  . LYS A 1 60  ? 57.114  -2.133  6.105   1.00 94.73  ? 56   LYS A CE  1 
ATOM   393   N NZ  . LYS A 1 60  ? 55.686  -1.886  6.466   1.00 90.99  ? 56   LYS A NZ  1 
ATOM   394   N N   . ALA A 1 61  ? 56.238  -3.226  0.862   1.00 92.99  ? 57   ALA A N   1 
ATOM   395   C CA  . ALA A 1 61  ? 56.253  -1.951  0.138   1.00 93.48  ? 57   ALA A CA  1 
ATOM   396   C C   . ALA A 1 61  ? 54.902  -1.630  -0.507  1.00 90.34  ? 57   ALA A C   1 
ATOM   397   O O   . ALA A 1 61  ? 54.512  -0.464  -0.593  1.00 89.63  ? 57   ALA A O   1 
ATOM   398   C CB  . ALA A 1 61  ? 57.361  -1.946  -0.909  1.00 96.95  ? 57   ALA A CB  1 
ATOM   399   N N   . ASP A 1 62  ? 54.200  -2.671  -0.956  1.00 88.59  ? 58   ASP A N   1 
ATOM   400   C CA  . ASP A 1 62  ? 52.857  -2.533  -1.522  1.00 85.78  ? 58   ASP A CA  1 
ATOM   401   C C   . ASP A 1 62  ? 51.845  -2.163  -0.444  1.00 82.87  ? 58   ASP A C   1 
ATOM   402   O O   . ASP A 1 62  ? 50.916  -1.389  -0.692  1.00 81.14  ? 58   ASP A O   1 
ATOM   403   C CB  . ASP A 1 62  ? 52.428  -3.829  -2.213  1.00 85.11  ? 58   ASP A CB  1 
ATOM   404   C CG  . ASP A 1 62  ? 53.290  -4.166  -3.410  1.00 88.03  ? 58   ASP A CG  1 
ATOM   405   O OD1 . ASP A 1 62  ? 53.062  -3.583  -4.493  1.00 88.65  ? 58   ASP A OD1 1 
ATOM   406   O OD2 . ASP A 1 62  ? 54.189  -5.022  -3.270  1.00 90.19  ? 58   ASP A OD2 1 
ATOM   407   N N   . ILE A 1 63  ? 52.033  -2.728  0.748   1.00 82.52  ? 59   ILE A N   1 
ATOM   408   C CA  . ILE A 1 63  ? 51.183  -2.443  1.902   1.00 80.11  ? 59   ILE A CA  1 
ATOM   409   C C   . ILE A 1 63  ? 51.299  -0.970  2.288   1.00 80.45  ? 59   ILE A C   1 
ATOM   410   O O   . ILE A 1 63  ? 50.287  -0.276  2.407   1.00 78.35  ? 59   ILE A O   1 
ATOM   411   C CB  . ILE A 1 63  ? 51.533  -3.355  3.118   1.00 80.34  ? 59   ILE A CB  1 
ATOM   412   C CG1 . ILE A 1 63  ? 51.410  -4.847  2.757   1.00 80.06  ? 59   ILE A CG1 1 
ATOM   413   C CG2 . ILE A 1 63  ? 50.687  -2.995  4.347   1.00 78.13  ? 59   ILE A CG2 1 
ATOM   414   C CD1 . ILE A 1 63  ? 50.008  -5.330  2.388   1.00 76.86  ? 59   ILE A CD1 1 
ATOM   415   N N   . ASP A 1 64  ? 52.537  -0.504  2.455   1.00 83.34  ? 60   ASP A N   1 
ATOM   416   C CA  . ASP A 1 64  ? 52.833  0.885   2.826   1.00 84.31  ? 60   ASP A CA  1 
ATOM   417   C C   . ASP A 1 64  ? 52.105  1.914   1.959   1.00 83.29  ? 60   ASP A C   1 
ATOM   418   O O   . ASP A 1 64  ? 51.537  2.876   2.484   1.00 82.18  ? 60   ASP A O   1 
ATOM   419   C CB  . ASP A 1 64  ? 54.345  1.143   2.786   1.00 88.14  ? 60   ASP A CB  1 
ATOM   420   C CG  . ASP A 1 64  ? 55.097  0.435   3.901   1.00 89.54  ? 60   ASP A CG  1 
ATOM   421   O OD1 . ASP A 1 64  ? 54.462  0.006   4.888   1.00 87.54  ? 60   ASP A OD1 1 
ATOM   422   O OD2 . ASP A 1 64  ? 56.334  0.315   3.792   1.00 92.94  ? 60   ASP A OD2 1 
ATOM   423   N N   . LYS A 1 65  ? 52.127  1.706   0.642   1.00 83.82  ? 61   LYS A N   1 
ATOM   424   C CA  . LYS A 1 65  ? 51.444  2.592   -0.299  1.00 83.05  ? 61   LYS A CA  1 
ATOM   425   C C   . LYS A 1 65  ? 49.938  2.556   -0.080  1.00 79.57  ? 61   LYS A C   1 
ATOM   426   O O   . LYS A 1 65  ? 49.285  3.601   -0.040  1.00 78.62  ? 61   LYS A O   1 
ATOM   427   C CB  . LYS A 1 65  ? 51.775  2.227   -1.750  1.00 84.59  ? 61   LYS A CB  1 
ATOM   428   C CG  . LYS A 1 65  ? 53.184  2.617   -2.205  1.00 88.35  ? 61   LYS A CG  1 
ATOM   429   C CD  . LYS A 1 65  ? 53.260  2.865   -3.714  1.00 89.60  ? 61   LYS A CD  1 
ATOM   430   C CE  . LYS A 1 65  ? 52.967  1.609   -4.527  1.00 89.00  ? 61   LYS A CE  1 
ATOM   431   N NZ  . LYS A 1 65  ? 53.076  1.860   -5.990  1.00 90.76  ? 61   LYS A NZ  1 
ATOM   432   N N   . ALA A 1 66  ? 49.402  1.348   0.076   1.00 77.89  ? 62   ALA A N   1 
ATOM   433   C CA  . ALA A 1 66  ? 47.970  1.148   0.286   1.00 74.85  ? 62   ALA A CA  1 
ATOM   434   C C   . ALA A 1 66  ? 47.485  1.801   1.574   1.00 73.34  ? 62   ALA A C   1 
ATOM   435   O O   . ALA A 1 66  ? 46.393  2.370   1.604   1.00 71.55  ? 62   ALA A O   1 
ATOM   436   C CB  . ALA A 1 66  ? 47.634  -0.328  0.281   1.00 73.87  ? 62   ALA A CB  1 
ATOM   437   N N   . VAL A 1 67  ? 48.302  1.718   2.624   1.00 74.31  ? 63   VAL A N   1 
ATOM   438   C CA  . VAL A 1 67  ? 47.982  2.323   3.918   1.00 73.26  ? 63   VAL A CA  1 
ATOM   439   C C   . VAL A 1 67  ? 47.921  3.842   3.797   1.00 73.77  ? 63   VAL A C   1 
ATOM   440   O O   . VAL A 1 67  ? 46.942  4.459   4.223   1.00 71.95  ? 63   VAL A O   1 
ATOM   441   C CB  . VAL A 1 67  ? 48.989  1.905   5.023   1.00 74.84  ? 63   VAL A CB  1 
ATOM   442   C CG1 . VAL A 1 67  ? 48.726  2.666   6.325   1.00 74.17  ? 63   VAL A CG1 1 
ATOM   443   C CG2 . VAL A 1 67  ? 48.919  0.406   5.269   1.00 74.23  ? 63   VAL A CG2 1 
ATOM   444   N N   . GLN A 1 68  ? 48.958  4.430   3.201   1.00 76.45  ? 64   GLN A N   1 
ATOM   445   C CA  . GLN A 1 68  ? 49.020  5.876   2.971   1.00 77.51  ? 64   GLN A CA  1 
ATOM   446   C C   . GLN A 1 68  ? 47.828  6.370   2.156   1.00 75.74  ? 64   GLN A C   1 
ATOM   447   O O   . GLN A 1 68  ? 47.298  7.453   2.416   1.00 75.25  ? 64   GLN A O   1 
ATOM   448   C CB  . GLN A 1 68  ? 50.323  6.263   2.268   1.00 80.95  ? 64   GLN A CB  1 
ATOM   449   C CG  . GLN A 1 68  ? 51.561  6.182   3.144   1.00 83.57  ? 64   GLN A CG  1 
ATOM   450   C CD  . GLN A 1 68  ? 52.796  6.726   2.455   1.00 87.40  ? 64   GLN A CD  1 
ATOM   451   O OE1 . GLN A 1 68  ? 52.828  7.882   2.033   1.00 88.56  ? 64   GLN A OE1 1 
ATOM   452   N NE2 . GLN A 1 68  ? 53.826  5.895   2.344   1.00 89.58  ? 64   GLN A NE2 1 
ATOM   453   N N   . ALA A 1 69  ? 47.417  5.564   1.177   1.00 74.99  ? 65   ALA A N   1 
ATOM   454   C CA  . ALA A 1 69  ? 46.267  5.869   0.329   1.00 73.53  ? 65   ALA A CA  1 
ATOM   455   C C   . ALA A 1 69  ? 44.951  5.832   1.107   1.00 70.65  ? 65   ALA A C   1 
ATOM   456   O O   . ALA A 1 69  ? 44.071  6.673   0.896   1.00 69.74  ? 65   ALA A O   1 
ATOM   457   C CB  . ALA A 1 69  ? 46.217  4.915   -0.855  1.00 73.81  ? 65   ALA A CB  1 
ATOM   458   N N   . ALA A 1 70  ? 44.828  4.857   2.005   1.00 69.39  ? 66   ALA A N   1 
ATOM   459   C CA  . ALA A 1 70  ? 43.641  4.717   2.842   1.00 66.94  ? 66   ALA A CA  1 
ATOM   460   C C   . ALA A 1 70  ? 43.615  5.756   3.959   1.00 66.83  ? 66   ALA A C   1 
ATOM   461   O O   . ALA A 1 70  ? 42.539  6.158   4.411   1.00 65.11  ? 66   ALA A O   1 
ATOM   462   C CB  . ALA A 1 70  ? 43.558  3.313   3.416   1.00 65.99  ? 66   ALA A CB  1 
ATOM   463   N N   . ARG A 1 71  ? 44.800  6.182   4.398   1.00 68.79  ? 67   ARG A N   1 
ATOM   464   C CA  . ARG A 1 71  ? 44.932  7.213   5.424   1.00 69.21  ? 67   ARG A CA  1 
ATOM   465   C C   . ARG A 1 71  ? 44.473  8.570   4.889   1.00 69.52  ? 67   ARG A C   1 
ATOM   466   O O   . ARG A 1 71  ? 43.770  9.312   5.581   1.00 68.47  ? 67   ARG A O   1 
ATOM   467   C CB  . ARG A 1 71  ? 46.382  7.294   5.915   1.00 71.79  ? 67   ARG A CB  1 
ATOM   468   C CG  . ARG A 1 71  ? 46.608  8.165   7.152   1.00 72.36  ? 67   ARG A CG  1 
ATOM   469   C CD  . ARG A 1 71  ? 46.520  7.363   8.449   1.00 71.45  ? 67   ARG A CD  1 
ATOM   470   N NE  . ARG A 1 71  ? 45.148  7.236   8.941   1.00 68.45  ? 67   ARG A NE  1 
ATOM   471   C CZ  . ARG A 1 71  ? 44.794  6.543   10.021  1.00 67.20  ? 67   ARG A CZ  1 
ATOM   472   N NH1 . ARG A 1 71  ? 45.706  5.896   10.736  1.00 68.57  ? 67   ARG A NH1 1 
ATOM   473   N NH2 . ARG A 1 71  ? 43.521  6.491   10.386  1.00 64.87  ? 67   ARG A NH2 1 
ATOM   474   N N   . LEU A 1 72  ? 44.870  8.877   3.653   1.00 71.11  ? 68   LEU A N   1 
ATOM   475   C CA  . LEU A 1 72  ? 44.513  10.134  2.991   1.00 71.82  ? 68   LEU A CA  1 
ATOM   476   C C   . LEU A 1 72  ? 43.007  10.237  2.735   1.00 69.55  ? 68   LEU A C   1 
ATOM   477   O O   . LEU A 1 72  ? 42.398  11.279  2.981   1.00 69.16  ? 68   LEU A O   1 
ATOM   478   C CB  . LEU A 1 72  ? 45.291  10.288  1.677   1.00 74.12  ? 68   LEU A CB  1 
ATOM   479   C CG  . LEU A 1 72  ? 45.172  11.601  0.894   1.00 75.46  ? 68   LEU A CG  1 
ATOM   480   C CD1 . LEU A 1 72  ? 45.953  12.717  1.575   1.00 77.42  ? 68   LEU A CD1 1 
ATOM   481   C CD2 . LEU A 1 72  ? 45.646  11.417  -0.542  1.00 77.22  ? 68   LEU A CD2 1 
ATOM   482   N N   . ALA A 1 73  ? 42.417  9.148   2.251   1.00 68.28  ? 69   ALA A N   1 
ATOM   483   C CA  . ALA A 1 73  ? 40.982  9.086   1.987   1.00 66.44  ? 69   ALA A CA  1 
ATOM   484   C C   . ALA A 1 73  ? 40.146  9.118   3.270   1.00 64.61  ? 69   ALA A C   1 
ATOM   485   O O   . ALA A 1 73  ? 38.916  9.149   3.214   1.00 63.08  ? 69   ALA A O   1 
ATOM   486   C CB  . ALA A 1 73  ? 40.652  7.850   1.166   1.00 65.82  ? 69   ALA A CB  1 
ATOM   487   N N   . PHE A 1 74  ? 40.817  9.116   4.421   1.00 65.06  ? 70   PHE A N   1 
ATOM   488   C CA  . PHE A 1 74  ? 40.132  9.145   5.712   1.00 63.60  ? 70   PHE A CA  1 
ATOM   489   C C   . PHE A 1 74  ? 40.387  10.427  6.514   1.00 64.60  ? 70   PHE A C   1 
ATOM   490   O O   . PHE A 1 74  ? 39.686  10.696  7.492   1.00 63.41  ? 70   PHE A O   1 
ATOM   491   C CB  . PHE A 1 74  ? 40.475  7.899   6.543   1.00 62.98  ? 70   PHE A CB  1 
ATOM   492   C CG  . PHE A 1 74  ? 39.669  7.774   7.805   1.00 61.09  ? 70   PHE A CG  1 
ATOM   493   C CD1 . PHE A 1 74  ? 38.339  7.382   7.758   1.00 59.09  ? 70   PHE A CD1 1 
ATOM   494   C CD2 . PHE A 1 74  ? 40.236  8.063   9.040   1.00 61.60  ? 70   PHE A CD2 1 
ATOM   495   C CE1 . PHE A 1 74  ? 37.588  7.277   8.921   1.00 57.80  ? 70   PHE A CE1 1 
ATOM   496   C CE2 . PHE A 1 74  ? 39.489  7.964   10.208  1.00 60.27  ? 70   PHE A CE2 1 
ATOM   497   C CZ  . PHE A 1 74  ? 38.163  7.566   10.148  1.00 58.25  ? 70   PHE A CZ  1 
ATOM   498   N N   . SER A 1 75  ? 41.374  11.219  6.094   1.00 58.93  ? 71   SER A N   1 
ATOM   499   C CA  . SER A 1 75  ? 41.693  12.491  6.758   1.00 60.52  ? 71   SER A CA  1 
ATOM   500   C C   . SER A 1 75  ? 40.475  13.421  6.883   1.00 60.25  ? 71   SER A C   1 
ATOM   501   O O   . SER A 1 75  ? 39.488  13.271  6.160   1.00 59.43  ? 71   SER A O   1 
ATOM   502   C CB  . SER A 1 75  ? 42.858  13.198  6.056   1.00 63.06  ? 71   SER A CB  1 
ATOM   503   O OG  . SER A 1 75  ? 42.649  13.274  4.659   1.00 63.62  ? 71   SER A OG  1 
ATOM   504   N N   . LEU A 1 76  ? 40.559  14.380  7.801   1.00 61.29  ? 72   LEU A N   1 
ATOM   505   C CA  . LEU A 1 76  ? 39.410  15.203  8.198   1.00 61.08  ? 72   LEU A CA  1 
ATOM   506   C C   . LEU A 1 76  ? 38.715  16.007  7.086   1.00 62.21  ? 72   LEU A C   1 
ATOM   507   O O   . LEU A 1 76  ? 37.538  16.353  7.215   1.00 61.60  ? 72   LEU A O   1 
ATOM   508   C CB  . LEU A 1 76  ? 39.792  16.114  9.371   1.00 62.22  ? 72   LEU A CB  1 
ATOM   509   C CG  . LEU A 1 76  ? 39.771  15.438  10.750  1.00 60.99  ? 72   LEU A CG  1 
ATOM   510   C CD1 . LEU A 1 76  ? 40.860  15.992  11.667  1.00 63.02  ? 72   LEU A CD1 1 
ATOM   511   C CD2 . LEU A 1 76  ? 38.387  15.543  11.402  1.00 59.15  ? 72   LEU A CD2 1 
ATOM   512   N N   . GLY A 1 77  ? 39.427  16.296  6.002   1.00 64.16  ? 73   GLY A N   1 
ATOM   513   C CA  . GLY A 1 77  ? 38.844  17.051  4.894   1.00 65.64  ? 73   GLY A CA  1 
ATOM   514   C C   . GLY A 1 77  ? 38.289  16.183  3.780   1.00 64.84  ? 73   GLY A C   1 
ATOM   515   O O   . GLY A 1 77  ? 37.605  16.682  2.884   1.00 65.81  ? 73   GLY A O   1 
ATOM   516   N N   . SER A 1 78  ? 38.575  14.883  3.852   1.00 63.37  ? 74   SER A N   1 
ATOM   517   C CA  . SER A 1 78  ? 38.264  13.917  2.790   1.00 62.87  ? 74   SER A CA  1 
ATOM   518   C C   . SER A 1 78  ? 36.816  13.940  2.298   1.00 62.21  ? 74   SER A C   1 
ATOM   519   O O   . SER A 1 78  ? 35.901  14.316  3.031   1.00 61.35  ? 74   SER A O   1 
ATOM   520   C CB  . SER A 1 78  ? 38.631  12.501  3.246   1.00 61.10  ? 74   SER A CB  1 
ATOM   521   O OG  . SER A 1 78  ? 38.318  11.541  2.253   1.00 60.81  ? 74   SER A OG  1 
ATOM   522   N N   . VAL A 1 79  ? 36.629  13.520  1.049   1.00 62.89  ? 75   VAL A N   1 
ATOM   523   C CA  . VAL A 1 79  ? 35.303  13.389  0.440   1.00 62.69  ? 75   VAL A CA  1 
ATOM   524   C C   . VAL A 1 79  ? 34.492  12.267  1.113   1.00 60.26  ? 75   VAL A C   1 
ATOM   525   O O   . VAL A 1 79  ? 33.261  12.321  1.164   1.00 59.66  ? 75   VAL A O   1 
ATOM   526   C CB  . VAL A 1 79  ? 35.406  13.127  -1.090  1.00 64.13  ? 75   VAL A CB  1 
ATOM   527   C CG1 . VAL A 1 79  ? 34.047  13.288  -1.764  1.00 64.46  ? 75   VAL A CG1 1 
ATOM   528   C CG2 . VAL A 1 79  ? 36.421  14.063  -1.734  1.00 66.64  ? 75   VAL A CG2 1 
ATOM   529   N N   . TRP A 1 80  ? 35.198  11.263  1.632   1.00 59.17  ? 76   TRP A N   1 
ATOM   530   C CA  . TRP A 1 80  ? 34.594  10.108  2.299   1.00 57.11  ? 76   TRP A CA  1 
ATOM   531   C C   . TRP A 1 80  ? 34.131  10.449  3.719   1.00 56.15  ? 76   TRP A C   1 
ATOM   532   O O   . TRP A 1 80  ? 33.336  9.715   4.318   1.00 54.56  ? 76   TRP A O   1 
ATOM   533   C CB  . TRP A 1 80  ? 35.602  8.952   2.310   1.00 56.61  ? 76   TRP A CB  1 
ATOM   534   C CG  . TRP A 1 80  ? 35.124  7.658   2.910   1.00 54.31  ? 76   TRP A CG  1 
ATOM   535   C CD1 . TRP A 1 80  ? 35.580  7.077   4.057   1.00 53.19  ? 76   TRP A CD1 1 
ATOM   536   C CD2 . TRP A 1 80  ? 34.122  6.773   2.385   1.00 53.23  ? 76   TRP A CD2 1 
ATOM   537   N NE1 . TRP A 1 80  ? 34.925  5.892   4.284   1.00 51.77  ? 76   TRP A NE1 1 
ATOM   538   C CE2 . TRP A 1 80  ? 34.023  5.681   3.274   1.00 51.84  ? 76   TRP A CE2 1 
ATOM   539   C CE3 . TRP A 1 80  ? 33.295  6.800   1.254   1.00 53.81  ? 76   TRP A CE3 1 
ATOM   540   C CZ2 . TRP A 1 80  ? 33.125  4.622   3.068   1.00 50.84  ? 76   TRP A CZ2 1 
ATOM   541   C CZ3 . TRP A 1 80  ? 32.406  5.745   1.048   1.00 52.74  ? 76   TRP A CZ3 1 
ATOM   542   C CH2 . TRP A 1 80  ? 32.330  4.673   1.952   1.00 51.11  ? 76   TRP A CH2 1 
ATOM   543   N N   . ARG A 1 81  ? 34.628  11.567  4.247   1.00 57.34  ? 77   ARG A N   1 
ATOM   544   C CA  . ARG A 1 81  ? 34.260  12.028  5.589   1.00 56.71  ? 77   ARG A CA  1 
ATOM   545   C C   . ARG A 1 81  ? 33.176  13.103  5.553   1.00 57.34  ? 77   ARG A C   1 
ATOM   546   O O   . ARG A 1 81  ? 32.372  13.209  6.475   1.00 56.40  ? 77   ARG A O   1 
ATOM   547   C CB  . ARG A 1 81  ? 35.492  12.529  6.350   1.00 57.54  ? 77   ARG A CB  1 
ATOM   548   C CG  . ARG A 1 81  ? 36.577  11.479  6.517   1.00 57.36  ? 77   ARG A CG  1 
ATOM   549   C CD  . ARG A 1 81  ? 36.375  10.625  7.762   1.00 55.68  ? 77   ARG A CD  1 
ATOM   550   N NE  . ARG A 1 81  ? 37.197  11.105  8.871   1.00 56.64  ? 77   ARG A NE  1 
ATOM   551   C CZ  . ARG A 1 81  ? 36.726  11.624  10.002  1.00 56.69  ? 77   ARG A CZ  1 
ATOM   552   N NH1 . ARG A 1 81  ? 35.419  11.728  10.210  1.00 55.75  ? 77   ARG A NH1 1 
ATOM   553   N NH2 . ARG A 1 81  ? 37.569  12.034  10.938  1.00 57.80  ? 77   ARG A NH2 1 
ATOM   554   N N   . ARG A 1 82  ? 33.158  13.898  4.487   1.00 59.33  ? 78   ARG A N   1 
ATOM   555   C CA  . ARG A 1 82  ? 32.124  14.916  4.302   1.00 60.44  ? 78   ARG A CA  1 
ATOM   556   C C   . ARG A 1 82  ? 30.812  14.289  3.829   1.00 59.51  ? 78   ARG A C   1 
ATOM   557   O O   . ARG A 1 82  ? 29.737  14.845  4.051   1.00 59.69  ? 78   ARG A O   1 
ATOM   558   C CB  . ARG A 1 82  ? 32.582  15.993  3.310   1.00 63.16  ? 78   ARG A CB  1 
ATOM   559   C CG  . ARG A 1 82  ? 33.760  16.834  3.788   1.00 64.97  ? 78   ARG A CG  1 
ATOM   560   C CD  . ARG A 1 82  ? 33.923  18.105  2.955   1.00 68.85  ? 78   ARG A CD  1 
ATOM   561   N NE  . ARG A 1 82  ? 32.915  19.113  3.292   1.00 70.18  ? 78   ARG A NE  1 
ATOM   562   C CZ  . ARG A 1 82  ? 32.997  20.403  2.974   1.00 73.00  ? 78   ARG A CZ  1 
ATOM   563   N NH1 . ARG A 1 82  ? 34.047  20.868  2.306   1.00 75.21  ? 78   ARG A NH1 1 
ATOM   564   N NH2 . ARG A 1 82  ? 32.027  21.234  3.334   1.00 73.73  ? 78   ARG A NH2 1 
ATOM   565   N N   . MET A 1 83  ? 30.919  13.129  3.183   1.00 58.79  ? 79   MET A N   1 
ATOM   566   C CA  . MET A 1 83  ? 29.777  12.408  2.621   1.00 58.26  ? 79   MET A CA  1 
ATOM   567   C C   . MET A 1 83  ? 28.722  12.104  3.677   1.00 56.59  ? 79   MET A C   1 
ATOM   568   O O   . MET A 1 83  ? 29.041  11.596  4.755   1.00 55.16  ? 79   MET A O   1 
ATOM   569   C CB  . MET A 1 83  ? 30.256  11.106  1.972   1.00 57.71  ? 79   MET A CB  1 
ATOM   570   C CG  . MET A 1 83  ? 29.190  10.312  1.223   1.00 57.79  ? 79   MET A CG  1 
ATOM   571   S SD  . MET A 1 83  ? 29.869  8.888   0.331   1.00 58.34  ? 79   MET A SD  1 
ATOM   572   C CE  . MET A 1 83  ? 30.761  9.705   -0.997  1.00 60.52  ? 79   MET A CE  1 
ATOM   573   N N   . ASP A 1 84  ? 27.469  12.428  3.363   1.00 57.07  ? 80   ASP A N   1 
ATOM   574   C CA  . ASP A 1 84  ? 26.338  12.072  4.219   1.00 55.59  ? 80   ASP A CA  1 
ATOM   575   C C   . ASP A 1 84  ? 26.313  10.556  4.418   1.00 53.84  ? 80   ASP A C   1 
ATOM   576   O O   . ASP A 1 84  ? 26.578  9.796   3.480   1.00 54.13  ? 80   ASP A O   1 
ATOM   577   C CB  . ASP A 1 84  ? 25.017  12.547  3.600   1.00 56.80  ? 80   ASP A CB  1 
ATOM   578   C CG  . ASP A 1 84  ? 24.930  14.063  3.471   1.00 58.72  ? 80   ASP A CG  1 
ATOM   579   O OD1 . ASP A 1 84  ? 25.256  14.779  4.442   1.00 58.50  ? 80   ASP A OD1 1 
ATOM   580   O OD2 . ASP A 1 84  ? 24.517  14.541  2.394   1.00 60.80  ? 80   ASP A OD2 1 
ATOM   581   N N   . ALA A 1 85  ? 26.010  10.119  5.638   1.00 52.20  ? 81   ALA A N   1 
ATOM   582   C CA  . ALA A 1 85  ? 25.989  8.691   5.951   1.00 50.77  ? 81   ALA A CA  1 
ATOM   583   C C   . ALA A 1 85  ? 25.024  7.922   5.046   1.00 51.12  ? 81   ALA A C   1 
ATOM   584   O O   . ALA A 1 85  ? 25.293  6.778   4.679   1.00 50.75  ? 81   ALA A O   1 
ATOM   585   C CB  . ALA A 1 85  ? 25.653  8.466   7.415   1.00 49.38  ? 81   ALA A CB  1 
ATOM   586   N N   . SER A 1 86  ? 23.915  8.564   4.675   1.00 52.07  ? 82   SER A N   1 
ATOM   587   C CA  . SER A 1 86  ? 22.910  7.954   3.802   1.00 52.76  ? 82   SER A CA  1 
ATOM   588   C C   . SER A 1 86  ? 23.450  7.691   2.401   1.00 53.98  ? 82   SER A C   1 
ATOM   589   O O   . SER A 1 86  ? 22.963  6.810   1.695   1.00 54.25  ? 82   SER A O   1 
ATOM   590   C CB  . SER A 1 86  ? 21.653  8.826   3.727   1.00 53.88  ? 82   SER A CB  1 
ATOM   591   O OG  . SER A 1 86  ? 21.886  10.020  3.000   1.00 55.70  ? 82   SER A OG  1 
ATOM   592   N N   . GLU A 1 87  ? 24.460  8.462   2.016   1.00 54.92  ? 83   GLU A N   1 
ATOM   593   C CA  . GLU A 1 87  ? 25.074  8.346   0.701   1.00 56.54  ? 83   GLU A CA  1 
ATOM   594   C C   . GLU A 1 87  ? 26.187  7.298   0.687   1.00 55.41  ? 83   GLU A C   1 
ATOM   595   O O   . GLU A 1 87  ? 26.603  6.842   -0.378  1.00 56.28  ? 83   GLU A O   1 
ATOM   596   C CB  . GLU A 1 87  ? 25.604  9.700   0.251   1.00 58.29  ? 83   GLU A CB  1 
ATOM   597   C CG  . GLU A 1 87  ? 25.425  9.961   -1.219  1.00 61.60  ? 83   GLU A CG  1 
ATOM   598   C CD  . GLU A 1 87  ? 25.585  11.424  -1.554  1.00 65.12  ? 83   GLU A CD  1 
ATOM   599   O OE1 . GLU A 1 87  ? 26.123  12.167  -0.703  1.00 65.43  ? 83   GLU A OE1 1 
ATOM   600   O OE2 . GLU A 1 87  ? 25.173  11.833  -2.662  1.00 67.60  ? 83   GLU A OE2 1 
ATOM   601   N N   . ARG A 1 88  ? 26.671  6.938   1.876   1.00 53.63  ? 84   ARG A N   1 
ATOM   602   C CA  . ARG A 1 88  ? 27.538  5.773   2.041   1.00 52.60  ? 84   ARG A CA  1 
ATOM   603   C C   . ARG A 1 88  ? 26.687  4.522   1.877   1.00 52.05  ? 84   ARG A C   1 
ATOM   604   O O   . ARG A 1 88  ? 27.161  3.485   1.412   1.00 52.03  ? 84   ARG A O   1 
ATOM   605   C CB  . ARG A 1 88  ? 28.229  5.777   3.410   1.00 51.25  ? 84   ARG A CB  1 
ATOM   606   C CG  . ARG A 1 88  ? 29.307  6.838   3.561   1.00 51.78  ? 84   ARG A CG  1 
ATOM   607   C CD  . ARG A 1 88  ? 30.229  6.556   4.737   1.00 50.50  ? 84   ARG A CD  1 
ATOM   608   N NE  . ARG A 1 88  ? 29.864  7.291   5.948   1.00 49.88  ? 84   ARG A NE  1 
ATOM   609   C CZ  . ARG A 1 88  ? 29.324  6.745   7.037   1.00 48.51  ? 84   ARG A CZ  1 
ATOM   610   N NH1 . ARG A 1 88  ? 29.069  5.445   7.086   1.00 47.55  ? 84   ARG A NH1 1 
ATOM   611   N NH2 . ARG A 1 88  ? 29.039  7.504   8.086   1.00 48.01  ? 84   ARG A NH2 1 
ATOM   612   N N   . GLY A 1 89  ? 25.419  4.637   2.261   1.00 51.73  ? 85   GLY A N   1 
ATOM   613   C CA  . GLY A 1 89  ? 24.437  3.589   2.024   1.00 51.61  ? 85   GLY A CA  1 
ATOM   614   C C   . GLY A 1 89  ? 24.109  3.495   0.552   1.00 53.20  ? 85   GLY A C   1 
ATOM   615   O O   . GLY A 1 89  ? 23.859  2.409   0.032   1.00 53.53  ? 85   GLY A O   1 
ATOM   616   N N   . ARG A 1 90  ? 24.125  4.643   -0.120  1.00 54.52  ? 86   ARG A N   1 
ATOM   617   C CA  . ARG A 1 90  ? 23.854  4.712   -1.553  1.00 56.46  ? 86   ARG A CA  1 
ATOM   618   C C   . ARG A 1 90  ? 24.926  4.001   -2.389  1.00 56.81  ? 86   ARG A C   1 
ATOM   619   O O   . ARG A 1 90  ? 24.609  3.332   -3.376  1.00 58.00  ? 86   ARG A O   1 
ATOM   620   C CB  . ARG A 1 90  ? 23.667  6.170   -2.000  1.00 58.07  ? 86   ARG A CB  1 
ATOM   621   C CG  . ARG A 1 90  ? 22.322  6.783   -1.578  1.00 58.79  ? 86   ARG A CG  1 
ATOM   622   C CD  . ARG A 1 90  ? 21.205  6.539   -2.603  1.00 61.64  ? 86   ARG A CD  1 
ATOM   623   N NE  . ARG A 1 90  ? 21.167  5.160   -3.098  1.00 62.35  ? 86   ARG A NE  1 
ATOM   624   C CZ  . ARG A 1 90  ? 20.658  4.784   -4.271  1.00 64.72  ? 86   ARG A CZ  1 
ATOM   625   N NH1 . ARG A 1 90  ? 20.126  5.679   -5.097  1.00 66.95  ? 86   ARG A NH1 1 
ATOM   626   N NH2 . ARG A 1 90  ? 20.684  3.504   -4.626  1.00 64.74  ? 86   ARG A NH2 1 
ATOM   627   N N   . LEU A 1 91  ? 26.186  4.137   -1.983  1.00 55.89  ? 87   LEU A N   1 
ATOM   628   C CA  . LEU A 1 91  ? 27.291  3.494   -2.689  1.00 56.19  ? 87   LEU A CA  1 
ATOM   629   C C   . LEU A 1 91  ? 27.346  1.996   -2.425  1.00 55.13  ? 87   LEU A C   1 
ATOM   630   O O   . LEU A 1 91  ? 27.773  1.226   -3.285  1.00 56.00  ? 87   LEU A O   1 
ATOM   631   C CB  . LEU A 1 91  ? 28.625  4.150   -2.332  1.00 55.96  ? 87   LEU A CB  1 
ATOM   632   C CG  . LEU A 1 91  ? 28.898  5.534   -2.923  1.00 57.41  ? 87   LEU A CG  1 
ATOM   633   C CD1 . LEU A 1 91  ? 30.123  6.142   -2.266  1.00 57.11  ? 87   LEU A CD1 1 
ATOM   634   C CD2 . LEU A 1 91  ? 29.066  5.477   -4.438  1.00 59.18  ? 87   LEU A CD2 1 
ATOM   635   N N   . LEU A 1 92  ? 26.914  1.586   -1.237  1.00 53.42  ? 88   LEU A N   1 
ATOM   636   C CA  . LEU A 1 92  ? 26.817  0.166   -0.916  1.00 52.66  ? 88   LEU A CA  1 
ATOM   637   C C   . LEU A 1 92  ? 25.689  -0.501  -1.696  1.00 53.57  ? 88   LEU A C   1 
ATOM   638   O O   . LEU A 1 92  ? 25.846  -1.624  -2.177  1.00 54.08  ? 88   LEU A O   1 
ATOM   639   C CB  . LEU A 1 92  ? 26.636  -0.054  0.592   1.00 50.93  ? 88   LEU A CB  1 
ATOM   640   C CG  . LEU A 1 92  ? 27.901  -0.142  1.451   1.00 49.95  ? 88   LEU A CG  1 
ATOM   641   C CD1 . LEU A 1 92  ? 27.571  0.060   2.925   1.00 48.66  ? 88   LEU A CD1 1 
ATOM   642   C CD2 . LEU A 1 92  ? 28.633  -1.464  1.237   1.00 49.84  ? 88   LEU A CD2 1 
ATOM   643   N N   . ASP A 1 93  ? 24.564  0.202   -1.826  1.00 53.98  ? 89   ASP A N   1 
ATOM   644   C CA  . ASP A 1 93  ? 23.396  -0.314  -2.536  1.00 55.17  ? 89   ASP A CA  1 
ATOM   645   C C   . ASP A 1 93  ? 23.641  -0.374  -4.039  1.00 57.14  ? 89   ASP A C   1 
ATOM   646   O O   . ASP A 1 93  ? 23.112  -1.253  -4.719  1.00 58.29  ? 89   ASP A O   1 
ATOM   647   C CB  . ASP A 1 93  ? 22.161  0.540   -2.237  1.00 55.47  ? 89   ASP A CB  1 
ATOM   648   C CG  . ASP A 1 93  ? 20.858  -0.210  -2.462  1.00 56.50  ? 89   ASP A CG  1 
ATOM   649   O OD1 . ASP A 1 93  ? 20.754  -1.379  -2.033  1.00 55.96  ? 89   ASP A OD1 1 
ATOM   650   O OD2 . ASP A 1 93  ? 19.929  0.377   -3.055  1.00 58.31  ? 89   ASP A OD2 1 
ATOM   651   N N   . LYS A 1 94  ? 24.440  0.567   -4.543  1.00 57.70  ? 90   LYS A N   1 
ATOM   652   C CA  . LYS A 1 94  ? 24.831  0.605   -5.952  1.00 59.66  ? 90   LYS A CA  1 
ATOM   653   C C   . LYS A 1 94  ? 25.834  -0.503  -6.272  1.00 59.45  ? 90   LYS A C   1 
ATOM   654   O O   . LYS A 1 94  ? 25.846  -1.035  -7.383  1.00 61.20  ? 90   LYS A O   1 
ATOM   655   C CB  . LYS A 1 94  ? 25.407  1.982   -6.317  1.00 60.60  ? 90   LYS A CB  1 
ATOM   656   C CG  . LYS A 1 94  ? 25.852  2.150   -7.786  1.00 63.36  ? 90   LYS A CG  1 
ATOM   657   C CD  . LYS A 1 94  ? 24.684  2.152   -8.778  1.00 66.16  ? 90   LYS A CD  1 
ATOM   658   C CE  . LYS A 1 94  ? 24.104  3.549   -8.992  1.00 68.20  ? 90   LYS A CE  1 
ATOM   659   N NZ  . LYS A 1 94  ? 23.324  4.055   -7.820  1.00 67.31  ? 90   LYS A NZ  1 
ATOM   660   N N   . LEU A 1 95  ? 26.673  -0.838  -5.295  1.00 57.58  ? 91   LEU A N   1 
ATOM   661   C CA  . LEU A 1 95  ? 27.632  -1.933  -5.426  1.00 57.32  ? 91   LEU A CA  1 
ATOM   662   C C   . LEU A 1 95  ? 26.904  -3.265  -5.563  1.00 57.61  ? 91   LEU A C   1 
ATOM   663   O O   . LEU A 1 95  ? 27.296  -4.115  -6.364  1.00 58.83  ? 91   LEU A O   1 
ATOM   664   C CB  . LEU A 1 95  ? 28.584  -1.958  -4.224  1.00 55.58  ? 91   LEU A CB  1 
ATOM   665   C CG  . LEU A 1 95  ? 29.726  -2.979  -4.137  1.00 55.25  ? 91   LEU A CG  1 
ATOM   666   C CD1 . LEU A 1 95  ? 30.570  -3.024  -5.411  1.00 56.78  ? 91   LEU A CD1 1 
ATOM   667   C CD2 . LEU A 1 95  ? 30.593  -2.654  -2.932  1.00 53.52  ? 91   LEU A CD2 1 
ATOM   668   N N   . ALA A 1 96  ? 25.834  -3.427  -4.787  1.00 56.64  ? 92   ALA A N   1 
ATOM   669   C CA  . ALA A 1 96  ? 24.988  -4.613  -4.850  1.00 57.09  ? 92   ALA A CA  1 
ATOM   670   C C   . ALA A 1 96  ? 24.386  -4.799  -6.243  1.00 59.33  ? 92   ALA A C   1 
ATOM   671   O O   . ALA A 1 96  ? 24.308  -5.925  -6.741  1.00 60.38  ? 92   ALA A O   1 
ATOM   672   C CB  . ALA A 1 96  ? 23.894  -4.535  -3.801  1.00 56.04  ? 92   ALA A CB  1 
ATOM   673   N N   . ASP A 1 97  ? 23.972  -3.689  -6.860  1.00 60.20  ? 93   ASP A N   1 
ATOM   674   C CA  . ASP A 1 97  ? 23.451  -3.683  -8.229  1.00 62.61  ? 93   ASP A CA  1 
ATOM   675   C C   . ASP A 1 97  ? 24.444  -4.282  -9.219  1.00 63.76  ? 93   ASP A C   1 
ATOM   676   O O   . ASP A 1 97  ? 24.077  -5.108  -10.060 1.00 65.53  ? 93   ASP A O   1 
ATOM   677   C CB  . ASP A 1 97  ? 23.115  -2.256  -8.672  1.00 63.58  ? 93   ASP A CB  1 
ATOM   678   C CG  . ASP A 1 97  ? 21.866  -1.714  -8.015  1.00 63.40  ? 93   ASP A CG  1 
ATOM   679   O OD1 . ASP A 1 97  ? 20.855  -2.446  -7.953  1.00 64.29  ? 93   ASP A OD1 1 
ATOM   680   O OD2 . ASP A 1 97  ? 21.892  -0.544  -7.579  1.00 62.97  ? 93   ASP A OD2 1 
ATOM   681   N N   . LEU A 1 98  ? 25.700  -3.858  -9.106  1.00 62.83  ? 94   LEU A N   1 
ATOM   682   C CA  . LEU A 1 98  ? 26.748  -4.267  -10.031 1.00 63.91  ? 94   LEU A CA  1 
ATOM   683   C C   . LEU A 1 98  ? 27.078  -5.745  -9.882  1.00 63.72  ? 94   LEU A C   1 
ATOM   684   O O   . LEU A 1 98  ? 27.387  -6.420  -10.867 1.00 65.46  ? 94   LEU A O   1 
ATOM   685   C CB  . LEU A 1 98  ? 27.999  -3.408  -9.838  1.00 63.19  ? 94   LEU A CB  1 
ATOM   686   C CG  . LEU A 1 98  ? 27.866  -1.922  -10.188 1.00 63.80  ? 94   LEU A CG  1 
ATOM   687   C CD1 . LEU A 1 98  ? 29.016  -1.137  -9.593  1.00 62.56  ? 94   LEU A CD1 1 
ATOM   688   C CD2 . LEU A 1 98  ? 27.778  -1.692  -11.697 1.00 66.34  ? 94   LEU A CD2 1 
ATOM   689   N N   . VAL A 1 99  ? 27.006  -6.242  -8.649  1.00 61.73  ? 95   VAL A N   1 
ATOM   690   C CA  . VAL A 1 99  ? 27.181  -7.669  -8.386  1.00 61.63  ? 95   VAL A CA  1 
ATOM   691   C C   . VAL A 1 99  ? 25.995  -8.445  -8.970  1.00 63.18  ? 95   VAL A C   1 
ATOM   692   O O   . VAL A 1 99  ? 26.179  -9.504  -9.570  1.00 64.58  ? 95   VAL A O   1 
ATOM   693   C CB  . VAL A 1 99  ? 27.368  -7.967  -6.874  1.00 59.43  ? 95   VAL A CB  1 
ATOM   694   C CG1 . VAL A 1 99  ? 27.633  -9.447  -6.638  1.00 59.70  ? 95   VAL A CG1 1 
ATOM   695   C CG2 . VAL A 1 99  ? 28.518  -7.141  -6.307  1.00 57.98  ? 95   VAL A CG2 1 
ATOM   696   N N   . GLU A 1 100 ? 24.792  -7.893  -8.814  1.00 63.12  ? 96   GLU A N   1 
ATOM   697   C CA  . GLU A 1 100 ? 23.568  -8.476  -9.375  1.00 64.84  ? 96   GLU A CA  1 
ATOM   698   C C   . GLU A 1 100 ? 23.627  -8.544  -10.905 1.00 67.38  ? 96   GLU A C   1 
ATOM   699   O O   . GLU A 1 100 ? 23.195  -9.530  -11.507 1.00 69.09  ? 96   GLU A O   1 
ATOM   700   C CB  . GLU A 1 100 ? 22.339  -7.680  -8.912  1.00 64.39  ? 96   GLU A CB  1 
ATOM   701   C CG  . GLU A 1 100 ? 20.992  -8.174  -9.443  1.00 66.72  ? 96   GLU A CG  1 
ATOM   702   C CD  . GLU A 1 100 ? 20.462  -9.393  -8.705  1.00 66.79  ? 96   GLU A CD  1 
ATOM   703   O OE1 . GLU A 1 100 ? 20.164  -9.285  -7.495  1.00 65.10  ? 96   GLU A OE1 1 
ATOM   704   O OE2 . GLU A 1 100 ? 20.327  -10.457 -9.345  1.00 68.70  ? 96   GLU A OE2 1 
ATOM   705   N N   . ARG A 1 101 ? 24.171  -7.493  -11.516 1.00 67.71  ? 97   ARG A N   1 
ATOM   706   C CA  . ARG A 1 101 ? 24.305  -7.403  -12.970 1.00 70.29  ? 97   ARG A CA  1 
ATOM   707   C C   . ARG A 1 101 ? 25.329  -8.406  -13.500 1.00 71.16  ? 97   ARG A C   1 
ATOM   708   O O   . ARG A 1 101 ? 25.114  -9.035  -14.540 1.00 73.52  ? 97   ARG A O   1 
ATOM   709   C CB  . ARG A 1 101 ? 24.694  -5.976  -13.374 1.00 70.48  ? 97   ARG A CB  1 
ATOM   710   C CG  . ARG A 1 101 ? 24.901  -5.766  -14.871 1.00 72.96  ? 97   ARG A CG  1 
ATOM   711   C CD  . ARG A 1 101 ? 25.758  -4.540  -15.146 1.00 72.28  ? 97   ARG A CD  1 
ATOM   712   N NE  . ARG A 1 101 ? 27.093  -4.658  -14.556 1.00 70.03  ? 97   ARG A NE  1 
ATOM   713   C CZ  . ARG A 1 101 ? 28.032  -3.716  -14.612 1.00 69.61  ? 97   ARG A CZ  1 
ATOM   714   N NH1 . ARG A 1 101 ? 27.798  -2.567  -15.234 1.00 70.91  ? 97   ARG A NH1 1 
ATOM   715   N NH2 . ARG A 1 101 ? 29.211  -3.922  -14.040 1.00 67.87  ? 97   ARG A NH2 1 
ATOM   716   N N   . ASP A 1 102 ? 26.438  -8.545  -12.777 1.00 69.43  ? 98   ASP A N   1 
ATOM   717   C CA  . ASP A 1 102 ? 27.514  -9.459  -13.154 1.00 70.20  ? 98   ASP A CA  1 
ATOM   718   C C   . ASP A 1 102 ? 27.493  -10.717 -12.283 1.00 69.35  ? 98   ASP A C   1 
ATOM   719   O O   . ASP A 1 102 ? 28.542  -11.283 -11.960 1.00 68.84  ? 98   ASP A O   1 
ATOM   720   C CB  . ASP A 1 102 ? 28.874  -8.752  -13.062 1.00 69.38  ? 98   ASP A CB  1 
ATOM   721   C CG  . ASP A 1 102 ? 28.935  -7.468  -13.888 1.00 70.61  ? 98   ASP A CG  1 
ATOM   722   O OD1 . ASP A 1 102 ? 28.016  -7.216  -14.701 1.00 72.55  ? 98   ASP A OD1 1 
ATOM   723   O OD2 . ASP A 1 102 ? 29.913  -6.706  -13.723 1.00 69.89  ? 98   ASP A OD2 1 
ATOM   724   N N   . ARG A 1 103 ? 26.285  -11.145 -11.917 1.00 69.45  ? 99   ARG A N   1 
ATOM   725   C CA  . ARG A 1 103 ? 26.075  -12.318 -11.063 1.00 68.96  ? 99   ARG A CA  1 
ATOM   726   C C   . ARG A 1 103 ? 26.596  -13.608 -11.707 1.00 70.88  ? 99   ARG A C   1 
ATOM   727   O O   . ARG A 1 103 ? 27.185  -14.453 -11.029 1.00 70.32  ? 99   ARG A O   1 
ATOM   728   C CB  . ARG A 1 103 ? 24.590  -12.448 -10.695 1.00 69.07  ? 99   ARG A CB  1 
ATOM   729   C CG  . ARG A 1 103 ? 24.298  -13.310 -9.470  1.00 68.14  ? 99   ARG A CG  1 
ATOM   730   C CD  . ARG A 1 103 ? 22.829  -13.216 -9.061  1.00 68.50  ? 99   ARG A CD  1 
ATOM   731   N NE  . ARG A 1 103 ? 22.475  -14.215 -8.053  1.00 68.59  ? 99   ARG A NE  1 
ATOM   732   C CZ  . ARG A 1 103 ? 21.377  -14.182 -7.299  1.00 68.74  ? 99   ARG A CZ  1 
ATOM   733   N NH1 . ARG A 1 103 ? 20.498  -13.192 -7.416  1.00 68.84  ? 99   ARG A NH1 1 
ATOM   734   N NH2 . ARG A 1 103 ? 21.158  -15.144 -6.412  1.00 68.84  ? 99   ARG A NH2 1 
ATOM   735   N N   . ALA A 1 104 ? 26.389  -13.743 -13.015 1.00 73.28  ? 100  ALA A N   1 
ATOM   736   C CA  . ALA A 1 104 ? 26.851  -14.909 -13.756 1.00 75.40  ? 100  ALA A CA  1 
ATOM   737   C C   . ALA A 1 104 ? 28.377  -14.948 -13.841 1.00 75.15  ? 100  ALA A C   1 
ATOM   738   O O   . ALA A 1 104 ? 28.988  -16.007 -13.679 1.00 75.77  ? 100  ALA A O   1 
ATOM   739   C CB  . ALA A 1 104 ? 26.234  -14.925 -15.143 1.00 78.22  ? 100  ALA A CB  1 
ATOM   740   N N   . VAL A 1 105 ? 28.978  -13.784 -14.080 1.00 74.45  ? 101  VAL A N   1 
ATOM   741   C CA  . VAL A 1 105 ? 30.426  -13.649 -14.252 1.00 74.35  ? 101  VAL A CA  1 
ATOM   742   C C   . VAL A 1 105 ? 31.181  -13.956 -12.957 1.00 72.43  ? 101  VAL A C   1 
ATOM   743   O O   . VAL A 1 105 ? 32.122  -14.753 -12.956 1.00 73.06  ? 101  VAL A O   1 
ATOM   744   C CB  . VAL A 1 105 ? 30.807  -12.226 -14.740 1.00 74.10  ? 101  VAL A CB  1 
ATOM   745   C CG1 . VAL A 1 105 ? 32.214  -12.212 -15.311 1.00 75.01  ? 101  VAL A CG1 1 
ATOM   746   C CG2 . VAL A 1 105 ? 29.811  -11.719 -15.776 1.00 75.79  ? 101  VAL A CG2 1 
ATOM   747   N N   . LEU A 1 106 ? 30.754  -13.322 -11.865 1.00 70.28  ? 102  LEU A N   1 
ATOM   748   C CA  . LEU A 1 106 ? 31.395  -13.470 -10.554 1.00 68.45  ? 102  LEU A CA  1 
ATOM   749   C C   . LEU A 1 106 ? 31.214  -14.855 -9.940  1.00 69.00  ? 102  LEU A C   1 
ATOM   750   O O   . LEU A 1 106 ? 32.067  -15.313 -9.174  1.00 68.51  ? 102  LEU A O   1 
ATOM   751   C CB  . LEU A 1 106 ? 30.891  -12.397 -9.583  1.00 66.04  ? 102  LEU A CB  1 
ATOM   752   C CG  . LEU A 1 106 ? 31.632  -11.059 -9.567  1.00 64.75  ? 102  LEU A CG  1 
ATOM   753   C CD1 . LEU A 1 106 ? 30.731  -9.946  -9.068  1.00 63.08  ? 102  LEU A CD1 1 
ATOM   754   C CD2 . LEU A 1 106 ? 32.893  -11.146 -8.722  1.00 63.59  ? 102  LEU A CD2 1 
ATOM   755   N N   . ALA A 1 107 ? 30.101  -15.510 -10.269 1.00 70.30  ? 103  ALA A N   1 
ATOM   756   C CA  . ALA A 1 107 ? 29.853  -16.880 -9.827  1.00 71.37  ? 103  ALA A CA  1 
ATOM   757   C C   . ALA A 1 107 ? 30.759  -17.851 -10.573 1.00 73.67  ? 103  ALA A C   1 
ATOM   758   O O   . ALA A 1 107 ? 31.205  -18.850 -10.009 1.00 74.20  ? 103  ALA A O   1 
ATOM   759   C CB  . ALA A 1 107 ? 28.392  -17.253 -10.018 1.00 72.26  ? 103  ALA A CB  1 
ATOM   760   N N   . THR A 1 108 ? 31.029  -17.540 -11.839 1.00 75.27  ? 104  THR A N   1 
ATOM   761   C CA  . THR A 1 108 ? 31.922  -18.342 -12.669 1.00 77.71  ? 104  THR A CA  1 
ATOM   762   C C   . THR A 1 108 ? 33.369  -18.256 -12.164 1.00 77.03  ? 104  THR A C   1 
ATOM   763   O O   . THR A 1 108 ? 34.066  -19.271 -12.108 1.00 78.46  ? 104  THR A O   1 
ATOM   764   C CB  . THR A 1 108 ? 31.832  -17.931 -14.159 1.00 79.58  ? 104  THR A CB  1 
ATOM   765   O OG1 . THR A 1 108 ? 30.458  -17.870 -14.558 1.00 80.42  ? 104  THR A OG1 1 
ATOM   766   C CG2 . THR A 1 108 ? 32.564  -18.925 -15.053 1.00 82.19  ? 104  THR A CG2 1 
ATOM   767   N N   . MET A 1 109 ? 33.806  -17.052 -11.794 1.00 75.18  ? 105  MET A N   1 
ATOM   768   C CA  . MET A 1 109 ? 35.126  -16.849 -11.194 1.00 74.51  ? 105  MET A CA  1 
ATOM   769   C C   . MET A 1 109 ? 35.279  -17.628 -9.890  1.00 73.78  ? 105  MET A C   1 
ATOM   770   O O   . MET A 1 109 ? 36.313  -18.248 -9.653  1.00 74.66  ? 105  MET A O   1 
ATOM   771   C CB  . MET A 1 109 ? 35.381  -15.367 -10.923 1.00 72.71  ? 105  MET A CB  1 
ATOM   772   C CG  . MET A 1 109 ? 35.946  -14.589 -12.088 1.00 74.28  ? 105  MET A CG  1 
ATOM   773   S SD  . MET A 1 109 ? 36.690  -13.048 -11.518 1.00 73.46  ? 105  MET A SD  1 
ATOM   774   C CE  . MET A 1 109 ? 36.946  -12.189 -13.070 1.00 75.25  ? 105  MET A CE  1 
ATOM   775   N N   . GLU A 1 110 ? 34.239  -17.587 -9.057  1.00 72.39  ? 106  GLU A N   1 
ATOM   776   C CA  . GLU A 1 110 ? 34.226  -18.246 -7.751  1.00 71.70  ? 106  GLU A CA  1 
ATOM   777   C C   . GLU A 1 110 ? 34.193  -19.769 -7.883  1.00 73.80  ? 106  GLU A C   1 
ATOM   778   O O   . GLU A 1 110 ? 34.599  -20.492 -6.973  1.00 74.00  ? 106  GLU A O   1 
ATOM   779   C CB  . GLU A 1 110 ? 33.020  -17.759 -6.941  1.00 69.96  ? 106  GLU A CB  1 
ATOM   780   C CG  . GLU A 1 110 ? 33.070  -18.075 -5.444  1.00 69.34  ? 106  GLU A CG  1 
ATOM   781   C CD  . GLU A 1 110 ? 33.816  -17.030 -4.628  1.00 68.01  ? 106  GLU A CD  1 
ATOM   782   O OE1 . GLU A 1 110 ? 34.729  -16.368 -5.169  1.00 67.86  ? 106  GLU A OE1 1 
ATOM   783   O OE2 . GLU A 1 110 ? 33.486  -16.876 -3.432  1.00 67.20  ? 106  GLU A OE2 1 
ATOM   784   N N   . SER A 1 111 ? 33.704  -20.243 -9.024  1.00 75.59  ? 107  SER A N   1 
ATOM   785   C CA  . SER A 1 111 ? 33.619  -21.671 -9.309  1.00 78.05  ? 107  SER A CA  1 
ATOM   786   C C   . SER A 1 111 ? 34.932  -22.198 -9.886  1.00 79.76  ? 107  SER A C   1 
ATOM   787   O O   . SER A 1 111 ? 35.430  -23.244 -9.468  1.00 81.15  ? 107  SER A O   1 
ATOM   788   C CB  . SER A 1 111 ? 32.463  -21.945 -10.275 1.00 79.53  ? 107  SER A CB  1 
ATOM   789   O OG  . SER A 1 111 ? 32.124  -23.319 -10.294 1.00 81.97  ? 107  SER A OG  1 
ATOM   790   N N   . LEU A 1 112 ? 35.476  -21.458 -10.851 1.00 79.80  ? 108  LEU A N   1 
ATOM   791   C CA  . LEU A 1 112 ? 36.747  -21.782 -11.499 1.00 81.45  ? 108  LEU A CA  1 
ATOM   792   C C   . LEU A 1 112 ? 37.924  -21.686 -10.526 1.00 80.56  ? 108  LEU A C   1 
ATOM   793   O O   . LEU A 1 112 ? 38.768  -22.581 -10.473 1.00 82.34  ? 108  LEU A O   1 
ATOM   794   C CB  . LEU A 1 112 ? 36.966  -20.851 -12.701 1.00 81.68  ? 108  LEU A CB  1 
ATOM   795   C CG  . LEU A 1 112 ? 38.325  -20.763 -13.401 1.00 83.05  ? 108  LEU A CG  1 
ATOM   796   C CD1 . LEU A 1 112 ? 38.564  -21.959 -14.310 1.00 86.51  ? 108  LEU A CD1 1 
ATOM   797   C CD2 . LEU A 1 112 ? 38.411  -19.476 -14.197 1.00 82.36  ? 108  LEU A CD2 1 
ATOM   798   N N   . ASN A 1 113 ? 37.961  -20.597 -9.760  1.00 77.98  ? 109  ASN A N   1 
ATOM   799   C CA  . ASN A 1 113 ? 39.049  -20.320 -8.824  1.00 77.04  ? 109  ASN A CA  1 
ATOM   800   C C   . ASN A 1 113 ? 38.858  -21.001 -7.464  1.00 76.53  ? 109  ASN A C   1 
ATOM   801   O O   . ASN A 1 113 ? 39.799  -21.580 -6.919  1.00 77.64  ? 109  ASN A O   1 
ATOM   802   C CB  . ASN A 1 113 ? 39.221  -18.803 -8.656  1.00 74.82  ? 109  ASN A CB  1 
ATOM   803   C CG  . ASN A 1 113 ? 40.508  -18.425 -7.941  1.00 74.39  ? 109  ASN A CG  1 
ATOM   804   O OD1 . ASN A 1 113 ? 40.581  -17.181 -7.488  1.00 72.43  ? 109  ASN A OD1 1 
ATOM   805   N ND2 . ASN A 1 113 ? 41.423  -19.235 -7.803  1.00 75.92  ? 109  ASN A ND2 1 
ATOM   806   N N   . GLY A 1 114 ? 37.644  -20.926 -6.923  1.00 75.06  ? 110  GLY A N   1 
ATOM   807   C CA  . GLY A 1 114 ? 37.328  -21.543 -5.635  1.00 74.56  ? 110  GLY A CA  1 
ATOM   808   C C   . GLY A 1 114 ? 37.180  -23.051 -5.716  1.00 77.01  ? 110  GLY A C   1 
ATOM   809   O O   . GLY A 1 114 ? 37.618  -23.771 -4.819  1.00 77.81  ? 110  GLY A O   1 
ATOM   810   N N   . GLY A 1 115 ? 36.562  -23.527 -6.796  1.00 78.38  ? 111  GLY A N   1 
ATOM   811   C CA  . GLY A 1 115 ? 36.311  -24.954 -6.986  1.00 80.98  ? 111  GLY A CA  1 
ATOM   812   C C   . GLY A 1 115 ? 34.870  -25.351 -6.722  1.00 80.85  ? 111  GLY A C   1 
ATOM   813   O O   . GLY A 1 115 ? 34.427  -26.420 -7.148  1.00 83.24  ? 111  GLY A O   1 
ATOM   814   N N   . LYS A 1 116 ? 34.142  -24.485 -6.017  1.00 78.23  ? 112  LYS A N   1 
ATOM   815   C CA  . LYS A 1 116 ? 32.746  -24.725 -5.652  1.00 77.96  ? 112  LYS A CA  1 
ATOM   816   C C   . LYS A 1 116 ? 31.854  -24.831 -6.896  1.00 79.05  ? 112  LYS A C   1 
ATOM   817   O O   . LYS A 1 116 ? 32.041  -24.069 -7.842  1.00 78.49  ? 112  LYS A O   1 
ATOM   818   C CB  . LYS A 1 116 ? 32.249  -23.604 -4.730  1.00 74.97  ? 112  LYS A CB  1 
ATOM   819   C CG  . LYS A 1 116 ? 30.961  -23.924 -3.994  1.00 74.98  ? 112  LYS A CG  1 
ATOM   820   C CD  . LYS A 1 116 ? 30.582  -22.825 -3.024  1.00 72.88  ? 112  LYS A CD  1 
ATOM   821   C CE  . LYS A 1 116 ? 29.362  -23.225 -2.207  1.00 73.06  ? 112  LYS A CE  1 
ATOM   822   N NZ  . LYS A 1 116 ? 29.127  -22.298 -1.072  1.00 70.73  ? 112  LYS A NZ  1 
ATOM   823   N N   . PRO A 1 117 ? 30.896  -25.788 -6.903  1.00 80.80  ? 113  PRO A N   1 
ATOM   824   C CA  . PRO A 1 117 ? 29.942  -25.949 -8.007  1.00 82.23  ? 113  PRO A CA  1 
ATOM   825   C C   . PRO A 1 117 ? 29.239  -24.645 -8.383  1.00 80.12  ? 113  PRO A C   1 
ATOM   826   O O   . PRO A 1 117 ? 28.796  -23.904 -7.501  1.00 77.82  ? 113  PRO A O   1 
ATOM   827   C CB  . PRO A 1 117 ? 28.936  -26.956 -7.448  1.00 83.72  ? 113  PRO A CB  1 
ATOM   828   C CG  . PRO A 1 117 ? 29.748  -27.800 -6.548  1.00 84.58  ? 113  PRO A CG  1 
ATOM   829   C CD  . PRO A 1 117 ? 30.745  -26.867 -5.908  1.00 82.05  ? 113  PRO A CD  1 
ATOM   830   N N   . PHE A 1 118 ? 29.144  -24.389 -9.687  1.00 81.17  ? 114  PHE A N   1 
ATOM   831   C CA  . PHE A 1 118 ? 28.666  -23.111 -10.216 1.00 79.57  ? 114  PHE A CA  1 
ATOM   832   C C   . PHE A 1 118 ? 27.278  -22.695 -9.728  1.00 78.47  ? 114  PHE A C   1 
ATOM   833   O O   . PHE A 1 118 ? 27.063  -21.526 -9.403  1.00 76.23  ? 114  PHE A O   1 
ATOM   834   C CB  . PHE A 1 118 ? 28.706  -23.104 -11.748 1.00 81.66  ? 114  PHE A CB  1 
ATOM   835   C CG  . PHE A 1 118 ? 28.104  -21.873 -12.359 1.00 80.79  ? 114  PHE A CG  1 
ATOM   836   C CD1 . PHE A 1 118 ? 28.824  -20.684 -12.406 1.00 78.92  ? 114  PHE A CD1 1 
ATOM   837   C CD2 . PHE A 1 118 ? 26.809  -21.896 -12.870 1.00 82.18  ? 114  PHE A CD2 1 
ATOM   838   C CE1 . PHE A 1 118 ? 28.267  -19.538 -12.958 1.00 78.45  ? 114  PHE A CE1 1 
ATOM   839   C CE2 . PHE A 1 118 ? 26.242  -20.756 -13.427 1.00 81.70  ? 114  PHE A CE2 1 
ATOM   840   C CZ  . PHE A 1 118 ? 26.972  -19.573 -13.470 1.00 79.96  ? 114  PHE A CZ  1 
ATOM   841   N N   . LEU A 1 119 ? 26.344  -23.643 -9.689  1.00 80.26  ? 115  LEU A N   1 
ATOM   842   C CA  . LEU A 1 119 ? 24.971  -23.353 -9.265  1.00 79.65  ? 115  LEU A CA  1 
ATOM   843   C C   . LEU A 1 119 ? 24.892  -22.934 -7.797  1.00 77.02  ? 115  LEU A C   1 
ATOM   844   O O   . LEU A 1 119 ? 24.079  -22.082 -7.434  1.00 75.38  ? 115  LEU A O   1 
ATOM   845   C CB  . LEU A 1 119 ? 24.041  -24.539 -9.545  1.00 82.55  ? 115  LEU A CB  1 
ATOM   846   C CG  . LEU A 1 119 ? 23.701  -24.862 -11.006 1.00 85.33  ? 115  LEU A CG  1 
ATOM   847   C CD1 . LEU A 1 119 ? 22.871  -26.134 -11.084 1.00 88.23  ? 115  LEU A CD1 1 
ATOM   848   C CD2 . LEU A 1 119 ? 22.980  -23.706 -11.700 1.00 84.62  ? 115  LEU A CD2 1 
ATOM   849   N N   . GLN A 1 120 ? 25.743  -23.532 -6.965  1.00 76.80  ? 116  GLN A N   1 
ATOM   850   C CA  . GLN A 1 120 ? 25.870  -23.137 -5.564  1.00 74.52  ? 116  GLN A CA  1 
ATOM   851   C C   . GLN A 1 120 ? 26.463  -21.738 -5.449  1.00 71.85  ? 116  GLN A C   1 
ATOM   852   O O   . GLN A 1 120 ? 26.097  -20.978 -4.556  1.00 69.79  ? 116  GLN A O   1 
ATOM   853   C CB  . GLN A 1 120 ? 26.739  -24.130 -4.792  1.00 75.34  ? 116  GLN A CB  1 
ATOM   854   C CG  . GLN A 1 120 ? 26.090  -25.483 -4.567  1.00 78.14  ? 116  GLN A CG  1 
ATOM   855   C CD  . GLN A 1 120 ? 26.959  -26.420 -3.753  1.00 79.46  ? 116  GLN A CD  1 
ATOM   856   O OE1 . GLN A 1 120 ? 27.417  -27.448 -4.250  1.00 82.08  ? 116  GLN A OE1 1 
ATOM   857   N NE2 . GLN A 1 120 ? 27.194  -26.068 -2.494  1.00 77.76  ? 116  GLN A NE2 1 
ATOM   858   N N   . ALA A 1 121 ? 27.377  -21.407 -6.358  1.00 72.16  ? 117  ALA A N   1 
ATOM   859   C CA  . ALA A 1 121 ? 28.014  -20.092 -6.375  1.00 70.05  ? 117  ALA A CA  1 
ATOM   860   C C   . ALA A 1 121 ? 27.048  -18.993 -6.820  1.00 69.14  ? 117  ALA A C   1 
ATOM   861   O O   . ALA A 1 121 ? 27.130  -17.859 -6.346  1.00 67.09  ? 117  ALA A O   1 
ATOM   862   C CB  . ALA A 1 121 ? 29.253  -20.110 -7.260  1.00 70.97  ? 117  ALA A CB  1 
ATOM   863   N N   . PHE A 1 122 ? 26.132  -19.338 -7.720  1.00 70.95  ? 118  PHE A N   1 
ATOM   864   C CA  . PHE A 1 122 ? 25.159  -18.384 -8.243  1.00 70.71  ? 118  PHE A CA  1 
ATOM   865   C C   . PHE A 1 122 ? 23.991  -18.166 -7.278  1.00 69.75  ? 118  PHE A C   1 
ATOM   866   O O   . PHE A 1 122 ? 23.525  -17.036 -7.108  1.00 68.31  ? 118  PHE A O   1 
ATOM   867   C CB  . PHE A 1 122 ? 24.644  -18.856 -9.607  1.00 73.38  ? 118  PHE A CB  1 
ATOM   868   C CG  . PHE A 1 122 ? 23.870  -17.811 -10.373 1.00 73.27  ? 118  PHE A CG  1 
ATOM   869   C CD1 . PHE A 1 122 ? 22.488  -17.711 -10.244 1.00 73.42  ? 118  PHE A CD1 1 
ATOM   870   C CD2 . PHE A 1 122 ? 24.519  -16.944 -11.244 1.00 73.03  ? 118  PHE A CD2 1 
ATOM   871   C CE1 . PHE A 1 122 ? 21.770  -16.755 -10.959 1.00 73.78  ? 118  PHE A CE1 1 
ATOM   872   C CE2 . PHE A 1 122 ? 23.806  -15.985 -11.964 1.00 73.27  ? 118  PHE A CE2 1 
ATOM   873   C CZ  . PHE A 1 122 ? 22.431  -15.891 -11.821 1.00 73.70  ? 118  PHE A CZ  1 
ATOM   874   N N   . TYR A 1 123 ? 23.526  -19.247 -6.651  1.00 70.77  ? 119  TYR A N   1 
ATOM   875   C CA  . TYR A 1 123 ? 22.318  -19.210 -5.820  1.00 70.38  ? 119  TYR A CA  1 
ATOM   876   C C   . TYR A 1 123 ? 22.574  -19.076 -4.318  1.00 68.23  ? 119  TYR A C   1 
ATOM   877   O O   . TYR A 1 123 ? 21.729  -18.549 -3.594  1.00 67.09  ? 119  TYR A O   1 
ATOM   878   C CB  . TYR A 1 123 ? 21.435  -20.435 -6.088  1.00 73.11  ? 119  TYR A CB  1 
ATOM   879   C CG  . TYR A 1 123 ? 20.626  -20.352 -7.365  1.00 75.53  ? 119  TYR A CG  1 
ATOM   880   C CD1 . TYR A 1 123 ? 19.406  -19.675 -7.398  1.00 75.89  ? 119  TYR A CD1 1 
ATOM   881   C CD2 . TYR A 1 123 ? 21.075  -20.955 -8.538  1.00 78.02  ? 119  TYR A CD2 1 
ATOM   882   C CE1 . TYR A 1 123 ? 18.655  -19.598 -8.572  1.00 78.33  ? 119  TYR A CE1 1 
ATOM   883   C CE2 . TYR A 1 123 ? 20.332  -20.883 -9.716  1.00 80.49  ? 119  TYR A CE2 1 
ATOM   884   C CZ  . TYR A 1 123 ? 19.125  -20.204 -9.724  1.00 80.61  ? 119  TYR A CZ  1 
ATOM   885   O OH  . TYR A 1 123 ? 18.388  -20.130 -10.884 1.00 83.44  ? 119  TYR A OH  1 
ATOM   886   N N   . VAL A 1 124 ? 23.723  -19.561 -3.851  1.00 67.97  ? 120  VAL A N   1 
ATOM   887   C CA  . VAL A 1 124 ? 24.049  -19.503 -2.424  1.00 66.25  ? 120  VAL A CA  1 
ATOM   888   C C   . VAL A 1 124 ? 25.081  -18.412 -2.146  1.00 64.10  ? 120  VAL A C   1 
ATOM   889   O O   . VAL A 1 124 ? 24.774  -17.427 -1.473  1.00 62.18  ? 120  VAL A O   1 
ATOM   890   C CB  . VAL A 1 124 ? 24.548  -20.868 -1.867  1.00 67.73  ? 120  VAL A CB  1 
ATOM   891   C CG1 . VAL A 1 124 ? 24.547  -20.853 -0.345  1.00 66.31  ? 120  VAL A CG1 1 
ATOM   892   C CG2 . VAL A 1 124 ? 23.692  -22.022 -2.388  1.00 70.39  ? 120  VAL A CG2 1 
ATOM   893   N N   . ASP A 1 125 ? 26.289  -18.588 -2.680  1.00 64.66  ? 121  ASP A N   1 
ATOM   894   C CA  . ASP A 1 125 ? 27.404  -17.671 -2.429  1.00 63.03  ? 121  ASP A CA  1 
ATOM   895   C C   . ASP A 1 125 ? 27.101  -16.222 -2.803  1.00 61.44  ? 121  ASP A C   1 
ATOM   896   O O   . ASP A 1 125 ? 27.201  -15.334 -1.959  1.00 59.58  ? 121  ASP A O   1 
ATOM   897   C CB  . ASP A 1 125 ? 28.683  -18.153 -3.132  1.00 64.41  ? 121  ASP A CB  1 
ATOM   898   C CG  . ASP A 1 125 ? 29.504  -19.108 -2.277  1.00 65.29  ? 121  ASP A CG  1 
ATOM   899   O OD1 . ASP A 1 125 ? 28.967  -19.659 -1.296  1.00 65.74  ? 121  ASP A OD1 1 
ATOM   900   O OD2 . ASP A 1 125 ? 30.696  -19.311 -2.587  1.00 66.62  ? 121  ASP A OD2 1 
ATOM   901   N N   . LEU A 1 126 ? 26.722  -15.990 -4.056  1.00 62.41  ? 122  LEU A N   1 
ATOM   902   C CA  . LEU A 1 126 ? 26.505  -14.627 -4.538  1.00 61.38  ? 122  LEU A CA  1 
ATOM   903   C C   . LEU A 1 126 ? 25.216  -13.971 -4.061  1.00 60.44  ? 122  LEU A C   1 
ATOM   904   O O   . LEU A 1 126 ? 25.147  -12.742 -3.977  1.00 59.17  ? 122  LEU A O   1 
ATOM   905   C CB  . LEU A 1 126 ? 26.612  -14.546 -6.061  1.00 63.06  ? 122  LEU A CB  1 
ATOM   906   C CG  . LEU A 1 126 ? 27.937  -13.951 -6.532  1.00 62.66  ? 122  LEU A CG  1 
ATOM   907   C CD1 . LEU A 1 126 ? 28.978  -15.038 -6.747  1.00 63.87  ? 122  LEU A CD1 1 
ATOM   908   C CD2 . LEU A 1 126 ? 27.716  -13.154 -7.795  1.00 63.52  ? 122  LEU A CD2 1 
ATOM   909   N N   . GLN A 1 127 ? 24.201  -14.778 -3.759  1.00 61.27  ? 123  GLN A N   1 
ATOM   910   C CA  . GLN A 1 127 ? 22.962  -14.247 -3.201  1.00 60.53  ? 123  GLN A CA  1 
ATOM   911   C C   . GLN A 1 127 ? 23.282  -13.600 -1.864  1.00 58.17  ? 123  GLN A C   1 
ATOM   912   O O   . GLN A 1 127 ? 22.870  -12.472 -1.605  1.00 56.94  ? 123  GLN A O   1 
ATOM   913   C CB  . GLN A 1 127 ? 21.908  -15.337 -3.032  1.00 62.06  ? 123  GLN A CB  1 
ATOM   914   C CG  . GLN A 1 127 ? 20.486  -14.799 -2.954  1.00 62.56  ? 123  GLN A CG  1 
ATOM   915   C CD  . GLN A 1 127 ? 19.461  -15.878 -2.666  1.00 64.79  ? 123  GLN A CD  1 
ATOM   916   O OE1 . GLN A 1 127 ? 19.479  -16.501 -1.604  1.00 64.73  ? 123  GLN A OE1 1 
ATOM   917   N NE2 . GLN A 1 127 ? 18.551  -16.097 -3.608  1.00 66.88  ? 123  GLN A NE2 1 
ATOM   918   N N   . GLY A 1 128 ? 24.045  -14.318 -1.039  1.00 57.81  ? 124  GLY A N   1 
ATOM   919   C CA  . GLY A 1 128 ? 24.556  -13.796 0.223   1.00 55.89  ? 124  GLY A CA  1 
ATOM   920   C C   . GLY A 1 128 ? 25.348  -12.516 0.041   1.00 54.63  ? 124  GLY A C   1 
ATOM   921   O O   . GLY A 1 128 ? 25.137  -11.549 0.770   1.00 53.19  ? 124  GLY A O   1 
ATOM   922   N N   . VAL A 1 129 ? 26.250  -12.508 -0.940  1.00 55.48  ? 125  VAL A N   1 
ATOM   923   C CA  . VAL A 1 129 ? 27.064  -11.330 -1.257  1.00 54.68  ? 125  VAL A CA  1 
ATOM   924   C C   . VAL A 1 129 ? 26.190  -10.099 -1.506  1.00 54.14  ? 125  VAL A C   1 
ATOM   925   O O   . VAL A 1 129 ? 26.397  -9.057  -0.887  1.00 52.78  ? 125  VAL A O   1 
ATOM   926   C CB  . VAL A 1 129 ? 27.997  -11.581 -2.470  1.00 56.07  ? 125  VAL A CB  1 
ATOM   927   C CG1 . VAL A 1 129 ? 28.749  -10.311 -2.855  1.00 55.42  ? 125  VAL A CG1 1 
ATOM   928   C CG2 . VAL A 1 129 ? 28.980  -12.700 -2.166  1.00 56.81  ? 125  VAL A CG2 1 
ATOM   929   N N   . ILE A 1 130 ? 25.209  -10.238 -2.398  1.00 55.51  ? 126  ILE A N   1 
ATOM   930   C CA  . ILE A 1 130 ? 24.280  -9.153  -2.724  1.00 55.50  ? 126  ILE A CA  1 
ATOM   931   C C   . ILE A 1 130 ? 23.446  -8.731  -1.509  1.00 54.28  ? 126  ILE A C   1 
ATOM   932   O O   . ILE A 1 130 ? 23.352  -7.541  -1.206  1.00 53.35  ? 126  ILE A O   1 
ATOM   933   C CB  . ILE A 1 130 ? 23.350  -9.530  -3.905  1.00 57.45  ? 126  ILE A CB  1 
ATOM   934   C CG1 . ILE A 1 130 ? 24.179  -9.868  -5.148  1.00 58.91  ? 126  ILE A CG1 1 
ATOM   935   C CG2 . ILE A 1 130 ? 22.375  -8.392  -4.208  1.00 57.53  ? 126  ILE A CG2 1 
ATOM   936   C CD1 . ILE A 1 130 ? 23.457  -10.721 -6.173  1.00 60.85  ? 126  ILE A CD1 1 
ATOM   937   N N   . LYS A 1 131 ? 22.866  -9.711  -0.817  1.00 54.55  ? 127  LYS A N   1 
ATOM   938   C CA  . LYS A 1 131 ? 21.993  -9.468  0.335   1.00 53.66  ? 127  LYS A CA  1 
ATOM   939   C C   . LYS A 1 131 ? 22.660  -8.666  1.444   1.00 51.93  ? 127  LYS A C   1 
ATOM   940   O O   . LYS A 1 131 ? 22.004  -7.846  2.089   1.00 51.14  ? 127  LYS A O   1 
ATOM   941   C CB  . LYS A 1 131 ? 21.472  -10.789 0.910   1.00 54.39  ? 127  LYS A CB  1 
ATOM   942   C CG  . LYS A 1 131 ? 20.303  -11.405 0.152   1.00 56.51  ? 127  LYS A CG  1 
ATOM   943   C CD  . LYS A 1 131 ? 18.959  -10.998 0.747   1.00 57.20  ? 127  LYS A CD  1 
ATOM   944   C CE  . LYS A 1 131 ? 17.800  -11.712 0.057   1.00 59.66  ? 127  LYS A CE  1 
ATOM   945   N NZ  . LYS A 1 131 ? 17.892  -13.201 0.160   1.00 61.25  ? 127  LYS A NZ  1 
ATOM   946   N N   . THR A 1 132 ? 23.953  -8.907  1.666   1.00 51.69  ? 128  THR A N   1 
ATOM   947   C CA  . THR A 1 132 ? 24.699  -8.212  2.719   1.00 50.35  ? 128  THR A CA  1 
ATOM   948   C C   . THR A 1 132 ? 25.001  -6.771  2.331   1.00 49.82  ? 128  THR A C   1 
ATOM   949   O O   . THR A 1 132 ? 24.930  -5.873  3.169   1.00 48.79  ? 128  THR A O   1 
ATOM   950   C CB  . THR A 1 132 ? 26.016  -8.934  3.102   1.00 50.41  ? 128  THR A CB  1 
ATOM   951   O OG1 . THR A 1 132 ? 26.850  -9.062  1.949   1.00 51.61  ? 128  THR A OG1 1 
ATOM   952   C CG2 . THR A 1 132 ? 25.734  -10.311 3.681   1.00 51.17  ? 128  THR A CG2 1 
ATOM   953   N N   . PHE A 1 133 ? 25.331  -6.550  1.061   1.00 50.86  ? 129  PHE A N   1 
ATOM   954   C CA  . PHE A 1 133 ? 25.548  -5.195  0.559   1.00 50.89  ? 129  PHE A CA  1 
ATOM   955   C C   . PHE A 1 133 ? 24.265  -4.365  0.591   1.00 50.90  ? 129  PHE A C   1 
ATOM   956   O O   . PHE A 1 133 ? 24.318  -3.145  0.734   1.00 50.56  ? 129  PHE A O   1 
ATOM   957   C CB  . PHE A 1 133 ? 26.149  -5.210  -0.850  1.00 52.29  ? 129  PHE A CB  1 
ATOM   958   C CG  . PHE A 1 133 ? 27.627  -5.510  -0.883  1.00 52.28  ? 129  PHE A CG  1 
ATOM   959   C CD1 . PHE A 1 133 ? 28.115  -6.576  -1.627  1.00 53.52  ? 129  PHE A CD1 1 
ATOM   960   C CD2 . PHE A 1 133 ? 28.529  -4.727  -0.170  1.00 51.32  ? 129  PHE A CD2 1 
ATOM   961   C CE1 . PHE A 1 133 ? 29.480  -6.858  -1.662  1.00 53.79  ? 129  PHE A CE1 1 
ATOM   962   C CE2 . PHE A 1 133 ? 29.892  -5.003  -0.196  1.00 51.55  ? 129  PHE A CE2 1 
ATOM   963   C CZ  . PHE A 1 133 ? 30.369  -6.068  -0.945  1.00 52.80  ? 129  PHE A CZ  1 
ATOM   964   N N   . ARG A 1 134 ? 23.121  -5.035  0.462   1.00 51.60  ? 130  ARG A N   1 
ATOM   965   C CA  . ARG A 1 134 ? 21.813  -4.401  0.619   1.00 51.73  ? 130  ARG A CA  1 
ATOM   966   C C   . ARG A 1 134 ? 21.478  -4.190  2.094   1.00 50.32  ? 130  ARG A C   1 
ATOM   967   O O   . ARG A 1 134 ? 20.833  -3.205  2.453   1.00 50.00  ? 130  ARG A O   1 
ATOM   968   C CB  . ARG A 1 134 ? 20.725  -5.250  -0.038  1.00 53.23  ? 130  ARG A CB  1 
ATOM   969   C CG  . ARG A 1 134 ? 20.835  -5.345  -1.551  1.00 55.27  ? 130  ARG A CG  1 
ATOM   970   C CD  . ARG A 1 134 ? 19.944  -4.331  -2.255  1.00 56.51  ? 130  ARG A CD  1 
ATOM   971   N NE  . ARG A 1 134 ? 20.460  -3.981  -3.578  1.00 57.94  ? 130  ARG A NE  1 
ATOM   972   C CZ  . ARG A 1 134 ? 20.276  -4.701  -4.682  1.00 59.86  ? 130  ARG A CZ  1 
ATOM   973   N NH1 . ARG A 1 134 ? 19.583  -5.833  -4.646  1.00 60.81  ? 130  ARG A NH1 1 
ATOM   974   N NH2 . ARG A 1 134 ? 20.792  -4.288  -5.830  1.00 61.21  ? 130  ARG A NH2 1 
ATOM   975   N N   . TYR A 1 135 ? 21.916  -5.120  2.941   1.00 49.75  ? 131  TYR A N   1 
ATOM   976   C CA  . TYR A 1 135 ? 21.660  -5.046  4.382   1.00 48.57  ? 131  TYR A CA  1 
ATOM   977   C C   . TYR A 1 135 ? 22.463  -3.937  5.062   1.00 47.41  ? 131  TYR A C   1 
ATOM   978   O O   . TYR A 1 135 ? 21.941  -3.235  5.931   1.00 46.75  ? 131  TYR A O   1 
ATOM   979   C CB  . TYR A 1 135 ? 21.937  -6.395  5.065   1.00 48.56  ? 131  TYR A CB  1 
ATOM   980   C CG  . TYR A 1 135 ? 21.648  -6.407  6.553   1.00 47.63  ? 131  TYR A CG  1 
ATOM   981   C CD1 . TYR A 1 135 ? 20.348  -6.574  7.028   1.00 48.02  ? 131  TYR A CD1 1 
ATOM   982   C CD2 . TYR A 1 135 ? 22.674  -6.248  7.488   1.00 47.08  ? 131  TYR A CD2 1 
ATOM   983   C CE1 . TYR A 1 135 ? 20.073  -6.583  8.398   1.00 47.51  ? 131  TYR A CE1 1 
ATOM   984   C CE2 . TYR A 1 135 ? 22.410  -6.256  8.863   1.00 46.43  ? 131  TYR A CE2 1 
ATOM   985   C CZ  . TYR A 1 135 ? 21.107  -6.425  9.306   1.00 46.53  ? 131  TYR A CZ  1 
ATOM   986   O OH  . TYR A 1 135 ? 20.834  -6.438  10.652  1.00 46.18  ? 131  TYR A OH  1 
ATOM   987   N N   . TYR A 1 136 ? 23.729  -3.792  4.677   1.00 47.32  ? 132  TYR A N   1 
ATOM   988   C CA  . TYR A 1 136 ? 24.602  -2.803  5.303   1.00 46.29  ? 132  TYR A CA  1 
ATOM   989   C C   . TYR A 1 136 ? 24.478  -1.430  4.661   1.00 46.46  ? 132  TYR A C   1 
ATOM   990   O O   . TYR A 1 136 ? 24.866  -0.425  5.257   1.00 45.92  ? 132  TYR A O   1 
ATOM   991   C CB  . TYR A 1 136 ? 26.050  -3.294  5.347   1.00 46.32  ? 132  TYR A CB  1 
ATOM   992   C CG  . TYR A 1 136 ? 26.261  -4.350  6.404   1.00 46.16  ? 132  TYR A CG  1 
ATOM   993   C CD1 . TYR A 1 136 ? 26.410  -3.998  7.746   1.00 45.54  ? 132  TYR A CD1 1 
ATOM   994   C CD2 . TYR A 1 136 ? 26.290  -5.703  6.071   1.00 47.41  ? 132  TYR A CD2 1 
ATOM   995   C CE1 . TYR A 1 136 ? 26.595  -4.969  8.730   1.00 45.69  ? 132  TYR A CE1 1 
ATOM   996   C CE2 . TYR A 1 136 ? 26.473  -6.684  7.047   1.00 47.63  ? 132  TYR A CE2 1 
ATOM   997   C CZ  . TYR A 1 136 ? 26.624  -6.307  8.373   1.00 46.69  ? 132  TYR A CZ  1 
ATOM   998   O OH  . TYR A 1 136 ? 26.807  -7.268  9.339   1.00 47.45  ? 132  TYR A OH  1 
ATOM   999   N N   . ALA A 1 137 ? 23.919  -1.391  3.455   1.00 47.47  ? 133  ALA A N   1 
ATOM   1000  C CA  . ALA A 1 137 ? 23.539  -0.129  2.831   1.00 48.03  ? 133  ALA A CA  1 
ATOM   1001  C C   . ALA A 1 137 ? 22.486  0.549   3.702   1.00 47.43  ? 133  ALA A C   1 
ATOM   1002  O O   . ALA A 1 137 ? 22.531  1.760   3.923   1.00 47.38  ? 133  ALA A O   1 
ATOM   1003  C CB  . ALA A 1 137 ? 23.001  -0.368  1.434   1.00 49.56  ? 133  ALA A CB  1 
ATOM   1004  N N   . GLY A 1 138 ? 21.555  -0.258  4.211   1.00 47.12  ? 134  GLY A N   1 
ATOM   1005  C CA  . GLY A 1 138 ? 20.468  0.217   5.057   1.00 46.65  ? 134  GLY A CA  1 
ATOM   1006  C C   . GLY A 1 138 ? 20.915  0.763   6.398   1.00 45.34  ? 134  GLY A C   1 
ATOM   1007  O O   . GLY A 1 138 ? 20.291  1.677   6.930   1.00 45.25  ? 134  GLY A O   1 
ATOM   1008  N N   . TRP A 1 139 ? 21.998  0.210   6.943   1.00 44.55  ? 135  TRP A N   1 
ATOM   1009  C CA  . TRP A 1 139 ? 22.490  0.609   8.265   1.00 43.52  ? 135  TRP A CA  1 
ATOM   1010  C C   . TRP A 1 139 ? 23.216  1.959   8.307   1.00 43.45  ? 135  TRP A C   1 
ATOM   1011  O O   . TRP A 1 139 ? 23.214  2.632   9.341   1.00 42.92  ? 135  TRP A O   1 
ATOM   1012  C CB  . TRP A 1 139 ? 23.384  -0.486  8.873   1.00 43.10  ? 135  TRP A CB  1 
ATOM   1013  C CG  . TRP A 1 139 ? 22.671  -1.423  9.822   1.00 42.79  ? 135  TRP A CG  1 
ATOM   1014  C CD1 . TRP A 1 139 ? 22.576  -2.784  9.716   1.00 43.05  ? 135  TRP A CD1 1 
ATOM   1015  C CD2 . TRP A 1 139 ? 21.966  -1.065  11.022  1.00 42.00  ? 135  TRP A CD2 1 
ATOM   1016  N NE1 . TRP A 1 139 ? 21.849  -3.292  10.769  1.00 42.52  ? 135  TRP A NE1 1 
ATOM   1017  C CE2 . TRP A 1 139 ? 21.464  -2.260  11.584  1.00 41.86  ? 135  TRP A CE2 1 
ATOM   1018  C CE3 . TRP A 1 139 ? 21.707  0.151   11.674  1.00 41.45  ? 135  TRP A CE3 1 
ATOM   1019  C CZ2 . TRP A 1 139 ? 20.719  -2.276  12.767  1.00 41.67  ? 135  TRP A CZ2 1 
ATOM   1020  C CZ3 . TRP A 1 139 ? 20.964  0.134   12.851  1.00 40.88  ? 135  TRP A CZ3 1 
ATOM   1021  C CH2 . TRP A 1 139 ? 20.481  -1.072  13.385  1.00 41.01  ? 135  TRP A CH2 1 
ATOM   1022  N N   . ALA A 1 140 ? 23.817  2.356   7.186   1.00 44.17  ? 136  ALA A N   1 
ATOM   1023  C CA  . ALA A 1 140 ? 24.707  3.527   7.128   1.00 44.41  ? 136  ALA A CA  1 
ATOM   1024  C C   . ALA A 1 140 ? 24.243  4.767   7.916   1.00 44.27  ? 136  ALA A C   1 
ATOM   1025  O O   . ALA A 1 140 ? 25.010  5.321   8.712   1.00 44.03  ? 136  ALA A O   1 
ATOM   1026  C CB  . ALA A 1 140 ? 25.018  3.886   5.679   1.00 45.50  ? 136  ALA A CB  1 
ATOM   1027  N N   . ASP A 1 141 ? 22.999  5.191   7.696   1.00 44.64  ? 137  ASP A N   1 
ATOM   1028  C CA  . ASP A 1 141 ? 22.455  6.382   8.360   1.00 44.69  ? 137  ASP A CA  1 
ATOM   1029  C C   . ASP A 1 141 ? 21.479  6.017   9.476   1.00 43.91  ? 137  ASP A C   1 
ATOM   1030  O O   . ASP A 1 141 ? 20.500  6.728   9.726   1.00 44.30  ? 137  ASP A O   1 
ATOM   1031  C CB  . ASP A 1 141 ? 21.795  7.325   7.345   1.00 46.15  ? 137  ASP A CB  1 
ATOM   1032  C CG  . ASP A 1 141 ? 20.647  6.673   6.584   1.00 46.76  ? 137  ASP A CG  1 
ATOM   1033  O OD1 . ASP A 1 141 ? 20.632  5.432   6.435   1.00 46.40  ? 137  ASP A OD1 1 
ATOM   1034  O OD2 . ASP A 1 141 ? 19.759  7.414   6.118   1.00 47.74  ? 137  ASP A OD2 1 
ATOM   1035  N N   . LYS A 1 142 ? 21.761  4.902   10.144  1.00 43.00  ? 138  LYS A N   1 
ATOM   1036  C CA  . LYS A 1 142 ? 20.923  4.406   11.228  1.00 42.30  ? 138  LYS A CA  1 
ATOM   1037  C C   . LYS A 1 142 ? 21.764  3.978   12.429  1.00 41.53  ? 138  LYS A C   1 
ATOM   1038  O O   . LYS A 1 142 ? 21.222  3.522   13.437  1.00 41.13  ? 138  LYS A O   1 
ATOM   1039  C CB  . LYS A 1 142 ? 20.039  3.254   10.739  1.00 42.47  ? 138  LYS A CB  1 
ATOM   1040  C CG  . LYS A 1 142 ? 18.949  3.681   9.761   1.00 43.48  ? 138  LYS A CG  1 
ATOM   1041  C CD  . LYS A 1 142 ? 18.206  2.484   9.188   1.00 43.96  ? 138  LYS A CD  1 
ATOM   1042  C CE  . LYS A 1 142 ? 17.291  2.886   8.032   1.00 45.48  ? 138  LYS A CE  1 
ATOM   1043  N NZ  . LYS A 1 142 ? 18.013  3.281   6.784   1.00 46.34  ? 138  LYS A NZ  1 
ATOM   1044  N N   . ILE A 1 143 ? 23.084  4.131   12.312  1.00 41.64  ? 139  ILE A N   1 
ATOM   1045  C CA  . ILE A 1 143 ? 24.005  3.879   13.422  1.00 41.26  ? 139  ILE A CA  1 
ATOM   1046  C C   . ILE A 1 143 ? 23.907  5.041   14.410  1.00 41.31  ? 139  ILE A C   1 
ATOM   1047  O O   . ILE A 1 143 ? 24.490  6.107   14.192  1.00 41.84  ? 139  ILE A O   1 
ATOM   1048  C CB  . ILE A 1 143 ? 25.473  3.727   12.948  1.00 41.58  ? 139  ILE A CB  1 
ATOM   1049  C CG1 . ILE A 1 143 ? 25.583  2.724   11.797  1.00 41.80  ? 139  ILE A CG1 1 
ATOM   1050  C CG2 . ILE A 1 143 ? 26.364  3.298   14.108  1.00 41.54  ? 139  ILE A CG2 1 
ATOM   1051  C CD1 . ILE A 1 143 ? 26.864  2.856   10.988  1.00 42.31  ? 139  ILE A CD1 1 
ATOM   1052  N N   . HIS A 1 144 ? 23.163  4.821   15.490  1.00 40.98  ? 140  HIS A N   1 
ATOM   1053  C CA  . HIS A 1 144 ? 22.860  5.874   16.454  1.00 41.11  ? 140  HIS A CA  1 
ATOM   1054  C C   . HIS A 1 144 ? 23.724  5.799   17.715  1.00 41.03  ? 140  HIS A C   1 
ATOM   1055  O O   . HIS A 1 144 ? 24.143  4.718   18.134  1.00 40.91  ? 140  HIS A O   1 
ATOM   1056  C CB  . HIS A 1 144 ? 21.379  5.828   16.845  1.00 41.03  ? 140  HIS A CB  1 
ATOM   1057  C CG  . HIS A 1 144 ? 20.436  5.882   15.682  1.00 41.85  ? 140  HIS A CG  1 
ATOM   1058  N ND1 . HIS A 1 144 ? 19.424  4.965   15.502  1.00 42.12  ? 140  HIS A ND1 1 
ATOM   1059  C CD2 . HIS A 1 144 ? 20.350  6.744   14.641  1.00 42.97  ? 140  HIS A CD2 1 
ATOM   1060  C CE1 . HIS A 1 144 ? 18.754  5.259   14.402  1.00 43.06  ? 140  HIS A CE1 1 
ATOM   1061  N NE2 . HIS A 1 144 ? 19.297  6.334   13.859  1.00 43.56  ? 140  HIS A NE2 1 
ATOM   1062  N N   . GLY A 1 145 ? 23.991  6.962   18.306  1.00 41.36  ? 141  GLY A N   1 
ATOM   1063  C CA  . GLY A 1 145 ? 24.587  7.043   19.634  1.00 41.50  ? 141  GLY A CA  1 
ATOM   1064  C C   . GLY A 1 145 ? 23.479  7.213   20.655  1.00 41.31  ? 141  GLY A C   1 
ATOM   1065  O O   . GLY A 1 145 ? 22.365  6.728   20.447  1.00 41.06  ? 141  GLY A O   1 
ATOM   1066  N N   . MET A 1 146 ? 23.773  7.899   21.756  1.00 41.68  ? 142  MET A N   1 
ATOM   1067  C CA  . MET A 1 146 ? 22.766  8.140   22.795  1.00 41.60  ? 142  MET A CA  1 
ATOM   1068  C C   . MET A 1 146 ? 23.051  9.353   23.679  1.00 42.19  ? 142  MET A C   1 
ATOM   1069  O O   . MET A 1 146 ? 24.184  9.832   23.747  1.00 42.64  ? 142  MET A O   1 
ATOM   1070  C CB  . MET A 1 146 ? 22.537  6.884   23.652  1.00 41.46  ? 142  MET A CB  1 
ATOM   1071  C CG  . MET A 1 146 ? 23.794  6.189   24.156  1.00 42.32  ? 142  MET A CG  1 
ATOM   1072  S SD  . MET A 1 146 ? 23.396  4.706   25.110  1.00 44.06  ? 142  MET A SD  1 
ATOM   1073  C CE  . MET A 1 146 ? 22.990  3.536   23.810  1.00 43.10  ? 142  MET A CE  1 
ATOM   1074  N N   . THR A 1 147 ? 22.000  9.847   24.335  1.00 42.17  ? 143  THR A N   1 
ATOM   1075  C CA  . THR A 1 147 ? 22.097  10.962  25.283  1.00 42.77  ? 143  THR A CA  1 
ATOM   1076  C C   . THR A 1 147 ? 21.805  10.466  26.702  1.00 42.77  ? 143  THR A C   1 
ATOM   1077  O O   . THR A 1 147 ? 20.752  9.878   26.961  1.00 42.26  ? 143  THR A O   1 
ATOM   1078  C CB  . THR A 1 147 ? 21.156  12.150  24.909  1.00 43.18  ? 143  THR A CB  1 
ATOM   1079  O OG1 . THR A 1 147 ? 19.799  11.702  24.851  1.00 42.43  ? 143  THR A OG1 1 
ATOM   1080  C CG2 . THR A 1 147 ? 21.532  12.747  23.561  1.00 43.25  ? 143  THR A CG2 1 
ATOM   1081  N N   . ILE A 1 148 ? 22.748  10.706  27.610  1.00 43.49  ? 144  ILE A N   1 
ATOM   1082  C CA  . ILE A 1 148 ? 22.701  10.152  28.968  1.00 43.76  ? 144  ILE A CA  1 
ATOM   1083  C C   . ILE A 1 148 ? 22.387  11.230  30.020  1.00 44.70  ? 144  ILE A C   1 
ATOM   1084  O O   . ILE A 1 148 ? 23.042  12.276  30.050  1.00 45.56  ? 144  ILE A O   1 
ATOM   1085  C CB  . ILE A 1 148 ? 24.029  9.423   29.316  1.00 44.21  ? 144  ILE A CB  1 
ATOM   1086  C CG1 . ILE A 1 148 ? 24.497  8.577   28.128  1.00 43.29  ? 144  ILE A CG1 1 
ATOM   1087  C CG2 . ILE A 1 148 ? 23.877  8.556   30.572  1.00 44.78  ? 144  ILE A CG2 1 
ATOM   1088  C CD1 . ILE A 1 148 ? 25.977  8.297   28.116  1.00 44.51  ? 144  ILE A CD1 1 
ATOM   1089  N N   . PRO A 1 149 ? 21.377  10.977  30.881  1.00 44.67  ? 145  PRO A N   1 
ATOM   1090  C CA  . PRO A 1 149 ? 21.014  11.931  31.931  1.00 45.73  ? 145  PRO A CA  1 
ATOM   1091  C C   . PRO A 1 149 ? 21.887  11.790  33.184  1.00 46.80  ? 145  PRO A C   1 
ATOM   1092  O O   . PRO A 1 149 ? 21.406  11.371  34.239  1.00 47.40  ? 145  PRO A O   1 
ATOM   1093  C CB  . PRO A 1 149 ? 19.550  11.581  32.224  1.00 45.26  ? 145  PRO A CB  1 
ATOM   1094  C CG  . PRO A 1 149 ? 19.447  10.126  31.926  1.00 44.38  ? 145  PRO A CG  1 
ATOM   1095  C CD  . PRO A 1 149 ? 20.466  9.814   30.857  1.00 43.89  ? 145  PRO A CD  1 
ATOM   1096  N N   . VAL A 1 150 ? 23.158  12.160  33.058  1.00 47.39  ? 146  VAL A N   1 
ATOM   1097  C CA  . VAL A 1 150 ? 24.143  11.998  34.130  1.00 48.73  ? 146  VAL A CA  1 
ATOM   1098  C C   . VAL A 1 150 ? 23.921  13.021  35.248  1.00 50.15  ? 146  VAL A C   1 
ATOM   1099  O O   . VAL A 1 150 ? 23.270  14.043  35.033  1.00 50.28  ? 146  VAL A O   1 
ATOM   1100  C CB  . VAL A 1 150 ? 25.590  12.101  33.578  1.00 49.30  ? 146  VAL A CB  1 
ATOM   1101  C CG1 . VAL A 1 150 ? 26.596  11.491  34.559  1.00 50.94  ? 146  VAL A CG1 1 
ATOM   1102  C CG2 . VAL A 1 150 ? 25.692  11.399  32.233  1.00 47.56  ? 146  VAL A CG2 1 
ATOM   1103  N N   . ASP A 1 151 ? 24.454  12.729  36.435  1.00 51.51  ? 147  ASP A N   1 
ATOM   1104  C CA  . ASP A 1 151 ? 24.333  13.603  37.611  1.00 53.20  ? 147  ASP A CA  1 
ATOM   1105  C C   . ASP A 1 151 ? 24.940  14.988  37.387  1.00 54.37  ? 147  ASP A C   1 
ATOM   1106  O O   . ASP A 1 151 ? 25.843  15.152  36.565  1.00 54.42  ? 147  ASP A O   1 
ATOM   1107  C CB  . ASP A 1 151 ? 24.996  12.952  38.834  1.00 54.74  ? 147  ASP A CB  1 
ATOM   1108  C CG  . ASP A 1 151 ? 24.292  11.685  39.287  1.00 54.04  ? 147  ASP A CG  1 
ATOM   1109  O OD1 . ASP A 1 151 ? 23.154  11.424  38.840  1.00 52.57  ? 147  ASP A OD1 1 
ATOM   1110  O OD2 . ASP A 1 151 ? 24.883  10.947  40.103  1.00 54.98  ? 147  ASP A OD2 1 
ATOM   1111  N N   . GLY A 1 152 ? 24.440  15.980  38.121  1.00 55.66  ? 148  GLY A N   1 
ATOM   1112  C CA  . GLY A 1 152 ? 24.978  17.345  38.063  1.00 57.24  ? 148  GLY A CA  1 
ATOM   1113  C C   . GLY A 1 152 ? 24.555  18.127  36.832  1.00 56.31  ? 148  GLY A C   1 
ATOM   1114  O O   . GLY A 1 152 ? 23.920  17.580  35.928  1.00 54.46  ? 148  GLY A O   1 
ATOM   1115  N N   . ASP A 1 153 ? 24.916  19.408  36.793  1.00 57.88  ? 149  ASP A N   1 
ATOM   1116  C CA  . ASP A 1 153 ? 24.536  20.287  35.687  1.00 57.61  ? 149  ASP A CA  1 
ATOM   1117  C C   . ASP A 1 153 ? 25.364  20.010  34.429  1.00 56.85  ? 149  ASP A C   1 
ATOM   1118  O O   . ASP A 1 153 ? 26.218  20.808  34.037  1.00 58.23  ? 149  ASP A O   1 
ATOM   1119  C CB  . ASP A 1 153 ? 24.624  21.758  36.111  1.00 59.90  ? 149  ASP A CB  1 
ATOM   1120  C CG  . ASP A 1 153 ? 23.576  22.132  37.150  1.00 60.79  ? 149  ASP A CG  1 
ATOM   1121  O OD1 . ASP A 1 153 ? 22.464  21.559  37.116  1.00 59.17  ? 149  ASP A OD1 1 
ATOM   1122  O OD2 . ASP A 1 153 ? 23.859  23.005  38.000  1.00 63.12  ? 149  ASP A OD2 1 
ATOM   1123  N N   . TYR A 1 154 ? 25.092  18.866  33.805  1.00 54.90  ? 150  TYR A N   1 
ATOM   1124  C CA  . TYR A 1 154 ? 25.800  18.422  32.610  1.00 54.03  ? 150  TYR A CA  1 
ATOM   1125  C C   . TYR A 1 154 ? 24.840  17.781  31.613  1.00 52.11  ? 150  TYR A C   1 
ATOM   1126  O O   . TYR A 1 154 ? 23.687  17.503  31.934  1.00 51.44  ? 150  TYR A O   1 
ATOM   1127  C CB  . TYR A 1 154 ? 26.906  17.422  32.968  1.00 54.07  ? 150  TYR A CB  1 
ATOM   1128  C CG  . TYR A 1 154 ? 27.969  17.959  33.900  1.00 56.30  ? 150  TYR A CG  1 
ATOM   1129  C CD1 . TYR A 1 154 ? 29.056  18.678  33.411  1.00 57.43  ? 150  TYR A CD1 1 
ATOM   1130  C CD2 . TYR A 1 154 ? 27.890  17.740  35.274  1.00 57.48  ? 150  TYR A CD2 1 
ATOM   1131  C CE1 . TYR A 1 154 ? 30.033  19.172  34.267  1.00 59.72  ? 150  TYR A CE1 1 
ATOM   1132  C CE2 . TYR A 1 154 ? 28.862  18.230  36.137  1.00 59.82  ? 150  TYR A CE2 1 
ATOM   1133  C CZ  . TYR A 1 154 ? 29.929  18.942  35.627  1.00 60.88  ? 150  TYR A CZ  1 
ATOM   1134  O OH  . TYR A 1 154 ? 30.891  19.424  36.482  1.00 63.73  ? 150  TYR A OH  1 
ATOM   1135  N N   . PHE A 1 155 ? 25.334  17.553  30.401  1.00 51.65  ? 151  PHE A N   1 
ATOM   1136  C CA  . PHE A 1 155 ? 24.571  16.934  29.324  1.00 50.16  ? 151  PHE A CA  1 
ATOM   1137  C C   . PHE A 1 155 ? 25.550  16.151  28.452  1.00 49.49  ? 151  PHE A C   1 
ATOM   1138  O O   . PHE A 1 155 ? 26.373  16.741  27.745  1.00 50.27  ? 151  PHE A O   1 
ATOM   1139  C CB  . PHE A 1 155 ? 23.816  18.018  28.529  1.00 50.71  ? 151  PHE A CB  1 
ATOM   1140  C CG  . PHE A 1 155 ? 23.424  17.612  27.127  1.00 49.93  ? 151  PHE A CG  1 
ATOM   1141  C CD1 . PHE A 1 155 ? 22.407  16.684  26.906  1.00 49.06  ? 151  PHE A CD1 1 
ATOM   1142  C CD2 . PHE A 1 155 ? 24.058  18.187  26.024  1.00 50.73  ? 151  PHE A CD2 1 
ATOM   1143  C CE1 . PHE A 1 155 ? 22.042  16.320  25.605  1.00 48.54  ? 151  PHE A CE1 1 
ATOM   1144  C CE2 . PHE A 1 155 ? 23.704  17.829  24.721  1.00 50.09  ? 151  PHE A CE2 1 
ATOM   1145  C CZ  . PHE A 1 155 ? 22.697  16.895  24.510  1.00 48.87  ? 151  PHE A CZ  1 
ATOM   1146  N N   . THR A 1 156 ? 25.484  14.824  28.532  1.00 48.32  ? 152  THR A N   1 
ATOM   1147  C CA  . THR A 1 156 ? 26.413  13.966  27.785  1.00 47.88  ? 152  THR A CA  1 
ATOM   1148  C C   . THR A 1 156 ? 25.730  13.232  26.632  1.00 46.49  ? 152  THR A C   1 
ATOM   1149  O O   . THR A 1 156 ? 24.596  12.765  26.761  1.00 45.56  ? 152  THR A O   1 
ATOM   1150  C CB  . THR A 1 156 ? 27.173  12.941  28.692  1.00 48.02  ? 152  THR A CB  1 
ATOM   1151  O OG1 . THR A 1 156 ? 26.372  11.773  28.904  1.00 46.78  ? 152  THR A OG1 1 
ATOM   1152  C CG2 . THR A 1 156 ? 27.540  13.548  30.031  1.00 49.65  ? 152  THR A CG2 1 
ATOM   1153  N N   . PHE A 1 157 ? 26.431  13.146  25.505  1.00 46.59  ? 153  PHE A N   1 
ATOM   1154  C CA  . PHE A 1 157 ? 25.974  12.356  24.366  1.00 45.70  ? 153  PHE A CA  1 
ATOM   1155  C C   . PHE A 1 157 ? 27.114  11.551  23.742  1.00 45.86  ? 153  PHE A C   1 
ATOM   1156  O O   . PHE A 1 157 ? 28.278  11.934  23.844  1.00 46.92  ? 153  PHE A O   1 
ATOM   1157  C CB  . PHE A 1 157 ? 25.275  13.233  23.318  1.00 45.69  ? 153  PHE A CB  1 
ATOM   1158  C CG  . PHE A 1 157 ? 26.133  14.337  22.763  1.00 46.69  ? 153  PHE A CG  1 
ATOM   1159  C CD1 . PHE A 1 157 ? 27.014  14.094  21.709  1.00 46.46  ? 153  PHE A CD1 1 
ATOM   1160  C CD2 . PHE A 1 157 ? 26.039  15.626  23.274  1.00 47.76  ? 153  PHE A CD2 1 
ATOM   1161  C CE1 . PHE A 1 157 ? 27.803  15.117  21.187  1.00 47.82  ? 153  PHE A CE1 1 
ATOM   1162  C CE2 . PHE A 1 157 ? 26.820  16.657  22.759  1.00 49.21  ? 153  PHE A CE2 1 
ATOM   1163  C CZ  . PHE A 1 157 ? 27.703  16.402  21.711  1.00 49.26  ? 153  PHE A CZ  1 
ATOM   1164  N N   . THR A 1 158 ? 26.774  10.435  23.104  1.00 45.18  ? 154  THR A N   1 
ATOM   1165  C CA  . THR A 1 158 ? 27.779  9.579   22.484  1.00 45.51  ? 154  THR A CA  1 
ATOM   1166  C C   . THR A 1 158 ? 27.685  9.617   20.967  1.00 45.46  ? 154  THR A C   1 
ATOM   1167  O O   . THR A 1 158 ? 26.593  9.677   20.399  1.00 44.80  ? 154  THR A O   1 
ATOM   1168  C CB  . THR A 1 158 ? 27.698  8.107   22.971  1.00 44.92  ? 154  THR A CB  1 
ATOM   1169  O OG1 . THR A 1 158 ? 26.455  7.526   22.560  1.00 44.14  ? 154  THR A OG1 1 
ATOM   1170  C CG2 . THR A 1 158 ? 27.821  8.022   24.487  1.00 45.34  ? 154  THR A CG2 1 
ATOM   1171  N N   . ARG A 1 159 ? 28.854  9.594   20.332  1.00 46.60  ? 155  ARG A N   1 
ATOM   1172  C CA  . ARG A 1 159 ? 28.991  9.536   18.881  1.00 46.86  ? 155  ARG A CA  1 
ATOM   1173  C C   . ARG A 1 159 ? 29.563  8.185   18.471  1.00 46.49  ? 155  ARG A C   1 
ATOM   1174  O O   . ARG A 1 159 ? 30.576  7.737   19.024  1.00 47.07  ? 155  ARG A O   1 
ATOM   1175  C CB  . ARG A 1 159 ? 29.955  10.617  18.399  1.00 48.32  ? 155  ARG A CB  1 
ATOM   1176  C CG  . ARG A 1 159 ? 29.342  11.944  18.015  1.00 49.94  ? 155  ARG A CG  1 
ATOM   1177  C CD  . ARG A 1 159 ? 30.307  12.673  17.087  1.00 53.09  ? 155  ARG A CD  1 
ATOM   1178  N NE  . ARG A 1 159 ? 29.864  14.022  16.751  1.00 56.10  ? 155  ARG A NE  1 
ATOM   1179  C CZ  . ARG A 1 159 ? 30.290  14.712  15.695  1.00 58.27  ? 155  ARG A CZ  1 
ATOM   1180  N NH1 . ARG A 1 159 ? 31.173  14.175  14.859  1.00 58.73  ? 155  ARG A NH1 1 
ATOM   1181  N NH2 . ARG A 1 159 ? 29.827  15.938  15.470  1.00 59.95  ? 155  ARG A NH2 1 
ATOM   1182  N N   . HIS A 1 160 ? 28.918  7.541   17.502  1.00 45.81  ? 156  HIS A N   1 
ATOM   1183  C CA  . HIS A 1 160 ? 29.486  6.356   16.865  1.00 45.65  ? 156  HIS A CA  1 
ATOM   1184  C C   . HIS A 1 160 ? 30.281  6.778   15.632  1.00 46.20  ? 156  HIS A C   1 
ATOM   1185  O O   . HIS A 1 160 ? 29.715  7.199   14.623  1.00 46.19  ? 156  HIS A O   1 
ATOM   1186  C CB  . HIS A 1 160 ? 28.397  5.347   16.505  1.00 44.83  ? 156  HIS A CB  1 
ATOM   1187  C CG  . HIS A 1 160 ? 27.958  4.494   17.655  1.00 44.77  ? 156  HIS A CG  1 
ATOM   1188  N ND1 . HIS A 1 160 ? 28.062  3.119   17.643  1.00 44.95  ? 156  HIS A ND1 1 
ATOM   1189  C CD2 . HIS A 1 160 ? 27.417  4.821   18.853  1.00 44.82  ? 156  HIS A CD2 1 
ATOM   1190  C CE1 . HIS A 1 160 ? 27.600  2.635   18.782  1.00 45.09  ? 156  HIS A CE1 1 
ATOM   1191  N NE2 . HIS A 1 160 ? 27.203  3.647   19.534  1.00 45.04  ? 156  HIS A NE2 1 
ATOM   1192  N N   . GLU A 1 161 ? 31.600  6.675   15.738  1.00 46.91  ? 157  GLU A N   1 
ATOM   1193  C CA  . GLU A 1 161 ? 32.508  7.137   14.699  1.00 47.85  ? 157  GLU A CA  1 
ATOM   1194  C C   . GLU A 1 161 ? 33.297  5.985   14.088  1.00 47.84  ? 157  GLU A C   1 
ATOM   1195  O O   . GLU A 1 161 ? 33.490  4.958   14.738  1.00 47.63  ? 157  GLU A O   1 
ATOM   1196  C CB  . GLU A 1 161 ? 33.478  8.165   15.279  1.00 49.19  ? 157  GLU A CB  1 
ATOM   1197  C CG  . GLU A 1 161 ? 32.874  9.538   15.491  1.00 50.11  ? 157  GLU A CG  1 
ATOM   1198  C CD  . GLU A 1 161 ? 33.779  10.450  16.287  1.00 52.11  ? 157  GLU A CD  1 
ATOM   1199  O OE1 . GLU A 1 161 ? 34.699  9.939   16.963  1.00 52.62  ? 157  GLU A OE1 1 
ATOM   1200  O OE2 . GLU A 1 161 ? 33.565  11.680  16.242  1.00 53.34  ? 157  GLU A OE2 1 
ATOM   1201  N N   . PRO A 1 162 ? 33.763  6.151   12.834  1.00 48.25  ? 158  PRO A N   1 
ATOM   1202  C CA  . PRO A 1 162 ? 34.669  5.170   12.242  1.00 48.64  ? 158  PRO A CA  1 
ATOM   1203  C C   . PRO A 1 162 ? 35.958  5.041   13.052  1.00 49.57  ? 158  PRO A C   1 
ATOM   1204  O O   . PRO A 1 162 ? 36.343  5.985   13.747  1.00 50.31  ? 158  PRO A O   1 
ATOM   1205  C CB  . PRO A 1 162 ? 34.977  5.761   10.858  1.00 49.38  ? 158  PRO A CB  1 
ATOM   1206  C CG  . PRO A 1 162 ? 34.579  7.191   10.938  1.00 49.66  ? 158  PRO A CG  1 
ATOM   1207  C CD  . PRO A 1 162 ? 33.428  7.222   11.880  1.00 48.67  ? 158  PRO A CD  1 
ATOM   1208  N N   . ILE A 1 163 ? 36.606  3.882   12.965  1.00 49.66  ? 159  ILE A N   1 
ATOM   1209  C CA  . ILE A 1 163 ? 37.878  3.651   13.649  1.00 50.78  ? 159  ILE A CA  1 
ATOM   1210  C C   . ILE A 1 163 ? 39.019  4.319   12.886  1.00 52.09  ? 159  ILE A C   1 
ATOM   1211  O O   . ILE A 1 163 ? 39.798  5.081   13.462  1.00 53.33  ? 159  ILE A O   1 
ATOM   1212  C CB  . ILE A 1 163 ? 38.171  2.139   13.828  1.00 50.97  ? 159  ILE A CB  1 
ATOM   1213  C CG1 . ILE A 1 163 ? 37.029  1.466   14.598  1.00 49.70  ? 159  ILE A CG1 1 
ATOM   1214  C CG2 . ILE A 1 163 ? 39.522  1.926   14.529  1.00 52.65  ? 159  ILE A CG2 1 
ATOM   1215  C CD1 . ILE A 1 163 ? 37.050  -0.044  14.557  1.00 49.70  ? 159  ILE A CD1 1 
ATOM   1216  N N   . GLY A 1 164 ? 39.101  4.025   11.591  1.00 52.02  ? 160  GLY A N   1 
ATOM   1217  C CA  . GLY A 1 164 ? 40.153  4.547   10.727  1.00 53.26  ? 160  GLY A CA  1 
ATOM   1218  C C   . GLY A 1 164 ? 40.500  3.573   9.620   1.00 53.42  ? 160  GLY A C   1 
ATOM   1219  O O   . GLY A 1 164 ? 39.614  3.059   8.926   1.00 52.31  ? 160  GLY A O   1 
ATOM   1220  N N   . VAL A 1 165 ? 41.796  3.325   9.456   1.00 54.84  ? 161  VAL A N   1 
ATOM   1221  C CA  . VAL A 1 165 ? 42.277  2.348   8.491   1.00 55.27  ? 161  VAL A CA  1 
ATOM   1222  C C   . VAL A 1 165 ? 42.092  0.951   9.083   1.00 54.72  ? 161  VAL A C   1 
ATOM   1223  O O   . VAL A 1 165 ? 42.564  0.667   10.187  1.00 55.23  ? 161  VAL A O   1 
ATOM   1224  C CB  . VAL A 1 165 ? 43.755  2.609   8.095   1.00 57.44  ? 161  VAL A CB  1 
ATOM   1225  C CG1 . VAL A 1 165 ? 44.214  1.623   7.023   1.00 58.06  ? 161  VAL A CG1 1 
ATOM   1226  C CG2 . VAL A 1 165 ? 43.933  4.040   7.600   1.00 58.05  ? 161  VAL A CG2 1 
ATOM   1227  N N   . CYS A 1 166 ? 41.382  0.097   8.349   1.00 53.83  ? 162  CYS A N   1 
ATOM   1228  C CA  . CYS A 1 166 ? 41.071  -1.257  8.801   1.00 53.47  ? 162  CYS A CA  1 
ATOM   1229  C C   . CYS A 1 166 ? 41.751  -2.328  7.959   1.00 54.43  ? 162  CYS A C   1 
ATOM   1230  O O   . CYS A 1 166 ? 41.446  -2.492  6.776   1.00 54.41  ? 162  CYS A O   1 
ATOM   1231  C CB  . CYS A 1 166 ? 39.562  -1.490  8.786   1.00 51.71  ? 162  CYS A CB  1 
ATOM   1232  S SG  . CYS A 1 166 ? 38.645  -0.458  9.925   1.00 51.26  ? 162  CYS A SG  1 
ATOM   1233  N N   . GLY A 1 167 ? 42.674  -3.055  8.577   1.00 55.52  ? 163  GLY A N   1 
ATOM   1234  C CA  . GLY A 1 167 ? 43.288  -4.209  7.940   1.00 56.58  ? 163  GLY A CA  1 
ATOM   1235  C C   . GLY A 1 167 ? 42.341  -5.389  7.983   1.00 55.70  ? 163  GLY A C   1 
ATOM   1236  O O   . GLY A 1 167 ? 41.734  -5.669  9.016   1.00 55.07  ? 163  GLY A O   1 
ATOM   1237  N N   . GLN A 1 168 ? 42.202  -6.077  6.856   1.00 55.86  ? 164  GLN A N   1 
ATOM   1238  C CA  . GLN A 1 168 ? 41.335  -7.244  6.773   1.00 55.35  ? 164  GLN A CA  1 
ATOM   1239  C C   . GLN A 1 168 ? 42.030  -8.392  6.050   1.00 57.07  ? 164  GLN A C   1 
ATOM   1240  O O   . GLN A 1 168 ? 42.606  -8.206  4.977   1.00 57.85  ? 164  GLN A O   1 
ATOM   1241  C CB  . GLN A 1 168 ? 40.021  -6.888  6.076   1.00 53.76  ? 164  GLN A CB  1 
ATOM   1242  C CG  . GLN A 1 168 ? 39.044  -6.096  6.938   1.00 51.99  ? 164  GLN A CG  1 
ATOM   1243  C CD  . GLN A 1 168 ? 37.850  -5.571  6.156   1.00 50.56  ? 164  GLN A CD  1 
ATOM   1244  O OE1 . GLN A 1 168 ? 37.709  -5.833  4.962   1.00 50.97  ? 164  GLN A OE1 1 
ATOM   1245  N NE2 . GLN A 1 168 ? 36.989  -4.817  6.828   1.00 48.98  ? 164  GLN A NE2 1 
ATOM   1246  N N   . ILE A 1 169 ? 41.983  -9.575  6.654   1.00 57.82  ? 165  ILE A N   1 
ATOM   1247  C CA  . ILE A 1 169 ? 42.575  -10.773 6.070   1.00 59.73  ? 165  ILE A CA  1 
ATOM   1248  C C   . ILE A 1 169 ? 41.551  -11.906 6.093   1.00 59.64  ? 165  ILE A C   1 
ATOM   1249  O O   . ILE A 1 169 ? 41.072  -12.295 7.160   1.00 59.46  ? 165  ILE A O   1 
ATOM   1250  C CB  . ILE A 1 169 ? 43.883  -11.188 6.809   1.00 61.83  ? 165  ILE A CB  1 
ATOM   1251  C CG1 . ILE A 1 169 ? 44.971  -10.121 6.626   1.00 62.34  ? 165  ILE A CG1 1 
ATOM   1252  C CG2 . ILE A 1 169 ? 44.395  -12.536 6.305   1.00 64.06  ? 165  ILE A CG2 1 
ATOM   1253  C CD1 . ILE A 1 169 ? 46.112  -10.200 7.628   1.00 63.77  ? 165  ILE A CD1 1 
ATOM   1254  N N   . ILE A 1 170 ? 41.208  -12.417 4.913   1.00 60.02  ? 166  ILE A N   1 
ATOM   1255  C CA  . ILE A 1 170 ? 40.228  -13.500 4.792   1.00 60.32  ? 166  ILE A CA  1 
ATOM   1256  C C   . ILE A 1 170 ? 40.825  -14.773 4.169   1.00 62.77  ? 166  ILE A C   1 
ATOM   1257  O O   . ILE A 1 170 ? 41.823  -14.698 3.442   1.00 63.93  ? 166  ILE A O   1 
ATOM   1258  C CB  . ILE A 1 170 ? 38.944  -13.066 4.010   1.00 58.73  ? 166  ILE A CB  1 
ATOM   1259  C CG1 . ILE A 1 170 ? 39.218  -12.873 2.505   1.00 59.31  ? 166  ILE A CG1 1 
ATOM   1260  C CG2 . ILE A 1 170 ? 38.279  -11.854 4.674   1.00 56.84  ? 166  ILE A CG2 1 
ATOM   1261  C CD1 . ILE A 1 170 ? 39.684  -11.489 2.093   1.00 58.60  ? 166  ILE A CD1 1 
ATOM   1262  N N   . PRO A 1 171 ? 40.219  -15.947 4.459   1.00 63.69  ? 167  PRO A N   1 
ATOM   1263  C CA  . PRO A 1 171 ? 40.704  -17.202 3.887   1.00 66.12  ? 167  PRO A CA  1 
ATOM   1264  C C   . PRO A 1 171 ? 40.226  -17.446 2.447   1.00 66.47  ? 167  PRO A C   1 
ATOM   1265  O O   . PRO A 1 171 ? 39.861  -16.500 1.739   1.00 65.01  ? 167  PRO A O   1 
ATOM   1266  C CB  . PRO A 1 171 ? 40.127  -18.254 4.837   1.00 66.94  ? 167  PRO A CB  1 
ATOM   1267  C CG  . PRO A 1 171 ? 38.871  -17.652 5.331   1.00 64.54  ? 167  PRO A CG  1 
ATOM   1268  C CD  . PRO A 1 171 ? 39.123  -16.176 5.423   1.00 62.70  ? 167  PRO A CD  1 
ATOM   1269  N N   . TRP A 1 172 ? 40.249  -18.712 2.034   1.00 68.61  ? 168  TRP A N   1 
ATOM   1270  C CA  . TRP A 1 172 ? 39.855  -19.138 0.690   1.00 69.50  ? 168  TRP A CA  1 
ATOM   1271  C C   . TRP A 1 172 ? 38.506  -19.862 0.698   1.00 69.61  ? 168  TRP A C   1 
ATOM   1272  O O   . TRP A 1 172 ? 38.035  -20.331 -0.343  1.00 70.40  ? 168  TRP A O   1 
ATOM   1273  C CB  . TRP A 1 172 ? 40.936  -20.053 0.101   1.00 72.18  ? 168  TRP A CB  1 
ATOM   1274  C CG  . TRP A 1 172 ? 41.503  -21.024 1.103   1.00 73.98  ? 168  TRP A CG  1 
ATOM   1275  C CD1 . TRP A 1 172 ? 42.647  -20.872 1.835   1.00 74.75  ? 168  TRP A CD1 1 
ATOM   1276  C CD2 . TRP A 1 172 ? 40.941  -22.281 1.497   1.00 75.45  ? 168  TRP A CD2 1 
ATOM   1277  N NE1 . TRP A 1 172 ? 42.836  -21.959 2.653   1.00 76.63  ? 168  TRP A NE1 1 
ATOM   1278  C CE2 . TRP A 1 172 ? 41.803  -22.839 2.466   1.00 77.14  ? 168  TRP A CE2 1 
ATOM   1279  C CE3 . TRP A 1 172 ? 39.793  -22.993 1.122   1.00 75.64  ? 168  TRP A CE3 1 
ATOM   1280  C CZ2 . TRP A 1 172 ? 41.555  -24.076 3.068   1.00 79.25  ? 168  TRP A CZ2 1 
ATOM   1281  C CZ3 . TRP A 1 172 ? 39.546  -24.221 1.723   1.00 77.62  ? 168  TRP A CZ3 1 
ATOM   1282  C CH2 . TRP A 1 172 ? 40.424  -24.750 2.684   1.00 79.42  ? 168  TRP A CH2 1 
ATOM   1283  N N   . ASN A 1 173 ? 37.898  -19.936 1.882   1.00 69.05  ? 169  ASN A N   1 
ATOM   1284  C CA  . ASN A 1 173 ? 36.651  -20.668 2.118   1.00 69.48  ? 169  ASN A CA  1 
ATOM   1285  C C   . ASN A 1 173 ? 35.484  -20.171 1.268   1.00 68.25  ? 169  ASN A C   1 
ATOM   1286  O O   . ASN A 1 173 ? 34.912  -20.923 0.477   1.00 69.63  ? 169  ASN A O   1 
ATOM   1287  C CB  . ASN A 1 173 ? 36.278  -20.613 3.606   1.00 68.76  ? 169  ASN A CB  1 
ATOM   1288  C CG  . ASN A 1 173 ? 37.138  -21.530 4.468   1.00 71.35  ? 169  ASN A CG  1 
ATOM   1289  O OD1 . ASN A 1 173 ? 36.633  -22.476 5.070   1.00 73.36  ? 169  ASN A OD1 1 
ATOM   1290  N ND2 . ASN A 1 173 ? 38.437  -21.250 4.536   1.00 72.21  ? 169  ASN A ND2 1 
ATOM   1291  N N   . PHE A 1 174 ? 35.135  -18.901 1.444   1.00 65.96  ? 170  PHE A N   1 
ATOM   1292  C CA  . PHE A 1 174 ? 34.087  -18.263 0.658   1.00 64.81  ? 170  PHE A CA  1 
ATOM   1293  C C   . PHE A 1 174 ? 34.620  -16.912 0.178   1.00 63.35  ? 170  PHE A C   1 
ATOM   1294  O O   . PHE A 1 174 ? 34.163  -15.863 0.639   1.00 61.57  ? 170  PHE A O   1 
ATOM   1295  C CB  . PHE A 1 174 ? 32.817  -18.082 1.496   1.00 63.54  ? 170  PHE A CB  1 
ATOM   1296  C CG  . PHE A 1 174 ? 32.252  -19.367 2.044   1.00 65.35  ? 170  PHE A CG  1 
ATOM   1297  C CD1 . PHE A 1 174 ? 31.344  -20.117 1.303   1.00 67.01  ? 170  PHE A CD1 1 
ATOM   1298  C CD2 . PHE A 1 174 ? 32.615  -19.820 3.309   1.00 65.93  ? 170  PHE A CD2 1 
ATOM   1299  C CE1 . PHE A 1 174 ? 30.814  -21.301 1.809   1.00 68.74  ? 170  PHE A CE1 1 
ATOM   1300  C CE2 . PHE A 1 174 ? 32.092  -21.004 3.820   1.00 67.64  ? 170  PHE A CE2 1 
ATOM   1301  C CZ  . PHE A 1 174 ? 31.190  -21.744 3.070   1.00 69.07  ? 170  PHE A CZ  1 
ATOM   1302  N N   . PRO A 1 175 ? 35.591  -16.939 -0.758  1.00 64.30  ? 171  PRO A N   1 
ATOM   1303  C CA  . PRO A 1 175 ? 36.395  -15.777 -1.156  1.00 63.44  ? 171  PRO A CA  1 
ATOM   1304  C C   . PRO A 1 175 ? 35.607  -14.468 -1.282  1.00 61.43  ? 171  PRO A C   1 
ATOM   1305  O O   . PRO A 1 175 ? 36.022  -13.444 -0.732  1.00 60.04  ? 171  PRO A O   1 
ATOM   1306  C CB  . PRO A 1 175 ? 36.956  -16.198 -2.516  1.00 65.20  ? 171  PRO A CB  1 
ATOM   1307  C CG  . PRO A 1 175 ? 37.043  -17.665 -2.428  1.00 67.16  ? 171  PRO A CG  1 
ATOM   1308  C CD  . PRO A 1 175 ? 35.881  -18.111 -1.604  1.00 66.57  ? 171  PRO A CD  1 
ATOM   1309  N N   . LEU A 1 176 ? 34.479  -14.520 -1.986  1.00 61.32  ? 172  LEU A N   1 
ATOM   1310  C CA  . LEU A 1 176 ? 33.672  -13.336 -2.257  1.00 59.87  ? 172  LEU A CA  1 
ATOM   1311  C C   . LEU A 1 176 ? 32.718  -13.003 -1.113  1.00 58.28  ? 172  LEU A C   1 
ATOM   1312  O O   . LEU A 1 176 ? 32.531  -11.830 -0.784  1.00 56.77  ? 172  LEU A O   1 
ATOM   1313  C CB  . LEU A 1 176 ? 32.902  -13.509 -3.570  1.00 60.96  ? 172  LEU A CB  1 
ATOM   1314  C CG  . LEU A 1 176 ? 32.184  -12.303 -4.183  1.00 60.03  ? 172  LEU A CG  1 
ATOM   1315  C CD1 . LEU A 1 176 ? 33.131  -11.134 -4.397  1.00 59.27  ? 172  LEU A CD1 1 
ATOM   1316  C CD2 . LEU A 1 176 ? 31.537  -12.705 -5.492  1.00 61.66  ? 172  LEU A CD2 1 
ATOM   1317  N N   . LEU A 1 177 ? 32.110  -14.030 -0.521  1.00 58.71  ? 173  LEU A N   1 
ATOM   1318  C CA  . LEU A 1 177 ? 31.270  -13.844 0.662   1.00 57.42  ? 173  LEU A CA  1 
ATOM   1319  C C   . LEU A 1 177 ? 32.079  -13.255 1.808   1.00 56.40  ? 173  LEU A C   1 
ATOM   1320  O O   . LEU A 1 177 ? 31.647  -12.295 2.445   1.00 54.93  ? 173  LEU A O   1 
ATOM   1321  C CB  . LEU A 1 177 ? 30.622  -15.157 1.105   1.00 58.47  ? 173  LEU A CB  1 
ATOM   1322  C CG  . LEU A 1 177 ? 29.141  -15.411 0.823   1.00 58.57  ? 173  LEU A CG  1 
ATOM   1323  C CD1 . LEU A 1 177 ? 28.783  -16.831 1.218   1.00 60.15  ? 173  LEU A CD1 1 
ATOM   1324  C CD2 . LEU A 1 177 ? 28.252  -14.421 1.567   1.00 56.79  ? 173  LEU A CD2 1 
ATOM   1325  N N   . MET A 1 178 ? 33.252  -13.833 2.057   1.00 57.44  ? 174  MET A N   1 
ATOM   1326  C CA  . MET A 1 178 ? 34.162  -13.337 3.083   1.00 57.02  ? 174  MET A CA  1 
ATOM   1327  C C   . MET A 1 178 ? 34.573  -11.895 2.813   1.00 55.75  ? 174  MET A C   1 
ATOM   1328  O O   . MET A 1 178 ? 34.696  -11.090 3.739   1.00 54.67  ? 174  MET A O   1 
ATOM   1329  C CB  . MET A 1 178 ? 35.402  -14.230 3.189   1.00 58.92  ? 174  MET A CB  1 
ATOM   1330  C CG  . MET A 1 178 ? 35.179  -15.544 3.927   1.00 60.93  ? 174  MET A CG  1 
ATOM   1331  S SD  . MET A 1 178 ? 34.284  -15.358 5.486   1.00 61.87  ? 174  MET A SD  1 
ATOM   1332  C CE  . MET A 1 178 ? 35.353  -14.243 6.401   1.00 60.95  ? 174  MET A CE  1 
ATOM   1333  N N   . PHE A 1 179 ? 34.780  -11.585 1.536   1.00 56.18  ? 175  PHE A N   1 
ATOM   1334  C CA  . PHE A 1 179 ? 35.082  -10.230 1.092   1.00 55.28  ? 175  PHE A CA  1 
ATOM   1335  C C   . PHE A 1 179 ? 33.916  -9.318  1.447   1.00 53.63  ? 175  PHE A C   1 
ATOM   1336  O O   . PHE A 1 179 ? 34.112  -8.258  2.040   1.00 52.59  ? 175  PHE A O   1 
ATOM   1337  C CB  . PHE A 1 179 ? 35.349  -10.216 -0.419  1.00 56.40  ? 175  PHE A CB  1 
ATOM   1338  C CG  . PHE A 1 179 ? 35.898  -8.913  -0.936  1.00 56.09  ? 175  PHE A CG  1 
ATOM   1339  C CD1 . PHE A 1 179 ? 35.052  -7.961  -1.500  1.00 55.45  ? 175  PHE A CD1 1 
ATOM   1340  C CD2 . PHE A 1 179 ? 37.263  -8.643  -0.873  1.00 56.59  ? 175  PHE A CD2 1 
ATOM   1341  C CE1 . PHE A 1 179 ? 35.555  -6.754  -1.985  1.00 55.38  ? 175  PHE A CE1 1 
ATOM   1342  C CE2 . PHE A 1 179 ? 37.776  -7.439  -1.353  1.00 56.51  ? 175  PHE A CE2 1 
ATOM   1343  C CZ  . PHE A 1 179 ? 36.921  -6.493  -1.910  1.00 56.03  ? 175  PHE A CZ  1 
ATOM   1344  N N   . ALA A 1 180 ? 32.706  -9.763  1.103   1.00 53.57  ? 176  ALA A N   1 
ATOM   1345  C CA  . ALA A 1 180 ? 31.476  -9.011  1.350   1.00 52.31  ? 176  ALA A CA  1 
ATOM   1346  C C   . ALA A 1 180 ? 31.196  -8.816  2.837   1.00 51.04  ? 176  ALA A C   1 
ATOM   1347  O O   . ALA A 1 180 ? 30.905  -7.705  3.270   1.00 49.95  ? 176  ALA A O   1 
ATOM   1348  C CB  . ALA A 1 180 ? 30.294  -9.692  0.668   1.00 52.99  ? 176  ALA A CB  1 
ATOM   1349  N N   . TRP A 1 181 ? 31.300  -9.896  3.610   1.00 51.47  ? 177  TRP A N   1 
ATOM   1350  C CA  . TRP A 1 181 ? 31.062  -9.865  5.055   1.00 50.57  ? 177  TRP A CA  1 
ATOM   1351  C C   . TRP A 1 181 ? 32.027  -8.965  5.828   1.00 49.81  ? 177  TRP A C   1 
ATOM   1352  O O   . TRP A 1 181 ? 31.735  -8.568  6.958   1.00 48.91  ? 177  TRP A O   1 
ATOM   1353  C CB  . TRP A 1 181 ? 31.120  -11.279 5.636   1.00 51.74  ? 177  TRP A CB  1 
ATOM   1354  C CG  . TRP A 1 181 ? 29.890  -12.106 5.395   1.00 52.89  ? 177  TRP A CG  1 
ATOM   1355  C CD1 . TRP A 1 181 ? 28.641  -11.653 5.069   1.00 52.56  ? 177  TRP A CD1 1 
ATOM   1356  C CD2 . TRP A 1 181 ? 29.782  -13.530 5.507   1.00 55.00  ? 177  TRP A CD2 1 
ATOM   1357  N NE1 . TRP A 1 181 ? 27.769  -12.709 4.950   1.00 53.78  ? 177  TRP A NE1 1 
ATOM   1358  C CE2 . TRP A 1 181 ? 28.442  -13.872 5.216   1.00 55.21  ? 177  TRP A CE2 1 
ATOM   1359  C CE3 . TRP A 1 181 ? 30.690  -14.553 5.817   1.00 57.00  ? 177  TRP A CE3 1 
ATOM   1360  C CZ2 . TRP A 1 181 ? 27.985  -15.194 5.224   1.00 57.10  ? 177  TRP A CZ2 1 
ATOM   1361  C CZ3 . TRP A 1 181 ? 30.234  -15.871 5.827   1.00 58.90  ? 177  TRP A CZ3 1 
ATOM   1362  C CH2 . TRP A 1 181 ? 28.893  -16.177 5.532   1.00 58.86  ? 177  TRP A CH2 1 
ATOM   1363  N N   . LYS A 1 182 ? 33.171  -8.651  5.224   1.00 50.23  ? 178  LYS A N   1 
ATOM   1364  C CA  . LYS A 1 182 ? 34.174  -7.816  5.875   1.00 49.90  ? 178  LYS A CA  1 
ATOM   1365  C C   . LYS A 1 182 ? 34.216  -6.389  5.340   1.00 49.13  ? 178  LYS A C   1 
ATOM   1366  O O   . LYS A 1 182 ? 34.427  -5.446  6.103   1.00 48.53  ? 178  LYS A O   1 
ATOM   1367  C CB  . LYS A 1 182 ? 35.559  -8.467  5.802   1.00 51.40  ? 178  LYS A CB  1 
ATOM   1368  C CG  . LYS A 1 182 ? 35.716  -9.634  6.761   1.00 52.37  ? 178  LYS A CG  1 
ATOM   1369  C CD  . LYS A 1 182 ? 37.115  -9.697  7.365   1.00 53.59  ? 178  LYS A CD  1 
ATOM   1370  C CE  . LYS A 1 182 ? 37.081  -10.214 8.807   1.00 53.73  ? 178  LYS A CE  1 
ATOM   1371  N NZ  . LYS A 1 182 ? 36.240  -11.431 8.993   1.00 54.09  ? 178  LYS A NZ  1 
ATOM   1372  N N   . ILE A 1 183 ? 34.023  -6.237  4.033   1.00 49.30  ? 179  ILE A N   1 
ATOM   1373  C CA  . ILE A 1 183 ? 34.003  -4.922  3.398   1.00 48.88  ? 179  ILE A CA  1 
ATOM   1374  C C   . ILE A 1 183 ? 32.762  -4.129  3.817   1.00 47.67  ? 179  ILE A C   1 
ATOM   1375  O O   . ILE A 1 183 ? 32.875  -2.987  4.269   1.00 47.18  ? 179  ILE A O   1 
ATOM   1376  C CB  . ILE A 1 183 ? 34.109  -5.048  1.844   1.00 49.98  ? 179  ILE A CB  1 
ATOM   1377  C CG1 . ILE A 1 183 ? 35.546  -5.386  1.425   1.00 51.31  ? 179  ILE A CG1 1 
ATOM   1378  C CG2 . ILE A 1 183 ? 33.601  -3.803  1.121   1.00 49.57  ? 179  ILE A CG2 1 
ATOM   1379  C CD1 . ILE A 1 183 ? 36.595  -4.345  1.804   1.00 51.56  ? 179  ILE A CD1 1 
ATOM   1380  N N   . ALA A 1 184 ? 31.591  -4.754  3.693   1.00 47.32  ? 180  ALA A N   1 
ATOM   1381  C CA  . ALA A 1 184 ? 30.306  -4.081  3.903   1.00 46.39  ? 180  ALA A CA  1 
ATOM   1382  C C   . ALA A 1 184 ? 30.174  -3.326  5.234   1.00 45.21  ? 180  ALA A C   1 
ATOM   1383  O O   . ALA A 1 184 ? 29.852  -2.138  5.222   1.00 44.85  ? 180  ALA A O   1 
ATOM   1384  C CB  . ALA A 1 184 ? 29.137  -5.053  3.702   1.00 46.59  ? 180  ALA A CB  1 
ATOM   1385  N N   . PRO A 1 185 ? 30.429  -3.999  6.378   1.00 44.78  ? 181  PRO A N   1 
ATOM   1386  C CA  . PRO A 1 185 ? 30.251  -3.289  7.645   1.00 43.82  ? 181  PRO A CA  1 
ATOM   1387  C C   . PRO A 1 185 ? 31.259  -2.160  7.823   1.00 43.84  ? 181  PRO A C   1 
ATOM   1388  O O   . PRO A 1 185 ? 30.894  -1.089  8.307   1.00 43.38  ? 181  PRO A O   1 
ATOM   1389  C CB  . PRO A 1 185 ? 30.482  -4.377  8.705   1.00 43.90  ? 181  PRO A CB  1 
ATOM   1390  C CG  . PRO A 1 185 ? 30.404  -5.671  7.978   1.00 44.89  ? 181  PRO A CG  1 
ATOM   1391  C CD  . PRO A 1 185 ? 30.884  -5.382  6.598   1.00 45.51  ? 181  PRO A CD  1 
ATOM   1392  N N   . ALA A 1 186 ? 32.505  -2.401  7.419   1.00 44.62  ? 182  ALA A N   1 
ATOM   1393  C CA  . ALA A 1 186 ? 33.588  -1.431  7.587   1.00 44.97  ? 182  ALA A CA  1 
ATOM   1394  C C   . ALA A 1 186 ? 33.259  -0.102  6.917   1.00 44.96  ? 182  ALA A C   1 
ATOM   1395  O O   . ALA A 1 186 ? 33.447  0.966   7.505   1.00 44.81  ? 182  ALA A O   1 
ATOM   1396  C CB  . ALA A 1 186 ? 34.890  -1.995  7.040   1.00 46.08  ? 182  ALA A CB  1 
ATOM   1397  N N   . LEU A 1 187 ? 32.753  -0.184  5.689   1.00 45.36  ? 183  LEU A N   1 
ATOM   1398  C CA  . LEU A 1 187 ? 32.409  0.994   4.904   1.00 45.65  ? 183  LEU A CA  1 
ATOM   1399  C C   . LEU A 1 187 ? 31.137  1.635   5.428   1.00 44.92  ? 183  LEU A C   1 
ATOM   1400  O O   . LEU A 1 187 ? 30.999  2.860   5.414   1.00 45.23  ? 183  LEU A O   1 
ATOM   1401  C CB  . LEU A 1 187 ? 32.239  0.625   3.434   1.00 46.44  ? 183  LEU A CB  1 
ATOM   1402  C CG  . LEU A 1 187 ? 33.419  -0.023  2.715   1.00 47.10  ? 183  LEU A CG  1 
ATOM   1403  C CD1 . LEU A 1 187 ? 33.011  -0.309  1.296   1.00 48.10  ? 183  LEU A CD1 1 
ATOM   1404  C CD2 . LEU A 1 187 ? 34.644  0.867   2.744   1.00 47.55  ? 183  LEU A CD2 1 
ATOM   1405  N N   . CYS A 1 188 ? 30.217  0.794   5.893   1.00 44.22  ? 184  CYS A N   1 
ATOM   1406  C CA  . CYS A 1 188 ? 28.962  1.243   6.486   1.00 43.47  ? 184  CYS A CA  1 
ATOM   1407  C C   . CYS A 1 188 ? 29.212  2.212   7.639   1.00 43.01  ? 184  CYS A C   1 
ATOM   1408  O O   . CYS A 1 188 ? 28.400  3.105   7.892   1.00 42.80  ? 184  CYS A O   1 
ATOM   1409  C CB  . CYS A 1 188 ? 28.157  0.037   6.967   1.00 42.90  ? 184  CYS A CB  1 
ATOM   1410  S SG  . CYS A 1 188 ? 26.621  0.424   7.799   1.00 42.23  ? 184  CYS A SG  1 
ATOM   1411  N N   . CYS A 1 189 ? 30.346  2.036   8.319   1.00 43.01  ? 185  CYS A N   1 
ATOM   1412  C CA  . CYS A 1 189 ? 30.720  2.871   9.459   1.00 42.79  ? 185  CYS A CA  1 
ATOM   1413  C C   . CYS A 1 189 ? 31.699  3.992   9.098   1.00 43.70  ? 185  CYS A C   1 
ATOM   1414  O O   . CYS A 1 189 ? 32.125  4.754   9.965   1.00 43.84  ? 185  CYS A O   1 
ATOM   1415  C CB  . CYS A 1 189 ? 31.291  2.006   10.580  1.00 42.52  ? 185  CYS A CB  1 
ATOM   1416  S SG  . CYS A 1 189 ? 30.129  0.780   11.191  1.00 41.95  ? 185  CYS A SG  1 
ATOM   1417  N N   . GLY A 1 190 ? 32.046  4.092   7.821   1.00 44.46  ? 186  GLY A N   1 
ATOM   1418  C CA  . GLY A 1 190 ? 32.878  5.189   7.339   1.00 45.65  ? 186  GLY A CA  1 
ATOM   1419  C C   . GLY A 1 190 ? 34.375  4.944   7.401   1.00 46.54  ? 186  GLY A C   1 
ATOM   1420  O O   . GLY A 1 190 ? 35.159  5.893   7.358   1.00 47.60  ? 186  GLY A O   1 
ATOM   1421  N N   . ASN A 1 191 ? 34.775  3.678   7.492   1.00 46.24  ? 187  ASN A N   1 
ATOM   1422  C CA  . ASN A 1 191 ? 36.189  3.321   7.507   1.00 47.23  ? 187  ASN A CA  1 
ATOM   1423  C C   . ASN A 1 191 ? 36.799  3.260   6.112   1.00 48.30  ? 187  ASN A C   1 
ATOM   1424  O O   . ASN A 1 191 ? 36.081  3.274   5.112   1.00 48.20  ? 187  ASN A O   1 
ATOM   1425  C CB  . ASN A 1 191 ? 36.395  1.986   8.218   1.00 46.91  ? 187  ASN A CB  1 
ATOM   1426  C CG  . ASN A 1 191 ? 36.110  2.069   9.701   1.00 46.46  ? 187  ASN A CG  1 
ATOM   1427  O OD1 . ASN A 1 191 ? 36.899  2.621   10.471  1.00 47.10  ? 187  ASN A OD1 1 
ATOM   1428  N ND2 . ASN A 1 191 ? 34.977  1.514   10.113  1.00 45.62  ? 187  ASN A ND2 1 
ATOM   1429  N N   . THR A 1 192 ? 38.130  3.217   6.062   1.00 49.41  ? 188  THR A N   1 
ATOM   1430  C CA  . THR A 1 192 ? 38.862  2.909   4.836   1.00 50.50  ? 188  THR A CA  1 
ATOM   1431  C C   . THR A 1 192 ? 39.525  1.550   5.010   1.00 50.64  ? 188  THR A C   1 
ATOM   1432  O O   . THR A 1 192 ? 40.098  1.261   6.064   1.00 50.72  ? 188  THR A O   1 
ATOM   1433  C CB  . THR A 1 192 ? 39.919  3.977   4.490   1.00 52.12  ? 188  THR A CB  1 
ATOM   1434  O OG1 . THR A 1 192 ? 40.735  4.240   5.636   1.00 52.68  ? 188  THR A OG1 1 
ATOM   1435  C CG2 . THR A 1 192 ? 39.252  5.269   4.043   1.00 52.35  ? 188  THR A CG2 1 
ATOM   1436  N N   . VAL A 1 193 ? 39.438  0.716   3.978   1.00 50.84  ? 189  VAL A N   1 
ATOM   1437  C CA  . VAL A 1 193 ? 39.816  -0.694  4.098   1.00 50.94  ? 189  VAL A CA  1 
ATOM   1438  C C   . VAL A 1 193 ? 41.033  -1.098  3.262   1.00 52.44  ? 189  VAL A C   1 
ATOM   1439  O O   . VAL A 1 193 ? 41.115  -0.801  2.065   1.00 53.09  ? 189  VAL A O   1 
ATOM   1440  C CB  . VAL A 1 193 ? 38.632  -1.639  3.745   1.00 50.08  ? 189  VAL A CB  1 
ATOM   1441  C CG1 . VAL A 1 193 ? 38.982  -3.080  4.075   1.00 50.51  ? 189  VAL A CG1 1 
ATOM   1442  C CG2 . VAL A 1 193 ? 37.369  -1.230  4.483   1.00 48.57  ? 189  VAL A CG2 1 
ATOM   1443  N N   . VAL A 1 194 ? 41.969  -1.776  3.919   1.00 52.97  ? 190  VAL A N   1 
ATOM   1444  C CA  . VAL A 1 194 ? 43.039  -2.497  3.247   1.00 54.36  ? 190  VAL A CA  1 
ATOM   1445  C C   . VAL A 1 194 ? 42.788  -3.983  3.507   1.00 54.13  ? 190  VAL A C   1 
ATOM   1446  O O   . VAL A 1 194 ? 42.929  -4.462  4.633   1.00 53.95  ? 190  VAL A O   1 
ATOM   1447  C CB  . VAL A 1 194 ? 44.443  -2.056  3.740   1.00 55.89  ? 190  VAL A CB  1 
ATOM   1448  C CG1 . VAL A 1 194 ? 45.537  -2.824  3.017   1.00 57.73  ? 190  VAL A CG1 1 
ATOM   1449  C CG2 . VAL A 1 194 ? 44.639  -0.562  3.536   1.00 55.97  ? 190  VAL A CG2 1 
ATOM   1450  N N   . ILE A 1 195 ? 42.387  -4.695  2.460   1.00 54.20  ? 191  ILE A N   1 
ATOM   1451  C CA  . ILE A 1 195 ? 42.018  -6.104  2.565   1.00 54.19  ? 191  ILE A CA  1 
ATOM   1452  C C   . ILE A 1 195 ? 43.025  -7.000  1.837   1.00 56.17  ? 191  ILE A C   1 
ATOM   1453  O O   . ILE A 1 195 ? 43.656  -6.573  0.866   1.00 57.28  ? 191  ILE A O   1 
ATOM   1454  C CB  . ILE A 1 195 ? 40.570  -6.344  2.051   1.00 52.98  ? 191  ILE A CB  1 
ATOM   1455  C CG1 . ILE A 1 195 ? 40.070  -7.738  2.443   1.00 52.69  ? 191  ILE A CG1 1 
ATOM   1456  C CG2 . ILE A 1 195 ? 40.464  -6.086  0.537   1.00 53.54  ? 191  ILE A CG2 1 
ATOM   1457  C CD1 . ILE A 1 195 ? 38.569  -7.872  2.444   1.00 51.10  ? 191  ILE A CD1 1 
ATOM   1458  N N   . LYS A 1 196 ? 43.175  -8.233  2.314   1.00 56.79  ? 192  LYS A N   1 
ATOM   1459  C CA  . LYS A 1 196 ? 44.123  -9.177  1.733   1.00 58.75  ? 192  LYS A CA  1 
ATOM   1460  C C   . LYS A 1 196 ? 43.458  -10.532 1.472   1.00 59.05  ? 192  LYS A C   1 
ATOM   1461  O O   . LYS A 1 196 ? 43.330  -11.349 2.386   1.00 59.26  ? 192  LYS A O   1 
ATOM   1462  C CB  . LYS A 1 196 ? 45.330  -9.342  2.658   1.00 60.15  ? 192  LYS A CB  1 
ATOM   1463  C CG  . LYS A 1 196 ? 46.661  -9.614  1.956   1.00 62.65  ? 192  LYS A CG  1 
ATOM   1464  C CD  . LYS A 1 196 ? 46.722  -10.974 1.258   1.00 64.27  ? 192  LYS A CD  1 
ATOM   1465  C CE  . LYS A 1 196 ? 46.637  -12.132 2.242   1.00 65.04  ? 192  LYS A CE  1 
ATOM   1466  N NZ  . LYS A 1 196 ? 46.510  -13.434 1.533   1.00 66.70  ? 192  LYS A NZ  1 
ATOM   1467  N N   . PRO A 1 197 ? 43.028  -10.774 0.221   1.00 59.34  ? 193  PRO A N   1 
ATOM   1468  C CA  . PRO A 1 197 ? 42.407  -12.053 -0.105  1.00 59.96  ? 193  PRO A CA  1 
ATOM   1469  C C   . PRO A 1 197 ? 43.428  -13.176 -0.163  1.00 62.34  ? 193  PRO A C   1 
ATOM   1470  O O   . PRO A 1 197 ? 44.604  -12.929 -0.438  1.00 63.66  ? 193  PRO A O   1 
ATOM   1471  C CB  . PRO A 1 197 ? 41.797  -11.806 -1.487  1.00 59.85  ? 193  PRO A CB  1 
ATOM   1472  C CG  . PRO A 1 197 ? 42.613  -10.722 -2.076  1.00 60.12  ? 193  PRO A CG  1 
ATOM   1473  C CD  . PRO A 1 197 ? 43.037  -9.854  -0.932  1.00 59.30  ? 193  PRO A CD  1 
ATOM   1474  N N   . ALA A 1 198 ? 42.964  -14.398 0.092   1.00 63.20  ? 194  ALA A N   1 
ATOM   1475  C CA  . ALA A 1 198 ? 43.810  -15.593 0.106   1.00 65.73  ? 194  ALA A CA  1 
ATOM   1476  C C   . ALA A 1 198 ? 44.679  -15.717 -1.138  1.00 67.58  ? 194  ALA A C   1 
ATOM   1477  O O   . ALA A 1 198 ? 44.292  -15.273 -2.223  1.00 67.09  ? 194  ALA A O   1 
ATOM   1478  C CB  . ALA A 1 198 ? 42.957  -16.836 0.274   1.00 66.24  ? 194  ALA A CB  1 
ATOM   1479  N N   . GLU A 1 199 ? 45.851  -16.326 -0.968  1.00 70.00  ? 195  GLU A N   1 
ATOM   1480  C CA  . GLU A 1 199 ? 46.799  -16.530 -2.070  1.00 72.18  ? 195  GLU A CA  1 
ATOM   1481  C C   . GLU A 1 199 ? 46.209  -17.344 -3.221  1.00 73.06  ? 195  GLU A C   1 
ATOM   1482  O O   . GLU A 1 199 ? 46.477  -17.058 -4.388  1.00 73.73  ? 195  GLU A O   1 
ATOM   1483  C CB  . GLU A 1 199 ? 48.120  -17.150 -1.581  1.00 74.68  ? 195  GLU A CB  1 
ATOM   1484  C CG  . GLU A 1 199 ? 47.986  -18.370 -0.674  1.00 76.03  ? 195  GLU A CG  1 
ATOM   1485  C CD  . GLU A 1 199 ? 48.012  -18.010 0.800   1.00 75.53  ? 195  GLU A CD  1 
ATOM   1486  O OE1 . GLU A 1 199 ? 49.118  -17.973 1.381   1.00 77.20  ? 195  GLU A OE1 1 
ATOM   1487  O OE2 . GLU A 1 199 ? 46.929  -17.775 1.380   1.00 73.39  ? 195  GLU A OE2 1 
ATOM   1488  N N   . GLN A 1 200 ? 45.398  -18.343 -2.882  1.00 73.30  ? 196  GLN A N   1 
ATOM   1489  C CA  . GLN A 1 200 ? 44.803  -19.237 -3.876  1.00 74.50  ? 196  GLN A CA  1 
ATOM   1490  C C   . GLN A 1 200 ? 43.531  -18.686 -4.527  1.00 72.76  ? 196  GLN A C   1 
ATOM   1491  O O   . GLN A 1 200 ? 43.226  -19.036 -5.665  1.00 73.75  ? 196  GLN A O   1 
ATOM   1492  C CB  . GLN A 1 200 ? 44.562  -20.640 -3.298  1.00 76.01  ? 196  GLN A CB  1 
ATOM   1493  C CG  . GLN A 1 200 ? 44.019  -20.676 -1.870  1.00 74.76  ? 196  GLN A CG  1 
ATOM   1494  C CD  . GLN A 1 200 ? 45.101  -20.501 -0.810  1.00 75.34  ? 196  GLN A CD  1 
ATOM   1495  O OE1 . GLN A 1 200 ? 45.015  -19.611 0.038   1.00 73.39  ? 196  GLN A OE1 1 
ATOM   1496  N NE2 . GLN A 1 200 ? 46.124  -21.349 -0.857  1.00 78.06  ? 196  GLN A NE2 1 
ATOM   1497  N N   . THR A 1 201 ? 42.797  -17.829 -3.818  1.00 70.51  ? 197  THR A N   1 
ATOM   1498  C CA  . THR A 1 201 ? 41.564  -17.243 -4.370  1.00 69.14  ? 197  THR A CA  1 
ATOM   1499  C C   . THR A 1 201 ? 41.522  -15.707 -4.343  1.00 67.28  ? 197  THR A C   1 
ATOM   1500  O O   . THR A 1 201 ? 40.781  -15.124 -3.551  1.00 65.37  ? 197  THR A O   1 
ATOM   1501  C CB  . THR A 1 201 ? 40.285  -17.796 -3.687  1.00 68.23  ? 197  THR A CB  1 
ATOM   1502  O OG1 . THR A 1 201 ? 40.367  -17.609 -2.269  1.00 67.13  ? 197  THR A OG1 1 
ATOM   1503  C CG2 . THR A 1 201 ? 40.094  -19.272 -3.995  1.00 70.65  ? 197  THR A CG2 1 
ATOM   1504  N N   . PRO A 1 202 ? 42.308  -15.047 -5.219  1.00 68.09  ? 198  PRO A N   1 
ATOM   1505  C CA  . PRO A 1 202 ? 42.272  -13.590 -5.246  1.00 66.63  ? 198  PRO A CA  1 
ATOM   1506  C C   . PRO A 1 202 ? 41.400  -12.996 -6.360  1.00 66.36  ? 198  PRO A C   1 
ATOM   1507  O O   . PRO A 1 202 ? 41.083  -11.808 -6.313  1.00 65.13  ? 198  PRO A O   1 
ATOM   1508  C CB  . PRO A 1 202 ? 43.741  -13.220 -5.473  1.00 67.94  ? 198  PRO A CB  1 
ATOM   1509  C CG  . PRO A 1 202 ? 44.340  -14.407 -6.198  1.00 70.27  ? 198  PRO A CG  1 
ATOM   1510  C CD  . PRO A 1 202 ? 43.379  -15.570 -6.088  1.00 70.45  ? 198  PRO A CD  1 
ATOM   1511  N N   . LEU A 1 203 ? 41.009  -13.814 -7.335  1.00 67.77  ? 199  LEU A N   1 
ATOM   1512  C CA  . LEU A 1 203 ? 40.343  -13.321 -8.548  1.00 68.12  ? 199  LEU A CA  1 
ATOM   1513  C C   . LEU A 1 203 ? 38.991  -12.649 -8.283  1.00 66.37  ? 199  LEU A C   1 
ATOM   1514  O O   . LEU A 1 203 ? 38.736  -11.543 -8.768  1.00 65.91  ? 199  LEU A O   1 
ATOM   1515  C CB  . LEU A 1 203 ? 40.207  -14.442 -9.592  1.00 70.23  ? 199  LEU A CB  1 
ATOM   1516  C CG  . LEU A 1 203 ? 41.470  -15.241 -9.955  1.00 72.32  ? 199  LEU A CG  1 
ATOM   1517  C CD1 . LEU A 1 203 ? 41.146  -16.363 -10.929 1.00 74.21  ? 199  LEU A CD1 1 
ATOM   1518  C CD2 . LEU A 1 203 ? 42.576  -14.353 -10.507 1.00 72.74  ? 199  LEU A CD2 1 
ATOM   1519  N N   . SER A 1 204 ? 38.141  -13.315 -7.504  1.00 65.58  ? 200  SER A N   1 
ATOM   1520  C CA  . SER A 1 204 ? 36.823  -12.784 -7.157  1.00 64.00  ? 200  SER A CA  1 
ATOM   1521  C C   . SER A 1 204 ? 36.934  -11.435 -6.456  1.00 62.18  ? 200  SER A C   1 
ATOM   1522  O O   . SER A 1 204 ? 36.137  -10.530 -6.706  1.00 61.44  ? 200  SER A O   1 
ATOM   1523  C CB  . SER A 1 204 ? 36.058  -13.775 -6.278  1.00 63.59  ? 200  SER A CB  1 
ATOM   1524  O OG  . SER A 1 204 ? 36.823  -14.152 -5.146  1.00 63.30  ? 200  SER A OG  1 
ATOM   1525  N N   . ALA A 1 205 ? 37.936  -11.314 -5.590  1.00 61.75  ? 201  ALA A N   1 
ATOM   1526  C CA  . ALA A 1 205 ? 38.197  -10.085 -4.850  1.00 60.27  ? 201  ALA A CA  1 
ATOM   1527  C C   . ALA A 1 205 ? 38.626  -8.936  -5.763  1.00 60.77  ? 201  ALA A C   1 
ATOM   1528  O O   . ALA A 1 205 ? 38.205  -7.796  -5.572  1.00 59.81  ? 201  ALA A O   1 
ATOM   1529  C CB  . ALA A 1 205 ? 39.244  -10.332 -3.777  1.00 60.19  ? 201  ALA A CB  1 
ATOM   1530  N N   . LEU A 1 206 ? 39.453  -9.240  -6.759  1.00 62.50  ? 202  LEU A N   1 
ATOM   1531  C CA  . LEU A 1 206 ? 39.990  -8.211  -7.646  1.00 63.31  ? 202  LEU A CA  1 
ATOM   1532  C C   . LEU A 1 206 ? 38.952  -7.678  -8.627  1.00 63.56  ? 202  LEU A C   1 
ATOM   1533  O O   . LEU A 1 206 ? 38.992  -6.500  -8.994  1.00 63.70  ? 202  LEU A O   1 
ATOM   1534  C CB  . LEU A 1 206 ? 41.229  -8.713  -8.392  1.00 65.36  ? 202  LEU A CB  1 
ATOM   1535  C CG  . LEU A 1 206 ? 42.474  -9.046  -7.559  1.00 65.79  ? 202  LEU A CG  1 
ATOM   1536  C CD1 . LEU A 1 206 ? 43.496  -9.765  -8.414  1.00 68.25  ? 202  LEU A CD1 1 
ATOM   1537  C CD2 . LEU A 1 206 ? 43.089  -7.811  -6.911  1.00 65.35  ? 202  LEU A CD2 1 
ATOM   1538  N N   . TYR A 1 207 ? 38.028  -8.539  -9.050  1.00 63.88  ? 203  TYR A N   1 
ATOM   1539  C CA  . TYR A 1 207 ? 36.942  -8.106  -9.924  1.00 64.30  ? 203  TYR A CA  1 
ATOM   1540  C C   . TYR A 1 207 ? 36.061  -7.102  -9.196  1.00 62.56  ? 203  TYR A C   1 
ATOM   1541  O O   . TYR A 1 207 ? 35.525  -6.177  -9.809  1.00 63.04  ? 203  TYR A O   1 
ATOM   1542  C CB  . TYR A 1 207 ? 36.103  -9.286  -10.419 1.00 65.19  ? 203  TYR A CB  1 
ATOM   1543  C CG  . TYR A 1 207 ? 35.058  -8.883  -11.445 1.00 66.38  ? 203  TYR A CG  1 
ATOM   1544  C CD1 . TYR A 1 207 ? 35.392  -8.743  -12.790 1.00 68.73  ? 203  TYR A CD1 1 
ATOM   1545  C CD2 . TYR A 1 207 ? 33.740  -8.627  -11.067 1.00 65.60  ? 203  TYR A CD2 1 
ATOM   1546  C CE1 . TYR A 1 207 ? 34.438  -8.366  -13.735 1.00 70.12  ? 203  TYR A CE1 1 
ATOM   1547  C CE2 . TYR A 1 207 ? 32.777  -8.251  -12.004 1.00 66.89  ? 203  TYR A CE2 1 
ATOM   1548  C CZ  . TYR A 1 207 ? 33.134  -8.122  -13.335 1.00 69.33  ? 203  TYR A CZ  1 
ATOM   1549  O OH  . TYR A 1 207 ? 32.191  -7.750  -14.268 1.00 70.90  ? 203  TYR A OH  1 
ATOM   1550  N N   . MET A 1 208 ? 35.922  -7.287  -7.887  1.00 60.80  ? 204  MET A N   1 
ATOM   1551  C CA  . MET A 1 208 ? 35.183  -6.349  -7.052  1.00 59.08  ? 204  MET A CA  1 
ATOM   1552  C C   . MET A 1 208 ? 35.821  -4.970  -7.058  1.00 58.96  ? 204  MET A C   1 
ATOM   1553  O O   . MET A 1 208 ? 35.142  -3.972  -6.827  1.00 58.16  ? 204  MET A O   1 
ATOM   1554  C CB  . MET A 1 208 ? 35.064  -6.874  -5.626  1.00 57.52  ? 204  MET A CB  1 
ATOM   1555  C CG  . MET A 1 208 ? 33.935  -7.858  -5.448  1.00 57.50  ? 204  MET A CG  1 
ATOM   1556  S SD  . MET A 1 208 ? 32.334  -7.123  -5.833  1.00 58.07  ? 204  MET A SD  1 
ATOM   1557  C CE  . MET A 1 208 ? 31.958  -6.269  -4.298  1.00 55.26  ? 204  MET A CE  1 
ATOM   1558  N N   . GLY A 1 209 ? 37.125  -4.927  -7.329  1.00 59.93  ? 205  GLY A N   1 
ATOM   1559  C CA  . GLY A 1 209 ? 37.852  -3.671  -7.487  1.00 60.42  ? 205  GLY A CA  1 
ATOM   1560  C C   . GLY A 1 209 ? 37.311  -2.847  -8.638  1.00 61.64  ? 205  GLY A C   1 
ATOM   1561  O O   . GLY A 1 209 ? 37.167  -1.626  -8.524  1.00 61.56  ? 205  GLY A O   1 
ATOM   1562  N N   . ALA A 1 210 ? 37.000  -3.525  -9.743  1.00 62.97  ? 206  ALA A N   1 
ATOM   1563  C CA  . ALA A 1 210 ? 36.416  -2.889  -10.922 1.00 64.43  ? 206  ALA A CA  1 
ATOM   1564  C C   . ALA A 1 210 ? 35.004  -2.372  -10.653 1.00 63.55  ? 206  ALA A C   1 
ATOM   1565  O O   . ALA A 1 210 ? 34.607  -1.334  -11.183 1.00 64.51  ? 206  ALA A O   1 
ATOM   1566  C CB  . ALA A 1 210 ? 36.415  -3.849  -12.092 1.00 66.21  ? 206  ALA A CB  1 
ATOM   1567  N N   . LEU A 1 211 ? 34.254  -3.102  -9.829  1.00 61.93  ? 207  LEU A N   1 
ATOM   1568  C CA  . LEU A 1 211 ? 32.904  -2.695  -9.447  1.00 60.97  ? 207  LEU A CA  1 
ATOM   1569  C C   . LEU A 1 211 ? 32.928  -1.566  -8.426  1.00 59.50  ? 207  LEU A C   1 
ATOM   1570  O O   . LEU A 1 211 ? 32.009  -0.752  -8.374  1.00 59.38  ? 207  LEU A O   1 
ATOM   1571  C CB  . LEU A 1 211 ? 32.104  -3.883  -8.908  1.00 60.01  ? 207  LEU A CB  1 
ATOM   1572  C CG  . LEU A 1 211 ? 31.899  -5.080  -9.841  1.00 61.60  ? 207  LEU A CG  1 
ATOM   1573  C CD1 . LEU A 1 211 ? 31.007  -6.113  -9.184  1.00 60.92  ? 207  LEU A CD1 1 
ATOM   1574  C CD2 . LEU A 1 211 ? 31.317  -4.657  -11.184 1.00 63.94  ? 207  LEU A CD2 1 
ATOM   1575  N N   . ILE A 1 212 ? 33.984  -1.523  -7.619  1.00 58.62  ? 208  ILE A N   1 
ATOM   1576  C CA  . ILE A 1 212 ? 34.165  -0.460  -6.635  1.00 57.54  ? 208  ILE A CA  1 
ATOM   1577  C C   . ILE A 1 212 ? 34.392  0.893   -7.313  1.00 58.97  ? 208  ILE A C   1 
ATOM   1578  O O   . ILE A 1 212 ? 33.705  1.869   -6.995  1.00 58.63  ? 208  ILE A O   1 
ATOM   1579  C CB  . ILE A 1 212 ? 35.277  -0.813  -5.614  1.00 56.55  ? 208  ILE A CB  1 
ATOM   1580  C CG1 . ILE A 1 212 ? 34.695  -1.711  -4.520  1.00 54.86  ? 208  ILE A CG1 1 
ATOM   1581  C CG2 . ILE A 1 212 ? 35.882  0.441   -4.990  1.00 56.38  ? 208  ILE A CG2 1 
ATOM   1582  C CD1 . ILE A 1 212 ? 35.705  -2.592  -3.828  1.00 54.77  ? 208  ILE A CD1 1 
ATOM   1583  N N   . LYS A 1 213 ? 35.328  0.945   -8.260  1.00 60.72  ? 209  LYS A N   1 
ATOM   1584  C CA  . LYS A 1 213 ? 35.586  2.181   -8.999  1.00 62.43  ? 209  LYS A CA  1 
ATOM   1585  C C   . LYS A 1 213 ? 34.368  2.590   -9.829  1.00 63.53  ? 209  LYS A C   1 
ATOM   1586  O O   . LYS A 1 213 ? 34.031  3.775   -9.900  1.00 64.30  ? 209  LYS A O   1 
ATOM   1587  C CB  . LYS A 1 213 ? 36.831  2.061   -9.884  1.00 64.28  ? 209  LYS A CB  1 
ATOM   1588  C CG  . LYS A 1 213 ? 37.349  3.406   -10.398 1.00 66.18  ? 209  LYS A CG  1 
ATOM   1589  C CD  . LYS A 1 213 ? 38.510  3.249   -11.366 1.00 68.31  ? 209  LYS A CD  1 
ATOM   1590  C CE  . LYS A 1 213 ? 38.968  4.603   -11.883 1.00 70.36  ? 209  LYS A CE  1 
ATOM   1591  N NZ  . LYS A 1 213 ? 40.117  4.488   -12.820 1.00 72.76  ? 209  LYS A NZ  1 
ATOM   1592  N N   . GLU A 1 214 ? 33.706  1.606   -10.437 1.00 63.85  ? 210  GLU A N   1 
ATOM   1593  C CA  . GLU A 1 214 ? 32.521  1.857   -11.257 1.00 65.14  ? 210  GLU A CA  1 
ATOM   1594  C C   . GLU A 1 214 ? 31.355  2.409   -10.431 1.00 63.90  ? 210  GLU A C   1 
ATOM   1595  O O   . GLU A 1 214 ? 30.634  3.297   -10.889 1.00 65.14  ? 210  GLU A O   1 
ATOM   1596  C CB  . GLU A 1 214 ? 32.092  0.593   -12.008 1.00 65.85  ? 210  GLU A CB  1 
ATOM   1597  C CG  . GLU A 1 214 ? 31.323  0.878   -13.296 1.00 68.29  ? 210  GLU A CG  1 
ATOM   1598  C CD  . GLU A 1 214 ? 30.473  -0.291  -13.762 1.00 68.73  ? 210  GLU A CD  1 
ATOM   1599  O OE1 . GLU A 1 214 ? 30.857  -1.459  -13.531 1.00 67.93  ? 210  GLU A OE1 1 
ATOM   1600  O OE2 . GLU A 1 214 ? 29.414  -0.036  -14.371 1.00 69.94  ? 210  GLU A OE2 1 
ATOM   1601  N N   . ALA A 1 215 ? 31.189  1.885   -9.215  1.00 61.59  ? 211  ALA A N   1 
ATOM   1602  C CA  . ALA A 1 215 ? 30.128  2.324   -8.305  1.00 60.31  ? 211  ALA A CA  1 
ATOM   1603  C C   . ALA A 1 215 ? 30.256  3.797   -7.928  1.00 60.54  ? 211  ALA A C   1 
ATOM   1604  O O   . ALA A 1 215 ? 29.252  4.475   -7.704  1.00 60.70  ? 211  ALA A O   1 
ATOM   1605  C CB  . ALA A 1 215 ? 30.102  1.456   -7.052  1.00 57.95  ? 211  ALA A CB  1 
ATOM   1606  N N   . GLY A 1 216 ? 31.492  4.284   -7.859  1.00 60.86  ? 212  GLY A N   1 
ATOM   1607  C CA  . GLY A 1 216 ? 31.761  5.678   -7.522  1.00 61.38  ? 212  GLY A CA  1 
ATOM   1608  C C   . GLY A 1 216 ? 32.321  5.881   -6.124  1.00 59.55  ? 212  GLY A C   1 
ATOM   1609  O O   . GLY A 1 216 ? 32.105  6.930   -5.512  1.00 59.50  ? 212  GLY A O   1 
ATOM   1610  N N   . PHE A 1 217 ? 33.034  4.877   -5.616  1.00 58.23  ? 213  PHE A N   1 
ATOM   1611  C CA  . PHE A 1 217 ? 33.738  4.998   -4.343  1.00 56.72  ? 213  PHE A CA  1 
ATOM   1612  C C   . PHE A 1 217 ? 34.925  5.946   -4.489  1.00 58.10  ? 213  PHE A C   1 
ATOM   1613  O O   . PHE A 1 217 ? 35.628  5.899   -5.502  1.00 59.81  ? 213  PHE A O   1 
ATOM   1614  C CB  . PHE A 1 217 ? 34.210  3.629   -3.849  1.00 55.44  ? 213  PHE A CB  1 
ATOM   1615  C CG  . PHE A 1 217 ? 33.116  2.788   -3.258  1.00 53.72  ? 213  PHE A CG  1 
ATOM   1616  C CD1 . PHE A 1 217 ? 32.646  3.040   -1.968  1.00 51.86  ? 213  PHE A CD1 1 
ATOM   1617  C CD2 . PHE A 1 217 ? 32.555  1.743   -3.984  1.00 53.66  ? 213  PHE A CD2 1 
ATOM   1618  C CE1 . PHE A 1 217 ? 31.634  2.266   -1.415  1.00 50.61  ? 213  PHE A CE1 1 
ATOM   1619  C CE2 . PHE A 1 217 ? 31.543  0.961   -3.439  1.00 52.61  ? 213  PHE A CE2 1 
ATOM   1620  C CZ  . PHE A 1 217 ? 31.081  1.223   -2.151  1.00 51.12  ? 213  PHE A CZ  1 
ATOM   1621  N N   . PRO A 1 218 ? 35.147  6.821   -3.486  1.00 57.63  ? 214  PRO A N   1 
ATOM   1622  C CA  . PRO A 1 218 ? 36.282  7.746   -3.541  1.00 59.00  ? 214  PRO A CA  1 
ATOM   1623  C C   . PRO A 1 218 ? 37.610  6.991   -3.610  1.00 59.25  ? 214  PRO A C   1 
ATOM   1624  O O   . PRO A 1 218 ? 37.715  5.890   -3.057  1.00 57.87  ? 214  PRO A O   1 
ATOM   1625  C CB  . PRO A 1 218 ? 36.174  8.519   -2.219  1.00 58.10  ? 214  PRO A CB  1 
ATOM   1626  C CG  . PRO A 1 218 ? 34.755  8.371   -1.797  1.00 56.66  ? 214  PRO A CG  1 
ATOM   1627  C CD  . PRO A 1 218 ? 34.342  7.013   -2.265  1.00 55.86  ? 214  PRO A CD  1 
ATOM   1628  N N   . PRO A 1 219 ? 38.616  7.564   -4.299  1.00 61.22  ? 215  PRO A N   1 
ATOM   1629  C CA  . PRO A 1 219 ? 39.918  6.903   -4.404  1.00 61.77  ? 215  PRO A CA  1 
ATOM   1630  C C   . PRO A 1 219 ? 40.546  6.620   -3.039  1.00 60.50  ? 215  PRO A C   1 
ATOM   1631  O O   . PRO A 1 219 ? 40.569  7.497   -2.167  1.00 60.21  ? 215  PRO A O   1 
ATOM   1632  C CB  . PRO A 1 219 ? 40.770  7.906   -5.198  1.00 64.24  ? 215  PRO A CB  1 
ATOM   1633  C CG  . PRO A 1 219 ? 40.032  9.199   -5.133  1.00 64.77  ? 215  PRO A CG  1 
ATOM   1634  C CD  . PRO A 1 219 ? 38.588  8.829   -5.053  1.00 63.32  ? 215  PRO A CD  1 
ATOM   1635  N N   . GLY A 1 220 ? 41.019  5.389   -2.861  1.00 59.82  ? 216  GLY A N   1 
ATOM   1636  C CA  . GLY A 1 220 ? 41.748  4.998   -1.660  1.00 59.01  ? 216  GLY A CA  1 
ATOM   1637  C C   . GLY A 1 220 ? 40.901  4.421   -0.544  1.00 56.79  ? 216  GLY A C   1 
ATOM   1638  O O   . GLY A 1 220 ? 41.442  3.886   0.423   1.00 56.35  ? 216  GLY A O   1 
ATOM   1639  N N   . VAL A 1 221 ? 39.578  4.530   -0.676  1.00 55.66  ? 217  VAL A N   1 
ATOM   1640  C CA  . VAL A 1 221 ? 38.632  4.059   0.351   1.00 53.56  ? 217  VAL A CA  1 
ATOM   1641  C C   . VAL A 1 221 ? 38.735  2.544   0.545   1.00 52.82  ? 217  VAL A C   1 
ATOM   1642  O O   . VAL A 1 221 ? 38.820  2.055   1.677   1.00 51.77  ? 217  VAL A O   1 
ATOM   1643  C CB  . VAL A 1 221 ? 37.168  4.502   0.029   1.00 52.89  ? 217  VAL A CB  1 
ATOM   1644  C CG1 . VAL A 1 221 ? 36.140  3.698   0.821   1.00 50.85  ? 217  VAL A CG1 1 
ATOM   1645  C CG2 . VAL A 1 221 ? 36.997  5.987   0.298   1.00 53.20  ? 217  VAL A CG2 1 
ATOM   1646  N N   . ILE A 1 222 ? 38.738  1.815   -0.569  1.00 53.42  ? 218  ILE A N   1 
ATOM   1647  C CA  . ILE A 1 222 ? 38.944  0.370   -0.555  1.00 53.15  ? 218  ILE A CA  1 
ATOM   1648  C C   . ILE A 1 222 ? 40.196  0.030   -1.371  1.00 54.89  ? 218  ILE A C   1 
ATOM   1649  O O   . ILE A 1 222 ? 40.289  0.360   -2.560  1.00 56.04  ? 218  ILE A O   1 
ATOM   1650  C CB  . ILE A 1 222 ? 37.710  -0.393  -1.097  1.00 52.49  ? 218  ILE A CB  1 
ATOM   1651  C CG1 . ILE A 1 222 ? 36.428  0.125   -0.443  1.00 50.93  ? 218  ILE A CG1 1 
ATOM   1652  C CG2 . ILE A 1 222 ? 37.853  -1.892  -0.853  1.00 52.20  ? 218  ILE A CG2 1 
ATOM   1653  C CD1 . ILE A 1 222 ? 35.267  0.267   -1.397  1.00 50.99  ? 218  ILE A CD1 1 
ATOM   1654  N N   . ASN A 1 223 ? 41.158  -0.609  -0.709  1.00 55.14  ? 219  ASN A N   1 
ATOM   1655  C CA  . ASN A 1 223 ? 42.403  -1.033  -1.341  1.00 56.91  ? 219  ASN A CA  1 
ATOM   1656  C C   . ASN A 1 223 ? 42.571  -2.543  -1.236  1.00 56.93  ? 219  ASN A C   1 
ATOM   1657  O O   . ASN A 1 223 ? 42.587  -3.098  -0.134  1.00 56.29  ? 219  ASN A O   1 
ATOM   1658  C CB  . ASN A 1 223 ? 43.605  -0.318  -0.710  1.00 57.92  ? 219  ASN A CB  1 
ATOM   1659  C CG  . ASN A 1 223 ? 43.561  1.192   -0.902  1.00 58.46  ? 219  ASN A CG  1 
ATOM   1660  O OD1 . ASN A 1 223 ? 43.597  1.691   -2.027  1.00 60.08  ? 219  ASN A OD1 1 
ATOM   1661  N ND2 . ASN A 1 223 ? 43.496  1.925   0.203   1.00 57.78  ? 219  ASN A ND2 1 
ATOM   1662  N N   . ILE A 1 224 ? 42.687  -3.202  -2.384  1.00 57.85  ? 220  ILE A N   1 
ATOM   1663  C CA  . ILE A 1 224 ? 42.803  -4.657  -2.432  1.00 58.21  ? 220  ILE A CA  1 
ATOM   1664  C C   . ILE A 1 224 ? 44.237  -5.065  -2.776  1.00 60.26  ? 220  ILE A C   1 
ATOM   1665  O O   . ILE A 1 224 ? 44.845  -4.503  -3.691  1.00 61.68  ? 220  ILE A O   1 
ATOM   1666  C CB  . ILE A 1 224 ? 41.799  -5.268  -3.441  1.00 58.11  ? 220  ILE A CB  1 
ATOM   1667  C CG1 . ILE A 1 224 ? 40.401  -4.675  -3.224  1.00 56.21  ? 220  ILE A CG1 1 
ATOM   1668  C CG2 . ILE A 1 224 ? 41.768  -6.793  -3.323  1.00 58.46  ? 220  ILE A CG2 1 
ATOM   1669  C CD1 . ILE A 1 224 ? 39.453  -4.859  -4.387  1.00 56.25  ? 220  ILE A CD1 1 
ATOM   1670  N N   . LEU A 1 225 ? 44.777  -6.029  -2.031  1.00 60.75  ? 221  LEU A N   1 
ATOM   1671  C CA  . LEU A 1 225 ? 46.157  -6.489  -2.235  1.00 62.90  ? 221  LEU A CA  1 
ATOM   1672  C C   . LEU A 1 225 ? 46.291  -8.016  -2.230  1.00 63.87  ? 221  LEU A C   1 
ATOM   1673  O O   . LEU A 1 225 ? 46.240  -8.640  -1.170  1.00 63.58  ? 221  LEU A O   1 
ATOM   1674  C CB  . LEU A 1 225 ? 47.107  -5.864  -1.204  1.00 63.29  ? 221  LEU A CB  1 
ATOM   1675  C CG  . LEU A 1 225 ? 47.397  -4.367  -1.336  1.00 63.23  ? 221  LEU A CG  1 
ATOM   1676  C CD1 . LEU A 1 225 ? 46.439  -3.558  -0.482  1.00 61.12  ? 221  LEU A CD1 1 
ATOM   1677  C CD2 . LEU A 1 225 ? 48.830  -4.068  -0.945  1.00 65.12  ? 221  LEU A CD2 1 
ATOM   1678  N N   . PRO A 1 226 ? 46.467  -8.618  -3.421  1.00 65.33  ? 222  PRO A N   1 
ATOM   1679  C CA  . PRO A 1 226 ? 46.596  -10.072 -3.565  1.00 66.64  ? 222  PRO A CA  1 
ATOM   1680  C C   . PRO A 1 226 ? 48.014  -10.593 -3.308  1.00 68.93  ? 222  PRO A C   1 
ATOM   1681  O O   . PRO A 1 226 ? 48.992  -9.997  -3.774  1.00 70.28  ? 222  PRO A O   1 
ATOM   1682  C CB  . PRO A 1 226 ? 46.199  -10.313 -5.023  1.00 67.36  ? 222  PRO A CB  1 
ATOM   1683  C CG  . PRO A 1 226 ? 46.547  -9.044  -5.729  1.00 67.54  ? 222  PRO A CG  1 
ATOM   1684  C CD  . PRO A 1 226 ? 46.480  -7.925  -4.724  1.00 65.96  ? 222  PRO A CD  1 
ATOM   1685  N N   . GLY A 1 227 ? 48.112  -11.701 -2.573  1.00 69.61  ? 223  GLY A N   1 
ATOM   1686  C CA  . GLY A 1 227 ? 49.403  -12.323 -2.274  1.00 71.96  ? 223  GLY A CA  1 
ATOM   1687  C C   . GLY A 1 227 ? 49.376  -13.364 -1.167  1.00 72.50  ? 223  GLY A C   1 
ATOM   1688  O O   . GLY A 1 227 ? 48.310  -13.840 -0.765  1.00 71.20  ? 223  GLY A O   1 
ATOM   1689  N N   . TYR A 1 228 ? 50.565  -13.704 -0.673  1.00 74.66  ? 224  TYR A N   1 
ATOM   1690  C CA  . TYR A 1 228 ? 50.742  -14.747 0.339   1.00 75.88  ? 224  TYR A CA  1 
ATOM   1691  C C   . TYR A 1 228 ? 50.508  -14.237 1.769   1.00 74.68  ? 224  TYR A C   1 
ATOM   1692  O O   . TYR A 1 228 ? 50.155  -13.072 1.972   1.00 72.69  ? 224  TYR A O   1 
ATOM   1693  C CB  . TYR A 1 228 ? 52.130  -15.390 0.198   1.00 79.08  ? 224  TYR A CB  1 
ATOM   1694  C CG  . TYR A 1 228 ? 52.314  -16.187 -1.081  1.00 80.69  ? 224  TYR A CG  1 
ATOM   1695  C CD1 . TYR A 1 228 ? 52.020  -17.552 -1.123  1.00 82.08  ? 224  TYR A CD1 1 
ATOM   1696  C CD2 . TYR A 1 228 ? 52.780  -15.580 -2.247  1.00 81.13  ? 224  TYR A CD2 1 
ATOM   1697  C CE1 . TYR A 1 228 ? 52.184  -18.292 -2.296  1.00 83.72  ? 224  TYR A CE1 1 
ATOM   1698  C CE2 . TYR A 1 228 ? 52.945  -16.311 -3.425  1.00 82.82  ? 224  TYR A CE2 1 
ATOM   1699  C CZ  . TYR A 1 228 ? 52.646  -17.665 -3.440  1.00 84.10  ? 224  TYR A CZ  1 
ATOM   1700  O OH  . TYR A 1 228 ? 52.811  -18.392 -4.597  1.00 86.05  ? 224  TYR A OH  1 
ATOM   1701  N N   . GLY A 1 229 ? 50.706  -15.119 2.749   1.00 76.01  ? 225  GLY A N   1 
ATOM   1702  C CA  . GLY A 1 229 ? 50.429  -14.814 4.151   1.00 75.14  ? 225  GLY A CA  1 
ATOM   1703  C C   . GLY A 1 229 ? 51.526  -14.077 4.899   1.00 76.41  ? 225  GLY A C   1 
ATOM   1704  O O   . GLY A 1 229 ? 51.348  -12.918 5.268   1.00 74.70  ? 225  GLY A O   1 
ATOM   1705  N N   . PRO A 1 230 ? 52.665  -14.751 5.146   1.00 79.63  ? 226  PRO A N   1 
ATOM   1706  C CA  . PRO A 1 230 ? 53.792  -14.131 5.854   1.00 81.42  ? 226  PRO A CA  1 
ATOM   1707  C C   . PRO A 1 230 ? 54.318  -12.854 5.197   1.00 81.03  ? 226  PRO A C   1 
ATOM   1708  O O   . PRO A 1 230 ? 54.929  -12.029 5.880   1.00 81.64  ? 226  PRO A O   1 
ATOM   1709  C CB  . PRO A 1 230 ? 54.865  -15.222 5.824   1.00 84.98  ? 226  PRO A CB  1 
ATOM   1710  C CG  . PRO A 1 230 ? 54.099  -16.489 5.755   1.00 85.00  ? 226  PRO A CG  1 
ATOM   1711  C CD  . PRO A 1 230 ? 52.910  -16.184 4.890   1.00 81.99  ? 226  PRO A CD  1 
ATOM   1712  N N   . THR A 1 231 ? 54.086  -12.696 3.892   1.00 80.33  ? 227  THR A N   1 
ATOM   1713  C CA  . THR A 1 231 ? 54.488  -11.483 3.175   1.00 80.02  ? 227  THR A CA  1 
ATOM   1714  C C   . THR A 1 231 ? 53.498  -10.330 3.393   1.00 77.16  ? 227  THR A C   1 
ATOM   1715  O O   . THR A 1 231 ? 53.692  -9.504  4.289   1.00 76.91  ? 227  THR A O   1 
ATOM   1716  C CB  . THR A 1 231 ? 54.724  -11.733 1.657   1.00 80.73  ? 227  THR A CB  1 
ATOM   1717  O OG1 . THR A 1 231 ? 53.758  -12.666 1.157   1.00 79.58  ? 227  THR A OG1 1 
ATOM   1718  C CG2 . THR A 1 231 ? 56.119  -12.280 1.412   1.00 84.12  ? 227  THR A CG2 1 
ATOM   1719  N N   . ALA A 1 232 ? 52.439  -10.289 2.587   1.00 75.24  ? 228  ALA A N   1 
ATOM   1720  C CA  . ALA A 1 232 ? 51.470  -9.193  2.627   1.00 72.71  ? 228  ALA A CA  1 
ATOM   1721  C C   . ALA A 1 232 ? 50.578  -9.219  3.871   1.00 71.12  ? 228  ALA A C   1 
ATOM   1722  O O   . ALA A 1 232 ? 50.166  -8.167  4.364   1.00 69.68  ? 228  ALA A O   1 
ATOM   1723  C CB  . ALA A 1 232 ? 50.624  -9.185  1.360   1.00 71.36  ? 228  ALA A CB  1 
ATOM   1724  N N   . GLY A 1 233 ? 50.286  -10.419 4.369   1.00 71.65  ? 229  GLY A N   1 
ATOM   1725  C CA  . GLY A 1 233 ? 49.416  -10.590 5.530   1.00 70.43  ? 229  GLY A CA  1 
ATOM   1726  C C   . GLY A 1 233 ? 50.029  -10.081 6.822   1.00 71.34  ? 229  GLY A C   1 
ATOM   1727  O O   . GLY A 1 233 ? 49.412  -9.286  7.538   1.00 69.62  ? 229  GLY A O   1 
ATOM   1728  N N   . ALA A 1 234 ? 51.245  -10.540 7.119   1.00 74.16  ? 230  ALA A N   1 
ATOM   1729  C CA  . ALA A 1 234 ? 51.949  -10.136 8.337   1.00 75.58  ? 230  ALA A CA  1 
ATOM   1730  C C   . ALA A 1 234 ? 52.280  -8.646  8.330   1.00 75.04  ? 230  ALA A C   1 
ATOM   1731  O O   . ALA A 1 234 ? 52.291  -8.003  9.383   1.00 74.94  ? 230  ALA A O   1 
ATOM   1732  C CB  . ALA A 1 234 ? 53.210  -10.965 8.531   1.00 79.03  ? 230  ALA A CB  1 
ATOM   1733  N N   . ALA A 1 235 ? 52.531  -8.108  7.137   1.00 74.92  ? 231  ALA A N   1 
ATOM   1734  C CA  . ALA A 1 235 ? 52.830  -6.686  6.957   1.00 74.62  ? 231  ALA A CA  1 
ATOM   1735  C C   . ALA A 1 235 ? 51.658  -5.784  7.348   1.00 71.79  ? 231  ALA A C   1 
ATOM   1736  O O   . ALA A 1 235 ? 51.865  -4.657  7.799   1.00 71.73  ? 231  ALA A O   1 
ATOM   1737  C CB  . ALA A 1 235 ? 53.264  -6.411  5.526   1.00 75.28  ? 231  ALA A CB  1 
ATOM   1738  N N   . ILE A 1 236 ? 50.437  -6.284  7.166   1.00 69.66  ? 232  ILE A N   1 
ATOM   1739  C CA  . ILE A 1 236 ? 49.232  -5.597  7.635   1.00 67.16  ? 232  ILE A CA  1 
ATOM   1740  C C   . ILE A 1 236 ? 49.169  -5.641  9.161   1.00 67.34  ? 232  ILE A C   1 
ATOM   1741  O O   . ILE A 1 236 ? 48.859  -4.634  9.806   1.00 66.47  ? 232  ILE A O   1 
ATOM   1742  C CB  . ILE A 1 236 ? 47.945  -6.220  7.033   1.00 65.20  ? 232  ILE A CB  1 
ATOM   1743  C CG1 . ILE A 1 236 ? 47.873  -5.949  5.529   1.00 64.93  ? 232  ILE A CG1 1 
ATOM   1744  C CG2 . ILE A 1 236 ? 46.692  -5.679  7.724   1.00 62.81  ? 232  ILE A CG2 1 
ATOM   1745  C CD1 . ILE A 1 236 ? 46.803  -6.740  4.810   1.00 63.64  ? 232  ILE A CD1 1 
ATOM   1746  N N   . ALA A 1 237 ? 49.477  -6.810  9.722   1.00 68.76  ? 233  ALA A N   1 
ATOM   1747  C CA  . ALA A 1 237 ? 49.431  -7.044  11.167  1.00 69.21  ? 233  ALA A CA  1 
ATOM   1748  C C   . ALA A 1 237 ? 50.439  -6.198  11.940  1.00 70.92  ? 233  ALA A C   1 
ATOM   1749  O O   . ALA A 1 237 ? 50.139  -5.711  13.034  1.00 70.46  ? 233  ALA A O   1 
ATOM   1750  C CB  . ALA A 1 237 ? 49.639  -8.523  11.468  1.00 70.87  ? 233  ALA A CB  1 
ATOM   1751  N N   . SER A 1 238 ? 51.628  -6.025  11.365  1.00 72.94  ? 234  SER A N   1 
ATOM   1752  C CA  . SER A 1 238 ? 52.692  -5.258  12.006  1.00 75.00  ? 234  SER A CA  1 
ATOM   1753  C C   . SER A 1 238 ? 52.877  -3.872  11.385  1.00 74.41  ? 234  SER A C   1 
ATOM   1754  O O   . SER A 1 238 ? 54.006  -3.397  11.242  1.00 76.73  ? 234  SER A O   1 
ATOM   1755  C CB  . SER A 1 238 ? 54.004  -6.042  11.964  1.00 78.31  ? 234  SER A CB  1 
ATOM   1756  O OG  . SER A 1 238 ? 53.845  -7.311  12.569  1.00 79.36  ? 234  SER A OG  1 
ATOM   1757  N N   . HIS A 1 239 ? 51.768  -3.227  11.024  1.00 71.56  ? 235  HIS A N   1 
ATOM   1758  C CA  . HIS A 1 239 ? 51.816  -1.880  10.453  1.00 71.00  ? 235  HIS A CA  1 
ATOM   1759  C C   . HIS A 1 239 ? 51.367  -0.810  11.449  1.00 70.03  ? 235  HIS A C   1 
ATOM   1760  O O   . HIS A 1 239 ? 50.271  -0.880  12.012  1.00 67.97  ? 235  HIS A O   1 
ATOM   1761  C CB  . HIS A 1 239 ? 51.003  -1.786  9.159   1.00 69.07  ? 235  HIS A CB  1 
ATOM   1762  C CG  . HIS A 1 239 ? 51.482  -0.715  8.230   1.00 69.83  ? 235  HIS A CG  1 
ATOM   1763  N ND1 . HIS A 1 239 ? 51.214  0.621   8.434   1.00 69.52  ? 235  HIS A ND1 1 
ATOM   1764  C CD2 . HIS A 1 239 ? 52.227  -0.781  7.102   1.00 71.44  ? 235  HIS A CD2 1 
ATOM   1765  C CE1 . HIS A 1 239 ? 51.768  1.332   7.468   1.00 70.69  ? 235  HIS A CE1 1 
ATOM   1766  N NE2 . HIS A 1 239 ? 52.386  0.505   6.645   1.00 71.83  ? 235  HIS A NE2 1 
ATOM   1767  N N   . ILE A 1 240 ? 52.232  0.183   11.636  1.00 71.61  ? 236  ILE A N   1 
ATOM   1768  C CA  . ILE A 1 240 ? 52.046  1.251   12.623  1.00 71.25  ? 236  ILE A CA  1 
ATOM   1769  C C   . ILE A 1 240 ? 50.912  2.228   12.260  1.00 68.52  ? 236  ILE A C   1 
ATOM   1770  O O   . ILE A 1 240 ? 50.370  2.914   13.132  1.00 67.76  ? 236  ILE A O   1 
ATOM   1771  C CB  . ILE A 1 240 ? 53.407  2.000   12.890  1.00 74.45  ? 236  ILE A CB  1 
ATOM   1772  C CG1 . ILE A 1 240 ? 53.346  2.870   14.154  1.00 75.12  ? 236  ILE A CG1 1 
ATOM   1773  C CG2 . ILE A 1 240 ? 53.882  2.790   11.655  1.00 75.08  ? 236  ILE A CG2 1 
ATOM   1774  C CD1 . ILE A 1 240 ? 53.724  2.139   15.434  1.00 76.83  ? 236  ILE A CD1 1 
ATOM   1775  N N   . GLY A 1 241 ? 50.551  2.267   10.978  1.00 67.14  ? 237  GLY A N   1 
ATOM   1776  C CA  . GLY A 1 241 ? 49.536  3.193   10.475  1.00 64.80  ? 237  GLY A CA  1 
ATOM   1777  C C   . GLY A 1 241 ? 48.135  2.617   10.378  1.00 61.81  ? 237  GLY A C   1 
ATOM   1778  O O   . GLY A 1 241 ? 47.198  3.325   10.002  1.00 60.35  ? 237  GLY A O   1 
ATOM   1779  N N   . ILE A 1 242 ? 47.992  1.335   10.710  1.00 61.09  ? 238  ILE A N   1 
ATOM   1780  C CA  . ILE A 1 242 ? 46.693  0.659   10.691  1.00 58.38  ? 238  ILE A CA  1 
ATOM   1781  C C   . ILE A 1 242 ? 46.068  0.649   12.087  1.00 57.30  ? 238  ILE A C   1 
ATOM   1782  O O   . ILE A 1 242 ? 46.704  0.247   13.062  1.00 58.68  ? 238  ILE A O   1 
ATOM   1783  C CB  . ILE A 1 242 ? 46.802  -0.776  10.109  1.00 58.61  ? 238  ILE A CB  1 
ATOM   1784  C CG1 . ILE A 1 242 ? 47.017  -0.714  8.595   1.00 58.75  ? 238  ILE A CG1 1 
ATOM   1785  C CG2 . ILE A 1 242 ? 45.556  -1.597  10.427  1.00 56.70  ? 238  ILE A CG2 1 
ATOM   1786  C CD1 . ILE A 1 242 ? 47.415  -2.034  7.963   1.00 59.53  ? 238  ILE A CD1 1 
ATOM   1787  N N   . ASP A 1 243 ? 44.819  1.097   12.167  1.00 54.91  ? 239  ASP A N   1 
ATOM   1788  C CA  . ASP A 1 243 ? 44.126  1.264   13.441  1.00 53.70  ? 239  ASP A CA  1 
ATOM   1789  C C   . ASP A 1 243 ? 43.429  -0.002  13.938  1.00 52.57  ? 239  ASP A C   1 
ATOM   1790  O O   . ASP A 1 243 ? 43.140  -0.122  15.132  1.00 52.46  ? 239  ASP A O   1 
ATOM   1791  C CB  . ASP A 1 243 ? 43.117  2.411   13.337  1.00 52.25  ? 239  ASP A CB  1 
ATOM   1792  C CG  . ASP A 1 243 ? 43.785  3.772   13.289  1.00 53.37  ? 239  ASP A CG  1 
ATOM   1793  O OD1 . ASP A 1 243 ? 44.192  4.271   14.358  1.00 54.29  ? 239  ASP A OD1 1 
ATOM   1794  O OD2 . ASP A 1 243 ? 43.892  4.346   12.185  1.00 53.59  ? 239  ASP A OD2 1 
ATOM   1795  N N   . LYS A 1 244 ? 43.160  -0.937  13.026  1.00 51.75  ? 240  LYS A N   1 
ATOM   1796  C CA  . LYS A 1 244 ? 42.443  -2.171  13.364  1.00 50.79  ? 240  LYS A CA  1 
ATOM   1797  C C   . LYS A 1 244 ? 42.734  -3.308  12.387  1.00 51.22  ? 240  LYS A C   1 
ATOM   1798  O O   . LYS A 1 244 ? 42.880  -3.079  11.186  1.00 51.07  ? 240  LYS A O   1 
ATOM   1799  C CB  . LYS A 1 244 ? 40.931  -1.921  13.405  1.00 48.60  ? 240  LYS A CB  1 
ATOM   1800  C CG  . LYS A 1 244 ? 40.133  -3.065  14.001  1.00 47.84  ? 240  LYS A CG  1 
ATOM   1801  C CD  . LYS A 1 244 ? 38.764  -3.170  13.370  1.00 46.06  ? 240  LYS A CD  1 
ATOM   1802  C CE  . LYS A 1 244 ? 38.003  -4.360  13.916  1.00 45.80  ? 240  LYS A CE  1 
ATOM   1803  N NZ  . LYS A 1 244 ? 38.668  -5.639  13.565  1.00 47.22  ? 240  LYS A NZ  1 
ATOM   1804  N N   . ILE A 1 245 ? 42.804  -4.530  12.915  1.00 51.78  ? 241  ILE A N   1 
ATOM   1805  C CA  . ILE A 1 245 ? 42.932  -5.733  12.088  1.00 52.25  ? 241  ILE A CA  1 
ATOM   1806  C C   . ILE A 1 245 ? 41.777  -6.710  12.338  1.00 51.25  ? 241  ILE A C   1 
ATOM   1807  O O   . ILE A 1 245 ? 41.372  -6.925  13.484  1.00 51.18  ? 241  ILE A O   1 
ATOM   1808  C CB  . ILE A 1 245 ? 44.312  -6.431  12.270  1.00 54.76  ? 241  ILE A CB  1 
ATOM   1809  C CG1 . ILE A 1 245 ? 44.452  -7.612  11.300  1.00 55.44  ? 241  ILE A CG1 1 
ATOM   1810  C CG2 . ILE A 1 245 ? 44.531  -6.863  13.727  1.00 55.94  ? 241  ILE A CG2 1 
ATOM   1811  C CD1 . ILE A 1 245 ? 45.875  -7.977  10.943  1.00 57.69  ? 241  ILE A CD1 1 
ATOM   1812  N N   . ALA A 1 246 ? 41.247  -7.283  11.258  1.00 50.63  ? 242  ALA A N   1 
ATOM   1813  C CA  . ALA A 1 246 ? 40.183  -8.286  11.345  1.00 50.01  ? 242  ALA A CA  1 
ATOM   1814  C C   . ALA A 1 246 ? 40.552  -9.536  10.554  1.00 51.34  ? 242  ALA A C   1 
ATOM   1815  O O   . ALA A 1 246 ? 40.502  -9.554  9.322   1.00 51.21  ? 242  ALA A O   1 
ATOM   1816  C CB  . ALA A 1 246 ? 38.855  -7.713  10.868  1.00 47.94  ? 242  ALA A CB  1 
ATOM   1817  N N   . PHE A 1 247 ? 40.927  -10.579 11.283  1.00 52.86  ? 243  PHE A N   1 
ATOM   1818  C CA  . PHE A 1 247 ? 41.414  -11.808 10.682  1.00 54.60  ? 243  PHE A CA  1 
ATOM   1819  C C   . PHE A 1 247 ? 40.374  -12.916 10.750  1.00 54.60  ? 243  PHE A C   1 
ATOM   1820  O O   . PHE A 1 247 ? 39.616  -13.015 11.711  1.00 54.11  ? 243  PHE A O   1 
ATOM   1821  C CB  . PHE A 1 247 ? 42.714  -12.251 11.366  1.00 56.97  ? 243  PHE A CB  1 
ATOM   1822  C CG  . PHE A 1 247 ? 43.173  -13.629 10.972  1.00 59.21  ? 243  PHE A CG  1 
ATOM   1823  C CD1 . PHE A 1 247 ? 42.948  -14.718 11.814  1.00 60.69  ? 243  PHE A CD1 1 
ATOM   1824  C CD2 . PHE A 1 247 ? 43.824  -13.842 9.761   1.00 59.84  ? 243  PHE A CD2 1 
ATOM   1825  C CE1 . PHE A 1 247 ? 43.365  -15.999 11.454  1.00 63.06  ? 243  PHE A CE1 1 
ATOM   1826  C CE2 . PHE A 1 247 ? 44.245  -15.116 9.395   1.00 62.24  ? 243  PHE A CE2 1 
ATOM   1827  C CZ  . PHE A 1 247 ? 44.016  -16.198 10.244  1.00 63.76  ? 243  PHE A CZ  1 
ATOM   1828  N N   . THR A 1 248 ? 40.352  -13.742 9.711   1.00 55.50  ? 244  THR A N   1 
ATOM   1829  C CA  . THR A 1 248 ? 39.556  -14.960 9.683   1.00 56.27  ? 244  THR A CA  1 
ATOM   1830  C C   . THR A 1 248 ? 40.414  -16.069 9.074   1.00 58.88  ? 244  THR A C   1 
ATOM   1831  O O   . THR A 1 248 ? 41.064  -15.864 8.047   1.00 59.35  ? 244  THR A O   1 
ATOM   1832  C CB  . THR A 1 248 ? 38.255  -14.768 8.868   1.00 54.51  ? 244  THR A CB  1 
ATOM   1833  O OG1 . THR A 1 248 ? 37.512  -13.665 9.401   1.00 52.42  ? 244  THR A OG1 1 
ATOM   1834  C CG2 . THR A 1 248 ? 37.383  -16.016 8.912   1.00 55.32  ? 244  THR A CG2 1 
ATOM   1835  N N   . GLY A 1 249 ? 40.428  -17.232 9.721   1.00 60.87  ? 245  GLY A N   1 
ATOM   1836  C CA  . GLY A 1 249 ? 41.189  -18.376 9.231   1.00 63.63  ? 245  GLY A CA  1 
ATOM   1837  C C   . GLY A 1 249 ? 41.547  -19.362 10.322  1.00 66.22  ? 245  GLY A C   1 
ATOM   1838  O O   . GLY A 1 249 ? 40.772  -19.574 11.257  1.00 65.86  ? 245  GLY A O   1 
ATOM   1839  N N   . SER A 1 250 ? 42.727  -19.964 10.196  1.00 68.99  ? 246  SER A N   1 
ATOM   1840  C CA  . SER A 1 250 ? 43.201  -20.960 11.153  1.00 72.03  ? 246  SER A CA  1 
ATOM   1841  C C   . SER A 1 250 ? 43.668  -20.330 12.465  1.00 72.27  ? 246  SER A C   1 
ATOM   1842  O O   . SER A 1 250 ? 44.057  -19.159 12.506  1.00 70.65  ? 246  SER A O   1 
ATOM   1843  C CB  . SER A 1 250 ? 44.305  -21.832 10.538  1.00 75.12  ? 246  SER A CB  1 
ATOM   1844  O OG  . SER A 1 250 ? 45.432  -21.061 10.160  1.00 75.19  ? 246  SER A OG  1 
ATOM   1845  N N   . THR A 1 251 ? 43.624  -21.129 13.528  1.00 74.58  ? 247  THR A N   1 
ATOM   1846  C CA  . THR A 1 251 ? 43.911  -20.675 14.890  1.00 75.29  ? 247  THR A CA  1 
ATOM   1847  C C   . THR A 1 251 ? 45.386  -20.340 15.136  1.00 77.38  ? 247  THR A C   1 
ATOM   1848  O O   . THR A 1 251 ? 45.696  -19.453 15.933  1.00 76.95  ? 247  THR A O   1 
ATOM   1849  C CB  . THR A 1 251 ? 43.461  -21.723 15.932  1.00 77.45  ? 247  THR A CB  1 
ATOM   1850  O OG1 . THR A 1 251 ? 43.943  -23.015 15.545  1.00 80.81  ? 247  THR A OG1 1 
ATOM   1851  C CG2 . THR A 1 251 ? 41.944  -21.774 16.035  1.00 75.29  ? 247  THR A CG2 1 
ATOM   1852  N N   . GLU A 1 252 ? 46.284  -21.047 14.454  1.00 79.92  ? 248  GLU A N   1 
ATOM   1853  C CA  . GLU A 1 252 ? 47.726  -20.888 14.670  1.00 82.57  ? 248  GLU A CA  1 
ATOM   1854  C C   . GLU A 1 252 ? 48.323  -19.708 13.904  1.00 80.90  ? 248  GLU A C   1 
ATOM   1855  O O   . GLU A 1 252 ? 49.492  -19.362 14.086  1.00 82.70  ? 248  GLU A O   1 
ATOM   1856  C CB  . GLU A 1 252 ? 48.462  -22.187 14.338  1.00 86.34  ? 248  GLU A CB  1 
ATOM   1857  C CG  . GLU A 1 252 ? 48.012  -23.366 15.195  1.00 89.18  ? 248  GLU A CG  1 
ATOM   1858  C CD  . GLU A 1 252 ? 48.810  -24.632 14.947  1.00 94.05  ? 248  GLU A CD  1 
ATOM   1859  O OE1 . GLU A 1 252 ? 49.429  -24.763 13.869  1.00 94.93  ? 248  GLU A OE1 1 
ATOM   1860  O OE2 . GLU A 1 252 ? 48.813  -25.508 15.838  1.00 97.15  ? 248  GLU A OE2 1 
ATOM   1861  N N   . VAL A 1 253 ? 47.508  -19.098 13.048  1.00 77.80  ? 249  VAL A N   1 
ATOM   1862  C CA  . VAL A 1 253 ? 47.870  -17.867 12.353  1.00 75.99  ? 249  VAL A CA  1 
ATOM   1863  C C   . VAL A 1 253 ? 47.281  -16.672 13.107  1.00 73.52  ? 249  VAL A C   1 
ATOM   1864  O O   . VAL A 1 253 ? 47.904  -15.612 13.204  1.00 73.04  ? 249  VAL A O   1 
ATOM   1865  C CB  . VAL A 1 253 ? 47.389  -17.894 10.884  1.00 74.38  ? 249  VAL A CB  1 
ATOM   1866  C CG1 . VAL A 1 253 ? 47.620  -16.553 10.202  1.00 72.37  ? 249  VAL A CG1 1 
ATOM   1867  C CG2 . VAL A 1 253 ? 48.096  -19.006 10.120  1.00 77.04  ? 249  VAL A CG2 1 
ATOM   1868  N N   . GLY A 1 254 ? 46.083  -16.863 13.652  1.00 72.14  ? 250  GLY A N   1 
ATOM   1869  C CA  . GLY A 1 254 ? 45.441  -15.861 14.495  1.00 70.30  ? 250  GLY A CA  1 
ATOM   1870  C C   . GLY A 1 254 ? 46.195  -15.553 15.780  1.00 72.17  ? 250  GLY A C   1 
ATOM   1871  O O   . GLY A 1 254 ? 46.107  -14.438 16.303  1.00 70.84  ? 250  GLY A O   1 
ATOM   1872  N N   . LYS A 1 255 ? 46.930  -16.540 16.293  1.00 75.55  ? 251  LYS A N   1 
ATOM   1873  C CA  . LYS A 1 255 ? 47.777  -16.343 17.471  1.00 77.94  ? 251  LYS A CA  1 
ATOM   1874  C C   . LYS A 1 255 ? 48.950  -15.419 17.152  1.00 78.57  ? 251  LYS A C   1 
ATOM   1875  O O   . LYS A 1 255 ? 49.371  -14.623 17.997  1.00 79.03  ? 251  LYS A O   1 
ATOM   1876  C CB  . LYS A 1 255 ? 48.280  -17.683 18.027  1.00 81.69  ? 251  LYS A CB  1 
ATOM   1877  C CG  . LYS A 1 255 ? 47.286  -18.402 18.938  1.00 81.85  ? 251  LYS A CG  1 
ATOM   1878  C CD  . LYS A 1 255 ? 47.969  -19.465 19.798  1.00 86.12  ? 251  LYS A CD  1 
ATOM   1879  C CE  . LYS A 1 255 ? 47.018  -20.043 20.842  1.00 86.32  ? 251  LYS A CE  1 
ATOM   1880  N NZ  . LYS A 1 255 ? 47.678  -21.061 21.704  1.00 90.63  ? 251  LYS A NZ  1 
ATOM   1881  N N   . LEU A 1 256 ? 49.461  -15.527 15.926  1.00 78.77  ? 252  LEU A N   1 
ATOM   1882  C CA  . LEU A 1 256 ? 50.540  -14.664 15.449  1.00 79.42  ? 252  LEU A CA  1 
ATOM   1883  C C   . LEU A 1 256 ? 50.047  -13.260 15.082  1.00 76.27  ? 252  LEU A C   1 
ATOM   1884  O O   . LEU A 1 256 ? 50.846  -12.329 14.986  1.00 76.82  ? 252  LEU A O   1 
ATOM   1885  C CB  . LEU A 1 256 ? 51.271  -15.297 14.255  1.00 80.89  ? 252  LEU A CB  1 
ATOM   1886  C CG  . LEU A 1 256 ? 52.018  -16.630 14.416  1.00 84.73  ? 252  LEU A CG  1 
ATOM   1887  C CD1 . LEU A 1 256 ? 52.602  -17.068 13.077  1.00 85.52  ? 252  LEU A CD1 1 
ATOM   1888  C CD2 . LEU A 1 256 ? 53.114  -16.566 15.483  1.00 87.86  ? 252  LEU A CD2 1 
ATOM   1889  N N   . ILE A 1 257 ? 48.738  -13.112 14.878  1.00 111.20 ? 253  ILE A N   1 
ATOM   1890  C CA  . ILE A 1 257 ? 48.154  -11.811 14.543  1.00 107.66 ? 253  ILE A CA  1 
ATOM   1891  C C   . ILE A 1 257 ? 48.086  -10.887 15.765  1.00 108.25 ? 253  ILE A C   1 
ATOM   1892  O O   . ILE A 1 257 ? 48.552  -9.747  15.704  1.00 109.09 ? 253  ILE A O   1 
ATOM   1893  C CB  . ILE A 1 257 ? 46.762  -11.954 13.854  1.00 102.49 ? 253  ILE A CB  1 
ATOM   1894  C CG1 . ILE A 1 257 ? 46.902  -12.583 12.460  1.00 102.18 ? 253  ILE A CG1 1 
ATOM   1895  C CG2 . ILE A 1 257 ? 46.032  -10.607 13.775  1.00 99.05  ? 253  ILE A CG2 1 
ATOM   1896  C CD1 . ILE A 1 257 ? 47.799  -11.822 11.491  1.00 103.25 ? 253  ILE A CD1 1 
ATOM   1897  N N   . GLN A 1 258 ? 47.515  -11.384 16.863  1.00 108.16 ? 254  GLN A N   1 
ATOM   1898  C CA  . GLN A 1 258 ? 47.432  -10.625 18.114  1.00 109.33 ? 254  GLN A CA  1 
ATOM   1899  C C   . GLN A 1 258 ? 48.802  -10.210 18.637  1.00 114.81 ? 254  GLN A C   1 
ATOM   1900  O O   . GLN A 1 258 ? 48.991  -9.066  19.057  1.00 115.80 ? 254  GLN A O   1 
ATOM   1901  C CB  . GLN A 1 258 ? 46.703  -11.425 19.193  1.00 109.08 ? 254  GLN A CB  1 
ATOM   1902  C CG  . GLN A 1 258 ? 45.301  -10.931 19.492  1.00 104.94 ? 254  GLN A CG  1 
ATOM   1903  C CD  . GLN A 1 258 ? 44.879  -11.193 20.928  1.00 106.57 ? 254  GLN A CD  1 
ATOM   1904  O OE1 . GLN A 1 258 ? 45.167  -12.248 21.496  1.00 109.17 ? 254  GLN A OE1 1 
ATOM   1905  N NE2 . GLN A 1 258 ? 44.187  -10.228 21.520  1.00 105.30 ? 254  GLN A NE2 1 
ATOM   1906  N N   . GLU A 1 259 ? 49.743  -11.152 18.608  1.00 118.74 ? 255  GLU A N   1 
ATOM   1907  C CA  . GLU A 1 259 ? 51.115  -10.930 19.061  1.00 124.68 ? 255  GLU A CA  1 
ATOM   1908  C C   . GLU A 1 259 ? 51.812  -9.831  18.251  1.00 125.38 ? 255  GLU A C   1 
ATOM   1909  O O   . GLU A 1 259 ? 52.467  -8.953  18.820  1.00 128.78 ? 255  GLU A O   1 
ATOM   1910  C CB  . GLU A 1 259 ? 51.906  -12.241 18.989  1.00 128.57 ? 255  GLU A CB  1 
ATOM   1911  C CG  . GLU A 1 259 ? 53.308  -12.181 19.590  1.00 135.71 ? 255  GLU A CG  1 
ATOM   1912  C CD  . GLU A 1 259 ? 54.088  -13.471 19.396  1.00 140.02 ? 255  GLU A CD  1 
ATOM   1913  O OE1 . GLU A 1 259 ? 53.550  -14.554 19.713  1.00 139.34 ? 255  GLU A OE1 1 
ATOM   1914  O OE2 . GLU A 1 259 ? 55.247  -13.400 18.933  1.00 144.38 ? 255  GLU A OE2 1 
ATOM   1915  N N   . ALA A 1 260 ? 51.660  -9.886  16.929  1.00 122.41 ? 256  ALA A N   1 
ATOM   1916  C CA  . ALA A 1 260 ? 52.244  -8.893  16.027  1.00 122.66 ? 256  ALA A CA  1 
ATOM   1917  C C   . ALA A 1 260 ? 51.597  -7.523  16.200  1.00 119.77 ? 256  ALA A C   1 
ATOM   1918  O O   . ALA A 1 260 ? 52.228  -6.496  15.949  1.00 121.57 ? 256  ALA A O   1 
ATOM   1919  C CB  . ALA A 1 260 ? 52.130  -9.354  14.583  1.00 120.29 ? 256  ALA A CB  1 
ATOM   1920  N N   . ALA A 1 261 ? 50.338  -7.520  16.630  1.00 115.56 ? 257  ALA A N   1 
ATOM   1921  C CA  . ALA A 1 261 ? 49.593  -6.289  16.868  1.00 112.82 ? 257  ALA A CA  1 
ATOM   1922  C C   . ALA A 1 261 ? 49.995  -5.632  18.186  1.00 116.55 ? 257  ALA A C   1 
ATOM   1923  C CB  . ALA A 1 261 ? 48.103  -6.564  16.846  1.00 107.57 ? 257  ALA A CB  1 
ATOM   1924  N N   . GLY A 1 262 ? 50.212  -6.453  19.210  1.00 119.30 ? 258  GLY A N   1 
ATOM   1925  C CA  . GLY A 1 262 ? 50.589  -5.958  20.530  1.00 123.42 ? 258  GLY A CA  1 
ATOM   1926  C C   . GLY A 1 262 ? 51.995  -5.396  20.580  1.00 129.09 ? 258  GLY A C   1 
ATOM   1927  O O   . GLY A 1 262 ? 52.294  -4.513  21.388  1.00 132.37 ? 258  GLY A O   1 
ATOM   1928  N N   . ARG A 1 263 ? 52.861  -5.915  19.714  1.00 130.58 ? 259  ARG A N   1 
ATOM   1929  C CA  . ARG A 1 263 ? 54.232  -5.437  19.615  1.00 136.10 ? 259  ARG A CA  1 
ATOM   1930  C C   . ARG A 1 263 ? 54.392  -4.363  18.542  1.00 134.38 ? 259  ARG A C   1 
ATOM   1931  O O   . ARG A 1 263 ? 55.504  -3.903  18.277  1.00 138.75 ? 259  ARG A O   1 
ATOM   1932  C CB  . ARG A 1 263 ? 55.193  -6.604  19.379  1.00 139.88 ? 259  ARG A CB  1 
ATOM   1933  C CG  . ARG A 1 263 ? 55.578  -7.322  20.657  1.00 144.79 ? 259  ARG A CG  1 
ATOM   1934  C CD  . ARG A 1 263 ? 56.842  -8.146  20.491  1.00 150.84 ? 259  ARG A CD  1 
ATOM   1935  N NE  . ARG A 1 263 ? 56.558  -9.560  20.253  1.00 149.66 ? 259  ARG A NE  1 
ATOM   1936  C CZ  . ARG A 1 263 ? 57.435  -10.546 20.433  1.00 154.79 ? 259  ARG A CZ  1 
ATOM   1937  N NH1 . ARG A 1 263 ? 58.667  -10.288 20.857  1.00 161.77 ? 259  ARG A NH1 1 
ATOM   1938  N NH2 . ARG A 1 263 ? 57.077  -11.799 20.191  1.00 153.30 ? 259  ARG A NH2 1 
ATOM   1939  N N   . SER A 1 264 ? 53.277  -3.960  17.935  1.00 128.26 ? 260  SER A N   1 
ATOM   1940  C CA  . SER A 1 264 ? 53.284  -2.889  16.942  1.00 126.27 ? 260  SER A CA  1 
ATOM   1941  C C   . SER A 1 264 ? 52.682  -1.601  17.503  1.00 125.24 ? 260  SER A C   1 
ATOM   1942  O O   . SER A 1 264 ? 53.388  -0.810  18.130  1.00 129.88 ? 260  SER A O   1 
ATOM   1943  C CB  . SER A 1 264 ? 52.568  -3.322  15.660  1.00 120.80 ? 260  SER A CB  1 
ATOM   1944  O OG  . SER A 1 264 ? 51.233  -3.705  15.931  1.00 116.09 ? 260  SER A OG  1 
ATOM   1945  N N   . ASN A 1 265 ? 51.384  -1.398  17.287  1.00 119.55 ? 261  ASN A N   1 
ATOM   1946  C CA  . ASN A 1 265 ? 50.709  -0.176  17.725  1.00 118.30 ? 261  ASN A CA  1 
ATOM   1947  C C   . ASN A 1 265 ? 49.479  -0.432  18.590  1.00 115.39 ? 261  ASN A C   1 
ATOM   1948  O O   . ASN A 1 265 ? 48.694  0.484   18.849  1.00 113.62 ? 261  ASN A O   1 
ATOM   1949  C CB  . ASN A 1 265 ? 50.348  0.704   16.520  1.00 114.84 ? 261  ASN A CB  1 
ATOM   1950  C CG  . ASN A 1 265 ? 49.394  0.021   15.550  1.00 109.13 ? 261  ASN A CG  1 
ATOM   1951  O OD1 . ASN A 1 265 ? 49.113  -1.174  15.659  1.00 107.74 ? 261  ASN A OD1 1 
ATOM   1952  N ND2 . ASN A 1 265 ? 48.894  0.786   14.586  1.00 105.84 ? 261  ASN A ND2 1 
ATOM   1953  N N   . LEU A 1 266 ? 49.330  -1.681  19.032  1.00 115.14 ? 262  LEU A N   1 
ATOM   1954  C CA  . LEU A 1 266 ? 48.198  -2.116  19.856  1.00 112.67 ? 262  LEU A CA  1 
ATOM   1955  C C   . LEU A 1 266 ? 46.849  -1.847  19.181  1.00 106.65 ? 262  LEU A C   1 
ATOM   1956  O O   . LEU A 1 266 ? 45.894  -1.402  19.822  1.00 105.08 ? 262  LEU A O   1 
ATOM   1957  C CB  . LEU A 1 266 ? 48.253  -1.475  21.252  1.00 116.45 ? 262  LEU A CB  1 
ATOM   1958  C CG  . LEU A 1 266 ? 49.499  -1.701  22.114  1.00 123.16 ? 262  LEU A CG  1 
ATOM   1959  C CD1 . LEU A 1 266 ? 49.637  -0.591  23.148  1.00 127.18 ? 262  LEU A CD1 1 
ATOM   1960  C CD2 . LEU A 1 266 ? 49.477  -3.070  22.784  1.00 124.13 ? 262  LEU A CD2 1 
ATOM   1961  N N   . LYS A 1 267 ? 46.785  -2.121  17.880  1.00 103.66 ? 263  LYS A N   1 
ATOM   1962  C CA  . LYS A 1 267 ? 45.551  -1.985  17.109  1.00 98.35  ? 263  LYS A CA  1 
ATOM   1963  C C   . LYS A 1 267 ? 44.503  -2.975  17.603  1.00 95.84  ? 263  LYS A C   1 
ATOM   1964  O O   . LYS A 1 267 ? 44.848  -4.047  18.101  1.00 97.59  ? 263  LYS A O   1 
ATOM   1965  C CB  . LYS A 1 267 ? 45.821  -2.202  15.615  1.00 96.52  ? 263  LYS A CB  1 
ATOM   1966  C CG  . LYS A 1 267 ? 46.466  -3.547  15.269  1.00 97.54  ? 263  LYS A CG  1 
ATOM   1967  C CD  . LYS A 1 267 ? 46.646  -3.742  13.764  1.00 95.71  ? 263  LYS A CD  1 
ATOM   1968  C CE  . LYS A 1 267 ? 47.827  -2.950  13.200  1.00 98.72  ? 263  LYS A CE  1 
ATOM   1969  N NZ  . LYS A 1 267 ? 49.135  -3.310  13.818  1.00 103.73 ? 263  LYS A NZ  1 
ATOM   1970  N N   . ARG A 1 268 ? 43.230  -2.609  17.476  1.00 92.08  ? 264  ARG A N   1 
ATOM   1971  C CA  . ARG A 1 268 ? 42.141  -3.505  17.854  1.00 89.65  ? 264  ARG A CA  1 
ATOM   1972  C C   . ARG A 1 268 ? 42.220  -4.788  17.036  1.00 88.36  ? 264  ARG A C   1 
ATOM   1973  O O   . ARG A 1 268 ? 42.400  -4.748  15.817  1.00 87.03  ? 264  ARG A O   1 
ATOM   1974  C CB  . ARG A 1 268 ? 40.775  -2.841  17.660  1.00 86.06  ? 264  ARG A CB  1 
ATOM   1975  C CG  . ARG A 1 268 ? 40.466  -1.703  18.623  1.00 87.67  ? 264  ARG A CG  1 
ATOM   1976  C CD  . ARG A 1 268 ? 40.727  -0.341  17.990  1.00 88.40  ? 264  ARG A CD  1 
ATOM   1977  N NE  . ARG A 1 268 ? 40.154  0.753   18.776  1.00 89.64  ? 264  ARG A NE  1 
ATOM   1978  C CZ  . ARG A 1 268 ? 38.895  1.180   18.682  1.00 86.98  ? 264  ARG A CZ  1 
ATOM   1979  N NH1 . ARG A 1 268 ? 38.046  0.611   17.837  1.00 83.29  ? 264  ARG A NH1 1 
ATOM   1980  N NH2 . ARG A 1 268 ? 38.479  2.183   19.442  1.00 88.53  ? 264  ARG A NH2 1 
ATOM   1981  N N   . VAL A 1 269 ? 42.107  -5.924  17.715  1.00 89.14  ? 265  VAL A N   1 
ATOM   1982  C CA  . VAL A 1 269 ? 42.178  -7.217  17.047  1.00 88.59  ? 265  VAL A CA  1 
ATOM   1983  C C   . VAL A 1 269 ? 40.847  -7.950  17.138  1.00 85.56  ? 265  VAL A C   1 
ATOM   1984  O O   . VAL A 1 269 ? 40.293  -8.127  18.224  1.00 85.77  ? 265  VAL A O   1 
ATOM   1985  C CB  . VAL A 1 269 ? 43.295  -8.118  17.623  1.00 92.70  ? 265  VAL A CB  1 
ATOM   1986  C CG1 . VAL A 1 269 ? 43.520  -9.324  16.721  1.00 92.60  ? 265  VAL A CG1 1 
ATOM   1987  C CG2 . VAL A 1 269 ? 44.587  -7.343  17.777  1.00 96.62  ? 265  VAL A CG2 1 
ATOM   1988  N N   . THR A 1 270 ? 40.342  -8.360  15.980  1.00 83.11  ? 266  THR A N   1 
ATOM   1989  C CA  . THR A 1 270 ? 39.182  -9.230  15.901  1.00 80.86  ? 266  THR A CA  1 
ATOM   1990  C C   . THR A 1 270 ? 39.593  -10.502 15.174  1.00 81.77  ? 266  THR A C   1 
ATOM   1991  O O   . THR A 1 270 ? 40.022  -10.458 14.020  1.00 81.73  ? 266  THR A O   1 
ATOM   1992  C CB  . THR A 1 270 ? 38.003  -8.558  15.165  1.00 77.32  ? 266  THR A CB  1 
ATOM   1993  O OG1 . THR A 1 270 ? 37.684  -7.311  15.798  1.00 76.92  ? 266  THR A OG1 1 
ATOM   1994  C CG2 . THR A 1 270 ? 36.773  -9.459  15.182  1.00 75.48  ? 266  THR A CG2 1 
ATOM   1995  N N   . LEU A 1 271 ? 39.469  -11.629 15.864  1.00 82.98  ? 267  LEU A N   1 
ATOM   1996  C CA  . LEU A 1 271 ? 39.812  -12.922 15.291  1.00 84.33  ? 267  LEU A CA  1 
ATOM   1997  C C   . LEU A 1 271 ? 38.562  -13.747 15.045  1.00 82.28  ? 267  LEU A C   1 
ATOM   1998  O O   . LEU A 1 271 ? 37.669  -13.801 15.891  1.00 81.12  ? 267  LEU A O   1 
ATOM   1999  C CB  . LEU A 1 271 ? 40.759  -13.691 16.215  1.00 88.09  ? 267  LEU A CB  1 
ATOM   2000  C CG  . LEU A 1 271 ? 42.103  -13.064 16.587  1.00 91.17  ? 267  LEU A CG  1 
ATOM   2001  C CD1 . LEU A 1 271 ? 42.702  -13.810 17.761  1.00 94.73  ? 267  LEU A CD1 1 
ATOM   2002  C CD2 . LEU A 1 271 ? 43.064  -13.052 15.405  1.00 92.46  ? 267  LEU A CD2 1 
ATOM   2003  N N   . GLU A 1 272 ? 38.505  -14.378 13.878  1.00 82.26  ? 268  GLU A N   1 
ATOM   2004  C CA  . GLU A 1 272 ? 37.445  -15.323 13.561  1.00 81.37  ? 268  GLU A CA  1 
ATOM   2005  C C   . GLU A 1 272 ? 38.083  -16.673 13.242  1.00 84.29  ? 268  GLU A C   1 
ATOM   2006  O O   . GLU A 1 272 ? 38.319  -17.012 12.080  1.00 84.85  ? 268  GLU A O   1 
ATOM   2007  C CB  . GLU A 1 272 ? 36.582  -14.811 12.404  1.00 78.84  ? 268  GLU A CB  1 
ATOM   2008  C CG  . GLU A 1 272 ? 35.248  -15.540 12.239  1.00 77.91  ? 268  GLU A CG  1 
ATOM   2009  C CD  . GLU A 1 272 ? 34.377  -14.955 11.138  1.00 76.33  ? 268  GLU A CD  1 
ATOM   2010  O OE1 . GLU A 1 272 ? 34.847  -14.063 10.398  1.00 76.13  ? 268  GLU A OE1 1 
ATOM   2011  O OE2 . GLU A 1 272 ? 33.214  -15.393 11.013  1.00 75.61  ? 268  GLU A OE2 1 
ATOM   2012  N N   . LEU A 1 273 ? 38.365  -17.431 14.299  1.00 86.50  ? 269  LEU A N   1 
ATOM   2013  C CA  . LEU A 1 273 ? 39.105  -18.686 14.195  1.00 90.01  ? 269  LEU A CA  1 
ATOM   2014  C C   . LEU A 1 273 ? 38.183  -19.890 14.010  1.00 90.02  ? 269  LEU A C   1 
ATOM   2015  O O   . LEU A 1 273 ? 36.962  -19.740 13.953  1.00 87.35  ? 269  LEU A O   1 
ATOM   2016  C CB  . LEU A 1 273 ? 40.006  -18.870 15.422  1.00 92.93  ? 269  LEU A CB  1 
ATOM   2017  C CG  . LEU A 1 273 ? 40.989  -17.749 15.789  1.00 94.06  ? 269  LEU A CG  1 
ATOM   2018  C CD1 . LEU A 1 273 ? 41.758  -18.106 17.056  1.00 97.61  ? 269  LEU A CD1 1 
ATOM   2019  C CD2 . LEU A 1 273 ? 41.954  -17.427 14.648  1.00 95.32  ? 269  LEU A CD2 1 
ATOM   2020  N N   . GLY A 1 274 ? 38.775  -21.080 13.914  1.00 93.44  ? 270  GLY A N   1 
ATOM   2021  C CA  . GLY A 1 274 ? 38.023  -22.315 13.688  1.00 94.29  ? 270  GLY A CA  1 
ATOM   2022  C C   . GLY A 1 274 ? 37.332  -22.859 14.926  1.00 94.26  ? 270  GLY A C   1 
ATOM   2023  O O   . GLY A 1 274 ? 36.782  -22.102 15.731  1.00 92.02  ? 270  GLY A O   1 
ATOM   2024  N N   . GLY A 1 275 ? 37.358  -24.180 15.074  1.00 97.05  ? 271  GLY A N   1 
ATOM   2025  C CA  . GLY A 1 275 ? 36.708  -24.846 16.201  1.00 97.48  ? 271  GLY A CA  1 
ATOM   2026  C C   . GLY A 1 275 ? 35.569  -25.748 15.765  1.00 97.22  ? 271  GLY A C   1 
ATOM   2027  O O   . GLY A 1 275 ? 34.861  -25.445 14.800  1.00 95.36  ? 271  GLY A O   1 
ATOM   2028  N N   . LYS A 1 276 ? 35.393  -26.853 16.488  1.00 99.40  ? 272  LYS A N   1 
ATOM   2029  C CA  . LYS A 1 276 ? 34.383  -27.868 16.162  1.00 99.91  ? 272  LYS A CA  1 
ATOM   2030  C C   . LYS A 1 276 ? 32.948  -27.336 16.182  1.00 96.22  ? 272  LYS A C   1 
ATOM   2031  O O   . LYS A 1 276 ? 32.666  -26.293 16.777  1.00 93.51  ? 272  LYS A O   1 
ATOM   2032  C CB  . LYS A 1 276 ? 34.517  -29.093 17.078  1.00 103.23 ? 272  LYS A CB  1 
ATOM   2033  C CG  . LYS A 1 276 ? 34.788  -28.765 18.541  1.00 103.42 ? 272  LYS A CG  1 
ATOM   2034  C CD  . LYS A 1 276 ? 34.582  -29.965 19.447  1.00 106.57 ? 272  LYS A CD  1 
ATOM   2035  C CE  . LYS A 1 276 ? 33.161  -30.012 19.982  1.00 104.52 ? 272  LYS A CE  1 
ATOM   2036  N NZ  . LYS A 1 276 ? 33.066  -30.843 21.213  1.00 106.95 ? 272  LYS A NZ  1 
ATOM   2037  N N   . SER A 1 277 ? 32.056  -28.061 15.512  1.00 96.51  ? 273  SER A N   1 
ATOM   2038  C CA  . SER A 1 277 ? 30.648  -27.684 15.409  1.00 93.60  ? 273  SER A CA  1 
ATOM   2039  C C   . SER A 1 277 ? 29.733  -28.915 15.489  1.00 95.31  ? 273  SER A C   1 
ATOM   2040  O O   . SER A 1 277 ? 29.389  -29.507 14.462  1.00 96.88  ? 273  SER A O   1 
ATOM   2041  C CB  . SER A 1 277 ? 30.401  -26.884 14.125  1.00 91.79  ? 273  SER A CB  1 
ATOM   2042  O OG  . SER A 1 277 ? 29.019  -26.800 13.823  1.00 90.60  ? 273  SER A OG  1 
ATOM   2043  N N   . PRO A 1 278 ? 29.334  -29.299 16.716  1.00 95.26  ? 274  PRO A N   1 
ATOM   2044  C CA  . PRO A 1 278 ? 28.572  -30.528 16.929  1.00 97.40  ? 274  PRO A CA  1 
ATOM   2045  C C   . PRO A 1 278 ? 27.102  -30.441 16.511  1.00 95.89  ? 274  PRO A C   1 
ATOM   2046  O O   . PRO A 1 278 ? 26.407  -29.486 16.863  1.00 92.89  ? 274  PRO A O   1 
ATOM   2047  C CB  . PRO A 1 278 ? 28.683  -30.747 18.440  1.00 97.83  ? 274  PRO A CB  1 
ATOM   2048  C CG  . PRO A 1 278 ? 28.857  -29.384 19.004  1.00 94.69  ? 274  PRO A CG  1 
ATOM   2049  C CD  . PRO A 1 278 ? 29.629  -28.604 17.984  1.00 93.73  ? 274  PRO A CD  1 
ATOM   2050  N N   . ASN A 1 279 ? 26.652  -31.435 15.748  1.00 98.33  ? 275  ASN A N   1 
ATOM   2051  C CA  . ASN A 1 279 ? 25.230  -31.641 15.496  1.00 98.06  ? 275  ASN A CA  1 
ATOM   2052  C C   . ASN A 1 279 ? 24.688  -32.627 16.516  1.00 99.76  ? 275  ASN A C   1 
ATOM   2053  O O   . ASN A 1 279 ? 25.307  -33.658 16.780  1.00 102.79 ? 275  ASN A O   1 
ATOM   2054  C CB  . ASN A 1 279 ? 24.984  -32.188 14.088  1.00 100.60 ? 275  ASN A CB  1 
ATOM   2055  C CG  . ASN A 1 279 ? 25.173  -31.146 13.004  1.00 98.79  ? 275  ASN A CG  1 
ATOM   2056  O OD1 . ASN A 1 279 ? 26.284  -30.673 12.762  1.00 98.41  ? 275  ASN A OD1 1 
ATOM   2057  N ND2 . ASN A 1 279 ? 24.084  -30.800 12.324  1.00 98.39  ? 275  ASN A ND2 1 
ATOM   2058  N N   . ILE A 1 280 ? 23.541  -32.306 17.101  1.00 97.88  ? 276  ILE A N   1 
ATOM   2059  C CA  . ILE A 1 280 ? 22.885  -33.215 18.033  1.00 99.50  ? 276  ILE A CA  1 
ATOM   2060  C C   . ILE A 1 280 ? 21.517  -33.591 17.480  1.00 100.69 ? 276  ILE A C   1 
ATOM   2061  O O   . ILE A 1 280 ? 20.692  -32.721 17.190  1.00 98.44  ? 276  ILE A O   1 
ATOM   2062  C CB  . ILE A 1 280 ? 22.767  -32.619 19.457  1.00 97.20  ? 276  ILE A CB  1 
ATOM   2063  C CG1 . ILE A 1 280 ? 24.105  -32.022 19.901  1.00 95.73  ? 276  ILE A CG1 1 
ATOM   2064  C CG2 . ILE A 1 280 ? 22.317  -33.693 20.442  1.00 99.65  ? 276  ILE A CG2 1 
ATOM   2065  C CD1 . ILE A 1 280 ? 24.008  -31.062 21.061  1.00 92.98  ? 276  ILE A CD1 1 
ATOM   2066  N N   . ILE A 1 281 ? 21.296  -34.892 17.314  1.00 104.53 ? 277  ILE A N   1 
ATOM   2067  C CA  . ILE A 1 281 ? 20.057  -35.401 16.733  1.00 106.67 ? 277  ILE A CA  1 
ATOM   2068  C C   . ILE A 1 281 ? 19.365  -36.386 17.675  1.00 109.16 ? 277  ILE A C   1 
ATOM   2069  O O   . ILE A 1 281 ? 19.888  -37.468 17.964  1.00 112.22 ? 277  ILE A O   1 
ATOM   2070  C CB  . ILE A 1 281 ? 20.296  -36.021 15.333  1.00 109.84 ? 277  ILE A CB  1 
ATOM   2071  C CG1 . ILE A 1 281 ? 20.737  -34.931 14.351  1.00 107.29 ? 277  ILE A CG1 1 
ATOM   2072  C CG2 . ILE A 1 281 ? 19.034  -36.715 14.819  1.00 113.11 ? 277  ILE A CG2 1 
ATOM   2073  C CD1 . ILE A 1 281 ? 21.404  -35.442 13.097  1.00 110.28 ? 277  ILE A CD1 1 
ATOM   2074  N N   . PHE A 1 282 ? 18.188  -35.983 18.149  1.00 107.94 ? 278  PHE A N   1 
ATOM   2075  C CA  . PHE A 1 282 ? 17.383  -36.779 19.070  1.00 110.08 ? 278  PHE A CA  1 
ATOM   2076  C C   . PHE A 1 282 ? 16.435  -37.719 18.325  1.00 114.33 ? 278  PHE A C   1 
ATOM   2077  O O   . PHE A 1 282 ? 16.186  -37.545 17.130  1.00 115.10 ? 278  PHE A O   1 
ATOM   2078  C CB  . PHE A 1 282 ? 16.592  -35.862 20.006  1.00 107.05 ? 278  PHE A CB  1 
ATOM   2079  C CG  . PHE A 1 282 ? 17.414  -35.260 21.114  1.00 104.10 ? 278  PHE A CG  1 
ATOM   2080  C CD1 . PHE A 1 282 ? 17.373  -35.800 22.395  1.00 105.10 ? 278  PHE A CD1 1 
ATOM   2081  C CD2 . PHE A 1 282 ? 18.216  -34.149 20.884  1.00 100.51 ? 278  PHE A CD2 1 
ATOM   2082  C CE1 . PHE A 1 282 ? 18.123  -35.245 23.429  1.00 102.91 ? 278  PHE A CE1 1 
ATOM   2083  C CE2 . PHE A 1 282 ? 18.970  -33.589 21.911  1.00 98.42  ? 278  PHE A CE2 1 
ATOM   2084  C CZ  . PHE A 1 282 ? 18.923  -34.138 23.185  1.00 99.65  ? 278  PHE A CZ  1 
ATOM   2085  N N   . ALA A 1 283 ? 15.903  -38.702 19.048  1.00 117.37 ? 279  ALA A N   1 
ATOM   2086  C CA  . ALA A 1 283 ? 15.066  -39.756 18.470  1.00 122.31 ? 279  ALA A CA  1 
ATOM   2087  C C   . ALA A 1 283 ? 13.723  -39.274 17.909  1.00 122.61 ? 279  ALA A C   1 
ATOM   2088  O O   . ALA A 1 283 ? 13.203  -39.860 16.956  1.00 126.39 ? 279  ALA A O   1 
ATOM   2089  C CB  . ALA A 1 283 ? 14.843  -40.869 19.491  1.00 125.33 ? 279  ALA A CB  1 
ATOM   2090  N N   . ASP A 1 284 ? 13.169  -38.214 18.497  1.00 119.15 ? 280  ASP A N   1 
ATOM   2091  C CA  . ASP A 1 284 ? 11.844  -37.716 18.106  1.00 119.58 ? 280  ASP A CA  1 
ATOM   2092  C C   . ASP A 1 284 ? 11.850  -36.831 16.851  1.00 118.21 ? 280  ASP A C   1 
ATOM   2093  O O   . ASP A 1 284 ? 10.790  -36.448 16.352  1.00 119.10 ? 280  ASP A O   1 
ATOM   2094  C CB  . ASP A 1 284 ? 11.145  -37.013 19.284  1.00 117.04 ? 280  ASP A CB  1 
ATOM   2095  C CG  . ASP A 1 284 ? 11.967  -35.877 19.871  1.00 112.03 ? 280  ASP A CG  1 
ATOM   2096  O OD1 . ASP A 1 284 ? 12.291  -34.922 19.134  1.00 109.52 ? 280  ASP A OD1 1 
ATOM   2097  O OD2 . ASP A 1 284 ? 12.273  -35.932 21.081  1.00 110.89 ? 280  ASP A OD2 1 
ATOM   2098  N N   . ALA A 1 285 ? 13.043  -36.522 16.347  1.00 116.41 ? 281  ALA A N   1 
ATOM   2099  C CA  . ALA A 1 285 ? 13.199  -35.692 15.152  1.00 115.20 ? 281  ALA A CA  1 
ATOM   2100  C C   . ALA A 1 285 ? 12.742  -36.413 13.885  1.00 120.00 ? 281  ALA A C   1 
ATOM   2101  O O   . ALA A 1 285 ? 12.772  -37.645 13.817  1.00 124.25 ? 281  ALA A O   1 
ATOM   2102  C CB  . ALA A 1 285 ? 14.643  -35.238 15.012  1.00 112.29 ? 281  ALA A CB  1 
ATOM   2103  N N   . ASP A 1 286 ? 12.313  -35.636 12.891  1.00 119.71 ? 282  ASP A N   1 
ATOM   2104  C CA  . ASP A 1 286 ? 11.898  -36.180 11.595  1.00 124.46 ? 282  ASP A CA  1 
ATOM   2105  C C   . ASP A 1 286 ? 13.097  -36.683 10.794  1.00 125.93 ? 282  ASP A C   1 
ATOM   2106  O O   . ASP A 1 286 ? 13.953  -35.901 10.377  1.00 122.82 ? 282  ASP A O   1 
ATOM   2107  C CB  . ASP A 1 286 ? 11.076  -35.157 10.790  1.00 123.85 ? 282  ASP A CB  1 
ATOM   2108  C CG  . ASP A 1 286 ? 11.600  -33.726 10.917  1.00 118.21 ? 282  ASP A CG  1 
ATOM   2109  O OD1 . ASP A 1 286 ? 12.766  -33.524 11.322  1.00 115.15 ? 282  ASP A OD1 1 
ATOM   2110  O OD2 . ASP A 1 286 ? 10.833  -32.791 10.603  1.00 117.19 ? 282  ASP A OD2 1 
ATOM   2111  N N   . LEU A 1 287 ? 13.146  -37.997 10.590  1.00 131.00 ? 283  LEU A N   1 
ATOM   2112  C CA  . LEU A 1 287 ? 14.302  -38.657 9.981   1.00 133.17 ? 283  LEU A CA  1 
ATOM   2113  C C   . LEU A 1 287 ? 14.610  -38.162 8.565   1.00 133.87 ? 283  LEU A C   1 
ATOM   2114  O O   . LEU A 1 287 ? 15.777  -38.011 8.205   1.00 132.65 ? 283  LEU A O   1 
ATOM   2115  C CB  . LEU A 1 287 ? 14.120  -40.181 9.998   1.00 139.21 ? 283  LEU A CB  1 
ATOM   2116  C CG  . LEU A 1 287 ? 15.371  -41.067 9.974   1.00 141.28 ? 283  LEU A CG  1 
ATOM   2117  C CD1 . LEU A 1 287 ? 16.209  -40.894 11.240  1.00 137.11 ? 283  LEU A CD1 1 
ATOM   2118  C CD2 . LEU A 1 287 ? 14.982  -42.528 9.786   1.00 148.01 ? 283  LEU A CD2 1 
ATOM   2119  N N   . ASP A 1 288 ? 13.565  -37.906 7.778   1.00 136.08 ? 284  ASP A N   1 
ATOM   2120  C CA  . ASP A 1 288 ? 13.714  -37.403 6.409   1.00 137.14 ? 284  ASP A CA  1 
ATOM   2121  C C   . ASP A 1 288 ? 14.413  -36.045 6.362   1.00 131.25 ? 284  ASP A C   1 
ATOM   2122  O O   . ASP A 1 288 ? 15.292  -35.821 5.526   1.00 131.16 ? 284  ASP A O   1 
ATOM   2123  C CB  . ASP A 1 288 ? 12.351  -37.311 5.713   1.00 140.60 ? 284  ASP A CB  1 
ATOM   2124  C CG  . ASP A 1 288 ? 11.753  -38.670 5.410   1.00 147.67 ? 284  ASP A CG  1 
ATOM   2125  O OD1 . ASP A 1 288 ? 12.487  -39.560 4.929   1.00 151.27 ? 284  ASP A OD1 1 
ATOM   2126  O OD2 . ASP A 1 288 ? 10.540  -38.844 5.643   1.00 150.02 ? 284  ASP A OD2 1 
ATOM   2127  N N   . TYR A 1 289 ? 14.021  -35.150 7.266   1.00 126.61 ? 285  TYR A N   1 
ATOM   2128  C CA  . TYR A 1 289 ? 14.570  -33.797 7.314   1.00 121.14 ? 285  TYR A CA  1 
ATOM   2129  C C   . TYR A 1 289 ? 15.947  -33.748 7.979   1.00 118.01 ? 285  TYR A C   1 
ATOM   2130  O O   . TYR A 1 289 ? 16.838  -33.034 7.515   1.00 115.54 ? 285  TYR A O   1 
ATOM   2131  C CB  . TYR A 1 289 ? 13.595  -32.849 8.026   1.00 117.93 ? 285  TYR A CB  1 
ATOM   2132  C CG  . TYR A 1 289 ? 14.011  -31.392 8.002   1.00 112.71 ? 285  TYR A CG  1 
ATOM   2133  C CD1 . TYR A 1 289 ? 13.719  -30.580 6.904   1.00 112.70 ? 285  TYR A CD1 1 
ATOM   2134  C CD2 . TYR A 1 289 ? 14.691  -30.823 9.080   1.00 107.95 ? 285  TYR A CD2 1 
ATOM   2135  C CE1 . TYR A 1 289 ? 14.100  -29.243 6.879   1.00 108.16 ? 285  TYR A CE1 1 
ATOM   2136  C CE2 . TYR A 1 289 ? 15.077  -29.491 9.062   1.00 103.46 ? 285  TYR A CE2 1 
ATOM   2137  C CZ  . TYR A 1 289 ? 14.777  -28.707 7.961   1.00 103.58 ? 285  TYR A CZ  1 
ATOM   2138  O OH  . TYR A 1 289 ? 15.156  -27.388 7.940   1.00 99.62  ? 285  TYR A OH  1 
ATOM   2139  N N   . ALA A 1 290 ? 16.110  -34.508 9.061   1.00 118.46 ? 286  ALA A N   1 
ATOM   2140  C CA  . ALA A 1 290 ? 17.341  -34.492 9.855   1.00 115.92 ? 286  ALA A CA  1 
ATOM   2141  C C   . ALA A 1 290 ? 18.549  -35.064 9.113   1.00 118.25 ? 286  ALA A C   1 
ATOM   2142  O O   . ALA A 1 290 ? 19.649  -34.519 9.208   1.00 115.52 ? 286  ALA A O   1 
ATOM   2143  C CB  . ALA A 1 290 ? 17.132  -35.219 11.180  1.00 116.37 ? 286  ALA A CB  1 
ATOM   2144  N N   . VAL A 1 291 ? 18.337  -36.156 8.379   1.00 123.67 ? 287  VAL A N   1 
ATOM   2145  C CA  . VAL A 1 291 ? 19.403  -36.800 7.608   1.00 126.83 ? 287  VAL A CA  1 
ATOM   2146  C C   . VAL A 1 291 ? 19.918  -35.885 6.497   1.00 125.45 ? 287  VAL A C   1 
ATOM   2147  O O   . VAL A 1 291 ? 21.127  -35.784 6.287   1.00 124.86 ? 287  VAL A O   1 
ATOM   2148  C CB  . VAL A 1 291 ? 18.950  -38.171 7.030   1.00 133.53 ? 287  VAL A CB  1 
ATOM   2149  C CG1 . VAL A 1 291 ? 19.921  -38.679 5.965   1.00 137.14 ? 287  VAL A CG1 1 
ATOM   2150  C CG2 . VAL A 1 291 ? 18.809  -39.194 8.147   1.00 135.34 ? 287  VAL A CG2 1 
ATOM   2151  N N   . GLU A 1 292 ? 18.999  -35.213 5.807   1.00 125.19 ? 288  GLU A N   1 
ATOM   2152  C CA  . GLU A 1 292 ? 19.354  -34.331 4.695   1.00 124.27 ? 288  GLU A CA  1 
ATOM   2153  C C   . GLU A 1 292 ? 20.046  -33.036 5.145   1.00 118.39 ? 288  GLU A C   1 
ATOM   2154  O O   . GLU A 1 292 ? 20.990  -32.586 4.494   1.00 117.65 ? 288  GLU A O   1 
ATOM   2155  C CB  . GLU A 1 292 ? 18.123  -34.026 3.831   1.00 126.19 ? 288  GLU A CB  1 
ATOM   2156  C CG  . GLU A 1 292 ? 18.436  -33.435 2.450   1.00 127.09 ? 288  GLU A CG  1 
ATOM   2157  C CD  . GLU A 1 292 ? 19.173  -34.400 1.526   1.00 132.24 ? 288  GLU A CD  1 
ATOM   2158  O OE1 . GLU A 1 292 ? 18.810  -35.595 1.484   1.00 137.27 ? 288  GLU A OE1 1 
ATOM   2159  O OE2 . GLU A 1 292 ? 20.114  -33.957 0.832   1.00 131.38 ? 288  GLU A OE2 1 
ATOM   2160  N N   . GLN A 1 293 ? 19.583  -32.448 6.250   1.00 114.66 ? 289  GLN A N   1 
ATOM   2161  C CA  . GLN A 1 293 ? 20.145  -31.183 6.753   1.00 109.35 ? 289  GLN A CA  1 
ATOM   2162  C C   . GLN A 1 293 ? 21.507  -31.341 7.435   1.00 108.08 ? 289  GLN A C   1 
ATOM   2163  O O   . GLN A 1 293 ? 22.338  -30.430 7.386   1.00 105.07 ? 289  GLN A O   1 
ATOM   2164  C CB  . GLN A 1 293 ? 19.159  -30.466 7.685   1.00 106.16 ? 289  GLN A CB  1 
ATOM   2165  C CG  . GLN A 1 293 ? 18.150  -29.562 6.970   1.00 105.40 ? 289  GLN A CG  1 
ATOM   2166  C CD  . GLN A 1 293 ? 18.730  -28.212 6.567   1.00 101.52 ? 289  GLN A CD  1 
ATOM   2167  O OE1 . GLN A 1 293 ? 19.096  -27.397 7.415   1.00 97.48  ? 289  GLN A OE1 1 
ATOM   2168  N NE2 . GLN A 1 293 ? 18.799  -27.966 5.265   1.00 103.02 ? 289  GLN A NE2 1 
ATOM   2169  N N   . ALA A 1 294 ? 21.725  -32.492 8.070   1.00 110.71 ? 290  ALA A N   1 
ATOM   2170  C CA  . ALA A 1 294 ? 23.013  -32.804 8.690   1.00 110.54 ? 290  ALA A CA  1 
ATOM   2171  C C   . ALA A 1 294 ? 24.048  -33.227 7.647   1.00 113.58 ? 290  ALA A C   1 
ATOM   2172  O O   . ALA A 1 294 ? 25.249  -33.028 7.843   1.00 112.66 ? 290  ALA A O   1 
ATOM   2173  C CB  . ALA A 1 294 ? 22.852  -33.881 9.752   1.00 112.47 ? 290  ALA A CB  1 
ATOM   2174  N N   . HIS A 1 295 ? 23.569  -33.815 6.550   1.00 117.65 ? 291  HIS A N   1 
ATOM   2175  C CA  . HIS A 1 295 ? 24.407  -34.193 5.407   1.00 121.14 ? 291  HIS A CA  1 
ATOM   2176  C C   . HIS A 1 295 ? 24.921  -32.952 4.674   1.00 118.30 ? 291  HIS A C   1 
ATOM   2177  O O   . HIS A 1 295 ? 26.082  -32.901 4.258   1.00 118.96 ? 291  HIS A O   1 
ATOM   2178  C CB  . HIS A 1 295 ? 23.619  -35.101 4.453   1.00 126.44 ? 291  HIS A CB  1 
ATOM   2179  C CG  . HIS A 1 295 ? 24.348  -35.441 3.189   1.00 130.30 ? 291  HIS A CG  1 
ATOM   2180  N ND1 . HIS A 1 295 ? 25.276  -36.457 3.115   1.00 134.21 ? 291  HIS A ND1 1 
ATOM   2181  C CD2 . HIS A 1 295 ? 24.274  -34.908 1.947   1.00 131.11 ? 291  HIS A CD2 1 
ATOM   2182  C CE1 . HIS A 1 295 ? 25.749  -36.529 1.883   1.00 137.30 ? 291  HIS A CE1 1 
ATOM   2183  N NE2 . HIS A 1 295 ? 25.157  -35.600 1.155   1.00 135.45 ? 291  HIS A NE2 1 
ATOM   2184  N N   . GLN A 1 296 ? 24.047  -31.958 4.523   1.00 115.42 ? 292  GLN A N   1 
ATOM   2185  C CA  . GLN A 1 296 ? 24.411  -30.671 3.933   1.00 112.36 ? 292  GLN A CA  1 
ATOM   2186  C C   . GLN A 1 296 ? 25.112  -29.762 4.950   1.00 107.67 ? 292  GLN A C   1 
ATOM   2187  O O   . GLN A 1 296 ? 25.652  -28.715 4.586   1.00 105.07 ? 292  GLN A O   1 
ATOM   2188  C CB  . GLN A 1 296 ? 23.170  -29.974 3.362   1.00 111.56 ? 292  GLN A CB  1 
ATOM   2189  C CG  . GLN A 1 296 ? 22.660  -30.558 2.045   1.00 116.35 ? 292  GLN A CG  1 
ATOM   2190  C CD  . GLN A 1 296 ? 23.377  -30.007 0.820   1.00 116.93 ? 292  GLN A CD  1 
ATOM   2191  O OE1 . GLN A 1 296 ? 24.362  -29.275 0.928   1.00 113.92 ? 292  GLN A OE1 1 
ATOM   2192  N NE2 . GLN A 1 296 ? 22.875  -30.359 -0.357  1.00 121.29 ? 292  GLN A NE2 1 
ATOM   2193  N N   . GLY A 1 297 ? 25.095  -30.171 6.219   1.00 106.90 ? 293  GLY A N   1 
ATOM   2194  C CA  . GLY A 1 297 ? 25.773  -29.446 7.295   1.00 103.19 ? 293  GLY A CA  1 
ATOM   2195  C C   . GLY A 1 297 ? 27.227  -29.851 7.482   1.00 104.56 ? 293  GLY A C   1 
ATOM   2196  O O   . GLY A 1 297 ? 27.914  -29.329 8.363   1.00 102.15 ? 293  GLY A O   1 
ATOM   2197  N N   . VAL A 1 298 ? 27.688  -30.792 6.658   1.00 108.82 ? 294  VAL A N   1 
ATOM   2198  C CA  . VAL A 1 298 ? 29.082  -31.239 6.667   1.00 110.91 ? 294  VAL A CA  1 
ATOM   2199  C C   . VAL A 1 298 ? 29.698  -31.075 5.279   1.00 112.87 ? 294  VAL A C   1 
ATOM   2200  O O   . VAL A 1 298 ? 30.768  -30.484 5.136   1.00 111.94 ? 294  VAL A O   1 
ATOM   2201  C CB  . VAL A 1 298 ? 29.223  -32.722 7.111   1.00 115.17 ? 294  VAL A CB  1 
ATOM   2202  C CG1 . VAL A 1 298 ? 30.692  -33.132 7.159   1.00 117.54 ? 294  VAL A CG1 1 
ATOM   2203  C CG2 . VAL A 1 298 ? 28.572  -32.954 8.464   1.00 113.67 ? 294  VAL A CG2 1 
ATOM   2204  N N   . PHE A 1 299 ? 29.002  -31.592 4.268   1.00 115.90 ? 295  PHE A N   1 
ATOM   2205  C CA  . PHE A 1 299 ? 29.525  -31.685 2.902   1.00 119.00 ? 295  PHE A CA  1 
ATOM   2206  C C   . PHE A 1 299 ? 29.438  -30.394 2.082   1.00 116.14 ? 295  PHE A C   1 
ATOM   2207  O O   . PHE A 1 299 ? 30.046  -30.297 1.011   1.00 118.25 ? 295  PHE A O   1 
ATOM   2208  C CB  . PHE A 1 299 ? 28.833  -32.828 2.153   1.00 124.19 ? 295  PHE A CB  1 
ATOM   2209  C CG  . PHE A 1 299 ? 29.284  -34.196 2.581   1.00 128.55 ? 295  PHE A CG  1 
ATOM   2210  C CD1 . PHE A 1 299 ? 30.369  -34.810 1.959   1.00 132.74 ? 295  PHE A CD1 1 
ATOM   2211  C CD2 . PHE A 1 299 ? 28.624  -34.874 3.602   1.00 128.66 ? 295  PHE A CD2 1 
ATOM   2212  C CE1 . PHE A 1 299 ? 30.792  -36.075 2.351   1.00 137.13 ? 295  PHE A CE1 1 
ATOM   2213  C CE2 . PHE A 1 299 ? 29.040  -36.140 4.001   1.00 132.88 ? 295  PHE A CE2 1 
ATOM   2214  C CZ  . PHE A 1 299 ? 30.126  -36.743 3.374   1.00 137.20 ? 295  PHE A CZ  1 
ATOM   2215  N N   . PHE A 1 300 ? 28.683  -29.416 2.583   1.00 111.66 ? 296  PHE A N   1 
ATOM   2216  C CA  . PHE A 1 300 ? 28.512  -28.125 1.911   1.00 108.75 ? 296  PHE A CA  1 
ATOM   2217  C C   . PHE A 1 300 ? 29.848  -27.407 1.715   1.00 107.42 ? 296  PHE A C   1 
ATOM   2218  O O   . PHE A 1 300 ? 30.665  -27.339 2.637   1.00 106.10 ? 296  PHE A O   1 
ATOM   2219  C CB  . PHE A 1 300 ? 27.539  -27.244 2.701   1.00 104.36 ? 296  PHE A CB  1 
ATOM   2220  C CG  . PHE A 1 300 ? 27.286  -25.904 2.077   1.00 101.48 ? 296  PHE A CG  1 
ATOM   2221  C CD1 . PHE A 1 300 ? 26.483  -25.789 0.945   1.00 103.11 ? 296  PHE A CD1 1 
ATOM   2222  C CD2 . PHE A 1 300 ? 27.844  -24.753 2.628   1.00 97.46  ? 296  PHE A CD2 1 
ATOM   2223  C CE1 . PHE A 1 300 ? 26.246  -24.549 0.366   1.00 100.88 ? 296  PHE A CE1 1 
ATOM   2224  C CE2 . PHE A 1 300 ? 27.613  -23.505 2.058   1.00 95.13  ? 296  PHE A CE2 1 
ATOM   2225  C CZ  . PHE A 1 300 ? 26.811  -23.402 0.926   1.00 96.82  ? 296  PHE A CZ  1 
ATOM   2226  N N   . ASN A 1 301 ? 30.050  -26.875 0.508   1.00 108.08 ? 297  ASN A N   1 
ATOM   2227  C CA  . ASN A 1 301 ? 31.317  -26.252 0.099   1.00 107.61 ? 297  ASN A CA  1 
ATOM   2228  C C   . ASN A 1 301 ? 32.510  -27.208 0.254   1.00 111.12 ? 297  ASN A C   1 
ATOM   2229  O O   . ASN A 1 301 ? 33.570  -26.829 0.762   1.00 110.02 ? 297  ASN A O   1 
ATOM   2230  C CB  . ASN A 1 301 ? 31.548  -24.920 0.837   1.00 102.49 ? 297  ASN A CB  1 
ATOM   2231  C CG  . ASN A 1 301 ? 32.617  -24.052 0.179   1.00 101.81 ? 297  ASN A CG  1 
ATOM   2232  O OD1 . ASN A 1 301 ? 32.764  -24.038 -1.043  1.00 103.95 ? 297  ASN A OD1 1 
ATOM   2233  N ND2 . ASN A 1 301 ? 33.363  -23.318 0.997   1.00 98.89  ? 297  ASN A ND2 1 
ATOM   2234  N N   . GLN A 1 302 ? 32.307  -28.454 -0.181  1.00 115.74 ? 298  GLN A N   1 
ATOM   2235  C CA  . GLN A 1 302 ? 33.335  -29.510 -0.176  1.00 120.04 ? 298  GLN A CA  1 
ATOM   2236  C C   . GLN A 1 302 ? 33.839  -29.901 1.220   1.00 119.19 ? 298  GLN A C   1 
ATOM   2237  O O   . GLN A 1 302 ? 34.853  -30.594 1.348   1.00 122.40 ? 298  GLN A O   1 
ATOM   2238  C CB  . GLN A 1 302 ? 34.509  -29.147 -1.101  1.00 121.78 ? 298  GLN A CB  1 
ATOM   2239  C CG  . GLN A 1 302 ? 34.178  -29.184 -2.591  1.00 124.62 ? 298  GLN A CG  1 
ATOM   2240  C CD  . GLN A 1 302 ? 33.178  -28.116 -3.008  1.00 120.87 ? 298  GLN A CD  1 
ATOM   2241  O OE1 . GLN A 1 302 ? 32.058  -28.428 -3.408  1.00 122.10 ? 298  GLN A OE1 1 
ATOM   2242  N NE2 . GLN A 1 302 ? 33.573  -26.851 -2.900  1.00 116.55 ? 298  GLN A NE2 1 
ATOM   2243  N N   . GLY A 1 303 ? 33.124  -29.462 2.254   1.00 115.20 ? 299  GLY A N   1 
ATOM   2244  C CA  . GLY A 1 303 ? 33.481  -29.769 3.637   1.00 114.31 ? 299  GLY A CA  1 
ATOM   2245  C C   . GLY A 1 303 ? 34.281  -28.680 4.326   1.00 110.83 ? 299  GLY A C   1 
ATOM   2246  O O   . GLY A 1 303 ? 34.090  -28.421 5.516   1.00 108.31 ? 299  GLY A O   1 
ATOM   2247  N N   . GLN A 1 304 ? 35.174  -28.043 3.572   1.00 111.10 ? 300  GLN A N   1 
ATOM   2248  C CA  . GLN A 1 304 ? 36.063  -27.004 4.096   1.00 108.54 ? 300  GLN A CA  1 
ATOM   2249  C C   . GLN A 1 304 ? 35.341  -25.683 4.387   1.00 103.53 ? 300  GLN A C   1 
ATOM   2250  O O   . GLN A 1 304 ? 35.413  -24.729 3.606   1.00 101.96 ? 300  GLN A O   1 
ATOM   2251  C CB  . GLN A 1 304 ? 37.262  -26.794 3.156   1.00 110.89 ? 300  GLN A CB  1 
ATOM   2252  C CG  . GLN A 1 304 ? 36.913  -26.771 1.666   1.00 112.26 ? 300  GLN A CG  1 
ATOM   2253  C CD  . GLN A 1 304 ? 38.072  -27.184 0.778   1.00 116.56 ? 300  GLN A CD  1 
ATOM   2254  O OE1 . GLN A 1 304 ? 38.836  -28.093 1.108   1.00 120.09 ? 300  GLN A OE1 1 
ATOM   2255  N NE2 . GLN A 1 304 ? 38.202  -26.520 -0.365  1.00 116.56 ? 300  GLN A NE2 1 
ATOM   2256  N N   . CYS A 1 305 ? 34.635  -25.647 5.516   1.00 100.12 ? 301  CYS A N   1 
ATOM   2257  C CA  . CYS A 1 305 ? 33.998  -24.423 6.008   1.00 100.48 ? 301  CYS A CA  1 
ATOM   2258  C C   . CYS A 1 305 ? 33.983  -24.363 7.534   1.00 101.27 ? 301  CYS A C   1 
ATOM   2259  O O   . CYS A 1 305 ? 33.560  -25.312 8.202   1.00 100.52 ? 301  CYS A O   1 
ATOM   2260  C CB  . CYS A 1 305 ? 32.584  -24.248 5.435   1.00 99.29  ? 301  CYS A CB  1 
ATOM   2261  S SG  . CYS A 1 305 ? 31.481  -25.669 5.606   1.00 98.09  ? 301  CYS A SG  1 
ATOM   2262  N N   . CYS A 1 306 ? 34.459  -23.240 8.070   1.00 103.12 ? 302  CYS A N   1 
ATOM   2263  C CA  . CYS A 1 306 ? 34.521  -23.010 9.514   1.00 104.51 ? 302  CYS A CA  1 
ATOM   2264  C C   . CYS A 1 306 ? 33.135  -22.839 10.135  1.00 103.67 ? 302  CYS A C   1 
ATOM   2265  O O   . CYS A 1 306 ? 32.944  -23.110 11.324  1.00 104.08 ? 302  CYS A O   1 
ATOM   2266  C CB  . CYS A 1 306 ? 35.409  -21.798 9.833   1.00 107.34 ? 302  CYS A CB  1 
ATOM   2267  S SG  . CYS A 1 306 ? 34.992  -20.269 8.948   1.00 108.04 ? 302  CYS A SG  1 
ATOM   2268  N N   . THR A 1 307 ? 32.176  -22.399 9.320   1.00 102.84 ? 303  THR A N   1 
ATOM   2269  C CA  . THR A 1 307 ? 30.788  -22.195 9.751   1.00 102.46 ? 303  THR A CA  1 
ATOM   2270  C C   . THR A 1 307 ? 30.040  -23.508 10.030  1.00 100.60 ? 303  THR A C   1 
ATOM   2271  O O   . THR A 1 307 ? 29.057  -23.520 10.773  1.00 100.59 ? 303  THR A O   1 
ATOM   2272  C CB  . THR A 1 307 ? 29.984  -21.329 8.733   1.00 102.80 ? 303  THR A CB  1 
ATOM   2273  O OG1 . THR A 1 307 ? 30.197  -21.814 7.401   1.00 101.68 ? 303  THR A OG1 1 
ATOM   2274  C CG2 . THR A 1 307 ? 30.407  -19.862 8.804   1.00 105.25 ? 303  THR A CG2 1 
ATOM   2275  N N   . ALA A 1 308 ? 30.516  -24.604 9.438   1.00 99.43  ? 304  ALA A N   1 
ATOM   2276  C CA  . ALA A 1 308 ? 29.904  -25.923 9.620   1.00 98.11  ? 304  ALA A CA  1 
ATOM   2277  C C   . ALA A 1 308 ? 30.741  -26.836 10.521  1.00 98.33  ? 304  ALA A C   1 
ATOM   2278  O O   . ALA A 1 308 ? 31.776  -26.420 11.050  1.00 99.65  ? 304  ALA A O   1 
ATOM   2279  C CB  . ALA A 1 308 ? 29.648  -26.581 8.269   1.00 97.24  ? 304  ALA A CB  1 
ATOM   2280  N N   . GLY A 1 309 ? 30.286  -28.077 10.691  1.00 97.45  ? 305  GLY A N   1 
ATOM   2281  C CA  . GLY A 1 309 ? 30.954  -29.034 11.568  1.00 97.89  ? 305  GLY A CA  1 
ATOM   2282  C C   . GLY A 1 309 ? 30.717  -30.485 11.212  1.00 97.35  ? 305  GLY A C   1 
ATOM   2283  O O   . GLY A 1 309 ? 29.604  -30.875 10.851  1.00 96.44  ? 305  GLY A O   1 
ATOM   2284  N N   . SER A 1 310 ? 31.775  -31.282 11.341  1.00 98.37  ? 306  SER A N   1 
ATOM   2285  C CA  . SER A 1 310 ? 31.770  -32.678 10.910  1.00 98.64  ? 306  SER A CA  1 
ATOM   2286  C C   . SER A 1 310 ? 31.155  -33.637 11.928  1.00 98.71  ? 306  SER A C   1 
ATOM   2287  O O   . SER A 1 310 ? 30.493  -34.606 11.543  1.00 98.71  ? 306  SER A O   1 
ATOM   2288  C CB  . SER A 1 310 ? 33.190  -33.131 10.549  1.00 100.51 ? 306  SER A CB  1 
ATOM   2289  O OG  . SER A 1 310 ? 34.062  -33.039 11.665  1.00 102.34 ? 306  SER A OG  1 
ATOM   2290  N N   . ARG A 1 311 ? 31.373  -33.374 13.216  1.00 98.98  ? 307  ARG A N   1 
ATOM   2291  C CA  . ARG A 1 311 ? 30.908  -34.285 14.267  1.00 99.16  ? 307  ARG A CA  1 
ATOM   2292  C C   . ARG A 1 311 ? 29.401  -34.187 14.526  1.00 97.44  ? 307  ARG A C   1 
ATOM   2293  O O   . ARG A 1 311 ? 28.857  -33.098 14.719  1.00 96.46  ? 307  ARG A O   1 
ATOM   2294  C CB  . ARG A 1 311 ? 31.733  -34.136 15.555  1.00 100.76 ? 307  ARG A CB  1 
ATOM   2295  C CG  . ARG A 1 311 ? 31.748  -32.748 16.179  1.00 100.51 ? 307  ARG A CG  1 
ATOM   2296  C CD  . ARG A 1 311 ? 33.025  -32.504 16.980  1.00 103.14 ? 307  ARG A CD  1 
ATOM   2297  N NE  . ARG A 1 311 ? 33.408  -33.638 17.824  1.00 105.09 ? 307  ARG A NE  1 
ATOM   2298  C CZ  . ARG A 1 311 ? 32.912  -33.888 19.033  1.00 105.45 ? 307  ARG A CZ  1 
ATOM   2299  N NH1 . ARG A 1 311 ? 31.993  -33.093 19.562  1.00 104.09 ? 307  ARG A NH1 1 
ATOM   2300  N NH2 . ARG A 1 311 ? 33.331  -34.945 19.716  1.00 107.68 ? 307  ARG A NH2 1 
ATOM   2301  N N   . ILE A 1 312 ? 28.744  -35.345 14.503  1.00 97.45  ? 308  ILE A N   1 
ATOM   2302  C CA  . ILE A 1 312 ? 27.293  -35.453 14.653  1.00 96.30  ? 308  ILE A CA  1 
ATOM   2303  C C   . ILE A 1 312 ? 26.949  -36.540 15.673  1.00 97.10  ? 308  ILE A C   1 
ATOM   2304  O O   . ILE A 1 312 ? 27.339  -37.701 15.513  1.00 98.53  ? 308  ILE A O   1 
ATOM   2305  C CB  . ILE A 1 312 ? 26.607  -35.791 13.301  1.00 96.12  ? 308  ILE A CB  1 
ATOM   2306  C CG1 . ILE A 1 312 ? 26.884  -34.703 12.256  1.00 95.23  ? 308  ILE A CG1 1 
ATOM   2307  C CG2 . ILE A 1 312 ? 25.105  -36.005 13.490  1.00 95.94  ? 308  ILE A CG2 1 
ATOM   2308  C CD1 . ILE A 1 312 ? 26.598  -35.124 10.826  1.00 95.50  ? 308  ILE A CD1 1 
ATOM   2309  N N   . PHE A 1 313 ? 26.219  -36.155 16.718  1.00 96.36  ? 309  PHE A N   1 
ATOM   2310  C CA  . PHE A 1 313 ? 25.765  -37.096 17.739  1.00 97.01  ? 309  PHE A CA  1 
ATOM   2311  C C   . PHE A 1 313 ? 24.345  -37.577 17.440  1.00 96.83  ? 309  PHE A C   1 
ATOM   2312  O O   . PHE A 1 313 ? 23.427  -36.768 17.286  1.00 96.04  ? 309  PHE A O   1 
ATOM   2313  C CB  . PHE A 1 313 ? 25.812  -36.452 19.127  1.00 96.90  ? 309  PHE A CB  1 
ATOM   2314  C CG  . PHE A 1 313 ? 27.190  -36.041 19.571  1.00 97.63  ? 309  PHE A CG  1 
ATOM   2315  C CD1 . PHE A 1 313 ? 27.603  -34.716 19.461  1.00 97.01  ? 309  PHE A CD1 1 
ATOM   2316  C CD2 . PHE A 1 313 ? 28.067  -36.971 20.118  1.00 99.30  ? 309  PHE A CD2 1 
ATOM   2317  C CE1 . PHE A 1 313 ? 28.872  -34.328 19.878  1.00 98.31  ? 309  PHE A CE1 1 
ATOM   2318  C CE2 . PHE A 1 313 ? 29.337  -36.593 20.538  1.00 100.72 ? 309  PHE A CE2 1 
ATOM   2319  C CZ  . PHE A 1 313 ? 29.740  -35.270 20.418  1.00 100.27 ? 309  PHE A CZ  1 
ATOM   2320  N N   . VAL A 1 314 ? 24.171  -38.894 17.356  1.00 98.11  ? 310  VAL A N   1 
ATOM   2321  C CA  . VAL A 1 314 ? 22.862  -39.493 17.077  1.00 98.62  ? 310  VAL A CA  1 
ATOM   2322  C C   . VAL A 1 314 ? 22.444  -40.401 18.236  1.00 99.76  ? 310  VAL A C   1 
ATOM   2323  O O   . VAL A 1 314 ? 23.243  -41.208 18.720  1.00 101.03 ? 310  VAL A O   1 
ATOM   2324  C CB  . VAL A 1 314 ? 22.860  -40.280 15.735  1.00 99.88  ? 310  VAL A CB  1 
ATOM   2325  C CG1 . VAL A 1 314 ? 21.461  -40.771 15.392  1.00 100.95 ? 310  VAL A CG1 1 
ATOM   2326  C CG2 . VAL A 1 314 ? 23.397  -39.417 14.599  1.00 98.76  ? 310  VAL A CG2 1 
ATOM   2327  N N   . GLU A 1 315 ? 21.195  -40.253 18.679  1.00 99.62  ? 311  GLU A N   1 
ATOM   2328  C CA  . GLU A 1 315 ? 20.667  -41.013 19.815  1.00 100.64 ? 311  GLU A CA  1 
ATOM   2329  C C   . GLU A 1 315 ? 20.620  -42.507 19.510  1.00 103.04 ? 311  GLU A C   1 
ATOM   2330  O O   . GLU A 1 315 ? 20.348  -42.908 18.376  1.00 104.06 ? 311  GLU A O   1 
ATOM   2331  C CB  . GLU A 1 315 ? 19.280  -40.502 20.216  1.00 100.32 ? 311  GLU A CB  1 
ATOM   2332  C CG  . GLU A 1 315 ? 18.878  -40.839 21.651  1.00 100.59 ? 311  GLU A CG  1 
ATOM   2333  C CD  . GLU A 1 315 ? 17.540  -40.241 22.061  1.00 100.42 ? 311  GLU A CD  1 
ATOM   2334  O OE1 . GLU A 1 315 ? 17.122  -39.218 21.477  1.00 99.64  ? 311  GLU A OE1 1 
ATOM   2335  O OE2 . GLU A 1 315 ? 16.907  -40.796 22.982  1.00 101.28 ? 311  GLU A OE2 1 
ATOM   2336  N N   . GLU A 1 316 ? 20.882  -43.313 20.537  1.00 104.32 ? 312  GLU A N   1 
ATOM   2337  C CA  . GLU A 1 316 ? 20.981  -44.773 20.423  1.00 107.24 ? 312  GLU A CA  1 
ATOM   2338  C C   . GLU A 1 316 ? 19.794  -45.430 19.717  1.00 108.94 ? 312  GLU A C   1 
ATOM   2339  O O   . GLU A 1 316 ? 19.955  -46.449 19.045  1.00 111.45 ? 312  GLU A O   1 
ATOM   2340  C CB  . GLU A 1 316 ? 21.169  -45.401 21.807  1.00 108.44 ? 312  GLU A CB  1 
ATOM   2341  C CG  . GLU A 1 316 ? 22.464  -45.000 22.507  1.00 108.29 ? 312  GLU A CG  1 
ATOM   2342  C CD  . GLU A 1 316 ? 22.592  -45.570 23.912  1.00 110.07 ? 312  GLU A CD  1 
ATOM   2343  O OE1 . GLU A 1 316 ? 21.560  -45.744 24.596  1.00 110.21 ? 312  GLU A OE1 1 
ATOM   2344  O OE2 . GLU A 1 316 ? 23.736  -45.834 24.339  1.00 111.63 ? 312  GLU A OE2 1 
ATOM   2345  N N   . SER A 1 317 ? 18.612  -44.838 19.876  1.00 108.12 ? 313  SER A N   1 
ATOM   2346  C CA  . SER A 1 317 ? 17.375  -45.355 19.288  1.00 110.24 ? 313  SER A CA  1 
ATOM   2347  C C   . SER A 1 317 ? 17.390  -45.334 17.758  1.00 111.08 ? 313  SER A C   1 
ATOM   2348  O O   . SER A 1 317 ? 16.994  -46.308 17.114  1.00 114.03 ? 313  SER A O   1 
ATOM   2349  C CB  . SER A 1 317 ? 16.168  -44.560 19.802  1.00 109.36 ? 313  SER A CB  1 
ATOM   2350  O OG  . SER A 1 317 ? 16.190  -44.442 21.214  1.00 108.47 ? 313  SER A OG  1 
ATOM   2351  N N   . ILE A 1 318 ? 17.850  -44.222 17.189  1.00 108.83 ? 314  ILE A N   1 
ATOM   2352  C CA  . ILE A 1 318 ? 17.830  -44.017 15.738  1.00 109.42 ? 314  ILE A CA  1 
ATOM   2353  C C   . ILE A 1 318 ? 19.215  -44.127 15.090  1.00 109.03 ? 314  ILE A C   1 
ATOM   2354  O O   . ILE A 1 318 ? 19.374  -43.847 13.900  1.00 109.10 ? 314  ILE A O   1 
ATOM   2355  C CB  . ILE A 1 318 ? 17.156  -42.668 15.352  1.00 107.82 ? 314  ILE A CB  1 
ATOM   2356  C CG1 . ILE A 1 318 ? 17.811  -41.495 16.094  1.00 104.70 ? 314  ILE A CG1 1 
ATOM   2357  C CG2 . ILE A 1 318 ? 15.648  -42.724 15.618  1.00 109.55 ? 314  ILE A CG2 1 
ATOM   2358  C CD1 . ILE A 1 318 ? 17.564  -40.142 15.454  1.00 103.24 ? 314  ILE A CD1 1 
ATOM   2359  N N   . TYR A 1 319 ? 20.204  -44.543 15.879  1.00 109.02 ? 315  TYR A N   1 
ATOM   2360  C CA  . TYR A 1 319 ? 21.587  -44.680 15.416  1.00 109.25 ? 315  TYR A CA  1 
ATOM   2361  C C   . TYR A 1 319 ? 21.721  -45.676 14.262  1.00 112.34 ? 315  TYR A C   1 
ATOM   2362  O O   . TYR A 1 319 ? 22.450  -45.420 13.302  1.00 112.12 ? 315  TYR A O   1 
ATOM   2363  C CB  . TYR A 1 319 ? 22.499  -45.086 16.580  1.00 109.60 ? 315  TYR A CB  1 
ATOM   2364  C CG  . TYR A 1 319 ? 23.981  -45.035 16.268  1.00 109.87 ? 315  TYR A CG  1 
ATOM   2365  C CD1 . TYR A 1 319 ? 24.707  -43.855 16.429  1.00 107.40 ? 315  TYR A CD1 1 
ATOM   2366  C CD2 . TYR A 1 319 ? 24.660  -46.170 15.823  1.00 113.09 ? 315  TYR A CD2 1 
ATOM   2367  C CE1 . TYR A 1 319 ? 26.071  -43.805 16.149  1.00 108.06 ? 315  TYR A CE1 1 
ATOM   2368  C CE2 . TYR A 1 319 ? 26.023  -46.129 15.538  1.00 113.84 ? 315  TYR A CE2 1 
ATOM   2369  C CZ  . TYR A 1 319 ? 26.721  -44.944 15.703  1.00 111.27 ? 315  TYR A CZ  1 
ATOM   2370  O OH  . TYR A 1 319 ? 28.069  -44.900 15.424  1.00 112.43 ? 315  TYR A OH  1 
ATOM   2371  N N   . GLU A 1 320 ? 21.015  -46.802 14.370  1.00 115.55 ? 316  GLU A N   1 
ATOM   2372  C CA  . GLU A 1 320 ? 21.009  -47.846 13.343  1.00 119.40 ? 316  GLU A CA  1 
ATOM   2373  C C   . GLU A 1 320 ? 20.507  -47.313 12.000  1.00 119.39 ? 316  GLU A C   1 
ATOM   2374  O O   . GLU A 1 320 ? 21.179  -47.461 10.975  1.00 120.41 ? 316  GLU A O   1 
ATOM   2375  C CB  . GLU A 1 320 ? 20.160  -49.043 13.805  1.00 122.93 ? 316  GLU A CB  1 
ATOM   2376  C CG  . GLU A 1 320 ? 19.895  -50.123 12.747  1.00 127.47 ? 316  GLU A CG  1 
ATOM   2377  C CD  . GLU A 1 320 ? 21.068  -51.065 12.540  1.00 130.32 ? 316  GLU A CD  1 
ATOM   2378  O OE1 . GLU A 1 320 ? 22.107  -50.629 12.000  1.00 129.14 ? 316  GLU A OE1 1 
ATOM   2379  O OE2 . GLU A 1 320 ? 20.944  -52.252 12.906  1.00 134.16 ? 316  GLU A OE2 1 
ATOM   2380  N N   . GLU A 1 321 ? 19.331  -46.687 12.024  1.00 118.60 ? 317  GLU A N   1 
ATOM   2381  C CA  . GLU A 1 321 ? 18.700  -46.144 10.823  1.00 119.11 ? 317  GLU A CA  1 
ATOM   2382  C C   . GLU A 1 321 ? 19.466  -44.970 10.225  1.00 116.17 ? 317  GLU A C   1 
ATOM   2383  O O   . GLU A 1 321 ? 19.499  -44.807 9.003   1.00 117.03 ? 317  GLU A O   1 
ATOM   2384  C CB  . GLU A 1 321 ? 17.252  -45.733 11.110  1.00 119.36 ? 317  GLU A CB  1 
ATOM   2385  C CG  . GLU A 1 321 ? 16.280  -46.900 11.204  1.00 123.50 ? 317  GLU A CG  1 
ATOM   2386  C CD  . GLU A 1 321 ? 16.242  -47.734 9.936   1.00 127.39 ? 317  GLU A CD  1 
ATOM   2387  O OE1 . GLU A 1 321 ? 16.027  -47.161 8.847   1.00 127.46 ? 317  GLU A OE1 1 
ATOM   2388  O OE2 . GLU A 1 321 ? 16.430  -48.964 10.032  1.00 130.71 ? 317  GLU A OE2 1 
ATOM   2389  N N   . PHE A 1 322 ? 20.078  -44.161 11.089  1.00 113.14 ? 318  PHE A N   1 
ATOM   2390  C CA  . PHE A 1 322 ? 20.816  -42.977 10.651  1.00 110.56 ? 318  PHE A CA  1 
ATOM   2391  C C   . PHE A 1 322 ? 21.971  -43.347 9.728   1.00 111.55 ? 318  PHE A C   1 
ATOM   2392  O O   . PHE A 1 322 ? 22.128  -42.754 8.661   1.00 111.06 ? 318  PHE A O   1 
ATOM   2393  C CB  . PHE A 1 322 ? 21.325  -42.164 11.846  1.00 107.69 ? 318  PHE A CB  1 
ATOM   2394  C CG  . PHE A 1 322 ? 21.714  -40.755 11.494  1.00 105.19 ? 318  PHE A CG  1 
ATOM   2395  C CD1 . PHE A 1 322 ? 23.024  -40.445 11.144  1.00 104.39 ? 318  PHE A CD1 1 
ATOM   2396  C CD2 . PHE A 1 322 ? 20.765  -39.738 11.500  1.00 104.13 ? 318  PHE A CD2 1 
ATOM   2397  C CE1 . PHE A 1 322 ? 23.383  -39.142 10.812  1.00 102.36 ? 318  PHE A CE1 1 
ATOM   2398  C CE2 . PHE A 1 322 ? 21.114  -38.436 11.168  1.00 102.20 ? 318  PHE A CE2 1 
ATOM   2399  C CZ  . PHE A 1 322 ? 22.426  -38.138 10.825  1.00 101.32 ? 318  PHE A CZ  1 
ATOM   2400  N N   . VAL A 1 323 ? 22.763  -44.335 10.141  1.00 113.39 ? 319  VAL A N   1 
ATOM   2401  C CA  . VAL A 1 323 ? 23.899  -44.810 9.352   1.00 115.12 ? 319  VAL A CA  1 
ATOM   2402  C C   . VAL A 1 323 ? 23.432  -45.291 7.974   1.00 117.87 ? 319  VAL A C   1 
ATOM   2403  O O   . VAL A 1 323 ? 24.050  -44.964 6.959   1.00 117.77 ? 319  VAL A O   1 
ATOM   2404  C CB  . VAL A 1 323 ? 24.693  -45.921 10.096  1.00 117.46 ? 319  VAL A CB  1 
ATOM   2405  C CG1 . VAL A 1 323 ? 25.855  -46.426 9.249   1.00 119.77 ? 319  VAL A CG1 1 
ATOM   2406  C CG2 . VAL A 1 323 ? 25.212  -45.405 11.432  1.00 115.22 ? 319  VAL A CG2 1 
ATOM   2407  N N   . ARG A 1 324 ? 22.330  -46.041 7.953   1.00 120.68 ? 320  ARG A N   1 
ATOM   2408  C CA  . ARG A 1 324 ? 21.735  -46.549 6.713   1.00 124.12 ? 320  ARG A CA  1 
ATOM   2409  C C   . ARG A 1 324 ? 21.314  -45.432 5.762   1.00 122.54 ? 320  ARG A C   1 
ATOM   2410  O O   . ARG A 1 324 ? 21.522  -45.528 4.552   1.00 124.20 ? 320  ARG A O   1 
ATOM   2411  C CB  . ARG A 1 324 ? 20.523  -47.430 7.018   1.00 127.36 ? 320  ARG A CB  1 
ATOM   2412  C CG  . ARG A 1 324 ? 20.848  -48.843 7.451   1.00 131.15 ? 320  ARG A CG  1 
ATOM   2413  C CD  . ARG A 1 324 ? 19.566  -49.612 7.696   1.00 134.82 ? 320  ARG A CD  1 
ATOM   2414  N NE  . ARG A 1 324 ? 19.805  -51.036 7.907   1.00 139.75 ? 320  ARG A NE  1 
ATOM   2415  C CZ  . ARG A 1 324 ? 18.851  -51.963 7.934   1.00 144.20 ? 320  ARG A CZ  1 
ATOM   2416  N NH1 . ARG A 1 324 ? 19.169  -53.233 8.131   1.00 148.59 ? 320  ARG A NH1 1 
ATOM   2417  N NH2 . ARG A 1 324 ? 17.579  -51.627 7.760   1.00 144.75 ? 320  ARG A NH2 1 
ATOM   2418  N N   . ARG A 1 325 ? 20.714  -44.383 6.318   1.00 119.80 ? 321  ARG A N   1 
ATOM   2419  C CA  . ARG A 1 325 ? 20.259  -43.233 5.538   1.00 118.57 ? 321  ARG A CA  1 
ATOM   2420  C C   . ARG A 1 325 ? 21.427  -42.352 5.101   1.00 115.93 ? 321  ARG A C   1 
ATOM   2421  O O   . ARG A 1 325 ? 21.369  -41.703 4.055   1.00 115.77 ? 321  ARG A O   1 
ATOM   2422  C CB  . ARG A 1 325 ? 19.263  -42.397 6.349   1.00 116.93 ? 321  ARG A CB  1 
ATOM   2423  C CG  . ARG A 1 325 ? 17.898  -43.038 6.569   1.00 120.00 ? 321  ARG A CG  1 
ATOM   2424  C CD  . ARG A 1 325 ? 16.976  -42.829 5.377   1.00 122.78 ? 321  ARG A CD  1 
ATOM   2425  N NE  . ARG A 1 325 ? 15.570  -42.984 5.746   1.00 125.38 ? 321  ARG A NE  1 
ATOM   2426  C CZ  . ARG A 1 325 ? 14.764  -41.982 6.092   1.00 124.51 ? 321  ARG A CZ  1 
ATOM   2427  N NH1 . ARG A 1 325 ? 15.211  -40.732 6.118   1.00 121.29 ? 321  ARG A NH1 1 
ATOM   2428  N NH2 . ARG A 1 325 ? 13.501  -42.230 6.411   1.00 127.32 ? 321  ARG A NH2 1 
ATOM   2429  N N   . SER A 1 326 ? 22.481  -42.339 5.914   1.00 114.29 ? 322  SER A N   1 
ATOM   2430  C CA  . SER A 1 326 ? 23.649  -41.496 5.678   1.00 112.10 ? 322  SER A CA  1 
ATOM   2431  C C   . SER A 1 326 ? 24.529  -42.033 4.549   1.00 114.02 ? 322  SER A C   1 
ATOM   2432  O O   . SER A 1 326 ? 25.015  -41.262 3.719   1.00 112.90 ? 322  SER A O   1 
ATOM   2433  C CB  . SER A 1 326 ? 24.465  -41.352 6.966   1.00 110.38 ? 322  SER A CB  1 
ATOM   2434  O OG  . SER A 1 326 ? 25.180  -40.131 6.990   1.00 107.89 ? 322  SER A OG  1 
ATOM   2435  N N   . VAL A 1 327 ? 24.726  -43.350 4.522   1.00 117.23 ? 323  VAL A N   1 
ATOM   2436  C CA  . VAL A 1 327 ? 25.559  -43.985 3.498   1.00 119.81 ? 323  VAL A CA  1 
ATOM   2437  C C   . VAL A 1 327 ? 24.932  -43.921 2.102   1.00 121.55 ? 323  VAL A C   1 
ATOM   2438  O O   . VAL A 1 327 ? 25.646  -43.886 1.100   1.00 122.42 ? 323  VAL A O   1 
ATOM   2439  C CB  . VAL A 1 327 ? 25.944  -45.452 3.858   1.00 123.52 ? 323  VAL A CB  1 
ATOM   2440  C CG1 . VAL A 1 327 ? 26.815  -45.487 5.106   1.00 122.36 ? 323  VAL A CG1 1 
ATOM   2441  C CG2 . VAL A 1 327 ? 24.707  -46.338 4.027   1.00 126.32 ? 323  VAL A CG2 1 
ATOM   2442  N N   . GLU A 1 328 ? 23.602  -43.899 2.046   1.00 122.44 ? 324  GLU A N   1 
ATOM   2443  C CA  . GLU A 1 328 ? 22.876  -43.866 0.776   1.00 124.78 ? 324  GLU A CA  1 
ATOM   2444  C C   . GLU A 1 328 ? 22.885  -42.484 0.122   1.00 122.14 ? 324  GLU A C   1 
ATOM   2445  O O   . GLU A 1 328 ? 22.711  -42.369 -1.094  1.00 123.79 ? 324  GLU A O   1 
ATOM   2446  C CB  . GLU A 1 328 ? 21.441  -44.365 0.960   1.00 127.40 ? 324  GLU A CB  1 
ATOM   2447  C CG  . GLU A 1 328 ? 21.322  -45.879 1.074   1.00 131.89 ? 324  GLU A CG  1 
ATOM   2448  C CD  . GLU A 1 328 ? 19.906  -46.337 1.368   1.00 134.79 ? 324  GLU A CD  1 
ATOM   2449  O OE1 . GLU A 1 328 ? 19.436  -46.139 2.508   1.00 133.08 ? 324  GLU A OE1 1 
ATOM   2450  O OE2 . GLU A 1 328 ? 19.266  -46.905 0.460   1.00 139.12 ? 324  GLU A OE2 1 
ATOM   2451  N N   . ARG A 1 329 ? 23.086  -41.445 0.931   1.00 118.46 ? 325  ARG A N   1 
ATOM   2452  C CA  . ARG A 1 329 ? 23.178  -40.071 0.428   1.00 116.11 ? 325  ARG A CA  1 
ATOM   2453  C C   . ARG A 1 329 ? 24.592  -39.736 -0.048  1.00 114.72 ? 325  ARG A C   1 
ATOM   2454  O O   . ARG A 1 329 ? 24.793  -38.770 -0.787  1.00 113.55 ? 325  ARG A O   1 
ATOM   2455  C CB  . ARG A 1 329 ? 22.708  -39.059 1.483   1.00 113.34 ? 325  ARG A CB  1 
ATOM   2456  C CG  . ARG A 1 329 ? 21.209  -39.106 1.801   1.00 115.14 ? 325  ARG A CG  1 
ATOM   2457  C CD  . ARG A 1 329 ? 20.347  -38.724 0.598   1.00 117.91 ? 325  ARG A CD  1 
ATOM   2458  N NE  . ARG A 1 329 ? 18.945  -39.101 0.784   1.00 120.98 ? 325  ARG A NE  1 
ATOM   2459  C CZ  . ARG A 1 329 ? 18.066  -39.260 -0.203  1.00 124.54 ? 325  ARG A CZ  1 
ATOM   2460  N NH1 . ARG A 1 329 ? 18.428  -39.082 -1.468  1.00 125.71 ? 325  ARG A NH1 1 
ATOM   2461  N NH2 . ARG A 1 329 ? 16.817  -39.606 0.076   1.00 127.32 ? 325  ARG A NH2 1 
ATOM   2462  N N   . ALA A 1 330 ? 25.562  -40.541 0.382   1.00 115.24 ? 326  ALA A N   1 
ATOM   2463  C CA  . ALA A 1 330 ? 26.950  -40.394 -0.051  1.00 114.74 ? 326  ALA A CA  1 
ATOM   2464  C C   . ALA A 1 330 ? 27.243  -41.237 -1.296  1.00 118.02 ? 326  ALA A C   1 
ATOM   2465  O O   . ALA A 1 330 ? 28.062  -40.851 -2.134  1.00 117.84 ? 326  ALA A O   1 
ATOM   2466  C CB  . ALA A 1 330 ? 27.902  -40.755 1.080   1.00 114.21 ? 326  ALA A CB  1 
ATOM   2467  N N   . LYS A 1 331 ? 26.569  -42.383 -1.406  1.00 121.29 ? 327  LYS A N   1 
ATOM   2468  C CA  . LYS A 1 331 ? 26.695  -43.274 -2.565  1.00 125.19 ? 327  LYS A CA  1 
ATOM   2469  C C   . LYS A 1 331 ? 25.954  -42.737 -3.793  1.00 125.84 ? 327  LYS A C   1 
ATOM   2470  O O   . LYS A 1 331 ? 26.178  -43.203 -4.914  1.00 128.78 ? 327  LYS A O   1 
ATOM   2471  C CB  . LYS A 1 331 ? 26.192  -44.685 -2.224  1.00 129.12 ? 327  LYS A CB  1 
ATOM   2472  C CG  . LYS A 1 331 ? 27.187  -45.558 -1.463  1.00 130.39 ? 327  LYS A CG  1 
ATOM   2473  C CD  . LYS A 1 331 ? 26.573  -46.911 -1.107  1.00 134.48 ? 327  LYS A CD  1 
ATOM   2474  C CE  . LYS A 1 331 ? 27.559  -47.816 -0.378  1.00 136.34 ? 327  LYS A CE  1 
ATOM   2475  N NZ  . LYS A 1 331 ? 28.569  -48.418 -1.293  1.00 139.75 ? 327  LYS A NZ  1 
ATOM   2476  N N   . ARG A 1 332 ? 25.073  -41.762 -3.572  1.00 123.51 ? 328  ARG A N   1 
ATOM   2477  C CA  . ARG A 1 332 ? 24.292  -41.146 -4.646  1.00 124.31 ? 328  ARG A CA  1 
ATOM   2478  C C   . ARG A 1 332 ? 24.724  -39.706 -4.936  1.00 120.79 ? 328  ARG A C   1 
ATOM   2479  O O   . ARG A 1 332 ? 24.194  -39.067 -5.848  1.00 121.46 ? 328  ARG A O   1 
ATOM   2480  C CB  . ARG A 1 332 ? 22.795  -41.196 -4.318  1.00 125.72 ? 328  ARG A CB  1 
ATOM   2481  C CG  . ARG A 1 332 ? 22.183  -42.585 -4.408  1.00 130.44 ? 328  ARG A CG  1 
ATOM   2482  C CD  . ARG A 1 332 ? 20.744  -42.589 -3.919  1.00 132.04 ? 328  ARG A CD  1 
ATOM   2483  N NE  . ARG A 1 332 ? 20.185  -43.939 -3.880  1.00 136.72 ? 328  ARG A NE  1 
ATOM   2484  C CZ  . ARG A 1 332 ? 19.508  -44.509 -4.873  1.00 141.66 ? 328  ARG A CZ  1 
ATOM   2485  N NH1 . ARG A 1 332 ? 19.291  -43.854 -6.007  1.00 142.61 ? 328  ARG A NH1 1 
ATOM   2486  N NH2 . ARG A 1 332 ? 19.044  -45.743 -4.733  1.00 146.11 ? 328  ARG A NH2 1 
ATOM   2487  N N   . ARG A 1 333 ? 25.686  -39.204 -4.164  1.00 117.45 ? 329  ARG A N   1 
ATOM   2488  C CA  . ARG A 1 333 ? 26.177  -37.839 -4.336  1.00 114.33 ? 329  ARG A CA  1 
ATOM   2489  C C   . ARG A 1 333 ? 27.145  -37.746 -5.512  1.00 114.77 ? 329  ARG A C   1 
ATOM   2490  O O   . ARG A 1 333 ? 28.255  -38.278 -5.460  1.00 115.10 ? 329  ARG A O   1 
ATOM   2491  C CB  . ARG A 1 333 ? 26.832  -37.324 -3.048  1.00 111.35 ? 329  ARG A CB  1 
ATOM   2492  C CG  . ARG A 1 333 ? 27.043  -35.812 -3.019  1.00 108.99 ? 329  ARG A CG  1 
ATOM   2493  C CD  . ARG A 1 333 ? 27.340  -35.316 -1.614  1.00 107.23 ? 329  ARG A CD  1 
ATOM   2494  N NE  . ARG A 1 333 ? 27.042  -33.892 -1.465  1.00 106.05 ? 329  ARG A NE  1 
ATOM   2495  C CZ  . ARG A 1 333 ? 27.951  -32.938 -1.281  1.00 104.57 ? 329  ARG A CZ  1 
ATOM   2496  N NH1 . ARG A 1 333 ? 29.241  -33.240 -1.205  1.00 104.58 ? 329  ARG A NH1 1 
ATOM   2497  N NH2 . ARG A 1 333 ? 27.565  -31.675 -1.158  1.00 103.38 ? 329  ARG A NH2 1 
ATOM   2498  N N   . VAL A 1 334 ? 26.707  -37.070 -6.570  1.00 115.03 ? 330  VAL A N   1 
ATOM   2499  C CA  . VAL A 1 334 ? 27.527  -36.863 -7.762  1.00 115.45 ? 330  VAL A CA  1 
ATOM   2500  C C   . VAL A 1 334 ? 28.656  -35.871 -7.506  1.00 112.33 ? 330  VAL A C   1 
ATOM   2501  O O   . VAL A 1 334 ? 28.419  -34.743 -7.062  1.00 110.07 ? 330  VAL A O   1 
ATOM   2502  C CB  . VAL A 1 334 ? 26.689  -36.402 -8.981  1.00 117.21 ? 330  VAL A CB  1 
ATOM   2503  C CG1 . VAL A 1 334 ? 26.407  -37.570 -9.910  1.00 121.39 ? 330  VAL A CG1 1 
ATOM   2504  C CG2 . VAL A 1 334 ? 25.397  -35.731 -8.534  1.00 116.69 ? 330  VAL A CG2 1 
ATOM   2505  N N   . VAL A 1 335 ? 29.881  -36.313 -7.777  1.00 112.66 ? 331  VAL A N   1 
ATOM   2506  C CA  . VAL A 1 335 ? 31.078  -35.492 -7.600  1.00 110.42 ? 331  VAL A CA  1 
ATOM   2507  C C   . VAL A 1 335 ? 31.787  -35.347 -8.944  1.00 111.51 ? 331  VAL A C   1 
ATOM   2508  O O   . VAL A 1 335 ? 31.997  -36.337 -9.648  1.00 114.31 ? 331  VAL A O   1 
ATOM   2509  C CB  . VAL A 1 335 ? 32.052  -36.110 -6.560  1.00 110.33 ? 331  VAL A CB  1 
ATOM   2510  C CG1 . VAL A 1 335 ? 33.217  -35.167 -6.275  1.00 108.61 ? 331  VAL A CG1 1 
ATOM   2511  C CG2 . VAL A 1 335 ? 31.325  -36.453 -5.265  1.00 109.59 ? 331  VAL A CG2 1 
ATOM   2512  N N   . GLY A 1 336 ? 32.149  -34.117 -9.296  1.00 109.61 ? 332  GLY A N   1 
ATOM   2513  C CA  . GLY A 1 336 ? 32.846  -33.851 -10.552 1.00 110.44 ? 332  GLY A CA  1 
ATOM   2514  C C   . GLY A 1 336 ? 33.098  -32.382 -10.836 1.00 108.42 ? 332  GLY A C   1 
ATOM   2515  O O   . GLY A 1 336 ? 33.346  -31.595 -9.919  1.00 106.40 ? 332  GLY A O   1 
ATOM   2516  N N   . SER A 1 337 ? 33.030  -32.020 -12.116 1.00 109.31 ? 333  SER A N   1 
ATOM   2517  C CA  . SER A 1 337 ? 33.333  -30.665 -12.577 1.00 107.94 ? 333  SER A CA  1 
ATOM   2518  C C   . SER A 1 337 ? 32.376  -29.624 -11.998 1.00 106.35 ? 333  SER A C   1 
ATOM   2519  O O   . SER A 1 337 ? 31.164  -29.837 -11.994 1.00 107.13 ? 333  SER A O   1 
ATOM   2520  C CB  . SER A 1 337 ? 33.309  -30.605 -14.107 1.00 109.77 ? 333  SER A CB  1 
ATOM   2521  O OG  . SER A 1 337 ? 33.671  -29.316 -14.572 1.00 108.75 ? 333  SER A OG  1 
ATOM   2522  N N   . PRO A 1 338 ? 32.923  -28.495 -11.506 1.00 104.62 ? 334  PRO A N   1 
ATOM   2523  C CA  . PRO A 1 338 ? 32.124  -27.404 -10.940 1.00 103.59 ? 334  PRO A CA  1 
ATOM   2524  C C   . PRO A 1 338 ? 31.189  -26.724 -11.949 1.00 104.84 ? 334  PRO A C   1 
ATOM   2525  O O   . PRO A 1 338 ? 30.151  -26.190 -11.553 1.00 105.04 ? 334  PRO A O   1 
ATOM   2526  C CB  . PRO A 1 338 ? 33.184  -26.417 -10.434 1.00 102.36 ? 334  PRO A CB  1 
ATOM   2527  C CG  . PRO A 1 338 ? 34.420  -26.757 -11.174 1.00 102.99 ? 334  PRO A CG  1 
ATOM   2528  C CD  . PRO A 1 338 ? 34.366  -28.231 -11.376 1.00 104.11 ? 334  PRO A CD  1 
ATOM   2529  N N   . PHE A 1 339 ? 31.554  -26.749 -13.231 1.00 106.03 ? 335  PHE A N   1 
ATOM   2530  C CA  . PHE A 1 339 ? 30.731  -26.159 -14.292 1.00 107.70 ? 335  PHE A CA  1 
ATOM   2531  C C   . PHE A 1 339 ? 29.562  -27.054 -14.700 1.00 109.74 ? 335  PHE A C   1 
ATOM   2532  O O   . PHE A 1 339 ? 28.589  -26.581 -15.290 1.00 111.56 ? 335  PHE A O   1 
ATOM   2533  C CB  . PHE A 1 339 ? 31.581  -25.835 -15.523 1.00 108.48 ? 335  PHE A CB  1 
ATOM   2534  C CG  . PHE A 1 339 ? 32.594  -24.749 -15.297 1.00 107.27 ? 335  PHE A CG  1 
ATOM   2535  C CD1 . PHE A 1 339 ? 32.201  -23.416 -15.223 1.00 107.42 ? 335  PHE A CD1 1 
ATOM   2536  C CD2 . PHE A 1 339 ? 33.946  -25.058 -15.175 1.00 106.71 ? 335  PHE A CD2 1 
ATOM   2537  C CE1 . PHE A 1 339 ? 33.135  -22.408 -15.018 1.00 106.74 ? 335  PHE A CE1 1 
ATOM   2538  C CE2 . PHE A 1 339 ? 34.891  -24.055 -14.972 1.00 106.09 ? 335  PHE A CE2 1 
ATOM   2539  C CZ  . PHE A 1 339 ? 34.482  -22.726 -14.893 1.00 106.07 ? 335  PHE A CZ  1 
ATOM   2540  N N   . ASP A 1 340 ? 29.674  -28.344 -14.390 1.00 109.92 ? 336  ASP A N   1 
ATOM   2541  C CA  . ASP A 1 340 ? 28.646  -29.332 -14.713 1.00 112.39 ? 336  ASP A CA  1 
ATOM   2542  C C   . ASP A 1 340 ? 27.457  -29.188 -13.760 1.00 112.23 ? 336  ASP A C   1 
ATOM   2543  O O   . ASP A 1 340 ? 27.600  -29.424 -12.559 1.00 110.34 ? 336  ASP A O   1 
ATOM   2544  C CB  . ASP A 1 340 ? 29.238  -30.748 -14.646 1.00 113.08 ? 336  ASP A CB  1 
ATOM   2545  C CG  . ASP A 1 340 ? 28.284  -31.821 -15.154 1.00 116.51 ? 336  ASP A CG  1 
ATOM   2546  O OD1 . ASP A 1 340 ? 27.468  -31.540 -16.058 1.00 119.03 ? 336  ASP A OD1 1 
ATOM   2547  O OD2 . ASP A 1 340 ? 28.363  -32.962 -14.653 1.00 117.39 ? 336  ASP A OD2 1 
ATOM   2548  N N   . PRO A 1 341 ? 26.281  -28.798 -14.295 1.00 114.58 ? 337  PRO A N   1 
ATOM   2549  C CA  . PRO A 1 341 ? 25.095  -28.497 -13.482 1.00 115.07 ? 337  PRO A CA  1 
ATOM   2550  C C   . PRO A 1 341 ? 24.588  -29.660 -12.626 1.00 115.31 ? 337  PRO A C   1 
ATOM   2551  O O   . PRO A 1 341 ? 23.870  -29.433 -11.652 1.00 114.84 ? 337  PRO A O   1 
ATOM   2552  C CB  . PRO A 1 341 ? 24.038  -28.109 -14.526 1.00 118.76 ? 337  PRO A CB  1 
ATOM   2553  C CG  . PRO A 1 341 ? 24.521  -28.693 -15.803 1.00 120.49 ? 337  PRO A CG  1 
ATOM   2554  C CD  . PRO A 1 341 ? 26.009  -28.615 -15.732 1.00 117.41 ? 337  PRO A CD  1 
ATOM   2555  N N   . THR A 1 342 ? 24.962  -30.885 -12.987 1.00 116.35 ? 338  THR A N   1 
ATOM   2556  C CA  . THR A 1 342 ? 24.514  -32.079 -12.266 1.00 117.19 ? 338  THR A CA  1 
ATOM   2557  C C   . THR A 1 342 ? 25.325  -32.369 -11.000 1.00 114.02 ? 338  THR A C   1 
ATOM   2558  O O   . THR A 1 342 ? 24.855  -33.088 -10.118 1.00 114.16 ? 338  THR A O   1 
ATOM   2559  C CB  . THR A 1 342 ? 24.524  -33.340 -13.168 1.00 120.48 ? 338  THR A CB  1 
ATOM   2560  O OG1 . THR A 1 342 ? 25.798  -33.466 -13.813 1.00 119.77 ? 338  THR A OG1 1 
ATOM   2561  C CG2 . THR A 1 342 ? 23.424  -33.265 -14.222 1.00 124.55 ? 338  THR A CG2 1 
ATOM   2562  N N   . THR A 1 343 ? 26.529  -31.803 -10.911 1.00 111.50 ? 339  THR A N   1 
ATOM   2563  C CA  . THR A 1 343 ? 27.455  -32.108 -9.812  1.00 109.13 ? 339  THR A CA  1 
ATOM   2564  C C   . THR A 1 343 ? 27.102  -31.425 -8.492  1.00 106.98 ? 339  THR A C   1 
ATOM   2565  O O   . THR A 1 343 ? 26.777  -30.232 -8.455  1.00 106.19 ? 339  THR A O   1 
ATOM   2566  C CB  . THR A 1 343 ? 28.918  -31.772 -10.173 1.00 107.84 ? 339  THR A CB  1 
ATOM   2567  O OG1 . THR A 1 343 ? 29.021  -30.390 -10.534 1.00 106.81 ? 339  THR A OG1 1 
ATOM   2568  C CG2 . THR A 1 343 ? 29.400  -32.640 -11.328 1.00 110.24 ? 339  THR A CG2 1 
ATOM   2569  N N   . GLU A 1 344 ? 27.181  -32.199 -7.413  1.00 106.31 ? 340  GLU A N   1 
ATOM   2570  C CA  . GLU A 1 344 ? 26.901  -31.705 -6.069  1.00 104.50 ? 340  GLU A CA  1 
ATOM   2571  C C   . GLU A 1 344 ? 28.179  -31.248 -5.371  1.00 102.23 ? 340  GLU A C   1 
ATOM   2572  O O   . GLU A 1 344 ? 28.190  -30.214 -4.702  1.00 100.82 ? 340  GLU A O   1 
ATOM   2573  C CB  . GLU A 1 344 ? 26.199  -32.778 -5.230  1.00 105.31 ? 340  GLU A CB  1 
ATOM   2574  C CG  . GLU A 1 344 ? 24.814  -33.174 -5.729  1.00 108.15 ? 340  GLU A CG  1 
ATOM   2575  C CD  . GLU A 1 344 ? 24.103  -34.126 -4.785  1.00 109.25 ? 340  GLU A CD  1 
ATOM   2576  O OE1 . GLU A 1 344 ? 23.648  -33.677 -3.711  1.00 108.04 ? 340  GLU A OE1 1 
ATOM   2577  O OE2 . GLU A 1 344 ? 23.990  -35.323 -5.124  1.00 111.59 ? 340  GLU A OE2 1 
ATOM   2578  N N   . GLN A 1 345 ? 29.251  -32.022 -5.534  1.00 102.38 ? 341  GLN A N   1 
ATOM   2579  C CA  . GLN A 1 345 ? 30.522  -31.732 -4.875  1.00 100.97 ? 341  GLN A CA  1 
ATOM   2580  C C   . GLN A 1 345 ? 31.635  -31.444 -5.876  1.00 101.26 ? 341  GLN A C   1 
ATOM   2581  O O   . GLN A 1 345 ? 31.771  -32.138 -6.886  1.00 102.94 ? 341  GLN A O   1 
ATOM   2582  C CB  . GLN A 1 345 ? 30.928  -32.894 -3.966  1.00 101.42 ? 341  GLN A CB  1 
ATOM   2583  C CG  . GLN A 1 345 ? 32.126  -32.604 -3.066  1.00 100.74 ? 341  GLN A CG  1 
ATOM   2584  C CD  . GLN A 1 345 ? 32.514  -33.787 -2.201  1.00 102.19 ? 341  GLN A CD  1 
ATOM   2585  O OE1 . GLN A 1 345 ? 31.662  -34.426 -1.582  1.00 102.57 ? 341  GLN A OE1 1 
ATOM   2586  N NE2 . GLN A 1 345 ? 33.809  -34.084 -2.150  1.00 103.38 ? 341  GLN A NE2 1 
ATOM   2587  N N   . GLY A 1 346 ? 32.426  -30.415 -5.580  1.00 99.89  ? 342  GLY A N   1 
ATOM   2588  C CA  . GLY A 1 346 ? 33.608  -30.086 -6.371  1.00 100.09 ? 342  GLY A CA  1 
ATOM   2589  C C   . GLY A 1 346 ? 34.868  -30.699 -5.781  1.00 100.48 ? 342  GLY A C   1 
ATOM   2590  O O   . GLY A 1 346 ? 34.786  -31.640 -4.987  1.00 100.90 ? 342  GLY A O   1 
ATOM   2591  N N   . PRO A 1 347 ? 36.045  -30.175 -6.173  1.00 100.74 ? 343  PRO A N   1 
ATOM   2592  C CA  . PRO A 1 347 ? 37.329  -30.615 -5.634  1.00 101.80 ? 343  PRO A CA  1 
ATOM   2593  C C   . PRO A 1 347 ? 37.764  -29.805 -4.413  1.00 100.99 ? 343  PRO A C   1 
ATOM   2594  O O   . PRO A 1 347 ? 37.170  -28.766 -4.114  1.00 99.54  ? 343  PRO A O   1 
ATOM   2595  C CB  . PRO A 1 347 ? 38.285  -30.346 -6.791  1.00 103.04 ? 343  PRO A CB  1 
ATOM   2596  C CG  . PRO A 1 347 ? 37.712  -29.144 -7.456  1.00 101.68 ? 343  PRO A CG  1 
ATOM   2597  C CD  . PRO A 1 347 ? 36.221  -29.218 -7.283  1.00 100.65 ? 343  PRO A CD  1 
ATOM   2598  N N   . GLN A 1 348 ? 38.797  -30.280 -3.721  1.00 102.34 ? 344  GLN A N   1 
ATOM   2599  C CA  . GLN A 1 348 ? 39.409  -29.519 -2.632  1.00 102.39 ? 344  GLN A CA  1 
ATOM   2600  C C   . GLN A 1 348 ? 40.285  -28.413 -3.220  1.00 103.01 ? 344  GLN A C   1 
ATOM   2601  O O   . GLN A 1 348 ? 40.587  -28.425 -4.415  1.00 103.56 ? 344  GLN A O   1 
ATOM   2602  C CB  . GLN A 1 348 ? 40.230  -30.425 -1.705  1.00 104.44 ? 344  GLN A CB  1 
ATOM   2603  C CG  . GLN A 1 348 ? 39.565  -31.750 -1.306  1.00 104.50 ? 344  GLN A CG  1 
ATOM   2604  C CD  . GLN A 1 348 ? 38.142  -31.600 -0.794  1.00 102.06 ? 344  GLN A CD  1 
ATOM   2605  O OE1 . GLN A 1 348 ? 37.218  -32.222 -1.318  1.00 101.29 ? 344  GLN A OE1 1 
ATOM   2606  N NE2 . GLN A 1 348 ? 37.959  -30.775 0.235   1.00 101.16 ? 344  GLN A NE2 1 
ATOM   2607  N N   . ILE A 1 349 ? 40.694  -27.466 -2.381  1.00 103.21 ? 345  ILE A N   1 
ATOM   2608  C CA  . ILE A 1 349 ? 41.403  -26.275 -2.854  1.00 103.94 ? 345  ILE A CA  1 
ATOM   2609  C C   . ILE A 1 349 ? 42.862  -26.527 -3.283  1.00 106.74 ? 345  ILE A C   1 
ATOM   2610  O O   . ILE A 1 349 ? 43.286  -26.059 -4.343  1.00 107.24 ? 345  ILE A O   1 
ATOM   2611  C CB  . ILE A 1 349 ? 41.295  -25.093 -1.830  1.00 103.86 ? 345  ILE A CB  1 
ATOM   2612  C CG1 . ILE A 1 349 ? 41.659  -23.756 -2.485  1.00 104.39 ? 345  ILE A CG1 1 
ATOM   2613  C CG2 . ILE A 1 349 ? 42.128  -25.353 -0.569  1.00 105.87 ? 345  ILE A CG2 1 
ATOM   2614  C CD1 . ILE A 1 349 ? 40.579  -23.195 -3.391  1.00 102.23 ? 345  ILE A CD1 1 
ATOM   2615  N N   . ASP A 1 350 ? 43.608  -27.277 -2.474  1.00 108.79 ? 346  ASP A N   1 
ATOM   2616  C CA  . ASP A 1 350 ? 45.055  -27.400 -2.645  1.00 112.18 ? 346  ASP A CA  1 
ATOM   2617  C C   . ASP A 1 350 ? 45.561  -28.834 -2.651  1.00 114.43 ? 346  ASP A C   1 
ATOM   2618  O O   . ASP A 1 350 ? 44.829  -29.765 -2.317  1.00 113.39 ? 346  ASP A O   1 
ATOM   2619  C CB  . ASP A 1 350 ? 45.776  -26.636 -1.529  1.00 114.25 ? 346  ASP A CB  1 
ATOM   2620  C CG  . ASP A 1 350 ? 46.115  -25.210 -1.913  1.00 114.64 ? 346  ASP A CG  1 
ATOM   2621  O OD1 . ASP A 1 350 ? 45.975  -24.848 -3.101  1.00 113.64 ? 346  ASP A OD1 1 
ATOM   2622  O OD2 . ASP A 1 350 ? 46.534  -24.448 -1.018  1.00 116.39 ? 346  ASP A OD2 1 
ATOM   2623  N N   . LYS A 1 351 ? 46.825  -28.989 -3.041  1.00 117.91 ? 347  LYS A N   1 
ATOM   2624  C CA  . LYS A 1 351 ? 47.580  -30.213 -2.802  1.00 121.47 ? 347  LYS A CA  1 
ATOM   2625  C C   . LYS A 1 351 ? 47.842  -30.312 -1.303  1.00 123.19 ? 347  LYS A C   1 
ATOM   2626  O O   . LYS A 1 351 ? 47.822  -31.401 -0.728  1.00 124.67 ? 347  LYS A O   1 
ATOM   2627  C CB  . LYS A 1 351 ? 48.902  -30.180 -3.580  1.00 125.24 ? 347  LYS A CB  1 
ATOM   2628  C CG  . LYS A 1 351 ? 49.800  -31.414 -3.421  1.00 129.81 ? 347  LYS A CG  1 
ATOM   2629  C CD  . LYS A 1 351 ? 49.543  -32.476 -4.492  1.00 130.09 ? 347  LYS A CD  1 
ATOM   2630  C CE  . LYS A 1 351 ? 48.483  -33.487 -4.068  1.00 128.42 ? 347  LYS A CE  1 
ATOM   2631  N NZ  . LYS A 1 351 ? 48.306  -34.568 -5.079  1.00 129.54 ? 347  LYS A NZ  1 
ATOM   2632  N N   . LYS A 1 352 ? 48.075  -29.154 -0.685  1.00 123.32 ? 348  LYS A N   1 
ATOM   2633  C CA  . LYS A 1 352 ? 48.274  -29.034 0.757   1.00 125.02 ? 348  LYS A CA  1 
ATOM   2634  C C   . LYS A 1 352 ? 47.036  -29.500 1.522   1.00 121.91 ? 348  LYS A C   1 
ATOM   2635  O O   . LYS A 1 352 ? 47.149  -30.168 2.550   1.00 123.65 ? 348  LYS A O   1 
ATOM   2636  C CB  . LYS A 1 352 ? 48.598  -27.580 1.115   1.00 125.54 ? 348  LYS A CB  1 
ATOM   2637  C CG  . LYS A 1 352 ? 49.466  -27.408 2.348   1.00 129.86 ? 348  LYS A CG  1 
ATOM   2638  C CD  . LYS A 1 352 ? 49.882  -25.953 2.520   1.00 131.45 ? 348  LYS A CD  1 
ATOM   2639  C CE  . LYS A 1 352 ? 51.129  -25.820 3.385   1.00 137.49 ? 348  LYS A CE  1 
ATOM   2640  N NZ  . LYS A 1 352 ? 50.903  -26.239 4.797   1.00 138.66 ? 348  LYS A NZ  1 
ATOM   2641  N N   . GLN A 1 353 ? 45.863  -29.145 1.001   1.00 117.75 ? 349  GLN A N   1 
ATOM   2642  C CA  . GLN A 1 353 ? 44.581  -29.499 1.605   1.00 114.75 ? 349  GLN A CA  1 
ATOM   2643  C C   . GLN A 1 353 ? 44.232  -30.968 1.360   1.00 114.86 ? 349  GLN A C   1 
ATOM   2644  O O   . GLN A 1 353 ? 43.941  -31.711 2.299   1.00 115.25 ? 349  GLN A O   1 
ATOM   2645  C CB  . GLN A 1 353 ? 43.480  -28.584 1.054   1.00 111.04 ? 349  GLN A CB  1 
ATOM   2646  C CG  . GLN A 1 353 ? 42.089  -28.813 1.637   1.00 108.22 ? 349  GLN A CG  1 
ATOM   2647  C CD  . GLN A 1 353 ? 41.881  -28.167 2.998   1.00 108.31 ? 349  GLN A CD  1 
ATOM   2648  O OE1 . GLN A 1 353 ? 42.780  -27.535 3.554   1.00 110.73 ? 349  GLN A OE1 1 
ATOM   2649  N NE2 . GLN A 1 353 ? 40.681  -28.322 3.537   1.00 106.11 ? 349  GLN A NE2 1 
ATOM   2650  N N   . TYR A 1 354 ? 44.268  -31.366 0.090   1.00 114.83 ? 350  TYR A N   1 
ATOM   2651  C CA  . TYR A 1 354 ? 43.984  -32.734 -0.350  1.00 115.63 ? 350  TYR A CA  1 
ATOM   2652  C C   . TYR A 1 354 ? 44.719  -33.785 0.487   1.00 119.47 ? 350  TYR A C   1 
ATOM   2653  O O   . TYR A 1 354 ? 44.103  -34.734 0.980   1.00 119.42 ? 350  TYR A O   1 
ATOM   2654  C CB  . TYR A 1 354 ? 44.348  -32.866 -1.835  1.00 116.40 ? 350  TYR A CB  1 
ATOM   2655  C CG  . TYR A 1 354 ? 44.103  -34.218 -2.468  1.00 117.67 ? 350  TYR A CG  1 
ATOM   2656  C CD1 . TYR A 1 354 ? 42.819  -34.616 -2.840  1.00 115.09 ? 350  TYR A CD1 1 
ATOM   2657  C CD2 . TYR A 1 354 ? 45.164  -35.085 -2.731  1.00 121.89 ? 350  TYR A CD2 1 
ATOM   2658  C CE1 . TYR A 1 354 ? 42.596  -35.853 -3.437  1.00 116.93 ? 350  TYR A CE1 1 
ATOM   2659  C CE2 . TYR A 1 354 ? 44.951  -36.323 -3.327  1.00 123.69 ? 350  TYR A CE2 1 
ATOM   2660  C CZ  . TYR A 1 354 ? 43.665  -36.700 -3.676  1.00 121.20 ? 350  TYR A CZ  1 
ATOM   2661  O OH  . TYR A 1 354 ? 43.449  -37.924 -4.266  1.00 123.54 ? 350  TYR A OH  1 
ATOM   2662  N N   . ASN A 1 355 ? 46.029  -33.597 0.649   1.00 123.19 ? 351  ASN A N   1 
ATOM   2663  C CA  . ASN A 1 355 ? 46.869  -34.504 1.433   1.00 127.72 ? 351  ASN A CA  1 
ATOM   2664  C C   . ASN A 1 355 ? 46.540  -34.494 2.924   1.00 127.51 ? 351  ASN A C   1 
ATOM   2665  O O   . ASN A 1 355 ? 46.560  -35.540 3.575   1.00 129.72 ? 351  ASN A O   1 
ATOM   2666  C CB  . ASN A 1 355 ? 48.354  -34.179 1.226   1.00 132.14 ? 351  ASN A CB  1 
ATOM   2667  C CG  . ASN A 1 355 ? 48.858  -34.576 -0.152  1.00 133.83 ? 351  ASN A CG  1 
ATOM   2668  O OD1 . ASN A 1 355 ? 49.523  -33.792 -0.829  1.00 134.57 ? 351  ASN A OD1 1 
ATOM   2669  N ND2 . ASN A 1 355 ? 48.551  -35.799 -0.571  1.00 134.84 ? 351  ASN A ND2 1 
ATOM   2670  N N   . LYS A 1 356 ? 46.233  -33.309 3.448   1.00 125.16 ? 352  LYS A N   1 
ATOM   2671  C CA  . LYS A 1 356 ? 45.939  -33.126 4.869   1.00 125.05 ? 352  LYS A CA  1 
ATOM   2672  C C   . LYS A 1 356 ? 44.646  -33.826 5.279   1.00 122.03 ? 352  LYS A C   1 
ATOM   2673  O O   . LYS A 1 356 ? 44.505  -34.254 6.426   1.00 122.96 ? 352  LYS A O   1 
ATOM   2674  C CB  . LYS A 1 356 ? 45.863  -31.636 5.206   1.00 123.48 ? 352  LYS A CB  1 
ATOM   2675  C CG  . LYS A 1 356 ? 46.227  -31.298 6.642   1.00 126.10 ? 352  LYS A CG  1 
ATOM   2676  C CD  . LYS A 1 356 ? 46.432  -29.802 6.813   1.00 126.51 ? 352  LYS A CD  1 
ATOM   2677  C CE  . LYS A 1 356 ? 47.025  -29.474 8.173   1.00 130.32 ? 352  LYS A CE  1 
ATOM   2678  N NZ  . LYS A 1 356 ? 47.197  -28.008 8.363   1.00 130.84 ? 352  LYS A NZ  1 
ATOM   2679  N N   . ILE A 1 357 ? 43.711  -33.938 4.338   1.00 118.78 ? 353  ILE A N   1 
ATOM   2680  C CA  . ILE A 1 357 ? 42.437  -34.615 4.579   1.00 116.27 ? 353  ILE A CA  1 
ATOM   2681  C C   . ILE A 1 357 ? 42.616  -36.134 4.569   1.00 119.19 ? 353  ILE A C   1 
ATOM   2682  O O   . ILE A 1 357 ? 42.163  -36.816 5.489   1.00 119.54 ? 353  ILE A O   1 
ATOM   2683  C CB  . ILE A 1 357 ? 41.345  -34.179 3.567   1.00 112.44 ? 353  ILE A CB  1 
ATOM   2684  C CG1 . ILE A 1 357 ? 41.054  -32.682 3.710   1.00 109.93 ? 353  ILE A CG1 1 
ATOM   2685  C CG2 . ILE A 1 357 ? 40.061  -34.983 3.773   1.00 110.61 ? 353  ILE A CG2 1 
ATOM   2686  C CD1 . ILE A 1 357 ? 40.350  -32.067 2.516   1.00 107.29 ? 353  ILE A CD1 1 
ATOM   2687  N N   . LEU A 1 358 ? 43.286  -36.651 3.538   1.00 121.64 ? 354  LEU A N   1 
ATOM   2688  C CA  . LEU A 1 358 ? 43.557  -38.089 3.414   1.00 125.30 ? 354  LEU A CA  1 
ATOM   2689  C C   . LEU A 1 358 ? 44.360  -38.627 4.595   1.00 129.38 ? 354  LEU A C   1 
ATOM   2690  O O   . LEU A 1 358 ? 44.134  -39.751 5.048   1.00 131.39 ? 354  LEU A O   1 
ATOM   2691  C CB  . LEU A 1 358 ? 44.293  -38.395 2.106   1.00 127.74 ? 354  LEU A CB  1 
ATOM   2692  C CG  . LEU A 1 358 ? 43.521  -38.334 0.786   1.00 125.13 ? 354  LEU A CG  1 
ATOM   2693  C CD1 . LEU A 1 358 ? 44.496  -38.337 -0.378  1.00 127.76 ? 354  LEU A CD1 1 
ATOM   2694  C CD2 . LEU A 1 358 ? 42.527  -39.487 0.657   1.00 125.08 ? 354  LEU A CD2 1 
ATOM   2695  N N   . GLU A 1 359 ? 45.295  -37.810 5.076   1.00 131.02 ? 355  GLU A N   1 
ATOM   2696  C CA  . GLU A 1 359 ? 46.105  -38.117 6.253   1.00 135.35 ? 355  GLU A CA  1 
ATOM   2697  C C   . GLU A 1 359 ? 45.228  -38.455 7.456   1.00 133.81 ? 355  GLU A C   1 
ATOM   2698  O O   . GLU A 1 359 ? 45.490  -39.420 8.176   1.00 137.32 ? 355  GLU A O   1 
ATOM   2699  C CB  . GLU A 1 359 ? 47.026  -36.929 6.572   1.00 136.61 ? 355  GLU A CB  1 
ATOM   2700  C CG  . GLU A 1 359 ? 47.743  -36.986 7.923   1.00 140.99 ? 355  GLU A CG  1 
ATOM   2701  C CD  . GLU A 1 359 ? 48.690  -38.166 8.048   1.00 147.84 ? 355  GLU A CD  1 
ATOM   2702  O OE1 . GLU A 1 359 ? 49.550  -38.350 7.160   1.00 151.33 ? 355  GLU A OE1 1 
ATOM   2703  O OE2 . GLU A 1 359 ? 48.576  -38.906 9.047   1.00 150.15 ? 355  GLU A OE2 1 
ATOM   2704  N N   . LEU A 1 360 ? 44.180  -37.660 7.650   1.00 128.93 ? 356  LEU A N   1 
ATOM   2705  C CA  . LEU A 1 360 ? 43.292  -37.803 8.796   1.00 127.24 ? 356  LEU A CA  1 
ATOM   2706  C C   . LEU A 1 360 ? 42.231  -38.889 8.579   1.00 126.03 ? 356  LEU A C   1 
ATOM   2707  O O   . LEU A 1 360 ? 41.680  -39.419 9.546   1.00 126.02 ? 356  LEU A O   1 
ATOM   2708  C CB  . LEU A 1 360 ? 42.648  -36.450 9.129   1.00 123.14 ? 356  LEU A CB  1 
ATOM   2709  C CG  . LEU A 1 360 ? 42.422  -36.044 10.592  1.00 122.98 ? 356  LEU A CG  1 
ATOM   2710  C CD1 . LEU A 1 360 ? 43.579  -36.456 11.493  1.00 128.03 ? 356  LEU A CD1 1 
ATOM   2711  C CD2 . LEU A 1 360 ? 42.188  -34.540 10.692  1.00 120.36 ? 356  LEU A CD2 1 
ATOM   2712  N N   . ILE A 1 361 ? 41.960  -39.220 7.316   1.00 125.39 ? 357  ILE A N   1 
ATOM   2713  C CA  . ILE A 1 361 ? 41.021  -40.293 6.970   1.00 125.12 ? 357  ILE A CA  1 
ATOM   2714  C C   . ILE A 1 361 ? 41.606  -41.652 7.339   1.00 130.32 ? 357  ILE A C   1 
ATOM   2715  O O   . ILE A 1 361 ? 41.004  -42.410 8.100   1.00 130.83 ? 357  ILE A O   1 
ATOM   2716  C CB  . ILE A 1 361 ? 40.646  -40.281 5.465   1.00 123.70 ? 357  ILE A CB  1 
ATOM   2717  C CG1 . ILE A 1 361 ? 39.792  -39.054 5.133   1.00 118.79 ? 357  ILE A CG1 1 
ATOM   2718  C CG2 . ILE A 1 361 ? 39.906  -41.568 5.078   1.00 124.94 ? 357  ILE A CG2 1 
ATOM   2719  C CD1 . ILE A 1 361 ? 39.672  -38.757 3.647   1.00 117.70 ? 357  ILE A CD1 1 
ATOM   2720  N N   . GLN A 1 362 ? 42.788  -41.940 6.799   1.00 134.61 ? 358  GLN A N   1 
ATOM   2721  C CA  . GLN A 1 362 ? 43.483  -43.200 7.046   1.00 140.60 ? 358  GLN A CA  1 
ATOM   2722  C C   . GLN A 1 362 ? 43.995  -43.286 8.484   1.00 143.15 ? 358  GLN A C   1 
ATOM   2723  O O   . GLN A 1 362 ? 44.394  -44.357 8.947   1.00 148.01 ? 358  GLN A O   1 
ATOM   2724  C CB  . GLN A 1 362 ? 44.624  -43.378 6.043   1.00 144.64 ? 358  GLN A CB  1 
ATOM   2725  C CG  . GLN A 1 362 ? 44.151  -43.522 4.599   1.00 143.67 ? 358  GLN A CG  1 
ATOM   2726  C CD  . GLN A 1 362 ? 45.236  -43.230 3.576   1.00 147.00 ? 358  GLN A CD  1 
ATOM   2727  O OE1 . GLN A 1 362 ? 46.287  -42.675 3.900   1.00 149.40 ? 358  GLN A OE1 1 
ATOM   2728  N NE2 . GLN A 1 362 ? 44.978  -43.598 2.327   1.00 147.44 ? 358  GLN A NE2 1 
ATOM   2729  N N   . SER A 1 363 ? 43.977  -42.150 9.178   1.00 140.31 ? 359  SER A N   1 
ATOM   2730  C CA  . SER A 1 363 ? 44.264  -42.095 10.606  1.00 142.11 ? 359  SER A CA  1 
ATOM   2731  C C   . SER A 1 363 ? 43.150  -42.794 11.383  1.00 140.52 ? 359  SER A C   1 
ATOM   2732  O O   . SER A 1 363 ? 43.417  -43.654 12.222  1.00 144.37 ? 359  SER A O   1 
ATOM   2733  C CB  . SER A 1 363 ? 44.412  -40.641 11.065  1.00 139.45 ? 359  SER A CB  1 
ATOM   2734  O OG  . SER A 1 363 ? 44.570  -40.546 12.469  1.00 141.11 ? 359  SER A OG  1 
ATOM   2735  N N   . GLY A 1 364 ? 41.905  -42.428 11.079  1.00 135.21 ? 360  GLY A N   1 
ATOM   2736  C CA  . GLY A 1 364 ? 40.729  -43.000 11.735  1.00 133.38 ? 360  GLY A CA  1 
ATOM   2737  C C   . GLY A 1 364 ? 40.452  -44.451 11.381  1.00 136.34 ? 360  GLY A C   1 
ATOM   2738  O O   . GLY A 1 364 ? 39.847  -45.179 12.173  1.00 137.01 ? 360  GLY A O   1 
ATOM   2739  N N   . VAL A 1 365 ? 40.889  -44.866 10.192  1.00 129.90 ? 361  VAL A N   1 
ATOM   2740  C CA  . VAL A 1 365 ? 40.742  -46.252 9.730   1.00 133.36 ? 361  VAL A CA  1 
ATOM   2741  C C   . VAL A 1 365 ? 41.518  -47.206 10.642  1.00 138.44 ? 361  VAL A C   1 
ATOM   2742  O O   . VAL A 1 365 ? 41.016  -48.270 11.012  1.00 140.51 ? 361  VAL A O   1 
ATOM   2743  C CB  . VAL A 1 365 ? 41.192  -46.422 8.246   1.00 134.93 ? 361  VAL A CB  1 
ATOM   2744  C CG1 . VAL A 1 365 ? 41.183  -47.892 7.823   1.00 139.47 ? 361  VAL A CG1 1 
ATOM   2745  C CG2 . VAL A 1 365 ? 40.302  -45.608 7.316   1.00 130.26 ? 361  VAL A CG2 1 
ATOM   2746  N N   . ALA A 1 366 ? 42.732  -46.805 11.013  1.00 140.68 ? 362  ALA A N   1 
ATOM   2747  C CA  . ALA A 1 366 ? 43.592  -47.612 11.875  1.00 145.91 ? 362  ALA A CA  1 
ATOM   2748  C C   . ALA A 1 366 ? 43.436  -47.274 13.362  1.00 145.01 ? 362  ALA A C   1 
ATOM   2749  O O   . ALA A 1 366 ? 44.165  -47.809 14.202  1.00 149.25 ? 362  ALA A O   1 
ATOM   2750  C CB  . ALA A 1 366 ? 45.053  -47.480 11.439  1.00 149.84 ? 362  ALA A CB  1 
ATOM   2751  N N   . GLU A 1 367 ? 42.483  -46.400 13.685  1.00 139.85 ? 363  GLU A N   1 
ATOM   2752  C CA  . GLU A 1 367 ? 42.280  -45.959 15.068  1.00 138.87 ? 363  GLU A CA  1 
ATOM   2753  C C   . GLU A 1 367 ? 41.016  -46.528 15.719  1.00 137.30 ? 363  GLU A C   1 
ATOM   2754  O O   . GLU A 1 367 ? 40.891  -46.517 16.944  1.00 137.83 ? 363  GLU A O   1 
ATOM   2755  C CB  . GLU A 1 367 ? 42.292  -44.428 15.161  1.00 135.02 ? 363  GLU A CB  1 
ATOM   2756  C CG  . GLU A 1 367 ? 42.734  -43.889 16.521  1.00 136.24 ? 363  GLU A CG  1 
ATOM   2757  C CD  . GLU A 1 367 ? 42.878  -42.376 16.548  1.00 133.49 ? 363  GLU A CD  1 
ATOM   2758  O OE1 . GLU A 1 367 ? 41.963  -41.671 16.072  1.00 129.08 ? 363  GLU A OE1 1 
ATOM   2759  O OE2 . GLU A 1 367 ? 43.908  -41.890 17.060  1.00 136.09 ? 363  GLU A OE2 1 
ATOM   2760  N N   . GLY A 1 368 ? 40.087  -47.026 14.906  1.00 135.70 ? 364  GLY A N   1 
ATOM   2761  C CA  . GLY A 1 368 ? 38.897  -47.689 15.438  1.00 134.95 ? 364  GLY A CA  1 
ATOM   2762  C C   . GLY A 1 368 ? 37.612  -47.513 14.652  1.00 131.00 ? 364  GLY A C   1 
ATOM   2763  O O   . GLY A 1 368 ? 36.781  -48.424 14.609  1.00 131.82 ? 364  GLY A O   1 
ATOM   2764  N N   . ALA A 1 369 ? 37.443  -46.343 14.039  1.00 127.04 ? 365  ALA A N   1 
ATOM   2765  C CA  . ALA A 1 369 ? 36.223  -46.018 13.296  1.00 123.21 ? 365  ALA A CA  1 
ATOM   2766  C C   . ALA A 1 369 ? 36.056  -46.892 12.055  1.00 124.92 ? 365  ALA A C   1 
ATOM   2767  O O   . ALA A 1 369 ? 37.023  -47.153 11.335  1.00 127.52 ? 365  ALA A O   1 
ATOM   2768  C CB  . ALA A 1 369 ? 36.206  -44.543 12.918  1.00 119.12 ? 365  ALA A CB  1 
ATOM   2769  N N   . LYS A 1 370 ? 34.826  -47.342 11.820  1.00 123.82 ? 366  LYS A N   1 
ATOM   2770  C CA  . LYS A 1 370 ? 34.526  -48.206 10.682  1.00 125.81 ? 366  LYS A CA  1 
ATOM   2771  C C   . LYS A 1 370 ? 34.323  -47.392 9.408   1.00 122.93 ? 366  LYS A C   1 
ATOM   2772  O O   . LYS A 1 370 ? 33.488  -46.485 9.362   1.00 118.75 ? 366  LYS A O   1 
ATOM   2773  C CB  . LYS A 1 370 ? 33.299  -49.080 10.962  1.00 126.46 ? 366  LYS A CB  1 
ATOM   2774  C CG  . LYS A 1 370 ? 33.131  -50.225 9.975   1.00 130.14 ? 366  LYS A CG  1 
ATOM   2775  C CD  . LYS A 1 370 ? 31.881  -51.039 10.250  1.00 131.00 ? 366  LYS A CD  1 
ATOM   2776  C CE  . LYS A 1 370 ? 31.759  -52.183 9.255   1.00 135.21 ? 366  LYS A CE  1 
ATOM   2777  N NZ  . LYS A 1 370 ? 30.493  -52.942 9.424   1.00 136.23 ? 366  LYS A NZ  1 
ATOM   2778  N N   . LEU A 1 371 ? 35.102  -47.726 8.382   1.00 125.52 ? 367  LEU A N   1 
ATOM   2779  C CA  . LEU A 1 371 ? 34.998  -47.086 7.076   1.00 123.60 ? 367  LEU A CA  1 
ATOM   2780  C C   . LEU A 1 371 ? 33.762  -47.603 6.343   1.00 123.36 ? 367  LEU A C   1 
ATOM   2781  O O   . LEU A 1 371 ? 33.777  -48.695 5.767   1.00 127.29 ? 367  LEU A O   1 
ATOM   2782  C CB  . LEU A 1 371 ? 36.273  -47.334 6.256   1.00 127.03 ? 367  LEU A CB  1 
ATOM   2783  C CG  . LEU A 1 371 ? 36.429  -46.705 4.865   1.00 125.75 ? 367  LEU A CG  1 
ATOM   2784  C CD1 . LEU A 1 371 ? 36.488  -45.184 4.938   1.00 121.07 ? 367  LEU A CD1 1 
ATOM   2785  C CD2 . LEU A 1 371 ? 37.670  -47.253 4.174   1.00 130.29 ? 367  LEU A CD2 1 
ATOM   2786  N N   . GLU A 1 372 ? 32.692  -46.812 6.383   1.00 119.18 ? 368  GLU A N   1 
ATOM   2787  C CA  . GLU A 1 372 ? 31.422  -47.180 5.758   1.00 118.80 ? 368  GLU A CA  1 
ATOM   2788  C C   . GLU A 1 372 ? 31.454  -46.984 4.242   1.00 119.01 ? 368  GLU A C   1 
ATOM   2789  O O   . GLU A 1 372 ? 30.898  -47.793 3.495   1.00 121.42 ? 368  GLU A O   1 
ATOM   2790  C CB  . GLU A 1 372 ? 30.266  -46.391 6.381   1.00 114.61 ? 368  GLU A CB  1 
ATOM   2791  C CG  . GLU A 1 372 ? 30.008  -46.698 7.860   1.00 114.84 ? 368  GLU A CG  1 
ATOM   2792  C CD  . GLU A 1 372 ? 29.273  -48.015 8.085   1.00 118.02 ? 368  GLU A CD  1 
ATOM   2793  O OE1 . GLU A 1 372 ? 28.189  -48.208 7.494   1.00 117.66 ? 368  GLU A OE1 1 
ATOM   2794  O OE2 . GLU A 1 372 ? 29.773  -48.852 8.867   1.00 121.03 ? 368  GLU A OE2 1 
ATOM   2795  N N   . CYS A 1 373 ? 32.105  -45.908 3.801   1.00 116.80 ? 369  CYS A N   1 
ATOM   2796  C CA  . CYS A 1 373 ? 32.273  -45.602 2.379   1.00 116.99 ? 369  CYS A CA  1 
ATOM   2797  C C   . CYS A 1 373 ? 33.400  -44.591 2.189   1.00 115.70 ? 369  CYS A C   1 
ATOM   2798  O O   . CYS A 1 373 ? 33.901  -44.027 3.160   1.00 114.30 ? 369  CYS A O   1 
ATOM   2799  C CB  . CYS A 1 373 ? 30.976  -45.043 1.790   1.00 113.96 ? 369  CYS A CB  1 
ATOM   2800  S SG  . CYS A 1 373 ? 30.468  -43.467 2.511   1.00 108.45 ? 369  CYS A SG  1 
ATOM   2801  N N   . GLY A 1 374 ? 33.789  -44.366 0.936   1.00 116.54 ? 370  GLY A N   1 
ATOM   2802  C CA  . GLY A 1 374 ? 34.839  -43.404 0.606   1.00 115.77 ? 370  GLY A CA  1 
ATOM   2803  C C   . GLY A 1 374 ? 36.208  -43.818 1.112   1.00 119.15 ? 370  GLY A C   1 
ATOM   2804  O O   . GLY A 1 374 ? 36.533  -45.007 1.143   1.00 123.38 ? 370  GLY A O   1 
ATOM   2805  N N   . GLY A 1 375 ? 37.009  -42.831 1.507   1.00 117.67 ? 371  GLY A N   1 
ATOM   2806  C CA  . GLY A 1 375 ? 38.333  -43.083 2.075   1.00 120.88 ? 371  GLY A CA  1 
ATOM   2807  C C   . GLY A 1 375 ? 39.488  -42.630 1.203   1.00 122.62 ? 371  GLY A C   1 
ATOM   2808  O O   . GLY A 1 375 ? 40.454  -42.041 1.696   1.00 123.02 ? 371  GLY A O   1 
ATOM   2809  N N   . LYS A 1 376 ? 39.389  -42.910 -0.093  1.00 124.01 ? 372  LYS A N   1 
ATOM   2810  C CA  . LYS A 1 376 ? 40.438  -42.567 -1.054  1.00 126.16 ? 372  LYS A CA  1 
ATOM   2811  C C   . LYS A 1 376 ? 40.053  -41.362 -1.921  1.00 122.43 ? 372  LYS A C   1 
ATOM   2812  O O   . LYS A 1 376 ? 38.955  -40.823 -1.791  1.00 118.44 ? 372  LYS A O   1 
ATOM   2813  C CB  . LYS A 1 376 ? 40.787  -43.784 -1.926  1.00 131.40 ? 372  LYS A CB  1 
ATOM   2814  C CG  . LYS A 1 376 ? 39.602  -44.412 -2.668  1.00 131.42 ? 372  LYS A CG  1 
ATOM   2815  C CD  . LYS A 1 376 ? 40.035  -45.557 -3.580  1.00 137.31 ? 372  LYS A CD  1 
ATOM   2816  C CE  . LYS A 1 376 ? 40.255  -46.857 -2.813  1.00 141.59 ? 372  LYS A CE  1 
ATOM   2817  N NZ  . LYS A 1 376 ? 38.977  -47.439 -2.319  1.00 140.28 ? 372  LYS A NZ  1 
ATOM   2818  N N   . GLY A 1 377 ? 40.968  -40.940 -2.791  1.00 124.04 ? 373  GLY A N   1 
ATOM   2819  C CA  . GLY A 1 377 ? 40.697  -39.865 -3.743  1.00 121.23 ? 373  GLY A CA  1 
ATOM   2820  C C   . GLY A 1 377 ? 40.027  -40.387 -4.999  1.00 122.27 ? 373  GLY A C   1 
ATOM   2821  O O   . GLY A 1 377 ? 39.849  -41.597 -5.157  1.00 125.45 ? 373  GLY A O   1 
ATOM   2822  N N   . LEU A 1 378 ? 39.653  -39.477 -5.896  1.00 119.92 ? 374  LEU A N   1 
ATOM   2823  C CA  . LEU A 1 378 ? 39.005  -39.862 -7.152  1.00 121.05 ? 374  LEU A CA  1 
ATOM   2824  C C   . LEU A 1 378 ? 39.969  -40.050 -8.326  1.00 125.13 ? 374  LEU A C   1 
ATOM   2825  O O   . LEU A 1 378 ? 39.646  -40.752 -9.288  1.00 127.84 ? 374  LEU A O   1 
ATOM   2826  C CB  . LEU A 1 378 ? 37.882  -38.888 -7.527  1.00 116.62 ? 374  LEU A CB  1 
ATOM   2827  C CG  . LEU A 1 378 ? 36.522  -39.045 -6.838  1.00 113.68 ? 374  LEU A CG  1 
ATOM   2828  C CD1 . LEU A 1 378 ? 35.533  -38.043 -7.410  1.00 110.06 ? 374  LEU A CD1 1 
ATOM   2829  C CD2 . LEU A 1 378 ? 35.971  -40.461 -6.975  1.00 116.81 ? 374  LEU A CD2 1 
ATOM   2830  N N   . GLY A 1 379 ? 41.139  -39.419 -8.249  1.00 125.91 ? 375  GLY A N   1 
ATOM   2831  C CA  . GLY A 1 379 ? 42.168  -39.567 -9.280  1.00 130.14 ? 375  GLY A CA  1 
ATOM   2832  C C   . GLY A 1 379 ? 42.894  -38.285 -9.644  1.00 128.88 ? 375  GLY A C   1 
ATOM   2833  O O   . GLY A 1 379 ? 42.750  -37.262 -8.969  1.00 125.01 ? 375  GLY A O   1 
ATOM   2834  N N   . ARG A 1 380 ? 43.674  -38.353 -10.724 1.00 132.53 ? 376  ARG A N   1 
ATOM   2835  C CA  . ARG A 1 380 ? 44.474  -37.223 -11.215 1.00 132.30 ? 376  ARG A CA  1 
ATOM   2836  C C   . ARG A 1 380 ? 43.653  -36.004 -11.640 1.00 127.57 ? 376  ARG A C   1 
ATOM   2837  O O   . ARG A 1 380 ? 42.442  -36.101 -11.864 1.00 125.11 ? 376  ARG A O   1 
ATOM   2838  C CB  . ARG A 1 380 ? 45.378  -37.664 -12.375 1.00 137.66 ? 376  ARG A CB  1 
ATOM   2839  C CG  . ARG A 1 380 ? 46.867  -37.751 -12.040 1.00 141.97 ? 376  ARG A CG  1 
ATOM   2840  C CD  . ARG A 1 380 ? 47.215  -38.999 -11.245 1.00 145.95 ? 376  ARG A CD  1 
ATOM   2841  N NE  . ARG A 1 380 ? 46.897  -40.222 -11.977 1.00 150.12 ? 376  ARG A NE  1 
ATOM   2842  C CZ  . ARG A 1 380 ? 46.856  -41.435 -11.434 1.00 153.25 ? 376  ARG A CZ  1 
ATOM   2843  N NH1 . ARG A 1 380 ? 47.113  -41.608 -10.143 1.00 152.81 ? 376  ARG A NH1 1 
ATOM   2844  N NH2 . ARG A 1 380 ? 46.552  -42.482 -12.188 1.00 157.21 ? 376  ARG A NH2 1 
ATOM   2845  N N   . LYS A 1 381 ? 44.345  -34.868 -11.754 1.00 126.69 ? 377  LYS A N   1 
ATOM   2846  C CA  . LYS A 1 381 ? 43.770  -33.576 -12.154 1.00 122.75 ? 377  LYS A CA  1 
ATOM   2847  C C   . LYS A 1 381 ? 42.626  -33.113 -11.259 1.00 117.66 ? 377  LYS A C   1 
ATOM   2848  O O   . LYS A 1 381 ? 41.520  -33.658 -11.291 1.00 116.23 ? 377  LYS A O   1 
ATOM   2849  C CB  . LYS A 1 381 ? 43.372  -33.558 -13.635 1.00 123.84 ? 377  LYS A CB  1 
ATOM   2850  C CG  . LYS A 1 381 ? 44.558  -33.411 -14.577 1.00 128.16 ? 377  LYS A CG  1 
ATOM   2851  C CD  . LYS A 1 381 ? 44.167  -32.679 -15.848 1.00 127.90 ? 377  LYS A CD  1 
ATOM   2852  C CE  . LYS A 1 381 ? 45.395  -32.251 -16.630 1.00 131.52 ? 377  LYS A CE  1 
ATOM   2853  N NZ  . LYS A 1 381 ? 45.040  -31.328 -17.740 1.00 130.68 ? 377  LYS A NZ  1 
ATOM   2854  N N   . GLY A 1 382 ? 42.912  -32.089 -10.464 1.00 115.24 ? 378  GLY A N   1 
ATOM   2855  C CA  . GLY A 1 382 ? 41.988  -31.634 -9.442  1.00 110.92 ? 378  GLY A CA  1 
ATOM   2856  C C   . GLY A 1 382 ? 42.225  -32.390 -8.153  1.00 111.42 ? 378  GLY A C   1 
ATOM   2857  O O   . GLY A 1 382 ? 42.910  -33.418 -8.140  1.00 114.99 ? 378  GLY A O   1 
ATOM   2858  N N   . PHE A 1 383 ? 41.658  -31.879 -7.065  1.00 108.08 ? 379  PHE A N   1 
ATOM   2859  C CA  . PHE A 1 383 ? 41.824  -32.495 -5.754  1.00 108.31 ? 379  PHE A CA  1 
ATOM   2860  C C   . PHE A 1 383 ? 40.494  -33.076 -5.273  1.00 105.81 ? 379  PHE A C   1 
ATOM   2861  O O   . PHE A 1 383 ? 39.890  -32.577 -4.326  1.00 103.12 ? 379  PHE A O   1 
ATOM   2862  C CB  . PHE A 1 383 ? 42.399  -31.480 -4.755  1.00 107.39 ? 379  PHE A CB  1 
ATOM   2863  C CG  . PHE A 1 383 ? 43.591  -30.718 -5.277  1.00 109.48 ? 379  PHE A CG  1 
ATOM   2864  C CD1 . PHE A 1 383 ? 44.837  -31.334 -5.397  1.00 113.67 ? 379  PHE A CD1 1 
ATOM   2865  C CD2 . PHE A 1 383 ? 43.469  -29.383 -5.651  1.00 107.53 ? 379  PHE A CD2 1 
ATOM   2866  C CE1 . PHE A 1 383 ? 45.938  -30.632 -5.885  1.00 115.87 ? 379  PHE A CE1 1 
ATOM   2867  C CE2 . PHE A 1 383 ? 44.567  -28.671 -6.137  1.00 109.73 ? 379  PHE A CE2 1 
ATOM   2868  C CZ  . PHE A 1 383 ? 45.803  -29.298 -6.254  1.00 113.87 ? 379  PHE A CZ  1 
ATOM   2869  N N   . PHE A 1 384 ? 40.047  -34.138 -5.940  1.00 107.09 ? 380  PHE A N   1 
ATOM   2870  C CA  . PHE A 1 384 ? 38.746  -34.747 -5.662  1.00 105.16 ? 380  PHE A CA  1 
ATOM   2871  C C   . PHE A 1 384 ? 38.832  -35.882 -4.644  1.00 106.72 ? 380  PHE A C   1 
ATOM   2872  O O   . PHE A 1 384 ? 39.663  -36.785 -4.774  1.00 110.58 ? 380  PHE A O   1 
ATOM   2873  C CB  . PHE A 1 384 ? 38.112  -35.273 -6.952  1.00 106.18 ? 380  PHE A CB  1 
ATOM   2874  C CG  . PHE A 1 384 ? 37.805  -34.208 -7.964  1.00 104.44 ? 380  PHE A CG  1 
ATOM   2875  C CD1 . PHE A 1 384 ? 38.745  -33.850 -8.926  1.00 106.64 ? 380  PHE A CD1 1 
ATOM   2876  C CD2 . PHE A 1 384 ? 36.567  -33.575 -7.969  1.00 101.13 ? 380  PHE A CD2 1 
ATOM   2877  C CE1 . PHE A 1 384 ? 38.463  -32.869 -9.870  1.00 105.27 ? 380  PHE A CE1 1 
ATOM   2878  C CE2 . PHE A 1 384 ? 36.274  -32.591 -8.909  1.00 99.91  ? 380  PHE A CE2 1 
ATOM   2879  C CZ  . PHE A 1 384 ? 37.224  -32.237 -9.862  1.00 101.93 ? 380  PHE A CZ  1 
ATOM   2880  N N   . ILE A 1 385 ? 37.964  -35.824 -3.635  1.00 103.93 ? 381  ILE A N   1 
ATOM   2881  C CA  . ILE A 1 385 ? 37.829  -36.891 -2.643  1.00 105.04 ? 381  ILE A CA  1 
ATOM   2882  C C   . ILE A 1 385 ? 36.384  -37.390 -2.624  1.00 103.37 ? 381  ILE A C   1 
ATOM   2883  O O   . ILE A 1 385 ? 35.446  -36.594 -2.532  1.00 100.01 ? 381  ILE A O   1 
ATOM   2884  C CB  . ILE A 1 385 ? 38.254  -36.422 -1.223  1.00 104.02 ? 381  ILE A CB  1 
ATOM   2885  C CG1 . ILE A 1 385 ? 39.720  -35.976 -1.218  1.00 106.19 ? 381  ILE A CG1 1 
ATOM   2886  C CG2 . ILE A 1 385 ? 38.025  -37.530 -0.190  1.00 105.29 ? 381  ILE A CG2 1 
ATOM   2887  C CD1 . ILE A 1 385 ? 40.139  -35.192 0.014   1.00 105.18 ? 381  ILE A CD1 1 
ATOM   2888  N N   . GLU A 1 386 ? 36.210  -38.707 -2.727  1.00 106.11 ? 382  GLU A N   1 
ATOM   2889  C CA  . GLU A 1 386 ? 34.881  -39.319 -2.658  1.00 105.29 ? 382  GLU A CA  1 
ATOM   2890  C C   . GLU A 1 386 ? 34.299  -39.212 -1.242  1.00 103.03 ? 382  GLU A C   1 
ATOM   2891  O O   . GLU A 1 386 ? 35.024  -39.405 -0.263  1.00 104.01 ? 382  GLU A O   1 
ATOM   2892  C CB  . GLU A 1 386 ? 34.906  -40.776 -3.154  1.00 109.48 ? 382  GLU A CB  1 
ATOM   2893  C CG  . GLU A 1 386 ? 35.934  -41.690 -2.481  1.00 113.12 ? 382  GLU A CG  1 
ATOM   2894  C CD  . GLU A 1 386 ? 36.021  -43.077 -3.115  1.00 117.85 ? 382  GLU A CD  1 
ATOM   2895  O OE1 . GLU A 1 386 ? 35.861  -43.195 -4.349  1.00 119.21 ? 382  GLU A OE1 1 
ATOM   2896  O OE2 . GLU A 1 386 ? 36.266  -44.054 -2.375  1.00 120.44 ? 382  GLU A OE2 1 
ATOM   2897  N N   . PRO A 1 387 ? 32.993  -38.881 -1.134  1.00 100.23 ? 383  PRO A N   1 
ATOM   2898  C CA  . PRO A 1 387 ? 32.303  -38.718 0.148   1.00 98.15  ? 383  PRO A CA  1 
ATOM   2899  C C   . PRO A 1 387 ? 32.554  -39.882 1.105   1.00 100.71 ? 383  PRO A C   1 
ATOM   2900  O O   . PRO A 1 387 ? 32.457  -41.045 0.705   1.00 103.69 ? 383  PRO A O   1 
ATOM   2901  C CB  . PRO A 1 387 ? 30.831  -38.671 -0.260  1.00 96.48  ? 383  PRO A CB  1 
ATOM   2902  C CG  . PRO A 1 387 ? 30.851  -38.083 -1.612  1.00 96.03  ? 383  PRO A CG  1 
ATOM   2903  C CD  . PRO A 1 387 ? 32.089  -38.615 -2.269  1.00 99.24  ? 383  PRO A CD  1 
ATOM   2904  N N   . THR A 1 388 ? 32.875  -39.558 2.356   1.00 99.90  ? 384  THR A N   1 
ATOM   2905  C CA  . THR A 1 388 ? 33.281  -40.556 3.346   1.00 102.54 ? 384  THR A CA  1 
ATOM   2906  C C   . THR A 1 388 ? 32.435  -40.466 4.621   1.00 100.85 ? 384  THR A C   1 
ATOM   2907  O O   . THR A 1 388 ? 32.139  -39.371 5.106   1.00 98.01  ? 384  THR A O   1 
ATOM   2908  C CB  . THR A 1 388 ? 34.790  -40.413 3.685   1.00 104.49 ? 384  THR A CB  1 
ATOM   2909  O OG1 . THR A 1 388 ? 35.561  -40.468 2.478   1.00 106.35 ? 384  THR A OG1 1 
ATOM   2910  C CG2 . THR A 1 388 ? 35.260  -41.519 4.624   1.00 107.71 ? 384  THR A CG2 1 
ATOM   2911  N N   . VAL A 1 389 ? 32.044  -41.627 5.147   1.00 103.03 ? 385  VAL A N   1 
ATOM   2912  C CA  . VAL A 1 389 ? 31.273  -41.720 6.391   1.00 102.10 ? 385  VAL A CA  1 
ATOM   2913  C C   . VAL A 1 389 ? 31.962  -42.676 7.371   1.00 105.35 ? 385  VAL A C   1 
ATOM   2914  O O   . VAL A 1 389 ? 32.314  -43.802 7.008   1.00 108.75 ? 385  VAL A O   1 
ATOM   2915  C CB  . VAL A 1 389 ? 29.805  -42.182 6.134   1.00 101.45 ? 385  VAL A CB  1 
ATOM   2916  C CG1 . VAL A 1 389 ? 29.037  -42.331 7.442   1.00 100.71 ? 385  VAL A CG1 1 
ATOM   2917  C CG2 . VAL A 1 389 ? 29.080  -41.212 5.209   1.00 98.49  ? 385  VAL A CG2 1 
ATOM   2918  N N   . PHE A 1 390 ? 32.156  -42.214 8.605   1.00 104.67 ? 386  PHE A N   1 
ATOM   2919  C CA  . PHE A 1 390 ? 32.735  -43.039 9.666   1.00 107.81 ? 386  PHE A CA  1 
ATOM   2920  C C   . PHE A 1 390 ? 31.737  -43.315 10.786  1.00 107.36 ? 386  PHE A C   1 
ATOM   2921  O O   . PHE A 1 390 ? 31.097  -42.398 11.306  1.00 104.49 ? 386  PHE A O   1 
ATOM   2922  C CB  . PHE A 1 390 ? 34.003  -42.396 10.238  1.00 108.43 ? 386  PHE A CB  1 
ATOM   2923  C CG  . PHE A 1 390 ? 35.224  -42.590 9.383   1.00 110.84 ? 386  PHE A CG  1 
ATOM   2924  C CD1 . PHE A 1 390 ? 35.810  -43.848 9.255   1.00 115.09 ? 386  PHE A CD1 1 
ATOM   2925  C CD2 . PHE A 1 390 ? 35.800  -41.514 8.717   1.00 109.25 ? 386  PHE A CD2 1 
ATOM   2926  C CE1 . PHE A 1 390 ? 36.945  -44.031 8.466   1.00 117.80 ? 386  PHE A CE1 1 
ATOM   2927  C CE2 . PHE A 1 390 ? 36.937  -41.686 7.927   1.00 111.78 ? 386  PHE A CE2 1 
ATOM   2928  C CZ  . PHE A 1 390 ? 37.509  -42.947 7.801   1.00 116.06 ? 386  PHE A CZ  1 
ATOM   2929  N N   . SER A 1 391 ? 31.620  -44.590 11.147  1.00 110.62 ? 387  SER A N   1 
ATOM   2930  C CA  . SER A 1 391 ? 30.731  -45.032 12.216  1.00 110.98 ? 387  SER A CA  1 
ATOM   2931  C C   . SER A 1 391 ? 31.531  -45.409 13.463  1.00 113.65 ? 387  SER A C   1 
ATOM   2932  O O   . SER A 1 391 ? 32.732  -45.679 13.378  1.00 116.19 ? 387  SER A O   1 
ATOM   2933  C CB  . SER A 1 391 ? 29.890  -46.221 11.742  1.00 112.94 ? 387  SER A CB  1 
ATOM   2934  O OG  . SER A 1 391 ? 28.969  -46.635 12.736  1.00 113.20 ? 387  SER A OG  1 
ATOM   2935  N N   . ASN A 1 392 ? 30.852  -45.421 14.611  1.00 113.45 ? 388  ASN A N   1 
ATOM   2936  C CA  . ASN A 1 392 ? 31.445  -45.788 15.906  1.00 116.14 ? 388  ASN A CA  1 
ATOM   2937  C C   . ASN A 1 392 ? 32.650  -44.931 16.295  1.00 116.29 ? 388  ASN A C   1 
ATOM   2938  O O   . ASN A 1 392 ? 33.757  -45.442 16.480  1.00 119.58 ? 388  ASN A O   1 
ATOM   2939  C CB  . ASN A 1 392 ? 31.809  -47.283 15.948  1.00 120.66 ? 388  ASN A CB  1 
ATOM   2940  C CG  . ASN A 1 392 ? 30.601  -48.191 15.787  1.00 121.46 ? 388  ASN A CG  1 
ATOM   2941  O OD1 . ASN A 1 392 ? 29.654  -47.871 15.066  1.00 119.08 ? 388  ASN A OD1 1 
ATOM   2942  N ND2 . ASN A 1 392 ? 30.637  -49.340 16.455  1.00 125.19 ? 388  ASN A ND2 1 
ATOM   2943  N N   . VAL A 1 393 ? 32.423  -43.625 16.415  1.00 113.15 ? 389  VAL A N   1 
ATOM   2944  C CA  . VAL A 1 393 ? 33.484  -42.678 16.759  1.00 113.32 ? 389  VAL A CA  1 
ATOM   2945  C C   . VAL A 1 393 ? 33.356  -42.236 18.219  1.00 113.73 ? 389  VAL A C   1 
ATOM   2946  O O   . VAL A 1 393 ? 32.254  -41.968 18.700  1.00 111.90 ? 389  VAL A O   1 
ATOM   2947  C CB  . VAL A 1 393 ? 33.478  -41.443 15.816  1.00 110.02 ? 389  VAL A CB  1 
ATOM   2948  C CG1 . VAL A 1 393 ? 34.677  -40.539 16.089  1.00 110.61 ? 389  VAL A CG1 1 
ATOM   2949  C CG2 . VAL A 1 393 ? 33.468  -41.879 14.353  1.00 109.76 ? 389  VAL A CG2 1 
ATOM   2950  N N   . THR A 1 394 ? 34.488  -42.183 18.917  1.00 116.63 ? 390  THR A N   1 
ATOM   2951  C CA  . THR A 1 394 ? 34.537  -41.693 20.297  1.00 117.63 ? 390  THR A CA  1 
ATOM   2952  C C   . THR A 1 394 ? 35.209  -40.319 20.367  1.00 116.88 ? 390  THR A C   1 
ATOM   2953  O O   . THR A 1 394 ? 35.778  -39.847 19.378  1.00 115.98 ? 390  THR A O   1 
ATOM   2954  C CB  . THR A 1 394 ? 35.257  -42.687 21.245  1.00 122.03 ? 390  THR A CB  1 
ATOM   2955  O OG1 . THR A 1 394 ? 36.494  -43.112 20.657  1.00 124.65 ? 390  THR A OG1 1 
ATOM   2956  C CG2 . THR A 1 394 ? 34.383  -43.903 21.521  1.00 122.99 ? 390  THR A CG2 1 
ATOM   2957  N N   . ASP A 1 395 ? 35.134  -39.689 21.539  1.00 117.62 ? 391  ASP A N   1 
ATOM   2958  C CA  . ASP A 1 395 ? 35.661  -38.338 21.756  1.00 117.39 ? 391  ASP A CA  1 
ATOM   2959  C C   . ASP A 1 395 ? 37.187  -38.239 21.682  1.00 120.55 ? 391  ASP A C   1 
ATOM   2960  O O   . ASP A 1 395 ? 37.724  -37.244 21.188  1.00 119.77 ? 391  ASP A O   1 
ATOM   2961  C CB  . ASP A 1 395 ? 35.181  -37.795 23.107  1.00 117.95 ? 391  ASP A CB  1 
ATOM   2962  C CG  . ASP A 1 395 ? 33.685  -37.530 23.142  1.00 114.99 ? 391  ASP A CG  1 
ATOM   2963  O OD1 . ASP A 1 395 ? 32.923  -38.237 22.448  1.00 113.35 ? 391  ASP A OD1 1 
ATOM   2964  O OD2 . ASP A 1 395 ? 33.272  -36.610 23.876  1.00 114.72 ? 391  ASP A OD2 1 
ATOM   2965  N N   . ASP A 1 396 ? 37.874  -39.271 22.170  1.00 124.48 ? 392  ASP A N   1 
ATOM   2966  C CA  . ASP A 1 396 ? 39.335  -39.247 22.329  1.00 128.43 ? 392  ASP A CA  1 
ATOM   2967  C C   . ASP A 1 396 ? 40.140  -39.505 21.045  1.00 129.04 ? 392  ASP A C   1 
ATOM   2968  O O   . ASP A 1 396 ? 41.373  -39.448 21.061  1.00 132.31 ? 392  ASP A O   1 
ATOM   2969  C CB  . ASP A 1 396 ? 39.775  -40.199 23.456  1.00 132.76 ? 392  ASP A CB  1 
ATOM   2970  C CG  . ASP A 1 396 ? 39.327  -41.637 23.230  1.00 133.52 ? 392  ASP A CG  1 
ATOM   2971  O OD1 . ASP A 1 396 ? 38.125  -41.866 22.982  1.00 130.50 ? 392  ASP A OD1 1 
ATOM   2972  O OD2 . ASP A 1 396 ? 40.181  -42.545 23.320  1.00 137.54 ? 392  ASP A OD2 1 
ATOM   2973  N N   . MET A 1 397 ? 39.443  -39.772 19.941  1.00 126.30 ? 393  MET A N   1 
ATOM   2974  C CA  . MET A 1 397 ? 40.088  -39.996 18.644  1.00 126.79 ? 393  MET A CA  1 
ATOM   2975  C C   . MET A 1 397 ? 40.625  -38.695 18.050  1.00 125.49 ? 393  MET A C   1 
ATOM   2976  O O   . MET A 1 397 ? 40.102  -37.614 18.335  1.00 122.92 ? 393  MET A O   1 
ATOM   2977  C CB  . MET A 1 397 ? 39.117  -40.662 17.666  1.00 124.36 ? 393  MET A CB  1 
ATOM   2978  C CG  . MET A 1 397 ? 38.745  -42.093 18.033  1.00 126.64 ? 393  MET A CG  1 
ATOM   2979  S SD  . MET A 1 397 ? 37.629  -42.869 16.848  1.00 124.65 ? 393  MET A SD  1 
ATOM   2980  C CE  . MET A 1 397 ? 38.726  -43.149 15.460  1.00 126.68 ? 393  MET A CE  1 
ATOM   2981  N N   . ARG A 1 398 ? 41.666  -38.810 17.225  1.00 127.69 ? 394  ARG A N   1 
ATOM   2982  C CA  . ARG A 1 398 ? 42.303  -37.648 16.592  1.00 127.16 ? 394  ARG A CA  1 
ATOM   2983  C C   . ARG A 1 398 ? 41.352  -36.910 15.644  1.00 122.57 ? 394  ARG A C   1 
ATOM   2984  O O   . ARG A 1 398 ? 41.445  -35.690 15.488  1.00 121.10 ? 394  ARG A O   1 
ATOM   2985  C CB  . ARG A 1 398 ? 43.586  -38.054 15.851  1.00 130.60 ? 394  ARG A CB  1 
ATOM   2986  C CG  . ARG A 1 398 ? 44.477  -36.873 15.468  1.00 131.16 ? 394  ARG A CG  1 
ATOM   2987  C CD  . ARG A 1 398 ? 45.488  -37.229 14.390  1.00 133.84 ? 394  ARG A CD  1 
ATOM   2988  N NE  . ARG A 1 398 ? 46.751  -37.718 14.936  1.00 139.46 ? 394  ARG A NE  1 
ATOM   2989  C CZ  . ARG A 1 398 ? 47.098  -38.999 15.009  1.00 143.01 ? 394  ARG A CZ  1 
ATOM   2990  N NH1 . ARG A 1 398 ? 46.278  -39.946 14.570  1.00 141.67 ? 394  ARG A NH1 1 
ATOM   2991  N NH2 . ARG A 1 398 ? 48.273  -39.336 15.522  1.00 148.27 ? 394  ARG A NH2 1 
ATOM   2992  N N   . ILE A 1 399 ? 40.443  -37.655 15.020  1.00 120.75 ? 395  ILE A N   1 
ATOM   2993  C CA  . ILE A 1 399 ? 39.450  -37.074 14.115  1.00 116.71 ? 395  ILE A CA  1 
ATOM   2994  C C   . ILE A 1 399 ? 38.372  -36.270 14.853  1.00 113.95 ? 395  ILE A C   1 
ATOM   2995  O O   . ILE A 1 399 ? 37.838  -35.299 14.311  1.00 111.00 ? 395  ILE A O   1 
ATOM   2996  C CB  . ILE A 1 399 ? 38.796  -38.144 13.199  1.00 116.02 ? 395  ILE A CB  1 
ATOM   2997  C CG1 . ILE A 1 399 ? 38.368  -39.377 14.007  1.00 117.88 ? 395  ILE A CG1 1 
ATOM   2998  C CG2 . ILE A 1 399 ? 39.749  -38.529 12.078  1.00 118.06 ? 395  ILE A CG2 1 
ATOM   2999  C CD1 . ILE A 1 399 ? 37.352  -40.268 13.303  1.00 116.81 ? 395  ILE A CD1 1 
ATOM   3000  N N   . ALA A 1 400 ? 38.071  -36.670 16.089  1.00 115.26 ? 396  ALA A N   1 
ATOM   3001  C CA  . ALA A 1 400 ? 37.045  -36.011 16.903  1.00 113.31 ? 396  ALA A CA  1 
ATOM   3002  C C   . ALA A 1 400 ? 37.511  -34.674 17.481  1.00 113.74 ? 396  ALA A C   1 
ATOM   3003  O O   . ALA A 1 400 ? 36.756  -33.699 17.475  1.00 111.28 ? 396  ALA A O   1 
ATOM   3004  C CB  . ALA A 1 400 ? 36.569  -36.936 18.013  1.00 114.74 ? 396  ALA A CB  1 
ATOM   3005  N N   . LYS A 1 401 ? 38.747  -34.637 17.979  1.00 117.33 ? 397  LYS A N   1 
ATOM   3006  C CA  . LYS A 1 401 ? 39.332  -33.412 18.534  1.00 118.66 ? 397  LYS A CA  1 
ATOM   3007  C C   . LYS A 1 401 ? 39.685  -32.414 17.425  1.00 117.31 ? 397  LYS A C   1 
ATOM   3008  O O   . LYS A 1 401 ? 39.016  -31.388 17.272  1.00 114.91 ? 397  LYS A O   1 
ATOM   3009  C CB  . LYS A 1 401 ? 40.563  -33.724 19.398  1.00 123.30 ? 397  LYS A CB  1 
ATOM   3010  C CG  . LYS A 1 401 ? 40.281  -34.549 20.655  1.00 125.28 ? 397  LYS A CG  1 
ATOM   3011  C CD  . LYS A 1 401 ? 41.355  -34.345 21.732  1.00 129.92 ? 397  LYS A CD  1 
ATOM   3012  C CE  . LYS A 1 401 ? 42.709  -34.947 21.349  1.00 133.65 ? 397  LYS A CE  1 
ATOM   3013  N NZ  . LYS A 1 401 ? 42.703  -36.437 21.341  1.00 135.14 ? 397  LYS A NZ  1 
ATOM   3014  N N   . GLU A 1 402 ? 40.734  -32.722 16.661  1.00 119.20 ? 398  GLU A N   1 
ATOM   3015  C CA  . GLU A 1 402 ? 41.126  -31.925 15.497  1.00 118.20 ? 398  GLU A CA  1 
ATOM   3016  C C   . GLU A 1 402 ? 40.101  -32.142 14.396  1.00 114.54 ? 398  GLU A C   1 
ATOM   3017  O O   . GLU A 1 402 ? 40.013  -33.232 13.822  1.00 114.63 ? 398  GLU A O   1 
ATOM   3018  C CB  . GLU A 1 402 ? 42.507  -32.344 14.985  1.00 121.51 ? 398  GLU A CB  1 
ATOM   3019  C CG  . GLU A 1 402 ? 43.631  -32.282 16.007  1.00 125.93 ? 398  GLU A CG  1 
ATOM   3020  C CD  . GLU A 1 402 ? 44.828  -33.131 15.613  1.00 129.54 ? 398  GLU A CD  1 
ATOM   3021  O OE1 . GLU A 1 402 ? 44.876  -33.617 14.461  1.00 128.60 ? 398  GLU A OE1 1 
ATOM   3022  O OE2 . GLU A 1 402 ? 45.723  -33.317 16.461  1.00 133.71 ? 398  GLU A OE2 1 
ATOM   3023  N N   . GLU A 1 403 ? 39.324  -31.103 14.107  1.00 111.77 ? 399  GLU A N   1 
ATOM   3024  C CA  . GLU A 1 403 ? 38.253  -31.214 13.127  1.00 108.43 ? 399  GLU A CA  1 
ATOM   3025  C C   . GLU A 1 403 ? 38.797  -31.302 11.705  1.00 108.21 ? 399  GLU A C   1 
ATOM   3026  O O   . GLU A 1 403 ? 39.732  -30.583 11.336  1.00 109.49 ? 399  GLU A O   1 
ATOM   3027  C CB  . GLU A 1 403 ? 37.269  -30.053 13.257  1.00 105.92 ? 399  GLU A CB  1 
ATOM   3028  C CG  . GLU A 1 403 ? 35.895  -30.369 12.690  1.00 103.09 ? 399  GLU A CG  1 
ATOM   3029  C CD  . GLU A 1 403 ? 34.957  -29.184 12.718  1.00 101.21 ? 399  GLU A CD  1 
ATOM   3030  O OE1 . GLU A 1 403 ? 35.299  -28.130 12.138  1.00 100.85 ? 399  GLU A OE1 1 
ATOM   3031  O OE2 . GLU A 1 403 ? 33.867  -29.318 13.312  1.00 100.23 ? 399  GLU A OE2 1 
ATOM   3032  N N   . ILE A 1 404 ? 38.208  -32.202 10.922  1.00 106.89 ? 400  ILE A N   1 
ATOM   3033  C CA  . ILE A 1 404 ? 38.569  -32.371 9.519   1.00 106.65 ? 400  ILE A CA  1 
ATOM   3034  C C   . ILE A 1 404 ? 37.859  -31.306 8.687   1.00 103.48 ? 400  ILE A C   1 
ATOM   3035  O O   . ILE A 1 404 ? 36.664  -31.053 8.865   1.00 100.97 ? 400  ILE A O   1 
ATOM   3036  C CB  . ILE A 1 404 ? 38.223  -33.790 8.971   1.00 107.15 ? 400  ILE A CB  1 
ATOM   3037  C CG1 . ILE A 1 404 ? 38.646  -34.894 9.949   1.00 110.06 ? 400  ILE A CG1 1 
ATOM   3038  C CG2 . ILE A 1 404 ? 38.875  -34.022 7.609   1.00 108.12 ? 400  ILE A CG2 1 
ATOM   3039  C CD1 . ILE A 1 404 ? 37.536  -35.377 10.868  1.00 109.08 ? 400  ILE A CD1 1 
ATOM   3040  N N   . PHE A 1 405 ? 38.616  -30.683 7.789   1.00 103.80 ? 401  PHE A N   1 
ATOM   3041  C CA  . PHE A 1 405 ? 38.103  -29.636 6.913   1.00 101.21 ? 401  PHE A CA  1 
ATOM   3042  C C   . PHE A 1 405 ? 37.904  -30.157 5.486   1.00 100.19 ? 401  PHE A C   1 
ATOM   3043  O O   . PHE A 1 405 ? 38.454  -29.612 4.525   1.00 100.51 ? 401  PHE A O   1 
ATOM   3044  C CB  . PHE A 1 405 ? 39.022  -28.402 6.949   1.00 102.55 ? 401  PHE A CB  1 
ATOM   3045  C CG  . PHE A 1 405 ? 40.417  -28.684 7.471   1.00 106.71 ? 401  PHE A CG  1 
ATOM   3046  C CD1 . PHE A 1 405 ? 40.748  -28.400 8.796   1.00 108.70 ? 401  PHE A CD1 1 
ATOM   3047  C CD2 . PHE A 1 405 ? 41.400  -29.223 6.639   1.00 109.21 ? 401  PHE A CD2 1 
ATOM   3048  C CE1 . PHE A 1 405 ? 42.034  -28.654 9.286   1.00 112.64 ? 401  PHE A CE1 1 
ATOM   3049  C CE2 . PHE A 1 405 ? 42.689  -29.479 7.120   1.00 113.11 ? 401  PHE A CE2 1 
ATOM   3050  C CZ  . PHE A 1 405 ? 43.005  -29.193 8.445   1.00 114.83 ? 401  PHE A CZ  1 
ATOM   3051  N N   . GLY A 1 406 ? 37.108  -31.219 5.364   1.00 99.13  ? 402  GLY A N   1 
ATOM   3052  C CA  . GLY A 1 406 ? 36.831  -31.855 4.075   1.00 98.42  ? 402  GLY A CA  1 
ATOM   3053  C C   . GLY A 1 406 ? 35.551  -32.678 4.070   1.00 96.71  ? 402  GLY A C   1 
ATOM   3054  O O   . GLY A 1 406 ? 34.783  -32.630 5.033   1.00 95.50  ? 402  GLY A O   1 
ATOM   3055  N N   . PRO A 1 407 ? 35.315  -33.449 2.987   1.00 96.96  ? 403  PRO A N   1 
ATOM   3056  C CA  . PRO A 1 407 ? 34.078  -34.221 2.833   1.00 95.84  ? 403  PRO A CA  1 
ATOM   3057  C C   . PRO A 1 407 ? 34.066  -35.519 3.653   1.00 97.56  ? 403  PRO A C   1 
ATOM   3058  O O   . PRO A 1 407 ? 33.961  -36.615 3.093   1.00 99.33  ? 403  PRO A O   1 
ATOM   3059  C CB  . PRO A 1 407 ? 34.036  -34.513 1.330   1.00 96.47  ? 403  PRO A CB  1 
ATOM   3060  C CG  . PRO A 1 407 ? 35.461  -34.543 0.910   1.00 98.96  ? 403  PRO A CG  1 
ATOM   3061  C CD  . PRO A 1 407 ? 36.231  -33.644 1.845   1.00 98.88  ? 403  PRO A CD  1 
ATOM   3062  N N   . VAL A 1 408 ? 34.176  -35.378 4.973   1.00 97.24  ? 404  VAL A N   1 
ATOM   3063  C CA  . VAL A 1 408 ? 34.159  -36.510 5.899   1.00 98.85  ? 404  VAL A CA  1 
ATOM   3064  C C   . VAL A 1 408 ? 33.293  -36.164 7.111   1.00 97.02  ? 404  VAL A C   1 
ATOM   3065  O O   . VAL A 1 408 ? 33.541  -35.168 7.795   1.00 96.09  ? 404  VAL A O   1 
ATOM   3066  C CB  . VAL A 1 408 ? 35.589  -36.886 6.386   1.00 101.96 ? 404  VAL A CB  1 
ATOM   3067  C CG1 . VAL A 1 408 ? 35.549  -38.112 7.291   1.00 104.14 ? 404  VAL A CG1 1 
ATOM   3068  C CG2 . VAL A 1 408 ? 36.532  -37.127 5.210   1.00 103.93 ? 404  VAL A CG2 1 
ATOM   3069  N N   . GLN A 1 409 ? 32.277  -36.983 7.368   1.00 96.80  ? 405  GLN A N   1 
ATOM   3070  C CA  . GLN A 1 409 ? 31.440  -36.817 8.557   1.00 95.60  ? 405  GLN A CA  1 
ATOM   3071  C C   . GLN A 1 409 ? 31.569  -38.003 9.509   1.00 98.02  ? 405  GLN A C   1 
ATOM   3072  O O   . GLN A 1 409 ? 31.641  -39.157 9.074   1.00 100.10 ? 405  GLN A O   1 
ATOM   3073  C CB  . GLN A 1 409 ? 29.970  -36.584 8.186   1.00 93.31  ? 405  GLN A CB  1 
ATOM   3074  C CG  . GLN A 1 409 ? 29.303  -37.719 7.415   1.00 94.23  ? 405  GLN A CG  1 
ATOM   3075  C CD  . GLN A 1 409 ? 27.789  -37.617 7.415   1.00 92.58  ? 405  GLN A CD  1 
ATOM   3076  O OE1 . GLN A 1 409 ? 27.169  -37.462 6.366   1.00 91.60  ? 405  GLN A OE1 1 
ATOM   3077  N NE2 . GLN A 1 409 ? 27.187  -37.701 8.596   1.00 92.48  ? 405  GLN A NE2 1 
ATOM   3078  N N   . GLU A 1 410 ? 31.612  -37.707 10.806  1.00 98.03  ? 406  GLU A N   1 
ATOM   3079  C CA  . GLU A 1 410 ? 31.622  -38.743 11.834  1.00 100.19 ? 406  GLU A CA  1 
ATOM   3080  C C   . GLU A 1 410 ? 30.226  -38.924 12.409  1.00 98.94  ? 406  GLU A C   1 
ATOM   3081  O O   . GLU A 1 410 ? 29.473  -37.957 12.545  1.00 96.59  ? 406  GLU A O   1 
ATOM   3082  C CB  . GLU A 1 410 ? 32.596  -38.402 12.964  1.00 101.70 ? 406  GLU A CB  1 
ATOM   3083  C CG  . GLU A 1 410 ? 34.070  -38.487 12.596  1.00 104.01 ? 406  GLU A CG  1 
ATOM   3084  C CD  . GLU A 1 410 ? 34.738  -37.127 12.513  1.00 103.03 ? 406  GLU A CD  1 
ATOM   3085  O OE1 . GLU A 1 410 ? 34.333  -36.302 11.667  1.00 100.61 ? 406  GLU A OE1 1 
ATOM   3086  O OE2 . GLU A 1 410 ? 35.679  -36.887 13.298  1.00 104.91 ? 406  GLU A OE2 1 
ATOM   3087  N N   . ILE A 1 411 ? 29.883  -40.165 12.739  1.00 100.79 ? 407  ILE A N   1 
ATOM   3088  C CA  . ILE A 1 411 ? 28.614  -40.457 13.399  1.00 100.18 ? 407  ILE A CA  1 
ATOM   3089  C C   . ILE A 1 411 ? 28.878  -41.078 14.774  1.00 102.41 ? 407  ILE A C   1 
ATOM   3090  O O   . ILE A 1 411 ? 29.409  -42.188 14.878  1.00 105.22 ? 407  ILE A O   1 
ATOM   3091  C CB  . ILE A 1 411 ? 27.684  -41.330 12.514  1.00 100.49 ? 407  ILE A CB  1 
ATOM   3092  C CG1 . ILE A 1 411 ? 27.317  -40.572 11.231  1.00 98.10  ? 407  ILE A CG1 1 
ATOM   3093  C CG2 . ILE A 1 411 ? 26.420  -41.723 13.276  1.00 100.61 ? 407  ILE A CG2 1 
ATOM   3094  C CD1 . ILE A 1 411 ? 26.556  -41.386 10.200  1.00 98.86  ? 407  ILE A CD1 1 
ATOM   3095  N N   . LEU A 1 412 ? 28.512  -40.334 15.819  1.00 101.35 ? 408  LEU A N   1 
ATOM   3096  C CA  . LEU A 1 412 ? 28.785  -40.712 17.209  1.00 103.39 ? 408  LEU A CA  1 
ATOM   3097  C C   . LEU A 1 412 ? 27.516  -41.104 17.971  1.00 103.41 ? 408  LEU A C   1 
ATOM   3098  O O   . LEU A 1 412 ? 26.413  -40.663 17.639  1.00 101.37 ? 408  LEU A O   1 
ATOM   3099  C CB  . LEU A 1 412 ? 29.518  -39.582 17.949  1.00 103.06 ? 408  LEU A CB  1 
ATOM   3100  C CG  . LEU A 1 412 ? 30.927  -39.176 17.502  1.00 103.69 ? 408  LEU A CG  1 
ATOM   3101  C CD1 . LEU A 1 412 ? 30.886  -38.134 16.393  1.00 100.93 ? 408  LEU A CD1 1 
ATOM   3102  C CD2 . LEU A 1 412 ? 31.724  -38.649 18.682  1.00 105.34 ? 408  LEU A CD2 1 
ATOM   3103  N N   . ARG A 1 413 ? 27.693  -41.928 19.002  1.00 106.01 ? 409  ARG A N   1 
ATOM   3104  C CA  . ARG A 1 413 ? 26.590  -42.477 19.787  1.00 106.73 ? 409  ARG A CA  1 
ATOM   3105  C C   . ARG A 1 413 ? 26.456  -41.757 21.128  1.00 106.71 ? 409  ARG A C   1 
ATOM   3106  O O   . ARG A 1 413 ? 27.457  -41.511 21.802  1.00 108.10 ? 409  ARG A O   1 
ATOM   3107  C CB  . ARG A 1 413 ? 26.830  -43.975 20.011  1.00 110.17 ? 409  ARG A CB  1 
ATOM   3108  C CG  . ARG A 1 413 ? 25.825  -44.678 20.918  1.00 112.02 ? 409  ARG A CG  1 
ATOM   3109  C CD  . ARG A 1 413 ? 26.193  -46.142 21.136  1.00 116.38 ? 409  ARG A CD  1 
ATOM   3110  N NE  . ARG A 1 413 ? 26.115  -46.918 19.899  1.00 117.45 ? 409  ARG A NE  1 
ATOM   3111  C CZ  . ARG A 1 413 ? 26.176  -48.245 19.828  1.00 121.02 ? 409  ARG A CZ  1 
ATOM   3112  N NH1 . ARG A 1 413 ? 26.315  -48.975 20.928  1.00 124.10 ? 409  ARG A NH1 1 
ATOM   3113  N NH2 . ARG A 1 413 ? 26.094  -48.846 18.649  1.00 121.87 ? 409  ARG A NH2 1 
ATOM   3114  N N   . PHE A 1 414 ? 25.224  -41.422 21.511  1.00 105.45 ? 410  PHE A N   1 
ATOM   3115  C CA  . PHE A 1 414 ? 24.964  -40.881 22.848  1.00 106.00 ? 410  PHE A CA  1 
ATOM   3116  C C   . PHE A 1 414 ? 23.689  -41.428 23.486  1.00 106.84 ? 410  PHE A C   1 
ATOM   3117  O O   . PHE A 1 414 ? 22.682  -41.644 22.807  1.00 105.71 ? 410  PHE A O   1 
ATOM   3118  C CB  . PHE A 1 414 ? 24.979  -39.346 22.849  1.00 103.88 ? 410  PHE A CB  1 
ATOM   3119  C CG  . PHE A 1 414 ? 23.706  -38.711 22.357  1.00 101.41 ? 410  PHE A CG  1 
ATOM   3120  C CD1 . PHE A 1 414 ? 23.518  -38.451 21.004  1.00 98.97  ? 410  PHE A CD1 1 
ATOM   3121  C CD2 . PHE A 1 414 ? 22.707  -38.342 23.254  1.00 101.74 ? 410  PHE A CD2 1 
ATOM   3122  C CE1 . PHE A 1 414 ? 22.351  -37.846 20.549  1.00 97.08  ? 410  PHE A CE1 1 
ATOM   3123  C CE2 . PHE A 1 414 ? 21.534  -37.743 22.808  1.00 100.02 ? 410  PHE A CE2 1 
ATOM   3124  C CZ  . PHE A 1 414 ? 21.356  -37.495 21.451  1.00 97.71  ? 410  PHE A CZ  1 
ATOM   3125  N N   . LYS A 1 415 ? 23.754  -41.640 24.799  1.00 109.07 ? 411  LYS A N   1 
ATOM   3126  C CA  . LYS A 1 415 ? 22.676  -42.267 25.563  1.00 110.58 ? 411  LYS A CA  1 
ATOM   3127  C C   . LYS A 1 415 ? 21.725  -41.230 26.165  1.00 109.59 ? 411  LYS A C   1 
ATOM   3128  O O   . LYS A 1 415 ? 20.564  -41.139 25.760  1.00 108.44 ? 411  LYS A O   1 
ATOM   3129  C CB  . LYS A 1 415 ? 23.270  -43.179 26.652  1.00 114.06 ? 411  LYS A CB  1 
ATOM   3130  C CG  . LYS A 1 415 ? 22.269  -43.831 27.602  1.00 116.17 ? 411  LYS A CG  1 
ATOM   3131  C CD  . LYS A 1 415 ? 22.989  -44.460 28.793  1.00 119.58 ? 411  LYS A CD  1 
ATOM   3132  C CE  . LYS A 1 415 ? 22.021  -44.895 29.885  1.00 121.66 ? 411  LYS A CE  1 
ATOM   3133  N NZ  . LYS A 1 415 ? 21.241  -46.107 29.513  1.00 122.77 ? 411  LYS A NZ  1 
ATOM   3134  N N   . THR A 1 416 ? 22.228  -40.448 27.119  1.00 110.37 ? 412  THR A N   1 
ATOM   3135  C CA  . THR A 1 416 ? 21.404  -39.500 27.870  1.00 110.36 ? 412  THR A CA  1 
ATOM   3136  C C   . THR A 1 416 ? 21.542  -38.066 27.361  1.00 108.11 ? 412  THR A C   1 
ATOM   3137  O O   . THR A 1 416 ? 22.364  -37.778 26.486  1.00 106.58 ? 412  THR A O   1 
ATOM   3138  C CB  . THR A 1 416 ? 21.725  -39.537 29.385  1.00 113.41 ? 412  THR A CB  1 
ATOM   3139  O OG1 . THR A 1 416 ? 23.112  -39.243 29.593  1.00 114.27 ? 412  THR A OG1 1 
ATOM   3140  C CG2 . THR A 1 416 ? 21.403  -40.903 29.977  1.00 115.90 ? 412  THR A CG2 1 
ATOM   3141  N N   . MET A 1 417 ? 20.725  -37.177 27.922  1.00 108.25 ? 413  MET A N   1 
ATOM   3142  C CA  . MET A 1 417 ? 20.739  -35.759 27.579  1.00 106.71 ? 413  MET A CA  1 
ATOM   3143  C C   . MET A 1 417 ? 21.958  -35.060 28.179  1.00 107.84 ? 413  MET A C   1 
ATOM   3144  O O   . MET A 1 417 ? 22.592  -34.233 27.523  1.00 106.39 ? 413  MET A O   1 
ATOM   3145  C CB  . MET A 1 417 ? 19.456  -35.092 28.076  1.00 107.35 ? 413  MET A CB  1 
ATOM   3146  C CG  . MET A 1 417 ? 19.044  -33.848 27.301  1.00 105.67 ? 413  MET A CG  1 
ATOM   3147  S SD  . MET A 1 417 ? 17.716  -32.922 28.105  1.00 108.05 ? 413  MET A SD  1 
ATOM   3148  C CE  . MET A 1 417 ? 16.422  -34.157 28.245  1.00 108.74 ? 413  MET A CE  1 
ATOM   3149  N N   . ASP A 1 418 ? 22.279  -35.403 29.426  1.00 110.68 ? 414  ASP A N   1 
ATOM   3150  C CA  . ASP A 1 418 ? 23.431  -34.837 30.129  1.00 112.54 ? 414  ASP A CA  1 
ATOM   3151  C C   . ASP A 1 418 ? 24.763  -35.271 29.515  1.00 112.03 ? 414  ASP A C   1 
ATOM   3152  O O   . ASP A 1 418 ? 25.801  -34.663 29.779  1.00 113.22 ? 414  ASP A O   1 
ATOM   3153  C CB  . ASP A 1 418 ? 23.389  -35.210 31.616  1.00 116.17 ? 414  ASP A CB  1 
ATOM   3154  C CG  . ASP A 1 418 ? 22.314  -34.457 32.378  1.00 117.41 ? 414  ASP A CG  1 
ATOM   3155  O OD1 . ASP A 1 418 ? 22.458  -33.230 32.562  1.00 117.89 ? 414  ASP A OD1 1 
ATOM   3156  O OD2 . ASP A 1 418 ? 21.328  -35.095 32.806  1.00 118.35 ? 414  ASP A OD2 1 
ATOM   3157  N N   . GLU A 1 419 ? 24.719  -36.318 28.694  1.00 110.57 ? 415  GLU A N   1 
ATOM   3158  C CA  . GLU A 1 419 ? 25.908  -36.851 28.035  1.00 110.37 ? 415  GLU A CA  1 
ATOM   3159  C C   . GLU A 1 419 ? 26.407  -35.933 26.916  1.00 107.86 ? 415  GLU A C   1 
ATOM   3160  O O   . GLU A 1 419 ? 27.554  -35.483 26.948  1.00 108.78 ? 415  GLU A O   1 
ATOM   3161  C CB  . GLU A 1 419 ? 25.634  -38.257 27.496  1.00 110.17 ? 415  GLU A CB  1 
ATOM   3162  C CG  . GLU A 1 419 ? 26.877  -38.995 27.019  1.00 111.17 ? 415  GLU A CG  1 
ATOM   3163  C CD  . GLU A 1 419 ? 26.559  -40.331 26.374  1.00 111.28 ? 415  GLU A CD  1 
ATOM   3164  O OE1 . GLU A 1 419 ? 25.614  -41.009 26.829  1.00 112.05 ? 415  GLU A OE1 1 
ATOM   3165  O OE2 . GLU A 1 419 ? 27.262  -40.707 25.414  1.00 110.93 ? 415  GLU A OE2 1 
ATOM   3166  N N   . VAL A 1 420 ? 25.542  -35.661 25.940  1.00 104.95 ? 416  VAL A N   1 
ATOM   3167  C CA  . VAL A 1 420 ? 25.892  -34.815 24.794  1.00 102.50 ? 416  VAL A CA  1 
ATOM   3168  C C   . VAL A 1 420 ? 26.375  -33.428 25.185  1.00 103.05 ? 416  VAL A C   1 
ATOM   3169  O O   . VAL A 1 420 ? 27.374  -32.954 24.652  1.00 102.80 ? 416  VAL A O   1 
ATOM   3170  C CB  . VAL A 1 420 ? 24.734  -34.656 23.780  1.00 99.75  ? 416  VAL A CB  1 
ATOM   3171  C CG1 . VAL A 1 420 ? 24.956  -35.549 22.584  1.00 98.40  ? 416  VAL A CG1 1 
ATOM   3172  C CG2 . VAL A 1 420 ? 23.377  -34.906 24.432  1.00 100.22 ? 416  VAL A CG2 1 
ATOM   3173  N N   . ILE A 1 421 ? 25.668  -32.789 26.114  1.00 104.19 ? 417  ILE A N   1 
ATOM   3174  C CA  . ILE A 1 421 ? 25.988  -31.422 26.533  1.00 105.26 ? 417  ILE A CA  1 
ATOM   3175  C C   . ILE A 1 421 ? 27.425  -31.309 27.060  1.00 107.77 ? 417  ILE A C   1 
ATOM   3176  O O   . ILE A 1 421 ? 28.131  -30.360 26.728  1.00 107.84 ? 417  ILE A O   1 
ATOM   3177  C CB  . ILE A 1 421 ? 24.965  -30.871 27.565  1.00 106.81 ? 417  ILE A CB  1 
ATOM   3178  C CG1 . ILE A 1 421 ? 23.535  -31.018 27.033  1.00 104.78 ? 417  ILE A CG1 1 
ATOM   3179  C CG2 . ILE A 1 421 ? 25.256  -29.403 27.886  1.00 108.13 ? 417  ILE A CG2 1 
ATOM   3180  C CD1 . ILE A 1 421 ? 22.450  -30.874 28.088  1.00 106.82 ? 417  ILE A CD1 1 
ATOM   3181  N N   . GLU A 1 422 ? 27.851  -32.286 27.860  1.00 110.07 ? 418  GLU A N   1 
ATOM   3182  C CA  . GLU A 1 422 ? 29.230  -32.337 28.354  1.00 112.90 ? 418  GLU A CA  1 
ATOM   3183  C C   . GLU A 1 422 ? 30.228  -32.727 27.268  1.00 111.70 ? 418  GLU A C   1 
ATOM   3184  O O   . GLU A 1 422 ? 31.357  -32.233 27.248  1.00 113.23 ? 418  GLU A O   1 
ATOM   3185  C CB  . GLU A 1 422 ? 29.350  -33.289 29.548  1.00 116.03 ? 418  GLU A CB  1 
ATOM   3186  C CG  . GLU A 1 422 ? 29.361  -32.594 30.907  1.00 119.88 ? 418  GLU A CG  1 
ATOM   3187  C CD  . GLU A 1 422 ? 28.132  -31.728 31.149  1.00 119.82 ? 418  GLU A CD  1 
ATOM   3188  O OE1 . GLU A 1 422 ? 26.999  -32.257 31.091  1.00 118.69 ? 418  GLU A OE1 1 
ATOM   3189  O OE2 . GLU A 1 422 ? 28.303  -30.516 31.405  1.00 121.22 ? 418  GLU A OE2 1 
ATOM   3190  N N   . ARG A 1 423 ? 29.807  -33.610 26.367  1.00 109.35 ? 419  ARG A N   1 
ATOM   3191  C CA  . ARG A 1 423 ? 30.677  -34.080 25.296  1.00 108.51 ? 419  ARG A CA  1 
ATOM   3192  C C   . ARG A 1 423 ? 30.823  -33.060 24.167  1.00 106.14 ? 419  ARG A C   1 
ATOM   3193  O O   . ARG A 1 423 ? 31.896  -32.937 23.573  1.00 106.52 ? 419  ARG A O   1 
ATOM   3194  C CB  . ARG A 1 423 ? 30.199  -35.429 24.758  1.00 107.53 ? 419  ARG A CB  1 
ATOM   3195  C CG  . ARG A 1 423 ? 30.346  -36.573 25.757  1.00 110.34 ? 419  ARG A CG  1 
ATOM   3196  C CD  . ARG A 1 423 ? 30.543  -37.907 25.058  1.00 110.35 ? 419  ARG A CD  1 
ATOM   3197  N NE  . ARG A 1 423 ? 29.442  -38.224 24.153  1.00 107.43 ? 419  ARG A NE  1 
ATOM   3198  C CZ  . ARG A 1 423 ? 29.527  -39.063 23.125  1.00 106.67 ? 419  ARG A CZ  1 
ATOM   3199  N NH1 . ARG A 1 423 ? 30.669  -39.681 22.850  1.00 108.51 ? 419  ARG A NH1 1 
ATOM   3200  N NH2 . ARG A 1 423 ? 28.465  -39.280 22.365  1.00 104.42 ? 419  ARG A NH2 1 
ATOM   3201  N N   . ALA A 1 424 ? 29.749  -32.331 23.879  1.00 104.01 ? 420  ALA A N   1 
ATOM   3202  C CA  . ALA A 1 424 ? 29.773  -31.288 22.856  1.00 102.01 ? 420  ALA A CA  1 
ATOM   3203  C C   . ALA A 1 424 ? 30.453  -30.010 23.354  1.00 103.88 ? 420  ALA A C   1 
ATOM   3204  O O   . ALA A 1 424 ? 31.164  -29.346 22.595  1.00 103.40 ? 420  ALA A O   1 
ATOM   3205  C CB  . ALA A 1 424 ? 28.366  -30.991 22.359  1.00 99.41  ? 420  ALA A CB  1 
ATOM   3206  N N   . ASN A 1 425 ? 30.231  -29.672 24.625  1.00 106.36 ? 421  ASN A N   1 
ATOM   3207  C CA  . ASN A 1 425 ? 30.844  -28.492 25.244  1.00 108.95 ? 421  ASN A CA  1 
ATOM   3208  C C   . ASN A 1 425 ? 32.363  -28.564 25.325  1.00 111.49 ? 421  ASN A C   1 
ATOM   3209  O O   . ASN A 1 425 ? 33.040  -27.538 25.223  1.00 112.76 ? 421  ASN A O   1 
ATOM   3210  C CB  . ASN A 1 425 ? 30.281  -28.250 26.648  1.00 111.46 ? 421  ASN A CB  1 
ATOM   3211  C CG  . ASN A 1 425 ? 29.077  -27.327 26.651  1.00 110.39 ? 421  ASN A CG  1 
ATOM   3212  O OD1 . ASN A 1 425 ? 28.685  -26.783 25.618  1.00 107.73 ? 421  ASN A OD1 1 
ATOM   3213  N ND2 . ASN A 1 425 ? 28.486  -27.140 27.825  1.00 112.69 ? 421  ASN A ND2 1 
ATOM   3214  N N   . ASN A 1 426 ? 32.882  -29.777 25.513  1.00 112.65 ? 422  ASN A N   1 
ATOM   3215  C CA  . ASN A 1 426 ? 34.316  -30.018 25.682  1.00 115.68 ? 422  ASN A CA  1 
ATOM   3216  C C   . ASN A 1 426 ? 35.141  -29.575 24.465  1.00 114.75 ? 422  ASN A C   1 
ATOM   3217  O O   . ASN A 1 426 ? 35.570  -30.394 23.646  1.00 113.86 ? 422  ASN A O   1 
ATOM   3218  C CB  . ASN A 1 426 ? 34.564  -31.496 26.019  1.00 116.87 ? 422  ASN A CB  1 
ATOM   3219  C CG  . ASN A 1 426 ? 35.913  -31.736 26.677  1.00 120.95 ? 422  ASN A CG  1 
ATOM   3220  O OD1 . ASN A 1 426 ? 36.583  -30.804 27.121  1.00 123.36 ? 422  ASN A OD1 1 
ATOM   3221  N ND2 . ASN A 1 426 ? 36.313  -33.000 26.751  1.00 122.11 ? 422  ASN A ND2 1 
ATOM   3222  N N   . SER A 1 427 ? 35.344  -28.263 24.364  1.00 115.32 ? 423  SER A N   1 
ATOM   3223  C CA  . SER A 1 427 ? 36.064  -27.642 23.257  1.00 114.67 ? 423  SER A CA  1 
ATOM   3224  C C   . SER A 1 427 ? 36.685  -26.330 23.710  1.00 117.61 ? 423  SER A C   1 
ATOM   3225  O O   . SER A 1 427 ? 36.191  -25.689 24.639  1.00 119.14 ? 423  SER A O   1 
ATOM   3226  C CB  . SER A 1 427 ? 35.121  -27.382 22.084  1.00 110.47 ? 423  SER A CB  1 
ATOM   3227  O OG  . SER A 1 427 ? 35.761  -26.623 21.072  1.00 109.92 ? 423  SER A OG  1 
ATOM   3228  N N   . ASP A 1 428 ? 37.763  -25.931 23.041  1.00 118.83 ? 424  ASP A N   1 
ATOM   3229  C CA  . ASP A 1 428 ? 38.489  -24.717 23.399  1.00 122.24 ? 424  ASP A CA  1 
ATOM   3230  C C   . ASP A 1 428 ? 38.260  -23.596 22.388  1.00 120.38 ? 424  ASP A C   1 
ATOM   3231  O O   . ASP A 1 428 ? 38.715  -23.684 21.250  1.00 118.85 ? 424  ASP A O   1 
ATOM   3232  C CB  . ASP A 1 428 ? 39.990  -25.006 23.526  1.00 125.94 ? 424  ASP A CB  1 
ATOM   3233  C CG  . ASP A 1 428 ? 40.298  -26.119 24.519  1.00 128.46 ? 424  ASP A CG  1 
ATOM   3234  O OD1 . ASP A 1 428 ? 39.406  -26.502 25.306  1.00 127.94 ? 424  ASP A OD1 1 
ATOM   3235  O OD2 . ASP A 1 428 ? 41.446  -26.611 24.511  1.00 131.25 ? 424  ASP A OD2 1 
ATOM   3236  N N   . PHE A 1 429 ? 37.549  -22.556 22.823  1.00 120.95 ? 425  PHE A N   1 
ATOM   3237  C CA  . PHE A 1 429 ? 37.317  -21.325 22.043  1.00 120.09 ? 425  PHE A CA  1 
ATOM   3238  C C   . PHE A 1 429 ? 36.882  -21.496 20.583  1.00 115.71 ? 425  PHE A C   1 
ATOM   3239  O O   . PHE A 1 429 ? 37.714  -21.642 19.686  1.00 115.42 ? 425  PHE A O   1 
ATOM   3240  C CB  . PHE A 1 429 ? 38.525  -20.381 22.132  1.00 124.08 ? 425  PHE A CB  1 
ATOM   3241  C CG  . PHE A 1 429 ? 38.318  -19.226 23.067  1.00 127.76 ? 425  PHE A CG  1 
ATOM   3242  C CD1 . PHE A 1 429 ? 38.702  -19.313 24.402  1.00 132.21 ? 425  PHE A CD1 1 
ATOM   3243  C CD2 . PHE A 1 429 ? 37.728  -18.049 22.613  1.00 127.34 ? 425  PHE A CD2 1 
ATOM   3244  C CE1 . PHE A 1 429 ? 38.507  -18.240 25.275  1.00 135.94 ? 425  PHE A CE1 1 
ATOM   3245  C CE2 . PHE A 1 429 ? 37.527  -16.971 23.475  1.00 131.20 ? 425  PHE A CE2 1 
ATOM   3246  C CZ  . PHE A 1 429 ? 37.918  -17.067 24.810  1.00 135.49 ? 425  PHE A CZ  1 
ATOM   3247  N N   . GLY A 1 430 ? 35.573  -21.449 20.357  1.00 112.70 ? 426  GLY A N   1 
ATOM   3248  C CA  . GLY A 1 430 ? 35.016  -21.557 19.013  1.00 108.67 ? 426  GLY A CA  1 
ATOM   3249  C C   . GLY A 1 430 ? 34.097  -22.752 18.882  1.00 105.65 ? 426  GLY A C   1 
ATOM   3250  O O   . GLY A 1 430 ? 34.556  -23.896 18.848  1.00 105.53 ? 426  GLY A O   1 
ATOM   3251  N N   . LEU A 1 431 ? 32.796  -22.479 18.811  1.00 103.55 ? 427  LEU A N   1 
ATOM   3252  C CA  . LEU A 1 431 ? 31.787  -23.529 18.711  1.00 100.90 ? 427  LEU A CA  1 
ATOM   3253  C C   . LEU A 1 431 ? 30.528  -23.050 17.987  1.00 98.19  ? 427  LEU A C   1 
ATOM   3254  O O   . LEU A 1 431 ? 30.142  -21.882 18.091  1.00 98.91  ? 427  LEU A O   1 
ATOM   3255  C CB  . LEU A 1 431 ? 31.427  -24.057 20.106  1.00 102.74 ? 427  LEU A CB  1 
ATOM   3256  C CG  . LEU A 1 431 ? 30.984  -25.519 20.231  1.00 101.52 ? 427  LEU A CG  1 
ATOM   3257  C CD1 . LEU A 1 431 ? 32.169  -26.453 20.085  1.00 102.57 ? 427  LEU A CD1 1 
ATOM   3258  C CD2 . LEU A 1 431 ? 30.291  -25.768 21.561  1.00 103.15 ? 427  LEU A CD2 1 
ATOM   3259  N N   . VAL A 1 432 ? 29.909  -23.966 17.244  1.00 95.31  ? 428  VAL A N   1 
ATOM   3260  C CA  . VAL A 1 432 ? 28.627  -23.734 16.578  1.00 92.82  ? 428  VAL A CA  1 
ATOM   3261  C C   . VAL A 1 432 ? 27.763  -24.987 16.751  1.00 91.44  ? 428  VAL A C   1 
ATOM   3262  O O   . VAL A 1 432 ? 28.114  -26.060 16.264  1.00 90.60  ? 428  VAL A O   1 
ATOM   3263  C CB  . VAL A 1 432 ? 28.801  -23.415 15.064  1.00 90.88  ? 428  VAL A CB  1 
ATOM   3264  C CG1 . VAL A 1 432 ? 27.448  -23.232 14.389  1.00 88.88  ? 428  VAL A CG1 1 
ATOM   3265  C CG2 . VAL A 1 432 ? 29.663  -22.175 14.854  1.00 92.31  ? 428  VAL A CG2 1 
ATOM   3266  N N   . ALA A 1 433 ? 26.638  -24.853 17.444  1.00 91.46  ? 429  ALA A N   1 
ATOM   3267  C CA  . ALA A 1 433 ? 25.784  -26.003 17.745  1.00 90.57  ? 429  ALA A CA  1 
ATOM   3268  C C   . ALA A 1 433 ? 24.612  -26.160 16.771  1.00 88.27  ? 429  ALA A C   1 
ATOM   3269  O O   . ALA A 1 433 ? 24.183  -25.192 16.140  1.00 87.64  ? 429  ALA A O   1 
ATOM   3270  C CB  . ALA A 1 433 ? 25.281  -25.920 19.173  1.00 92.67  ? 429  ALA A CB  1 
ATOM   3271  N N   . ALA A 1 434 ? 24.107  -27.389 16.657  1.00 87.30  ? 430  ALA A N   1 
ATOM   3272  C CA  . ALA A 1 434 ? 22.942  -27.695 15.823  1.00 85.50  ? 430  ALA A CA  1 
ATOM   3273  C C   . ALA A 1 434 ? 22.110  -28.830 16.422  1.00 85.87  ? 430  ALA A C   1 
ATOM   3274  O O   . ALA A 1 434 ? 22.564  -29.974 16.487  1.00 86.13  ? 430  ALA A O   1 
ATOM   3275  C CB  . ALA A 1 434 ? 23.374  -28.035 14.404  1.00 83.90  ? 430  ALA A CB  1 
ATOM   3276  N N   . VAL A 1 435 ? 20.891  -28.505 16.850  1.00 86.08  ? 431  VAL A N   1 
ATOM   3277  C CA  . VAL A 1 435 ? 20.006  -29.470 17.512  1.00 86.70  ? 431  VAL A CA  1 
ATOM   3278  C C   . VAL A 1 435 ? 18.825  -29.860 16.624  1.00 85.67  ? 431  VAL A C   1 
ATOM   3279  O O   . VAL A 1 435 ? 18.260  -29.017 15.924  1.00 84.94  ? 431  VAL A O   1 
ATOM   3280  C CB  . VAL A 1 435 ? 19.443  -28.927 18.852  1.00 88.61  ? 431  VAL A CB  1 
ATOM   3281  C CG1 . VAL A 1 435 ? 19.235  -30.065 19.837  1.00 89.93  ? 431  VAL A CG1 1 
ATOM   3282  C CG2 . VAL A 1 435 ? 20.366  -27.877 19.453  1.00 89.68  ? 431  VAL A CG2 1 
ATOM   3283  N N   . PHE A 1 436 ? 18.456  -31.139 16.663  1.00 85.85  ? 432  PHE A N   1 
ATOM   3284  C CA  . PHE A 1 436 ? 17.286  -31.640 15.942  1.00 85.45  ? 432  PHE A CA  1 
ATOM   3285  C C   . PHE A 1 436 ? 16.340  -32.378 16.887  1.00 87.18  ? 432  PHE A C   1 
ATOM   3286  O O   . PHE A 1 436 ? 16.605  -33.514 17.290  1.00 88.05  ? 432  PHE A O   1 
ATOM   3287  C CB  . PHE A 1 436 ? 17.710  -32.529 14.769  1.00 84.48  ? 432  PHE A CB  1 
ATOM   3288  C CG  . PHE A 1 436 ? 18.292  -31.767 13.614  1.00 82.58  ? 432  PHE A CG  1 
ATOM   3289  C CD1 . PHE A 1 436 ? 19.649  -31.465 13.575  1.00 81.96  ? 432  PHE A CD1 1 
ATOM   3290  C CD2 . PHE A 1 436 ? 17.480  -31.341 12.568  1.00 81.67  ? 432  PHE A CD2 1 
ATOM   3291  C CE1 . PHE A 1 436 ? 20.191  -30.751 12.507  1.00 80.70  ? 432  PHE A CE1 1 
ATOM   3292  C CE2 . PHE A 1 436 ? 18.012  -30.628 11.495  1.00 80.27  ? 432  PHE A CE2 1 
ATOM   3293  C CZ  . PHE A 1 436 ? 19.370  -30.333 11.464  1.00 79.72  ? 432  PHE A CZ  1 
ATOM   3294  N N   . THR A 1 437 ? 15.245  -31.710 17.246  1.00 87.95  ? 433  THR A N   1 
ATOM   3295  C CA  . THR A 1 437 ? 14.291  -32.213 18.237  1.00 89.92  ? 433  THR A CA  1 
ATOM   3296  C C   . THR A 1 437 ? 12.907  -31.621 17.985  1.00 90.66  ? 433  THR A C   1 
ATOM   3297  O O   . THR A 1 437 ? 12.780  -30.562 17.367  1.00 89.83  ? 433  THR A O   1 
ATOM   3298  C CB  . THR A 1 437 ? 14.722  -31.839 19.683  1.00 91.29  ? 433  THR A CB  1 
ATOM   3299  O OG1 . THR A 1 437 ? 16.149  -31.863 19.793  1.00 90.78  ? 433  THR A OG1 1 
ATOM   3300  C CG2 . THR A 1 437 ? 14.139  -32.806 20.700  1.00 93.29  ? 433  THR A CG2 1 
ATOM   3301  N N   . ASN A 1 438 ? 11.875  -32.315 18.460  1.00 92.48  ? 434  ASN A N   1 
ATOM   3302  C CA  . ASN A 1 438 ? 10.516  -31.782 18.480  1.00 93.99  ? 434  ASN A CA  1 
ATOM   3303  C C   . ASN A 1 438 ? 9.979   -31.665 19.907  1.00 96.49  ? 434  ASN A C   1 
ATOM   3304  O O   . ASN A 1 438 ? 8.776   -31.507 20.123  1.00 98.42  ? 434  ASN A O   1 
ATOM   3305  C CB  . ASN A 1 438 ? 9.586   -32.627 17.605  1.00 94.50  ? 434  ASN A CB  1 
ATOM   3306  C CG  . ASN A 1 438 ? 9.839   -32.427 16.122  1.00 92.68  ? 434  ASN A CG  1 
ATOM   3307  O OD1 . ASN A 1 438 ? 10.396  -31.410 15.701  1.00 91.17  ? 434  ASN A OD1 1 
ATOM   3308  N ND2 . ASN A 1 438 ? 9.425   -33.399 15.318  1.00 93.14  ? 434  ASN A ND2 1 
ATOM   3309  N N   . ASP A 1 439 ? 10.894  -31.746 20.871  1.00 96.74  ? 435  ASP A N   1 
ATOM   3310  C CA  . ASP A 1 439 ? 10.587  -31.555 22.285  1.00 99.21  ? 435  ASP A CA  1 
ATOM   3311  C C   . ASP A 1 439 ? 11.081  -30.175 22.718  1.00 99.34  ? 435  ASP A C   1 
ATOM   3312  O O   . ASP A 1 439 ? 12.267  -29.866 22.586  1.00 97.90  ? 435  ASP A O   1 
ATOM   3313  C CB  . ASP A 1 439 ? 11.243  -32.661 23.123  1.00 99.96  ? 435  ASP A CB  1 
ATOM   3314  C CG  . ASP A 1 439 ? 10.854  -32.604 24.594  1.00 103.06 ? 435  ASP A CG  1 
ATOM   3315  O OD1 . ASP A 1 439 ? 11.211  -31.624 25.284  1.00 104.12 ? 435  ASP A OD1 1 
ATOM   3316  O OD2 . ASP A 1 439 ? 10.207  -33.561 25.069  1.00 105.11 ? 435  ASP A OD2 1 
ATOM   3317  N N   . ILE A 1 440 ? 10.166  -29.355 23.231  1.00 101.46 ? 436  ILE A N   1 
ATOM   3318  C CA  . ILE A 1 440 ? 10.482  -27.986 23.653  1.00 102.34 ? 436  ILE A CA  1 
ATOM   3319  C C   . ILE A 1 440 ? 11.521  -27.971 24.773  1.00 103.16 ? 436  ILE A C   1 
ATOM   3320  O O   . ILE A 1 440 ? 12.570  -27.335 24.646  1.00 102.20 ? 436  ILE A O   1 
ATOM   3321  C CB  . ILE A 1 440 ? 9.213   -27.203 24.093  1.00 105.30 ? 436  ILE A CB  1 
ATOM   3322  C CG1 . ILE A 1 440 ? 8.209   -27.114 22.941  1.00 104.86 ? 436  ILE A CG1 1 
ATOM   3323  C CG2 . ILE A 1 440 ? 9.575   -25.801 24.581  1.00 106.78 ? 436  ILE A CG2 1 
ATOM   3324  C CD1 . ILE A 1 440 ? 6.834   -26.620 23.351  1.00 108.64 ? 436  ILE A CD1 1 
ATOM   3325  N N   . ASN A 1 441 ? 11.227  -28.687 25.856  1.00 84.87  ? 437  ASN A N   1 
ATOM   3326  C CA  . ASN A 1 441 ? 12.108  -28.742 27.019  1.00 83.51  ? 437  ASN A CA  1 
ATOM   3327  C C   . ASN A 1 441 ? 13.489  -29.316 26.714  1.00 81.03  ? 437  ASN A C   1 
ATOM   3328  O O   . ASN A 1 441 ? 14.465  -28.955 27.368  1.00 79.70  ? 437  ASN A O   1 
ATOM   3329  C CB  . ASN A 1 441 ? 11.441  -29.508 28.166  1.00 85.23  ? 437  ASN A CB  1 
ATOM   3330  C CG  . ASN A 1 441 ? 10.294  -28.733 28.801  1.00 87.63  ? 437  ASN A CG  1 
ATOM   3331  O OD1 . ASN A 1 441 ? 10.299  -27.502 28.841  1.00 87.49  ? 437  ASN A OD1 1 
ATOM   3332  N ND2 . ASN A 1 441 ? 9.307   -29.458 29.310  1.00 89.84  ? 437  ASN A ND2 1 
ATOM   3333  N N   . LYS A 1 442 ? 13.565  -30.197 25.717  1.00 80.75  ? 438  LYS A N   1 
ATOM   3334  C CA  . LYS A 1 442 ? 14.838  -30.769 25.282  1.00 78.79  ? 438  LYS A CA  1 
ATOM   3335  C C   . LYS A 1 442 ? 15.667  -29.764 24.488  1.00 77.40  ? 438  LYS A C   1 
ATOM   3336  O O   . LYS A 1 442 ? 16.859  -29.612 24.737  1.00 75.92  ? 438  LYS A O   1 
ATOM   3337  C CB  . LYS A 1 442 ? 14.625  -32.048 24.468  1.00 79.26  ? 438  LYS A CB  1 
ATOM   3338  C CG  . LYS A 1 442 ? 14.322  -33.283 25.308  1.00 80.12  ? 438  LYS A CG  1 
ATOM   3339  C CD  . LYS A 1 442 ? 14.467  -34.565 24.494  1.00 80.29  ? 438  LYS A CD  1 
ATOM   3340  C CE  . LYS A 1 442 ? 14.457  -35.799 25.387  1.00 80.53  ? 438  LYS A CE  1 
ATOM   3341  N NZ  . LYS A 1 442 ? 14.743  -37.046 24.624  1.00 80.32  ? 438  LYS A NZ  1 
ATOM   3342  N N   . ALA A 1 443 ? 15.031  -29.076 23.544  1.00 78.19  ? 439  ALA A N   1 
ATOM   3343  C CA  . ALA A 1 443 ? 15.717  -28.092 22.708  1.00 77.17  ? 439  ALA A CA  1 
ATOM   3344  C C   . ALA A 1 443 ? 16.196  -26.887 23.512  1.00 76.23  ? 439  ALA A C   1 
ATOM   3345  O O   . ALA A 1 443 ? 17.337  -26.444 23.357  1.00 74.64  ? 439  ALA A O   1 
ATOM   3346  C CB  . ALA A 1 443 ? 14.821  -27.645 21.565  1.00 78.68  ? 439  ALA A CB  1 
ATOM   3347  N N   . LEU A 1 444 ? 15.320  -26.373 24.375  1.00 77.48  ? 440  LEU A N   1 
ATOM   3348  C CA  . LEU A 1 444 ? 15.603  -25.174 25.167  1.00 77.12  ? 440  LEU A CA  1 
ATOM   3349  C C   . LEU A 1 444 ? 16.685  -25.381 26.220  1.00 75.95  ? 440  LEU A C   1 
ATOM   3350  O O   . LEU A 1 444 ? 17.413  -24.444 26.557  1.00 75.02  ? 440  LEU A O   1 
ATOM   3351  C CB  . LEU A 1 444 ? 14.329  -24.641 25.832  1.00 79.22  ? 440  LEU A CB  1 
ATOM   3352  C CG  . LEU A 1 444 ? 13.470  -23.644 25.049  1.00 80.41  ? 440  LEU A CG  1 
ATOM   3353  C CD1 . LEU A 1 444 ? 12.126  -23.486 25.725  1.00 83.13  ? 440  LEU A CD1 1 
ATOM   3354  C CD2 . LEU A 1 444 ? 14.158  -22.289 24.917  1.00 79.32  ? 440  LEU A CD2 1 
ATOM   3355  N N   . THR A 1 445 ? 16.782  -26.603 26.738  1.00 76.13  ? 441  THR A N   1 
ATOM   3356  C CA  . THR A 1 445 ? 17.789  -26.921 27.744  1.00 75.39  ? 441  THR A CA  1 
ATOM   3357  C C   . THR A 1 445 ? 19.140  -27.264 27.111  1.00 73.66  ? 441  THR A C   1 
ATOM   3358  O O   . THR A 1 445 ? 20.179  -27.132 27.759  1.00 73.00  ? 441  THR A O   1 
ATOM   3359  C CB  . THR A 1 445 ? 17.321  -28.041 28.711  1.00 76.58  ? 441  THR A CB  1 
ATOM   3360  O OG1 . THR A 1 445 ? 18.076  -27.970 29.925  1.00 76.70  ? 441  THR A OG1 1 
ATOM   3361  C CG2 . THR A 1 445 ? 17.489  -29.421 28.097  1.00 76.18  ? 441  THR A CG2 1 
ATOM   3362  N N   . VAL A 1 446 ? 19.116  -27.695 25.850  1.00 73.32  ? 442  VAL A N   1 
ATOM   3363  C CA  . VAL A 1 446 ? 20.338  -28.026 25.116  1.00 72.08  ? 442  VAL A CA  1 
ATOM   3364  C C   . VAL A 1 446 ? 20.975  -26.763 24.538  1.00 71.25  ? 442  VAL A C   1 
ATOM   3365  O O   . VAL A 1 446 ? 22.181  -26.558 24.675  1.00 70.29  ? 442  VAL A O   1 
ATOM   3366  C CB  . VAL A 1 446 ? 20.086  -29.099 24.017  1.00 72.48  ? 442  VAL A CB  1 
ATOM   3367  C CG1 . VAL A 1 446 ? 21.188  -29.100 22.972  1.00 71.66  ? 442  VAL A CG1 1 
ATOM   3368  C CG2 . VAL A 1 446 ? 19.967  -30.481 24.642  1.00 72.98  ? 442  VAL A CG2 1 
ATOM   3369  N N   . SER A 1 447 ? 20.155  -25.915 23.919  1.00 71.83  ? 443  SER A N   1 
ATOM   3370  C CA  . SER A 1 447 ? 20.635  -24.685 23.282  1.00 71.29  ? 443  SER A CA  1 
ATOM   3371  C C   . SER A 1 447 ? 21.166  -23.655 24.279  1.00 70.78  ? 443  SER A C   1 
ATOM   3372  O O   . SER A 1 447 ? 22.072  -22.889 23.957  1.00 69.93  ? 443  SER A O   1 
ATOM   3373  C CB  . SER A 1 447 ? 19.538  -24.058 22.418  1.00 72.28  ? 443  SER A CB  1 
ATOM   3374  O OG  . SER A 1 447 ? 18.459  -23.607 23.213  1.00 73.31  ? 443  SER A OG  1 
ATOM   3375  N N   . SER A 1 448 ? 20.595  -23.638 25.480  1.00 71.62  ? 444  SER A N   1 
ATOM   3376  C CA  . SER A 1 448 ? 21.004  -22.699 26.525  1.00 71.57  ? 444  SER A CA  1 
ATOM   3377  C C   . SER A 1 448 ? 22.305  -23.121 27.216  1.00 70.91  ? 444  SER A C   1 
ATOM   3378  O O   . SER A 1 448 ? 23.169  -22.281 27.492  1.00 70.38  ? 444  SER A O   1 
ATOM   3379  C CB  . SER A 1 448 ? 19.887  -22.533 27.555  1.00 73.07  ? 444  SER A CB  1 
ATOM   3380  O OG  . SER A 1 448 ? 19.472  -23.789 28.059  1.00 74.09  ? 444  SER A OG  1 
ATOM   3381  N N   . ALA A 1 449 ? 22.437  -24.421 27.482  1.00 71.12  ? 445  ALA A N   1 
ATOM   3382  C CA  . ALA A 1 449 ? 23.601  -24.976 28.182  1.00 70.89  ? 445  ALA A CA  1 
ATOM   3383  C C   . ALA A 1 449 ? 24.833  -25.146 27.285  1.00 69.88  ? 445  ALA A C   1 
ATOM   3384  O O   . ALA A 1 449 ? 25.943  -25.378 27.775  1.00 69.83  ? 445  ALA A O   1 
ATOM   3385  C CB  . ALA A 1 449 ? 23.236  -26.303 28.841  1.00 71.77  ? 445  ALA A CB  1 
ATOM   3386  N N   . MET A 1 450 ? 24.625  -25.029 25.976  1.00 69.40  ? 446  MET A N   1 
ATOM   3387  C CA  . MET A 1 450 ? 25.694  -25.174 24.996  1.00 68.83  ? 446  MET A CA  1 
ATOM   3388  C C   . MET A 1 450 ? 26.584  -23.932 24.962  1.00 68.26  ? 446  MET A C   1 
ATOM   3389  O O   . MET A 1 450 ? 26.125  -22.839 24.621  1.00 68.07  ? 446  MET A O   1 
ATOM   3390  C CB  . MET A 1 450 ? 25.095  -25.444 23.613  1.00 68.97  ? 446  MET A CB  1 
ATOM   3391  C CG  . MET A 1 450 ? 25.876  -26.433 22.771  1.00 69.19  ? 446  MET A CG  1 
ATOM   3392  S SD  . MET A 1 450 ? 26.279  -27.963 23.635  1.00 69.92  ? 446  MET A SD  1 
ATOM   3393  C CE  . MET A 1 450 ? 24.666  -28.673 23.936  1.00 70.36  ? 446  MET A CE  1 
ATOM   3394  N N   . GLN A 1 451 ? 27.854  -24.108 25.325  1.00 68.18  ? 447  GLN A N   1 
ATOM   3395  C CA  . GLN A 1 451 ? 28.835  -23.020 25.310  1.00 67.75  ? 447  GLN A CA  1 
ATOM   3396  C C   . GLN A 1 451 ? 29.231  -22.681 23.874  1.00 67.41  ? 447  GLN A C   1 
ATOM   3397  O O   . GLN A 1 451 ? 30.295  -23.088 23.398  1.00 67.74  ? 447  GLN A O   1 
ATOM   3398  C CB  . GLN A 1 451 ? 30.082  -23.407 26.106  1.00 68.27  ? 447  GLN A CB  1 
ATOM   3399  C CG  . GLN A 1 451 ? 29.825  -23.907 27.509  1.00 69.08  ? 447  GLN A CG  1 
ATOM   3400  C CD  . GLN A 1 451 ? 31.102  -24.364 28.181  1.00 70.42  ? 447  GLN A CD  1 
ATOM   3401  O OE1 . GLN A 1 451 ? 31.387  -25.560 28.251  1.00 71.23  ? 447  GLN A OE1 1 
ATOM   3402  N NE2 . GLN A 1 451 ? 31.893  -23.409 28.661  1.00 70.75  ? 447  GLN A NE2 1 
ATOM   3403  N N   . ALA A 1 452 ? 28.372  -21.933 23.190  1.00 66.99  ? 448  ALA A N   1 
ATOM   3404  C CA  . ALA A 1 452 ? 28.557  -21.655 21.771  1.00 66.97  ? 448  ALA A CA  1 
ATOM   3405  C C   . ALA A 1 452 ? 28.241  -20.207 21.415  1.00 66.57  ? 448  ALA A C   1 
ATOM   3406  O O   . ALA A 1 452 ? 27.519  -19.520 22.140  1.00 66.31  ? 448  ALA A O   1 
ATOM   3407  C CB  . ALA A 1 452 ? 27.708  -22.605 20.940  1.00 67.56  ? 448  ALA A CB  1 
ATOM   3408  N N   . GLY A 1 453 ? 28.796  -19.755 20.293  1.00 66.72  ? 449  GLY A N   1 
ATOM   3409  C CA  . GLY A 1 453 ? 28.549  -18.410 19.778  1.00 66.46  ? 449  GLY A CA  1 
ATOM   3410  C C   . GLY A 1 453 ? 27.284  -18.325 18.945  1.00 66.92  ? 449  GLY A C   1 
ATOM   3411  O O   . GLY A 1 453 ? 26.696  -17.248 18.811  1.00 66.93  ? 449  GLY A O   1 
ATOM   3412  N N   . THR A 1 454 ? 26.877  -19.464 18.382  1.00 67.54  ? 450  THR A N   1 
ATOM   3413  C CA  . THR A 1 454 ? 25.648  -19.572 17.587  1.00 68.38  ? 450  THR A CA  1 
ATOM   3414  C C   . THR A 1 454 ? 25.076  -21.000 17.609  1.00 68.92  ? 450  THR A C   1 
ATOM   3415  O O   . THR A 1 454 ? 25.814  -21.970 17.429  1.00 69.09  ? 450  THR A O   1 
ATOM   3416  C CB  . THR A 1 454 ? 25.839  -19.042 16.129  1.00 69.36  ? 450  THR A CB  1 
ATOM   3417  O OG1 . THR A 1 454 ? 24.776  -19.512 15.292  1.00 70.86  ? 450  THR A OG1 1 
ATOM   3418  C CG2 . THR A 1 454 ? 27.175  -19.485 15.543  1.00 69.84  ? 450  THR A CG2 1 
ATOM   3419  N N   . VAL A 1 455 ? 23.765  -21.109 17.846  1.00 69.38  ? 451  VAL A N   1 
ATOM   3420  C CA  . VAL A 1 455 ? 23.057  -22.402 17.937  1.00 69.96  ? 451  VAL A CA  1 
ATOM   3421  C C   . VAL A 1 455 ? 21.876  -22.475 16.958  1.00 71.60  ? 451  VAL A C   1 
ATOM   3422  O O   . VAL A 1 455 ? 20.993  -21.613 16.976  1.00 72.05  ? 451  VAL A O   1 
ATOM   3423  C CB  . VAL A 1 455 ? 22.522  -22.678 19.377  1.00 69.39  ? 451  VAL A CB  1 
ATOM   3424  C CG1 . VAL A 1 455 ? 21.932  -24.081 19.478  1.00 69.92  ? 451  VAL A CG1 1 
ATOM   3425  C CG2 . VAL A 1 455 ? 23.615  -22.489 20.422  1.00 68.13  ? 451  VAL A CG2 1 
ATOM   3426  N N   . TRP A 1 456 ? 21.865  -23.513 16.119  1.00 72.70  ? 452  TRP A N   1 
ATOM   3427  C CA  . TRP A 1 456 ? 20.783  -23.736 15.153  1.00 74.64  ? 452  TRP A CA  1 
ATOM   3428  C C   . TRP A 1 456 ? 19.805  -24.794 15.668  1.00 75.16  ? 452  TRP A C   1 
ATOM   3429  O O   . TRP A 1 456 ? 20.218  -25.873 16.089  1.00 74.58  ? 452  TRP A O   1 
ATOM   3430  C CB  . TRP A 1 456 ? 21.337  -24.182 13.793  1.00 76.01  ? 452  TRP A CB  1 
ATOM   3431  C CG  . TRP A 1 456 ? 22.421  -23.314 13.214  1.00 76.04  ? 452  TRP A CG  1 
ATOM   3432  C CD1 . TRP A 1 456 ? 23.746  -23.340 13.536  1.00 75.11  ? 452  TRP A CD1 1 
ATOM   3433  C CD2 . TRP A 1 456 ? 22.278  -22.319 12.189  1.00 77.92  ? 452  TRP A CD2 1 
ATOM   3434  N NE1 . TRP A 1 456 ? 24.436  -22.416 12.790  1.00 75.85  ? 452  TRP A NE1 1 
ATOM   3435  C CE2 . TRP A 1 456 ? 23.561  -21.775 11.954  1.00 77.53  ? 452  TRP A CE2 1 
ATOM   3436  C CE3 . TRP A 1 456 ? 21.191  -21.833 11.448  1.00 80.20  ? 452  TRP A CE3 1 
ATOM   3437  C CZ2 . TRP A 1 456 ? 23.789  -20.763 11.010  1.00 78.88  ? 452  TRP A CZ2 1 
ATOM   3438  C CZ3 . TRP A 1 456 ? 21.417  -20.824 10.506  1.00 81.46  ? 452  TRP A CZ3 1 
ATOM   3439  C CH2 . TRP A 1 456 ? 22.708  -20.303 10.298  1.00 80.77  ? 452  TRP A CH2 1 
ATOM   3440  N N   . ILE A 1 457 ? 18.512  -24.477 15.632  1.00 76.47  ? 453  ILE A N   1 
ATOM   3441  C CA  . ILE A 1 457 ? 17.464  -25.428 16.009  1.00 77.60  ? 453  ILE A CA  1 
ATOM   3442  C C   . ILE A 1 457 ? 16.720  -25.903 14.758  1.00 80.31  ? 453  ILE A C   1 
ATOM   3443  O O   . ILE A 1 457 ? 16.056  -25.109 14.083  1.00 81.91  ? 453  ILE A O   1 
ATOM   3444  C CB  . ILE A 1 457 ? 16.446  -24.816 17.016  1.00 77.72  ? 453  ILE A CB  1 
ATOM   3445  C CG1 . ILE A 1 457 ? 17.152  -24.198 18.234  1.00 75.49  ? 453  ILE A CG1 1 
ATOM   3446  C CG2 . ILE A 1 457 ? 15.395  -25.851 17.431  1.00 78.88  ? 453  ILE A CG2 1 
ATOM   3447  C CD1 . ILE A 1 457 ? 17.591  -25.183 19.302  1.00 74.26  ? 453  ILE A CD1 1 
ATOM   3448  N N   . ASN A 1 458 ? 16.845  -27.197 14.461  1.00 81.09  ? 454  ASN A N   1 
ATOM   3449  C CA  . ASN A 1 458 ? 16.186  -27.840 13.313  1.00 83.91  ? 454  ASN A CA  1 
ATOM   3450  C C   . ASN A 1 458 ? 16.537  -27.250 11.942  1.00 85.64  ? 454  ASN A C   1 
ATOM   3451  O O   . ASN A 1 458 ? 15.691  -27.201 11.045  1.00 88.22  ? 454  ASN A O   1 
ATOM   3452  C CB  . ASN A 1 458 ? 14.663  -27.894 13.512  1.00 85.70  ? 454  ASN A CB  1 
ATOM   3453  C CG  . ASN A 1 458 ? 14.250  -28.865 14.601  1.00 84.97  ? 454  ASN A CG  1 
ATOM   3454  O OD1 . ASN A 1 458 ? 13.949  -28.463 15.723  1.00 83.67  ? 454  ASN A OD1 1 
ATOM   3455  N ND2 . ASN A 1 458 ? 14.239  -30.153 14.277  1.00 85.66  ? 454  ASN A ND2 1 
ATOM   3456  N N   . CYS A 1 459 ? 17.788  -26.813 11.788  1.00 84.65  ? 455  CYS A N   1 
ATOM   3457  C CA  . CYS A 1 459 ? 18.268  -26.211 10.538  1.00 86.49  ? 455  CYS A CA  1 
ATOM   3458  C C   . CYS A 1 459 ? 19.793  -26.069 10.498  1.00 85.30  ? 455  CYS A C   1 
ATOM   3459  O O   . CYS A 1 459 ? 20.492  -26.535 11.402  1.00 83.34  ? 455  CYS A O   1 
ATOM   3460  C CB  . CYS A 1 459 ? 17.618  -24.841 10.327  1.00 87.16  ? 455  CYS A CB  1 
ATOM   3461  S SG  . CYS A 1 459 ? 17.943  -23.659 11.652  1.00 84.02  ? 455  CYS A SG  1 
ATOM   3462  N N   . TYR A 1 460 ? 20.295  -25.434 9.435   1.00 87.00  ? 456  TYR A N   1 
ATOM   3463  C CA  . TYR A 1 460 ? 21.712  -25.078 9.315   1.00 86.35  ? 456  TYR A CA  1 
ATOM   3464  C C   . TYR A 1 460 ? 21.914  -23.900 8.360   1.00 87.66  ? 456  TYR A C   1 
ATOM   3465  O O   . TYR A 1 460 ? 22.871  -23.131 8.488   1.00 86.46  ? 456  TYR A O   1 
ATOM   3466  C CB  . TYR A 1 460 ? 22.547  -26.273 8.851   1.00 87.35  ? 456  TYR A CB  1 
ATOM   3467  C CG  . TYR A 1 460 ? 23.839  -26.424 9.617   1.00 85.86  ? 456  TYR A CG  1 
ATOM   3468  C CD1 . TYR A 1 460 ? 24.890  -25.523 9.440   1.00 85.89  ? 456  TYR A CD1 1 
ATOM   3469  C CD2 . TYR A 1 460 ? 24.009  -27.463 10.529  1.00 85.22  ? 456  TYR A CD2 1 
ATOM   3470  C CE1 . TYR A 1 460 ? 26.080  -25.658 10.153  1.00 84.76  ? 456  TYR A CE1 1 
ATOM   3471  C CE2 . TYR A 1 460 ? 25.196  -27.609 11.245  1.00 83.94  ? 456  TYR A CE2 1 
ATOM   3472  C CZ  . TYR A 1 460 ? 26.225  -26.705 11.053  1.00 83.72  ? 456  TYR A CZ  1 
ATOM   3473  O OH  . TYR A 1 460 ? 27.397  -26.848 11.761  1.00 82.66  ? 456  TYR A OH  1 
ATOM   3474  N N   . GLY A 1 482 ? 24.852  -9.223  11.901  1.00 78.34  ? 478  GLY A N   1 
ATOM   3475  C CA  . GLY A 1 482 ? 23.691  -8.291  12.003  1.00 79.01  ? 478  GLY A CA  1 
ATOM   3476  C C   . GLY A 1 482 ? 24.041  -6.993  12.706  1.00 77.71  ? 478  GLY A C   1 
ATOM   3477  O O   . GLY A 1 482 ? 25.091  -6.402  12.443  1.00 77.10  ? 478  GLY A O   1 
ATOM   3478  N N   . GLU A 1 483 ? 23.152  -6.556  13.598  1.00 77.55  ? 479  GLU A N   1 
ATOM   3479  C CA  . GLU A 1 483 ? 23.336  -5.336  14.396  1.00 76.58  ? 479  GLU A CA  1 
ATOM   3480  C C   . GLU A 1 483 ? 24.622  -5.365  15.234  1.00 74.62  ? 479  GLU A C   1 
ATOM   3481  O O   . GLU A 1 483 ? 25.337  -4.360  15.321  1.00 74.03  ? 479  GLU A O   1 
ATOM   3482  C CB  . GLU A 1 483 ? 22.093  -5.090  15.274  1.00 77.16  ? 479  GLU A CB  1 
ATOM   3483  C CG  . GLU A 1 483 ? 22.334  -4.418  16.637  1.00 76.23  ? 479  GLU A CG  1 
ATOM   3484  C CD  . GLU A 1 483 ? 22.330  -2.899  16.583  1.00 76.59  ? 479  GLU A CD  1 
ATOM   3485  O OE1 . GLU A 1 483 ? 23.297  -2.316  16.047  1.00 76.16  ? 479  GLU A OE1 1 
ATOM   3486  O OE2 . GLU A 1 483 ? 21.369  -2.287  17.101  1.00 77.41  ? 479  GLU A OE2 1 
ATOM   3487  N N   . PHE A 1 484 ? 24.916  -6.521  15.828  1.00 73.81  ? 480  PHE A N   1 
ATOM   3488  C CA  . PHE A 1 484 ? 26.102  -6.687  16.670  1.00 72.29  ? 480  PHE A CA  1 
ATOM   3489  C C   . PHE A 1 484 ? 27.411  -6.697  15.875  1.00 71.93  ? 480  PHE A C   1 
ATOM   3490  O O   . PHE A 1 484 ? 28.486  -6.459  16.435  1.00 71.05  ? 480  PHE A O   1 
ATOM   3491  C CB  . PHE A 1 484 ? 25.991  -7.963  17.514  1.00 72.04  ? 480  PHE A CB  1 
ATOM   3492  C CG  . PHE A 1 484 ? 24.847  -7.949  18.494  1.00 72.73  ? 480  PHE A CG  1 
ATOM   3493  C CD1 . PHE A 1 484 ? 24.828  -7.048  19.556  1.00 72.65  ? 480  PHE A CD1 1 
ATOM   3494  C CD2 . PHE A 1 484 ? 23.796  -8.849  18.366  1.00 73.94  ? 480  PHE A CD2 1 
ATOM   3495  C CE1 . PHE A 1 484 ? 23.770  -7.036  20.466  1.00 73.51  ? 480  PHE A CE1 1 
ATOM   3496  C CE2 . PHE A 1 484 ? 22.737  -8.846  19.275  1.00 74.55  ? 480  PHE A CE2 1 
ATOM   3497  C CZ  . PHE A 1 484 ? 22.725  -7.939  20.324  1.00 74.33  ? 480  PHE A CZ  1 
ATOM   3498  N N   . GLY A 1 485 ? 27.309  -6.968  14.574  1.00 72.82  ? 481  GLY A N   1 
ATOM   3499  C CA  . GLY A 1 485 ? 28.469  -7.056  13.691  1.00 72.81  ? 481  GLY A CA  1 
ATOM   3500  C C   . GLY A 1 485 ? 29.165  -5.735  13.416  1.00 72.40  ? 481  GLY A C   1 
ATOM   3501  O O   . GLY A 1 485 ? 30.393  -5.687  13.324  1.00 72.21  ? 481  GLY A O   1 
ATOM   3502  N N   . LEU A 1 486 ? 28.386  -4.663  13.288  1.00 72.33  ? 482  LEU A N   1 
ATOM   3503  C CA  . LEU A 1 486 ? 28.936  -3.352  12.922  1.00 72.00  ? 482  LEU A CA  1 
ATOM   3504  C C   . LEU A 1 486 ? 29.504  -2.570  14.110  1.00 70.25  ? 482  LEU A C   1 
ATOM   3505  O O   . LEU A 1 486 ? 30.111  -1.511  13.925  1.00 70.11  ? 482  LEU A O   1 
ATOM   3506  C CB  . LEU A 1 486 ? 27.907  -2.516  12.140  1.00 73.23  ? 482  LEU A CB  1 
ATOM   3507  C CG  . LEU A 1 486 ? 26.586  -2.092  12.786  1.00 72.99  ? 482  LEU A CG  1 
ATOM   3508  C CD1 . LEU A 1 486 ? 26.719  -0.757  13.503  1.00 72.14  ? 482  LEU A CD1 1 
ATOM   3509  C CD2 . LEU A 1 486 ? 25.525  -1.996  11.720  1.00 74.96  ? 482  LEU A CD2 1 
ATOM   3510  N N   . ARG A 1 487 ? 29.303  -3.094  15.318  1.00 68.93  ? 483  ARG A N   1 
ATOM   3511  C CA  . ARG A 1 487 ? 29.844  -2.478  16.530  1.00 67.57  ? 483  ARG A CA  1 
ATOM   3512  C C   . ARG A 1 487 ? 31.372  -2.545  16.580  1.00 66.86  ? 483  ARG A C   1 
ATOM   3513  O O   . ARG A 1 487 ? 32.019  -1.625  17.079  1.00 66.43  ? 483  ARG A O   1 
ATOM   3514  C CB  . ARG A 1 487 ? 29.235  -3.110  17.784  1.00 67.22  ? 483  ARG A CB  1 
ATOM   3515  C CG  . ARG A 1 487 ? 27.759  -2.802  17.972  1.00 68.42  ? 483  ARG A CG  1 
ATOM   3516  C CD  . ARG A 1 487 ? 27.236  -3.349  19.287  1.00 69.36  ? 483  ARG A CD  1 
ATOM   3517  N NE  . ARG A 1 487 ? 25.776  -3.273  19.361  1.00 71.21  ? 483  ARG A NE  1 
ATOM   3518  C CZ  . ARG A 1 487 ? 25.047  -3.656  20.408  1.00 71.98  ? 483  ARG A CZ  1 
ATOM   3519  N NH1 . ARG A 1 487 ? 25.632  -4.147  21.496  1.00 71.53  ? 483  ARG A NH1 1 
ATOM   3520  N NH2 . ARG A 1 487 ? 23.725  -3.547  20.367  1.00 73.33  ? 483  ARG A NH2 1 
ATOM   3521  N N   . GLU A 1 488 ? 31.941  -3.625  16.049  1.00 66.84  ? 484  GLU A N   1 
ATOM   3522  C CA  . GLU A 1 488 ? 33.397  -3.790  16.007  1.00 66.56  ? 484  GLU A CA  1 
ATOM   3523  C C   . GLU A 1 488 ? 34.075  -2.922  14.937  1.00 67.00  ? 484  GLU A C   1 
ATOM   3524  O O   . GLU A 1 488 ? 35.305  -2.847  14.881  1.00 67.35  ? 484  GLU A O   1 
ATOM   3525  C CB  . GLU A 1 488 ? 33.783  -5.266  15.833  1.00 67.15  ? 484  GLU A CB  1 
ATOM   3526  C CG  . GLU A 1 488 ? 33.430  -5.869  14.480  1.00 68.61  ? 484  GLU A CG  1 
ATOM   3527  C CD  . GLU A 1 488 ? 34.385  -6.975  14.070  1.00 70.20  ? 484  GLU A CD  1 
ATOM   3528  O OE1 . GLU A 1 488 ? 35.560  -6.671  13.778  1.00 71.21  ? 484  GLU A OE1 1 
ATOM   3529  O OE2 . GLU A 1 488 ? 33.962  -8.150  14.026  1.00 70.57  ? 484  GLU A OE2 1 
ATOM   3530  N N   . TYR A 1 489 ? 33.272  -2.275  14.093  1.00 67.00  ? 485  TYR A N   1 
ATOM   3531  C CA  . TYR A 1 489 ? 33.791  -1.381  13.055  1.00 67.42  ? 485  TYR A CA  1 
ATOM   3532  C C   . TYR A 1 489 ? 33.559  0.109   13.328  1.00 66.57  ? 485  TYR A C   1 
ATOM   3533  O O   . TYR A 1 489 ? 33.846  0.953   12.477  1.00 67.42  ? 485  TYR A O   1 
ATOM   3534  C CB  . TYR A 1 489 ? 33.260  -1.778  11.673  1.00 68.98  ? 485  TYR A CB  1 
ATOM   3535  C CG  . TYR A 1 489 ? 34.052  -2.891  11.029  1.00 69.83  ? 485  TYR A CG  1 
ATOM   3536  C CD1 . TYR A 1 489 ? 35.381  -2.694  10.648  1.00 70.52  ? 485  TYR A CD1 1 
ATOM   3537  C CD2 . TYR A 1 489 ? 33.480  -4.139  10.805  1.00 69.88  ? 485  TYR A CD2 1 
ATOM   3538  C CE1 . TYR A 1 489 ? 36.118  -3.712  10.063  1.00 71.91  ? 485  TYR A CE1 1 
ATOM   3539  C CE2 . TYR A 1 489 ? 34.207  -5.164  10.216  1.00 71.25  ? 485  TYR A CE2 1 
ATOM   3540  C CZ  . TYR A 1 489 ? 35.526  -4.944  9.848   1.00 72.38  ? 485  TYR A CZ  1 
ATOM   3541  O OH  . TYR A 1 489 ? 36.254  -5.953  9.261   1.00 74.27  ? 485  TYR A OH  1 
ATOM   3542  N N   . SER A 1 490 ? 33.049  0.426   14.514  1.00 64.94  ? 486  SER A N   1 
ATOM   3543  C CA  . SER A 1 490 ? 32.925  1.814   14.949  1.00 64.10  ? 486  SER A CA  1 
ATOM   3544  C C   . SER A 1 490 ? 33.437  1.980   16.378  1.00 62.80  ? 486  SER A C   1 
ATOM   3545  O O   . SER A 1 490 ? 33.505  1.008   17.128  1.00 62.40  ? 486  SER A O   1 
ATOM   3546  C CB  . SER A 1 490 ? 31.480  2.305   14.816  1.00 64.31  ? 486  SER A CB  1 
ATOM   3547  O OG  . SER A 1 490 ? 30.597  1.529   15.604  1.00 64.05  ? 486  SER A OG  1 
ATOM   3548  N N   . GLU A 1 491 ? 33.819  3.202   16.740  1.00 62.26  ? 487  GLU A N   1 
ATOM   3549  C CA  . GLU A 1 491 ? 34.253  3.493   18.106  1.00 61.43  ? 487  GLU A CA  1 
ATOM   3550  C C   . GLU A 1 491 ? 33.435  4.596   18.768  1.00 60.86  ? 487  GLU A C   1 
ATOM   3551  O O   . GLU A 1 491 ? 33.140  5.621   18.152  1.00 61.06  ? 487  GLU A O   1 
ATOM   3552  C CB  . GLU A 1 491 ? 35.762  3.778   18.182  1.00 61.86  ? 487  GLU A CB  1 
ATOM   3553  C CG  . GLU A 1 491 ? 36.287  4.959   17.355  1.00 62.69  ? 487  GLU A CG  1 
ATOM   3554  C CD  . GLU A 1 491 ? 37.761  5.268   17.640  1.00 63.72  ? 487  GLU A CD  1 
ATOM   3555  O OE1 . GLU A 1 491 ? 38.248  4.912   18.737  1.00 63.82  ? 487  GLU A OE1 1 
ATOM   3556  O OE2 . GLU A 1 491 ? 38.433  5.870   16.771  1.00 64.21  ? 487  GLU A OE2 1 
ATOM   3557  N N   . VAL A 1 492 ? 33.069  4.364   20.026  1.00 60.24  ? 488  VAL A N   1 
ATOM   3558  C CA  . VAL A 1 492 ? 32.254  5.298   20.803  1.00 60.03  ? 488  VAL A CA  1 
ATOM   3559  C C   . VAL A 1 492 ? 33.061  6.541   21.166  1.00 59.84  ? 488  VAL A C   1 
ATOM   3560  O O   . VAL A 1 492 ? 34.267  6.462   21.396  1.00 59.81  ? 488  VAL A O   1 
ATOM   3561  C CB  . VAL A 1 492 ? 31.697  4.635   22.100  1.00 60.16  ? 488  VAL A CB  1 
ATOM   3562  C CG1 . VAL A 1 492 ? 30.699  5.547   22.802  1.00 60.69  ? 488  VAL A CG1 1 
ATOM   3563  C CG2 . VAL A 1 492 ? 31.042  3.295   21.791  1.00 60.10  ? 488  VAL A CG2 1 
ATOM   3564  N N   . LYS A 1 493 ? 32.385  7.685   21.196  1.00 59.84  ? 489  LYS A N   1 
ATOM   3565  C CA  . LYS A 1 493 ? 32.982  8.944   21.621  1.00 59.73  ? 489  LYS A CA  1 
ATOM   3566  C C   . LYS A 1 493 ? 31.972  9.714   22.466  1.00 60.16  ? 489  LYS A C   1 
ATOM   3567  O O   . LYS A 1 493 ? 30.996  10.253  21.940  1.00 60.50  ? 489  LYS A O   1 
ATOM   3568  C CB  . LYS A 1 493 ? 33.398  9.769   20.404  1.00 59.69  ? 489  LYS A CB  1 
ATOM   3569  C CG  . LYS A 1 493 ? 34.114  11.068  20.725  1.00 59.78  ? 489  LYS A CG  1 
ATOM   3570  C CD  . LYS A 1 493 ? 34.058  11.984  19.524  1.00 60.18  ? 489  LYS A CD  1 
ATOM   3571  C CE  . LYS A 1 493 ? 35.115  13.066  19.567  1.00 60.38  ? 489  LYS A CE  1 
ATOM   3572  N NZ  . LYS A 1 493 ? 35.237  13.729  18.233  1.00 60.45  ? 489  LYS A NZ  1 
ATOM   3573  N N   . THR A 1 494 ? 32.205  9.755   23.775  1.00 60.35  ? 490  THR A N   1 
ATOM   3574  C CA  . THR A 1 494 ? 31.297  10.448  24.690  1.00 61.07  ? 490  THR A CA  1 
ATOM   3575  C C   . THR A 1 494 ? 31.673  11.929  24.805  1.00 61.22  ? 490  THR A C   1 
ATOM   3576  O O   . THR A 1 494 ? 32.815  12.261  25.117  1.00 61.18  ? 490  THR A O   1 
ATOM   3577  C CB  . THR A 1 494 ? 31.250  9.782   26.099  1.00 61.83  ? 490  THR A CB  1 
ATOM   3578  O OG1 . THR A 1 494 ? 32.370  10.206  26.882  1.00 62.42  ? 490  THR A OG1 1 
ATOM   3579  C CG2 . THR A 1 494 ? 31.258  8.257   25.997  1.00 61.25  ? 490  THR A CG2 1 
ATOM   3580  N N   . VAL A 1 495 ? 30.714  12.809  24.528  1.00 61.49  ? 491  VAL A N   1 
ATOM   3581  C CA  . VAL A 1 495 ? 30.912  14.252  24.674  1.00 61.76  ? 491  VAL A CA  1 
ATOM   3582  C C   . VAL A 1 495 ? 29.970  14.793  25.745  1.00 63.22  ? 491  VAL A C   1 
ATOM   3583  O O   . VAL A 1 495 ? 28.757  14.608  25.662  1.00 63.92  ? 491  VAL A O   1 
ATOM   3584  C CB  . VAL A 1 495 ? 30.680  15.010  23.346  1.00 61.34  ? 491  VAL A CB  1 
ATOM   3585  C CG1 . VAL A 1 495 ? 30.884  16.508  23.536  1.00 61.78  ? 491  VAL A CG1 1 
ATOM   3586  C CG2 . VAL A 1 495 ? 31.597  14.484  22.253  1.00 60.31  ? 491  VAL A CG2 1 
ATOM   3587  N N   . THR A 1 496 ? 30.538  15.459  26.746  1.00 63.85  ? 492  THR A N   1 
ATOM   3588  C CA  . THR A 1 496 ? 29.763  15.997  27.861  1.00 65.57  ? 492  THR A CA  1 
ATOM   3589  C C   . THR A 1 496 ? 29.905  17.513  27.991  1.00 66.29  ? 492  THR A C   1 
ATOM   3590  O O   . THR A 1 496 ? 31.014  18.043  28.048  1.00 65.82  ? 492  THR A O   1 
ATOM   3591  C CB  . THR A 1 496 ? 30.096  15.277  29.194  1.00 66.59  ? 492  THR A CB  1 
ATOM   3592  O OG1 . THR A 1 496 ? 29.983  16.192  30.289  1.00 68.65  ? 492  THR A OG1 1 
ATOM   3593  C CG2 . THR A 1 496 ? 31.491  14.681  29.171  1.00 65.55  ? 492  THR A CG2 1 
ATOM   3594  N N   . VAL A 1 497 ? 28.763  18.195  28.033  1.00 67.60  ? 493  VAL A N   1 
ATOM   3595  C CA  . VAL A 1 497 ? 28.710  19.656  28.047  1.00 68.50  ? 493  VAL A CA  1 
ATOM   3596  C C   . VAL A 1 497 ? 28.154  20.182  29.372  1.00 71.21  ? 493  VAL A C   1 
ATOM   3597  O O   . VAL A 1 497 ? 27.143  19.685  29.871  1.00 72.72  ? 493  VAL A O   1 
ATOM   3598  C CB  . VAL A 1 497 ? 27.835  20.195  26.886  1.00 68.29  ? 493  VAL A CB  1 
ATOM   3599  C CG1 . VAL A 1 497 ? 27.983  21.703  26.743  1.00 68.79  ? 493  VAL A CG1 1 
ATOM   3600  C CG2 . VAL A 1 497 ? 28.192  19.508  25.581  1.00 66.29  ? 493  VAL A CG2 1 
ATOM   3601  N N   . LYS A 1 498 ? 28.821  21.191  29.930  1.00 72.09  ? 494  LYS A N   1 
ATOM   3602  C CA  . LYS A 1 498 ? 28.356  21.878  31.132  1.00 75.01  ? 494  LYS A CA  1 
ATOM   3603  C C   . LYS A 1 498 ? 27.177  22.787  30.794  1.00 76.46  ? 494  LYS A C   1 
ATOM   3604  O O   . LYS A 1 498 ? 27.237  23.562  29.839  1.00 75.45  ? 494  LYS A O   1 
ATOM   3605  C CB  . LYS A 1 498 ? 29.505  22.688  31.744  1.00 75.54  ? 494  LYS A CB  1 
ATOM   3606  C CG  . LYS A 1 498 ? 29.142  23.564  32.945  1.00 78.82  ? 494  LYS A CG  1 
ATOM   3607  C CD  . LYS A 1 498 ? 29.037  22.771  34.241  1.00 80.73  ? 494  LYS A CD  1 
ATOM   3608  C CE  . LYS A 1 498 ? 29.049  23.696  35.448  1.00 83.95  ? 494  LYS A CE  1 
ATOM   3609  N NZ  . LYS A 1 498 ? 27.909  24.653  35.440  1.00 85.87  ? 494  LYS A NZ  1 
ATOM   3610  N N   . ILE A 1 499 ? 26.110  22.684  31.581  1.00 79.19  ? 495  ILE A N   1 
ATOM   3611  C CA  . ILE A 1 499 ? 24.893  23.473  31.356  1.00 81.34  ? 495  ILE A CA  1 
ATOM   3612  C C   . ILE A 1 499 ? 24.565  24.403  32.543  1.00 84.89  ? 495  ILE A C   1 
ATOM   3613  O O   . ILE A 1 499 ? 24.914  24.092  33.684  1.00 86.31  ? 495  ILE A O   1 
ATOM   3614  C CB  . ILE A 1 499 ? 23.672  22.571  30.995  1.00 81.88  ? 495  ILE A CB  1 
ATOM   3615  C CG1 . ILE A 1 499 ? 23.520  21.421  31.999  1.00 83.04  ? 495  ILE A CG1 1 
ATOM   3616  C CG2 . ILE A 1 499 ? 23.799  22.047  29.566  1.00 78.89  ? 495  ILE A CG2 1 
ATOM   3617  C CD1 . ILE A 1 499 ? 22.250  20.604  31.844  1.00 84.43  ? 495  ILE A CD1 1 
ATOM   3618  N N   . PRO A 1 500 ? 23.913  25.555  32.269  1.00 86.58  ? 496  PRO A N   1 
ATOM   3619  C CA  . PRO A 1 500 ? 23.538  26.540  33.295  1.00 90.22  ? 496  PRO A CA  1 
ATOM   3620  C C   . PRO A 1 500 ? 22.652  26.013  34.422  1.00 93.81  ? 496  PRO A C   1 
ATOM   3621  O O   . PRO A 1 500 ? 22.824  26.427  35.568  1.00 96.57  ? 496  PRO A O   1 
ATOM   3622  C CB  . PRO A 1 500 ? 22.783  27.599  32.493  1.00 90.94  ? 496  PRO A CB  1 
ATOM   3623  C CG  . PRO A 1 500 ? 23.409  27.538  31.154  1.00 87.28  ? 496  PRO A CG  1 
ATOM   3624  C CD  . PRO A 1 500 ? 23.665  26.082  30.913  1.00 85.03  ? 496  PRO A CD  1 
ATOM   3625  N N   . GLN A 1 501 ? 21.712  25.125  34.093  1.00 94.18  ? 497  GLN A N   1 
ATOM   3626  C CA  . GLN A 1 501 ? 20.826  24.493  35.081  1.00 97.55  ? 497  GLN A CA  1 
ATOM   3627  C C   . GLN A 1 501 ? 20.140  23.268  34.471  1.00 96.52  ? 497  GLN A C   1 
ATOM   3628  O O   . GLN A 1 501 ? 19.528  23.362  33.404  1.00 95.76  ? 497  GLN A O   1 
ATOM   3629  C CB  . GLN A 1 501 ? 19.777  25.487  35.596  1.00 101.84 ? 497  GLN A CB  1 
ATOM   3630  C CG  . GLN A 1 501 ? 18.974  24.994  36.797  1.00 106.17 ? 497  GLN A CG  1 
ATOM   3631  C CD  . GLN A 1 501 ? 17.948  26.007  37.287  1.00 111.03 ? 497  GLN A CD  1 
ATOM   3632  O OE1 . GLN A 1 501 ? 18.155  27.218  37.201  1.00 111.73 ? 497  GLN A OE1 1 
ATOM   3633  N NE2 . GLN A 1 501 ? 16.836  25.509  37.815  1.00 114.54 ? 497  GLN A NE2 1 
ATOM   3634  N N   . LYS A 1 502 ? 20.241  22.126  35.149  1.00 96.74  ? 498  LYS A N   1 
ATOM   3635  C CA  . LYS A 1 502 ? 19.660  20.885  34.641  1.00 95.69  ? 498  LYS A CA  1 
ATOM   3636  C C   . LYS A 1 502 ? 18.223  20.690  35.106  1.00 99.61  ? 498  LYS A C   1 
ATOM   3637  O O   . LYS A 1 502 ? 17.903  20.871  36.283  1.00 103.17 ? 498  LYS A O   1 
ATOM   3638  C CB  . LYS A 1 502 ? 20.507  19.667  35.033  1.00 93.78  ? 498  LYS A CB  1 
ATOM   3639  C CG  . LYS A 1 502 ? 20.206  18.416  34.200  1.00 91.50  ? 498  LYS A CG  1 
ATOM   3640  C CD  . LYS A 1 502 ? 20.927  17.173  34.706  1.00 89.94  ? 498  LYS A CD  1 
ATOM   3641  C CE  . LYS A 1 502 ? 20.147  16.476  35.812  1.00 93.36  ? 498  LYS A CE  1 
ATOM   3642  N NZ  . LYS A 1 502 ? 20.744  15.159  36.177  1.00 91.94  ? 498  LYS A NZ  1 
ATOM   3643  N N   . ASN A 1 503 ? 17.367  20.324  34.158  1.00 99.24  ? 499  ASN A N   1 
ATOM   3644  C CA  . ASN A 1 503 ? 16.003  19.907  34.443  1.00 102.67 ? 499  ASN A CA  1 
ATOM   3645  C C   . ASN A 1 503 ? 15.688  18.627  33.686  1.00 100.71 ? 499  ASN A C   1 
ATOM   3646  O O   . ASN A 1 503 ? 16.132  18.452  32.551  1.00 97.35  ? 499  ASN A O   1 
ATOM   3647  C CB  . ASN A 1 503 ? 15.011  21.009  34.071  1.00 105.50 ? 499  ASN A CB  1 
ATOM   3648  C CG  . ASN A 1 503 ? 15.062  22.185  35.025  1.00 108.59 ? 499  ASN A CG  1 
ATOM   3649  O OD1 . ASN A 1 503 ? 14.878  22.029  36.233  1.00 111.51 ? 499  ASN A OD1 1 
ATOM   3650  N ND2 . ASN A 1 503 ? 15.309  23.372  34.485  1.00 108.15 ? 499  ASN A ND2 1 
ATOM   3651  N N   . SER A 1 504 ? 14.930  17.738  34.322  1.00 103.04 ? 500  SER A N   1 
ATOM   3652  C CA  . SER A 1 504 ? 14.562  16.452  33.730  1.00 101.65 ? 500  SER A CA  1 
ATOM   3653  C C   . SER A 1 504 ? 14.030  16.591  32.301  1.00 100.52 ? 500  SER A C   1 
ATOM   3654  O O   . SER A 1 504 ? 13.148  17.404  32.021  1.00 103.10 ? 500  SER A O   1 
ATOM   3655  C CB  . SER A 1 504 ? 13.547  15.723  34.618  1.00 105.39 ? 500  SER A CB  1 
ATOM   3656  O OG  . SER A 1 504 ? 12.502  16.586  35.030  1.00 110.00 ? 500  SER A OG  1 
ATOM   3657  O OXT . SER A 1 504 ? 14.488  15.903  31.387  1.00 97.18  ? 500  SER A OXT 1 
ATOM   3658  N N   . LEU B 1 12  ? 29.918  18.170  58.244  1.00 89.70  ? 8    LEU B N   1 
ATOM   3659  C CA  . LEU B 1 12  ? 31.336  18.392  58.648  1.00 91.36  ? 8    LEU B CA  1 
ATOM   3660  C C   . LEU B 1 12  ? 32.003  17.065  59.044  1.00 88.87  ? 8    LEU B C   1 
ATOM   3661  O O   . LEU B 1 12  ? 32.197  16.800  60.233  1.00 92.27  ? 8    LEU B O   1 
ATOM   3662  C CB  . LEU B 1 12  ? 31.405  19.397  59.807  1.00 98.45  ? 8    LEU B CB  1 
ATOM   3663  C CG  . LEU B 1 12  ? 30.549  20.667  59.743  1.00 102.24 ? 8    LEU B CG  1 
ATOM   3664  C CD1 . LEU B 1 12  ? 30.313  21.218  61.141  1.00 109.35 ? 8    LEU B CD1 1 
ATOM   3665  C CD2 . LEU B 1 12  ? 31.175  21.722  58.838  1.00 102.28 ? 8    LEU B CD2 1 
ATOM   3666  N N   . PRO B 1 13  ? 32.355  16.224  58.048  1.00 83.26  ? 9    PRO B N   1 
ATOM   3667  C CA  . PRO B 1 13  ? 32.927  14.911  58.346  1.00 80.77  ? 9    PRO B CA  1 
ATOM   3668  C C   . PRO B 1 13  ? 34.403  14.986  58.715  1.00 82.14  ? 9    PRO B C   1 
ATOM   3669  O O   . PRO B 1 13  ? 35.080  15.954  58.368  1.00 83.66  ? 9    PRO B O   1 
ATOM   3670  C CB  . PRO B 1 13  ? 32.750  14.148  57.034  1.00 74.88  ? 9    PRO B CB  1 
ATOM   3671  C CG  . PRO B 1 13  ? 32.791  15.190  55.989  1.00 74.41  ? 9    PRO B CG  1 
ATOM   3672  C CD  . PRO B 1 13  ? 32.273  16.467  56.596  1.00 79.46  ? 9    PRO B CD  1 
ATOM   3673  N N   . SER B 1 14  ? 34.886  13.965  59.418  1.00 81.96  ? 10   SER B N   1 
ATOM   3674  C CA  . SER B 1 14  ? 36.290  13.883  59.820  1.00 83.33  ? 10   SER B CA  1 
ATOM   3675  C C   . SER B 1 14  ? 36.798  12.436  59.780  1.00 79.79  ? 10   SER B C   1 
ATOM   3676  O O   . SER B 1 14  ? 36.002  11.499  59.890  1.00 77.89  ? 10   SER B O   1 
ATOM   3677  C CB  . SER B 1 14  ? 36.495  14.497  61.213  1.00 89.74  ? 10   SER B CB  1 
ATOM   3678  O OG  . SER B 1 14  ? 35.757  13.803  62.200  1.00 91.41  ? 10   SER B OG  1 
ATOM   3679  N N   . PRO B 1 15  ? 38.123  12.249  59.603  1.00 79.16  ? 11   PRO B N   1 
ATOM   3680  C CA  . PRO B 1 15  ? 38.705  10.903  59.588  1.00 76.24  ? 11   PRO B CA  1 
ATOM   3681  C C   . PRO B 1 15  ? 38.576  10.175  60.920  1.00 78.93  ? 11   PRO B C   1 
ATOM   3682  O O   . PRO B 1 15  ? 38.484  10.813  61.972  1.00 83.98  ? 11   PRO B O   1 
ATOM   3683  C CB  . PRO B 1 15  ? 40.184  11.159  59.272  1.00 76.44  ? 11   PRO B CB  1 
ATOM   3684  C CG  . PRO B 1 15  ? 40.417  12.594  59.593  1.00 80.93  ? 11   PRO B CG  1 
ATOM   3685  C CD  . PRO B 1 15  ? 39.131  13.279  59.289  1.00 81.10  ? 11   PRO B CD  1 
ATOM   3686  N N   . THR B 1 16  ? 38.563  8.847   60.863  1.00 76.01  ? 12   THR B N   1 
ATOM   3687  C CA  . THR B 1 16  ? 38.522  8.021   62.069  1.00 78.44  ? 12   THR B CA  1 
ATOM   3688  C C   . THR B 1 16  ? 39.910  7.928   62.713  1.00 80.75  ? 12   THR B C   1 
ATOM   3689  O O   . THR B 1 16  ? 40.831  7.359   62.120  1.00 77.84  ? 12   THR B O   1 
ATOM   3690  C CB  . THR B 1 16  ? 37.914  6.610   61.797  1.00 74.85  ? 12   THR B CB  1 
ATOM   3691  O OG1 . THR B 1 16  ? 38.595  5.620   62.577  1.00 75.81  ? 12   THR B OG1 1 
ATOM   3692  C CG2 . THR B 1 16  ? 38.041  6.240   60.344  1.00 69.48  ? 12   THR B CG2 1 
ATOM   3693  N N   . PRO B 1 17  ? 40.062  8.501   63.925  1.00 86.42  ? 13   PRO B N   1 
ATOM   3694  C CA  . PRO B 1 17  ? 41.353  8.511   64.621  1.00 89.54  ? 13   PRO B CA  1 
ATOM   3695  C C   . PRO B 1 17  ? 41.773  7.116   65.080  1.00 88.43  ? 13   PRO B C   1 
ATOM   3696  O O   . PRO B 1 17  ? 40.914  6.262   65.323  1.00 87.30  ? 13   PRO B O   1 
ATOM   3697  C CB  . PRO B 1 17  ? 41.092  9.414   65.831  1.00 96.30  ? 13   PRO B CB  1 
ATOM   3698  C CG  . PRO B 1 17  ? 39.632  9.310   66.073  1.00 96.62  ? 13   PRO B CG  1 
ATOM   3699  C CD  . PRO B 1 17  ? 39.005  9.153   64.720  1.00 90.68  ? 13   PRO B CD  1 
ATOM   3700  N N   . ASN B 1 18  ? 43.085  6.904   65.194  1.00 89.00  ? 14   ASN B N   1 
ATOM   3701  C CA  . ASN B 1 18  ? 43.661  5.610   65.576  1.00 88.08  ? 14   ASN B CA  1 
ATOM   3702  C C   . ASN B 1 18  ? 43.106  4.458   64.736  1.00 82.53  ? 14   ASN B C   1 
ATOM   3703  O O   . ASN B 1 18  ? 42.585  3.474   65.270  1.00 82.61  ? 14   ASN B O   1 
ATOM   3704  C CB  . ASN B 1 18  ? 43.471  5.341   67.079  1.00 93.38  ? 14   ASN B CB  1 
ATOM   3705  C CG  . ASN B 1 18  ? 44.154  6.382   67.958  1.00 99.63  ? 14   ASN B CG  1 
ATOM   3706  O OD1 . ASN B 1 18  ? 44.900  7.234   67.477  1.00 99.98  ? 14   ASN B OD1 1 
ATOM   3707  N ND2 . ASN B 1 18  ? 43.898  6.311   69.260  1.00 105.07 ? 14   ASN B ND2 1 
ATOM   3708  N N   . LEU B 1 19  ? 43.218  4.602   63.417  1.00 78.25  ? 15   LEU B N   1 
ATOM   3709  C CA  . LEU B 1 19  ? 42.675  3.629   62.475  1.00 73.26  ? 15   LEU B CA  1 
ATOM   3710  C C   . LEU B 1 19  ? 43.392  2.286   62.580  1.00 71.81  ? 15   LEU B C   1 
ATOM   3711  O O   . LEU B 1 19  ? 44.614  2.236   62.733  1.00 72.81  ? 15   LEU B O   1 
ATOM   3712  C CB  . LEU B 1 19  ? 42.757  4.165   61.041  1.00 69.74  ? 15   LEU B CB  1 
ATOM   3713  C CG  . LEU B 1 19  ? 42.090  3.347   59.927  1.00 65.16  ? 15   LEU B CG  1 
ATOM   3714  C CD1 . LEU B 1 19  ? 40.577  3.509   59.946  1.00 65.01  ? 15   LEU B CD1 1 
ATOM   3715  C CD2 . LEU B 1 19  ? 42.646  3.729   58.563  1.00 62.69  ? 15   LEU B CD2 1 
ATOM   3716  N N   . GLU B 1 20  ? 42.616  1.208   62.512  1.00 69.84  ? 16   GLU B N   1 
ATOM   3717  C CA  . GLU B 1 20  ? 43.155  -0.147  62.506  1.00 68.31  ? 16   GLU B CA  1 
ATOM   3718  C C   . GLU B 1 20  ? 42.921  -0.813  61.163  1.00 63.60  ? 16   GLU B C   1 
ATOM   3719  O O   . GLU B 1 20  ? 41.791  -0.866  60.676  1.00 61.98  ? 16   GLU B O   1 
ATOM   3720  C CB  . GLU B 1 20  ? 42.509  -0.993  63.600  1.00 70.70  ? 16   GLU B CB  1 
ATOM   3721  C CG  . GLU B 1 20  ? 43.147  -0.855  64.969  1.00 75.76  ? 16   GLU B CG  1 
ATOM   3722  C CD  . GLU B 1 20  ? 42.865  -2.049  65.862  1.00 77.72  ? 16   GLU B CD  1 
ATOM   3723  O OE1 . GLU B 1 20  ? 42.127  -2.962  65.428  1.00 75.36  ? 16   GLU B OE1 1 
ATOM   3724  O OE2 . GLU B 1 20  ? 43.386  -2.077  66.996  1.00 81.82  ? 16   GLU B OE2 1 
ATOM   3725  N N   . ILE B 1 21  ? 43.991  -1.321  60.565  1.00 61.78  ? 17   ILE B N   1 
ATOM   3726  C CA  . ILE B 1 21  ? 43.865  -2.095  59.343  1.00 58.03  ? 17   ILE B CA  1 
ATOM   3727  C C   . ILE B 1 21  ? 43.597  -3.544  59.726  1.00 57.80  ? 17   ILE B C   1 
ATOM   3728  O O   . ILE B 1 21  ? 44.523  -4.322  59.977  1.00 58.23  ? 17   ILE B O   1 
ATOM   3729  C CB  . ILE B 1 21  ? 45.108  -1.970  58.439  1.00 56.63  ? 17   ILE B CB  1 
ATOM   3730  C CG1 . ILE B 1 21  ? 45.486  -0.492  58.222  1.00 57.95  ? 17   ILE B CG1 1 
ATOM   3731  C CG2 . ILE B 1 21  ? 44.885  -2.703  57.111  1.00 53.44  ? 17   ILE B CG2 1 
ATOM   3732  C CD1 . ILE B 1 21  ? 44.429  0.368   57.507  1.00 56.86  ? 17   ILE B CD1 1 
ATOM   3733  N N   . LYS B 1 22  ? 42.312  -3.885  59.788  1.00 57.48  ? 18   LYS B N   1 
ATOM   3734  C CA  . LYS B 1 22  ? 41.868  -5.197  60.250  1.00 57.96  ? 18   LYS B CA  1 
ATOM   3735  C C   . LYS B 1 22  ? 42.065  -6.277  59.186  1.00 55.15  ? 18   LYS B C   1 
ATOM   3736  O O   . LYS B 1 22  ? 42.345  -7.433  59.515  1.00 55.81  ? 18   LYS B O   1 
ATOM   3737  C CB  . LYS B 1 22  ? 40.401  -5.136  60.701  1.00 59.17  ? 18   LYS B CB  1 
ATOM   3738  C CG  . LYS B 1 22  ? 39.904  -6.367  61.464  1.00 61.02  ? 18   LYS B CG  1 
ATOM   3739  C CD  . LYS B 1 22  ? 38.459  -6.184  61.929  1.00 62.87  ? 18   LYS B CD  1 
ATOM   3740  C CE  . LYS B 1 22  ? 37.741  -7.516  62.127  1.00 63.43  ? 18   LYS B CE  1 
ATOM   3741  N NZ  . LYS B 1 22  ? 38.200  -8.251  63.337  1.00 66.84  ? 18   LYS B NZ  1 
ATOM   3742  N N   . TYR B 1 23  ? 41.938  -5.893  57.919  1.00 52.40  ? 19   TYR B N   1 
ATOM   3743  C CA  . TYR B 1 23  ? 41.955  -6.860  56.824  1.00 50.25  ? 19   TYR B CA  1 
ATOM   3744  C C   . TYR B 1 23  ? 43.231  -6.779  55.978  1.00 49.00  ? 19   TYR B C   1 
ATOM   3745  O O   . TYR B 1 23  ? 43.418  -5.843  55.190  1.00 47.89  ? 19   TYR B O   1 
ATOM   3746  C CB  . TYR B 1 23  ? 40.681  -6.727  55.978  1.00 48.82  ? 19   TYR B CB  1 
ATOM   3747  C CG  . TYR B 1 23  ? 39.417  -6.763  56.813  1.00 50.39  ? 19   TYR B CG  1 
ATOM   3748  C CD1 . TYR B 1 23  ? 38.874  -7.973  57.243  1.00 51.28  ? 19   TYR B CD1 1 
ATOM   3749  C CD2 . TYR B 1 23  ? 38.777  -5.584  57.194  1.00 51.35  ? 19   TYR B CD2 1 
ATOM   3750  C CE1 . TYR B 1 23  ? 37.721  -8.007  58.022  1.00 53.15  ? 19   TYR B CE1 1 
ATOM   3751  C CE2 . TYR B 1 23  ? 37.624  -5.609  57.974  1.00 52.88  ? 19   TYR B CE2 1 
ATOM   3752  C CZ  . TYR B 1 23  ? 37.103  -6.821  58.383  1.00 53.98  ? 19   TYR B CZ  1 
ATOM   3753  O OH  . TYR B 1 23  ? 35.961  -6.846  59.151  1.00 56.70  ? 19   TYR B OH  1 
ATOM   3754  N N   . THR B 1 24  ? 44.105  -7.770  56.164  1.00 49.41  ? 20   THR B N   1 
ATOM   3755  C CA  . THR B 1 24  ? 45.434  -7.791  55.542  1.00 48.76  ? 20   THR B CA  1 
ATOM   3756  C C   . THR B 1 24  ? 45.723  -9.094  54.803  1.00 48.03  ? 20   THR B C   1 
ATOM   3757  O O   . THR B 1 24  ? 46.774  -9.233  54.169  1.00 47.73  ? 20   THR B O   1 
ATOM   3758  C CB  . THR B 1 24  ? 46.552  -7.589  56.589  1.00 50.79  ? 20   THR B CB  1 
ATOM   3759  O OG1 . THR B 1 24  ? 46.401  -8.547  57.646  1.00 52.41  ? 20   THR B OG1 1 
ATOM   3760  C CG2 . THR B 1 24  ? 46.523  -6.172  57.161  1.00 51.85  ? 20   THR B CG2 1 
ATOM   3761  N N   . LYS B 1 25  ? 44.797  -10.046 54.896  1.00 48.09  ? 21   LYS B N   1 
ATOM   3762  C CA  . LYS B 1 25  ? 44.964  -11.358 54.274  1.00 48.00  ? 21   LYS B CA  1 
ATOM   3763  C C   . LYS B 1 25  ? 44.356  -11.426 52.870  1.00 46.52  ? 21   LYS B C   1 
ATOM   3764  O O   . LYS B 1 25  ? 43.674  -10.498 52.432  1.00 45.39  ? 21   LYS B O   1 
ATOM   3765  C CB  . LYS B 1 25  ? 44.374  -12.456 55.168  1.00 49.73  ? 21   LYS B CB  1 
ATOM   3766  C CG  . LYS B 1 25  ? 45.183  -12.751 56.424  1.00 51.82  ? 21   LYS B CG  1 
ATOM   3767  C CD  . LYS B 1 25  ? 44.430  -13.685 57.365  1.00 54.37  ? 21   LYS B CD  1 
ATOM   3768  C CE  . LYS B 1 25  ? 44.693  -15.162 57.065  1.00 55.64  ? 21   LYS B CE  1 
ATOM   3769  N NZ  . LYS B 1 25  ? 44.116  -16.068 58.115  1.00 58.15  ? 21   LYS B NZ  1 
ATOM   3770  N N   . ILE B 1 26  ? 44.620  -12.533 52.179  1.00 46.76  ? 22   ILE B N   1 
ATOM   3771  C CA  . ILE B 1 26  ? 44.085  -12.791 50.843  1.00 46.06  ? 22   ILE B CA  1 
ATOM   3772  C C   . ILE B 1 26  ? 42.616  -13.211 50.929  1.00 46.47  ? 22   ILE B C   1 
ATOM   3773  O O   . ILE B 1 26  ? 42.231  -13.955 51.836  1.00 47.80  ? 22   ILE B O   1 
ATOM   3774  C CB  . ILE B 1 26  ? 44.920  -13.874 50.113  1.00 47.04  ? 22   ILE B CB  1 
ATOM   3775  C CG1 . ILE B 1 26  ? 46.359  -13.384 49.911  1.00 46.77  ? 22   ILE B CG1 1 
ATOM   3776  C CG2 . ILE B 1 26  ? 44.291  -14.247 48.776  1.00 47.20  ? 22   ILE B CG2 1 
ATOM   3777  C CD1 . ILE B 1 26  ? 47.335  -14.459 49.466  1.00 48.20  ? 22   ILE B CD1 1 
ATOM   3778  N N   . PHE B 1 27  ? 41.807  -12.720 49.988  1.00 45.50  ? 23   PHE B N   1 
ATOM   3779  C CA  . PHE B 1 27  ? 40.373  -13.002 49.956  1.00 45.94  ? 23   PHE B CA  1 
ATOM   3780  C C   . PHE B 1 27  ? 40.008  -13.944 48.807  1.00 47.02  ? 23   PHE B C   1 
ATOM   3781  O O   . PHE B 1 27  ? 39.899  -13.529 47.653  1.00 46.51  ? 23   PHE B O   1 
ATOM   3782  C CB  . PHE B 1 27  ? 39.570  -11.696 49.877  1.00 44.61  ? 23   PHE B CB  1 
ATOM   3783  C CG  . PHE B 1 27  ? 38.097  -11.867 50.146  1.00 45.46  ? 23   PHE B CG  1 
ATOM   3784  C CD1 . PHE B 1 27  ? 37.609  -11.888 51.451  1.00 46.36  ? 23   PHE B CD1 1 
ATOM   3785  C CD2 . PHE B 1 27  ? 37.195  -11.999 49.095  1.00 45.61  ? 23   PHE B CD2 1 
ATOM   3786  C CE1 . PHE B 1 27  ? 36.246  -12.046 51.703  1.00 47.16  ? 23   PHE B CE1 1 
ATOM   3787  C CE2 . PHE B 1 27  ? 35.828  -12.159 49.341  1.00 46.61  ? 23   PHE B CE2 1 
ATOM   3788  C CZ  . PHE B 1 27  ? 35.356  -12.181 50.646  1.00 47.13  ? 23   PHE B CZ  1 
ATOM   3789  N N   . ILE B 1 28  ? 39.832  -15.218 49.143  1.00 48.94  ? 24   ILE B N   1 
ATOM   3790  C CA  . ILE B 1 28  ? 39.461  -16.250 48.179  1.00 50.75  ? 24   ILE B CA  1 
ATOM   3791  C C   . ILE B 1 28  ? 38.320  -17.088 48.746  1.00 52.88  ? 24   ILE B C   1 
ATOM   3792  O O   . ILE B 1 28  ? 38.396  -17.562 49.887  1.00 53.62  ? 24   ILE B O   1 
ATOM   3793  C CB  . ILE B 1 28  ? 40.654  -17.182 47.845  1.00 51.97  ? 24   ILE B CB  1 
ATOM   3794  C CG1 . ILE B 1 28  ? 41.740  -16.425 47.076  1.00 50.69  ? 24   ILE B CG1 1 
ATOM   3795  C CG2 . ILE B 1 28  ? 40.191  -18.404 47.048  1.00 54.65  ? 24   ILE B CG2 1 
ATOM   3796  C CD1 . ILE B 1 28  ? 43.061  -17.174 46.969  1.00 51.88  ? 24   ILE B CD1 1 
ATOM   3797  N N   . ASN B 1 29  ? 37.265  -17.250 47.945  1.00 54.07  ? 25   ASN B N   1 
ATOM   3798  C CA  . ASN B 1 29  ? 36.137  -18.125 48.271  1.00 56.66  ? 25   ASN B CA  1 
ATOM   3799  C C   . ASN B 1 29  ? 35.470  -17.744 49.598  1.00 56.52  ? 25   ASN B C   1 
ATOM   3800  O O   . ASN B 1 29  ? 35.052  -18.611 50.371  1.00 58.83  ? 25   ASN B O   1 
ATOM   3801  C CB  . ASN B 1 29  ? 36.598  -19.590 48.276  1.00 59.38  ? 25   ASN B CB  1 
ATOM   3802  C CG  . ASN B 1 29  ? 35.530  -20.553 47.795  1.00 62.76  ? 25   ASN B CG  1 
ATOM   3803  O OD1 . ASN B 1 29  ? 34.645  -20.196 47.013  1.00 63.05  ? 25   ASN B OD1 1 
ATOM   3804  N ND2 . ASN B 1 29  ? 35.622  -21.796 48.249  1.00 65.66  ? 25   ASN B ND2 1 
ATOM   3805  N N   . ASN B 1 30  ? 35.383  -16.434 49.842  1.00 54.23  ? 26   ASN B N   1 
ATOM   3806  C CA  . ASN B 1 30  ? 34.829  -15.852 51.077  1.00 54.19  ? 26   ASN B CA  1 
ATOM   3807  C C   . ASN B 1 30  ? 35.548  -16.218 52.380  1.00 55.00  ? 26   ASN B C   1 
ATOM   3808  O O   . ASN B 1 30  ? 35.017  -16.020 53.479  1.00 56.01  ? 26   ASN B O   1 
ATOM   3809  C CB  . ASN B 1 30  ? 33.319  -16.092 51.176  1.00 56.13  ? 26   ASN B CB  1 
ATOM   3810  C CG  . ASN B 1 30  ? 32.538  -15.256 50.188  1.00 54.92  ? 26   ASN B CG  1 
ATOM   3811  O OD1 . ASN B 1 30  ? 33.119  -14.555 49.354  1.00 52.76  ? 26   ASN B OD1 1 
ATOM   3812  N ND2 . ASN B 1 30  ? 31.213  -15.321 50.272  1.00 56.26  ? 26   ASN B ND2 1 
ATOM   3813  N N   . GLU B 1 31  ? 36.762  -16.745 52.240  1.00 54.93  ? 27   GLU B N   1 
ATOM   3814  C CA  . GLU B 1 31  ? 37.621  -17.065 53.373  1.00 55.75  ? 27   GLU B CA  1 
ATOM   3815  C C   . GLU B 1 31  ? 38.853  -16.167 53.337  1.00 53.60  ? 27   GLU B C   1 
ATOM   3816  O O   . GLU B 1 31  ? 39.263  -15.702 52.265  1.00 52.03  ? 27   GLU B O   1 
ATOM   3817  C CB  . GLU B 1 31  ? 38.050  -18.535 53.329  1.00 57.91  ? 27   GLU B CB  1 
ATOM   3818  C CG  . GLU B 1 31  ? 36.927  -19.539 53.562  1.00 61.24  ? 27   GLU B CG  1 
ATOM   3819  C CD  . GLU B 1 31  ? 36.455  -19.574 55.004  1.00 63.50  ? 27   GLU B CD  1 
ATOM   3820  O OE1 . GLU B 1 31  ? 37.304  -19.475 55.918  1.00 63.84  ? 27   GLU B OE1 1 
ATOM   3821  O OE2 . GLU B 1 31  ? 35.233  -19.708 55.224  1.00 65.38  ? 27   GLU B OE2 1 
ATOM   3822  N N   . TRP B 1 32  ? 39.434  -15.920 54.508  1.00 53.91  ? 28   TRP B N   1 
ATOM   3823  C CA  . TRP B 1 32  ? 40.689  -15.190 54.599  1.00 52.45  ? 28   TRP B CA  1 
ATOM   3824  C C   . TRP B 1 32  ? 41.835  -16.181 54.720  1.00 53.47  ? 28   TRP B C   1 
ATOM   3825  O O   . TRP B 1 32  ? 41.989  -16.849 55.748  1.00 55.48  ? 28   TRP B O   1 
ATOM   3826  C CB  . TRP B 1 32  ? 40.681  -14.239 55.791  1.00 52.75  ? 28   TRP B CB  1 
ATOM   3827  C CG  . TRP B 1 32  ? 39.679  -13.152 55.677  1.00 52.00  ? 28   TRP B CG  1 
ATOM   3828  C CD1 . TRP B 1 32  ? 38.474  -13.084 56.308  1.00 53.62  ? 28   TRP B CD1 1 
ATOM   3829  C CD2 . TRP B 1 32  ? 39.786  -11.968 54.881  1.00 50.16  ? 28   TRP B CD2 1 
ATOM   3830  N NE1 . TRP B 1 32  ? 37.821  -11.927 55.958  1.00 52.66  ? 28   TRP B NE1 1 
ATOM   3831  C CE2 . TRP B 1 32  ? 38.604  -11.223 55.081  1.00 50.45  ? 28   TRP B CE2 1 
ATOM   3832  C CE3 . TRP B 1 32  ? 40.767  -11.462 54.019  1.00 48.62  ? 28   TRP B CE3 1 
ATOM   3833  C CZ2 . TRP B 1 32  ? 38.373  -9.998  54.449  1.00 48.87  ? 28   TRP B CZ2 1 
ATOM   3834  C CZ3 . TRP B 1 32  ? 40.537  -10.244 53.390  1.00 47.45  ? 28   TRP B CZ3 1 
ATOM   3835  C CH2 . TRP B 1 32  ? 39.348  -9.526  53.610  1.00 47.46  ? 28   TRP B CH2 1 
ATOM   3836  N N   . GLN B 1 33  ? 42.632  -16.277 53.663  1.00 52.46  ? 29   GLN B N   1 
ATOM   3837  C CA  . GLN B 1 33  ? 43.731  -17.232 53.619  1.00 53.58  ? 29   GLN B CA  1 
ATOM   3838  C C   . GLN B 1 33  ? 45.088  -16.535 53.672  1.00 52.55  ? 29   GLN B C   1 
ATOM   3839  O O   . GLN B 1 33  ? 45.261  -15.443 53.126  1.00 50.90  ? 29   GLN B O   1 
ATOM   3840  C CB  . GLN B 1 33  ? 43.626  -18.106 52.363  1.00 54.27  ? 29   GLN B CB  1 
ATOM   3841  C CG  . GLN B 1 33  ? 42.465  -19.115 52.372  1.00 56.34  ? 29   GLN B CG  1 
ATOM   3842  C CD  . GLN B 1 33  ? 42.794  -20.418 53.101  1.00 59.21  ? 29   GLN B CD  1 
ATOM   3843  O OE1 . GLN B 1 33  ? 43.888  -20.971 52.960  1.00 59.64  ? 29   GLN B OE1 1 
ATOM   3844  N NE2 . GLN B 1 33  ? 41.832  -20.922 53.871  1.00 61.07  ? 29   GLN B NE2 1 
ATOM   3845  N N   . ASN B 1 34  ? 46.042  -17.169 54.347  1.00 53.83  ? 30   ASN B N   1 
ATOM   3846  C CA  . ASN B 1 34  ? 47.431  -16.738 54.307  1.00 53.43  ? 30   ASN B CA  1 
ATOM   3847  C C   . ASN B 1 34  ? 48.035  -17.086 52.956  1.00 53.22  ? 30   ASN B C   1 
ATOM   3848  O O   . ASN B 1 34  ? 47.520  -17.955 52.250  1.00 54.01  ? 30   ASN B O   1 
ATOM   3849  C CB  . ASN B 1 34  ? 48.235  -17.408 55.422  1.00 55.34  ? 30   ASN B CB  1 
ATOM   3850  C CG  . ASN B 1 34  ? 47.907  -16.855 56.797  1.00 55.95  ? 30   ASN B CG  1 
ATOM   3851  O OD1 . ASN B 1 34  ? 48.037  -15.657 57.050  1.00 54.94  ? 30   ASN B OD1 1 
ATOM   3852  N ND2 . ASN B 1 34  ? 47.492  -17.734 57.699  1.00 57.84  ? 30   ASN B ND2 1 
ATOM   3853  N N   . SER B 1 35  ? 49.122  -16.407 52.599  1.00 52.79  ? 31   SER B N   1 
ATOM   3854  C CA  . SER B 1 35  ? 49.824  -16.676 51.341  1.00 53.16  ? 31   SER B CA  1 
ATOM   3855  C C   . SER B 1 35  ? 50.530  -18.037 51.366  1.00 55.40  ? 31   SER B C   1 
ATOM   3856  O O   . SER B 1 35  ? 51.099  -18.430 52.388  1.00 56.41  ? 31   SER B O   1 
ATOM   3857  C CB  . SER B 1 35  ? 50.811  -15.550 51.013  1.00 52.32  ? 31   SER B CB  1 
ATOM   3858  O OG  . SER B 1 35  ? 51.778  -15.386 52.033  1.00 52.87  ? 31   SER B OG  1 
ATOM   3859  N N   . GLU B 1 36  ? 50.472  -18.745 50.237  1.00 56.56  ? 32   GLU B N   1 
ATOM   3860  C CA  . GLU B 1 36  ? 51.047  -20.092 50.097  1.00 59.19  ? 32   GLU B CA  1 
ATOM   3861  C C   . GLU B 1 36  ? 52.532  -20.152 50.456  1.00 60.18  ? 32   GLU B C   1 
ATOM   3862  O O   . GLU B 1 36  ? 52.981  -21.086 51.122  1.00 61.90  ? 32   GLU B O   1 
ATOM   3863  C CB  . GLU B 1 36  ? 50.822  -20.633 48.678  1.00 60.51  ? 32   GLU B CB  1 
ATOM   3864  C CG  . GLU B 1 36  ? 49.402  -21.130 48.405  1.00 60.98  ? 32   GLU B CG  1 
ATOM   3865  C CD  . GLU B 1 36  ? 49.071  -22.428 49.131  1.00 63.32  ? 32   GLU B CD  1 
ATOM   3866  O OE1 . GLU B 1 36  ? 49.967  -23.289 49.270  1.00 65.60  ? 32   GLU B OE1 1 
ATOM   3867  O OE2 . GLU B 1 36  ? 47.910  -22.590 49.560  1.00 63.15  ? 32   GLU B OE2 1 
ATOM   3868  N N   . SER B 1 37  ? 53.279  -19.148 50.006  1.00 59.50  ? 33   SER B N   1 
ATOM   3869  C CA  . SER B 1 37  ? 54.685  -18.993 50.352  1.00 60.62  ? 33   SER B CA  1 
ATOM   3870  C C   . SER B 1 37  ? 54.838  -18.611 51.819  1.00 60.41  ? 33   SER B C   1 
ATOM   3871  O O   . SER B 1 37  ? 55.801  -19.010 52.479  1.00 62.00  ? 33   SER B O   1 
ATOM   3872  C CB  . SER B 1 37  ? 55.323  -17.917 49.474  1.00 60.04  ? 33   SER B CB  1 
ATOM   3873  O OG  . SER B 1 37  ? 54.606  -16.700 49.568  1.00 57.67  ? 33   SER B OG  1 
ATOM   3874  N N   . GLY B 1 38  ? 53.877  -17.839 52.320  1.00 58.89  ? 34   GLY B N   1 
ATOM   3875  C CA  . GLY B 1 38  ? 53.925  -17.310 53.678  1.00 59.09  ? 34   GLY B CA  1 
ATOM   3876  C C   . GLY B 1 38  ? 54.457  -15.890 53.704  1.00 58.49  ? 34   GLY B C   1 
ATOM   3877  O O   . GLY B 1 38  ? 54.320  -15.184 54.705  1.00 58.49  ? 34   GLY B O   1 
ATOM   3878  N N   . ARG B 1 39  ? 55.067  -15.474 52.598  1.00 44.97  ? 35   ARG B N   1 
ATOM   3879  C CA  . ARG B 1 39  ? 55.692  -14.160 52.487  1.00 44.45  ? 35   ARG B CA  1 
ATOM   3880  C C   . ARG B 1 39  ? 54.688  -13.014 52.696  1.00 43.64  ? 35   ARG B C   1 
ATOM   3881  O O   . ARG B 1 39  ? 53.490  -13.159 52.431  1.00 43.34  ? 35   ARG B O   1 
ATOM   3882  C CB  . ARG B 1 39  ? 56.414  -14.036 51.138  1.00 43.97  ? 35   ARG B CB  1 
ATOM   3883  C CG  . ARG B 1 39  ? 57.580  -13.061 51.147  1.00 44.25  ? 35   ARG B CG  1 
ATOM   3884  C CD  . ARG B 1 39  ? 58.380  -13.099 49.854  1.00 44.68  ? 35   ARG B CD  1 
ATOM   3885  N NE  . ARG B 1 39  ? 59.421  -14.127 49.865  1.00 46.06  ? 35   ARG B NE  1 
ATOM   3886  C CZ  . ARG B 1 39  ? 59.360  -15.265 49.182  1.00 46.84  ? 35   ARG B CZ  1 
ATOM   3887  N NH1 . ARG B 1 39  ? 58.310  -15.533 48.413  1.00 46.41  ? 35   ARG B NH1 1 
ATOM   3888  N NH2 . ARG B 1 39  ? 60.361  -16.134 49.255  1.00 47.53  ? 35   ARG B NH2 1 
ATOM   3889  N N   . VAL B 1 40  ? 55.190  -11.884 53.191  1.00 43.48  ? 36   VAL B N   1 
ATOM   3890  C CA  . VAL B 1 40  ? 54.361  -10.733 53.538  1.00 42.97  ? 36   VAL B CA  1 
ATOM   3891  C C   . VAL B 1 40  ? 55.043  -9.440  53.092  1.00 42.40  ? 36   VAL B C   1 
ATOM   3892  O O   . VAL B 1 40  ? 56.233  -9.246  53.341  1.00 42.94  ? 36   VAL B O   1 
ATOM   3893  C CB  . VAL B 1 40  ? 54.054  -10.719 55.059  1.00 43.83  ? 36   VAL B CB  1 
ATOM   3894  C CG1 . VAL B 1 40  ? 53.844  -9.316  55.571  1.00 43.62  ? 36   VAL B CG1 1 
ATOM   3895  C CG2 . VAL B 1 40  ? 52.837  -11.575 55.361  1.00 44.14  ? 36   VAL B CG2 1 
ATOM   3896  N N   . PHE B 1 41  ? 54.288  -8.565  52.428  1.00 41.60  ? 37   PHE B N   1 
ATOM   3897  C CA  . PHE B 1 41  ? 54.843  -7.320  51.879  1.00 41.18  ? 37   PHE B CA  1 
ATOM   3898  C C   . PHE B 1 41  ? 54.327  -6.052  52.588  1.00 41.16  ? 37   PHE B C   1 
ATOM   3899  O O   . PHE B 1 41  ? 53.186  -6.025  53.051  1.00 41.28  ? 37   PHE B O   1 
ATOM   3900  C CB  . PHE B 1 41  ? 54.610  -7.247  50.360  1.00 40.37  ? 37   PHE B CB  1 
ATOM   3901  C CG  . PHE B 1 41  ? 53.195  -6.912  49.966  1.00 39.61  ? 37   PHE B CG  1 
ATOM   3902  C CD1 . PHE B 1 41  ? 52.254  -7.916  49.782  1.00 39.59  ? 37   PHE B CD1 1 
ATOM   3903  C CD2 . PHE B 1 41  ? 52.809  -5.589  49.759  1.00 39.05  ? 37   PHE B CD2 1 
ATOM   3904  C CE1 . PHE B 1 41  ? 50.947  -7.605  49.408  1.00 39.22  ? 37   PHE B CE1 1 
ATOM   3905  C CE2 . PHE B 1 41  ? 51.503  -5.270  49.392  1.00 38.30  ? 37   PHE B CE2 1 
ATOM   3906  C CZ  . PHE B 1 41  ? 50.572  -6.278  49.214  1.00 38.22  ? 37   PHE B CZ  1 
ATOM   3907  N N   . PRO B 1 42  ? 55.159  -4.990  52.656  1.00 41.24  ? 38   PRO B N   1 
ATOM   3908  C CA  . PRO B 1 42  ? 54.760  -3.804  53.409  1.00 41.43  ? 38   PRO B CA  1 
ATOM   3909  C C   . PRO B 1 42  ? 53.962  -2.774  52.606  1.00 40.81  ? 38   PRO B C   1 
ATOM   3910  O O   . PRO B 1 42  ? 54.093  -2.680  51.378  1.00 40.16  ? 38   PRO B O   1 
ATOM   3911  C CB  . PRO B 1 42  ? 56.100  -3.212  53.853  1.00 42.03  ? 38   PRO B CB  1 
ATOM   3912  C CG  . PRO B 1 42  ? 57.099  -3.681  52.829  1.00 41.72  ? 38   PRO B CG  1 
ATOM   3913  C CD  . PRO B 1 42  ? 56.495  -4.823  52.050  1.00 41.31  ? 38   PRO B CD  1 
ATOM   3914  N N   . VAL B 1 43  ? 53.142  -2.008  53.322  1.00 41.13  ? 39   VAL B N   1 
ATOM   3915  C CA  . VAL B 1 43  ? 52.330  -0.936  52.743  1.00 40.55  ? 39   VAL B CA  1 
ATOM   3916  C C   . VAL B 1 43  ? 52.655  0.383   53.456  1.00 41.17  ? 39   VAL B C   1 
ATOM   3917  O O   . VAL B 1 43  ? 52.597  0.471   54.688  1.00 41.98  ? 39   VAL B O   1 
ATOM   3918  C CB  . VAL B 1 43  ? 50.814  -1.268  52.829  1.00 40.22  ? 39   VAL B CB  1 
ATOM   3919  C CG1 . VAL B 1 43  ? 49.966  -0.101  52.363  1.00 39.73  ? 39   VAL B CG1 1 
ATOM   3920  C CG2 . VAL B 1 43  ? 50.498  -2.505  52.006  1.00 39.64  ? 39   VAL B CG2 1 
ATOM   3921  N N   . TYR B 1 44  ? 52.994  1.403   52.673  1.00 40.88  ? 40   TYR B N   1 
ATOM   3922  C CA  . TYR B 1 44  ? 53.540  2.643   53.219  1.00 41.61  ? 40   TYR B CA  1 
ATOM   3923  C C   . TYR B 1 44  ? 52.564  3.808   53.220  1.00 41.59  ? 40   TYR B C   1 
ATOM   3924  O O   . TYR B 1 44  ? 51.726  3.931   52.326  1.00 40.89  ? 40   TYR B O   1 
ATOM   3925  C CB  . TYR B 1 44  ? 54.812  3.026   52.463  1.00 41.63  ? 40   TYR B CB  1 
ATOM   3926  C CG  . TYR B 1 44  ? 55.965  2.092   52.736  1.00 42.30  ? 40   TYR B CG  1 
ATOM   3927  C CD1 . TYR B 1 44  ? 55.973  0.792   52.231  1.00 41.97  ? 40   TYR B CD1 1 
ATOM   3928  C CD2 . TYR B 1 44  ? 57.049  2.504   53.504  1.00 43.67  ? 40   TYR B CD2 1 
ATOM   3929  C CE1 . TYR B 1 44  ? 57.029  -0.071  52.489  1.00 42.73  ? 40   TYR B CE1 1 
ATOM   3930  C CE2 . TYR B 1 44  ? 58.116  1.647   53.766  1.00 44.19  ? 40   TYR B CE2 1 
ATOM   3931  C CZ  . TYR B 1 44  ? 58.097  0.361   53.256  1.00 43.75  ? 40   TYR B CZ  1 
ATOM   3932  O OH  . TYR B 1 44  ? 59.147  -0.494  53.509  1.00 44.66  ? 40   TYR B OH  1 
ATOM   3933  N N   . ASN B 1 45  ? 52.678  4.647   54.246  1.00 42.46  ? 41   ASN B N   1 
ATOM   3934  C CA  . ASN B 1 45  ? 51.990  5.924   54.300  1.00 42.79  ? 41   ASN B CA  1 
ATOM   3935  C C   . ASN B 1 45  ? 52.822  6.953   53.533  1.00 42.97  ? 41   ASN B C   1 
ATOM   3936  O O   . ASN B 1 45  ? 53.897  7.340   53.993  1.00 43.92  ? 41   ASN B O   1 
ATOM   3937  C CB  . ASN B 1 45  ? 51.799  6.352   55.760  1.00 44.04  ? 41   ASN B CB  1 
ATOM   3938  C CG  . ASN B 1 45  ? 51.130  7.719   55.906  1.00 44.61  ? 41   ASN B CG  1 
ATOM   3939  O OD1 . ASN B 1 45  ? 50.948  8.456   54.936  1.00 44.04  ? 41   ASN B OD1 1 
ATOM   3940  N ND2 . ASN B 1 45  ? 50.769  8.060   57.138  1.00 45.60  ? 41   ASN B ND2 1 
ATOM   3941  N N   . PRO B 1 46  ? 52.325  7.406   52.363  1.00 42.21  ? 42   PRO B N   1 
ATOM   3942  C CA  . PRO B 1 46  ? 53.092  8.294   51.479  1.00 42.34  ? 42   PRO B CA  1 
ATOM   3943  C C   . PRO B 1 46  ? 53.308  9.712   52.024  1.00 43.62  ? 42   PRO B C   1 
ATOM   3944  O O   . PRO B 1 46  ? 54.041  10.497  51.418  1.00 44.01  ? 42   PRO B O   1 
ATOM   3945  C CB  . PRO B 1 46  ? 52.236  8.342   50.210  1.00 41.35  ? 42   PRO B CB  1 
ATOM   3946  C CG  . PRO B 1 46  ? 50.869  8.089   50.675  1.00 41.02  ? 42   PRO B CG  1 
ATOM   3947  C CD  . PRO B 1 46  ? 50.974  7.146   51.835  1.00 41.29  ? 42   PRO B CD  1 
ATOM   3948  N N   . ALA B 1 47  ? 52.681  10.032  53.154  1.00 44.33  ? 43   ALA B N   1 
ATOM   3949  C CA  . ALA B 1 47  ? 52.779  11.365  53.740  1.00 45.78  ? 43   ALA B CA  1 
ATOM   3950  C C   . ALA B 1 47  ? 53.940  11.494  54.724  1.00 47.00  ? 43   ALA B C   1 
ATOM   3951  O O   . ALA B 1 47  ? 54.403  12.602  55.012  1.00 48.14  ? 43   ALA B O   1 
ATOM   3952  C CB  . ALA B 1 47  ? 51.465  11.743  54.412  1.00 46.30  ? 43   ALA B CB  1 
ATOM   3953  N N   . THR B 1 48  ? 54.400  10.357  55.239  1.00 46.79  ? 44   THR B N   1 
ATOM   3954  C CA  . THR B 1 48  ? 55.474  10.328  56.231  1.00 47.90  ? 44   THR B CA  1 
ATOM   3955  C C   . THR B 1 48  ? 56.553  9.316   55.868  1.00 47.29  ? 44   THR B C   1 
ATOM   3956  O O   . THR B 1 48  ? 57.679  9.399   56.356  1.00 48.06  ? 44   THR B O   1 
ATOM   3957  C CB  . THR B 1 48  ? 54.944  10.013  57.657  1.00 48.78  ? 44   THR B CB  1 
ATOM   3958  O OG1 . THR B 1 48  ? 53.963  8.968   57.595  1.00 47.58  ? 44   THR B OG1 1 
ATOM   3959  C CG2 . THR B 1 48  ? 54.325  11.251  58.293  1.00 50.10  ? 44   THR B CG2 1 
ATOM   3960  N N   . GLY B 1 49  ? 56.206  8.368   55.005  1.00 46.06  ? 45   GLY B N   1 
ATOM   3961  C CA  . GLY B 1 49  ? 57.104  7.271   54.665  1.00 45.82  ? 45   GLY B CA  1 
ATOM   3962  C C   . GLY B 1 49  ? 56.983  6.097   55.624  1.00 46.14  ? 45   GLY B C   1 
ATOM   3963  O O   . GLY B 1 49  ? 57.550  5.034   55.372  1.00 45.72  ? 45   GLY B O   1 
ATOM   3964  N N   . GLU B 1 50  ? 56.240  6.290   56.718  1.00 47.01  ? 46   GLU B N   1 
ATOM   3965  C CA  . GLU B 1 50  ? 56.029  5.264   57.746  1.00 47.47  ? 46   GLU B CA  1 
ATOM   3966  C C   . GLU B 1 50  ? 55.354  4.018   57.160  1.00 46.26  ? 46   GLU B C   1 
ATOM   3967  O O   . GLU B 1 50  ? 54.581  4.114   56.203  1.00 45.44  ? 46   GLU B O   1 
ATOM   3968  C CB  . GLU B 1 50  ? 55.190  5.834   58.910  1.00 48.68  ? 46   GLU B CB  1 
ATOM   3969  C CG  . GLU B 1 50  ? 53.681  5.471   58.873  1.00 48.40  ? 46   GLU B CG  1 
ATOM   3970  C CD  . GLU B 1 50  ? 52.738  6.566   59.394  1.00 49.35  ? 46   GLU B CD  1 
ATOM   3971  O OE1 . GLU B 1 50  ? 53.210  7.584   59.951  1.00 50.71  ? 46   GLU B OE1 1 
ATOM   3972  O OE2 . GLU B 1 50  ? 51.505  6.396   59.238  1.00 48.28  ? 46   GLU B OE2 1 
ATOM   3973  N N   . GLN B 1 51  ? 55.656  2.855   57.732  1.00 46.39  ? 47   GLN B N   1 
ATOM   3974  C CA  . GLN B 1 51  ? 54.968  1.618   57.366  1.00 45.50  ? 47   GLN B CA  1 
ATOM   3975  C C   . GLN B 1 51  ? 53.630  1.536   58.095  1.00 45.71  ? 47   GLN B C   1 
ATOM   3976  O O   . GLN B 1 51  ? 53.579  1.595   59.328  1.00 46.83  ? 47   GLN B O   1 
ATOM   3977  C CB  . GLN B 1 51  ? 55.830  0.393   57.694  1.00 45.83  ? 47   GLN B CB  1 
ATOM   3978  C CG  . GLN B 1 51  ? 55.182  -0.957  57.355  1.00 45.29  ? 47   GLN B CG  1 
ATOM   3979  C CD  . GLN B 1 51  ? 55.978  -2.148  57.876  1.00 46.33  ? 47   GLN B CD  1 
ATOM   3980  O OE1 . GLN B 1 51  ? 55.429  -3.030  58.542  1.00 47.11  ? 47   GLN B OE1 1 
ATOM   3981  N NE2 . GLN B 1 51  ? 57.276  -2.178  57.579  1.00 46.18  ? 47   GLN B NE2 1 
ATOM   3982  N N   . VAL B 1 52  ? 52.555  1.403   57.322  1.00 44.65  ? 48   VAL B N   1 
ATOM   3983  C CA  . VAL B 1 52  ? 51.202  1.293   57.870  1.00 44.68  ? 48   VAL B CA  1 
ATOM   3984  C C   . VAL B 1 52  ? 50.955  -0.093  58.469  1.00 44.92  ? 48   VAL B C   1 
ATOM   3985  O O   . VAL B 1 52  ? 50.576  -0.214  59.638  1.00 45.95  ? 48   VAL B O   1 
ATOM   3986  C CB  . VAL B 1 52  ? 50.132  1.590   56.793  1.00 43.59  ? 48   VAL B CB  1 
ATOM   3987  C CG1 . VAL B 1 52  ? 48.727  1.384   57.354  1.00 43.95  ? 48   VAL B CG1 1 
ATOM   3988  C CG2 . VAL B 1 52  ? 50.298  3.003   56.245  1.00 43.47  ? 48   VAL B CG2 1 
ATOM   3989  N N   . CYS B 1 53  ? 51.176  -1.127  57.658  1.00 44.05  ? 49   CYS B N   1 
ATOM   3990  C CA  . CYS B 1 53  ? 50.909  -2.510  58.046  1.00 44.28  ? 49   CYS B CA  1 
ATOM   3991  C C   . CYS B 1 53  ? 51.653  -3.481  57.142  1.00 43.56  ? 49   CYS B C   1 
ATOM   3992  O O   . CYS B 1 53  ? 52.460  -3.073  56.305  1.00 43.01  ? 49   CYS B O   1 
ATOM   3993  C CB  . CYS B 1 53  ? 49.409  -2.801  57.963  1.00 44.02  ? 49   CYS B CB  1 
ATOM   3994  S SG  . CYS B 1 53  ? 48.758  -2.702  56.277  1.00 42.69  ? 49   CYS B SG  1 
ATOM   3995  N N   . GLU B 1 54  ? 51.361  -4.767  57.319  1.00 43.81  ? 50   GLU B N   1 
ATOM   3996  C CA  . GLU B 1 54  ? 51.904  -5.833  56.485  1.00 43.38  ? 50   GLU B CA  1 
ATOM   3997  C C   . GLU B 1 54  ? 50.765  -6.655  55.879  1.00 42.83  ? 50   GLU B C   1 
ATOM   3998  O O   . GLU B 1 54  ? 49.857  -7.090  56.586  1.00 43.48  ? 50   GLU B O   1 
ATOM   3999  C CB  . GLU B 1 54  ? 52.836  -6.728  57.303  1.00 44.41  ? 50   GLU B CB  1 
ATOM   4000  C CG  . GLU B 1 54  ? 54.187  -6.109  57.612  1.00 45.02  ? 50   GLU B CG  1 
ATOM   4001  C CD  . GLU B 1 54  ? 55.128  -7.067  58.328  1.00 46.73  ? 50   GLU B CD  1 
ATOM   4002  O OE1 . GLU B 1 54  ? 54.791  -7.530  59.441  1.00 47.91  ? 50   GLU B OE1 1 
ATOM   4003  O OE2 . GLU B 1 54  ? 56.215  -7.349  57.779  1.00 46.77  ? 50   GLU B OE2 1 
ATOM   4004  N N   . VAL B 1 55  ? 50.821  -6.854  54.567  1.00 41.85  ? 51   VAL B N   1 
ATOM   4005  C CA  . VAL B 1 55  ? 49.780  -7.560  53.824  1.00 41.35  ? 51   VAL B CA  1 
ATOM   4006  C C   . VAL B 1 55  ? 50.342  -8.878  53.280  1.00 41.59  ? 51   VAL B C   1 
ATOM   4007  O O   . VAL B 1 55  ? 51.529  -8.959  52.956  1.00 41.80  ? 51   VAL B O   1 
ATOM   4008  C CB  . VAL B 1 55  ? 49.246  -6.677  52.660  1.00 40.27  ? 51   VAL B CB  1 
ATOM   4009  C CG1 . VAL B 1 55  ? 48.182  -7.399  51.859  1.00 39.84  ? 51   VAL B CG1 1 
ATOM   4010  C CG2 . VAL B 1 55  ? 48.686  -5.364  53.187  1.00 40.02  ? 51   VAL B CG2 1 
ATOM   4011  N N   . GLN B 1 56  ? 49.497  -9.906  53.193  1.00 41.70  ? 52   GLN B N   1 
ATOM   4012  C CA  . GLN B 1 56  ? 49.897  -11.200 52.627  1.00 42.05  ? 52   GLN B CA  1 
ATOM   4013  C C   . GLN B 1 56  ? 50.191  -11.067 51.136  1.00 41.25  ? 52   GLN B C   1 
ATOM   4014  O O   . GLN B 1 56  ? 49.460  -10.378 50.424  1.00 40.36  ? 52   GLN B O   1 
ATOM   4015  C CB  . GLN B 1 56  ? 48.804  -12.251 52.846  1.00 42.56  ? 52   GLN B CB  1 
ATOM   4016  C CG  . GLN B 1 56  ? 48.463  -12.533 54.304  1.00 43.48  ? 52   GLN B CG  1 
ATOM   4017  C CD  . GLN B 1 56  ? 49.513  -13.355 55.014  1.00 44.55  ? 52   GLN B CD  1 
ATOM   4018  O OE1 . GLN B 1 56  ? 49.970  -14.381 54.509  1.00 45.08  ? 52   GLN B OE1 1 
ATOM   4019  N NE2 . GLN B 1 56  ? 49.896  -12.913 56.202  1.00 45.54  ? 52   GLN B NE2 1 
ATOM   4020  N N   . GLU B 1 57  ? 51.255  -11.723 50.667  1.00 41.73  ? 53   GLU B N   1 
ATOM   4021  C CA  . GLU B 1 57  ? 51.683  -11.599 49.261  1.00 41.31  ? 53   GLU B CA  1 
ATOM   4022  C C   . GLU B 1 57  ? 51.253  -12.764 48.368  1.00 41.41  ? 53   GLU B C   1 
ATOM   4023  O O   . GLU B 1 57  ? 51.753  -13.879 48.505  1.00 42.44  ? 53   GLU B O   1 
ATOM   4024  C CB  . GLU B 1 57  ? 53.203  -11.391 49.146  1.00 41.60  ? 53   GLU B CB  1 
ATOM   4025  C CG  . GLU B 1 57  ? 53.673  -11.166 47.701  1.00 41.57  ? 53   GLU B CG  1 
ATOM   4026  C CD  . GLU B 1 57  ? 55.175  -10.973 47.557  1.00 42.81  ? 53   GLU B CD  1 
ATOM   4027  O OE1 . GLU B 1 57  ? 55.876  -10.784 48.581  1.00 43.47  ? 53   GLU B OE1 1 
ATOM   4028  O OE2 . GLU B 1 57  ? 55.654  -11.003 46.399  1.00 42.83  ? 53   GLU B OE2 1 
ATOM   4029  N N   . ALA B 1 58  ? 50.352  -12.484 47.432  1.00 40.60  ? 54   ALA B N   1 
ATOM   4030  C CA  . ALA B 1 58  ? 49.878  -13.490 46.489  1.00 40.88  ? 54   ALA B CA  1 
ATOM   4031  C C   . ALA B 1 58  ? 50.875  -13.732 45.360  1.00 41.10  ? 54   ALA B C   1 
ATOM   4032  O O   . ALA B 1 58  ? 51.571  -12.810 44.926  1.00 40.77  ? 54   ALA B O   1 
ATOM   4033  C CB  . ALA B 1 58  ? 48.531  -13.085 45.922  1.00 40.16  ? 54   ALA B CB  1 
ATOM   4034  N N   . ASP B 1 59  ? 50.929  -14.978 44.891  1.00 41.90  ? 55   ASP B N   1 
ATOM   4035  C CA  . ASP B 1 59  ? 51.787  -15.373 43.774  1.00 42.24  ? 55   ASP B CA  1 
ATOM   4036  C C   . ASP B 1 59  ? 51.042  -16.382 42.887  1.00 42.66  ? 55   ASP B C   1 
ATOM   4037  O O   . ASP B 1 59  ? 49.829  -16.537 43.016  1.00 42.40  ? 55   ASP B O   1 
ATOM   4038  C CB  . ASP B 1 59  ? 53.100  -15.961 44.306  1.00 43.23  ? 55   ASP B CB  1 
ATOM   4039  C CG  . ASP B 1 59  ? 54.284  -15.717 43.375  1.00 43.80  ? 55   ASP B CG  1 
ATOM   4040  O OD1 . ASP B 1 59  ? 54.080  -15.563 42.149  1.00 43.90  ? 55   ASP B OD1 1 
ATOM   4041  O OD2 . ASP B 1 59  ? 55.431  -15.690 43.877  1.00 44.76  ? 55   ASP B OD2 1 
ATOM   4042  N N   . LYS B 1 60  ? 51.764  -17.058 41.994  1.00 43.44  ? 56   LYS B N   1 
ATOM   4043  C CA  . LYS B 1 60  ? 51.181  -18.029 41.062  1.00 44.24  ? 56   LYS B CA  1 
ATOM   4044  C C   . LYS B 1 60  ? 50.321  -19.076 41.770  1.00 45.04  ? 56   LYS B C   1 
ATOM   4045  O O   . LYS B 1 60  ? 49.204  -19.370 41.331  1.00 45.08  ? 56   LYS B O   1 
ATOM   4046  C CB  . LYS B 1 60  ? 52.285  -18.718 40.245  1.00 45.40  ? 56   LYS B CB  1 
ATOM   4047  C CG  . LYS B 1 60  ? 51.819  -19.385 38.946  1.00 46.20  ? 56   LYS B CG  1 
ATOM   4048  C CD  . LYS B 1 60  ? 51.373  -20.836 39.156  1.00 47.63  ? 56   LYS B CD  1 
ATOM   4049  C CE  . LYS B 1 60  ? 50.831  -21.457 37.870  1.00 48.46  ? 56   LYS B CE  1 
ATOM   4050  N NZ  . LYS B 1 60  ? 49.601  -20.770 37.367  1.00 47.80  ? 56   LYS B NZ  1 
ATOM   4051  N N   . ALA B 1 61  ? 50.851  -19.638 42.856  1.00 45.72  ? 57   ALA B N   1 
ATOM   4052  C CA  . ALA B 1 61  ? 50.125  -20.619 43.656  1.00 46.48  ? 57   ALA B CA  1 
ATOM   4053  C C   . ALA B 1 61  ? 48.823  -20.015 44.173  1.00 45.51  ? 57   ALA B C   1 
ATOM   4054  O O   . ALA B 1 61  ? 47.753  -20.613 44.035  1.00 45.80  ? 57   ALA B O   1 
ATOM   4055  C CB  . ALA B 1 61  ? 50.992  -21.107 44.808  1.00 47.37  ? 57   ALA B CB  1 
ATOM   4056  N N   . ASP B 1 62  ? 48.931  -18.815 44.740  1.00 44.41  ? 58   ASP B N   1 
ATOM   4057  C CA  . ASP B 1 62  ? 47.794  -18.084 45.302  1.00 43.55  ? 58   ASP B CA  1 
ATOM   4058  C C   . ASP B 1 62  ? 46.732  -17.732 44.262  1.00 42.73  ? 58   ASP B C   1 
ATOM   4059  O O   . ASP B 1 62  ? 45.542  -17.786 44.557  1.00 42.75  ? 58   ASP B O   1 
ATOM   4060  C CB  . ASP B 1 62  ? 48.277  -16.818 46.018  1.00 42.67  ? 58   ASP B CB  1 
ATOM   4061  C CG  . ASP B 1 62  ? 49.027  -17.121 47.309  1.00 43.55  ? 58   ASP B CG  1 
ATOM   4062  O OD1 . ASP B 1 62  ? 48.375  -17.484 48.313  1.00 44.34  ? 58   ASP B OD1 1 
ATOM   4063  O OD2 . ASP B 1 62  ? 50.269  -16.985 47.325  1.00 43.74  ? 58   ASP B OD2 1 
ATOM   4064  N N   . ILE B 1 63  ? 47.166  -17.370 43.057  1.00 42.29  ? 59   ILE B N   1 
ATOM   4065  C CA  . ILE B 1 63  ? 46.253  -17.094 41.942  1.00 41.72  ? 59   ILE B CA  1 
ATOM   4066  C C   . ILE B 1 63  ? 45.540  -18.375 41.484  1.00 42.84  ? 59   ILE B C   1 
ATOM   4067  O O   . ILE B 1 63  ? 44.350  -18.348 41.164  1.00 42.68  ? 59   ILE B O   1 
ATOM   4068  C CB  . ILE B 1 63  ? 46.993  -16.418 40.743  1.00 41.27  ? 59   ILE B CB  1 
ATOM   4069  C CG1 . ILE B 1 63  ? 47.553  -15.036 41.133  1.00 40.04  ? 59   ILE B CG1 1 
ATOM   4070  C CG2 . ILE B 1 63  ? 46.101  -16.333 39.492  1.00 41.03  ? 59   ILE B CG2 1 
ATOM   4071  C CD1 . ILE B 1 63  ? 46.523  -13.935 41.353  1.00 38.17  ? 59   ILE B CD1 1 
ATOM   4072  N N   . ASP B 1 64  ? 46.265  -19.493 41.470  1.00 44.09  ? 60   ASP B N   1 
ATOM   4073  C CA  . ASP B 1 64  ? 45.690  -20.785 41.095  1.00 45.29  ? 60   ASP B CA  1 
ATOM   4074  C C   . ASP B 1 64  ? 44.483  -21.168 41.945  1.00 45.47  ? 60   ASP B C   1 
ATOM   4075  O O   . ASP B 1 64  ? 43.477  -21.653 41.419  1.00 45.82  ? 60   ASP B O   1 
ATOM   4076  C CB  . ASP B 1 64  ? 46.746  -21.887 41.165  1.00 46.76  ? 60   ASP B CB  1 
ATOM   4077  C CG  . ASP B 1 64  ? 47.460  -22.093 39.849  1.00 47.31  ? 60   ASP B CG  1 
ATOM   4078  O OD1 . ASP B 1 64  ? 47.143  -21.380 38.869  1.00 46.31  ? 60   ASP B OD1 1 
ATOM   4079  O OD2 . ASP B 1 64  ? 48.340  -22.979 39.798  1.00 48.80  ? 60   ASP B OD2 1 
ATOM   4080  N N   . LYS B 1 65  ? 44.594  -20.948 43.253  1.00 45.27  ? 61   LYS B N   1 
ATOM   4081  C CA  . LYS B 1 65  ? 43.506  -21.241 44.185  1.00 45.58  ? 61   LYS B CA  1 
ATOM   4082  C C   . LYS B 1 65  ? 42.318  -20.316 43.958  1.00 44.37  ? 61   LYS B C   1 
ATOM   4083  O O   . LYS B 1 65  ? 41.164  -20.721 44.129  1.00 44.85  ? 61   LYS B O   1 
ATOM   4084  C CB  . LYS B 1 65  ? 43.976  -21.120 45.636  1.00 45.73  ? 61   LYS B CB  1 
ATOM   4085  C CG  . LYS B 1 65  ? 44.934  -22.211 46.081  1.00 47.24  ? 61   LYS B CG  1 
ATOM   4086  C CD  . LYS B 1 65  ? 44.856  -22.454 47.582  1.00 47.85  ? 61   LYS B CD  1 
ATOM   4087  C CE  . LYS B 1 65  ? 45.308  -21.244 48.385  1.00 46.76  ? 61   LYS B CE  1 
ATOM   4088  N NZ  . LYS B 1 65  ? 45.221  -21.510 49.847  1.00 47.75  ? 61   LYS B NZ  1 
ATOM   4089  N N   . ALA B 1 66  ? 42.616  -19.078 43.572  1.00 42.92  ? 62   ALA B N   1 
ATOM   4090  C CA  . ALA B 1 66  ? 41.600  -18.056 43.366  1.00 41.65  ? 62   ALA B CA  1 
ATOM   4091  C C   . ALA B 1 66  ? 40.773  -18.326 42.118  1.00 41.56  ? 62   ALA B C   1 
ATOM   4092  O O   . ALA B 1 66  ? 39.561  -18.105 42.115  1.00 41.25  ? 62   ALA B O   1 
ATOM   4093  C CB  . ALA B 1 66  ? 42.241  -16.686 43.295  1.00 40.52  ? 62   ALA B CB  1 
ATOM   4094  N N   . VAL B 1 67  ? 41.427  -18.809 41.065  1.00 41.94  ? 63   VAL B N   1 
ATOM   4095  C CA  . VAL B 1 67  ? 40.736  -19.120 39.819  1.00 42.19  ? 63   VAL B CA  1 
ATOM   4096  C C   . VAL B 1 67  ? 39.798  -20.307 40.015  1.00 43.40  ? 63   VAL B C   1 
ATOM   4097  O O   . VAL B 1 67  ? 38.658  -20.279 39.560  1.00 43.36  ? 63   VAL B O   1 
ATOM   4098  C CB  . VAL B 1 67  ? 41.713  -19.383 38.653  1.00 42.65  ? 63   VAL B CB  1 
ATOM   4099  C CG1 . VAL B 1 67  ? 40.950  -19.699 37.371  1.00 42.84  ? 63   VAL B CG1 1 
ATOM   4100  C CG2 . VAL B 1 67  ? 42.617  -18.180 38.440  1.00 41.53  ? 63   VAL B CG2 1 
ATOM   4101  N N   . GLN B 1 68  ? 40.278  -21.334 40.711  1.00 44.67  ? 64   GLN B N   1 
ATOM   4102  C CA  . GLN B 1 68  ? 39.463  -22.508 41.019  1.00 46.04  ? 64   GLN B CA  1 
ATOM   4103  C C   . GLN B 1 68  ? 38.214  -22.142 41.814  1.00 45.48  ? 64   GLN B C   1 
ATOM   4104  O O   . GLN B 1 68  ? 37.171  -22.775 41.659  1.00 46.27  ? 64   GLN B O   1 
ATOM   4105  C CB  . GLN B 1 68  ? 40.268  -23.539 41.805  1.00 47.59  ? 64   GLN B CB  1 
ATOM   4106  C CG  . GLN B 1 68  ? 41.358  -24.244 41.025  1.00 48.78  ? 64   GLN B CG  1 
ATOM   4107  C CD  . GLN B 1 68  ? 42.064  -25.287 41.869  1.00 50.78  ? 64   GLN B CD  1 
ATOM   4108  O OE1 . GLN B 1 68  ? 41.467  -26.296 42.255  1.00 52.14  ? 64   GLN B OE1 1 
ATOM   4109  N NE2 . GLN B 1 68  ? 43.341  -25.047 42.167  1.00 50.54  ? 64   GLN B NE2 1 
ATOM   4110  N N   . ALA B 1 69  ? 38.332  -21.131 42.672  1.00 44.32  ? 65   ALA B N   1 
ATOM   4111  C CA  . ALA B 1 69  ? 37.197  -20.644 43.448  1.00 43.88  ? 65   ALA B CA  1 
ATOM   4112  C C   . ALA B 1 69  ? 36.188  -19.927 42.552  1.00 42.95  ? 65   ALA B C   1 
ATOM   4113  O O   . ALA B 1 69  ? 34.977  -20.076 42.729  1.00 43.19  ? 65   ALA B O   1 
ATOM   4114  C CB  . ALA B 1 69  ? 37.667  -19.736 44.563  1.00 43.08  ? 65   ALA B CB  1 
ATOM   4115  N N   . ALA B 1 70  ? 36.694  -19.165 41.583  1.00 42.00  ? 66   ALA B N   1 
ATOM   4116  C CA  . ALA B 1 70  ? 35.848  -18.444 40.634  1.00 41.10  ? 66   ALA B CA  1 
ATOM   4117  C C   . ALA B 1 70  ? 35.222  -19.362 39.580  1.00 41.99  ? 66   ALA B C   1 
ATOM   4118  O O   . ALA B 1 70  ? 34.077  -19.155 39.177  1.00 41.84  ? 66   ALA B O   1 
ATOM   4119  C CB  . ALA B 1 70  ? 36.627  -17.326 39.975  1.00 39.96  ? 66   ALA B CB  1 
ATOM   4120  N N   . ARG B 1 71  ? 35.973  -20.369 39.142  1.00 43.09  ? 67   ARG B N   1 
ATOM   4121  C CA  . ARG B 1 71  ? 35.487  -21.348 38.172  1.00 44.28  ? 67   ARG B CA  1 
ATOM   4122  C C   . ARG B 1 71  ? 34.332  -22.164 38.752  1.00 45.38  ? 67   ARG B C   1 
ATOM   4123  O O   . ARG B 1 71  ? 33.381  -22.495 38.040  1.00 45.81  ? 67   ARG B O   1 
ATOM   4124  C CB  . ARG B 1 71  ? 36.623  -22.282 37.742  1.00 45.47  ? 67   ARG B CB  1 
ATOM   4125  C CG  . ARG B 1 71  ? 36.276  -23.262 36.621  1.00 46.67  ? 67   ARG B CG  1 
ATOM   4126  C CD  . ARG B 1 71  ? 36.707  -22.739 35.262  1.00 46.33  ? 67   ARG B CD  1 
ATOM   4127  N NE  . ARG B 1 71  ? 35.664  -21.967 34.592  1.00 45.16  ? 67   ARG B NE  1 
ATOM   4128  C CZ  . ARG B 1 71  ? 35.893  -21.020 33.686  1.00 44.16  ? 67   ARG B CZ  1 
ATOM   4129  N NH1 . ARG B 1 71  ? 37.133  -20.696 33.341  1.00 43.88  ? 67   ARG B NH1 1 
ATOM   4130  N NH2 . ARG B 1 71  ? 34.875  -20.382 33.131  1.00 43.76  ? 67   ARG B NH2 1 
ATOM   4131  N N   . LEU B 1 72  ? 34.426  -22.485 40.042  1.00 45.95  ? 68   LEU B N   1 
ATOM   4132  C CA  . LEU B 1 72  ? 33.386  -23.243 40.738  1.00 47.06  ? 68   LEU B CA  1 
ATOM   4133  C C   . LEU B 1 72  ? 32.123  -22.397 40.927  1.00 46.21  ? 68   LEU B C   1 
ATOM   4134  O O   . LEU B 1 72  ? 31.005  -22.875 40.705  1.00 46.73  ? 68   LEU B O   1 
ATOM   4135  C CB  . LEU B 1 72  ? 33.904  -23.753 42.089  1.00 47.87  ? 68   LEU B CB  1 
ATOM   4136  C CG  . LEU B 1 72  ? 33.077  -24.786 42.866  1.00 49.24  ? 68   LEU B CG  1 
ATOM   4137  C CD1 . LEU B 1 72  ? 32.933  -26.094 42.099  1.00 50.63  ? 68   LEU B CD1 1 
ATOM   4138  C CD2 . LEU B 1 72  ? 33.700  -25.040 44.228  1.00 49.90  ? 68   LEU B CD2 1 
ATOM   4139  N N   . ALA B 1 73  ? 32.321  -21.139 41.321  1.00 44.84  ? 69   ALA B N   1 
ATOM   4140  C CA  . ALA B 1 73  ? 31.236  -20.184 41.528  1.00 43.88  ? 69   ALA B CA  1 
ATOM   4141  C C   . ALA B 1 73  ? 30.512  -19.828 40.227  1.00 43.47  ? 69   ALA B C   1 
ATOM   4142  O O   . ALA B 1 73  ? 29.450  -19.198 40.249  1.00 42.90  ? 69   ALA B O   1 
ATOM   4143  C CB  . ALA B 1 73  ? 31.773  -18.933 42.193  1.00 42.54  ? 69   ALA B CB  1 
ATOM   4144  N N   . PHE B 1 74  ? 31.090  -20.244 39.102  1.00 43.96  ? 70   PHE B N   1 
ATOM   4145  C CA  . PHE B 1 74  ? 30.541  -19.951 37.777  1.00 43.76  ? 70   PHE B CA  1 
ATOM   4146  C C   . PHE B 1 74  ? 29.912  -21.183 37.104  1.00 45.32  ? 70   PHE B C   1 
ATOM   4147  O O   . PHE B 1 74  ? 29.280  -21.070 36.053  1.00 45.21  ? 70   PHE B O   1 
ATOM   4148  C CB  . PHE B 1 74  ? 31.632  -19.329 36.888  1.00 43.06  ? 70   PHE B CB  1 
ATOM   4149  C CG  . PHE B 1 74  ? 31.112  -18.732 35.605  1.00 42.35  ? 70   PHE B CG  1 
ATOM   4150  C CD1 . PHE B 1 74  ? 30.409  -17.529 35.614  1.00 40.89  ? 70   PHE B CD1 1 
ATOM   4151  C CD2 . PHE B 1 74  ? 31.336  -19.370 34.389  1.00 42.77  ? 70   PHE B CD2 1 
ATOM   4152  C CE1 . PHE B 1 74  ? 29.929  -16.980 34.433  1.00 40.55  ? 70   PHE B CE1 1 
ATOM   4153  C CE2 . PHE B 1 74  ? 30.860  -18.831 33.206  1.00 42.43  ? 70   PHE B CE2 1 
ATOM   4154  C CZ  . PHE B 1 74  ? 30.153  -17.634 33.225  1.00 41.45  ? 70   PHE B CZ  1 
ATOM   4155  N N   . SER B 1 75  ? 30.075  -22.351 37.724  1.00 46.97  ? 71   SER B N   1 
ATOM   4156  C CA  . SER B 1 75  ? 29.561  -23.613 37.180  1.00 48.90  ? 71   SER B CA  1 
ATOM   4157  C C   . SER B 1 75  ? 28.043  -23.587 36.968  1.00 49.08  ? 71   SER B C   1 
ATOM   4158  O O   . SER B 1 75  ? 27.345  -22.777 37.571  1.00 48.10  ? 71   SER B O   1 
ATOM   4159  C CB  . SER B 1 75  ? 29.962  -24.786 38.083  1.00 50.49  ? 71   SER B CB  1 
ATOM   4160  O OG  . SER B 1 75  ? 29.416  -24.647 39.385  1.00 50.52  ? 71   SER B OG  1 
ATOM   4161  N N   . LEU B 1 76  ? 27.546  -24.483 36.117  1.00 50.62  ? 72   LEU B N   1 
ATOM   4162  C CA  . LEU B 1 76  ? 26.136  -24.489 35.707  1.00 50.98  ? 72   LEU B CA  1 
ATOM   4163  C C   . LEU B 1 76  ? 25.122  -24.695 36.840  1.00 51.50  ? 72   LEU B C   1 
ATOM   4164  O O   . LEU B 1 76  ? 24.019  -24.145 36.798  1.00 51.01  ? 72   LEU B O   1 
ATOM   4165  C CB  . LEU B 1 76  ? 25.906  -25.505 34.586  1.00 52.56  ? 72   LEU B CB  1 
ATOM   4166  C CG  . LEU B 1 76  ? 26.301  -25.064 33.173  1.00 52.31  ? 72   LEU B CG  1 
ATOM   4167  C CD1 . LEU B 1 76  ? 26.624  -26.267 32.285  1.00 54.71  ? 72   LEU B CD1 1 
ATOM   4168  C CD2 . LEU B 1 76  ? 25.219  -24.193 32.541  1.00 51.05  ? 72   LEU B CD2 1 
ATOM   4169  N N   . GLY B 1 77  ? 25.489  -25.477 37.847  1.00 52.73  ? 73   GLY B N   1 
ATOM   4170  C CA  . GLY B 1 77  ? 24.601  -25.703 38.987  1.00 53.54  ? 73   GLY B CA  1 
ATOM   4171  C C   . GLY B 1 77  ? 24.601  -24.571 40.003  1.00 52.26  ? 73   GLY B C   1 
ATOM   4172  O O   . GLY B 1 77  ? 23.654  -24.430 40.777  1.00 52.42  ? 73   GLY B O   1 
ATOM   4173  N N   . SER B 1 78  ? 25.660  -23.759 39.972  1.00 51.11  ? 74   SER B N   1 
ATOM   4174  C CA  . SER B 1 78  ? 25.973  -22.752 40.998  1.00 49.98  ? 74   SER B CA  1 
ATOM   4175  C C   . SER B 1 78  ? 24.830  -21.830 41.421  1.00 49.18  ? 74   SER B C   1 
ATOM   4176  O O   . SER B 1 78  ? 23.909  -21.558 40.650  1.00 48.89  ? 74   SER B O   1 
ATOM   4177  C CB  . SER B 1 78  ? 27.166  -21.906 40.537  1.00 48.70  ? 74   SER B CB  1 
ATOM   4178  O OG  . SER B 1 78  ? 27.441  -20.841 41.432  1.00 47.82  ? 74   SER B OG  1 
ATOM   4179  N N   . VAL B 1 79  ? 24.924  -21.351 42.659  1.00 48.98  ? 75   VAL B N   1 
ATOM   4180  C CA  . VAL B 1 79  ? 24.024  -20.336 43.206  1.00 48.28  ? 75   VAL B CA  1 
ATOM   4181  C C   . VAL B 1 79  ? 24.067  -19.031 42.388  1.00 46.75  ? 75   VAL B C   1 
ATOM   4182  O O   . VAL B 1 79  ? 23.025  -18.442 42.096  1.00 46.37  ? 75   VAL B O   1 
ATOM   4183  C CB  . VAL B 1 79  ? 24.357  -20.060 44.700  1.00 48.37  ? 75   VAL B CB  1 
ATOM   4184  C CG1 . VAL B 1 79  ? 23.583  -18.868 45.232  1.00 47.57  ? 75   VAL B CG1 1 
ATOM   4185  C CG2 . VAL B 1 79  ? 24.070  -21.290 45.547  1.00 50.28  ? 75   VAL B CG2 1 
ATOM   4186  N N   . TRP B 1 80  ? 25.273  -18.608 42.009  1.00 46.17  ? 76   TRP B N   1 
ATOM   4187  C CA  . TRP B 1 80  ? 25.500  -17.354 41.272  1.00 44.81  ? 76   TRP B CA  1 
ATOM   4188  C C   . TRP B 1 80  ? 24.951  -17.359 39.836  1.00 44.75  ? 76   TRP B C   1 
ATOM   4189  O O   . TRP B 1 80  ? 24.722  -16.298 39.247  1.00 43.71  ? 76   TRP B O   1 
ATOM   4190  C CB  . TRP B 1 80  ? 27.001  -17.015 41.281  1.00 44.22  ? 76   TRP B CB  1 
ATOM   4191  C CG  . TRP B 1 80  ? 27.388  -15.681 40.664  1.00 42.44  ? 76   TRP B CG  1 
ATOM   4192  C CD1 . TRP B 1 80  ? 28.246  -15.483 39.618  1.00 41.88  ? 76   TRP B CD1 1 
ATOM   4193  C CD2 . TRP B 1 80  ? 26.948  -14.375 41.070  1.00 41.01  ? 76   TRP B CD2 1 
ATOM   4194  N NE1 . TRP B 1 80  ? 28.364  -14.140 39.345  1.00 40.43  ? 76   TRP B NE1 1 
ATOM   4195  C CE2 . TRP B 1 80  ? 27.579  -13.439 40.220  1.00 39.88  ? 76   TRP B CE2 1 
ATOM   4196  C CE3 . TRP B 1 80  ? 26.082  -13.905 42.066  1.00 40.96  ? 76   TRP B CE3 1 
ATOM   4197  C CZ2 . TRP B 1 80  ? 27.370  -12.064 40.336  1.00 38.69  ? 76   TRP B CZ2 1 
ATOM   4198  C CZ3 . TRP B 1 80  ? 25.876  -12.536 42.179  1.00 39.87  ? 76   TRP B CZ3 1 
ATOM   4199  C CH2 . TRP B 1 80  ? 26.520  -11.633 41.319  1.00 38.63  ? 76   TRP B CH2 1 
ATOM   4200  N N   . ARG B 1 81  ? 24.741  -18.550 39.281  1.00 46.08  ? 77   ARG B N   1 
ATOM   4201  C CA  . ARG B 1 81  ? 24.202  -18.684 37.929  1.00 46.27  ? 77   ARG B CA  1 
ATOM   4202  C C   . ARG B 1 81  ? 22.695  -18.885 37.961  1.00 46.87  ? 77   ARG B C   1 
ATOM   4203  O O   . ARG B 1 81  ? 21.973  -18.336 37.122  1.00 46.34  ? 77   ARG B O   1 
ATOM   4204  C CB  . ARG B 1 81  ? 24.885  -19.832 37.187  1.00 47.35  ? 77   ARG B CB  1 
ATOM   4205  C CG  . ARG B 1 81  ? 26.375  -19.632 37.013  1.00 47.00  ? 77   ARG B CG  1 
ATOM   4206  C CD  . ARG B 1 81  ? 26.714  -18.876 35.736  1.00 46.40  ? 77   ARG B CD  1 
ATOM   4207  N NE  . ARG B 1 81  ? 27.223  -19.779 34.706  1.00 47.97  ? 77   ARG B NE  1 
ATOM   4208  C CZ  . ARG B 1 81  ? 26.708  -19.924 33.488  1.00 48.57  ? 77   ARG B CZ  1 
ATOM   4209  N NH1 . ARG B 1 81  ? 25.656  -19.208 33.107  1.00 47.82  ? 77   ARG B NH1 1 
ATOM   4210  N NH2 . ARG B 1 81  ? 27.262  -20.785 32.640  1.00 49.78  ? 77   ARG B NH2 1 
ATOM   4211  N N   . ARG B 1 82  ? 22.233  -19.671 38.938  1.00 48.13  ? 78   ARG B N   1 
ATOM   4212  C CA  . ARG B 1 82  ? 20.805  -19.940 39.141  1.00 48.93  ? 78   ARG B CA  1 
ATOM   4213  C C   . ARG B 1 82  ? 20.048  -18.693 39.586  1.00 47.79  ? 78   ARG B C   1 
ATOM   4214  O O   . ARG B 1 82  ? 18.868  -18.531 39.272  1.00 47.81  ? 78   ARG B O   1 
ATOM   4215  C CB  . ARG B 1 82  ? 20.598  -21.064 40.163  1.00 50.54  ? 78   ARG B CB  1 
ATOM   4216  C CG  . ARG B 1 82  ? 20.813  -22.468 39.609  1.00 52.53  ? 78   ARG B CG  1 
ATOM   4217  C CD  . ARG B 1 82  ? 20.064  -23.518 40.428  1.00 55.10  ? 78   ARG B CD  1 
ATOM   4218  N NE  . ARG B 1 82  ? 18.619  -23.481 40.192  1.00 55.80  ? 78   ARG B NE  1 
ATOM   4219  C CZ  . ARG B 1 82  ? 17.758  -24.422 40.580  1.00 57.84  ? 78   ARG B CZ  1 
ATOM   4220  N NH1 . ARG B 1 82  ? 18.179  -25.500 41.233  1.00 59.61  ? 78   ARG B NH1 1 
ATOM   4221  N NH2 . ARG B 1 82  ? 16.466  -24.288 40.309  1.00 58.13  ? 78   ARG B NH2 1 
ATOM   4222  N N   . MET B 1 83  ? 20.750  -17.825 40.315  1.00 46.93  ? 79   MET B N   1 
ATOM   4223  C CA  . MET B 1 83  ? 20.221  -16.570 40.844  1.00 45.88  ? 79   MET B CA  1 
ATOM   4224  C C   . MET B 1 83  ? 19.524  -15.734 39.775  1.00 44.91  ? 79   MET B C   1 
ATOM   4225  O O   . MET B 1 83  ? 19.934  -15.732 38.612  1.00 44.67  ? 79   MET B O   1 
ATOM   4226  C CB  . MET B 1 83  ? 21.372  -15.775 41.461  1.00 45.09  ? 79   MET B CB  1 
ATOM   4227  C CG  . MET B 1 83  ? 20.985  -14.474 42.129  1.00 44.64  ? 79   MET B CG  1 
ATOM   4228  S SD  . MET B 1 83  ? 22.348  -13.738 43.050  1.00 44.67  ? 79   MET B SD  1 
ATOM   4229  C CE  . MET B 1 83  ? 22.316  -14.721 44.548  1.00 46.02  ? 79   MET B CE  1 
ATOM   4230  N N   . ASP B 1 84  ? 18.465  -15.039 40.181  1.00 44.58  ? 80   ASP B N   1 
ATOM   4231  C CA  . ASP B 1 84  ? 17.782  -14.074 39.324  1.00 43.66  ? 80   ASP B CA  1 
ATOM   4232  C C   . ASP B 1 84  ? 18.693  -12.896 39.004  1.00 42.41  ? 80   ASP B C   1 
ATOM   4233  O O   . ASP B 1 84  ? 19.526  -12.514 39.824  1.00 42.28  ? 80   ASP B O   1 
ATOM   4234  C CB  . ASP B 1 84  ? 16.521  -13.554 40.016  1.00 43.76  ? 80   ASP B CB  1 
ATOM   4235  C CG  . ASP B 1 84  ? 15.311  -14.432 39.772  1.00 44.73  ? 80   ASP B CG  1 
ATOM   4236  O OD1 . ASP B 1 84  ? 15.294  -15.159 38.754  1.00 44.93  ? 80   ASP B OD1 1 
ATOM   4237  O OD2 . ASP B 1 84  ? 14.370  -14.383 40.598  1.00 45.29  ? 80   ASP B OD2 1 
ATOM   4238  N N   . ALA B 1 85  ? 18.531  -12.319 37.817  1.00 41.78  ? 81   ALA B N   1 
ATOM   4239  C CA  . ALA B 1 85  ? 19.298  -11.133 37.437  1.00 40.84  ? 81   ALA B CA  1 
ATOM   4240  C C   . ALA B 1 85  ? 19.035  -9.960  38.382  1.00 40.34  ? 81   ALA B C   1 
ATOM   4241  O O   . ALA B 1 85  ? 19.965  -9.248  38.762  1.00 39.89  ? 81   ALA B O   1 
ATOM   4242  C CB  . ALA B 1 85  ? 19.009  -10.737 35.993  1.00 40.49  ? 81   ALA B CB  1 
ATOM   4243  N N   . SER B 1 86  ? 17.773  -9.779  38.770  1.00 40.65  ? 82   SER B N   1 
ATOM   4244  C CA  . SER B 1 86  ? 17.376  -8.699  39.673  1.00 40.53  ? 82   SER B CA  1 
ATOM   4245  C C   . SER B 1 86  ? 18.042  -8.829  41.043  1.00 41.05  ? 82   SER B C   1 
ATOM   4246  O O   . SER B 1 86  ? 18.300  -7.830  41.717  1.00 40.80  ? 82   SER B O   1 
ATOM   4247  C CB  . SER B 1 86  ? 15.857  -8.665  39.833  1.00 40.88  ? 82   SER B CB  1 
ATOM   4248  O OG  . SER B 1 86  ? 15.408  -9.711  40.673  1.00 41.93  ? 82   SER B OG  1 
ATOM   4249  N N   . GLU B 1 87  ? 18.308  -10.070 41.443  1.00 41.96  ? 83   GLU B N   1 
ATOM   4250  C CA  . GLU B 1 87  ? 19.002  -10.364 42.694  1.00 42.63  ? 83   GLU B CA  1 
ATOM   4251  C C   . GLU B 1 87  ? 20.492  -10.018 42.633  1.00 41.84  ? 83   GLU B C   1 
ATOM   4252  O O   . GLU B 1 87  ? 21.084  -9.616  43.634  1.00 41.87  ? 83   GLU B O   1 
ATOM   4253  C CB  . GLU B 1 87  ? 18.807  -11.832 43.065  1.00 43.85  ? 83   GLU B CB  1 
ATOM   4254  C CG  . GLU B 1 87  ? 17.465  -12.129 43.702  1.00 45.78  ? 83   GLU B CG  1 
ATOM   4255  C CD  . GLU B 1 87  ? 17.453  -11.859 45.199  1.00 47.66  ? 83   GLU B CD  1 
ATOM   4256  O OE1 . GLU B 1 87  ? 18.389  -12.320 45.893  1.00 48.71  ? 83   GLU B OE1 1 
ATOM   4257  O OE2 . GLU B 1 87  ? 16.502  -11.201 45.679  1.00 48.04  ? 83   GLU B OE2 1 
ATOM   4258  N N   . ARG B 1 88  ? 21.091  -10.182 41.456  1.00 41.24  ? 84   ARG B N   1 
ATOM   4259  C CA  . ARG B 1 88  ? 22.478  -9.780  41.235  1.00 40.51  ? 84   ARG B CA  1 
ATOM   4260  C C   . ARG B 1 88  ? 22.646  -8.282  41.476  1.00 39.75  ? 84   ARG B C   1 
ATOM   4261  O O   . ARG B 1 88  ? 23.646  -7.847  42.051  1.00 39.63  ? 84   ARG B O   1 
ATOM   4262  C CB  . ARG B 1 88  ? 22.942  -10.158 39.825  1.00 40.15  ? 84   ARG B CB  1 
ATOM   4263  C CG  . ARG B 1 88  ? 23.282  -11.623 39.676  1.00 40.78  ? 84   ARG B CG  1 
ATOM   4264  C CD  . ARG B 1 88  ? 24.149  -11.877 38.458  1.00 40.30  ? 84   ARG B CD  1 
ATOM   4265  N NE  . ARG B 1 88  ? 23.364  -12.289 37.295  1.00 40.55  ? 84   ARG B NE  1 
ATOM   4266  C CZ  . ARG B 1 88  ? 23.231  -11.579 36.177  1.00 39.80  ? 84   ARG B CZ  1 
ATOM   4267  N NH1 . ARG B 1 88  ? 23.840  -10.408 36.044  1.00 39.07  ? 84   ARG B NH1 1 
ATOM   4268  N NH2 . ARG B 1 88  ? 22.494  -12.049 35.181  1.00 39.92  ? 84   ARG B NH2 1 
ATOM   4269  N N   . GLY B 1 89  ? 21.657  -7.503  41.042  1.00 39.26  ? 85   GLY B N   1 
ATOM   4270  C CA  . GLY B 1 89  ? 21.626  -6.068  41.307  1.00 38.56  ? 85   GLY B CA  1 
ATOM   4271  C C   . GLY B 1 89  ? 21.243  -5.755  42.743  1.00 38.96  ? 85   GLY B C   1 
ATOM   4272  O O   . GLY B 1 89  ? 21.614  -4.707  43.278  1.00 38.65  ? 85   GLY B O   1 
ATOM   4273  N N   . ARG B 1 90  ? 20.492  -6.661  43.363  1.00 39.60  ? 86   ARG B N   1 
ATOM   4274  C CA  . ARG B 1 90  ? 20.125  -6.513  44.761  1.00 40.36  ? 86   ARG B CA  1 
ATOM   4275  C C   . ARG B 1 90  ? 21.377  -6.530  45.638  1.00 40.43  ? 86   ARG B C   1 
ATOM   4276  O O   . ARG B 1 90  ? 21.534  -5.683  46.523  1.00 40.67  ? 86   ARG B O   1 
ATOM   4277  C CB  . ARG B 1 90  ? 19.142  -7.609  45.190  1.00 41.42  ? 86   ARG B CB  1 
ATOM   4278  C CG  . ARG B 1 90  ? 17.672  -7.310  44.894  1.00 42.09  ? 86   ARG B CG  1 
ATOM   4279  C CD  . ARG B 1 90  ? 16.993  -6.589  46.057  1.00 43.75  ? 86   ARG B CD  1 
ATOM   4280  N NE  . ARG B 1 90  ? 17.525  -5.240  46.251  1.00 44.01  ? 86   ARG B NE  1 
ATOM   4281  C CZ  . ARG B 1 90  ? 17.573  -4.603  47.419  1.00 45.00  ? 86   ARG B CZ  1 
ATOM   4282  N NH1 . ARG B 1 90  ? 17.125  -5.182  48.529  1.00 45.99  ? 86   ARG B NH1 1 
ATOM   4283  N NH2 . ARG B 1 90  ? 18.083  -3.380  47.475  1.00 44.90  ? 86   ARG B NH2 1 
ATOM   4284  N N   . LEU B 1 91  ? 22.270  -7.480  45.367  1.00 40.16  ? 87   LEU B N   1 
ATOM   4285  C CA  . LEU B 1 91  ? 23.495  -7.639  46.142  1.00 40.17  ? 87   LEU B CA  1 
ATOM   4286  C C   . LEU B 1 91  ? 24.417  -6.443  45.988  1.00 39.37  ? 87   LEU B C   1 
ATOM   4287  O O   . LEU B 1 91  ? 25.020  -5.994  46.963  1.00 39.72  ? 87   LEU B O   1 
ATOM   4288  C CB  . LEU B 1 91  ? 24.225  -8.924  45.751  1.00 40.30  ? 87   LEU B CB  1 
ATOM   4289  C CG  . LEU B 1 91  ? 23.664  -10.244 46.281  1.00 41.33  ? 87   LEU B CG  1 
ATOM   4290  C CD1 . LEU B 1 91  ? 24.517  -11.406 45.802  1.00 41.48  ? 87   LEU B CD1 1 
ATOM   4291  C CD2 . LEU B 1 91  ? 23.574  -10.238 47.802  1.00 42.12  ? 87   LEU B CD2 1 
ATOM   4292  N N   . LEU B 1 92  ? 24.514  -5.936  44.759  1.00 38.45  ? 88   LEU B N   1 
ATOM   4293  C CA  . LEU B 1 92  ? 25.289  -4.735  44.455  1.00 37.65  ? 88   LEU B CA  1 
ATOM   4294  C C   . LEU B 1 92  ? 24.756  -3.533  45.229  1.00 37.78  ? 88   LEU B C   1 
ATOM   4295  O O   . LEU B 1 92  ? 25.523  -2.742  45.776  1.00 37.67  ? 88   LEU B O   1 
ATOM   4296  C CB  . LEU B 1 92  ? 25.262  -4.441  42.951  1.00 36.86  ? 88   LEU B CB  1 
ATOM   4297  C CG  . LEU B 1 92  ? 26.043  -5.340  41.987  1.00 36.68  ? 88   LEU B CG  1 
ATOM   4298  C CD1 . LEU B 1 92  ? 25.558  -5.120  40.570  1.00 36.36  ? 88   LEU B CD1 1 
ATOM   4299  C CD2 . LEU B 1 92  ? 27.547  -5.098  42.066  1.00 36.58  ? 88   LEU B CD2 1 
ATOM   4300  N N   . ASP B 1 93  ? 23.433  -3.417  45.285  1.00 38.10  ? 89   ASP B N   1 
ATOM   4301  C CA  . ASP B 1 93  ? 22.787  -2.314  45.984  1.00 38.41  ? 89   ASP B CA  1 
ATOM   4302  C C   . ASP B 1 93  ? 23.080  -2.366  47.475  1.00 39.23  ? 89   ASP B C   1 
ATOM   4303  O O   . ASP B 1 93  ? 23.222  -1.326  48.121  1.00 39.54  ? 89   ASP B O   1 
ATOM   4304  C CB  . ASP B 1 93  ? 21.281  -2.336  45.742  1.00 38.60  ? 89   ASP B CB  1 
ATOM   4305  C CG  . ASP B 1 93  ? 20.664  -0.961  45.832  1.00 38.95  ? 89   ASP B CG  1 
ATOM   4306  O OD1 . ASP B 1 93  ? 21.214  -0.021  45.222  1.00 38.67  ? 89   ASP B OD1 1 
ATOM   4307  O OD2 . ASP B 1 93  ? 19.623  -0.821  46.505  1.00 40.55  ? 89   ASP B OD2 1 
ATOM   4308  N N   . LYS B 1 94  ? 23.173  -3.586  48.006  1.00 39.75  ? 90   LYS B N   1 
ATOM   4309  C CA  . LYS B 1 94  ? 23.510  -3.816  49.409  1.00 40.63  ? 90   LYS B CA  1 
ATOM   4310  C C   . LYS B 1 94  ? 24.970  -3.476  49.663  1.00 40.22  ? 90   LYS B C   1 
ATOM   4311  O O   . LYS B 1 94  ? 25.323  -3.002  50.742  1.00 40.93  ? 90   LYS B O   1 
ATOM   4312  C CB  . LYS B 1 94  ? 23.211  -5.267  49.812  1.00 41.42  ? 90   LYS B CB  1 
ATOM   4313  C CG  . LYS B 1 94  ? 23.504  -5.614  51.284  1.00 43.25  ? 90   LYS B CG  1 
ATOM   4314  C CD  . LYS B 1 94  ? 22.650  -4.814  52.281  1.00 45.05  ? 90   LYS B CD  1 
ATOM   4315  C CE  . LYS B 1 94  ? 21.357  -5.539  52.653  1.00 46.69  ? 90   LYS B CE  1 
ATOM   4316  N NZ  . LYS B 1 94  ? 20.463  -5.770  51.477  1.00 46.77  ? 90   LYS B NZ  1 
ATOM   4317  N N   . LEU B 1 95  ? 25.811  -3.713  48.660  1.00 39.25  ? 91   LEU B N   1 
ATOM   4318  C CA  . LEU B 1 95  ? 27.227  -3.379  48.746  1.00 38.88  ? 91   LEU B CA  1 
ATOM   4319  C C   . LEU B 1 95  ? 27.435  -1.866  48.833  1.00 38.71  ? 91   LEU B C   1 
ATOM   4320  O O   . LEU B 1 95  ? 28.265  -1.397  49.611  1.00 39.23  ? 91   LEU B O   1 
ATOM   4321  C CB  . LEU B 1 95  ? 28.007  -3.977  47.570  1.00 38.04  ? 91   LEU B CB  1 
ATOM   4322  C CG  . LEU B 1 95  ? 29.527  -4.105  47.715  1.00 37.78  ? 91   LEU B CG  1 
ATOM   4323  C CD1 . LEU B 1 95  ? 29.903  -4.891  48.966  1.00 38.54  ? 91   LEU B CD1 1 
ATOM   4324  C CD2 . LEU B 1 95  ? 30.136  -4.751  46.479  1.00 36.80  ? 91   LEU B CD2 1 
ATOM   4325  N N   . ALA B 1 96  ? 26.667  -1.111  48.051  1.00 38.17  ? 92   ALA B N   1 
ATOM   4326  C CA  . ALA B 1 96  ? 26.696  0.351   48.122  1.00 38.10  ? 92   ALA B CA  1 
ATOM   4327  C C   . ALA B 1 96  ? 26.269  0.834   49.508  1.00 39.16  ? 92   ALA B C   1 
ATOM   4328  O O   . ALA B 1 96  ? 26.901  1.728   50.073  1.00 39.60  ? 92   ALA B O   1 
ATOM   4329  C CB  . ALA B 1 96  ? 25.817  0.965   47.034  1.00 37.57  ? 92   ALA B CB  1 
ATOM   4330  N N   . ASP B 1 97  ? 25.206  0.226   50.044  1.00 39.70  ? 93   ASP B N   1 
ATOM   4331  C CA  . ASP B 1 97  ? 24.716  0.483   51.406  1.00 40.76  ? 93   ASP B CA  1 
ATOM   4332  C C   . ASP B 1 97  ? 25.828  0.384   52.446  1.00 41.30  ? 93   ASP B C   1 
ATOM   4333  O O   . ASP B 1 97  ? 25.980  1.262   53.299  1.00 42.19  ? 93   ASP B O   1 
ATOM   4334  C CB  . ASP B 1 97  ? 23.620  -0.522  51.775  1.00 41.31  ? 93   ASP B CB  1 
ATOM   4335  C CG  . ASP B 1 97  ? 22.236  -0.078  51.353  1.00 41.46  ? 93   ASP B CG  1 
ATOM   4336  O OD1 . ASP B 1 97  ? 22.109  0.821   50.495  1.00 41.33  ? 93   ASP B OD1 1 
ATOM   4337  O OD2 . ASP B 1 97  ? 21.262  -0.648  51.886  1.00 42.45  ? 93   ASP B OD2 1 
ATOM   4338  N N   . LEU B 1 98  ? 26.597  -0.696  52.365  1.00 40.80  ? 94   LEU B N   1 
ATOM   4339  C CA  . LEU B 1 98  ? 27.643  -0.973  53.337  1.00 41.35  ? 94   LEU B CA  1 
ATOM   4340  C C   . LEU B 1 98  ? 28.808  0.007   53.224  1.00 40.93  ? 94   LEU B C   1 
ATOM   4341  O O   . LEU B 1 98  ? 29.353  0.451   54.239  1.00 41.82  ? 94   LEU B O   1 
ATOM   4342  C CB  . LEU B 1 98  ? 28.115  -2.422  53.206  1.00 41.19  ? 94   LEU B CB  1 
ATOM   4343  C CG  . LEU B 1 98  ? 27.096  -3.499  53.605  1.00 41.80  ? 94   LEU B CG  1 
ATOM   4344  C CD1 . LEU B 1 98  ? 27.644  -4.887  53.324  1.00 41.68  ? 94   LEU B CD1 1 
ATOM   4345  C CD2 . LEU B 1 98  ? 26.695  -3.377  55.069  1.00 43.30  ? 94   LEU B CD2 1 
ATOM   4346  N N   . VAL B 1 99  ? 29.169  0.350   51.990  1.00 39.63  ? 95   VAL B N   1 
ATOM   4347  C CA  . VAL B 1 99  ? 30.168  1.381   51.721  1.00 39.18  ? 95   VAL B CA  1 
ATOM   4348  C C   . VAL B 1 99  ? 29.679  2.730   52.253  1.00 39.99  ? 95   VAL B C   1 
ATOM   4349  O O   . VAL B 1 99  ? 30.425  3.450   52.916  1.00 40.69  ? 95   VAL B O   1 
ATOM   4350  C CB  . VAL B 1 99  ? 30.492  1.477   50.216  1.00 37.79  ? 95   VAL B CB  1 
ATOM   4351  C CG1 . VAL B 1 99  ? 31.439  2.622   49.941  1.00 37.79  ? 95   VAL B CG1 1 
ATOM   4352  C CG2 . VAL B 1 99  ? 31.101  0.181   49.724  1.00 37.19  ? 95   VAL B CG2 1 
ATOM   4353  N N   . GLU B 1 100 ? 28.415  3.048   51.977  1.00 40.06  ? 96   GLU B N   1 
ATOM   4354  C CA  . GLU B 1 100 ? 27.774  4.262   52.480  1.00 40.90  ? 96   GLU B CA  1 
ATOM   4355  C C   . GLU B 1 100 ? 27.909  4.384   54.001  1.00 42.32  ? 96   GLU B C   1 
ATOM   4356  O O   . GLU B 1 100 ? 28.217  5.462   54.521  1.00 43.13  ? 96   GLU B O   1 
ATOM   4357  C CB  . GLU B 1 100 ? 26.297  4.292   52.063  1.00 40.76  ? 96   GLU B CB  1 
ATOM   4358  C CG  . GLU B 1 100 ? 25.506  5.496   52.564  1.00 42.16  ? 96   GLU B CG  1 
ATOM   4359  C CD  . GLU B 1 100 ? 25.893  6.789   51.870  1.00 42.45  ? 96   GLU B CD  1 
ATOM   4360  O OE1 . GLU B 1 100 ? 25.475  6.987   50.705  1.00 41.65  ? 96   GLU B OE1 1 
ATOM   4361  O OE2 . GLU B 1 100 ? 26.604  7.610   52.498  1.00 43.34  ? 96   GLU B OE2 1 
ATOM   4362  N N   . ARG B 1 101 ? 27.681  3.274   54.701  1.00 42.73  ? 97   ARG B N   1 
ATOM   4363  C CA  . ARG B 1 101 ? 27.782  3.232   56.156  1.00 44.16  ? 97   ARG B CA  1 
ATOM   4364  C C   . ARG B 1 101 ? 29.229  3.398   56.604  1.00 44.44  ? 97   ARG B C   1 
ATOM   4365  O O   . ARG B 1 101 ? 29.504  4.036   57.619  1.00 45.74  ? 97   ARG B O   1 
ATOM   4366  C CB  . ARG B 1 101 ? 27.207  1.918   56.691  1.00 44.61  ? 97   ARG B CB  1 
ATOM   4367  C CG  . ARG B 1 101 ? 27.278  1.755   58.212  1.00 45.84  ? 97   ARG B CG  1 
ATOM   4368  C CD  . ARG B 1 101 ? 27.194  0.291   58.613  1.00 45.29  ? 97   ARG B CD  1 
ATOM   4369  N NE  . ARG B 1 101 ? 28.288  -0.486  58.034  1.00 43.92  ? 97   ARG B NE  1 
ATOM   4370  C CZ  . ARG B 1 101 ? 28.328  -1.814  57.979  1.00 43.70  ? 97   ARG B CZ  1 
ATOM   4371  N NH1 . ARG B 1 101 ? 27.328  -2.537  58.468  1.00 44.18  ? 97   ARG B NH1 1 
ATOM   4372  N NH2 . ARG B 1 101 ? 29.374  -2.420  57.427  1.00 42.68  ? 97   ARG B NH2 1 
ATOM   4373  N N   . ASP B 1 102 ? 30.151  2.827   55.835  1.00 43.34  ? 98   ASP B N   1 
ATOM   4374  C CA  . ASP B 1 102 ? 31.563  2.855   56.195  1.00 43.60  ? 98   ASP B CA  1 
ATOM   4375  C C   . ASP B 1 102 ? 32.344  3.898   55.399  1.00 42.91  ? 98   ASP B C   1 
ATOM   4376  O O   . ASP B 1 102 ? 33.574  3.825   55.306  1.00 42.86  ? 98   ASP B O   1 
ATOM   4377  C CB  . ASP B 1 102 ? 32.180  1.458   56.047  1.00 43.09  ? 98   ASP B CB  1 
ATOM   4378  C CG  . ASP B 1 102 ? 31.511  0.421   56.944  1.00 44.26  ? 98   ASP B CG  1 
ATOM   4379  O OD1 . ASP B 1 102 ? 30.741  0.804   57.854  1.00 45.44  ? 98   ASP B OD1 1 
ATOM   4380  O OD2 . ASP B 1 102 ? 31.757  -0.785  56.736  1.00 44.05  ? 98   ASP B OD2 1 
ATOM   4381  N N   . ARG B 1 103 ? 31.622  4.878   54.853  1.00 42.61  ? 99   ARG B N   1 
ATOM   4382  C CA  . ARG B 1 103 ? 32.202  5.959   54.049  1.00 42.05  ? 99   ARG B CA  1 
ATOM   4383  C C   . ARG B 1 103 ? 33.308  6.709   54.785  1.00 42.95  ? 99   ARG B C   1 
ATOM   4384  O O   . ARG B 1 103 ? 34.281  7.144   54.176  1.00 42.44  ? 99   ARG B O   1 
ATOM   4385  C CB  . ARG B 1 103 ? 31.104  6.931   53.619  1.00 42.20  ? 99   ARG B CB  1 
ATOM   4386  C CG  . ARG B 1 103 ? 31.483  7.897   52.512  1.00 41.69  ? 99   ARG B CG  1 
ATOM   4387  C CD  . ARG B 1 103 ? 30.303  8.788   52.181  1.00 42.59  ? 99   ARG B CD  1 
ATOM   4388  N NE  . ARG B 1 103 ? 30.546  9.637   51.019  1.00 42.75  ? 99   ARG B NE  1 
ATOM   4389  C CZ  . ARG B 1 103 ? 29.609  10.357  50.405  1.00 43.35  ? 99   ARG B CZ  1 
ATOM   4390  N NH1 . ARG B 1 103 ? 28.352  10.342  50.836  1.00 43.99  ? 99   ARG B NH1 1 
ATOM   4391  N NH2 . ARG B 1 103 ? 29.928  11.095  49.350  1.00 43.26  ? 99   ARG B NH2 1 
ATOM   4392  N N   . ALA B 1 104 ? 33.149  6.851   56.098  1.00 44.52  ? 100  ALA B N   1 
ATOM   4393  C CA  . ALA B 1 104 ? 34.152  7.487   56.946  1.00 45.61  ? 100  ALA B CA  1 
ATOM   4394  C C   . ALA B 1 104 ? 35.482  6.733   56.901  1.00 45.16  ? 100  ALA B C   1 
ATOM   4395  O O   . ALA B 1 104 ? 36.516  7.315   56.575  1.00 44.96  ? 100  ALA B O   1 
ATOM   4396  C CB  . ALA B 1 104 ? 33.639  7.597   58.381  1.00 47.24  ? 100  ALA B CB  1 
ATOM   4397  N N   . VAL B 1 105 ? 35.442  5.435   57.202  1.00 45.14  ? 101  VAL B N   1 
ATOM   4398  C CA  . VAL B 1 105 ? 36.663  4.632   57.354  1.00 45.01  ? 101  VAL B CA  1 
ATOM   4399  C C   . VAL B 1 105 ? 37.336  4.305   56.019  1.00 43.50  ? 101  VAL B C   1 
ATOM   4400  O O   . VAL B 1 105 ? 38.565  4.265   55.936  1.00 43.40  ? 101  VAL B O   1 
ATOM   4401  C CB  . VAL B 1 105 ? 36.437  3.336   58.205  1.00 45.61  ? 101  VAL B CB  1 
ATOM   4402  C CG1 . VAL B 1 105 ? 35.839  3.675   59.572  1.00 47.34  ? 101  VAL B CG1 1 
ATOM   4403  C CG2 . VAL B 1 105 ? 35.548  2.335   57.478  1.00 44.81  ? 101  VAL B CG2 1 
ATOM   4404  N N   . LEU B 1 106 ? 36.528  4.079   54.983  1.00 42.46  ? 102  LEU B N   1 
ATOM   4405  C CA  . LEU B 1 106 ? 37.049  3.803   53.647  1.00 41.13  ? 102  LEU B CA  1 
ATOM   4406  C C   . LEU B 1 106 ? 37.810  5.002   53.092  1.00 41.16  ? 102  LEU B C   1 
ATOM   4407  O O   . LEU B 1 106 ? 38.933  4.852   52.616  1.00 40.83  ? 102  LEU B O   1 
ATOM   4408  C CB  . LEU B 1 106 ? 35.931  3.373   52.698  1.00 40.10  ? 102  LEU B CB  1 
ATOM   4409  C CG  . LEU B 1 106 ? 35.532  1.899   52.761  1.00 39.48  ? 102  LEU B CG  1 
ATOM   4410  C CD1 . LEU B 1 106 ? 34.072  1.736   52.420  1.00 39.06  ? 102  LEU B CD1 1 
ATOM   4411  C CD2 . LEU B 1 106 ? 36.401  1.049   51.843  1.00 38.31  ? 102  LEU B CD2 1 
ATOM   4412  N N   . ALA B 1 107 ? 37.206  6.187   53.178  1.00 41.80  ? 103  ALA B N   1 
ATOM   4413  C CA  . ALA B 1 107 ? 37.894  7.438   52.849  1.00 42.27  ? 103  ALA B CA  1 
ATOM   4414  C C   . ALA B 1 107 ? 39.194  7.615   53.640  1.00 43.25  ? 103  ALA B C   1 
ATOM   4415  O O   . ALA B 1 107 ? 40.197  8.066   53.086  1.00 43.16  ? 103  ALA B O   1 
ATOM   4416  C CB  . ALA B 1 107 ? 36.977  8.625   53.064  1.00 43.05  ? 103  ALA B CB  1 
ATOM   4417  N N   . THR B 1 108 ? 39.172  7.251   54.922  1.00 44.35  ? 104  THR B N   1 
ATOM   4418  C CA  . THR B 1 108 ? 40.364  7.305   55.771  1.00 45.47  ? 104  THR B CA  1 
ATOM   4419  C C   . THR B 1 108 ? 41.475  6.396   55.236  1.00 44.69  ? 104  THR B C   1 
ATOM   4420  O O   . THR B 1 108 ? 42.618  6.831   55.080  1.00 44.76  ? 104  THR B O   1 
ATOM   4421  C CB  . THR B 1 108 ? 40.036  6.943   57.240  1.00 46.82  ? 104  THR B CB  1 
ATOM   4422  O OG1 . THR B 1 108 ? 38.894  7.694   57.669  1.00 48.20  ? 104  THR B OG1 1 
ATOM   4423  C CG2 . THR B 1 108 ? 41.215  7.253   58.167  1.00 47.70  ? 104  THR B CG2 1 
ATOM   4424  N N   . MET B 1 109 ? 41.130  5.141   54.954  1.00 44.08  ? 105  MET B N   1 
ATOM   4425  C CA  . MET B 1 109 ? 42.067  4.195   54.358  1.00 43.41  ? 105  MET B CA  1 
ATOM   4426  C C   . MET B 1 109 ? 42.628  4.703   53.039  1.00 42.50  ? 105  MET B C   1 
ATOM   4427  O O   . MET B 1 109 ? 43.827  4.605   52.800  1.00 42.52  ? 105  MET B O   1 
ATOM   4428  C CB  . MET B 1 109 ? 41.401  2.845   54.134  1.00 42.93  ? 105  MET B CB  1 
ATOM   4429  C CG  . MET B 1 109 ? 41.801  1.788   55.133  1.00 44.20  ? 105  MET B CG  1 
ATOM   4430  S SD  . MET B 1 109 ? 40.966  0.234   54.780  1.00 45.10  ? 105  MET B SD  1 
ATOM   4431  C CE  . MET B 1 109 ? 39.338  0.580   55.442  1.00 45.49  ? 105  MET B CE  1 
ATOM   4432  N N   . GLU B 1 110 ? 41.757  5.245   52.190  1.00 41.89  ? 106  GLU B N   1 
ATOM   4433  C CA  . GLU B 1 110 ? 42.165  5.775   50.891  1.00 41.18  ? 106  GLU B CA  1 
ATOM   4434  C C   . GLU B 1 110 ? 43.144  6.940   51.060  1.00 41.65  ? 106  GLU B C   1 
ATOM   4435  O O   . GLU B 1 110 ? 44.088  7.085   50.283  1.00 41.27  ? 106  GLU B O   1 
ATOM   4436  C CB  . GLU B 1 110 ? 40.938  6.212   50.081  1.00 40.74  ? 106  GLU B CB  1 
ATOM   4437  C CG  . GLU B 1 110 ? 41.182  6.344   48.573  1.00 40.61  ? 106  GLU B CG  1 
ATOM   4438  C CD  . GLU B 1 110 ? 40.956  5.045   47.804  1.00 40.58  ? 106  GLU B CD  1 
ATOM   4439  O OE1 . GLU B 1 110 ? 41.037  3.956   48.417  1.00 40.29  ? 106  GLU B OE1 1 
ATOM   4440  O OE2 . GLU B 1 110 ? 40.692  5.119   46.578  1.00 40.51  ? 106  GLU B OE2 1 
ATOM   4441  N N   . SER B 1 111 ? 42.909  7.752   52.086  1.00 42.58  ? 107  SER B N   1 
ATOM   4442  C CA  . SER B 1 111 ? 43.748  8.900   52.400  1.00 43.39  ? 107  SER B CA  1 
ATOM   4443  C C   . SER B 1 111 ? 45.080  8.464   52.994  1.00 43.64  ? 107  SER B C   1 
ATOM   4444  O O   . SER B 1 111 ? 46.141  8.880   52.535  1.00 43.74  ? 107  SER B O   1 
ATOM   4445  C CB  . SER B 1 111 ? 43.016  9.826   53.377  1.00 44.66  ? 107  SER B CB  1 
ATOM   4446  O OG  . SER B 1 111 ? 43.784  10.980  53.671  1.00 45.95  ? 107  SER B OG  1 
ATOM   4447  N N   . LEU B 1 112 ? 45.004  7.619   54.018  1.00 43.91  ? 108  LEU B N   1 
ATOM   4448  C CA  . LEU B 1 112 ? 46.165  7.142   54.765  1.00 44.37  ? 108  LEU B CA  1 
ATOM   4449  C C   . LEU B 1 112 ? 47.104  6.319   53.880  1.00 43.28  ? 108  LEU B C   1 
ATOM   4450  O O   . LEU B 1 112 ? 48.323  6.491   53.919  1.00 43.60  ? 108  LEU B O   1 
ATOM   4451  C CB  . LEU B 1 112 ? 45.675  6.330   55.975  1.00 45.09  ? 108  LEU B CB  1 
ATOM   4452  C CG  . LEU B 1 112 ? 46.523  5.798   57.142  1.00 46.01  ? 108  LEU B CG  1 
ATOM   4453  C CD1 . LEU B 1 112 ? 46.945  4.370   56.871  1.00 45.52  ? 108  LEU B CD1 1 
ATOM   4454  C CD2 . LEU B 1 112 ? 47.722  6.661   57.494  1.00 46.91  ? 108  LEU B CD2 1 
ATOM   4455  N N   . ASN B 1 113 ? 46.513  5.449   53.067  1.00 42.08  ? 109  ASN B N   1 
ATOM   4456  C CA  . ASN B 1 113 ? 47.251  4.556   52.181  1.00 41.02  ? 109  ASN B CA  1 
ATOM   4457  C C   . ASN B 1 113 ? 47.651  5.209   50.858  1.00 40.37  ? 109  ASN B C   1 
ATOM   4458  O O   . ASN B 1 113 ? 48.781  5.044   50.405  1.00 40.33  ? 109  ASN B O   1 
ATOM   4459  C CB  . ASN B 1 113 ? 46.425  3.288   51.931  1.00 40.24  ? 109  ASN B CB  1 
ATOM   4460  C CG  . ASN B 1 113 ? 47.146  2.262   51.078  1.00 39.44  ? 109  ASN B CG  1 
ATOM   4461  O OD1 . ASN B 1 113 ? 46.397  1.276   50.607  1.00 38.39  ? 109  ASN B OD1 1 
ATOM   4462  N ND2 . ASN B 1 113 ? 48.353  2.344   50.851  1.00 39.74  ? 109  ASN B ND2 1 
ATOM   4463  N N   . GLY B 1 114 ? 46.730  5.948   50.248  1.00 40.01  ? 110  GLY B N   1 
ATOM   4464  C CA  . GLY B 1 114 ? 46.938  6.491   48.905  1.00 39.42  ? 110  GLY B CA  1 
ATOM   4465  C C   . GLY B 1 114 ? 47.468  7.911   48.819  1.00 40.05  ? 110  GLY B C   1 
ATOM   4466  O O   . GLY B 1 114 ? 47.914  8.339   47.754  1.00 39.85  ? 110  GLY B O   1 
ATOM   4467  N N   . GLY B 1 115 ? 47.407  8.646   49.927  1.00 40.93  ? 111  GLY B N   1 
ATOM   4468  C CA  . GLY B 1 115 ? 47.928  10.012  49.986  1.00 41.84  ? 111  GLY B CA  1 
ATOM   4469  C C   . GLY B 1 115 ? 46.903  11.101  49.737  1.00 42.14  ? 111  GLY B C   1 
ATOM   4470  O O   . GLY B 1 115 ? 47.107  12.253  50.126  1.00 43.22  ? 111  GLY B O   1 
ATOM   4471  N N   . LYS B 1 116 ? 45.801  10.732  49.092  1.00 41.28  ? 112  LYS B N   1 
ATOM   4472  C CA  . LYS B 1 116 ? 44.757  11.678  48.713  1.00 41.62  ? 112  LYS B CA  1 
ATOM   4473  C C   . LYS B 1 116 ? 44.099  12.312  49.943  1.00 42.61  ? 112  LYS B C   1 
ATOM   4474  O O   . LYS B 1 116 ? 43.659  11.594  50.835  1.00 42.64  ? 112  LYS B O   1 
ATOM   4475  C CB  . LYS B 1 116 ? 43.711  10.965  47.856  1.00 40.55  ? 112  LYS B CB  1 
ATOM   4476  C CG  . LYS B 1 116 ? 42.765  11.899  47.145  1.00 41.21  ? 112  LYS B CG  1 
ATOM   4477  C CD  . LYS B 1 116 ? 41.981  11.186  46.064  1.00 40.75  ? 112  LYS B CD  1 
ATOM   4478  C CE  . LYS B 1 116 ? 41.205  12.200  45.249  1.00 41.37  ? 112  LYS B CE  1 
ATOM   4479  N NZ  . LYS B 1 116 ? 40.676  11.594  44.011  1.00 41.01  ? 112  LYS B NZ  1 
ATOM   4480  N N   . PRO B 1 117 ? 44.030  13.661  49.993  1.00 43.61  ? 113  PRO B N   1 
ATOM   4481  C CA  . PRO B 1 117 ? 43.449  14.361  51.148  1.00 44.82  ? 113  PRO B CA  1 
ATOM   4482  C C   . PRO B 1 117 ? 42.064  13.824  51.520  1.00 44.45  ? 113  PRO B C   1 
ATOM   4483  O O   . PRO B 1 117 ? 41.287  13.454  50.634  1.00 43.39  ? 113  PRO B O   1 
ATOM   4484  C CB  . PRO B 1 117 ? 43.361  15.822  50.680  1.00 45.73  ? 113  PRO B CB  1 
ATOM   4485  C CG  . PRO B 1 117 ? 43.633  15.799  49.212  1.00 44.82  ? 113  PRO B CG  1 
ATOM   4486  C CD  . PRO B 1 117 ? 44.478  14.605  48.957  1.00 43.86  ? 113  PRO B CD  1 
ATOM   4487  N N   . PHE B 1 118 ? 41.772  13.783  52.820  1.00 45.35  ? 114  PHE B N   1 
ATOM   4488  C CA  . PHE B 1 118 ? 40.589  13.084  53.330  1.00 45.00  ? 114  PHE B CA  1 
ATOM   4489  C C   . PHE B 1 118 ? 39.256  13.557  52.754  1.00 44.69  ? 114  PHE B C   1 
ATOM   4490  O O   . PHE B 1 118 ? 38.450  12.729  52.327  1.00 43.68  ? 114  PHE B O   1 
ATOM   4491  C CB  . PHE B 1 118 ? 40.531  13.101  54.864  1.00 46.39  ? 114  PHE B CB  1 
ATOM   4492  C CG  . PHE B 1 118 ? 39.313  12.413  55.422  1.00 46.35  ? 114  PHE B CG  1 
ATOM   4493  C CD1 . PHE B 1 118 ? 39.283  11.026  55.558  1.00 45.50  ? 114  PHE B CD1 1 
ATOM   4494  C CD2 . PHE B 1 118 ? 38.185  13.146  55.781  1.00 47.18  ? 114  PHE B CD2 1 
ATOM   4495  C CE1 . PHE B 1 118 ? 38.157  10.384  56.054  1.00 45.51  ? 114  PHE B CE1 1 
ATOM   4496  C CE2 . PHE B 1 118 ? 37.052  12.514  56.282  1.00 47.32  ? 114  PHE B CE2 1 
ATOM   4497  C CZ  . PHE B 1 118 ? 37.037  11.130  56.419  1.00 46.63  ? 114  PHE B CZ  1 
ATOM   4498  N N   . LEU B 1 119 ? 39.022  14.870  52.758  1.00 45.66  ? 115  LEU B N   1 
ATOM   4499  C CA  . LEU B 1 119 ? 37.739  15.427  52.309  1.00 45.69  ? 115  LEU B CA  1 
ATOM   4500  C C   . LEU B 1 119 ? 37.437  15.119  50.840  1.00 44.31  ? 115  LEU B C   1 
ATOM   4501  O O   . LEU B 1 119 ? 36.294  14.817  50.487  1.00 43.65  ? 115  LEU B O   1 
ATOM   4502  C CB  . LEU B 1 119 ? 37.658  16.937  52.573  1.00 47.30  ? 115  LEU B CB  1 
ATOM   4503  C CG  . LEU B 1 119 ? 37.542  17.465  54.014  1.00 49.09  ? 115  LEU B CG  1 
ATOM   4504  C CD1 . LEU B 1 119 ? 37.445  18.987  54.014  1.00 50.42  ? 115  LEU B CD1 1 
ATOM   4505  C CD2 . LEU B 1 119 ? 36.362  16.862  54.776  1.00 49.01  ? 115  LEU B CD2 1 
ATOM   4506  N N   . GLN B 1 120 ? 38.470  15.191  50.000  1.00 43.92  ? 116  GLN B N   1 
ATOM   4507  C CA  . GLN B 1 120 ? 38.362  14.858  48.579  1.00 42.65  ? 116  GLN B CA  1 
ATOM   4508  C C   . GLN B 1 120 ? 38.056  13.378  48.365  1.00 41.35  ? 116  GLN B C   1 
ATOM   4509  O O   . GLN B 1 120 ? 37.301  13.026  47.461  1.00 40.64  ? 116  GLN B O   1 
ATOM   4510  C CB  . GLN B 1 120 ? 39.650  15.222  47.836  1.00 42.68  ? 116  GLN B CB  1 
ATOM   4511  C CG  . GLN B 1 120 ? 39.860  16.708  47.578  1.00 43.95  ? 116  GLN B CG  1 
ATOM   4512  C CD  . GLN B 1 120 ? 41.229  16.996  46.985  1.00 44.58  ? 116  GLN B CD  1 
ATOM   4513  O OE1 . GLN B 1 120 ? 41.752  16.211  46.192  1.00 44.05  ? 116  GLN B OE1 1 
ATOM   4514  N NE2 . GLN B 1 120 ? 41.822  18.121  47.375  1.00 45.74  ? 116  GLN B NE2 1 
ATOM   4515  N N   . ALA B 1 121 ? 38.649  12.515  49.188  1.00 41.24  ? 117  ALA B N   1 
ATOM   4516  C CA  . ALA B 1 121 ? 38.394  11.075  49.108  1.00 40.18  ? 117  ALA B CA  1 
ATOM   4517  C C   . ALA B 1 121 ? 36.998  10.724  49.626  1.00 40.18  ? 117  ALA B C   1 
ATOM   4518  O O   . ALA B 1 121 ? 36.408  9.723   49.219  1.00 39.30  ? 117  ALA B O   1 
ATOM   4519  C CB  . ALA B 1 121 ? 39.461  10.295  49.865  1.00 40.27  ? 117  ALA B CB  1 
ATOM   4520  N N   . PHE B 1 122 ? 36.479  11.557  50.522  1.00 41.28  ? 118  PHE B N   1 
ATOM   4521  C CA  . PHE B 1 122 ? 35.142  11.371  51.066  1.00 41.57  ? 118  PHE B CA  1 
ATOM   4522  C C   . PHE B 1 122 ? 34.085  11.843  50.066  1.00 41.23  ? 118  PHE B C   1 
ATOM   4523  O O   . PHE B 1 122 ? 33.222  11.069  49.645  1.00 40.37  ? 118  PHE B O   1 
ATOM   4524  C CB  . PHE B 1 122 ? 35.005  12.123  52.397  1.00 43.08  ? 118  PHE B CB  1 
ATOM   4525  C CG  . PHE B 1 122 ? 33.735  11.822  53.144  1.00 43.16  ? 118  PHE B CG  1 
ATOM   4526  C CD1 . PHE B 1 122 ? 33.663  10.737  54.007  1.00 42.91  ? 118  PHE B CD1 1 
ATOM   4527  C CD2 . PHE B 1 122 ? 32.615  12.631  52.995  1.00 43.30  ? 118  PHE B CD2 1 
ATOM   4528  C CE1 . PHE B 1 122 ? 32.491  10.460  54.705  1.00 43.49  ? 118  PHE B CE1 1 
ATOM   4529  C CE2 . PHE B 1 122 ? 31.441  12.360  53.689  1.00 43.75  ? 118  PHE B CE2 1 
ATOM   4530  C CZ  . PHE B 1 122 ? 31.379  11.275  54.546  1.00 43.72  ? 118  PHE B CZ  1 
ATOM   4531  N N   . TYR B 1 123 ? 34.175  13.115  49.687  1.00 41.98  ? 119  TYR B N   1 
ATOM   4532  C CA  . TYR B 1 123 ? 33.158  13.757  48.864  1.00 41.99  ? 119  TYR B CA  1 
ATOM   4533  C C   . TYR B 1 123 ? 33.275  13.465  47.370  1.00 40.78  ? 119  TYR B C   1 
ATOM   4534  O O   . TYR B 1 123 ? 32.294  13.616  46.639  1.00 40.49  ? 119  TYR B O   1 
ATOM   4535  C CB  . TYR B 1 123 ? 33.145  15.268  49.105  1.00 43.48  ? 119  TYR B CB  1 
ATOM   4536  C CG  . TYR B 1 123 ? 32.466  15.681  50.392  1.00 45.25  ? 119  TYR B CG  1 
ATOM   4537  C CD1 . TYR B 1 123 ? 31.084  15.552  50.548  1.00 45.79  ? 119  TYR B CD1 1 
ATOM   4538  C CD2 . TYR B 1 123 ? 33.201  16.218  51.449  1.00 46.86  ? 119  TYR B CD2 1 
ATOM   4539  C CE1 . TYR B 1 123 ? 30.451  15.937  51.730  1.00 47.29  ? 119  TYR B CE1 1 
ATOM   4540  C CE2 . TYR B 1 123 ? 32.578  16.607  52.636  1.00 48.47  ? 119  TYR B CE2 1 
ATOM   4541  C CZ  . TYR B 1 123 ? 31.205  16.462  52.766  1.00 48.67  ? 119  TYR B CZ  1 
ATOM   4542  O OH  . TYR B 1 123 ? 30.582  16.842  53.931  1.00 50.58  ? 119  TYR B OH  1 
ATOM   4543  N N   . VAL B 1 124 ? 34.457  13.056  46.914  1.00 40.19  ? 120  VAL B N   1 
ATOM   4544  C CA  . VAL B 1 124 ? 34.654  12.777  45.490  1.00 39.26  ? 120  VAL B CA  1 
ATOM   4545  C C   . VAL B 1 124 ? 34.786  11.274  45.231  1.00 38.23  ? 120  VAL B C   1 
ATOM   4546  O O   . VAL B 1 124 ? 33.904  10.667  44.613  1.00 37.41  ? 120  VAL B O   1 
ATOM   4547  C CB  . VAL B 1 124 ? 35.864  13.562  44.882  1.00 39.59  ? 120  VAL B CB  1 
ATOM   4548  C CG1 . VAL B 1 124 ? 35.979  13.311  43.383  1.00 38.75  ? 120  VAL B CG1 1 
ATOM   4549  C CG2 . VAL B 1 124 ? 35.745  15.055  45.153  1.00 40.86  ? 120  VAL B CG2 1 
ATOM   4550  N N   . ASP B 1 125 ? 35.878  10.684  45.721  1.00 38.30  ? 121  ASP B N   1 
ATOM   4551  C CA  . ASP B 1 125 ? 36.219  9.289   45.434  1.00 37.45  ? 121  ASP B CA  1 
ATOM   4552  C C   . ASP B 1 125 ? 35.110  8.321   45.813  1.00 37.11  ? 121  ASP B C   1 
ATOM   4553  O O   . ASP B 1 125 ? 34.640  7.555   44.969  1.00 36.40  ? 121  ASP B O   1 
ATOM   4554  C CB  . ASP B 1 125 ? 37.530  8.891   46.120  1.00 37.72  ? 121  ASP B CB  1 
ATOM   4555  C CG  . ASP B 1 125 ? 38.754  9.222   45.283  1.00 38.13  ? 121  ASP B CG  1 
ATOM   4556  O OD1 . ASP B 1 125 ? 38.716  10.221  44.537  1.00 38.66  ? 121  ASP B OD1 1 
ATOM   4557  O OD2 . ASP B 1 125 ? 39.757  8.479   45.367  1.00 38.78  ? 121  ASP B OD2 1 
ATOM   4558  N N   . LEU B 1 126 ? 34.689  8.374   47.075  1.00 37.78  ? 122  LEU B N   1 
ATOM   4559  C CA  . LEU B 1 126 ? 33.679  7.457   47.592  1.00 37.50  ? 122  LEU B CA  1 
ATOM   4560  C C   . LEU B 1 126 ? 32.277  7.763   47.108  1.00 37.38  ? 122  LEU B C   1 
ATOM   4561  O O   . LEU B 1 126 ? 31.461  6.848   46.971  1.00 37.07  ? 122  LEU B O   1 
ATOM   4562  C CB  . LEU B 1 126 ? 33.719  7.372   49.115  1.00 38.42  ? 122  LEU B CB  1 
ATOM   4563  C CG  . LEU B 1 126 ? 34.471  6.131   49.590  1.00 38.14  ? 122  LEU B CG  1 
ATOM   4564  C CD1 . LEU B 1 126 ? 35.882  6.486   50.025  1.00 38.50  ? 122  LEU B CD1 1 
ATOM   4565  C CD2 . LEU B 1 126 ? 33.713  5.470   50.718  1.00 38.73  ? 122  LEU B CD2 1 
ATOM   4566  N N   . GLN B 1 127 ? 31.993  9.036   46.844  1.00 37.82  ? 123  GLN B N   1 
ATOM   4567  C CA  . GLN B 1 127 ? 30.748  9.391   46.168  1.00 37.74  ? 123  GLN B CA  1 
ATOM   4568  C C   . GLN B 1 127 ? 30.672  8.613   44.858  1.00 36.61  ? 123  GLN B C   1 
ATOM   4569  O O   . GLN B 1 127 ? 29.651  8.007   44.556  1.00 36.22  ? 123  GLN B O   1 
ATOM   4570  C CB  . GLN B 1 127 ? 30.653  10.893  45.911  1.00 38.45  ? 123  GLN B CB  1 
ATOM   4571  C CG  . GLN B 1 127 ? 29.366  11.305  45.213  1.00 38.81  ? 123  GLN B CG  1 
ATOM   4572  C CD  . GLN B 1 127 ? 29.014  12.765  45.422  1.00 40.70  ? 123  GLN B CD  1 
ATOM   4573  O OE1 . GLN B 1 127 ? 29.038  13.271  46.547  1.00 42.06  ? 123  GLN B OE1 1 
ATOM   4574  N NE2 . GLN B 1 127 ? 28.666  13.447  44.336  1.00 40.55  ? 123  GLN B NE2 1 
ATOM   4575  N N   . GLY B 1 128 ? 31.775  8.612   44.112  1.00 36.23  ? 124  GLY B N   1 
ATOM   4576  C CA  . GLY B 1 128 ? 31.891  7.854   42.872  1.00 35.24  ? 124  GLY B CA  1 
ATOM   4577  C C   . GLY B 1 128 ? 31.817  6.351   43.066  1.00 34.73  ? 124  GLY B C   1 
ATOM   4578  O O   . GLY B 1 128 ? 31.362  5.637   42.173  1.00 34.19  ? 124  GLY B O   1 
ATOM   4579  N N   . VAL B 1 129 ? 32.263  5.872   44.227  1.00 35.05  ? 125  VAL B N   1 
ATOM   4580  C CA  . VAL B 1 129 ? 32.212  4.441   44.558  1.00 34.83  ? 125  VAL B CA  1 
ATOM   4581  C C   . VAL B 1 129 ? 30.768  4.013   44.812  1.00 34.98  ? 125  VAL B C   1 
ATOM   4582  O O   . VAL B 1 129 ? 30.263  3.090   44.169  1.00 34.37  ? 125  VAL B O   1 
ATOM   4583  C CB  . VAL B 1 129 ? 33.101  4.095   45.785  1.00 35.30  ? 125  VAL B CB  1 
ATOM   4584  C CG1 . VAL B 1 129 ? 32.898  2.648   46.222  1.00 35.18  ? 125  VAL B CG1 1 
ATOM   4585  C CG2 . VAL B 1 129 ? 34.573  4.353   45.479  1.00 35.25  ? 125  VAL B CG2 1 
ATOM   4586  N N   . ILE B 1 130 ? 30.115  4.705   45.744  1.00 35.84  ? 126  ILE B N   1 
ATOM   4587  C CA  . ILE B 1 130 ? 28.718  4.446   46.091  1.00 36.27  ? 126  ILE B CA  1 
ATOM   4588  C C   . ILE B 1 130 ? 27.805  4.550   44.861  1.00 35.94  ? 126  ILE B C   1 
ATOM   4589  O O   . ILE B 1 130 ? 27.009  3.646   44.602  1.00 35.78  ? 126  ILE B O   1 
ATOM   4590  C CB  . ILE B 1 130 ? 28.230  5.384   47.232  1.00 37.16  ? 126  ILE B CB  1 
ATOM   4591  C CG1 . ILE B 1 130 ? 29.000  5.092   48.525  1.00 37.77  ? 126  ILE B CG1 1 
ATOM   4592  C CG2 . ILE B 1 130 ? 26.728  5.227   47.467  1.00 37.43  ? 126  ILE B CG2 1 
ATOM   4593  C CD1 . ILE B 1 130 ? 29.044  6.250   49.509  1.00 38.46  ? 126  ILE B CD1 1 
ATOM   4594  N N   . LYS B 1 131 ? 27.945  5.639   44.104  1.00 36.06  ? 127  LYS B N   1 
ATOM   4595  C CA  . LYS B 1 131 ? 27.139  5.873   42.900  1.00 35.86  ? 127  LYS B CA  1 
ATOM   4596  C C   . LYS B 1 131 ? 27.282  4.759   41.855  1.00 35.32  ? 127  LYS B C   1 
ATOM   4597  O O   . LYS B 1 131 ? 26.286  4.347   41.256  1.00 35.19  ? 127  LYS B O   1 
ATOM   4598  C CB  . LYS B 1 131 ? 27.476  7.228   42.265  1.00 36.00  ? 127  LYS B CB  1 
ATOM   4599  C CG  . LYS B 1 131 ? 27.070  8.447   43.080  1.00 36.93  ? 127  LYS B CG  1 
ATOM   4600  C CD  . LYS B 1 131 ? 25.677  8.933   42.730  1.00 37.97  ? 127  LYS B CD  1 
ATOM   4601  C CE  . LYS B 1 131 ? 25.352  10.233  43.443  1.00 39.22  ? 127  LYS B CE  1 
ATOM   4602  N NZ  . LYS B 1 131 ? 26.272  11.332  43.039  1.00 40.07  ? 127  LYS B NZ  1 
ATOM   4603  N N   . THR B 1 132 ? 28.507  4.274   41.645  1.00 35.14  ? 128  THR B N   1 
ATOM   4604  C CA  . THR B 1 132 ? 28.758  3.254   40.618  1.00 34.95  ? 128  THR B CA  1 
ATOM   4605  C C   . THR B 1 132 ? 28.045  1.936   40.911  1.00 34.89  ? 128  THR B C   1 
ATOM   4606  O O   . THR B 1 132 ? 27.328  1.415   40.047  1.00 34.79  ? 128  THR B O   1 
ATOM   4607  C CB  . THR B 1 132 ? 30.267  3.011   40.353  1.00 34.80  ? 128  THR B CB  1 
ATOM   4608  O OG1 . THR B 1 132 ? 30.977  2.985   41.594  1.00 35.94  ? 128  THR B OG1 1 
ATOM   4609  C CG2 . THR B 1 132 ? 30.839  4.114   39.485  1.00 34.93  ? 128  THR B CG2 1 
ATOM   4610  N N   . PHE B 1 133 ? 28.230  1.408   42.122  1.00 35.17  ? 129  PHE B N   1 
ATOM   4611  C CA  . PHE B 1 133 ? 27.512  0.204   42.560  1.00 35.27  ? 129  PHE B CA  1 
ATOM   4612  C C   . PHE B 1 133 ? 26.002  0.390   42.461  1.00 35.41  ? 129  PHE B C   1 
ATOM   4613  O O   . PHE B 1 133 ? 25.287  -0.534  42.078  1.00 35.42  ? 129  PHE B O   1 
ATOM   4614  C CB  . PHE B 1 133 ? 27.882  -0.178  43.995  1.00 35.80  ? 129  PHE B CB  1 
ATOM   4615  C CG  . PHE B 1 133 ? 29.263  -0.753  44.139  1.00 35.61  ? 129  PHE B CG  1 
ATOM   4616  C CD1 . PHE B 1 133 ? 30.237  -0.072  44.860  1.00 35.46  ? 129  PHE B CD1 1 
ATOM   4617  C CD2 . PHE B 1 133 ? 29.586  -1.978  43.569  1.00 35.32  ? 129  PHE B CD2 1 
ATOM   4618  C CE1 . PHE B 1 133 ? 31.509  -0.597  45.005  1.00 35.27  ? 129  PHE B CE1 1 
ATOM   4619  C CE2 . PHE B 1 133 ? 30.863  -2.509  43.706  1.00 35.40  ? 129  PHE B CE2 1 
ATOM   4620  C CZ  . PHE B 1 133 ? 31.824  -1.817  44.427  1.00 35.32  ? 129  PHE B CZ  1 
ATOM   4621  N N   . ARG B 1 134 ? 25.529  1.588   42.806  1.00 35.73  ? 130  ARG B N   1 
ATOM   4622  C CA  . ARG B 1 134 ? 24.110  1.931   42.704  1.00 35.97  ? 130  ARG B CA  1 
ATOM   4623  C C   . ARG B 1 134 ? 23.666  1.898   41.246  1.00 35.42  ? 130  ARG B C   1 
ATOM   4624  O O   . ARG B 1 134 ? 22.614  1.347   40.922  1.00 35.36  ? 130  ARG B O   1 
ATOM   4625  C CB  . ARG B 1 134 ? 23.837  3.312   43.315  1.00 36.43  ? 130  ARG B CB  1 
ATOM   4626  C CG  . ARG B 1 134 ? 23.923  3.363   44.840  1.00 37.44  ? 130  ARG B CG  1 
ATOM   4627  C CD  . ARG B 1 134 ? 22.557  3.290   45.497  1.00 38.17  ? 130  ARG B CD  1 
ATOM   4628  N NE  . ARG B 1 134 ? 22.617  2.824   46.886  1.00 39.30  ? 130  ARG B NE  1 
ATOM   4629  C CZ  . ARG B 1 134 ? 22.920  3.587   47.936  1.00 40.16  ? 130  ARG B CZ  1 
ATOM   4630  N NH1 . ARG B 1 134 ? 23.216  4.872   47.779  1.00 40.33  ? 130  ARG B NH1 1 
ATOM   4631  N NH2 . ARG B 1 134 ? 22.935  3.058   49.151  1.00 40.83  ? 130  ARG B NH2 1 
ATOM   4632  N N   . TYR B 1 135 ? 24.493  2.471   40.377  1.00 35.07  ? 131  TYR B N   1 
ATOM   4633  C CA  . TYR B 1 135 ? 24.205  2.532   38.952  1.00 34.74  ? 131  TYR B CA  1 
ATOM   4634  C C   . TYR B 1 135 ? 24.093  1.142   38.324  1.00 34.48  ? 131  TYR B C   1 
ATOM   4635  O O   . TYR B 1 135 ? 23.128  0.854   37.620  1.00 34.38  ? 131  TYR B O   1 
ATOM   4636  C CB  . TYR B 1 135 ? 25.263  3.372   38.222  1.00 34.70  ? 131  TYR B CB  1 
ATOM   4637  C CG  . TYR B 1 135 ? 24.997  3.515   36.741  1.00 34.59  ? 131  TYR B CG  1 
ATOM   4638  C CD1 . TYR B 1 135 ? 24.047  4.417   36.273  1.00 34.72  ? 131  TYR B CD1 1 
ATOM   4639  C CD2 . TYR B 1 135 ? 25.685  2.739   35.810  1.00 34.46  ? 131  TYR B CD2 1 
ATOM   4640  C CE1 . TYR B 1 135 ? 23.788  4.546   34.917  1.00 35.02  ? 131  TYR B CE1 1 
ATOM   4641  C CE2 . TYR B 1 135 ? 25.435  2.863   34.453  1.00 34.67  ? 131  TYR B CE2 1 
ATOM   4642  C CZ  . TYR B 1 135 ? 24.483  3.767   34.013  1.00 34.85  ? 131  TYR B CZ  1 
ATOM   4643  O OH  . TYR B 1 135 ? 24.221  3.898   32.671  1.00 35.04  ? 131  TYR B OH  1 
ATOM   4644  N N   . TYR B 1 136 ? 25.079  0.287   38.581  1.00 34.45  ? 132  TYR B N   1 
ATOM   4645  C CA  . TYR B 1 136 ? 25.113  -1.036  37.960  1.00 34.34  ? 132  TYR B CA  1 
ATOM   4646  C C   . TYR B 1 136 ? 24.141  -2.009  38.602  1.00 34.56  ? 132  TYR B C   1 
ATOM   4647  O O   . TYR B 1 136 ? 23.659  -2.929  37.938  1.00 34.79  ? 132  TYR B O   1 
ATOM   4648  C CB  . TYR B 1 136 ? 26.534  -1.597  37.927  1.00 34.32  ? 132  TYR B CB  1 
ATOM   4649  C CG  . TYR B 1 136 ? 27.383  -0.949  36.861  1.00 34.36  ? 132  TYR B CG  1 
ATOM   4650  C CD1 . TYR B 1 136 ? 27.352  -1.408  35.546  1.00 34.45  ? 132  TYR B CD1 1 
ATOM   4651  C CD2 . TYR B 1 136 ? 28.203  0.139   37.163  1.00 34.61  ? 132  TYR B CD2 1 
ATOM   4652  C CE1 . TYR B 1 136 ? 28.124  -0.808  34.561  1.00 34.65  ? 132  TYR B CE1 1 
ATOM   4653  C CE2 . TYR B 1 136 ? 28.981  0.742   36.187  1.00 34.53  ? 132  TYR B CE2 1 
ATOM   4654  C CZ  . TYR B 1 136 ? 28.935  0.266   34.889  1.00 34.67  ? 132  TYR B CZ  1 
ATOM   4655  O OH  . TYR B 1 136 ? 29.702  0.865   33.917  1.00 35.47  ? 132  TYR B OH  1 
ATOM   4656  N N   . ALA B 1 137 ? 23.845  -1.798  39.882  1.00 34.69  ? 133  ALA B N   1 
ATOM   4657  C CA  . ALA B 1 137 ? 22.764  -2.522  40.546  1.00 35.09  ? 133  ALA B CA  1 
ATOM   4658  C C   . ALA B 1 137 ? 21.480  -2.408  39.720  1.00 34.96  ? 133  ALA B C   1 
ATOM   4659  O O   . ALA B 1 137 ? 20.695  -3.349  39.647  1.00 35.34  ? 133  ALA B O   1 
ATOM   4660  C CB  . ALA B 1 137 ? 22.543  -1.981  41.949  1.00 35.50  ? 133  ALA B CB  1 
ATOM   4661  N N   . GLY B 1 138 ? 21.295  -1.250  39.087  1.00 34.54  ? 134  GLY B N   1 
ATOM   4662  C CA  . GLY B 1 138 ? 20.133  -0.976  38.257  1.00 34.29  ? 134  GLY B CA  1 
ATOM   4663  C C   . GLY B 1 138 ? 20.185  -1.619  36.887  1.00 34.08  ? 134  GLY B C   1 
ATOM   4664  O O   . GLY B 1 138 ? 19.143  -1.903  36.297  1.00 34.24  ? 134  GLY B O   1 
ATOM   4665  N N   . TRP B 1 139 ? 21.393  -1.848  36.378  1.00 33.86  ? 135  TRP B N   1 
ATOM   4666  C CA  . TRP B 1 139 ? 21.562  -2.436  35.048  1.00 33.83  ? 135  TRP B CA  1 
ATOM   4667  C C   . TRP B 1 139 ? 21.312  -3.939  35.003  1.00 34.20  ? 135  TRP B C   1 
ATOM   4668  O O   . TRP B 1 139 ? 20.845  -4.451  33.988  1.00 34.52  ? 135  TRP B O   1 
ATOM   4669  C CB  . TRP B 1 139 ? 22.949  -2.134  34.471  1.00 33.58  ? 135  TRP B CB  1 
ATOM   4670  C CG  . TRP B 1 139 ? 23.008  -0.952  33.539  1.00 33.51  ? 135  TRP B CG  1 
ATOM   4671  C CD1 . TRP B 1 139 ? 23.828  0.133   33.650  1.00 33.23  ? 135  TRP B CD1 1 
ATOM   4672  C CD2 . TRP B 1 139 ? 22.231  -0.746  32.345  1.00 33.72  ? 135  TRP B CD2 1 
ATOM   4673  N NE1 . TRP B 1 139 ? 23.607  1.006   32.610  1.00 33.18  ? 135  TRP B NE1 1 
ATOM   4674  C CE2 . TRP B 1 139 ? 22.631  0.492   31.796  1.00 33.49  ? 135  TRP B CE2 1 
ATOM   4675  C CE3 . TRP B 1 139 ? 21.229  -1.483  31.693  1.00 33.83  ? 135  TRP B CE3 1 
ATOM   4676  C CZ2 . TRP B 1 139 ? 22.066  1.011   30.624  1.00 33.44  ? 135  TRP B CZ2 1 
ATOM   4677  C CZ3 . TRP B 1 139 ? 20.669  -0.965  30.528  1.00 33.76  ? 135  TRP B CZ3 1 
ATOM   4678  C CH2 . TRP B 1 139 ? 21.091  0.269   30.007  1.00 33.63  ? 135  TRP B CH2 1 
ATOM   4679  N N   . ALA B 1 140 ? 21.622  -4.634  36.097  1.00 34.38  ? 136  ALA B N   1 
ATOM   4680  C CA  . ALA B 1 140 ? 21.591  -6.103  36.146  1.00 34.88  ? 136  ALA B CA  1 
ATOM   4681  C C   . ALA B 1 140 ? 20.489  -6.765  35.303  1.00 35.25  ? 136  ALA B C   1 
ATOM   4682  O O   . ALA B 1 140 ? 20.781  -7.482  34.346  1.00 35.52  ? 136  ALA B O   1 
ATOM   4683  C CB  . ALA B 1 140 ? 21.531  -6.586  37.586  1.00 35.22  ? 136  ALA B CB  1 
ATOM   4684  N N   . ASP B 1 141 ? 19.231  -6.506  35.645  1.00 35.35  ? 137  ASP B N   1 
ATOM   4685  C CA  . ASP B 1 141 ? 18.102  -7.154  34.968  1.00 35.85  ? 137  ASP B CA  1 
ATOM   4686  C C   . ASP B 1 141 ? 17.586  -6.387  33.741  1.00 35.51  ? 137  ASP B C   1 
ATOM   4687  O O   . ASP B 1 141 ? 16.457  -6.603  33.286  1.00 35.84  ? 137  ASP B O   1 
ATOM   4688  C CB  . ASP B 1 141 ? 16.964  -7.433  35.965  1.00 36.33  ? 137  ASP B CB  1 
ATOM   4689  C CG  . ASP B 1 141 ? 16.540  -6.193  36.756  1.00 36.16  ? 137  ASP B CG  1 
ATOM   4690  O OD1 . ASP B 1 141 ? 17.173  -5.119  36.614  1.00 35.95  ? 137  ASP B OD1 1 
ATOM   4691  O OD2 . ASP B 1 141 ? 15.564  -6.301  37.531  1.00 36.28  ? 137  ASP B OD2 1 
ATOM   4692  N N   . LYS B 1 142 ? 18.425  -5.506  33.205  1.00 35.05  ? 138  LYS B N   1 
ATOM   4693  C CA  . LYS B 1 142 ? 18.054  -4.657  32.071  1.00 34.87  ? 138  LYS B CA  1 
ATOM   4694  C C   . LYS B 1 142 ? 19.041  -4.779  30.909  1.00 35.00  ? 138  LYS B C   1 
ATOM   4695  O O   . LYS B 1 142 ? 19.086  -3.926  30.023  1.00 34.97  ? 138  LYS B O   1 
ATOM   4696  C CB  . LYS B 1 142 ? 17.927  -3.204  32.526  1.00 34.38  ? 138  LYS B CB  1 
ATOM   4697  C CG  . LYS B 1 142 ? 16.750  -2.963  33.443  1.00 34.47  ? 138  LYS B CG  1 
ATOM   4698  C CD  . LYS B 1 142 ? 16.823  -1.607  34.107  1.00 34.21  ? 138  LYS B CD  1 
ATOM   4699  C CE  . LYS B 1 142 ? 15.855  -1.528  35.273  1.00 34.53  ? 138  LYS B CE  1 
ATOM   4700  N NZ  . LYS B 1 142 ? 16.147  -2.542  36.331  1.00 34.79  ? 138  LYS B NZ  1 
ATOM   4701  N N   . ILE B 1 143 ? 19.836  -5.843  30.929  1.00 35.42  ? 139  ILE B N   1 
ATOM   4702  C CA  . ILE B 1 143 ? 20.690  -6.200  29.805  1.00 35.74  ? 139  ILE B CA  1 
ATOM   4703  C C   . ILE B 1 143 ? 19.845  -7.029  28.831  1.00 36.52  ? 139  ILE B C   1 
ATOM   4704  O O   . ILE B 1 143 ? 19.642  -8.231  29.042  1.00 37.07  ? 139  ILE B O   1 
ATOM   4705  C CB  . ILE B 1 143 ? 21.924  -7.009  30.276  1.00 35.91  ? 139  ILE B CB  1 
ATOM   4706  C CG1 . ILE B 1 143 ? 22.652  -6.268  31.398  1.00 35.17  ? 139  ILE B CG1 1 
ATOM   4707  C CG2 . ILE B 1 143 ? 22.873  -7.298  29.108  1.00 36.46  ? 139  ILE B CG2 1 
ATOM   4708  C CD1 . ILE B 1 143 ? 23.495  -7.165  32.280  1.00 35.71  ? 139  ILE B CD1 1 
ATOM   4709  N N   . HIS B 1 144 ? 19.346  -6.373  27.781  1.00 36.60  ? 140  HIS B N   1 
ATOM   4710  C CA  . HIS B 1 144 ? 18.440  -7.003  26.815  1.00 37.34  ? 140  HIS B CA  1 
ATOM   4711  C C   . HIS B 1 144 ? 19.151  -7.463  25.554  1.00 38.02  ? 140  HIS B C   1 
ATOM   4712  O O   . HIS B 1 144 ? 20.042  -6.780  25.050  1.00 38.04  ? 140  HIS B O   1 
ATOM   4713  C CB  . HIS B 1 144 ? 17.325  -6.039  26.408  1.00 37.16  ? 140  HIS B CB  1 
ATOM   4714  C CG  . HIS B 1 144 ? 16.566  -5.466  27.559  1.00 37.22  ? 140  HIS B CG  1 
ATOM   4715  N ND1 . HIS B 1 144 ? 15.662  -6.202  28.295  1.00 38.16  ? 140  HIS B ND1 1 
ATOM   4716  C CD2 . HIS B 1 144 ? 16.566  -4.224  28.096  1.00 37.41  ? 140  HIS B CD2 1 
ATOM   4717  C CE1 . HIS B 1 144 ? 15.143  -5.439  29.241  1.00 38.12  ? 140  HIS B CE1 1 
ATOM   4718  N NE2 . HIS B 1 144 ? 15.674  -4.234  29.143  1.00 37.78  ? 140  HIS B NE2 1 
ATOM   4719  N N   . GLY B 1 145 ? 18.742  -8.615  25.034  1.00 38.88  ? 141  GLY B N   1 
ATOM   4720  C CA  . GLY B 1 145 ? 19.188  -9.052  23.714  1.00 39.85  ? 141  GLY B CA  1 
ATOM   4721  C C   . GLY B 1 145 ? 18.270  -8.457  22.665  1.00 40.17  ? 141  GLY B C   1 
ATOM   4722  O O   . GLY B 1 145 ? 17.705  -7.380  22.871  1.00 39.55  ? 141  GLY B O   1 
ATOM   4723  N N   . MET B 1 146 ? 18.116  -9.150  21.539  1.00 41.23  ? 142  MET B N   1 
ATOM   4724  C CA  . MET B 1 146 ? 17.152  -8.732  20.512  1.00 41.66  ? 142  MET B CA  1 
ATOM   4725  C C   . MET B 1 146 ? 16.576  -9.897  19.702  1.00 42.77  ? 142  MET B C   1 
ATOM   4726  O O   . MET B 1 146 ? 17.094  -11.016 19.748  1.00 43.43  ? 142  MET B O   1 
ATOM   4727  C CB  . MET B 1 146 ? 17.718  -7.624  19.596  1.00 41.74  ? 142  MET B CB  1 
ATOM   4728  C CG  . MET B 1 146 ? 19.192  -7.750  19.214  1.00 42.77  ? 142  MET B CG  1 
ATOM   4729  S SD  . MET B 1 146 ? 19.820  -6.337  18.257  1.00 44.82  ? 142  MET B SD  1 
ATOM   4730  C CE  . MET B 1 146 ? 19.888  -5.052  19.509  1.00 42.44  ? 142  MET B CE  1 
ATOM   4731  N N   . THR B 1 147 ? 15.484  -9.622  18.989  1.00 42.88  ? 143  THR B N   1 
ATOM   4732  C CA  . THR B 1 147 ? 14.886  -10.581 18.058  1.00 43.99  ? 143  THR B CA  1 
ATOM   4733  C C   . THR B 1 147 ? 14.954  -10.037 16.634  1.00 44.63  ? 143  THR B C   1 
ATOM   4734  O O   . THR B 1 147 ? 14.353  -9.007  16.318  1.00 44.17  ? 143  THR B O   1 
ATOM   4735  C CB  . THR B 1 147 ? 13.426  -10.944 18.433  1.00 44.04  ? 143  THR B CB  1 
ATOM   4736  O OG1 . THR B 1 147 ? 12.637  -9.753  18.548  1.00 42.97  ? 143  THR B OG1 1 
ATOM   4737  C CG2 . THR B 1 147 ? 13.381  -11.710 19.749  1.00 43.54  ? 143  THR B CG2 1 
ATOM   4738  N N   . ILE B 1 148 ? 15.701  -10.740 15.787  1.00 45.77  ? 144  ILE B N   1 
ATOM   4739  C CA  . ILE B 1 148 ? 15.992  -10.297 14.425  1.00 46.57  ? 144  ILE B CA  1 
ATOM   4740  C C   . ILE B 1 148 ? 15.073  -11.003 13.433  1.00 47.97  ? 144  ILE B C   1 
ATOM   4741  O O   . ILE B 1 148 ? 14.911  -12.224 13.501  1.00 48.91  ? 144  ILE B O   1 
ATOM   4742  C CB  . ILE B 1 148 ? 17.463  -10.610 14.021  1.00 47.28  ? 144  ILE B CB  1 
ATOM   4743  C CG1 . ILE B 1 148 ? 18.374  -10.811 15.250  1.00 46.35  ? 144  ILE B CG1 1 
ATOM   4744  C CG2 . ILE B 1 148 ? 18.000  -9.572  13.026  1.00 47.71  ? 144  ILE B CG2 1 
ATOM   4745  C CD1 . ILE B 1 148 ? 18.802  -9.543  15.984  1.00 45.22  ? 144  ILE B CD1 1 
ATOM   4746  N N   . PRO B 1 149 ? 14.464  -10.240 12.507  1.00 48.27  ? 145  PRO B N   1 
ATOM   4747  C CA  . PRO B 1 149 ? 13.674  -10.868 11.449  1.00 49.91  ? 145  PRO B CA  1 
ATOM   4748  C C   . PRO B 1 149 ? 14.551  -11.282 10.261  1.00 51.61  ? 145  PRO B C   1 
ATOM   4749  O O   . PRO B 1 149 ? 14.657  -10.553 9.274   1.00 52.32  ? 145  PRO B O   1 
ATOM   4750  C CB  . PRO B 1 149 ? 12.667  -9.777  11.060  1.00 49.49  ? 145  PRO B CB  1 
ATOM   4751  C CG  . PRO B 1 149 ? 13.255  -8.482  11.547  1.00 48.05  ? 145  PRO B CG  1 
ATOM   4752  C CD  . PRO B 1 149 ? 14.444  -8.769  12.417  1.00 47.25  ? 145  PRO B CD  1 
ATOM   4753  N N   . VAL B 1 150 ? 15.182  -12.447 10.371  1.00 52.39  ? 146  VAL B N   1 
ATOM   4754  C CA  . VAL B 1 150 ? 16.100  -12.927 9.340   1.00 54.14  ? 146  VAL B CA  1 
ATOM   4755  C C   . VAL B 1 150 ? 15.317  -13.647 8.245   1.00 56.17  ? 146  VAL B C   1 
ATOM   4756  O O   . VAL B 1 150 ? 14.347  -14.349 8.535   1.00 56.53  ? 146  VAL B O   1 
ATOM   4757  C CB  . VAL B 1 150 ? 17.210  -13.838 9.935   1.00 54.28  ? 146  VAL B CB  1 
ATOM   4758  C CG1 . VAL B 1 150 ? 18.299  -14.135 8.900   1.00 56.19  ? 146  VAL B CG1 1 
ATOM   4759  C CG2 . VAL B 1 150 ? 17.838  -13.174 11.146  1.00 52.14  ? 146  VAL B CG2 1 
ATOM   4760  N N   . ASP B 1 151 ? 15.743  -13.453 6.995   1.00 57.67  ? 147  ASP B N   1 
ATOM   4761  C CA  . ASP B 1 151 ? 15.100  -14.036 5.813   1.00 59.85  ? 147  ASP B CA  1 
ATOM   4762  C C   . ASP B 1 151 ? 14.814  -15.526 5.954   1.00 61.19  ? 147  ASP B C   1 
ATOM   4763  O O   . ASP B 1 151 ? 15.515  -16.235 6.678   1.00 61.05  ? 147  ASP B O   1 
ATOM   4764  C CB  . ASP B 1 151 ? 15.967  -13.809 4.569   1.00 61.61  ? 147  ASP B CB  1 
ATOM   4765  C CG  . ASP B 1 151 ? 16.067  -12.346 4.176   1.00 60.80  ? 147  ASP B CG  1 
ATOM   4766  O OD1 . ASP B 1 151 ? 15.363  -11.505 4.777   1.00 59.05  ? 147  ASP B OD1 1 
ATOM   4767  O OD2 . ASP B 1 151 ? 16.855  -12.040 3.257   1.00 61.78  ? 147  ASP B OD2 1 
ATOM   4768  N N   . GLY B 1 152 ? 13.784  -15.991 5.249   1.00 62.73  ? 148  GLY B N   1 
ATOM   4769  C CA  . GLY B 1 152 ? 13.380  -17.395 5.289   1.00 64.25  ? 148  GLY B CA  1 
ATOM   4770  C C   . GLY B 1 152 ? 12.543  -17.724 6.510   1.00 62.86  ? 148  GLY B C   1 
ATOM   4771  O O   . GLY B 1 152 ? 12.362  -16.884 7.394   1.00 60.64  ? 148  GLY B O   1 
ATOM   4772  N N   . ASP B 1 153 ? 12.034  -18.953 6.558   1.00 64.32  ? 149  ASP B N   1 
ATOM   4773  C CA  . ASP B 1 153 ? 11.205  -19.407 7.672   1.00 63.38  ? 149  ASP B CA  1 
ATOM   4774  C C   . ASP B 1 153 ? 12.058  -19.692 8.908   1.00 62.16  ? 149  ASP B C   1 
ATOM   4775  O O   . ASP B 1 153 ? 12.266  -20.846 9.296   1.00 63.22  ? 149  ASP B O   1 
ATOM   4776  C CB  . ASP B 1 153 ? 10.374  -20.628 7.267   1.00 65.53  ? 149  ASP B CB  1 
ATOM   4777  C CG  . ASP B 1 153 ? 9.455   -20.343 6.090   1.00 67.01  ? 149  ASP B CG  1 
ATOM   4778  O OD1 . ASP B 1 153 ? 8.984   -19.191 5.959   1.00 65.66  ? 149  ASP B OD1 1 
ATOM   4779  O OD2 . ASP B 1 153 ? 9.203   -21.275 5.294   1.00 69.55  ? 149  ASP B OD2 1 
ATOM   4780  N N   . TYR B 1 154 ? 12.549  -18.615 9.512   1.00 60.09  ? 150  TYR B N   1 
ATOM   4781  C CA  . TYR B 1 154 ? 13.384  -18.688 10.700  1.00 58.80  ? 150  TYR B CA  1 
ATOM   4782  C C   . TYR B 1 154 ? 12.983  -17.616 11.708  1.00 56.49  ? 150  TYR B C   1 
ATOM   4783  O O   . TYR B 1 154 ? 12.270  -16.664 11.374  1.00 55.90  ? 150  TYR B O   1 
ATOM   4784  C CB  . TYR B 1 154 ? 14.862  -18.514 10.337  1.00 58.99  ? 150  TYR B CB  1 
ATOM   4785  C CG  . TYR B 1 154 ? 15.442  -19.596 9.456   1.00 61.28  ? 150  TYR B CG  1 
ATOM   4786  C CD1 . TYR B 1 154 ? 15.856  -20.814 9.992   1.00 62.10  ? 150  TYR B CD1 1 
ATOM   4787  C CD2 . TYR B 1 154 ? 15.600  -19.393 8.088   1.00 62.90  ? 150  TYR B CD2 1 
ATOM   4788  C CE1 . TYR B 1 154 ? 16.399  -21.804 9.184   1.00 64.44  ? 150  TYR B CE1 1 
ATOM   4789  C CE2 . TYR B 1 154 ? 16.142  -20.380 7.270   1.00 65.33  ? 150  TYR B CE2 1 
ATOM   4790  C CZ  . TYR B 1 154 ? 16.540  -21.581 7.826   1.00 66.11  ? 150  TYR B CZ  1 
ATOM   4791  O OH  . TYR B 1 154 ? 17.078  -22.561 7.025   1.00 68.93  ? 150  TYR B OH  1 
ATOM   4792  N N   . PHE B 1 155 ? 13.446  -17.792 12.942  1.00 55.39  ? 151  PHE B N   1 
ATOM   4793  C CA  . PHE B 1 155 ? 13.264  -16.826 14.014  1.00 53.35  ? 151  PHE B CA  1 
ATOM   4794  C C   . PHE B 1 155 ? 14.527  -16.854 14.874  1.00 52.55  ? 151  PHE B C   1 
ATOM   4795  O O   . PHE B 1 155 ? 14.815  -17.854 15.539  1.00 53.09  ? 151  PHE B O   1 
ATOM   4796  C CB  . PHE B 1 155 ? 12.006  -17.162 14.827  1.00 53.02  ? 151  PHE B CB  1 
ATOM   4797  C CG  . PHE B 1 155 ? 12.018  -16.622 16.232  1.00 51.52  ? 151  PHE B CG  1 
ATOM   4798  C CD1 . PHE B 1 155 ? 11.860  -15.256 16.473  1.00 50.41  ? 151  PHE B CD1 1 
ATOM   4799  C CD2 . PHE B 1 155 ? 12.178  -17.482 17.317  1.00 51.59  ? 151  PHE B CD2 1 
ATOM   4800  C CE1 . PHE B 1 155 ? 11.875  -14.752 17.775  1.00 48.99  ? 151  PHE B CE1 1 
ATOM   4801  C CE2 . PHE B 1 155 ? 12.193  -16.989 18.620  1.00 50.44  ? 151  PHE B CE2 1 
ATOM   4802  C CZ  . PHE B 1 155 ? 12.044  -15.620 18.850  1.00 48.85  ? 151  PHE B CZ  1 
ATOM   4803  N N   . THR B 1 156 ? 15.291  -15.764 14.840  1.00 51.43  ? 152  THR B N   1 
ATOM   4804  C CA  . THR B 1 156 ? 16.581  -15.716 15.527  1.00 50.80  ? 152  THR B CA  1 
ATOM   4805  C C   . THR B 1 156 ? 16.595  -14.694 16.664  1.00 48.87  ? 152  THR B C   1 
ATOM   4806  O O   . THR B 1 156 ? 16.152  -13.557 16.493  1.00 47.94  ? 152  THR B O   1 
ATOM   4807  C CB  . THR B 1 156 ? 17.752  -15.419 14.556  1.00 51.45  ? 152  THR B CB  1 
ATOM   4808  O OG1 . THR B 1 156 ? 17.842  -14.010 14.325  1.00 50.26  ? 152  THR B OG1 1 
ATOM   4809  C CG2 . THR B 1 156 ? 17.563  -16.137 13.226  1.00 53.56  ? 152  THR B CG2 1 
ATOM   4810  N N   . PHE B 1 157 ? 17.117  -15.109 17.816  1.00 48.51  ? 153  PHE B N   1 
ATOM   4811  C CA  . PHE B 1 157 ? 17.209  -14.250 18.998  1.00 46.95  ? 153  PHE B CA  1 
ATOM   4812  C C   . PHE B 1 157 ? 18.584  -14.330 19.666  1.00 46.82  ? 153  PHE B C   1 
ATOM   4813  O O   . PHE B 1 157 ? 19.266  -15.353 19.588  1.00 47.89  ? 153  PHE B O   1 
ATOM   4814  C CB  . PHE B 1 157 ? 16.097  -14.579 20.007  1.00 46.37  ? 153  PHE B CB  1 
ATOM   4815  C CG  . PHE B 1 157 ? 16.114  -16.002 20.507  1.00 47.16  ? 153  PHE B CG  1 
ATOM   4816  C CD1 . PHE B 1 157 ? 16.857  -16.353 21.633  1.00 46.55  ? 153  PHE B CD1 1 
ATOM   4817  C CD2 . PHE B 1 157 ? 15.369  -16.989 19.863  1.00 48.60  ? 153  PHE B CD2 1 
ATOM   4818  C CE1 . PHE B 1 157 ? 16.869  -17.667 22.102  1.00 47.64  ? 153  PHE B CE1 1 
ATOM   4819  C CE2 . PHE B 1 157 ? 15.372  -18.306 20.322  1.00 49.60  ? 153  PHE B CE2 1 
ATOM   4820  C CZ  . PHE B 1 157 ? 16.123  -18.646 21.445  1.00 49.29  ? 153  PHE B CZ  1 
ATOM   4821  N N   . THR B 1 158 ? 18.979  -13.246 20.326  1.00 45.77  ? 154  THR B N   1 
ATOM   4822  C CA  . THR B 1 158 ? 20.282  -13.176 20.982  1.00 45.66  ? 154  THR B CA  1 
ATOM   4823  C C   . THR B 1 158 ? 20.156  -13.063 22.503  1.00 44.91  ? 154  THR B C   1 
ATOM   4824  O O   . THR B 1 158 ? 19.382  -12.251 23.016  1.00 44.08  ? 154  THR B O   1 
ATOM   4825  C CB  . THR B 1 158 ? 21.123  -11.990 20.458  1.00 45.02  ? 154  THR B CB  1 
ATOM   4826  O OG1 . THR B 1 158 ? 20.495  -10.755 20.827  1.00 43.97  ? 154  THR B OG1 1 
ATOM   4827  C CG2 . THR B 1 158 ? 21.261  -12.054 18.944  1.00 46.10  ? 154  THR B CG2 1 
ATOM   4828  N N   . ARG B 1 159 ? 20.915  -13.896 23.210  1.00 45.57  ? 155  ARG B N   1 
ATOM   4829  C CA  . ARG B 1 159 ? 21.063  -13.792 24.655  1.00 45.01  ? 155  ARG B CA  1 
ATOM   4830  C C   . ARG B 1 159 ? 22.387  -13.116 24.961  1.00 44.25  ? 155  ARG B C   1 
ATOM   4831  O O   . ARG B 1 159 ? 23.406  -13.443 24.348  1.00 45.00  ? 155  ARG B O   1 
ATOM   4832  C CB  . ARG B 1 159 ? 21.083  -15.176 25.295  1.00 46.19  ? 155  ARG B CB  1 
ATOM   4833  C CG  . ARG B 1 159 ? 19.743  -15.731 25.731  1.00 47.68  ? 155  ARG B CG  1 
ATOM   4834  C CD  . ARG B 1 159 ? 19.987  -16.882 26.703  1.00 50.41  ? 155  ARG B CD  1 
ATOM   4835  N NE  . ARG B 1 159 ? 18.842  -17.782 26.825  1.00 53.39  ? 155  ARG B NE  1 
ATOM   4836  C CZ  . ARG B 1 159 ? 18.860  -18.941 27.480  1.00 55.10  ? 155  ARG B CZ  1 
ATOM   4837  N NH1 . ARG B 1 159 ? 19.970  -19.355 28.084  1.00 55.41  ? 155  ARG B NH1 1 
ATOM   4838  N NH2 . ARG B 1 159 ? 17.764  -19.689 27.530  1.00 56.59  ? 155  ARG B NH2 1 
ATOM   4839  N N   . HIS B 1 160 ? 22.374  -12.186 25.910  1.00 43.04  ? 156  HIS B N   1 
ATOM   4840  C CA  . HIS B 1 160 ? 23.606  -11.599 26.430  1.00 42.39  ? 156  HIS B CA  1 
ATOM   4841  C C   . HIS B 1 160 ? 24.020  -12.353 27.696  1.00 42.30  ? 156  HIS B C   1 
ATOM   4842  O O   . HIS B 1 160 ? 23.376  -12.230 28.738  1.00 41.88  ? 156  HIS B O   1 
ATOM   4843  C CB  . HIS B 1 160 ? 23.416  -10.103 26.702  1.00 41.37  ? 156  HIS B CB  1 
ATOM   4844  C CG  . HIS B 1 160 ? 23.403  -9.257  25.463  1.00 41.86  ? 156  HIS B CG  1 
ATOM   4845  N ND1 . HIS B 1 160 ? 24.181  -8.126  25.325  1.00 41.74  ? 156  HIS B ND1 1 
ATOM   4846  C CD2 . HIS B 1 160 ? 22.715  -9.381  24.302  1.00 42.56  ? 156  HIS B CD2 1 
ATOM   4847  C CE1 . HIS B 1 160 ? 23.969  -7.589  24.137  1.00 41.98  ? 156  HIS B CE1 1 
ATOM   4848  N NE2 . HIS B 1 160 ? 23.084  -8.331  23.496  1.00 42.52  ? 156  HIS B NE2 1 
ATOM   4849  N N   . GLU B 1 161 ? 25.084  -13.147 27.587  1.00 42.88  ? 157  GLU B N   1 
ATOM   4850  C CA  . GLU B 1 161 ? 25.522  -14.033 28.670  1.00 43.18  ? 157  GLU B CA  1 
ATOM   4851  C C   . GLU B 1 161 ? 26.909  -13.668 29.202  1.00 42.51  ? 157  GLU B C   1 
ATOM   4852  O O   . GLU B 1 161 ? 27.766  -13.224 28.436  1.00 42.61  ? 157  GLU B O   1 
ATOM   4853  C CB  . GLU B 1 161 ? 25.528  -15.489 28.195  1.00 44.78  ? 157  GLU B CB  1 
ATOM   4854  C CG  . GLU B 1 161 ? 24.144  -16.066 27.895  1.00 46.30  ? 157  GLU B CG  1 
ATOM   4855  C CD  . GLU B 1 161 ? 24.193  -17.503 27.380  1.00 48.98  ? 157  GLU B CD  1 
ATOM   4856  O OE1 . GLU B 1 161 ? 25.310  -18.031 27.160  1.00 49.71  ? 157  GLU B OE1 1 
ATOM   4857  O OE2 . GLU B 1 161 ? 23.106  -18.104 27.196  1.00 49.92  ? 157  GLU B OE2 1 
ATOM   4858  N N   . PRO B 1 162 ? 27.138  -13.863 30.518  1.00 42.00  ? 158  PRO B N   1 
ATOM   4859  C CA  . PRO B 1 162 ? 28.446  -13.603 31.126  1.00 41.42  ? 158  PRO B CA  1 
ATOM   4860  C C   . PRO B 1 162 ? 29.568  -14.432 30.500  1.00 42.22  ? 158  PRO B C   1 
ATOM   4861  O O   . PRO B 1 162 ? 29.359  -15.596 30.140  1.00 43.28  ? 158  PRO B O   1 
ATOM   4862  C CB  . PRO B 1 162 ? 28.242  -14.019 32.590  1.00 41.36  ? 158  PRO B CB  1 
ATOM   4863  C CG  . PRO B 1 162 ? 27.045  -14.892 32.583  1.00 42.05  ? 158  PRO B CG  1 
ATOM   4864  C CD  . PRO B 1 162 ? 26.166  -14.318 31.525  1.00 42.00  ? 158  PRO B CD  1 
ATOM   4865  N N   . ILE B 1 163 ? 30.746  -13.822 30.385  1.00 41.63  ? 159  ILE B N   1 
ATOM   4866  C CA  . ILE B 1 163 ? 31.910  -14.458 29.776  1.00 42.25  ? 159  ILE B CA  1 
ATOM   4867  C C   . ILE B 1 163 ? 32.434  -15.608 30.635  1.00 42.87  ? 159  ILE B C   1 
ATOM   4868  O O   . ILE B 1 163 ? 32.571  -16.731 30.148  1.00 44.16  ? 159  ILE B O   1 
ATOM   4869  C CB  . ILE B 1 163 ? 33.041  -13.434 29.501  1.00 41.66  ? 159  ILE B CB  1 
ATOM   4870  C CG1 . ILE B 1 163 ? 32.497  -12.237 28.711  1.00 41.05  ? 159  ILE B CG1 1 
ATOM   4871  C CG2 . ILE B 1 163 ? 34.208  -14.098 28.764  1.00 42.62  ? 159  ILE B CG2 1 
ATOM   4872  C CD1 . ILE B 1 163 ? 33.496  -11.113 28.508  1.00 40.64  ? 159  ILE B CD1 1 
ATOM   4873  N N   . GLY B 1 164 ? 32.718  -15.324 31.905  1.00 42.06  ? 160  GLY B N   1 
ATOM   4874  C CA  . GLY B 1 164 ? 33.255  -16.328 32.823  1.00 42.67  ? 160  GLY B CA  1 
ATOM   4875  C C   . GLY B 1 164 ? 34.067  -15.744 33.964  1.00 41.84  ? 160  GLY B C   1 
ATOM   4876  O O   . GLY B 1 164 ? 33.623  -14.816 34.645  1.00 40.97  ? 160  GLY B O   1 
ATOM   4877  N N   . VAL B 1 165 ? 35.253  -16.302 34.183  1.00 42.20  ? 161  VAL B N   1 
ATOM   4878  C CA  . VAL B 1 165 ? 36.184  -15.752 35.158  1.00 41.44  ? 161  VAL B CA  1 
ATOM   4879  C C   . VAL B 1 165 ? 36.850  -14.532 34.527  1.00 40.56  ? 161  VAL B C   1 
ATOM   4880  O O   . VAL B 1 165 ? 37.430  -14.625 33.441  1.00 41.11  ? 161  VAL B O   1 
ATOM   4881  C CB  . VAL B 1 165 ? 37.257  -16.787 35.584  1.00 42.50  ? 161  VAL B CB  1 
ATOM   4882  C CG1 . VAL B 1 165 ? 38.175  -16.206 36.657  1.00 41.70  ? 161  VAL B CG1 1 
ATOM   4883  C CG2 . VAL B 1 165 ? 36.602  -18.081 36.075  1.00 43.63  ? 161  VAL B CG2 1 
ATOM   4884  N N   . CYS B 1 166 ? 36.744  -13.387 35.194  1.00 39.32  ? 162  CYS B N   1 
ATOM   4885  C CA  . CYS B 1 166 ? 37.377  -12.167 34.715  1.00 38.45  ? 162  CYS B CA  1 
ATOM   4886  C C   . CYS B 1 166 ? 38.523  -11.776 35.624  1.00 38.13  ? 162  CYS B C   1 
ATOM   4887  O O   . CYS B 1 166 ? 38.321  -11.507 36.810  1.00 37.71  ? 162  CYS B O   1 
ATOM   4888  C CB  . CYS B 1 166 ? 36.368  -11.024 34.617  1.00 37.57  ? 162  CYS B CB  1 
ATOM   4889  S SG  . CYS B 1 166 ? 35.071  -11.295 33.400  1.00 38.24  ? 162  CYS B SG  1 
ATOM   4890  N N   . GLY B 1 167 ? 39.728  -11.770 35.063  1.00 38.32  ? 163  GLY B N   1 
ATOM   4891  C CA  . GLY B 1 167 ? 40.906  -11.284 35.764  1.00 37.92  ? 163  GLY B CA  1 
ATOM   4892  C C   . GLY B 1 167 ? 40.980  -9.779  35.638  1.00 36.98  ? 163  GLY B C   1 
ATOM   4893  O O   . GLY B 1 167 ? 40.783  -9.232  34.552  1.00 36.92  ? 163  GLY B O   1 
ATOM   4894  N N   . GLN B 1 168 ? 41.255  -9.103  36.747  1.00 36.41  ? 164  GLN B N   1 
ATOM   4895  C CA  . GLN B 1 168 ? 41.325  -7.647  36.739  1.00 35.71  ? 164  GLN B CA  1 
ATOM   4896  C C   . GLN B 1 168 ? 42.547  -7.131  37.478  1.00 35.69  ? 164  GLN B C   1 
ATOM   4897  O O   . GLN B 1 168 ? 42.873  -7.606  38.565  1.00 35.87  ? 164  GLN B O   1 
ATOM   4898  C CB  . GLN B 1 168 ? 40.051  -7.051  37.335  1.00 35.20  ? 164  GLN B CB  1 
ATOM   4899  C CG  . GLN B 1 168 ? 38.838  -7.181  36.426  1.00 34.82  ? 164  GLN B CG  1 
ATOM   4900  C CD  . GLN B 1 168 ? 37.534  -6.994  37.159  1.00 34.01  ? 164  GLN B CD  1 
ATOM   4901  O OE1 . GLN B 1 168 ? 37.468  -7.145  38.374  1.00 33.95  ? 164  GLN B OE1 1 
ATOM   4902  N NE2 . GLN B 1 168 ? 36.483  -6.665  36.420  1.00 33.84  ? 164  GLN B NE2 1 
ATOM   4903  N N   . ILE B 1 169 ? 43.220  -6.158  36.872  1.00 35.58  ? 165  ILE B N   1 
ATOM   4904  C CA  . ILE B 1 169 ? 44.406  -5.536  37.463  1.00 35.62  ? 165  ILE B CA  1 
ATOM   4905  C C   . ILE B 1 169 ? 44.279  -4.013  37.399  1.00 35.28  ? 165  ILE B C   1 
ATOM   4906  O O   . ILE B 1 169 ? 44.155  -3.448  36.315  1.00 35.30  ? 165  ILE B O   1 
ATOM   4907  C CB  . ILE B 1 169 ? 45.701  -5.981  36.741  1.00 36.08  ? 165  ILE B CB  1 
ATOM   4908  C CG1 . ILE B 1 169 ? 45.835  -7.507  36.756  1.00 36.58  ? 165  ILE B CG1 1 
ATOM   4909  C CG2 . ILE B 1 169 ? 46.907  -5.348  37.396  1.00 36.23  ? 165  ILE B CG2 1 
ATOM   4910  C CD1 . ILE B 1 169 ? 46.743  -8.068  35.690  1.00 36.70  ? 165  ILE B CD1 1 
ATOM   4911  N N   . ILE B 1 170 ? 44.310  -3.358  38.557  1.00 35.19  ? 166  ILE B N   1 
ATOM   4912  C CA  . ILE B 1 170 ? 44.147  -1.899  38.626  1.00 35.12  ? 166  ILE B CA  1 
ATOM   4913  C C   . ILE B 1 170 ? 45.395  -1.169  39.144  1.00 35.40  ? 166  ILE B C   1 
ATOM   4914  O O   . ILE B 1 170 ? 46.249  -1.792  39.770  1.00 35.70  ? 166  ILE B O   1 
ATOM   4915  C CB  . ILE B 1 170 ? 42.886  -1.477  39.452  1.00 34.83  ? 166  ILE B CB  1 
ATOM   4916  C CG1 . ILE B 1 170 ? 42.949  -1.986  40.900  1.00 34.84  ? 166  ILE B CG1 1 
ATOM   4917  C CG2 . ILE B 1 170 ? 41.601  -1.883  38.723  1.00 34.70  ? 166  ILE B CG2 1 
ATOM   4918  C CD1 . ILE B 1 170 ? 42.391  -3.373  41.112  1.00 35.11  ? 166  ILE B CD1 1 
ATOM   4919  N N   . PRO B 1 171 ? 45.508  0.151   38.874  1.00 35.50  ? 167  PRO B N   1 
ATOM   4920  C CA  . PRO B 1 171 ? 46.650  0.906   39.362  1.00 35.99  ? 167  PRO B CA  1 
ATOM   4921  C C   . PRO B 1 171 ? 46.389  1.525   40.735  1.00 36.17  ? 167  PRO B C   1 
ATOM   4922  O O   . PRO B 1 171 ? 45.375  1.220   41.377  1.00 35.82  ? 167  PRO B O   1 
ATOM   4923  C CB  . PRO B 1 171 ? 46.798  2.002   38.309  1.00 36.15  ? 167  PRO B CB  1 
ATOM   4924  C CG  . PRO B 1 171 ? 45.411  2.289   37.890  1.00 35.62  ? 167  PRO B CG  1 
ATOM   4925  C CD  . PRO B 1 171 ? 44.631  1.000   38.043  1.00 35.38  ? 167  PRO B CD  1 
ATOM   4926  N N   . TRP B 1 172 ? 47.303  2.391   41.167  1.00 36.69  ? 168  TRP B N   1 
ATOM   4927  C CA  . TRP B 1 172 ? 47.200  3.066   42.457  1.00 37.09  ? 168  TRP B CA  1 
ATOM   4928  C C   . TRP B 1 172 ? 46.562  4.455   42.366  1.00 37.40  ? 168  TRP B C   1 
ATOM   4929  O O   . TRP B 1 172 ? 46.426  5.135   43.381  1.00 37.82  ? 168  TRP B O   1 
ATOM   4930  C CB  . TRP B 1 172 ? 48.579  3.169   43.101  1.00 37.56  ? 168  TRP B CB  1 
ATOM   4931  C CG  . TRP B 1 172 ? 49.652  3.571   42.134  1.00 38.08  ? 168  TRP B CG  1 
ATOM   4932  C CD1 . TRP B 1 172 ? 50.534  2.742   41.507  1.00 38.07  ? 168  TRP B CD1 1 
ATOM   4933  C CD2 . TRP B 1 172 ? 49.951  4.900   41.675  1.00 38.59  ? 168  TRP B CD2 1 
ATOM   4934  N NE1 . TRP B 1 172 ? 51.370  3.469   40.692  1.00 38.67  ? 168  TRP B NE1 1 
ATOM   4935  C CE2 . TRP B 1 172 ? 51.036  4.795   40.775  1.00 38.77  ? 168  TRP B CE2 1 
ATOM   4936  C CE3 . TRP B 1 172 ? 49.412  6.169   41.939  1.00 38.52  ? 168  TRP B CE3 1 
ATOM   4937  C CZ2 . TRP B 1 172 ? 51.593  5.912   40.132  1.00 39.23  ? 168  TRP B CZ2 1 
ATOM   4938  C CZ3 . TRP B 1 172 ? 49.966  7.278   41.299  1.00 39.00  ? 168  TRP B CZ3 1 
ATOM   4939  C CH2 . TRP B 1 172 ? 51.045  7.140   40.406  1.00 39.23  ? 168  TRP B CH2 1 
ATOM   4940  N N   . ASN B 1 173 ? 46.182  4.869   41.156  1.00 37.45  ? 169  ASN B N   1 
ATOM   4941  C CA  . ASN B 1 173 ? 45.535  6.164   40.918  1.00 37.87  ? 169  ASN B CA  1 
ATOM   4942  C C   . ASN B 1 173 ? 44.358  6.427   41.850  1.00 37.89  ? 169  ASN B C   1 
ATOM   4943  O O   . ASN B 1 173 ? 44.415  7.300   42.714  1.00 38.59  ? 169  ASN B O   1 
ATOM   4944  C CB  . ASN B 1 173 ? 45.050  6.263   39.470  1.00 37.74  ? 169  ASN B CB  1 
ATOM   4945  C CG  . ASN B 1 173 ? 46.185  6.341   38.470  1.00 38.82  ? 169  ASN B CG  1 
ATOM   4946  O OD1 . ASN B 1 173 ? 46.194  5.612   37.478  1.00 39.69  ? 169  ASN B OD1 1 
ATOM   4947  N ND2 . ASN B 1 173 ? 47.143  7.233   38.715  1.00 39.74  ? 169  ASN B ND2 1 
ATOM   4948  N N   . PHE B 1 174 ? 43.288  5.665   41.657  1.00 37.40  ? 170  PHE B N   1 
ATOM   4949  C CA  . PHE B 1 174 ? 42.100  5.767   42.484  1.00 37.33  ? 170  PHE B CA  1 
ATOM   4950  C C   . PHE B 1 174 ? 41.777  4.360   42.989  1.00 36.90  ? 170  PHE B C   1 
ATOM   4951  O O   . PHE B 1 174 ? 40.863  3.715   42.469  1.00 36.45  ? 170  PHE B O   1 
ATOM   4952  C CB  . PHE B 1 174 ? 40.927  6.319   41.667  1.00 37.28  ? 170  PHE B CB  1 
ATOM   4953  C CG  . PHE B 1 174 ? 41.187  7.661   41.030  1.00 38.06  ? 170  PHE B CG  1 
ATOM   4954  C CD1 . PHE B 1 174 ? 40.856  8.839   41.696  1.00 39.12  ? 170  PHE B CD1 1 
ATOM   4955  C CD2 . PHE B 1 174 ? 41.732  7.748   39.751  1.00 38.37  ? 170  PHE B CD2 1 
ATOM   4956  C CE1 . PHE B 1 174 ? 41.086  10.087  41.102  1.00 40.14  ? 170  PHE B CE1 1 
ATOM   4957  C CE2 . PHE B 1 174 ? 41.969  8.988   39.150  1.00 39.23  ? 170  PHE B CE2 1 
ATOM   4958  C CZ  . PHE B 1 174 ? 41.647  10.160  39.828  1.00 39.98  ? 170  PHE B CZ  1 
ATOM   4959  N N   . PRO B 1 175 ? 42.530  3.879   44.005  1.00 37.09  ? 171  PRO B N   1 
ATOM   4960  C CA  . PRO B 1 175 ? 42.483  2.481   44.450  1.00 36.80  ? 171  PRO B CA  1 
ATOM   4961  C C   . PRO B 1 175 ? 41.067  1.926   44.596  1.00 36.47  ? 171  PRO B C   1 
ATOM   4962  O O   . PRO B 1 175 ? 40.768  0.864   44.048  1.00 36.15  ? 171  PRO B O   1 
ATOM   4963  C CB  . PRO B 1 175 ? 43.187  2.527   45.808  1.00 37.33  ? 171  PRO B CB  1 
ATOM   4964  C CG  . PRO B 1 175 ? 44.124  3.655   45.691  1.00 37.56  ? 171  PRO B CG  1 
ATOM   4965  C CD  . PRO B 1 175 ? 43.432  4.682   44.854  1.00 37.67  ? 171  PRO B CD  1 
ATOM   4966  N N   . LEU B 1 176 ? 40.207  2.649   45.310  1.00 36.65  ? 172  LEU B N   1 
ATOM   4967  C CA  . LEU B 1 176 ? 38.840  2.198   45.556  1.00 36.46  ? 172  LEU B CA  1 
ATOM   4968  C C   . LEU B 1 176 ? 37.909  2.444   44.367  1.00 35.90  ? 172  LEU B C   1 
ATOM   4969  O O   . LEU B 1 176 ? 37.047  1.619   44.073  1.00 35.60  ? 172  LEU B O   1 
ATOM   4970  C CB  . LEU B 1 176 ? 38.277  2.844   46.825  1.00 37.05  ? 172  LEU B CB  1 
ATOM   4971  C CG  . LEU B 1 176 ? 37.048  2.199   47.475  1.00 37.06  ? 172  LEU B CG  1 
ATOM   4972  C CD1 . LEU B 1 176 ? 37.360  0.808   48.003  1.00 36.83  ? 172  LEU B CD1 1 
ATOM   4973  C CD2 . LEU B 1 176 ? 36.532  3.079   48.595  1.00 38.02  ? 172  LEU B CD2 1 
ATOM   4974  N N   . LEU B 1 177 ? 38.080  3.580   43.697  1.00 35.93  ? 173  LEU B N   1 
ATOM   4975  C CA  . LEU B 1 177 ? 37.301  3.889   42.502  1.00 35.61  ? 173  LEU B CA  1 
ATOM   4976  C C   . LEU B 1 177 ? 37.571  2.888   41.387  1.00 35.34  ? 173  LEU B C   1 
ATOM   4977  O O   . LEU B 1 177 ? 36.628  2.341   40.809  1.00 35.13  ? 173  LEU B O   1 
ATOM   4978  C CB  . LEU B 1 177 ? 37.574  5.310   42.011  1.00 35.80  ? 173  LEU B CB  1 
ATOM   4979  C CG  . LEU B 1 177 ? 36.569  6.394   42.393  1.00 36.11  ? 173  LEU B CG  1 
ATOM   4980  C CD1 . LEU B 1 177 ? 37.162  7.771   42.156  1.00 36.76  ? 173  LEU B CD1 1 
ATOM   4981  C CD2 . LEU B 1 177 ? 35.272  6.226   41.612  1.00 35.81  ? 173  LEU B CD2 1 
ATOM   4982  N N   . MET B 1 178 ? 38.852  2.649   41.095  1.00 35.43  ? 174  MET B N   1 
ATOM   4983  C CA  . MET B 1 178 ? 39.245  1.654   40.096  1.00 35.33  ? 174  MET B CA  1 
ATOM   4984  C C   . MET B 1 178 ? 38.711  0.270   40.452  1.00 35.02  ? 174  MET B C   1 
ATOM   4985  O O   . MET B 1 178 ? 38.377  -0.510  39.562  1.00 35.08  ? 174  MET B O   1 
ATOM   4986  C CB  . MET B 1 178 ? 40.768  1.587   39.922  1.00 35.77  ? 174  MET B CB  1 
ATOM   4987  C CG  . MET B 1 178 ? 41.439  2.798   39.248  1.00 37.02  ? 174  MET B CG  1 
ATOM   4988  S SD  . MET B 1 178 ? 40.810  3.365   37.637  1.00 39.63  ? 174  MET B SD  1 
ATOM   4989  C CE  . MET B 1 178 ? 40.619  1.849   36.699  1.00 39.10  ? 174  MET B CE  1 
ATOM   4990  N N   . PHE B 1 179 ? 38.633  -0.027  41.748  1.00 34.94  ? 175  PHE B N   1 
ATOM   4991  C CA  . PHE B 1 179 ? 38.048  -1.276  42.225  1.00 34.74  ? 175  PHE B CA  1 
ATOM   4992  C C   . PHE B 1 179 ? 36.559  -1.339  41.888  1.00 34.46  ? 175  PHE B C   1 
ATOM   4993  O O   . PHE B 1 179 ? 36.087  -2.332  41.339  1.00 34.36  ? 175  PHE B O   1 
ATOM   4994  C CB  . PHE B 1 179 ? 38.267  -1.436  43.729  1.00 35.13  ? 175  PHE B CB  1 
ATOM   4995  C CG  . PHE B 1 179 ? 37.759  -2.742  44.289  1.00 35.46  ? 175  PHE B CG  1 
ATOM   4996  C CD1 . PHE B 1 179 ? 36.459  -2.846  44.786  1.00 35.30  ? 175  PHE B CD1 1 
ATOM   4997  C CD2 . PHE B 1 179 ? 38.585  -3.862  44.334  1.00 35.51  ? 175  PHE B CD2 1 
ATOM   4998  C CE1 . PHE B 1 179 ? 35.989  -4.042  45.305  1.00 35.44  ? 175  PHE B CE1 1 
ATOM   4999  C CE2 . PHE B 1 179 ? 38.126  -5.065  44.856  1.00 35.77  ? 175  PHE B CE2 1 
ATOM   5000  C CZ  . PHE B 1 179 ? 36.826  -5.155  45.344  1.00 36.13  ? 175  PHE B CZ  1 
ATOM   5001  N N   . ALA B 1 180 ? 35.831  -0.273  42.216  1.00 34.45  ? 176  ALA B N   1 
ATOM   5002  C CA  . ALA B 1 180 ? 34.407  -0.167  41.901  1.00 34.21  ? 176  ALA B CA  1 
ATOM   5003  C C   . ALA B 1 180 ? 34.162  -0.278  40.398  1.00 33.90  ? 176  ALA B C   1 
ATOM   5004  O O   . ALA B 1 180 ? 33.445  -1.174  39.952  1.00 33.82  ? 176  ALA B O   1 
ATOM   5005  C CB  . ALA B 1 180 ? 33.835  1.135   42.443  1.00 34.33  ? 176  ALA B CB  1 
ATOM   5006  N N   . TRP B 1 181 ? 34.789  0.613   39.627  1.00 33.89  ? 177  TRP B N   1 
ATOM   5007  C CA  . TRP B 1 181 ? 34.647  0.649   38.167  1.00 33.74  ? 177  TRP B CA  1 
ATOM   5008  C C   . TRP B 1 181 ? 34.879  -0.690  37.486  1.00 33.62  ? 177  TRP B C   1 
ATOM   5009  O O   . TRP B 1 181 ? 34.456  -0.883  36.345  1.00 33.71  ? 177  TRP B O   1 
ATOM   5010  C CB  . TRP B 1 181 ? 35.587  1.687   37.544  1.00 34.01  ? 177  TRP B CB  1 
ATOM   5011  C CG  . TRP B 1 181 ? 35.125  3.104   37.682  1.00 34.78  ? 177  TRP B CG  1 
ATOM   5012  C CD1 . TRP B 1 181 ? 33.841  3.538   37.853  1.00 35.11  ? 177  TRP B CD1 1 
ATOM   5013  C CD2 . TRP B 1 181 ? 35.941  4.280   37.624  1.00 35.87  ? 177  TRP B CD2 1 
ATOM   5014  N NE1 . TRP B 1 181 ? 33.808  4.910   37.928  1.00 35.77  ? 177  TRP B NE1 1 
ATOM   5015  C CE2 . TRP B 1 181 ? 35.083  5.393   37.790  1.00 36.19  ? 177  TRP B CE2 1 
ATOM   5016  C CE3 . TRP B 1 181 ? 37.317  4.503   37.457  1.00 36.79  ? 177  TRP B CE3 1 
ATOM   5017  C CZ2 . TRP B 1 181 ? 35.554  6.712   37.793  1.00 36.88  ? 177  TRP B CZ2 1 
ATOM   5018  C CZ3 . TRP B 1 181 ? 37.789  5.820   37.464  1.00 37.50  ? 177  TRP B CZ3 1 
ATOM   5019  C CH2 . TRP B 1 181 ? 36.904  6.906   37.631  1.00 37.62  ? 177  TRP B CH2 1 
ATOM   5020  N N   . LYS B 1 182 ? 35.553  -1.606  38.176  1.00 33.60  ? 178  LYS B N   1 
ATOM   5021  C CA  . LYS B 1 182 ? 35.854  -2.917  37.608  1.00 33.74  ? 178  LYS B CA  1 
ATOM   5022  C C   . LYS B 1 182 ? 34.932  -4.012  38.127  1.00 33.77  ? 178  LYS B C   1 
ATOM   5023  O O   . LYS B 1 182 ? 34.455  -4.848  37.358  1.00 34.03  ? 178  LYS B O   1 
ATOM   5024  C CB  . LYS B 1 182 ? 37.322  -3.287  37.819  1.00 33.93  ? 178  LYS B CB  1 
ATOM   5025  C CG  . LYS B 1 182 ? 38.247  -2.449  36.977  1.00 34.06  ? 178  LYS B CG  1 
ATOM   5026  C CD  . LYS B 1 182 ? 39.276  -3.293  36.266  1.00 34.57  ? 178  LYS B CD  1 
ATOM   5027  C CE  . LYS B 1 182 ? 39.466  -2.809  34.839  1.00 34.67  ? 178  LYS B CE  1 
ATOM   5028  N NZ  . LYS B 1 182 ? 39.538  -1.326  34.732  1.00 34.80  ? 178  LYS B NZ  1 
ATOM   5029  N N   . ILE B 1 183 ? 34.681  -4.000  39.429  1.00 33.70  ? 179  ILE B N   1 
ATOM   5030  C CA  . ILE B 1 183 ? 33.818  -4.996  40.057  1.00 33.86  ? 179  ILE B CA  1 
ATOM   5031  C C   . ILE B 1 183 ? 32.378  -4.859  39.557  1.00 33.57  ? 179  ILE B C   1 
ATOM   5032  O O   . ILE B 1 183 ? 31.799  -5.822  39.048  1.00 33.70  ? 179  ILE B O   1 
ATOM   5033  C CB  . ILE B 1 183 ? 33.918  -4.912  41.615  1.00 34.19  ? 179  ILE B CB  1 
ATOM   5034  C CG1 . ILE B 1 183 ? 35.273  -5.449  42.091  1.00 34.68  ? 179  ILE B CG1 1 
ATOM   5035  C CG2 . ILE B 1 183 ? 32.766  -5.624  42.316  1.00 34.34  ? 179  ILE B CG2 1 
ATOM   5036  C CD1 . ILE B 1 183 ? 35.644  -6.819  41.551  1.00 34.89  ? 179  ILE B CD1 1 
ATOM   5037  N N   . ALA B 1 184 ? 31.835  -3.647  39.671  1.00 33.13  ? 180  ALA B N   1 
ATOM   5038  C CA  . ALA B 1 184 ? 30.431  -3.370  39.377  1.00 32.82  ? 180  ALA B CA  1 
ATOM   5039  C C   . ALA B 1 184 ? 29.929  -3.902  38.021  1.00 32.68  ? 180  ALA B C   1 
ATOM   5040  O O   . ALA B 1 184 ? 28.964  -4.661  37.996  1.00 32.92  ? 180  ALA B O   1 
ATOM   5041  C CB  . ALA B 1 184 ? 30.131  -1.881  39.541  1.00 32.57  ? 180  ALA B CB  1 
ATOM   5042  N N   . PRO B 1 185 ? 30.582  -3.528  36.899  1.00 32.46  ? 181  PRO B N   1 
ATOM   5043  C CA  . PRO B 1 185 ? 30.067  -3.994  35.605  1.00 32.53  ? 181  PRO B CA  1 
ATOM   5044  C C   . PRO B 1 185 ? 30.180  -5.511  35.429  1.00 32.97  ? 181  PRO B C   1 
ATOM   5045  O O   . PRO B 1 185 ? 29.264  -6.144  34.893  1.00 33.13  ? 181  PRO B O   1 
ATOM   5046  C CB  . PRO B 1 185 ? 30.966  -3.282  34.585  1.00 32.41  ? 181  PRO B CB  1 
ATOM   5047  C CG  . PRO B 1 185 ? 31.665  -2.207  35.345  1.00 32.27  ? 181  PRO B CG  1 
ATOM   5048  C CD  . PRO B 1 185 ? 31.803  -2.721  36.730  1.00 32.39  ? 181  PRO B CD  1 
ATOM   5049  N N   . ALA B 1 186 ? 31.296  -6.075  35.886  1.00 33.10  ? 182  ALA B N   1 
ATOM   5050  C CA  . ALA B 1 186 ? 31.558  -7.504  35.769  1.00 33.62  ? 182  ALA B CA  1 
ATOM   5051  C C   . ALA B 1 186 ? 30.530  -8.330  36.536  1.00 33.96  ? 182  ALA B C   1 
ATOM   5052  O O   . ALA B 1 186 ? 30.019  -9.322  36.014  1.00 34.50  ? 182  ALA B O   1 
ATOM   5053  C CB  . ALA B 1 186 ? 32.964  -7.821  36.244  1.00 33.83  ? 182  ALA B CB  1 
ATOM   5054  N N   . LEU B 1 187 ? 30.234  -7.910  37.769  1.00 33.79  ? 183  LEU B N   1 
ATOM   5055  C CA  . LEU B 1 187 ? 29.242  -8.577  38.614  1.00 34.13  ? 183  LEU B CA  1 
ATOM   5056  C C   . LEU B 1 187 ? 27.837  -8.327  38.090  1.00 34.22  ? 183  LEU B C   1 
ATOM   5057  O O   . LEU B 1 187 ? 26.948  -9.172  38.232  1.00 34.83  ? 183  LEU B O   1 
ATOM   5058  C CB  . LEU B 1 187 ? 29.336  -8.091  40.062  1.00 33.95  ? 183  LEU B CB  1 
ATOM   5059  C CG  . LEU B 1 187 ? 30.613  -8.270  40.891  1.00 34.04  ? 183  LEU B CG  1 
ATOM   5060  C CD1 . LEU B 1 187 ? 30.301  -8.011  42.357  1.00 34.05  ? 183  LEU B CD1 1 
ATOM   5061  C CD2 . LEU B 1 187 ? 31.239  -9.645  40.730  1.00 34.56  ? 183  LEU B CD2 1 
ATOM   5062  N N   . CYS B 1 188 ? 27.652  -7.154  37.485  1.00 33.78  ? 184  CYS B N   1 
ATOM   5063  C CA  . CYS B 1 188 ? 26.388  -6.761  36.873  1.00 33.71  ? 184  CYS B CA  1 
ATOM   5064  C C   . CYS B 1 188 ? 25.958  -7.763  35.794  1.00 34.06  ? 184  CYS B C   1 
ATOM   5065  O O   . CYS B 1 188 ? 24.780  -8.127  35.709  1.00 34.13  ? 184  CYS B O   1 
ATOM   5066  C CB  . CYS B 1 188 ? 26.527  -5.353  36.287  1.00 33.11  ? 184  CYS B CB  1 
ATOM   5067  S SG  . CYS B 1 188 ? 25.094  -4.733  35.404  1.00 34.08  ? 184  CYS B SG  1 
ATOM   5068  N N   . CYS B 1 189 ? 26.928  -8.207  34.990  1.00 34.23  ? 185  CYS B N   1 
ATOM   5069  C CA  . CYS B 1 189 ? 26.695  -9.161  33.904  1.00 34.69  ? 185  CYS B CA  1 
ATOM   5070  C C   . CYS B 1 189 ? 26.685  -10.614 34.361  1.00 35.52  ? 185  CYS B C   1 
ATOM   5071  O O   . CYS B 1 189 ? 26.257  -11.498 33.612  1.00 36.31  ? 185  CYS B O   1 
ATOM   5072  C CB  . CYS B 1 189 ? 27.728  -8.972  32.803  1.00 34.63  ? 185  CYS B CB  1 
ATOM   5073  S SG  . CYS B 1 189 ? 27.565  -7.399  31.979  1.00 34.00  ? 185  CYS B SG  1 
ATOM   5074  N N   . GLY B 1 190 ? 27.158  -10.858 35.581  1.00 35.49  ? 186  GLY B N   1 
ATOM   5075  C CA  . GLY B 1 190 ? 27.074  -12.183 36.190  1.00 36.37  ? 186  GLY B CA  1 
ATOM   5076  C C   . GLY B 1 190 ? 28.327  -13.027 36.087  1.00 36.87  ? 186  GLY B C   1 
ATOM   5077  O O   . GLY B 1 190 ? 28.257  -14.253 36.158  1.00 37.87  ? 186  GLY B O   1 
ATOM   5078  N N   . ASN B 1 191 ? 29.469  -12.366 35.918  1.00 36.33  ? 187  ASN B N   1 
ATOM   5079  C CA  . ASN B 1 191 ? 30.772  -13.024 35.899  1.00 36.75  ? 187  ASN B CA  1 
ATOM   5080  C C   . ASN B 1 191 ? 31.261  -13.303 37.321  1.00 36.92  ? 187  ASN B C   1 
ATOM   5081  O O   . ASN B 1 191 ? 30.591  -12.944 38.297  1.00 36.69  ? 187  ASN B O   1 
ATOM   5082  C CB  . ASN B 1 191 ? 31.794  -12.146 35.173  1.00 36.26  ? 187  ASN B CB  1 
ATOM   5083  C CG  . ASN B 1 191 ? 31.489  -11.981 33.693  1.00 36.26  ? 187  ASN B CG  1 
ATOM   5084  O OD1 . ASN B 1 191 ? 31.731  -12.885 32.892  1.00 36.98  ? 187  ASN B OD1 1 
ATOM   5085  N ND2 . ASN B 1 191 ? 30.981  -10.810 33.322  1.00 35.17  ? 187  ASN B ND2 1 
ATOM   5086  N N   . THR B 1 192 ? 32.418  -13.956 37.432  1.00 37.27  ? 188  THR B N   1 
ATOM   5087  C CA  . THR B 1 192 ? 33.109  -14.101 38.717  1.00 37.33  ? 188  THR B CA  1 
ATOM   5088  C C   . THR B 1 192 ? 34.493  -13.473 38.605  1.00 36.72  ? 188  THR B C   1 
ATOM   5089  O O   . THR B 1 192 ? 35.154  -13.595 37.574  1.00 36.99  ? 188  THR B O   1 
ATOM   5090  C CB  . THR B 1 192 ? 33.230  -15.571 39.174  1.00 38.55  ? 188  THR B CB  1 
ATOM   5091  O OG1 . THR B 1 192 ? 33.846  -16.347 38.142  1.00 39.58  ? 188  THR B OG1 1 
ATOM   5092  C CG2 . THR B 1 192 ? 31.862  -16.156 39.501  1.00 39.18  ? 188  THR B CG2 1 
ATOM   5093  N N   . VAL B 1 193 ? 34.930  -12.811 39.670  1.00 36.09  ? 189  VAL B N   1 
ATOM   5094  C CA  . VAL B 1 193 ? 36.114  -11.958 39.599  1.00 35.38  ? 189  VAL B CA  1 
ATOM   5095  C C   . VAL B 1 193 ? 37.339  -12.469 40.359  1.00 35.72  ? 189  VAL B C   1 
ATOM   5096  O O   . VAL B 1 193 ? 37.231  -13.039 41.445  1.00 36.13  ? 189  VAL B O   1 
ATOM   5097  C CB  . VAL B 1 193 ? 35.785  -10.510 40.043  1.00 34.50  ? 189  VAL B CB  1 
ATOM   5098  C CG1 . VAL B 1 193 ? 37.051  -9.732  40.337  1.00 33.94  ? 189  VAL B CG1 1 
ATOM   5099  C CG2 . VAL B 1 193 ? 34.960  -9.806  38.978  1.00 33.98  ? 189  VAL B CG2 1 
ATOM   5100  N N   . VAL B 1 194 ? 38.497  -12.255 39.736  1.00 35.51  ? 190  VAL B N   1 
ATOM   5101  C CA  . VAL B 1 194 ? 39.810  -12.411 40.345  1.00 35.58  ? 190  VAL B CA  1 
ATOM   5102  C C   . VAL B 1 194 ? 40.543  -11.068 40.145  1.00 34.74  ? 190  VAL B C   1 
ATOM   5103  O O   . VAL B 1 194 ? 41.061  -10.778 39.059  1.00 34.59  ? 190  VAL B O   1 
ATOM   5104  C CB  . VAL B 1 194 ? 40.582  -13.594 39.708  1.00 36.44  ? 190  VAL B CB  1 
ATOM   5105  C CG1 . VAL B 1 194 ? 41.970  -13.718 40.296  1.00 36.76  ? 190  VAL B CG1 1 
ATOM   5106  C CG2 . VAL B 1 194 ? 39.814  -14.899 39.895  1.00 37.22  ? 190  VAL B CG2 1 
ATOM   5107  N N   . ILE B 1 195 ? 40.553  -10.243 41.191  1.00 34.25  ? 191  ILE B N   1 
ATOM   5108  C CA  . ILE B 1 195 ? 41.053  -8.865  41.095  1.00 33.46  ? 191  ILE B CA  1 
ATOM   5109  C C   . ILE B 1 195 ? 42.379  -8.668  41.828  1.00 33.70  ? 191  ILE B C   1 
ATOM   5110  O O   . ILE B 1 195 ? 42.609  -9.248  42.892  1.00 34.34  ? 191  ILE B O   1 
ATOM   5111  C CB  . ILE B 1 195 ? 39.991  -7.831  41.578  1.00 32.84  ? 191  ILE B CB  1 
ATOM   5112  C CG1 . ILE B 1 195 ? 40.366  -6.412  41.144  1.00 32.02  ? 191  ILE B CG1 1 
ATOM   5113  C CG2 . ILE B 1 195 ? 39.756  -7.935  43.086  1.00 32.97  ? 191  ILE B CG2 1 
ATOM   5114  C CD1 . ILE B 1 195 ? 39.194  -5.459  41.095  1.00 31.47  ? 191  ILE B CD1 1 
ATOM   5115  N N   . LYS B 1 196 ? 43.236  -7.835  41.248  1.00 33.34  ? 192  LYS B N   1 
ATOM   5116  C CA  . LYS B 1 196 ? 44.589  -7.638  41.736  1.00 33.56  ? 192  LYS B CA  1 
ATOM   5117  C C   . LYS B 1 196 ? 44.852  -6.145  41.949  1.00 33.09  ? 192  LYS B C   1 
ATOM   5118  O O   . LYS B 1 196 ? 45.162  -5.424  41.000  1.00 32.96  ? 192  LYS B O   1 
ATOM   5119  C CB  . LYS B 1 196 ? 45.586  -8.228  40.732  1.00 33.93  ? 192  LYS B CB  1 
ATOM   5120  C CG  . LYS B 1 196 ? 46.866  -8.791  41.334  1.00 34.60  ? 192  LYS B CG  1 
ATOM   5121  C CD  . LYS B 1 196 ? 47.746  -7.730  42.000  1.00 34.66  ? 192  LYS B CD  1 
ATOM   5122  C CE  . LYS B 1 196 ? 48.446  -6.838  40.986  1.00 34.51  ? 192  LYS B CE  1 
ATOM   5123  N NZ  . LYS B 1 196 ? 49.371  -5.893  41.666  1.00 34.61  ? 192  LYS B NZ  1 
ATOM   5124  N N   . PRO B 1 197 ? 44.721  -5.672  43.197  1.00 33.10  ? 193  PRO B N   1 
ATOM   5125  C CA  . PRO B 1 197 ? 44.946  -4.254  43.438  1.00 33.03  ? 193  PRO B CA  1 
ATOM   5126  C C   . PRO B 1 197 ? 46.429  -3.931  43.532  1.00 33.50  ? 193  PRO B C   1 
ATOM   5127  O O   . PRO B 1 197 ? 47.200  -4.744  44.053  1.00 34.17  ? 193  PRO B O   1 
ATOM   5128  C CB  . PRO B 1 197 ? 44.234  -4.003  44.769  1.00 33.08  ? 193  PRO B CB  1 
ATOM   5129  C CG  . PRO B 1 197 ? 44.201  -5.312  45.449  1.00 33.51  ? 193  PRO B CG  1 
ATOM   5130  C CD  . PRO B 1 197 ? 44.319  -6.391  44.418  1.00 33.60  ? 193  PRO B CD  1 
ATOM   5131  N N   . ALA B 1 198 ? 46.814  -2.758  43.028  1.00 33.39  ? 194  ALA B N   1 
ATOM   5132  C CA  . ALA B 1 198 ? 48.214  -2.332  42.992  1.00 33.82  ? 194  ALA B CA  1 
ATOM   5133  C C   . ALA B 1 198 ? 48.941  -2.664  44.293  1.00 34.43  ? 194  ALA B C   1 
ATOM   5134  O O   . ALA B 1 198 ? 48.337  -2.664  45.369  1.00 34.55  ? 194  ALA B O   1 
ATOM   5135  C CB  . ALA B 1 198 ? 48.312  -0.848  42.679  1.00 33.69  ? 194  ALA B CB  1 
ATOM   5136  N N   . GLU B 1 199 ? 50.234  -2.957  44.184  1.00 35.04  ? 195  GLU B N   1 
ATOM   5137  C CA  . GLU B 1 199 ? 51.029  -3.421  45.330  1.00 35.83  ? 195  GLU B CA  1 
ATOM   5138  C C   . GLU B 1 199 ? 51.134  -2.410  46.474  1.00 36.18  ? 195  GLU B C   1 
ATOM   5139  O O   . GLU B 1 199 ? 51.189  -2.792  47.643  1.00 36.53  ? 195  GLU B O   1 
ATOM   5140  C CB  . GLU B 1 199 ? 52.428  -3.891  44.894  1.00 36.23  ? 195  GLU B CB  1 
ATOM   5141  C CG  . GLU B 1 199 ? 53.253  -2.883  44.090  1.00 36.35  ? 195  GLU B CG  1 
ATOM   5142  C CD  . GLU B 1 199 ? 53.289  -3.196  42.602  1.00 36.61  ? 195  GLU B CD  1 
ATOM   5143  O OE1 . GLU B 1 199 ? 54.403  -3.401  42.075  1.00 37.27  ? 195  GLU B OE1 1 
ATOM   5144  O OE2 . GLU B 1 199 ? 52.216  -3.241  41.961  1.00 35.82  ? 195  GLU B OE2 1 
ATOM   5145  N N   . GLN B 1 200 ? 51.154  -1.124  46.130  1.00 36.27  ? 196  GLN B N   1 
ATOM   5146  C CA  . GLN B 1 200 ? 51.295  -0.066  47.129  1.00 36.76  ? 196  GLN B CA  1 
ATOM   5147  C C   . GLN B 1 200 ? 50.001  0.212   47.875  1.00 36.79  ? 196  GLN B C   1 
ATOM   5148  O O   . GLN B 1 200 ? 50.036  0.503   49.072  1.00 37.41  ? 196  GLN B O   1 
ATOM   5149  C CB  . GLN B 1 200 ? 51.843  1.233   46.517  1.00 36.80  ? 196  GLN B CB  1 
ATOM   5150  C CG  . GLN B 1 200 ? 51.332  1.564   45.126  1.00 36.05  ? 196  GLN B CG  1 
ATOM   5151  C CD  . GLN B 1 200 ? 52.246  1.051   44.035  1.00 35.77  ? 196  GLN B CD  1 
ATOM   5152  O OE1 . GLN B 1 200 ? 51.823  0.302   43.160  1.00 35.80  ? 196  GLN B OE1 1 
ATOM   5153  N NE2 . GLN B 1 200 ? 53.507  1.448   44.085  1.00 36.22  ? 196  GLN B NE2 1 
ATOM   5154  N N   . THR B 1 201 ? 48.869  0.115   47.175  1.00 36.32  ? 197  THR B N   1 
ATOM   5155  C CA  . THR B 1 201 ? 47.561  0.446   47.762  1.00 36.37  ? 197  THR B CA  1 
ATOM   5156  C C   . THR B 1 201 ? 46.539  -0.700  47.750  1.00 36.15  ? 197  THR B C   1 
ATOM   5157  O O   . THR B 1 201 ? 45.552  -0.639  47.018  1.00 35.68  ? 197  THR B O   1 
ATOM   5158  C CB  . THR B 1 201 ? 46.919  1.668   47.072  1.00 35.98  ? 197  THR B CB  1 
ATOM   5159  O OG1 . THR B 1 201 ? 46.772  1.403   45.672  1.00 35.65  ? 197  THR B OG1 1 
ATOM   5160  C CG2 . THR B 1 201 ? 47.759  2.918   47.273  1.00 36.47  ? 197  THR B CG2 1 
ATOM   5161  N N   . PRO B 1 202 ? 46.755  -1.743  48.572  1.00 36.70  ? 198  PRO B N   1 
ATOM   5162  C CA  . PRO B 1 202 ? 45.783  -2.822  48.529  1.00 36.70  ? 198  PRO B CA  1 
ATOM   5163  C C   . PRO B 1 202 ? 44.674  -2.669  49.564  1.00 37.21  ? 198  PRO B C   1 
ATOM   5164  O O   . PRO B 1 202 ? 43.649  -3.345  49.456  1.00 37.38  ? 198  PRO B O   1 
ATOM   5165  C CB  . PRO B 1 202 ? 46.629  -4.059  48.845  1.00 37.07  ? 198  PRO B CB  1 
ATOM   5166  C CG  . PRO B 1 202 ? 47.783  -3.547  49.663  1.00 37.56  ? 198  PRO B CG  1 
ATOM   5167  C CD  . PRO B 1 202 ? 47.868  -2.049  49.490  1.00 37.35  ? 198  PRO B CD  1 
ATOM   5168  N N   . LEU B 1 203 ? 44.872  -1.772  50.531  1.00 37.72  ? 199  LEU B N   1 
ATOM   5169  C CA  . LEU B 1 203 ? 44.063  -1.733  51.759  1.00 38.34  ? 199  LEU B CA  1 
ATOM   5170  C C   . LEU B 1 203 ? 42.561  -1.488  51.566  1.00 38.04  ? 199  LEU B C   1 
ATOM   5171  O O   . LEU B 1 203 ? 41.739  -2.231  52.109  1.00 38.31  ? 199  LEU B O   1 
ATOM   5172  C CB  . LEU B 1 203 ? 44.653  -0.737  52.770  1.00 39.12  ? 199  LEU B CB  1 
ATOM   5173  C CG  . LEU B 1 203 ? 46.121  -0.927  53.175  1.00 39.47  ? 199  LEU B CG  1 
ATOM   5174  C CD1 . LEU B 1 203 ? 46.522  0.066   54.250  1.00 40.25  ? 199  LEU B CD1 1 
ATOM   5175  C CD2 . LEU B 1 203 ? 46.391  -2.347  53.639  1.00 39.90  ? 199  LEU B CD2 1 
ATOM   5176  N N   . SER B 1 204 ? 42.206  -0.461  50.799  1.00 37.49  ? 200  SER B N   1 
ATOM   5177  C CA  . SER B 1 204 ? 40.798  -0.147  50.559  1.00 37.27  ? 200  SER B CA  1 
ATOM   5178  C C   . SER B 1 204 ? 40.083  -1.262  49.793  1.00 36.75  ? 200  SER B C   1 
ATOM   5179  O O   . SER B 1 204 ? 38.882  -1.470  49.966  1.00 36.92  ? 200  SER B O   1 
ATOM   5180  C CB  . SER B 1 204 ? 40.650  1.193   49.838  1.00 36.90  ? 200  SER B CB  1 
ATOM   5181  O OG  . SER B 1 204 ? 41.417  1.227   48.648  1.00 36.54  ? 200  SER B OG  1 
ATOM   5182  N N   . ALA B 1 205 ? 40.831  -1.981  48.960  1.00 36.35  ? 201  ALA B N   1 
ATOM   5183  C CA  . ALA B 1 205 ? 40.295  -3.115  48.213  1.00 35.94  ? 201  ALA B CA  1 
ATOM   5184  C C   . ALA B 1 205 ? 40.033  -4.315  49.120  1.00 36.64  ? 201  ALA B C   1 
ATOM   5185  O O   . ALA B 1 205 ? 39.036  -5.020  48.950  1.00 36.67  ? 201  ALA B O   1 
ATOM   5186  C CB  . ALA B 1 205 ? 41.233  -3.494  47.093  1.00 35.61  ? 201  ALA B CB  1 
ATOM   5187  N N   . LEU B 1 206 ? 40.925  -4.537  50.083  1.00 37.25  ? 202  LEU B N   1 
ATOM   5188  C CA  . LEU B 1 206 ? 40.796  -5.661  51.012  1.00 38.06  ? 202  LEU B CA  1 
ATOM   5189  C C   . LEU B 1 206 ? 39.675  -5.494  52.033  1.00 38.69  ? 202  LEU B C   1 
ATOM   5190  O O   . LEU B 1 206 ? 39.122  -6.485  52.507  1.00 39.44  ? 202  LEU B O   1 
ATOM   5191  C CB  . LEU B 1 206 ? 42.120  -5.952  51.716  1.00 38.59  ? 202  LEU B CB  1 
ATOM   5192  C CG  . LEU B 1 206 ? 43.174  -6.620  50.831  1.00 38.57  ? 202  LEU B CG  1 
ATOM   5193  C CD1 . LEU B 1 206 ? 44.536  -6.628  51.501  1.00 39.18  ? 202  LEU B CD1 1 
ATOM   5194  C CD2 . LEU B 1 206 ? 42.746  -8.029  50.456  1.00 39.11  ? 202  LEU B CD2 1 
ATOM   5195  N N   . TYR B 1 207 ? 39.340  -4.249  52.369  1.00 38.62  ? 203  TYR B N   1 
ATOM   5196  C CA  . TYR B 1 207 ? 38.212  -3.983  53.263  1.00 39.36  ? 203  TYR B CA  1 
ATOM   5197  C C   . TYR B 1 207 ? 36.909  -4.325  52.551  1.00 38.93  ? 203  TYR B C   1 
ATOM   5198  O O   . TYR B 1 207 ? 35.949  -4.791  53.174  1.00 39.55  ? 203  TYR B O   1 
ATOM   5199  C CB  . TYR B 1 207 ? 38.193  -2.523  53.729  1.00 39.59  ? 203  TYR B CB  1 
ATOM   5200  C CG  . TYR B 1 207 ? 37.102  -2.215  54.741  1.00 40.61  ? 203  TYR B CG  1 
ATOM   5201  C CD1 . TYR B 1 207 ? 35.859  -1.722  54.335  1.00 40.51  ? 203  TYR B CD1 1 
ATOM   5202  C CD2 . TYR B 1 207 ? 37.312  -2.421  56.105  1.00 42.11  ? 203  TYR B CD2 1 
ATOM   5203  C CE1 . TYR B 1 207 ? 34.851  -1.442  55.264  1.00 41.57  ? 203  TYR B CE1 1 
ATOM   5204  C CE2 . TYR B 1 207 ? 36.312  -2.138  57.043  1.00 43.25  ? 203  TYR B CE2 1 
ATOM   5205  C CZ  . TYR B 1 207 ? 35.087  -1.651  56.613  1.00 42.99  ? 203  TYR B CZ  1 
ATOM   5206  O OH  . TYR B 1 207 ? 34.102  -1.377  57.534  1.00 44.15  ? 203  TYR B OH  1 
ATOM   5207  N N   . MET B 1 208 ? 36.890  -4.081  51.242  1.00 37.91  ? 204  MET B N   1 
ATOM   5208  C CA  . MET B 1 208 ? 35.754  -4.429  50.396  1.00 37.32  ? 204  MET B CA  1 
ATOM   5209  C C   . MET B 1 208 ? 35.523  -5.932  50.406  1.00 37.63  ? 204  MET B C   1 
ATOM   5210  O O   . MET B 1 208 ? 34.421  -6.395  50.115  1.00 37.58  ? 204  MET B O   1 
ATOM   5211  C CB  . MET B 1 208 ? 35.978  -3.933  48.971  1.00 36.30  ? 204  MET B CB  1 
ATOM   5212  C CG  . MET B 1 208 ? 35.870  -2.423  48.823  1.00 36.04  ? 204  MET B CG  1 
ATOM   5213  S SD  . MET B 1 208 ? 34.195  -1.794  49.070  1.00 36.13  ? 204  MET B SD  1 
ATOM   5214  C CE  . MET B 1 208 ? 33.319  -2.601  47.725  1.00 34.96  ? 204  MET B CE  1 
ATOM   5215  N N   . GLY B 1 209 ? 36.574  -6.680  50.745  1.00 37.96  ? 205  GLY B N   1 
ATOM   5216  C CA  . GLY B 1 209 ? 36.485  -8.121  50.932  1.00 38.61  ? 205  GLY B CA  1 
ATOM   5217  C C   . GLY B 1 209 ? 35.445  -8.445  51.980  1.00 39.60  ? 205  GLY B C   1 
ATOM   5218  O O   . GLY B 1 209 ? 34.514  -9.212  51.724  1.00 39.93  ? 205  GLY B O   1 
ATOM   5219  N N   . ALA B 1 210 ? 35.599  -7.835  53.154  1.00 40.21  ? 206  ALA B N   1 
ATOM   5220  C CA  . ALA B 1 210 ? 34.659  -7.997  54.261  1.00 41.28  ? 206  ALA B CA  1 
ATOM   5221  C C   . ALA B 1 210 ? 33.222  -7.639  53.865  1.00 41.00  ? 206  ALA B C   1 
ATOM   5222  O O   . ALA B 1 210 ? 32.302  -8.438  54.067  1.00 41.74  ? 206  ALA B O   1 
ATOM   5223  C CB  . ALA B 1 210 ? 35.108  -7.173  55.463  1.00 41.94  ? 206  ALA B CB  1 
ATOM   5224  N N   . LEU B 1 211 ? 33.039  -6.450  53.290  1.00 40.03  ? 207  LEU B N   1 
ATOM   5225  C CA  . LEU B 1 211 ? 31.715  -5.974  52.895  1.00 39.64  ? 207  LEU B CA  1 
ATOM   5226  C C   . LEU B 1 211 ? 31.071  -6.844  51.810  1.00 39.19  ? 207  LEU B C   1 
ATOM   5227  O O   . LEU B 1 211 ? 29.846  -6.955  51.750  1.00 39.34  ? 207  LEU B O   1 
ATOM   5228  C CB  . LEU B 1 211 ? 31.765  -4.506  52.457  1.00 38.86  ? 207  LEU B CB  1 
ATOM   5229  C CG  . LEU B 1 211 ? 32.178  -3.431  53.471  1.00 39.47  ? 207  LEU B CG  1 
ATOM   5230  C CD1 . LEU B 1 211 ? 32.076  -2.050  52.849  1.00 38.85  ? 207  LEU B CD1 1 
ATOM   5231  C CD2 . LEU B 1 211 ? 31.339  -3.489  54.734  1.00 40.98  ? 207  LEU B CD2 1 
ATOM   5232  N N   . ILE B 1 212 ? 31.897  -7.462  50.965  1.00 38.71  ? 208  ILE B N   1 
ATOM   5233  C CA  . ILE B 1 212 ? 31.412  -8.400  49.946  1.00 38.47  ? 208  ILE B CA  1 
ATOM   5234  C C   . ILE B 1 212 ? 30.810  -9.654  50.585  1.00 39.67  ? 208  ILE B C   1 
ATOM   5235  O O   . ILE B 1 212 ? 29.728  -10.097 50.184  1.00 39.88  ? 208  ILE B O   1 
ATOM   5236  C CB  . ILE B 1 212 ? 32.510  -8.742  48.895  1.00 37.84  ? 208  ILE B CB  1 
ATOM   5237  C CG1 . ILE B 1 212 ? 32.490  -7.697  47.773  1.00 36.69  ? 208  ILE B CG1 1 
ATOM   5238  C CG2 . ILE B 1 212 ? 32.315  -10.147 48.315  1.00 38.14  ? 208  ILE B CG2 1 
ATOM   5239  C CD1 . ILE B 1 212 ? 33.765  -7.598  46.976  1.00 36.31  ? 208  ILE B CD1 1 
ATOM   5240  N N   . LYS B 1 213 ? 31.497  -10.211 51.581  1.00 40.55  ? 209  LYS B N   1 
ATOM   5241  C CA  . LYS B 1 213 ? 30.954  -11.342 52.327  1.00 41.88  ? 209  LYS B CA  1 
ATOM   5242  C C   . LYS B 1 213 ? 29.723  -10.902 53.110  1.00 42.50  ? 209  LYS B C   1 
ATOM   5243  O O   . LYS B 1 213 ? 28.701  -11.589 53.090  1.00 43.27  ? 209  LYS B O   1 
ATOM   5244  C CB  . LYS B 1 213 ? 31.999  -11.952 53.269  1.00 42.96  ? 209  LYS B CB  1 
ATOM   5245  C CG  . LYS B 1 213 ? 31.517  -13.208 54.006  1.00 44.59  ? 209  LYS B CG  1 
ATOM   5246  C CD  . LYS B 1 213 ? 32.633  -13.860 54.812  1.00 45.63  ? 209  LYS B CD  1 
ATOM   5247  C CE  . LYS B 1 213 ? 32.183  -15.199 55.377  1.00 47.23  ? 209  LYS B CE  1 
ATOM   5248  N NZ  . LYS B 1 213 ? 33.339  -16.010 55.849  1.00 48.06  ? 209  LYS B NZ  1 
ATOM   5249  N N   . GLU B 1 214 ? 29.821  -9.750  53.776  1.00 42.38  ? 210  GLU B N   1 
ATOM   5250  C CA  . GLU B 1 214 ? 28.735  -9.229  54.612  1.00 43.04  ? 210  GLU B CA  1 
ATOM   5251  C C   . GLU B 1 214 ? 27.459  -8.962  53.809  1.00 42.43  ? 210  GLU B C   1 
ATOM   5252  O O   . GLU B 1 214 ? 26.350  -9.197  54.303  1.00 43.18  ? 210  GLU B O   1 
ATOM   5253  C CB  . GLU B 1 214 ? 29.168  -7.959  55.352  1.00 43.06  ? 210  GLU B CB  1 
ATOM   5254  C CG  . GLU B 1 214 ? 28.343  -7.666  56.605  1.00 44.41  ? 210  GLU B CG  1 
ATOM   5255  C CD  . GLU B 1 214 ? 28.421  -6.214  57.055  1.00 44.52  ? 210  GLU B CD  1 
ATOM   5256  O OE1 . GLU B 1 214 ? 29.519  -5.612  56.991  1.00 44.20  ? 210  GLU B OE1 1 
ATOM   5257  O OE2 . GLU B 1 214 ? 27.377  -5.676  57.484  1.00 44.87  ? 210  GLU B OE2 1 
ATOM   5258  N N   . ALA B 1 215 ? 27.627  -8.481  52.576  1.00 41.01  ? 211  ALA B N   1 
ATOM   5259  C CA  . ALA B 1 215 ? 26.504  -8.240  51.673  1.00 40.38  ? 211  ALA B CA  1 
ATOM   5260  C C   . ALA B 1 215 ? 25.827  -9.547  51.282  1.00 40.93  ? 211  ALA B C   1 
ATOM   5261  O O   . ALA B 1 215 ? 24.657  -9.554  50.893  1.00 40.95  ? 211  ALA B O   1 
ATOM   5262  C CB  . ALA B 1 215 ? 26.963  -7.496  50.437  1.00 38.97  ? 211  ALA B CB  1 
ATOM   5263  N N   . GLY B 1 216 ? 26.568  -10.647 51.388  1.00 41.41  ? 212  GLY B N   1 
ATOM   5264  C CA  . GLY B 1 216 ? 26.028  -11.971 51.106  1.00 42.17  ? 212  GLY B CA  1 
ATOM   5265  C C   . GLY B 1 216 ? 26.225  -12.408 49.668  1.00 41.37  ? 212  GLY B C   1 
ATOM   5266  O O   . GLY B 1 216 ? 25.346  -13.046 49.080  1.00 41.68  ? 212  GLY B O   1 
ATOM   5267  N N   . PHE B 1 217 ? 27.375  -12.056 49.098  1.00 40.44  ? 213  PHE B N   1 
ATOM   5268  C CA  . PHE B 1 217 ? 27.764  -12.545 47.780  1.00 39.82  ? 213  PHE B CA  1 
ATOM   5269  C C   . PHE B 1 217 ? 28.176  -14.013 47.881  1.00 40.92  ? 213  PHE B C   1 
ATOM   5270  O O   . PHE B 1 217 ? 28.900  -14.385 48.812  1.00 41.71  ? 213  PHE B O   1 
ATOM   5271  C CB  . PHE B 1 217 ? 28.923  -11.718 47.215  1.00 38.83  ? 213  PHE B CB  1 
ATOM   5272  C CG  . PHE B 1 217 ? 28.505  -10.401 46.624  1.00 37.32  ? 213  PHE B CG  1 
ATOM   5273  C CD1 . PHE B 1 217 ? 28.115  -10.317 45.295  1.00 36.19  ? 213  PHE B CD1 1 
ATOM   5274  C CD2 . PHE B 1 217 ? 28.513  -9.243  47.395  1.00 36.97  ? 213  PHE B CD2 1 
ATOM   5275  C CE1 . PHE B 1 217 ? 27.732  -9.104  44.744  1.00 35.62  ? 213  PHE B CE1 1 
ATOM   5276  C CE2 . PHE B 1 217 ? 28.132  -8.022  46.851  1.00 36.31  ? 213  PHE B CE2 1 
ATOM   5277  C CZ  . PHE B 1 217 ? 27.742  -7.952  45.522  1.00 35.55  ? 213  PHE B CZ  1 
ATOM   5278  N N   . PRO B 1 218 ? 27.716  -14.856 46.932  1.00 41.15  ? 214  PRO B N   1 
ATOM   5279  C CA  . PRO B 1 218 ? 28.084  -16.276 46.957  1.00 42.30  ? 214  PRO B CA  1 
ATOM   5280  C C   . PRO B 1 218 ? 29.604  -16.451 46.989  1.00 42.23  ? 214  PRO B C   1 
ATOM   5281  O O   . PRO B 1 218 ? 30.320  -15.661 46.368  1.00 41.14  ? 214  PRO B O   1 
ATOM   5282  C CB  . PRO B 1 218 ? 27.509  -16.814 45.641  1.00 42.27  ? 214  PRO B CB  1 
ATOM   5283  C CG  . PRO B 1 218 ? 26.401  -15.879 45.297  1.00 41.38  ? 214  PRO B CG  1 
ATOM   5284  C CD  . PRO B 1 218 ? 26.846  -14.531 45.784  1.00 40.42  ? 214  PRO B CD  1 
ATOM   5285  N N   . PRO B 1 219 ? 30.100  -17.463 47.728  1.00 43.45  ? 215  PRO B N   1 
ATOM   5286  C CA  . PRO B 1 219 ? 31.548  -17.669 47.826  1.00 43.45  ? 215  PRO B CA  1 
ATOM   5287  C C   . PRO B 1 219 ? 32.202  -17.901 46.465  1.00 42.86  ? 215  PRO B C   1 
ATOM   5288  O O   . PRO B 1 219 ? 31.655  -18.621 45.624  1.00 43.24  ? 215  PRO B O   1 
ATOM   5289  C CB  . PRO B 1 219 ? 31.675  -18.914 48.715  1.00 45.11  ? 215  PRO B CB  1 
ATOM   5290  C CG  . PRO B 1 219 ? 30.326  -19.560 48.688  1.00 46.04  ? 215  PRO B CG  1 
ATOM   5291  C CD  . PRO B 1 219 ? 29.351  -18.441 48.535  1.00 45.02  ? 215  PRO B CD  1 
ATOM   5292  N N   . GLY B 1 220 ? 33.351  -17.264 46.257  1.00 41.98  ? 216  GLY B N   1 
ATOM   5293  C CA  . GLY B 1 220 ? 34.116  -17.418 45.028  1.00 41.53  ? 216  GLY B CA  1 
ATOM   5294  C C   . GLY B 1 220 ? 33.713  -16.489 43.895  1.00 40.35  ? 216  GLY B C   1 
ATOM   5295  O O   . GLY B 1 220 ? 34.235  -16.611 42.786  1.00 40.26  ? 216  GLY B O   1 
ATOM   5296  N N   . VAL B 1 221 ? 32.788  -15.566 44.156  1.00 39.51  ? 217  VAL B N   1 
ATOM   5297  C CA  . VAL B 1 221 ? 32.355  -14.616 43.126  1.00 38.24  ? 217  VAL B CA  1 
ATOM   5298  C C   . VAL B 1 221 ? 33.382  -13.500 42.984  1.00 37.16  ? 217  VAL B C   1 
ATOM   5299  O O   . VAL B 1 221 ? 33.794  -13.169 41.875  1.00 36.72  ? 217  VAL B O   1 
ATOM   5300  C CB  . VAL B 1 221 ? 30.926  -14.058 43.383  1.00 38.02  ? 217  VAL B CB  1 
ATOM   5301  C CG1 . VAL B 1 221 ? 30.597  -12.917 42.428  1.00 36.85  ? 217  VAL B CG1 1 
ATOM   5302  C CG2 . VAL B 1 221 ? 29.892  -15.161 43.228  1.00 38.87  ? 217  VAL B CG2 1 
ATOM   5303  N N   . ILE B 1 222 ? 33.800  -12.925 44.104  1.00 36.92  ? 218  ILE B N   1 
ATOM   5304  C CA  . ILE B 1 222 ? 34.879  -11.945 44.078  1.00 36.09  ? 218  ILE B CA  1 
ATOM   5305  C C   . ILE B 1 222 ? 36.076  -12.450 44.877  1.00 36.65  ? 218  ILE B C   1 
ATOM   5306  O O   . ILE B 1 222 ? 35.976  -12.712 46.077  1.00 37.13  ? 218  ILE B O   1 
ATOM   5307  C CB  . ILE B 1 222 ? 34.443  -10.541 44.577  1.00 35.40  ? 218  ILE B CB  1 
ATOM   5308  C CG1 . ILE B 1 222 ? 33.120  -10.102 43.936  1.00 35.01  ? 218  ILE B CG1 1 
ATOM   5309  C CG2 . ILE B 1 222 ? 35.521  -9.509  44.266  1.00 34.53  ? 218  ILE B CG2 1 
ATOM   5310  C CD1 . ILE B 1 222 ? 31.890  -10.385 44.770  1.00 35.10  ? 218  ILE B CD1 1 
ATOM   5311  N N   . ASN B 1 223 ? 37.201  -12.593 44.185  1.00 36.55  ? 219  ASN B N   1 
ATOM   5312  C CA  . ASN B 1 223 ? 38.457  -13.007 44.793  1.00 37.10  ? 219  ASN B CA  1 
ATOM   5313  C C   . ASN B 1 223 ? 39.507  -11.906 44.709  1.00 36.42  ? 219  ASN B C   1 
ATOM   5314  O O   . ASN B 1 223 ? 39.981  -11.554 43.621  1.00 35.91  ? 219  ASN B O   1 
ATOM   5315  C CB  . ASN B 1 223 ? 38.976  -14.279 44.129  1.00 37.93  ? 219  ASN B CB  1 
ATOM   5316  C CG  . ASN B 1 223 ? 38.011  -15.422 44.254  1.00 38.93  ? 219  ASN B CG  1 
ATOM   5317  O OD1 . ASN B 1 223 ? 37.984  -16.115 45.269  1.00 40.31  ? 219  ASN B OD1 1 
ATOM   5318  N ND2 . ASN B 1 223 ? 37.202  -15.627 43.222  1.00 39.21  ? 219  ASN B ND2 1 
ATOM   5319  N N   . ILE B 1 224 ? 39.868  -11.372 45.870  1.00 36.40  ? 220  ILE B N   1 
ATOM   5320  C CA  . ILE B 1 224 ? 40.797  -10.253 45.948  1.00 35.87  ? 220  ILE B CA  1 
ATOM   5321  C C   . ILE B 1 224 ? 42.204  -10.748 46.283  1.00 36.44  ? 220  ILE B C   1 
ATOM   5322  O O   . ILE B 1 224 ? 42.394  -11.482 47.257  1.00 37.26  ? 220  ILE B O   1 
ATOM   5323  C CB  . ILE B 1 224 ? 40.302  -9.203  46.967  1.00 35.61  ? 220  ILE B CB  1 
ATOM   5324  C CG1 . ILE B 1 224 ? 38.847  -8.832  46.649  1.00 34.99  ? 220  ILE B CG1 1 
ATOM   5325  C CG2 . ILE B 1 224 ? 41.207  -7.973  46.960  1.00 35.11  ? 220  ILE B CG2 1 
ATOM   5326  C CD1 . ILE B 1 224 ? 38.176  -7.963  47.675  1.00 35.20  ? 220  ILE B CD1 1 
ATOM   5327  N N   . LEU B 1 225 ? 43.180  -10.358 45.461  1.00 36.07  ? 221  LEU B N   1 
ATOM   5328  C CA  . LEU B 1 225 ? 44.563  -10.818 45.636  1.00 36.60  ? 221  LEU B CA  1 
ATOM   5329  C C   . LEU B 1 225 ? 45.593  -9.687  45.628  1.00 36.32  ? 221  LEU B C   1 
ATOM   5330  O O   . LEU B 1 225 ? 46.003  -9.227  44.563  1.00 35.85  ? 221  LEU B O   1 
ATOM   5331  C CB  . LEU B 1 225 ? 44.935  -11.884 44.597  1.00 36.79  ? 221  LEU B CB  1 
ATOM   5332  C CG  . LEU B 1 225 ? 44.136  -13.180 44.656  1.00 37.31  ? 221  LEU B CG  1 
ATOM   5333  C CD1 . LEU B 1 225 ? 43.071  -13.169 43.589  1.00 36.87  ? 221  LEU B CD1 1 
ATOM   5334  C CD2 . LEU B 1 225 ? 45.042  -14.368 44.483  1.00 38.66  ? 221  LEU B CD2 1 
ATOM   5335  N N   . PRO B 1 226 ? 46.018  -9.245  46.825  1.00 36.73  ? 222  PRO B N   1 
ATOM   5336  C CA  . PRO B 1 226 ? 47.070  -8.238  46.958  1.00 36.69  ? 222  PRO B CA  1 
ATOM   5337  C C   . PRO B 1 226 ? 48.453  -8.820  46.657  1.00 37.23  ? 222  PRO B C   1 
ATOM   5338  O O   . PRO B 1 226 ? 48.764  -9.931  47.090  1.00 37.97  ? 222  PRO B O   1 
ATOM   5339  C CB  . PRO B 1 226 ? 46.975  -7.826  48.428  1.00 37.17  ? 222  PRO B CB  1 
ATOM   5340  C CG  . PRO B 1 226 ? 46.410  -9.012  49.119  1.00 37.71  ? 222  PRO B CG  1 
ATOM   5341  C CD  . PRO B 1 226 ? 45.494  -9.677  48.135  1.00 37.37  ? 222  PRO B CD  1 
ATOM   5342  N N   . GLY B 1 227 ? 49.266  -8.071  45.919  1.00 36.97  ? 223  GLY B N   1 
ATOM   5343  C CA  . GLY B 1 227 ? 50.601  -8.522  45.535  1.00 37.50  ? 223  GLY B CA  1 
ATOM   5344  C C   . GLY B 1 227 ? 51.217  -7.679  44.433  1.00 37.32  ? 223  GLY B C   1 
ATOM   5345  O O   . GLY B 1 227 ? 50.630  -6.683  43.996  1.00 36.88  ? 223  GLY B O   1 
ATOM   5346  N N   . TYR B 1 228 ? 52.398  -8.090  43.975  1.00 37.74  ? 224  TYR B N   1 
ATOM   5347  C CA  . TYR B 1 228 ? 53.150  -7.329  42.981  1.00 37.57  ? 224  TYR B CA  1 
ATOM   5348  C C   . TYR B 1 228 ? 52.739  -7.639  41.548  1.00 37.53  ? 224  TYR B C   1 
ATOM   5349  O O   . TYR B 1 228 ? 51.919  -8.527  41.303  1.00 37.53  ? 224  TYR B O   1 
ATOM   5350  C CB  . TYR B 1 228 ? 54.654  -7.539  43.173  1.00 38.20  ? 224  TYR B CB  1 
ATOM   5351  C CG  . TYR B 1 228 ? 55.168  -6.900  44.435  1.00 38.28  ? 224  TYR B CG  1 
ATOM   5352  C CD1 . TYR B 1 228 ? 55.619  -5.584  44.433  1.00 38.10  ? 224  TYR B CD1 1 
ATOM   5353  C CD2 . TYR B 1 228 ? 55.183  -7.603  45.638  1.00 38.70  ? 224  TYR B CD2 1 
ATOM   5354  C CE1 . TYR B 1 228 ? 56.078  -4.984  45.595  1.00 38.69  ? 224  TYR B CE1 1 
ATOM   5355  C CE2 . TYR B 1 228 ? 55.639  -7.015  46.804  1.00 39.20  ? 224  TYR B CE2 1 
ATOM   5356  C CZ  . TYR B 1 228 ? 56.087  -5.704  46.779  1.00 39.26  ? 224  TYR B CZ  1 
ATOM   5357  O OH  . TYR B 1 228 ? 56.546  -5.112  47.936  1.00 40.13  ? 224  TYR B OH  1 
ATOM   5358  N N   . GLY B 1 229 ? 53.325  -6.897  40.612  1.00 37.59  ? 225  GLY B N   1 
ATOM   5359  C CA  . GLY B 1 229 ? 53.013  -7.018  39.195  1.00 37.58  ? 225  GLY B CA  1 
ATOM   5360  C C   . GLY B 1 229 ? 53.449  -8.304  38.515  1.00 38.38  ? 225  GLY B C   1 
ATOM   5361  O O   . GLY B 1 229 ? 52.604  -9.051  38.028  1.00 38.44  ? 225  GLY B O   1 
ATOM   5362  N N   . PRO B 1 230 ? 54.770  -8.565  38.455  1.00 39.14  ? 226  PRO B N   1 
ATOM   5363  C CA  . PRO B 1 230 ? 55.273  -9.765  37.780  1.00 40.16  ? 226  PRO B CA  1 
ATOM   5364  C C   . PRO B 1 230 ? 54.962  -11.086 38.493  1.00 40.66  ? 226  PRO B C   1 
ATOM   5365  O O   . PRO B 1 230 ? 55.046  -12.146 37.872  1.00 41.43  ? 226  PRO B O   1 
ATOM   5366  C CB  . PRO B 1 230 ? 56.787  -9.521  37.716  1.00 40.73  ? 226  PRO B CB  1 
ATOM   5367  C CG  . PRO B 1 230 ? 56.937  -8.044  37.824  1.00 40.08  ? 226  PRO B CG  1 
ATOM   5368  C CD  . PRO B 1 230 ? 55.874  -7.654  38.804  1.00 39.32  ? 226  PRO B CD  1 
ATOM   5369  N N   . THR B 1 231 ? 54.609  -11.027 39.775  1.00 40.51  ? 227  THR B N   1 
ATOM   5370  C CA  . THR B 1 231 ? 54.174  -12.224 40.502  1.00 41.18  ? 227  THR B CA  1 
ATOM   5371  C C   . THR B 1 231 ? 52.668  -12.456 40.353  1.00 40.92  ? 227  THR B C   1 
ATOM   5372  O O   . THR B 1 231 ? 52.241  -13.358 39.628  1.00 41.47  ? 227  THR B O   1 
ATOM   5373  C CB  . THR B 1 231 ? 54.551  -12.188 42.011  1.00 41.23  ? 227  THR B CB  1 
ATOM   5374  O OG1 . THR B 1 231 ? 54.134  -10.944 42.593  1.00 40.33  ? 227  THR B OG1 1 
ATOM   5375  C CG2 . THR B 1 231 ? 56.053  -12.381 42.201  1.00 41.94  ? 227  THR B CG2 1 
ATOM   5376  N N   . ALA B 1 232 ? 51.870  -11.633 41.028  1.00 40.18  ? 228  ALA B N   1 
ATOM   5377  C CA  . ALA B 1 232 ? 50.427  -11.825 41.061  1.00 39.94  ? 228  ALA B CA  1 
ATOM   5378  C C   . ALA B 1 232 ? 49.772  -11.507 39.721  1.00 39.68  ? 228  ALA B C   1 
ATOM   5379  O O   . ALA B 1 232 ? 49.041  -12.334 39.178  1.00 40.07  ? 228  ALA B O   1 
ATOM   5380  C CB  . ALA B 1 232 ? 49.804  -11.003 42.178  1.00 39.23  ? 228  ALA B CB  1 
ATOM   5381  N N   . GLY B 1 233 ? 50.055  -10.320 39.192  1.00 39.29  ? 229  GLY B N   1 
ATOM   5382  C CA  . GLY B 1 233 ? 49.425  -9.832  37.963  1.00 39.21  ? 229  GLY B CA  1 
ATOM   5383  C C   . GLY B 1 233 ? 49.703  -10.661 36.723  1.00 40.11  ? 229  GLY B C   1 
ATOM   5384  O O   . GLY B 1 233 ? 48.780  -11.010 35.983  1.00 40.27  ? 229  GLY B O   1 
ATOM   5385  N N   . ALA B 1 234 ? 50.974  -10.977 36.497  1.00 40.88  ? 230  ALA B N   1 
ATOM   5386  C CA  . ALA B 1 234 ? 51.389  -11.756 35.330  1.00 41.98  ? 230  ALA B CA  1 
ATOM   5387  C C   . ALA B 1 234 ? 50.864  -13.191 35.354  1.00 42.83  ? 230  ALA B C   1 
ATOM   5388  O O   . ALA B 1 234 ? 50.683  -13.804 34.300  1.00 43.74  ? 230  ALA B O   1 
ATOM   5389  C CB  . ALA B 1 234 ? 52.894  -11.745 35.200  1.00 42.59  ? 230  ALA B CB  1 
ATOM   5390  N N   . ALA B 1 235 ? 50.626  -13.719 36.555  1.00 42.77  ? 231  ALA B N   1 
ATOM   5391  C CA  . ALA B 1 235 ? 50.050  -15.053 36.725  1.00 43.45  ? 231  ALA B CA  1 
ATOM   5392  C C   . ALA B 1 235 ? 48.616  -15.095 36.219  1.00 43.18  ? 231  ALA B C   1 
ATOM   5393  O O   . ALA B 1 235 ? 48.169  -16.122 35.708  1.00 44.12  ? 231  ALA B O   1 
ATOM   5394  C CB  . ALA B 1 235 ? 50.110  -15.481 38.180  1.00 43.50  ? 231  ALA B CB  1 
ATOM   5395  N N   . ILE B 1 236 ? 47.909  -13.973 36.370  1.00 42.07  ? 232  ILE B N   1 
ATOM   5396  C CA  . ILE B 1 236 ? 46.544  -13.809 35.867  1.00 41.63  ? 232  ILE B CA  1 
ATOM   5397  C C   . ILE B 1 236 ? 46.533  -13.744 34.338  1.00 42.05  ? 232  ILE B C   1 
ATOM   5398  O O   . ILE B 1 236 ? 45.753  -14.444 33.690  1.00 42.64  ? 232  ILE B O   1 
ATOM   5399  C CB  . ILE B 1 236 ? 45.868  -12.537 36.453  1.00 40.43  ? 232  ILE B CB  1 
ATOM   5400  C CG1 . ILE B 1 236 ? 45.575  -12.714 37.946  1.00 40.18  ? 232  ILE B CG1 1 
ATOM   5401  C CG2 . ILE B 1 236 ? 44.584  -12.186 35.693  1.00 40.12  ? 232  ILE B CG2 1 
ATOM   5402  C CD1 . ILE B 1 236 ? 45.160  -11.429 38.664  1.00 38.94  ? 232  ILE B CD1 1 
ATOM   5403  N N   . ALA B 1 237 ? 47.410  -12.912 33.775  1.00 41.90  ? 233  ALA B N   1 
ATOM   5404  C CA  . ALA B 1 237 ? 47.483  -12.695 32.328  1.00 42.37  ? 233  ALA B CA  1 
ATOM   5405  C C   . ALA B 1 237 ? 47.871  -13.949 31.549  1.00 43.81  ? 233  ALA B C   1 
ATOM   5406  O O   . ALA B 1 237 ? 47.511  -14.094 30.377  1.00 44.51  ? 233  ALA B O   1 
ATOM   5407  C CB  . ALA B 1 237 ? 48.446  -11.558 32.010  1.00 42.20  ? 233  ALA B CB  1 
ATOM   5408  N N   . SER B 1 238 ? 48.603  -14.846 32.204  1.00 44.38  ? 234  SER B N   1 
ATOM   5409  C CA  . SER B 1 238 ? 49.056  -16.087 31.579  1.00 45.91  ? 234  SER B CA  1 
ATOM   5410  C C   . SER B 1 238 ? 48.206  -17.294 31.967  1.00 46.44  ? 234  SER B C   1 
ATOM   5411  O O   . SER B 1 238 ? 48.298  -18.347 31.332  1.00 47.93  ? 234  SER B O   1 
ATOM   5412  C CB  . SER B 1 238 ? 50.526  -16.348 31.911  1.00 46.52  ? 234  SER B CB  1 
ATOM   5413  O OG  . SER B 1 238 ? 51.361  -15.437 31.221  1.00 46.72  ? 234  SER B OG  1 
ATOM   5414  N N   . HIS B 1 239 ? 47.383  -17.137 33.004  1.00 45.39  ? 235  HIS B N   1 
ATOM   5415  C CA  . HIS B 1 239 ? 46.539  -18.225 33.495  1.00 45.85  ? 235  HIS B CA  1 
ATOM   5416  C C   . HIS B 1 239 ? 45.649  -18.795 32.397  1.00 46.46  ? 235  HIS B C   1 
ATOM   5417  O O   . HIS B 1 239 ? 45.068  -18.054 31.604  1.00 45.97  ? 235  HIS B O   1 
ATOM   5418  C CB  . HIS B 1 239 ? 45.683  -17.773 34.677  1.00 44.70  ? 235  HIS B CB  1 
ATOM   5419  C CG  . HIS B 1 239 ? 45.300  -18.890 35.593  1.00 45.69  ? 235  HIS B CG  1 
ATOM   5420  N ND1 . HIS B 1 239 ? 44.295  -19.785 35.294  1.00 46.59  ? 235  HIS B ND1 1 
ATOM   5421  C CD2 . HIS B 1 239 ? 45.802  -19.273 36.791  1.00 46.35  ? 235  HIS B CD2 1 
ATOM   5422  C CE1 . HIS B 1 239 ? 44.188  -20.666 36.273  1.00 47.63  ? 235  HIS B CE1 1 
ATOM   5423  N NE2 . HIS B 1 239 ? 45.089  -20.377 37.196  1.00 47.54  ? 235  HIS B NE2 1 
ATOM   5424  N N   . ILE B 1 240 ? 45.556  -20.119 32.363  1.00 47.68  ? 236  ILE B N   1 
ATOM   5425  C CA  . ILE B 1 240 ? 44.844  -20.820 31.302  1.00 48.56  ? 236  ILE B CA  1 
ATOM   5426  C C   . ILE B 1 240 ? 43.354  -21.002 31.630  1.00 47.99  ? 236  ILE B C   1 
ATOM   5427  O O   . ILE B 1 240 ? 42.550  -21.332 30.752  1.00 48.62  ? 236  ILE B O   1 
ATOM   5428  C CB  . ILE B 1 240 ? 45.548  -22.173 30.962  1.00 50.68  ? 236  ILE B CB  1 
ATOM   5429  C CG1 . ILE B 1 240 ? 45.201  -22.642 29.542  1.00 52.20  ? 236  ILE B CG1 1 
ATOM   5430  C CG2 . ILE B 1 240 ? 45.280  -23.242 32.034  1.00 51.31  ? 236  ILE B CG2 1 
ATOM   5431  C CD1 . ILE B 1 240 ? 46.034  -21.979 28.447  1.00 52.47  ? 236  ILE B CD1 1 
ATOM   5432  N N   . GLY B 1 241 ? 42.998  -20.771 32.893  1.00 46.77  ? 237  GLY B N   1 
ATOM   5433  C CA  . GLY B 1 241 ? 41.615  -20.907 33.359  1.00 46.01  ? 237  GLY B CA  1 
ATOM   5434  C C   . GLY B 1 241 ? 40.870  -19.595 33.562  1.00 43.98  ? 237  GLY B C   1 
ATOM   5435  O O   . GLY B 1 241 ? 39.794  -19.577 34.169  1.00 43.54  ? 237  GLY B O   1 
ATOM   5436  N N   . ILE B 1 242 ? 41.440  -18.501 33.055  1.00 42.75  ? 238  ILE B N   1 
ATOM   5437  C CA  . ILE B 1 242 ? 40.811  -17.179 33.117  1.00 40.80  ? 238  ILE B CA  1 
ATOM   5438  C C   . ILE B 1 242 ? 40.308  -16.778 31.730  1.00 40.52  ? 238  ILE B C   1 
ATOM   5439  O O   . ILE B 1 242 ? 41.077  -16.744 30.767  1.00 41.21  ? 238  ILE B O   1 
ATOM   5440  C CB  . ILE B 1 242 ? 41.772  -16.117 33.714  1.00 39.84  ? 238  ILE B CB  1 
ATOM   5441  C CG1 . ILE B 1 242 ? 41.848  -16.286 35.235  1.00 39.44  ? 238  ILE B CG1 1 
ATOM   5442  C CG2 . ILE B 1 242 ? 41.319  -14.701 33.368  1.00 38.70  ? 238  ILE B CG2 1 
ATOM   5443  C CD1 . ILE B 1 242 ? 42.937  -15.481 35.905  1.00 38.67  ? 238  ILE B CD1 1 
ATOM   5444  N N   . ASP B 1 243 ? 39.011  -16.494 31.639  1.00 72.02  ? 239  ASP B N   1 
ATOM   5445  C CA  . ASP B 1 243 ? 38.352  -16.232 30.361  1.00 74.20  ? 239  ASP B CA  1 
ATOM   5446  C C   . ASP B 1 243 ? 38.597  -14.829 29.836  1.00 71.74  ? 239  ASP B C   1 
ATOM   5447  O O   . ASP B 1 243 ? 38.616  -14.614 28.627  1.00 74.07  ? 239  ASP B O   1 
ATOM   5448  C CB  . ASP B 1 243 ? 36.845  -16.465 30.480  1.00 76.76  ? 239  ASP B CB  1 
ATOM   5449  C CG  . ASP B 1 243 ? 36.495  -17.918 30.692  1.00 79.98  ? 239  ASP B CG  1 
ATOM   5450  O OD1 . ASP B 1 243 ? 36.809  -18.741 29.811  1.00 83.42  ? 239  ASP B OD1 1 
ATOM   5451  O OD2 . ASP B 1 243 ? 35.894  -18.234 31.737  1.00 79.79  ? 239  ASP B OD2 1 
ATOM   5452  N N   . LYS B 1 244 ? 38.773  -13.878 30.747  1.00 67.53  ? 240  LYS B N   1 
ATOM   5453  C CA  . LYS B 1 244 ? 38.840  -12.470 30.381  1.00 65.39  ? 240  LYS B CA  1 
ATOM   5454  C C   . LYS B 1 244 ? 39.799  -11.706 31.284  1.00 61.58  ? 240  LYS B C   1 
ATOM   5455  O O   . LYS B 1 244 ? 39.884  -11.977 32.481  1.00 60.52  ? 240  LYS B O   1 
ATOM   5456  C CB  . LYS B 1 244 ? 37.439  -11.853 30.465  1.00 66.09  ? 240  LYS B CB  1 
ATOM   5457  C CG  . LYS B 1 244 ? 37.226  -10.588 29.643  1.00 65.90  ? 240  LYS B CG  1 
ATOM   5458  C CD  . LYS B 1 244 ? 37.412  -9.312  30.462  1.00 62.27  ? 240  LYS B CD  1 
ATOM   5459  C CE  . LYS B 1 244 ? 36.938  -8.083  29.691  1.00 62.48  ? 240  LYS B CE  1 
ATOM   5460  N NZ  . LYS B 1 244 ? 37.575  -7.957  28.347  1.00 63.61  ? 240  LYS B NZ  1 
ATOM   5461  N N   . ILE B 1 245 ? 40.520  -10.753 30.704  1.00 60.20  ? 241  ILE B N   1 
ATOM   5462  C CA  . ILE B 1 245 ? 41.357  -9.858  31.491  1.00 57.28  ? 241  ILE B CA  1 
ATOM   5463  C C   . ILE B 1 245 ? 41.067  -8.397  31.181  1.00 55.88  ? 241  ILE B C   1 
ATOM   5464  O O   . ILE B 1 245 ? 40.898  -8.014  30.021  1.00 57.03  ? 241  ILE B O   1 
ATOM   5465  C CB  . ILE B 1 245 ? 42.867  -10.167 31.345  1.00 57.69  ? 241  ILE B CB  1 
ATOM   5466  C CG1 . ILE B 1 245 ? 43.675  -9.307  32.322  1.00 55.64  ? 241  ILE B CG1 1 
ATOM   5467  C CG2 . ILE B 1 245 ? 43.336  -9.984  29.896  1.00 59.58  ? 241  ILE B CG2 1 
ATOM   5468  C CD1 . ILE B 1 245 ? 44.988  -9.906  32.740  1.00 56.97  ? 241  ILE B CD1 1 
ATOM   5469  N N   . ALA B 1 246 ? 40.996  -7.597  32.240  1.00 53.98  ? 242  ALA B N   1 
ATOM   5470  C CA  . ALA B 1 246 ? 40.802  -6.159  32.124  1.00 52.77  ? 242  ALA B CA  1 
ATOM   5471  C C   . ALA B 1 246 ? 41.888  -5.423  32.908  1.00 51.49  ? 242  ALA B C   1 
ATOM   5472  O O   . ALA B 1 246 ? 41.857  -5.361  34.144  1.00 51.50  ? 242  ALA B O   1 
ATOM   5473  C CB  . ALA B 1 246 ? 39.413  -5.765  32.604  1.00 53.09  ? 242  ALA B CB  1 
ATOM   5474  N N   . PHE B 1 247 ? 42.855  -4.886  32.168  1.00 51.28  ? 243  PHE B N   1 
ATOM   5475  C CA  . PHE B 1 247 ? 43.995  -4.183  32.738  1.00 50.84  ? 243  PHE B CA  1 
ATOM   5476  C C   . PHE B 1 247 ? 43.827  -2.679  32.592  1.00 50.01  ? 243  PHE B C   1 
ATOM   5477  O O   . PHE B 1 247 ? 43.197  -2.196  31.651  1.00 49.77  ? 243  PHE B O   1 
ATOM   5478  C CB  . PHE B 1 247 ? 45.298  -4.644  32.062  1.00 52.33  ? 243  PHE B CB  1 
ATOM   5479  C CG  . PHE B 1 247 ? 46.501  -3.786  32.379  1.00 52.79  ? 243  PHE B CG  1 
ATOM   5480  C CD1 . PHE B 1 247 ? 46.872  -2.744  31.536  1.00 52.89  ? 243  PHE B CD1 1 
ATOM   5481  C CD2 . PHE B 1 247 ? 47.263  -4.026  33.517  1.00 53.78  ? 243  PHE B CD2 1 
ATOM   5482  C CE1 . PHE B 1 247 ? 47.974  -1.948  31.828  1.00 54.20  ? 243  PHE B CE1 1 
ATOM   5483  C CE2 . PHE B 1 247 ? 48.370  -3.237  33.813  1.00 55.34  ? 243  PHE B CE2 1 
ATOM   5484  C CZ  . PHE B 1 247 ? 48.726  -2.197  32.966  1.00 55.54  ? 243  PHE B CZ  1 
ATOM   5485  N N   . THR B 1 248 ? 44.406  -1.956  33.544  1.00 50.16  ? 244  THR B N   1 
ATOM   5486  C CA  . THR B 1 248 ? 44.481  -0.505  33.513  1.00 50.02  ? 244  THR B CA  1 
ATOM   5487  C C   . THR B 1 248 ? 45.762  -0.033  34.217  1.00 51.49  ? 244  THR B C   1 
ATOM   5488  O O   . THR B 1 248 ? 46.007  -0.376  35.375  1.00 52.69  ? 244  THR B O   1 
ATOM   5489  C CB  . THR B 1 248 ? 43.206  0.144   34.111  1.00 49.61  ? 244  THR B CB  1 
ATOM   5490  O OG1 . THR B 1 248 ? 43.489  1.481   34.536  1.00 50.40  ? 244  THR B OG1 1 
ATOM   5491  C CG2 . THR B 1 248 ? 42.693  -0.653  35.289  1.00 50.68  ? 244  THR B CG2 1 
ATOM   5492  N N   . GLY B 1 249 ? 46.582  0.731   33.498  1.00 52.21  ? 245  GLY B N   1 
ATOM   5493  C CA  . GLY B 1 249 ? 47.853  1.238   34.023  1.00 54.55  ? 245  GLY B CA  1 
ATOM   5494  C C   . GLY B 1 249 ? 48.761  1.782   32.936  1.00 55.84  ? 245  GLY B C   1 
ATOM   5495  O O   . GLY B 1 249 ? 48.286  2.288   31.918  1.00 54.82  ? 245  GLY B O   1 
ATOM   5496  N N   . SER B 1 250 ? 50.070  1.672   33.151  1.00 58.81  ? 246  SER B N   1 
ATOM   5497  C CA  . SER B 1 250 ? 51.060  2.162   32.193  1.00 61.23  ? 246  SER B CA  1 
ATOM   5498  C C   . SER B 1 250 ? 51.028  1.376   30.884  1.00 61.51  ? 246  SER B C   1 
ATOM   5499  O O   . SER B 1 250 ? 50.672  0.197   30.865  1.00 60.66  ? 246  SER B O   1 
ATOM   5500  C CB  . SER B 1 250 ? 52.464  2.132   32.800  1.00 65.35  ? 246  SER B CB  1 
ATOM   5501  O OG  . SER B 1 250 ? 52.883  0.805   33.057  1.00 66.52  ? 246  SER B OG  1 
ATOM   5502  N N   . THR B 1 251 ? 51.403  2.047   29.797  1.00 63.45  ? 247  THR B N   1 
ATOM   5503  C CA  . THR B 1 251 ? 51.372  1.469   28.449  1.00 65.14  ? 247  THR B CA  1 
ATOM   5504  C C   . THR B 1 251 ? 52.354  0.306   28.277  1.00 68.79  ? 247  THR B C   1 
ATOM   5505  O O   . THR B 1 251 ? 52.030  -0.693  27.632  1.00 69.33  ? 247  THR B O   1 
ATOM   5506  C CB  . THR B 1 251 ? 51.652  2.536   27.359  1.00 67.17  ? 247  THR B CB  1 
ATOM   5507  O OG1 . THR B 1 251 ? 52.891  3.195   27.638  1.00 70.72  ? 247  THR B OG1 1 
ATOM   5508  C CG2 . THR B 1 251 ? 50.550  3.577   27.314  1.00 64.02  ? 247  THR B CG2 1 
ATOM   5509  N N   . GLU B 1 252 ? 53.544  0.443   28.861  1.00 71.99  ? 248  GLU B N   1 
ATOM   5510  C CA  . GLU B 1 252 ? 54.600  -0.568  28.743  1.00 76.57  ? 248  GLU B CA  1 
ATOM   5511  C C   . GLU B 1 252 ? 54.195  -1.906  29.350  1.00 74.99  ? 248  GLU B C   1 
ATOM   5512  O O   . GLU B 1 252 ? 54.520  -2.965  28.810  1.00 77.67  ? 248  GLU B O   1 
ATOM   5513  C CB  . GLU B 1 252 ? 55.897  -0.076  29.385  1.00 80.66  ? 248  GLU B CB  1 
ATOM   5514  C CG  . GLU B 1 252 ? 56.571  1.062   28.634  1.00 84.61  ? 248  GLU B CG  1 
ATOM   5515  C CD  . GLU B 1 252 ? 57.983  1.345   29.119  1.00 90.89  ? 248  GLU B CD  1 
ATOM   5516  O OE1 . GLU B 1 252 ? 58.322  0.981   30.267  1.00 91.68  ? 248  GLU B OE1 1 
ATOM   5517  O OE2 . GLU B 1 252 ? 58.759  1.942   28.346  1.00 95.58  ? 248  GLU B OE2 1 
ATOM   5518  N N   . VAL B 1 253 ? 53.491  -1.846  30.477  1.00 71.35  ? 249  VAL B N   1 
ATOM   5519  C CA  . VAL B 1 253 ? 52.990  -3.037  31.150  1.00 69.76  ? 249  VAL B CA  1 
ATOM   5520  C C   . VAL B 1 253 ? 51.787  -3.592  30.388  1.00 67.26  ? 249  VAL B C   1 
ATOM   5521  O O   . VAL B 1 253 ? 51.608  -4.808  30.302  1.00 67.78  ? 249  VAL B O   1 
ATOM   5522  C CB  . VAL B 1 253 ? 52.639  -2.741  32.627  1.00 67.76  ? 249  VAL B CB  1 
ATOM   5523  C CG1 . VAL B 1 253 ? 52.027  -3.955  33.302  1.00 66.27  ? 249  VAL B CG1 1 
ATOM   5524  C CG2 . VAL B 1 253 ? 53.881  -2.295  33.385  1.00 71.63  ? 249  VAL B CG2 1 
ATOM   5525  N N   . GLY B 1 254 ? 50.986  -2.692  29.819  1.00 65.25  ? 250  GLY B N   1 
ATOM   5526  C CA  . GLY B 1 254 ? 49.825  -3.065  29.011  1.00 63.91  ? 250  GLY B CA  1 
ATOM   5527  C C   . GLY B 1 254 ? 50.174  -3.867  27.770  1.00 67.71  ? 250  GLY B C   1 
ATOM   5528  O O   . GLY B 1 254 ? 49.451  -4.795  27.404  1.00 67.77  ? 250  GLY B O   1 
ATOM   5529  N N   . LYS B 1 255 ? 51.282  -3.504  27.125  1.00 71.72  ? 251  LYS B N   1 
ATOM   5530  C CA  . LYS B 1 255 ? 51.793  -4.236  25.962  1.00 76.87  ? 251  LYS B CA  1 
ATOM   5531  C C   . LYS B 1 255 ? 52.186  -5.667  26.336  1.00 78.84  ? 251  LYS B C   1 
ATOM   5532  O O   . LYS B 1 255 ? 52.063  -6.585  25.521  1.00 82.13  ? 251  LYS B O   1 
ATOM   5533  C CB  . LYS B 1 255 ? 52.993  -3.511  25.340  1.00 81.42  ? 251  LYS B CB  1 
ATOM   5534  C CG  . LYS B 1 255 ? 52.653  -2.200  24.646  1.00 80.89  ? 251  LYS B CG  1 
ATOM   5535  C CD  . LYS B 1 255 ? 53.853  -1.642  23.893  1.00 86.59  ? 251  LYS B CD  1 
ATOM   5536  C CE  . LYS B 1 255 ? 53.458  -0.458  23.025  1.00 86.76  ? 251  LYS B CE  1 
ATOM   5537  N NZ  . LYS B 1 255 ? 54.579  0.005   22.162  1.00 93.21  ? 251  LYS B NZ  1 
ATOM   5538  N N   . LEU B 1 256 ? 52.653  -5.841  27.573  1.00 77.49  ? 252  LEU B N   1 
ATOM   5539  C CA  . LEU B 1 256 ? 53.059  -7.148  28.092  1.00 79.26  ? 252  LEU B CA  1 
ATOM   5540  C C   . LEU B 1 256 ? 51.869  -8.010  28.512  1.00 75.93  ? 252  LEU B C   1 
ATOM   5541  O O   . LEU B 1 256 ? 51.994  -9.231  28.640  1.00 77.71  ? 252  LEU B O   1 
ATOM   5542  C CB  . LEU B 1 256 ? 54.029  -6.982  29.266  1.00 79.99  ? 252  LEU B CB  1 
ATOM   5543  C CG  . LEU B 1 256 ? 55.465  -6.545  28.956  1.00 85.39  ? 252  LEU B CG  1 
ATOM   5544  C CD1 . LEU B 1 256 ? 56.130  -6.004  30.212  1.00 85.58  ? 252  LEU B CD1 1 
ATOM   5545  C CD2 . LEU B 1 256 ? 56.290  -7.684  28.351  1.00 91.19  ? 252  LEU B CD2 1 
ATOM   5546  N N   . ILE B 1 257 ? 50.724  -7.368  28.730  1.00 71.65  ? 253  ILE B N   1 
ATOM   5547  C CA  . ILE B 1 257 ? 49.486  -8.073  29.050  1.00 69.11  ? 253  ILE B CA  1 
ATOM   5548  C C   . ILE B 1 257 ? 48.961  -8.820  27.820  1.00 71.79  ? 253  ILE B C   1 
ATOM   5549  O O   . ILE B 1 257 ? 48.786  -10.040 27.864  1.00 73.29  ? 253  ILE B O   1 
ATOM   5550  C CB  . ILE B 1 257 ? 48.395  -7.112  29.610  1.00 64.81  ? 253  ILE B CB  1 
ATOM   5551  C CG1 . ILE B 1 257 ? 48.856  -6.437  30.913  1.00 63.16  ? 253  ILE B CG1 1 
ATOM   5552  C CG2 . ILE B 1 257 ? 47.056  -7.837  29.798  1.00 63.33  ? 253  ILE B CG2 1 
ATOM   5553  C CD1 . ILE B 1 257 ? 48.961  -7.355  32.127  1.00 63.03  ? 253  ILE B CD1 1 
ATOM   5554  N N   . GLN B 1 258 ? 48.733  -8.089  26.727  1.00 73.08  ? 254  GLN B N   1 
ATOM   5555  C CA  . GLN B 1 258 ? 48.151  -8.666  25.512  1.00 76.62  ? 254  GLN B CA  1 
ATOM   5556  C C   . GLN B 1 258 ? 49.042  -9.741  24.884  1.00 82.27  ? 254  GLN B C   1 
ATOM   5557  O O   . GLN B 1 258 ? 48.544  -10.709 24.309  1.00 85.32  ? 254  GLN B O   1 
ATOM   5558  C CB  . GLN B 1 258 ? 47.810  -7.575  24.491  1.00 77.65  ? 254  GLN B CB  1 
ATOM   5559  C CG  . GLN B 1 258 ? 46.792  -8.018  23.435  1.00 81.08  ? 254  GLN B CG  1 
ATOM   5560  C CD  . GLN B 1 258 ? 46.188  -6.864  22.647  1.00 81.84  ? 254  GLN B CD  1 
ATOM   5561  O OE1 . GLN B 1 258 ? 45.954  -5.778  23.182  1.00 77.59  ? 254  GLN B OE1 1 
ATOM   5562  N NE2 . GLN B 1 258 ? 45.916  -7.104  21.367  1.00 87.60  ? 254  GLN B NE2 1 
ATOM   5563  N N   . GLU B 1 259 ? 50.355  -9.564  25.011  1.00 84.38  ? 255  GLU B N   1 
ATOM   5564  C CA  . GLU B 1 259 ? 51.330  -10.521 24.496  1.00 90.52  ? 255  GLU B CA  1 
ATOM   5565  C C   . GLU B 1 259 ? 51.311  -11.840 25.274  1.00 90.14  ? 255  GLU B C   1 
ATOM   5566  O O   . GLU B 1 259 ? 51.387  -12.916 24.679  1.00 94.84  ? 255  GLU B O   1 
ATOM   5567  C CB  . GLU B 1 259 ? 52.733  -9.909  24.516  1.00 93.38  ? 255  GLU B CB  1 
ATOM   5568  C CG  . GLU B 1 259 ? 53.778  -10.702 23.747  1.00 101.52 ? 255  GLU B CG  1 
ATOM   5569  C CD  . GLU B 1 259 ? 55.133  -10.020 23.720  1.00 105.62 ? 255  GLU B CD  1 
ATOM   5570  O OE1 . GLU B 1 259 ? 55.187  -8.777  23.851  1.00 103.07 ? 255  GLU B OE1 1 
ATOM   5571  O OE2 . GLU B 1 259 ? 56.148  -10.733 23.561  1.00 111.98 ? 255  GLU B OE2 1 
ATOM   5572  N N   . ALA B 1 260 ? 51.208  -11.748 26.598  1.00 85.16  ? 256  ALA B N   1 
ATOM   5573  C CA  . ALA B 1 260 ? 51.171  -12.934 27.456  1.00 84.71  ? 256  ALA B CA  1 
ATOM   5574  C C   . ALA B 1 260 ? 49.797  -13.605 27.453  1.00 82.71  ? 256  ALA B C   1 
ATOM   5575  O O   . ALA B 1 260 ? 49.668  -14.771 27.834  1.00 83.73  ? 256  ALA B O   1 
ATOM   5576  C CB  . ALA B 1 260 ? 51.594  -12.582 28.877  1.00 81.45  ? 256  ALA B CB  1 
ATOM   5577  N N   . ALA B 1 261 ? 48.779  -12.860 27.026  1.00 80.30  ? 257  ALA B N   1 
ATOM   5578  C CA  . ALA B 1 261 ? 47.420  -13.383 26.912  1.00 79.31  ? 257  ALA B CA  1 
ATOM   5579  C C   . ALA B 1 261 ? 47.246  -14.189 25.628  1.00 85.08  ? 257  ALA B C   1 
ATOM   5580  O O   . ALA B 1 261 ? 46.598  -15.237 25.627  1.00 86.64  ? 257  ALA B O   1 
ATOM   5581  C CB  . ALA B 1 261 ? 46.409  -12.248 26.971  1.00 75.53  ? 257  ALA B CB  1 
ATOM   5582  N N   . GLY B 1 262 ? 47.833  -13.692 24.541  1.00 88.89  ? 258  GLY B N   1 
ATOM   5583  C CA  . GLY B 1 262 ? 47.781  -14.361 23.244  1.00 95.81  ? 258  GLY B CA  1 
ATOM   5584  C C   . GLY B 1 262 ? 48.543  -15.674 23.208  1.00 100.57 ? 258  GLY B C   1 
ATOM   5585  O O   . GLY B 1 262 ? 48.181  -16.586 22.462  1.00 106.07 ? 258  GLY B O   1 
ATOM   5586  N N   . ARG B 1 263 ? 49.598  -15.771 24.015  1.00 99.12  ? 259  ARG B N   1 
ATOM   5587  C CA  . ARG B 1 263 ? 50.414  -16.985 24.073  1.00 103.76 ? 259  ARG B CA  1 
ATOM   5588  C C   . ARG B 1 263 ? 49.934  -17.990 25.124  1.00 100.72 ? 259  ARG B C   1 
ATOM   5589  O O   . ARG B 1 263 ? 50.636  -18.955 25.437  1.00 103.64 ? 259  ARG B O   1 
ATOM   5590  C CB  . ARG B 1 263 ? 51.896  -16.643 24.269  1.00 105.81 ? 259  ARG B CB  1 
ATOM   5591  C CG  . ARG B 1 263 ? 52.640  -16.450 22.961  1.00 113.59 ? 259  ARG B CG  1 
ATOM   5592  C CD  . ARG B 1 263 ? 54.138  -16.629 23.127  1.00 118.52 ? 259  ARG B CD  1 
ATOM   5593  N NE  . ARG B 1 263 ? 54.814  -15.363 23.393  1.00 116.73 ? 259  ARG B NE  1 
ATOM   5594  C CZ  . ARG B 1 263 ? 56.115  -15.151 23.209  1.00 122.28 ? 259  ARG B CZ  1 
ATOM   5595  N NH1 . ARG B 1 263 ? 56.899  -16.123 22.755  1.00 130.19 ? 259  ARG B NH1 1 
ATOM   5596  N NH2 . ARG B 1 263 ? 56.633  -13.960 23.477  1.00 120.45 ? 259  ARG B NH2 1 
ATOM   5597  N N   . SER B 1 264 ? 48.733  -17.765 25.652  1.00 95.41  ? 260  SER B N   1 
ATOM   5598  C CA  . SER B 1 264 ? 48.119  -18.690 26.602  1.00 93.09  ? 260  SER B CA  1 
ATOM   5599  C C   . SER B 1 264 ? 46.821  -19.301 26.056  1.00 94.89  ? 260  SER B C   1 
ATOM   5600  O O   . SER B 1 264 ? 46.826  -20.439 25.577  1.00 100.14 ? 260  SER B O   1 
ATOM   5601  C CB  . SER B 1 264 ? 47.898  -18.017 27.964  1.00 86.31  ? 260  SER B CB  1 
ATOM   5602  O OG  . SER B 1 264 ? 47.240  -16.770 27.826  1.00 82.87  ? 260  SER B OG  1 
ATOM   5603  N N   . ASN B 1 265 ? 45.724  -18.544 26.115  1.00 91.27  ? 261  ASN B N   1 
ATOM   5604  C CA  . ASN B 1 265 ? 44.412  -19.039 25.677  1.00 93.26  ? 261  ASN B CA  1 
ATOM   5605  C C   . ASN B 1 265 ? 43.654  -18.118 24.712  1.00 94.31  ? 261  ASN B C   1 
ATOM   5606  O O   . ASN B 1 265 ? 42.577  -18.476 24.225  1.00 97.28  ? 261  ASN B O   1 
ATOM   5607  C CB  . ASN B 1 265 ? 43.531  -19.407 26.888  1.00 89.28  ? 261  ASN B CB  1 
ATOM   5608  C CG  . ASN B 1 265 ? 43.261  -18.225 27.819  1.00 82.72  ? 261  ASN B CG  1 
ATOM   5609  O OD1 . ASN B 1 265 ? 43.844  -17.150 27.677  1.00 80.48  ? 261  ASN B OD1 1 
ATOM   5610  N ND2 . ASN B 1 265 ? 42.375  -18.432 28.785  1.00 80.01  ? 261  ASN B ND2 1 
ATOM   5611  N N   . LEU B 1 266 ? 44.233  -16.947 24.435  1.00 92.42  ? 262  LEU B N   1 
ATOM   5612  C CA  . LEU B 1 266 ? 43.620  -15.907 23.588  1.00 93.03  ? 262  LEU B CA  1 
ATOM   5613  C C   . LEU B 1 266 ? 42.430  -15.206 24.267  1.00 87.99  ? 262  LEU B C   1 
ATOM   5614  O O   . LEU B 1 266 ? 41.494  -14.757 23.602  1.00 89.83  ? 262  LEU B O   1 
ATOM   5615  C CB  . LEU B 1 266 ? 43.229  -16.462 22.206  1.00 101.04 ? 262  LEU B CB  1 
ATOM   5616  C CG  . LEU B 1 266 ? 44.333  -17.023 21.302  1.00 107.80 ? 262  LEU B CG  1 
ATOM   5617  C CD1 . LEU B 1 266 ? 43.764  -18.045 20.328  1.00 116.11 ? 262  LEU B CD1 1 
ATOM   5618  C CD2 . LEU B 1 266 ? 45.060  -15.908 20.558  1.00 109.06 ? 262  LEU B CD2 1 
ATOM   5619  N N   . LYS B 1 267 ? 42.495  -15.107 25.594  1.00 82.44  ? 263  LYS B N   1 
ATOM   5620  C CA  . LYS B 1 267 ? 41.465  -14.452 26.410  1.00 78.21  ? 263  LYS B CA  1 
ATOM   5621  C C   . LYS B 1 267 ? 41.181  -13.015 25.970  1.00 76.66  ? 263  LYS B C   1 
ATOM   5622  O O   . LYS B 1 267 ? 42.061  -12.345 25.431  1.00 76.93  ? 263  LYS B O   1 
ATOM   5623  C CB  . LYS B 1 267 ? 41.865  -14.475 27.894  1.00 73.55  ? 263  LYS B CB  1 
ATOM   5624  C CG  . LYS B 1 267 ? 43.258  -13.908 28.202  1.00 71.17  ? 263  LYS B CG  1 
ATOM   5625  C CD  . LYS B 1 267 ? 43.539  -13.815 29.703  1.00 67.10  ? 263  LYS B CD  1 
ATOM   5626  C CE  . LYS B 1 267 ? 43.842  -15.169 30.345  1.00 68.20  ? 263  LYS B CE  1 
ATOM   5627  N NZ  . LYS B 1 267 ? 45.132  -15.761 29.906  1.00 70.80  ? 263  LYS B NZ  1 
ATOM   5628  N N   . ARG B 1 268 ? 39.955  -12.548 26.205  1.00 75.67  ? 264  ARG B N   1 
ATOM   5629  C CA  . ARG B 1 268 ? 39.569  -11.180 25.849  1.00 74.50  ? 264  ARG B CA  1 
ATOM   5630  C C   . ARG B 1 268 ? 40.341  -10.152 26.672  1.00 69.49  ? 264  ARG B C   1 
ATOM   5631  O O   . ARG B 1 268 ? 40.416  -10.260 27.899  1.00 66.39  ? 264  ARG B O   1 
ATOM   5632  C CB  . ARG B 1 268 ? 38.061  -10.957 26.017  1.00 75.24  ? 264  ARG B CB  1 
ATOM   5633  C CG  . ARG B 1 268 ? 37.186  -11.620 24.962  1.00 81.61  ? 264  ARG B CG  1 
ATOM   5634  C CD  . ARG B 1 268 ? 36.414  -12.797 25.540  1.00 83.94  ? 264  ARG B CD  1 
ATOM   5635  N NE  . ARG B 1 268 ? 35.386  -13.295 24.623  1.00 91.06  ? 264  ARG B NE  1 
ATOM   5636  C CZ  . ARG B 1 268 ? 34.173  -12.761 24.468  1.00 93.39  ? 264  ARG B CZ  1 
ATOM   5637  N NH1 . ARG B 1 268 ? 33.806  -11.687 25.158  1.00 89.51  ? 264  ARG B NH1 1 
ATOM   5638  N NH2 . ARG B 1 268 ? 33.321  -13.303 23.608  1.00 100.40 ? 264  ARG B NH2 1 
ATOM   5639  N N   . VAL B 1 269 ? 40.910  -9.160  25.989  1.00 69.51  ? 265  VAL B N   1 
ATOM   5640  C CA  . VAL B 1 269 ? 41.734  -8.139  26.640  1.00 65.69  ? 265  VAL B CA  1 
ATOM   5641  C C   . VAL B 1 269 ? 41.121  -6.744  26.519  1.00 64.16  ? 265  VAL B C   1 
ATOM   5642  O O   . VAL B 1 269 ? 40.749  -6.312  25.427  1.00 66.76  ? 265  VAL B O   1 
ATOM   5643  C CB  . VAL B 1 269 ? 43.177  -8.113  26.071  1.00 67.26  ? 265  VAL B CB  1 
ATOM   5644  C CG1 . VAL B 1 269 ? 44.066  -7.191  26.899  1.00 63.92  ? 265  VAL B CG1 1 
ATOM   5645  C CG2 . VAL B 1 269 ? 43.771  -9.513  26.029  1.00 69.91  ? 265  VAL B CG2 1 
ATOM   5646  N N   . THR B 1 270 ? 41.013  -6.055  27.653  1.00 60.65  ? 266  THR B N   1 
ATOM   5647  C CA  . THR B 1 270 ? 40.615  -4.651  27.683  1.00 59.23  ? 266  THR B CA  1 
ATOM   5648  C C   . THR B 1 270 ? 41.681  -3.844  28.412  1.00 56.72  ? 266  THR B C   1 
ATOM   5649  O O   . THR B 1 270 ? 41.787  -3.897  29.642  1.00 54.81  ? 266  THR B O   1 
ATOM   5650  C CB  . THR B 1 270 ? 39.254  -4.425  28.387  1.00 58.62  ? 266  THR B CB  1 
ATOM   5651  O OG1 . THR B 1 270 ? 38.309  -5.412  27.960  1.00 61.64  ? 266  THR B OG1 1 
ATOM   5652  C CG2 . THR B 1 270 ? 38.711  -3.030  28.070  1.00 58.45  ? 266  THR B CG2 1 
ATOM   5653  N N   . LEU B 1 271 ? 42.463  -3.096  27.640  1.00 57.50  ? 267  LEU B N   1 
ATOM   5654  C CA  . LEU B 1 271 ? 43.494  -2.220  28.192  1.00 56.02  ? 267  LEU B CA  1 
ATOM   5655  C C   . LEU B 1 271 ? 42.967  -0.806  28.420  1.00 54.62  ? 267  LEU B C   1 
ATOM   5656  O O   . LEU B 1 271 ? 42.186  -0.286  27.624  1.00 55.50  ? 267  LEU B O   1 
ATOM   5657  C CB  . LEU B 1 271 ? 44.722  -2.186  27.277  1.00 58.19  ? 267  LEU B CB  1 
ATOM   5658  C CG  . LEU B 1 271 ? 45.415  -3.518  26.967  1.00 60.51  ? 267  LEU B CG  1 
ATOM   5659  C CD1 . LEU B 1 271 ? 46.500  -3.317  25.921  1.00 63.87  ? 267  LEU B CD1 1 
ATOM   5660  C CD2 . LEU B 1 271 ? 45.989  -4.175  28.224  1.00 59.06  ? 267  LEU B CD2 1 
ATOM   5661  N N   . GLU B 1 272 ? 43.387  -0.197  29.524  1.00 53.21  ? 268  GLU B N   1 
ATOM   5662  C CA  . GLU B 1 272 ? 43.076  1.199   29.802  1.00 52.56  ? 268  GLU B CA  1 
ATOM   5663  C C   . GLU B 1 272 ? 44.368  1.927   30.162  1.00 52.77  ? 268  GLU B C   1 
ATOM   5664  O O   . GLU B 1 272 ? 44.745  2.036   31.330  1.00 52.48  ? 268  GLU B O   1 
ATOM   5665  C CB  . GLU B 1 272 ? 42.031  1.318   30.910  1.00 51.81  ? 268  GLU B CB  1 
ATOM   5666  C CG  . GLU B 1 272 ? 41.423  2.703   31.046  1.00 52.25  ? 268  GLU B CG  1 
ATOM   5667  C CD  . GLU B 1 272 ? 40.608  2.867   32.316  1.00 53.49  ? 268  GLU B CD  1 
ATOM   5668  O OE1 . GLU B 1 272 ? 40.301  1.843   32.974  1.00 53.99  ? 268  GLU B OE1 1 
ATOM   5669  O OE2 . GLU B 1 272 ? 40.278  4.027   32.656  1.00 54.42  ? 268  GLU B OE2 1 
ATOM   5670  N N   . LEU B 1 273 ? 45.041  2.415   29.127  1.00 54.18  ? 269  LEU B N   1 
ATOM   5671  C CA  . LEU B 1 273 ? 46.358  3.015   29.259  1.00 55.43  ? 269  LEU B CA  1 
ATOM   5672  C C   . LEU B 1 273 ? 46.264  4.520   29.493  1.00 55.22  ? 269  LEU B C   1 
ATOM   5673  O O   . LEU B 1 273 ? 45.175  5.096   29.481  1.00 54.09  ? 269  LEU B O   1 
ATOM   5674  C CB  . LEU B 1 273 ? 47.188  2.710   28.009  1.00 57.96  ? 269  LEU B CB  1 
ATOM   5675  C CG  . LEU B 1 273 ? 47.153  1.271   27.475  1.00 59.18  ? 269  LEU B CG  1 
ATOM   5676  C CD1 . LEU B 1 273 ? 47.878  1.174   26.141  1.00 63.04  ? 269  LEU B CD1 1 
ATOM   5677  C CD2 . LEU B 1 273 ? 47.724  0.271   28.478  1.00 58.96  ? 269  LEU B CD2 1 
ATOM   5678  N N   . GLY B 1 274 ? 47.411  5.154   29.715  1.00 56.96  ? 270  GLY B N   1 
ATOM   5679  C CA  . GLY B 1 274 ? 47.462  6.596   29.906  1.00 57.57  ? 270  GLY B CA  1 
ATOM   5680  C C   . GLY B 1 274 ? 47.253  7.344   28.604  1.00 58.28  ? 270  GLY B C   1 
ATOM   5681  O O   . GLY B 1 274 ? 46.413  6.968   27.781  1.00 57.76  ? 270  GLY B O   1 
ATOM   5682  N N   . GLY B 1 275 ? 48.029  8.404   28.415  1.00 60.12  ? 271  GLY B N   1 
ATOM   5683  C CA  . GLY B 1 275 ? 47.914  9.237   27.229  1.00 61.33  ? 271  GLY B CA  1 
ATOM   5684  C C   . GLY B 1 275 ? 47.647  10.671  27.625  1.00 61.23  ? 271  GLY B C   1 
ATOM   5685  O O   . GLY B 1 275 ? 46.866  10.931  28.542  1.00 59.57  ? 271  GLY B O   1 
ATOM   5686  N N   . LYS B 1 276 ? 48.309  11.598  26.935  1.00 63.62  ? 272  LYS B N   1 
ATOM   5687  C CA  . LYS B 1 276 ? 48.164  13.028  27.201  1.00 64.09  ? 272  LYS B CA  1 
ATOM   5688  C C   . LYS B 1 276 ? 46.742  13.512  26.914  1.00 62.20  ? 272  LYS B C   1 
ATOM   5689  O O   . LYS B 1 276 ? 46.031  12.941  26.078  1.00 61.68  ? 272  LYS B O   1 
ATOM   5690  C CB  . LYS B 1 276 ? 49.197  13.841  26.408  1.00 67.59  ? 272  LYS B CB  1 
ATOM   5691  C CG  . LYS B 1 276 ? 49.015  13.801  24.898  1.00 69.24  ? 272  LYS B CG  1 
ATOM   5692  C CD  . LYS B 1 276 ? 50.143  14.518  24.183  1.00 73.94  ? 272  LYS B CD  1 
ATOM   5693  C CE  . LYS B 1 276 ? 49.699  14.978  22.804  1.00 76.08  ? 272  LYS B CE  1 
ATOM   5694  N NZ  . LYS B 1 276 ? 50.786  15.666  22.052  1.00 80.98  ? 272  LYS B NZ  1 
ATOM   5695  N N   . SER B 1 277 ? 46.341  14.564  27.623  1.00 61.94  ? 273  SER B N   1 
ATOM   5696  C CA  . SER B 1 277 ? 44.995  15.111  27.525  1.00 60.57  ? 273  SER B CA  1 
ATOM   5697  C C   . SER B 1 277 ? 45.042  16.637  27.423  1.00 61.95  ? 273  SER B C   1 
ATOM   5698  O O   . SER B 1 277 ? 45.265  17.326  28.416  1.00 62.92  ? 273  SER B O   1 
ATOM   5699  C CB  . SER B 1 277 ? 44.153  14.652  28.719  1.00 59.13  ? 273  SER B CB  1 
ATOM   5700  O OG  . SER B 1 277 ? 42.995  15.451  28.881  1.00 59.91  ? 273  SER B OG  1 
ATOM   5701  N N   . PRO B 1 278 ? 44.847  17.168  26.210  1.00 62.66  ? 274  PRO B N   1 
ATOM   5702  C CA  . PRO B 1 278 ? 44.923  18.614  25.989  1.00 64.43  ? 274  PRO B CA  1 
ATOM   5703  C C   . PRO B 1 278 ? 43.703  19.411  26.472  1.00 64.05  ? 274  PRO B C   1 
ATOM   5704  O O   . PRO B 1 278 ? 42.568  19.109  26.093  1.00 63.28  ? 274  PRO B O   1 
ATOM   5705  C CB  . PRO B 1 278 ? 45.066  18.725  24.468  1.00 66.11  ? 274  PRO B CB  1 
ATOM   5706  C CG  . PRO B 1 278 ? 44.444  17.480  23.940  1.00 65.05  ? 274  PRO B CG  1 
ATOM   5707  C CD  . PRO B 1 278 ? 44.738  16.417  24.947  1.00 62.93  ? 274  PRO B CD  1 
ATOM   5708  N N   . ASN B 1 279 ? 43.953  20.414  27.312  1.00 65.24  ? 275  ASN B N   1 
ATOM   5709  C CA  . ASN B 1 279 ? 42.961  21.435  27.633  1.00 66.19  ? 275  ASN B CA  1 
ATOM   5710  C C   . ASN B 1 279 ? 43.132  22.605  26.672  1.00 67.99  ? 275  ASN B C   1 
ATOM   5711  O O   . ASN B 1 279 ? 44.229  23.148  26.542  1.00 69.62  ? 275  ASN B O   1 
ATOM   5712  C CB  . ASN B 1 279 ? 43.130  21.939  29.069  1.00 67.97  ? 275  ASN B CB  1 
ATOM   5713  C CG  . ASN B 1 279 ? 42.625  20.955  30.107  1.00 67.16  ? 275  ASN B CG  1 
ATOM   5714  O OD1 . ASN B 1 279 ? 43.208  19.888  30.312  1.00 65.89  ? 275  ASN B OD1 1 
ATOM   5715  N ND2 . ASN B 1 279 ? 41.547  21.326  30.794  1.00 68.83  ? 275  ASN B ND2 1 
ATOM   5716  N N   . ILE B 1 280 ? 42.054  22.988  25.995  1.00 68.13  ? 276  ILE B N   1 
ATOM   5717  C CA  . ILE B 1 280 ? 42.098  24.104  25.052  1.00 70.14  ? 276  ILE B CA  1 
ATOM   5718  C C   . ILE B 1 280 ? 41.255  25.264  25.574  1.00 72.05  ? 276  ILE B C   1 
ATOM   5719  O O   . ILE B 1 280 ? 40.072  25.098  25.873  1.00 71.98  ? 276  ILE B O   1 
ATOM   5720  C CB  . ILE B 1 280 ? 41.631  23.690  23.637  1.00 70.36  ? 276  ILE B CB  1 
ATOM   5721  C CG1 . ILE B 1 280 ? 42.370  22.430  23.175  1.00 68.92  ? 276  ILE B CG1 1 
ATOM   5722  C CG2 . ILE B 1 280 ? 41.850  24.831  22.646  1.00 73.30  ? 276  ILE B CG2 1 
ATOM   5723  C CD1 . ILE B 1 280 ? 41.649  21.642  22.096  1.00 69.22  ? 276  ILE B CD1 1 
ATOM   5724  N N   . ILE B 1 281 ? 41.878  26.434  25.689  1.00 74.31  ? 277  ILE B N   1 
ATOM   5725  C CA  . ILE B 1 281 ? 41.214  27.610  26.243  1.00 76.84  ? 277  ILE B CA  1 
ATOM   5726  C C   . ILE B 1 281 ? 41.275  28.802  25.288  1.00 79.48  ? 277  ILE B C   1 
ATOM   5727  O O   . ILE B 1 281 ? 42.332  29.402  25.080  1.00 81.01  ? 277  ILE B O   1 
ATOM   5728  C CB  . ILE B 1 281 ? 41.767  27.961  27.648  1.00 78.35  ? 277  ILE B CB  1 
ATOM   5729  C CG1 . ILE B 1 281 ? 41.402  26.843  28.630  1.00 76.60  ? 277  ILE B CG1 1 
ATOM   5730  C CG2 . ILE B 1 281 ? 41.209  29.297  28.138  1.00 82.10  ? 277  ILE B CG2 1 
ATOM   5731  C CD1 . ILE B 1 281 ? 42.336  26.684  29.797  1.00 77.63  ? 277  ILE B CD1 1 
ATOM   5732  N N   . PHE B 1 282 ? 40.125  29.118  24.701  1.00 80.53  ? 278  PHE B N   1 
ATOM   5733  C CA  . PHE B 1 282 ? 39.985  30.265  23.812  1.00 83.52  ? 278  PHE B CA  1 
ATOM   5734  C C   . PHE B 1 282 ? 39.755  31.537  24.626  1.00 86.66  ? 278  PHE B C   1 
ATOM   5735  O O   . PHE B 1 282 ? 39.464  31.470  25.823  1.00 86.91  ? 278  PHE B O   1 
ATOM   5736  C CB  . PHE B 1 282 ? 38.840  30.040  22.819  1.00 84.24  ? 278  PHE B CB  1 
ATOM   5737  C CG  . PHE B 1 282 ? 39.101  28.937  21.825  1.00 82.48  ? 278  PHE B CG  1 
ATOM   5738  C CD1 . PHE B 1 282 ? 38.709  27.631  22.094  1.00 79.58  ? 278  PHE B CD1 1 
ATOM   5739  C CD2 . PHE B 1 282 ? 39.732  29.205  20.616  1.00 84.25  ? 278  PHE B CD2 1 
ATOM   5740  C CE1 . PHE B 1 282 ? 38.946  26.609  21.177  1.00 78.73  ? 278  PHE B CE1 1 
ATOM   5741  C CE2 . PHE B 1 282 ? 39.972  28.187  19.693  1.00 83.77  ? 278  PHE B CE2 1 
ATOM   5742  C CZ  . PHE B 1 282 ? 39.578  26.888  19.976  1.00 80.91  ? 278  PHE B CZ  1 
ATOM   5743  N N   . ALA B 1 283 ? 39.885  32.688  23.969  1.00 89.68  ? 279  ALA B N   1 
ATOM   5744  C CA  . ALA B 1 283 ? 39.819  33.987  24.638  1.00 93.41  ? 279  ALA B CA  1 
ATOM   5745  C C   . ALA B 1 283 ? 38.417  34.366  25.114  1.00 95.68  ? 279  ALA B C   1 
ATOM   5746  O O   . ALA B 1 283 ? 38.266  35.045  26.132  1.00 98.52  ? 279  ALA B O   1 
ATOM   5747  C CB  . ALA B 1 283 ? 40.389  35.078  23.736  1.00 96.21  ? 279  ALA B CB  1 
ATOM   5748  N N   . ASP B 1 284 ? 37.399  33.920  24.381  1.00 95.36  ? 280  ASP B N   1 
ATOM   5749  C CA  . ASP B 1 284 ? 36.011  34.292  24.668  1.00 98.51  ? 280  ASP B CA  1 
ATOM   5750  C C   . ASP B 1 284 ? 35.448  33.674  25.952  1.00 98.41  ? 280  ASP B C   1 
ATOM   5751  O O   . ASP B 1 284 ? 34.502  34.207  26.533  1.00 102.31 ? 280  ASP B O   1 
ATOM   5752  C CB  . ASP B 1 284 ? 35.103  33.990  23.467  1.00 99.17  ? 280  ASP B CB  1 
ATOM   5753  C CG  . ASP B 1 284 ? 35.370  32.627  22.852  1.00 95.42  ? 280  ASP B CG  1 
ATOM   5754  O OD1 . ASP B 1 284 ? 35.555  31.651  23.610  1.00 92.43  ? 280  ASP B OD1 1 
ATOM   5755  O OD2 . ASP B 1 284 ? 35.387  32.533  21.605  1.00 95.98  ? 280  ASP B OD2 1 
ATOM   5756  N N   . ALA B 1 285 ? 36.032  32.560  26.391  1.00 94.71  ? 281  ALA B N   1 
ATOM   5757  C CA  . ALA B 1 285 ? 35.617  31.890  27.624  1.00 94.81  ? 281  ALA B CA  1 
ATOM   5758  C C   . ALA B 1 285 ? 35.923  32.735  28.854  1.00 98.57  ? 281  ALA B C   1 
ATOM   5759  O O   . ALA B 1 285 ? 36.861  33.534  28.849  1.00 99.61  ? 281  ALA B O   1 
ATOM   5760  C CB  . ALA B 1 285 ? 36.288  30.541  27.742  1.00 90.09  ? 281  ALA B CB  1 
ATOM   5761  N N   . ASP B 1 286 ? 35.126  32.552  29.903  1.00 87.65  ? 282  ASP B N   1 
ATOM   5762  C CA  . ASP B 1 286 ? 35.316  33.274  31.163  1.00 90.99  ? 282  ASP B CA  1 
ATOM   5763  C C   . ASP B 1 286 ? 36.582  32.826  31.893  1.00 86.67  ? 282  ASP B C   1 
ATOM   5764  O O   . ASP B 1 286 ? 36.747  31.645  32.210  1.00 83.57  ? 282  ASP B O   1 
ATOM   5765  C CB  . ASP B 1 286 ? 34.081  33.156  32.070  1.00 97.74  ? 282  ASP B CB  1 
ATOM   5766  C CG  . ASP B 1 286 ? 33.529  31.737  32.151  1.00 97.01  ? 282  ASP B CG  1 
ATOM   5767  O OD1 . ASP B 1 286 ? 34.158  30.796  31.617  1.00 91.20  ? 282  ASP B OD1 1 
ATOM   5768  O OD2 . ASP B 1 286 ? 32.448  31.567  32.754  1.00 103.59 ? 282  ASP B OD2 1 
ATOM   5769  N N   . LEU B 1 287 ? 37.463  33.791  32.151  1.00 87.71  ? 283  LEU B N   1 
ATOM   5770  C CA  . LEU B 1 287 ? 38.788  33.546  32.723  1.00 85.08  ? 283  LEU B CA  1 
ATOM   5771  C C   . LEU B 1 287 ? 38.738  32.960  34.138  1.00 86.89  ? 283  LEU B C   1 
ATOM   5772  O O   . LEU B 1 287 ? 39.390  31.951  34.417  1.00 82.91  ? 283  LEU B O   1 
ATOM   5773  C CB  . LEU B 1 287 ? 39.611  34.842  32.708  1.00 88.51  ? 283  LEU B CB  1 
ATOM   5774  C CG  . LEU B 1 287 ? 41.141  34.764  32.726  1.00 86.40  ? 283  LEU B CG  1 
ATOM   5775  C CD1 . LEU B 1 287 ? 41.676  34.060  31.484  1.00 80.16  ? 283  LEU B CD1 1 
ATOM   5776  C CD2 . LEU B 1 287 ? 41.739  36.158  32.844  1.00 92.68  ? 283  LEU B CD2 1 
ATOM   5777  N N   . ASP B 1 288 ? 37.955  33.590  35.014  1.00 93.67  ? 284  ASP B N   1 
ATOM   5778  C CA  . ASP B 1 288 ? 37.812  33.160  36.408  1.00 96.97  ? 284  ASP B CA  1 
ATOM   5779  C C   . ASP B 1 288 ? 37.432  31.681  36.550  1.00 93.03  ? 284  ASP B C   1 
ATOM   5780  O O   . ASP B 1 288 ? 37.901  31.002  37.466  1.00 92.46  ? 284  ASP B O   1 
ATOM   5781  C CB  . ASP B 1 288 ? 36.794  34.047  37.138  1.00 106.30 ? 284  ASP B CB  1 
ATOM   5782  C CG  . ASP B 1 288 ? 37.252  35.497  37.258  1.00 112.43 ? 284  ASP B CG  1 
ATOM   5783  O OD1 . ASP B 1 288 ? 38.318  35.745  37.862  1.00 113.73 ? 284  ASP B OD1 1 
ATOM   5784  O OD2 . ASP B 1 288 ? 36.538  36.393  36.760  1.00 117.04 ? 284  ASP B OD2 1 
ATOM   5785  N N   . TYR B 1 289 ? 36.591  31.195  35.639  1.00 91.37  ? 285  TYR B N   1 
ATOM   5786  C CA  . TYR B 1 289 ? 36.172  29.792  35.616  1.00 89.19  ? 285  TYR B CA  1 
ATOM   5787  C C   . TYR B 1 289 ? 37.206  28.916  34.911  1.00 82.19  ? 285  TYR B C   1 
ATOM   5788  O O   . TYR B 1 289 ? 37.555  27.842  35.406  1.00 80.37  ? 285  TYR B O   1 
ATOM   5789  C CB  . TYR B 1 289 ? 34.803  29.655  34.935  1.00 92.76  ? 285  TYR B CB  1 
ATOM   5790  C CG  . TYR B 1 289 ? 34.223  28.250  34.916  1.00 92.97  ? 285  TYR B CG  1 
ATOM   5791  C CD1 . TYR B 1 289 ? 33.633  27.701  36.055  1.00 97.76  ? 285  TYR B CD1 1 
ATOM   5792  C CD2 . TYR B 1 289 ? 34.243  27.481  33.751  1.00 89.79  ? 285  TYR B CD2 1 
ATOM   5793  C CE1 . TYR B 1 289 ? 33.090  26.416  36.040  1.00 99.34  ? 285  TYR B CE1 1 
ATOM   5794  C CE2 . TYR B 1 289 ? 33.704  26.196  33.727  1.00 91.86  ? 285  TYR B CE2 1 
ATOM   5795  C CZ  . TYR B 1 289 ? 33.129  25.671  34.874  1.00 96.65  ? 285  TYR B CZ  1 
ATOM   5796  O OH  . TYR B 1 289 ? 32.593  24.403  34.863  1.00 99.97  ? 285  TYR B OH  1 
ATOM   5797  N N   . ALA B 1 290 ? 37.689  29.383  33.761  1.00 79.21  ? 286  ALA B N   1 
ATOM   5798  C CA  . ALA B 1 290 ? 38.638  28.623  32.949  1.00 74.02  ? 286  ALA B CA  1 
ATOM   5799  C C   . ALA B 1 290 ? 39.925  28.302  33.706  1.00 72.01  ? 286  ALA B C   1 
ATOM   5800  O O   . ALA B 1 290 ? 40.364  27.151  33.723  1.00 69.78  ? 286  ALA B O   1 
ATOM   5801  C CB  . ALA B 1 290 ? 38.945  29.357  31.650  1.00 72.46  ? 286  ALA B CB  1 
ATOM   5802  N N   . VAL B 1 291 ? 40.512  29.319  34.339  1.00 74.17  ? 287  VAL B N   1 
ATOM   5803  C CA  . VAL B 1 291 ? 41.741  29.154  35.118  1.00 74.08  ? 287  VAL B CA  1 
ATOM   5804  C C   . VAL B 1 291 ? 41.541  28.129  36.232  1.00 74.81  ? 287  VAL B C   1 
ATOM   5805  O O   . VAL B 1 291 ? 42.399  27.276  36.453  1.00 72.92  ? 287  VAL B O   1 
ATOM   5806  C CB  . VAL B 1 291 ? 42.235  30.501  35.715  1.00 78.92  ? 287  VAL B CB  1 
ATOM   5807  C CG1 . VAL B 1 291 ? 43.456  30.294  36.606  1.00 80.54  ? 287  VAL B CG1 1 
ATOM   5808  C CG2 . VAL B 1 291 ? 42.559  31.493  34.610  1.00 78.93  ? 287  VAL B CG2 1 
ATOM   5809  N N   . GLU B 1 292 ? 40.394  28.207  36.904  1.00 78.39  ? 288  GLU B N   1 
ATOM   5810  C CA  . GLU B 1 292 ? 40.099  27.363  38.060  1.00 80.53  ? 288  GLU B CA  1 
ATOM   5811  C C   . GLU B 1 292 ? 39.861  25.896  37.695  1.00 77.75  ? 288  GLU B C   1 
ATOM   5812  O O   . GLU B 1 292 ? 40.370  24.998  38.372  1.00 77.42  ? 288  GLU B O   1 
ATOM   5813  C CB  . GLU B 1 292 ? 38.911  27.932  38.849  1.00 86.69  ? 288  GLU B CB  1 
ATOM   5814  C CG  . GLU B 1 292 ? 38.619  27.236  40.182  1.00 90.26  ? 288  GLU B CG  1 
ATOM   5815  C CD  . GLU B 1 292 ? 39.763  27.334  41.180  1.00 91.52  ? 288  GLU B CD  1 
ATOM   5816  O OE1 . GLU B 1 292 ? 40.380  28.417  41.287  1.00 93.93  ? 288  GLU B OE1 1 
ATOM   5817  O OE2 . GLU B 1 292 ? 40.037  26.324  41.863  1.00 91.03  ? 288  GLU B OE2 1 
ATOM   5818  N N   . GLN B 1 293 ? 39.096  25.654  36.631  1.00 76.94  ? 289  GLN B N   1 
ATOM   5819  C CA  . GLN B 1 293 ? 38.757  24.283  36.220  1.00 76.39  ? 289  GLN B CA  1 
ATOM   5820  C C   . GLN B 1 293 ? 39.910  23.569  35.504  1.00 72.43  ? 289  GLN B C   1 
ATOM   5821  O O   . GLN B 1 293 ? 40.026  22.342  35.583  1.00 72.77  ? 289  GLN B O   1 
ATOM   5822  C CB  . GLN B 1 293 ? 37.481  24.255  35.368  1.00 79.00  ? 289  GLN B CB  1 
ATOM   5823  C CG  . GLN B 1 293 ? 36.190  24.543  36.143  1.00 84.99  ? 289  GLN B CG  1 
ATOM   5824  C CD  . GLN B 1 293 ? 35.720  23.379  37.011  1.00 88.42  ? 289  GLN B CD  1 
ATOM   5825  O OE1 . GLN B 1 293 ? 35.637  22.236  36.557  1.00 88.77  ? 289  GLN B OE1 1 
ATOM   5826  N NE2 . GLN B 1 293 ? 35.393  23.674  38.263  1.00 92.12  ? 289  GLN B NE2 1 
ATOM   5827  N N   . ALA B 1 294 ? 40.749  24.340  34.810  1.00 69.81  ? 290  ALA B N   1 
ATOM   5828  C CA  . ALA B 1 294 ? 41.959  23.807  34.185  1.00 67.34  ? 290  ALA B CA  1 
ATOM   5829  C C   . ALA B 1 294 ? 43.012  23.511  35.247  1.00 67.73  ? 290  ALA B C   1 
ATOM   5830  O O   . ALA B 1 294 ? 43.765  22.543  35.126  1.00 67.36  ? 290  ALA B O   1 
ATOM   5831  C CB  . ALA B 1 294 ? 42.501  24.773  33.151  1.00 65.66  ? 290  ALA B CB  1 
ATOM   5832  N N   . HIS B 1 295 ? 43.052  24.356  36.278  1.00 69.74  ? 291  HIS B N   1 
ATOM   5833  C CA  . HIS B 1 295 ? 43.894  24.154  37.461  1.00 71.70  ? 291  HIS B CA  1 
ATOM   5834  C C   . HIS B 1 295 ? 43.498  22.861  38.178  1.00 72.68  ? 291  HIS B C   1 
ATOM   5835  O O   . HIS B 1 295 ? 44.357  22.065  38.561  1.00 72.98  ? 291  HIS B O   1 
ATOM   5836  C CB  . HIS B 1 295 ? 43.776  25.363  38.402  1.00 75.32  ? 291  HIS B CB  1 
ATOM   5837  C CG  . HIS B 1 295 ? 44.540  25.226  39.683  1.00 78.71  ? 291  HIS B CG  1 
ATOM   5838  N ND1 . HIS B 1 295 ? 45.860  25.603  39.807  1.00 80.56  ? 291  HIS B ND1 1 
ATOM   5839  C CD2 . HIS B 1 295 ? 44.163  24.772  40.902  1.00 81.66  ? 291  HIS B CD2 1 
ATOM   5840  C CE1 . HIS B 1 295 ? 46.266  25.377  41.044  1.00 84.60  ? 291  HIS B CE1 1 
ATOM   5841  N NE2 . HIS B 1 295 ? 45.254  24.874  41.728  1.00 85.02  ? 291  HIS B NE2 1 
ATOM   5842  N N   . GLN B 1 296 ? 42.192  22.659  38.344  1.00 74.22  ? 292  GLN B N   1 
ATOM   5843  C CA  . GLN B 1 296 ? 41.654  21.418  38.905  1.00 76.37  ? 292  GLN B CA  1 
ATOM   5844  C C   . GLN B 1 296 ? 41.804  20.245  37.926  1.00 75.28  ? 292  GLN B C   1 
ATOM   5845  O O   . GLN B 1 296 ? 41.761  19.080  38.327  1.00 77.30  ? 292  GLN B O   1 
ATOM   5846  C CB  . GLN B 1 296 ? 40.183  21.598  39.313  1.00 79.91  ? 292  GLN B CB  1 
ATOM   5847  C CG  . GLN B 1 296 ? 39.970  22.358  40.628  1.00 83.55  ? 292  GLN B CG  1 
ATOM   5848  C CD  . GLN B 1 296 ? 40.305  21.532  41.868  1.00 86.09  ? 292  GLN B CD  1 
ATOM   5849  O OE1 . GLN B 1 296 ? 40.120  20.312  41.895  1.00 86.58  ? 292  GLN B OE1 1 
ATOM   5850  N NE2 . GLN B 1 296 ? 40.789  22.203  42.904  1.00 88.76  ? 292  GLN B NE2 1 
ATOM   5851  N N   . GLY B 1 297 ? 41.989  20.565  36.646  1.00 73.06  ? 293  GLY B N   1 
ATOM   5852  C CA  . GLY B 1 297 ? 42.160  19.554  35.603  1.00 73.30  ? 293  GLY B CA  1 
ATOM   5853  C C   . GLY B 1 297 ? 43.530  18.899  35.582  1.00 72.90  ? 293  GLY B C   1 
ATOM   5854  O O   . GLY B 1 297 ? 43.693  17.810  35.027  1.00 74.96  ? 293  GLY B O   1 
ATOM   5855  N N   . VAL B 1 298 ? 44.517  19.563  36.179  1.00 71.70  ? 294  VAL B N   1 
ATOM   5856  C CA  . VAL B 1 298 ? 45.884  19.046  36.228  1.00 72.64  ? 294  VAL B CA  1 
ATOM   5857  C C   . VAL B 1 298 ? 46.241  18.577  37.636  1.00 74.81  ? 294  VAL B C   1 
ATOM   5858  O O   . VAL B 1 298 ? 46.770  17.477  37.814  1.00 77.10  ? 294  VAL B O   1 
ATOM   5859  C CB  . VAL B 1 298 ? 46.926  20.106  35.773  1.00 71.69  ? 294  VAL B CB  1 
ATOM   5860  C CG1 . VAL B 1 298 ? 48.306  19.470  35.612  1.00 74.19  ? 294  VAL B CG1 1 
ATOM   5861  C CG2 . VAL B 1 298 ? 46.499  20.771  34.476  1.00 69.67  ? 294  VAL B CG2 1 
ATOM   5862  N N   . PHE B 1 299 ? 45.932  19.415  38.625  1.00 74.97  ? 295  PHE B N   1 
ATOM   5863  C CA  . PHE B 1 299 ? 46.381  19.221  40.006  1.00 77.79  ? 295  PHE B CA  1 
ATOM   5864  C C   . PHE B 1 299 ? 45.558  18.235  40.835  1.00 79.77  ? 295  PHE B C   1 
ATOM   5865  O O   . PHE B 1 299 ? 46.048  17.717  41.843  1.00 82.48  ? 295  PHE B O   1 
ATOM   5866  C CB  . PHE B 1 299 ? 46.448  20.570  40.728  1.00 79.07  ? 295  PHE B CB  1 
ATOM   5867  C CG  . PHE B 1 299 ? 47.621  21.415  40.327  1.00 79.75  ? 295  PHE B CG  1 
ATOM   5868  C CD1 . PHE B 1 299 ? 48.831  21.305  40.998  1.00 83.59  ? 295  PHE B CD1 1 
ATOM   5869  C CD2 . PHE B 1 299 ? 47.516  22.324  39.278  1.00 77.68  ? 295  PHE B CD2 1 
ATOM   5870  C CE1 . PHE B 1 299 ? 49.921  22.084  40.629  1.00 86.12  ? 295  PHE B CE1 1 
ATOM   5871  C CE2 . PHE B 1 299 ? 48.599  23.110  38.902  1.00 79.37  ? 295  PHE B CE2 1 
ATOM   5872  C CZ  . PHE B 1 299 ? 49.804  22.990  39.578  1.00 83.92  ? 295  PHE B CZ  1 
ATOM   5873  N N   . PHE B 1 300 ? 44.318  17.982  40.415  1.00 79.36  ? 296  PHE B N   1 
ATOM   5874  C CA  . PHE B 1 300 ? 43.419  17.068  41.126  1.00 82.55  ? 296  PHE B CA  1 
ATOM   5875  C C   . PHE B 1 300 ? 44.053  15.695  41.330  1.00 84.87  ? 296  PHE B C   1 
ATOM   5876  O O   . PHE B 1 300 ? 44.695  15.159  40.422  1.00 84.41  ? 296  PHE B O   1 
ATOM   5877  C CB  . PHE B 1 300 ? 42.079  16.941  40.392  1.00 83.27  ? 296  PHE B CB  1 
ATOM   5878  C CG  . PHE B 1 300 ? 41.142  15.931  40.998  1.00 88.08  ? 296  PHE B CG  1 
ATOM   5879  C CD1 . PHE B 1 300 ? 40.570  16.153  42.248  1.00 91.08  ? 296  PHE B CD1 1 
ATOM   5880  C CD2 . PHE B 1 300 ? 40.829  14.760  40.316  1.00 90.93  ? 296  PHE B CD2 1 
ATOM   5881  C CE1 . PHE B 1 300 ? 39.705  15.221  42.812  1.00 96.50  ? 296  PHE B CE1 1 
ATOM   5882  C CE2 . PHE B 1 300 ? 39.964  13.822  40.871  1.00 96.86  ? 296  PHE B CE2 1 
ATOM   5883  C CZ  . PHE B 1 300 ? 39.401  14.054  42.120  1.00 99.44  ? 296  PHE B CZ  1 
ATOM   5884  N N   . ASN B 1 301 ? 43.860  15.145  42.531  1.00 88.25  ? 297  ASN B N   1 
ATOM   5885  C CA  . ASN B 1 301 ? 44.470  13.879  42.965  1.00 91.48  ? 297  ASN B CA  1 
ATOM   5886  C C   . ASN B 1 301 ? 46.001  13.855  42.804  1.00 90.90  ? 297  ASN B C   1 
ATOM   5887  O O   . ASN B 1 301 ? 46.580  12.867  42.340  1.00 92.98  ? 297  ASN B O   1 
ATOM   5888  C CB  . ASN B 1 301 ? 43.796  12.670  42.289  1.00 94.43  ? 297  ASN B CB  1 
ATOM   5889  C CG  . ASN B 1 301 ? 44.208  11.341  42.907  1.00 99.12  ? 297  ASN B CG  1 
ATOM   5890  O OD1 . ASN B 1 301 ? 44.515  11.259  44.096  1.00 100.50 ? 297  ASN B OD1 1 
ATOM   5891  N ND2 . ASN B 1 301 ? 44.221  10.295  42.093  1.00 102.27 ? 297  ASN B ND2 1 
ATOM   5892  N N   . GLN B 1 302 ? 46.636  14.965  43.188  1.00 89.45  ? 298  GLN B N   1 
ATOM   5893  C CA  . GLN B 1 302 ? 48.099  15.120  43.171  1.00 90.48  ? 298  GLN B CA  1 
ATOM   5894  C C   . GLN B 1 302 ? 48.715  15.133  41.764  1.00 88.74  ? 298  GLN B C   1 
ATOM   5895  O O   . GLN B 1 302 ? 49.940  15.055  41.616  1.00 91.02  ? 298  GLN B O   1 
ATOM   5896  C CB  . GLN B 1 302 ? 48.777  14.056  44.053  1.00 95.18  ? 298  GLN B CB  1 
ATOM   5897  C CG  . GLN B 1 302 ? 48.590  14.259  45.554  1.00 97.94  ? 298  GLN B CG  1 
ATOM   5898  C CD  . GLN B 1 302 ? 47.151  14.093  46.016  1.00 97.49  ? 298  GLN B CD  1 
ATOM   5899  O OE1 . GLN B 1 302 ? 46.509  15.058  46.422  1.00 96.85  ? 298  GLN B OE1 1 
ATOM   5900  N NE2 . GLN B 1 302 ? 46.637  12.870  45.942  1.00 99.23  ? 298  GLN B NE2 1 
ATOM   5901  N N   . GLY B 1 303 ? 47.863  15.240  40.743  1.00 85.79  ? 299  GLY B N   1 
ATOM   5902  C CA  . GLY B 1 303 ? 48.300  15.230  39.344  1.00 84.74  ? 299  GLY B CA  1 
ATOM   5903  C C   . GLY B 1 303 ? 48.434  13.846  38.725  1.00 88.26  ? 299  GLY B C   1 
ATOM   5904  O O   . GLY B 1 303 ? 48.463  13.707  37.501  1.00 88.34  ? 299  GLY B O   1 
ATOM   5905  N N   . GLN B 1 304 ? 48.512  12.825  39.577  1.00 92.17  ? 300  GLN B N   1 
ATOM   5906  C CA  . GLN B 1 304 ? 48.715  11.442  39.144  1.00 97.36  ? 300  GLN B CA  1 
ATOM   5907  C C   . GLN B 1 304 ? 47.404  10.715  38.821  1.00 99.33  ? 300  GLN B C   1 
ATOM   5908  O O   . GLN B 1 304 ? 46.897  9.920   39.620  1.00 102.68 ? 300  GLN B O   1 
ATOM   5909  C CB  . GLN B 1 304 ? 49.557  10.665  40.171  1.00 101.99 ? 300  GLN B CB  1 
ATOM   5910  C CG  . GLN B 1 304 ? 49.246  10.971  41.639  1.00 100.93 ? 300  GLN B CG  1 
ATOM   5911  C CD  . GLN B 1 304 ? 50.345  10.519  42.592  1.00 105.26 ? 300  GLN B CD  1 
ATOM   5912  O OE1 . GLN B 1 304 ? 51.500  10.340  42.199  1.00 108.12 ? 300  GLN B OE1 1 
ATOM   5913  N NE2 . GLN B 1 304 ? 49.986  10.342  43.858  1.00 106.55 ? 300  GLN B NE2 1 
ATOM   5914  N N   . CYS B 1 305 ? 46.865  11.005  37.637  1.00 98.20  ? 301  CYS B N   1 
ATOM   5915  C CA  . CYS B 1 305 ? 45.658  10.343  37.130  1.00 101.85 ? 301  CYS B CA  1 
ATOM   5916  C C   . CYS B 1 305 ? 45.661  10.215  35.603  1.00 103.99 ? 301  CYS B C   1 
ATOM   5917  O O   . CYS B 1 305 ? 45.985  11.171  34.888  1.00 99.64  ? 301  CYS B O   1 
ATOM   5918  C CB  . CYS B 1 305 ? 44.384  11.050  37.618  1.00 98.94  ? 301  CYS B CB  1 
ATOM   5919  S SG  . CYS B 1 305 ? 44.386  12.859  37.512  1.00 90.85  ? 301  CYS B SG  1 
ATOM   5920  N N   . CYS B 1 306 ? 45.297  9.025   35.121  1.00 111.80 ? 302  CYS B N   1 
ATOM   5921  C CA  . CYS B 1 306 ? 45.243  8.719   33.686  1.00 116.35 ? 302  CYS B CA  1 
ATOM   5922  C C   . CYS B 1 306 ? 44.196  9.557   32.952  1.00 113.57 ? 302  CYS B C   1 
ATOM   5923  O O   . CYS B 1 306 ? 44.311  9.791   31.745  1.00 114.67 ? 302  CYS B O   1 
ATOM   5924  C CB  . CYS B 1 306 ? 44.966  7.228   33.469  1.00 127.32 ? 302  CYS B CB  1 
ATOM   5925  S SG  . CYS B 1 306 ? 43.415  6.634   34.194  1.00 132.07 ? 302  CYS B SG  1 
ATOM   5926  N N   . THR B 1 307 ? 43.185  10.003  33.695  1.00 110.87 ? 303  THR B N   1 
ATOM   5927  C CA  . THR B 1 307 ? 42.093  10.817  33.157  1.00 109.05 ? 303  THR B CA  1 
ATOM   5928  C C   . THR B 1 307 ? 42.472  12.301  32.993  1.00 100.10 ? 303  THR B C   1 
ATOM   5929  O O   . THR B 1 307 ? 41.766  13.055  32.318  1.00 98.65  ? 303  THR B O   1 
ATOM   5930  C CB  . THR B 1 307 ? 40.808  10.686  34.028  1.00 111.63 ? 303  THR B CB  1 
ATOM   5931  O OG1 . THR B 1 307 ? 41.092  11.078  35.377  1.00 106.87 ? 303  THR B OG1 1 
ATOM   5932  C CG2 . THR B 1 307 ? 40.285  9.246   34.026  1.00 122.23 ? 303  THR B CG2 1 
ATOM   5933  N N   . ALA B 1 308 ? 43.591  12.704  33.596  1.00 95.31  ? 304  ALA B N   1 
ATOM   5934  C CA  . ALA B 1 308 ? 44.016  14.110  33.616  1.00 88.18  ? 304  ALA B CA  1 
ATOM   5935  C C   . ALA B 1 308 ? 44.852  14.522  32.404  1.00 87.10  ? 304  ALA B C   1 
ATOM   5936  O O   . ALA B 1 308 ? 45.306  13.677  31.628  1.00 91.90  ? 304  ALA B O   1 
ATOM   5937  C CB  . ALA B 1 308 ? 44.771  14.418  34.898  1.00 85.36  ? 304  ALA B CB  1 
ATOM   5938  N N   . GLY B 1 309 ? 45.053  15.833  32.266  1.00 81.78  ? 305  GLY B N   1 
ATOM   5939  C CA  . GLY B 1 309 ? 45.838  16.403  31.177  1.00 80.64  ? 305  GLY B CA  1 
ATOM   5940  C C   . GLY B 1 309 ? 46.672  17.603  31.583  1.00 76.36  ? 305  GLY B C   1 
ATOM   5941  O O   . GLY B 1 309 ? 46.137  18.650  31.953  1.00 72.87  ? 305  GLY B O   1 
ATOM   5942  N N   . SER B 1 310 ? 47.989  17.447  31.485  1.00 78.00  ? 306  SER B N   1 
ATOM   5943  C CA  . SER B 1 310 ? 48.943  18.449  31.956  1.00 76.30  ? 306  SER B CA  1 
ATOM   5944  C C   . SER B 1 310 ? 49.131  19.625  30.998  1.00 74.48  ? 306  SER B C   1 
ATOM   5945  O O   . SER B 1 310 ? 49.475  20.730  31.429  1.00 73.10  ? 306  SER B O   1 
ATOM   5946  C CB  . SER B 1 310 ? 50.300  17.793  32.228  1.00 80.77  ? 306  SER B CB  1 
ATOM   5947  O OG  . SER B 1 310 ? 50.169  16.670  33.080  1.00 82.96  ? 306  SER B OG  1 
ATOM   5948  N N   . ARG B 1 311 ? 48.917  19.385  29.706  1.00 75.37  ? 307  ARG B N   1 
ATOM   5949  C CA  . ARG B 1 311 ? 49.183  20.400  28.687  1.00 74.44  ? 307  ARG B CA  1 
ATOM   5950  C C   . ARG B 1 311 ? 47.968  21.278  28.379  1.00 70.58  ? 307  ARG B C   1 
ATOM   5951  O O   . ARG B 1 311 ? 46.943  20.796  27.899  1.00 70.87  ? 307  ARG B O   1 
ATOM   5952  C CB  . ARG B 1 311 ? 49.766  19.762  27.420  1.00 79.06  ? 307  ARG B CB  1 
ATOM   5953  C CG  . ARG B 1 311 ? 48.922  18.657  26.808  1.00 81.84  ? 307  ARG B CG  1 
ATOM   5954  C CD  . ARG B 1 311 ? 49.781  17.539  26.239  1.00 89.01  ? 307  ARG B CD  1 
ATOM   5955  N NE  . ARG B 1 311 ? 50.799  18.008  25.300  1.00 92.11  ? 307  ARG B NE  1 
ATOM   5956  C CZ  . ARG B 1 311 ? 50.588  18.241  24.007  1.00 94.53  ? 307  ARG B CZ  1 
ATOM   5957  N NH1 . ARG B 1 311 ? 49.384  18.061  23.477  1.00 94.12  ? 307  ARG B NH1 1 
ATOM   5958  N NH2 . ARG B 1 311 ? 51.587  18.660  23.241  1.00 98.41  ? 307  ARG B NH2 1 
ATOM   5959  N N   . ILE B 1 312 ? 48.100  22.570  28.669  1.00 68.25  ? 308  ILE B N   1 
ATOM   5960  C CA  . ILE B 1 312 ? 47.015  23.536  28.479  1.00 65.45  ? 308  ILE B CA  1 
ATOM   5961  C C   . ILE B 1 312 ? 47.370  24.591  27.425  1.00 65.63  ? 308  ILE B C   1 
ATOM   5962  O O   . ILE B 1 312 ? 48.275  25.404  27.623  1.00 66.67  ? 308  ILE B O   1 
ATOM   5963  C CB  . ILE B 1 312 ? 46.641  24.250  29.804  1.00 63.97  ? 308  ILE B CB  1 
ATOM   5964  C CG1 . ILE B 1 312 ? 46.300  23.236  30.901  1.00 64.07  ? 308  ILE B CG1 1 
ATOM   5965  C CG2 . ILE B 1 312 ? 45.481  25.212  29.581  1.00 62.63  ? 308  ILE B CG2 1 
ATOM   5966  C CD1 . ILE B 1 312 ? 46.340  23.816  32.302  1.00 64.06  ? 308  ILE B CD1 1 
ATOM   5967  N N   . PHE B 1 313 ? 46.640  24.571  26.313  1.00 65.51  ? 309  PHE B N   1 
ATOM   5968  C CA  . PHE B 1 313 ? 46.818  25.544  25.240  1.00 65.88  ? 309  PHE B CA  1 
ATOM   5969  C C   . PHE B 1 313 ? 45.963  26.780  25.500  1.00 63.89  ? 309  PHE B C   1 
ATOM   5970  O O   . PHE B 1 313 ? 44.773  26.670  25.796  1.00 62.87  ? 309  PHE B O   1 
ATOM   5971  C CB  . PHE B 1 313 ? 46.444  24.923  23.892  1.00 68.14  ? 309  PHE B CB  1 
ATOM   5972  C CG  . PHE B 1 313 ? 47.282  23.731  23.512  1.00 71.62  ? 309  PHE B CG  1 
ATOM   5973  C CD1 . PHE B 1 313 ? 46.874  22.444  23.841  1.00 72.95  ? 309  PHE B CD1 1 
ATOM   5974  C CD2 . PHE B 1 313 ? 48.473  23.897  22.810  1.00 74.90  ? 309  PHE B CD2 1 
ATOM   5975  C CE1 . PHE B 1 313 ? 47.644  21.339  23.486  1.00 77.60  ? 309  PHE B CE1 1 
ATOM   5976  C CE2 . PHE B 1 313 ? 49.250  22.798  22.449  1.00 79.51  ? 309  PHE B CE2 1 
ATOM   5977  C CZ  . PHE B 1 313 ? 48.834  21.518  22.788  1.00 80.95  ? 309  PHE B CZ  1 
ATOM   5978  N N   . VAL B 1 314 ? 46.575  27.956  25.399  1.00 64.52  ? 310  VAL B N   1 
ATOM   5979  C CA  . VAL B 1 314 ? 45.876  29.213  25.670  1.00 64.16  ? 310  VAL B CA  1 
ATOM   5980  C C   . VAL B 1 314 ? 46.085  30.208  24.528  1.00 65.92  ? 310  VAL B C   1 
ATOM   5981  O O   . VAL B 1 314 ? 47.214  30.429  24.091  1.00 68.26  ? 310  VAL B O   1 
ATOM   5982  C CB  . VAL B 1 314 ? 46.313  29.829  27.025  1.00 65.12  ? 310  VAL B CB  1 
ATOM   5983  C CG1 . VAL B 1 314 ? 45.579  31.127  27.292  1.00 66.47  ? 310  VAL B CG1 1 
ATOM   5984  C CG2 . VAL B 1 314 ? 46.058  28.856  28.163  1.00 63.71  ? 310  VAL B CG2 1 
ATOM   5985  N N   . GLU B 1 315 ? 44.987  30.792  24.047  1.00 65.75  ? 311  GLU B N   1 
ATOM   5986  C CA  . GLU B 1 315 ? 45.014  31.740  22.931  1.00 67.71  ? 311  GLU B CA  1 
ATOM   5987  C C   . GLU B 1 315 ? 45.887  32.946  23.269  1.00 70.53  ? 311  GLU B C   1 
ATOM   5988  O O   . GLU B 1 315 ? 45.824  33.470  24.384  1.00 71.41  ? 311  GLU B O   1 
ATOM   5989  C CB  . GLU B 1 315 ? 43.590  32.180  22.566  1.00 67.87  ? 311  GLU B CB  1 
ATOM   5990  C CG  . GLU B 1 315 ? 43.436  32.781  21.164  1.00 69.93  ? 311  GLU B CG  1 
ATOM   5991  C CD  . GLU B 1 315 ? 41.993  32.785  20.657  1.00 70.66  ? 311  GLU B CD  1 
ATOM   5992  O OE1 . GLU B 1 315 ? 41.058  32.643  21.471  1.00 70.38  ? 311  GLU B OE1 1 
ATOM   5993  O OE2 . GLU B 1 315 ? 41.791  32.930  19.434  1.00 72.36  ? 311  GLU B OE2 1 
ATOM   5994  N N   . GLU B 1 316 ? 46.698  33.369  22.299  1.00 73.22  ? 312  GLU B N   1 
ATOM   5995  C CA  . GLU B 1 316 ? 47.693  34.436  22.481  1.00 77.83  ? 312  GLU B CA  1 
ATOM   5996  C C   . GLU B 1 316 ? 47.178  35.641  23.268  1.00 80.09  ? 312  GLU B C   1 
ATOM   5997  O O   . GLU B 1 316 ? 47.871  36.156  24.148  1.00 83.84  ? 312  GLU B O   1 
ATOM   5998  C CB  . GLU B 1 316 ? 48.245  34.895  21.125  1.00 81.15  ? 312  GLU B CB  1 
ATOM   5999  C CG  . GLU B 1 316 ? 49.179  33.891  20.448  1.00 82.52  ? 312  GLU B CG  1 
ATOM   6000  C CD  . GLU B 1 316 ? 49.730  34.380  19.111  1.00 87.38  ? 312  GLU B CD  1 
ATOM   6001  O OE1 . GLU B 1 316 ? 49.340  35.479  18.658  1.00 89.30  ? 312  GLU B OE1 1 
ATOM   6002  O OE2 . GLU B 1 316 ? 50.557  33.659  18.510  1.00 90.00  ? 312  GLU B OE2 1 
ATOM   6003  N N   . SER B 1 317 ? 45.958  36.069  22.946  1.00 79.09  ? 313  SER B N   1 
ATOM   6004  C CA  . SER B 1 317 ? 45.313  37.223  23.571  1.00 82.44  ? 313  SER B CA  1 
ATOM   6005  C C   . SER B 1 317 ? 45.379  37.182  25.096  1.00 83.58  ? 313  SER B C   1 
ATOM   6006  O O   . SER B 1 317 ? 45.917  38.095  25.727  1.00 89.22  ? 313  SER B O   1 
ATOM   6007  C CB  . SER B 1 317 ? 43.851  37.303  23.128  1.00 80.99  ? 313  SER B CB  1 
ATOM   6008  O OG  . SER B 1 317 ? 43.707  36.906  21.777  1.00 79.47  ? 313  SER B OG  1 
ATOM   6009  N N   . ILE B 1 318 ? 44.845  36.107  25.673  1.00 79.31  ? 314  ILE B N   1 
ATOM   6010  C CA  . ILE B 1 318 ? 44.714  35.970  27.125  1.00 80.37  ? 314  ILE B CA  1 
ATOM   6011  C C   . ILE B 1 318 ? 45.884  35.229  27.781  1.00 80.00  ? 314  ILE B C   1 
ATOM   6012  O O   . ILE B 1 318 ? 45.902  35.044  29.001  1.00 81.22  ? 314  ILE B O   1 
ATOM   6013  C CB  . ILE B 1 318 ? 43.368  35.292  27.517  1.00 77.42  ? 314  ILE B CB  1 
ATOM   6014  C CG1 . ILE B 1 318 ? 43.185  33.959  26.777  1.00 72.20  ? 314  ILE B CG1 1 
ATOM   6015  C CG2 . ILE B 1 318 ? 42.197  36.237  27.250  1.00 80.58  ? 314  ILE B CG2 1 
ATOM   6016  C CD1 . ILE B 1 318 ? 42.286  32.968  27.489  1.00 69.99  ? 314  ILE B CD1 1 
ATOM   6017  N N   . TYR B 1 319 ? 46.859  34.824  26.970  1.00 79.37  ? 315  TYR B N   1 
ATOM   6018  C CA  . TYR B 1 319 ? 48.007  34.044  27.439  1.00 79.92  ? 315  TYR B CA  1 
ATOM   6019  C C   . TYR B 1 319 ? 48.734  34.684  28.623  1.00 86.06  ? 315  TYR B C   1 
ATOM   6020  O O   . TYR B 1 319 ? 49.033  34.006  29.608  1.00 85.89  ? 315  TYR B O   1 
ATOM   6021  C CB  . TYR B 1 319 ? 48.980  33.784  26.285  1.00 80.71  ? 315  TYR B CB  1 
ATOM   6022  C CG  . TYR B 1 319 ? 50.095  32.822  26.622  1.00 81.73  ? 315  TYR B CG  1 
ATOM   6023  C CD1 . TYR B 1 319 ? 49.890  31.444  26.577  1.00 77.33  ? 315  TYR B CD1 1 
ATOM   6024  C CD2 . TYR B 1 319 ? 51.361  33.290  26.977  1.00 88.49  ? 315  TYR B CD2 1 
ATOM   6025  C CE1 . TYR B 1 319 ? 50.914  30.556  26.881  1.00 79.16  ? 315  TYR B CE1 1 
ATOM   6026  C CE2 . TYR B 1 319 ? 52.391  32.411  27.285  1.00 90.55  ? 315  TYR B CE2 1 
ATOM   6027  C CZ  . TYR B 1 319 ? 52.161  31.046  27.236  1.00 85.68  ? 315  TYR B CZ  1 
ATOM   6028  O OH  . TYR B 1 319 ? 53.179  30.172  27.539  1.00 88.60  ? 315  TYR B OH  1 
ATOM   6029  N N   . GLU B 1 320 ? 49.008  35.984  28.516  1.00 92.54  ? 316  GLU B N   1 
ATOM   6030  C CA  . GLU B 1 320 ? 49.679  36.749  29.570  1.00 100.95 ? 316  GLU B CA  1 
ATOM   6031  C C   . GLU B 1 320 ? 48.898  36.714  30.886  1.00 101.44 ? 316  GLU B C   1 
ATOM   6032  O O   . GLU B 1 320 ? 49.478  36.481  31.950  1.00 105.17 ? 316  GLU B O   1 
ATOM   6033  C CB  . GLU B 1 320 ? 49.915  38.196  29.109  1.00 108.62 ? 316  GLU B CB  1 
ATOM   6034  C CG  . GLU B 1 320 ? 50.135  39.231  30.224  1.00 118.92 ? 316  GLU B CG  1 
ATOM   6035  C CD  . GLU B 1 320 ? 51.529  39.184  30.834  1.00 126.78 ? 316  GLU B CD  1 
ATOM   6036  O OE1 . GLU B 1 320 ? 51.852  38.200  31.533  1.00 124.19 ? 316  GLU B OE1 1 
ATOM   6037  O OE2 . GLU B 1 320 ? 52.297  40.150  30.630  1.00 136.58 ? 316  GLU B OE2 1 
ATOM   6038  N N   . GLU B 1 321 ? 47.588  36.935  30.799  1.00 98.68  ? 317  GLU B N   1 
ATOM   6039  C CA  . GLU B 1 321 ? 46.719  36.951  31.974  1.00 100.17 ? 317  GLU B CA  1 
ATOM   6040  C C   . GLU B 1 321 ? 46.561  35.564  32.582  1.00 94.53  ? 317  GLU B C   1 
ATOM   6041  O O   . GLU B 1 321 ? 46.518  35.422  33.803  1.00 97.55  ? 317  GLU B O   1 
ATOM   6042  C CB  . GLU B 1 321 ? 45.342  37.537  31.631  1.00 99.77  ? 317  GLU B CB  1 
ATOM   6043  C CG  . GLU B 1 321 ? 45.346  39.027  31.295  1.00 107.39 ? 317  GLU B CG  1 
ATOM   6044  C CD  . GLU B 1 321 ? 45.894  39.887  32.420  1.00 117.71 ? 317  GLU B CD  1 
ATOM   6045  O OE1 . GLU B 1 321 ? 45.349  39.831  33.543  1.00 120.60 ? 317  GLU B OE1 1 
ATOM   6046  O OE2 . GLU B 1 321 ? 46.872  40.621  32.176  1.00 123.96 ? 317  GLU B OE2 1 
ATOM   6047  N N   . PHE B 1 322 ? 46.491  34.548  31.722  1.00 65.96  ? 318  PHE B N   1 
ATOM   6048  C CA  . PHE B 1 322 ? 46.270  33.168  32.152  1.00 62.98  ? 318  PHE B CA  1 
ATOM   6049  C C   . PHE B 1 322 ? 47.409  32.617  33.007  1.00 61.90  ? 318  PHE B C   1 
ATOM   6050  O O   . PHE B 1 322 ? 47.168  32.054  34.074  1.00 60.52  ? 318  PHE B O   1 
ATOM   6051  C CB  . PHE B 1 322 ? 46.032  32.255  30.948  1.00 61.40  ? 318  PHE B CB  1 
ATOM   6052  C CG  . PHE B 1 322 ? 45.530  30.894  31.321  1.00 58.96  ? 318  PHE B CG  1 
ATOM   6053  C CD1 . PHE B 1 322 ? 46.422  29.857  31.593  1.00 57.17  ? 318  PHE B CD1 1 
ATOM   6054  C CD2 . PHE B 1 322 ? 44.163  30.648  31.419  1.00 58.76  ? 318  PHE B CD2 1 
ATOM   6055  C CE1 . PHE B 1 322 ? 45.959  28.594  31.947  1.00 55.19  ? 318  PHE B CE1 1 
ATOM   6056  C CE2 . PHE B 1 322 ? 43.689  29.391  31.776  1.00 56.76  ? 318  PHE B CE2 1 
ATOM   6057  C CZ  . PHE B 1 322 ? 44.589  28.361  32.041  1.00 55.11  ? 318  PHE B CZ  1 
ATOM   6058  N N   . VAL B 1 323 ? 48.639  32.770  32.524  1.00 62.82  ? 319  VAL B N   1 
ATOM   6059  C CA  . VAL B 1 323 ? 49.829  32.383  33.280  1.00 62.58  ? 319  VAL B CA  1 
ATOM   6060  C C   . VAL B 1 323 ? 49.865  33.132  34.614  1.00 64.30  ? 319  VAL B C   1 
ATOM   6061  O O   . VAL B 1 323 ? 50.097  32.532  35.667  1.00 63.10  ? 319  VAL B O   1 
ATOM   6062  C CB  . VAL B 1 323 ? 51.136  32.653  32.478  1.00 64.05  ? 319  VAL B CB  1 
ATOM   6063  C CG1 . VAL B 1 323 ? 52.373  32.308  33.304  1.00 63.91  ? 319  VAL B CG1 1 
ATOM   6064  C CG2 . VAL B 1 323 ? 51.142  31.867  31.173  1.00 62.89  ? 319  VAL B CG2 1 
ATOM   6065  N N   . ARG B 1 324 ? 49.608  34.438  34.556  1.00 67.54  ? 320  ARG B N   1 
ATOM   6066  C CA  . ARG B 1 324 ? 49.612  35.297  35.736  1.00 70.11  ? 320  ARG B CA  1 
ATOM   6067  C C   . ARG B 1 324 ? 48.539  34.895  36.744  1.00 69.03  ? 320  ARG B C   1 
ATOM   6068  O O   . ARG B 1 324 ? 48.711  35.085  37.948  1.00 70.00  ? 320  ARG B O   1 
ATOM   6069  C CB  . ARG B 1 324 ? 49.444  36.762  35.327  1.00 74.07  ? 320  ARG B CB  1 
ATOM   6070  C CG  . ARG B 1 324 ? 49.944  37.754  36.361  1.00 77.61  ? 320  ARG B CG  1 
ATOM   6071  C CD  . ARG B 1 324 ? 50.330  39.075  35.726  1.00 82.26  ? 320  ARG B CD  1 
ATOM   6072  N NE  . ARG B 1 324 ? 49.173  39.799  35.204  1.00 84.42  ? 320  ARG B NE  1 
ATOM   6073  C CZ  . ARG B 1 324 ? 49.159  41.102  34.930  1.00 88.95  ? 320  ARG B CZ  1 
ATOM   6074  N NH1 . ARG B 1 324 ? 48.054  41.662  34.461  1.00 90.45  ? 320  ARG B NH1 1 
ATOM   6075  N NH2 . ARG B 1 324 ? 50.239  41.851  35.128  1.00 92.09  ? 320  ARG B NH2 1 
ATOM   6076  N N   . ARG B 1 325 ? 47.435  34.344  36.246  1.00 67.48  ? 321  ARG B N   1 
ATOM   6077  C CA  . ARG B 1 325 ? 46.399  33.790  37.110  1.00 66.53  ? 321  ARG B CA  1 
ATOM   6078  C C   . ARG B 1 325 ? 46.826  32.414  37.619  1.00 63.53  ? 321  ARG B C   1 
ATOM   6079  O O   . ARG B 1 325 ? 46.620  32.087  38.791  1.00 63.30  ? 321  ARG B O   1 
ATOM   6080  C CB  . ARG B 1 325 ? 45.058  33.686  36.372  1.00 66.27  ? 321  ARG B CB  1 
ATOM   6081  C CG  . ARG B 1 325 ? 44.373  35.016  36.062  1.00 69.67  ? 321  ARG B CG  1 
ATOM   6082  C CD  . ARG B 1 325 ? 43.506  35.517  37.210  1.00 71.82  ? 321  ARG B CD  1 
ATOM   6083  N NE  . ARG B 1 325 ? 42.721  36.689  36.815  1.00 75.35  ? 321  ARG B NE  1 
ATOM   6084  C CZ  . ARG B 1 325 ? 41.433  36.667  36.476  1.00 75.87  ? 321  ARG B CZ  1 
ATOM   6085  N NH1 . ARG B 1 325 ? 40.746  35.528  36.486  1.00 73.26  ? 321  ARG B NH1 1 
ATOM   6086  N NH2 . ARG B 1 325 ? 40.824  37.795  36.130  1.00 79.25  ? 321  ARG B NH2 1 
ATOM   6087  N N   . SER B 1 326 ? 47.436  31.625  36.735  1.00 61.70  ? 322  SER B N   1 
ATOM   6088  C CA  . SER B 1 326 ? 47.806  30.238  37.029  1.00 59.08  ? 322  SER B CA  1 
ATOM   6089  C C   . SER B 1 326 ? 48.889  30.096  38.095  1.00 59.20  ? 322  SER B C   1 
ATOM   6090  O O   . SER B 1 326 ? 48.964  29.067  38.773  1.00 57.37  ? 322  SER B O   1 
ATOM   6091  C CB  . SER B 1 326 ? 48.237  29.521  35.753  1.00 57.74  ? 322  SER B CB  1 
ATOM   6092  O OG  . SER B 1 326 ? 47.174  29.483  34.819  1.00 57.73  ? 322  SER B OG  1 
ATOM   6093  N N   . VAL B 1 327 ? 49.724  31.124  38.235  1.00 61.64  ? 323  VAL B N   1 
ATOM   6094  C CA  . VAL B 1 327 ? 50.764  31.133  39.263  1.00 62.38  ? 323  VAL B CA  1 
ATOM   6095  C C   . VAL B 1 327 ? 50.178  31.422  40.648  1.00 63.40  ? 323  VAL B C   1 
ATOM   6096  O O   . VAL B 1 327 ? 50.595  30.817  41.637  1.00 62.67  ? 323  VAL B O   1 
ATOM   6097  C CB  . VAL B 1 327 ? 51.947  32.105  38.933  1.00 65.07  ? 323  VAL B CB  1 
ATOM   6098  C CG1 . VAL B 1 327 ? 52.658  31.670  37.668  1.00 64.23  ? 323  VAL B CG1 1 
ATOM   6099  C CG2 . VAL B 1 327 ? 51.481  33.554  38.804  1.00 68.44  ? 323  VAL B CG2 1 
ATOM   6100  N N   . GLU B 1 328 ? 49.200  32.328  40.702  1.00 65.37  ? 324  GLU B N   1 
ATOM   6101  C CA  . GLU B 1 328 ? 48.580  32.751  41.958  1.00 67.13  ? 324  GLU B CA  1 
ATOM   6102  C C   . GLU B 1 328 ? 47.740  31.659  42.608  1.00 64.90  ? 324  GLU B C   1 
ATOM   6103  O O   . GLU B 1 328 ? 47.551  31.666  43.825  1.00 65.84  ? 324  GLU B O   1 
ATOM   6104  C CB  . GLU B 1 328 ? 47.735  34.010  41.751  1.00 70.23  ? 324  GLU B CB  1 
ATOM   6105  C CG  . GLU B 1 328 ? 48.522  35.309  41.840  1.00 74.31  ? 324  GLU B CG  1 
ATOM   6106  C CD  . GLU B 1 328 ? 47.650  36.538  41.628  1.00 78.02  ? 324  GLU B CD  1 
ATOM   6107  O OE1 . GLU B 1 328 ? 47.362  36.879  40.459  1.00 78.23  ? 324  GLU B OE1 1 
ATOM   6108  O OE2 . GLU B 1 328 ? 47.259  37.169  42.633  1.00 80.83  ? 324  GLU B OE2 1 
ATOM   6109  N N   . ARG B 1 329 ? 47.238  30.732  41.791  1.00 62.39  ? 325  ARG B N   1 
ATOM   6110  C CA  . ARG B 1 329 ? 46.499  29.567  42.288  1.00 60.48  ? 325  ARG B CA  1 
ATOM   6111  C C   . ARG B 1 329 ? 47.434  28.463  42.774  1.00 58.42  ? 325  ARG B C   1 
ATOM   6112  O O   . ARG B 1 329 ? 47.032  27.603  43.560  1.00 57.41  ? 325  ARG B O   1 
ATOM   6113  C CB  . ARG B 1 329 ? 45.543  29.016  41.220  1.00 59.10  ? 325  ARG B CB  1 
ATOM   6114  C CG  . ARG B 1 329 ? 44.284  29.850  41.002  1.00 61.62  ? 325  ARG B CG  1 
ATOM   6115  C CD  . ARG B 1 329 ? 43.472  29.997  42.289  1.00 63.96  ? 325  ARG B CD  1 
ATOM   6116  N NE  . ARG B 1 329 ? 42.596  31.170  42.265  1.00 67.22  ? 325  ARG B NE  1 
ATOM   6117  C CZ  . ARG B 1 329 ? 42.289  31.904  43.333  1.00 69.98  ? 325  ARG B CZ  1 
ATOM   6118  N NH1 . ARG B 1 329 ? 42.795  31.607  44.524  1.00 70.07  ? 325  ARG B NH1 1 
ATOM   6119  N NH2 . ARG B 1 329 ? 41.481  32.949  43.209  1.00 72.94  ? 325  ARG B NH2 1 
ATOM   6120  N N   . ALA B 1 330 ? 48.676  28.498  42.295  1.00 58.12  ? 326  ALA B N   1 
ATOM   6121  C CA  . ALA B 1 330 ? 49.700  27.534  42.685  1.00 56.57  ? 326  ALA B CA  1 
ATOM   6122  C C   . ALA B 1 330 ? 50.519  28.033  43.878  1.00 58.28  ? 326  ALA B C   1 
ATOM   6123  O O   . ALA B 1 330 ? 51.060  27.235  44.644  1.00 57.41  ? 326  ALA B O   1 
ATOM   6124  C CB  . ALA B 1 330 ? 50.601  27.223  41.506  1.00 55.73  ? 326  ALA B CB  1 
ATOM   6125  N N   . LYS B 1 331 ? 50.604  29.354  44.023  1.00 61.04  ? 327  LYS B N   1 
ATOM   6126  C CA  . LYS B 1 331 ? 51.278  29.980  45.161  1.00 63.41  ? 327  LYS B CA  1 
ATOM   6127  C C   . LYS B 1 331 ? 50.427  29.925  46.429  1.00 64.16  ? 327  LYS B C   1 
ATOM   6128  O O   . LYS B 1 331 ? 50.947  30.050  47.540  1.00 65.72  ? 327  LYS B O   1 
ATOM   6129  C CB  . LYS B 1 331 ? 51.623  31.438  44.844  1.00 66.76  ? 327  LYS B CB  1 
ATOM   6130  C CG  . LYS B 1 331 ? 52.881  31.631  44.012  1.00 67.21  ? 327  LYS B CG  1 
ATOM   6131  C CD  . LYS B 1 331 ? 52.986  33.069  43.524  1.00 70.56  ? 327  LYS B CD  1 
ATOM   6132  C CE  . LYS B 1 331 ? 54.338  33.354  42.893  1.00 71.81  ? 327  LYS B CE  1 
ATOM   6133  N NZ  . LYS B 1 331 ? 55.408  33.538  43.913  1.00 73.78  ? 327  LYS B NZ  1 
ATOM   6134  N N   . ARG B 1 332 ? 49.119  29.751  46.257  1.00 63.38  ? 328  ARG B N   1 
ATOM   6135  C CA  . ARG B 1 332 ? 48.191  29.706  47.383  1.00 64.39  ? 328  ARG B CA  1 
ATOM   6136  C C   . ARG B 1 332 ? 47.653  28.298  47.624  1.00 61.56  ? 328  ARG B C   1 
ATOM   6137  O O   . ARG B 1 332 ? 46.922  28.059  48.590  1.00 62.31  ? 328  ARG B O   1 
ATOM   6138  C CB  . ARG B 1 332 ? 47.047  30.704  47.179  1.00 66.69  ? 328  ARG B CB  1 
ATOM   6139  C CG  . ARG B 1 332 ? 47.474  32.153  47.332  1.00 70.62  ? 328  ARG B CG  1 
ATOM   6140  C CD  . ARG B 1 332 ? 46.411  33.108  46.816  1.00 73.19  ? 328  ARG B CD  1 
ATOM   6141  N NE  . ARG B 1 332 ? 46.849  34.502  46.892  1.00 77.26  ? 328  ARG B NE  1 
ATOM   6142  C CZ  . ARG B 1 332 ? 46.626  35.311  47.926  1.00 81.21  ? 328  ARG B CZ  1 
ATOM   6143  N NH1 . ARG B 1 332 ? 45.964  34.879  48.993  1.00 81.60  ? 328  ARG B NH1 1 
ATOM   6144  N NH2 . ARG B 1 332 ? 47.068  36.562  47.895  1.00 85.26  ? 328  ARG B NH2 1 
ATOM   6145  N N   . ARG B 1 333 ? 48.032  27.368  46.750  1.00 58.64  ? 329  ARG B N   1 
ATOM   6146  C CA  . ARG B 1 333 ? 47.623  25.973  46.874  1.00 56.23  ? 329  ARG B CA  1 
ATOM   6147  C C   . ARG B 1 333 ? 48.215  25.326  48.124  1.00 55.97  ? 329  ARG B C   1 
ATOM   6148  O O   . ARG B 1 333 ? 49.418  25.064  48.192  1.00 55.41  ? 329  ARG B O   1 
ATOM   6149  C CB  . ARG B 1 333 ? 48.018  25.187  45.625  1.00 53.97  ? 329  ARG B CB  1 
ATOM   6150  C CG  . ARG B 1 333 ? 47.430  23.793  45.579  1.00 52.57  ? 329  ARG B CG  1 
ATOM   6151  C CD  . ARG B 1 333 ? 47.107  23.387  44.158  1.00 52.03  ? 329  ARG B CD  1 
ATOM   6152  N NE  . ARG B 1 333 ? 45.991  22.446  44.124  1.00 51.91  ? 329  ARG B NE  1 
ATOM   6153  C CZ  . ARG B 1 333 ? 46.127  21.126  44.090  1.00 50.87  ? 329  ARG B CZ  1 
ATOM   6154  N NH1 . ARG B 1 333 ? 47.339  20.585  44.066  1.00 50.17  ? 329  ARG B NH1 1 
ATOM   6155  N NH2 . ARG B 1 333 ? 45.052  20.348  44.061  1.00 50.48  ? 329  ARG B NH2 1 
ATOM   6156  N N   . VAL B 1 334 ? 47.352  25.076  49.108  1.00 56.56  ? 330  VAL B N   1 
ATOM   6157  C CA  . VAL B 1 334 ? 47.767  24.520  50.399  1.00 56.67  ? 330  VAL B CA  1 
ATOM   6158  C C   . VAL B 1 334 ? 48.212  23.067  50.237  1.00 54.02  ? 330  VAL B C   1 
ATOM   6159  O O   . VAL B 1 334 ? 47.408  22.194  49.894  1.00 52.76  ? 330  VAL B O   1 
ATOM   6160  C CB  . VAL B 1 334 ? 46.641  24.630  51.473  1.00 58.49  ? 330  VAL B CB  1 
ATOM   6161  C CG1 . VAL B 1 334 ? 47.151  24.201  52.839  1.00 59.22  ? 330  VAL B CG1 1 
ATOM   6162  C CG2 . VAL B 1 334 ? 46.099  26.047  51.548  1.00 61.23  ? 330  VAL B CG2 1 
ATOM   6163  N N   . VAL B 1 335 ? 49.501  22.827  50.467  1.00 53.46  ? 331  VAL B N   1 
ATOM   6164  C CA  . VAL B 1 335 ? 50.072  21.486  50.364  1.00 51.40  ? 331  VAL B CA  1 
ATOM   6165  C C   . VAL B 1 335 ? 50.585  21.031  51.726  1.00 52.11  ? 331  VAL B C   1 
ATOM   6166  O O   . VAL B 1 335 ? 51.409  21.708  52.345  1.00 53.75  ? 331  VAL B O   1 
ATOM   6167  C CB  . VAL B 1 335 ? 51.220  21.413  49.330  1.00 50.31  ? 331  VAL B CB  1 
ATOM   6168  C CG1 . VAL B 1 335 ? 51.573  19.965  49.038  1.00 48.81  ? 331  VAL B CG1 1 
ATOM   6169  C CG2 . VAL B 1 335 ? 50.832  22.108  48.044  1.00 50.16  ? 331  VAL B CG2 1 
ATOM   6170  N N   . GLY B 1 336 ? 50.088  19.883  52.180  1.00 51.21  ? 332  GLY B N   1 
ATOM   6171  C CA  . GLY B 1 336 ? 50.454  19.319  53.479  1.00 51.77  ? 332  GLY B CA  1 
ATOM   6172  C C   . GLY B 1 336 ? 49.673  18.057  53.806  1.00 51.05  ? 332  GLY B C   1 
ATOM   6173  O O   . GLY B 1 336 ? 49.197  17.357  52.904  1.00 49.75  ? 332  GLY B O   1 
ATOM   6174  N N   . SER B 1 337 ? 49.531  17.779  55.100  1.00 52.22  ? 333  SER B N   1 
ATOM   6175  C CA  . SER B 1 337 ? 48.905  16.547  55.584  1.00 51.99  ? 333  SER B CA  1 
ATOM   6176  C C   . SER B 1 337 ? 47.533  16.274  54.958  1.00 51.62  ? 333  SER B C   1 
ATOM   6177  O O   . SER B 1 337 ? 46.664  17.144  54.967  1.00 52.66  ? 333  SER B O   1 
ATOM   6178  C CB  . SER B 1 337 ? 48.794  16.571  57.111  1.00 54.02  ? 333  SER B CB  1 
ATOM   6179  O OG  . SER B 1 337 ? 48.158  15.400  57.592  1.00 54.24  ? 333  SER B OG  1 
ATOM   6180  N N   . PRO B 1 338 ? 47.351  15.067  54.388  1.00 50.46  ? 334  PRO B N   1 
ATOM   6181  C CA  . PRO B 1 338 ? 46.052  14.596  53.897  1.00 50.62  ? 334  PRO B CA  1 
ATOM   6182  C C   . PRO B 1 338 ? 44.906  14.628  54.927  1.00 52.68  ? 334  PRO B C   1 
ATOM   6183  O O   . PRO B 1 338 ? 43.757  14.870  54.550  1.00 53.41  ? 334  PRO B O   1 
ATOM   6184  C CB  . PRO B 1 338 ? 46.334  13.148  53.461  1.00 49.84  ? 334  PRO B CB  1 
ATOM   6185  C CG  . PRO B 1 338 ? 47.812  12.913  53.673  1.00 49.13  ? 334  PRO B CG  1 
ATOM   6186  C CD  . PRO B 1 338 ? 48.455  14.235  53.880  1.00 49.11  ? 334  PRO B CD  1 
ATOM   6187  N N   . PHE B 1 339 ? 45.212  14.382  56.200  1.00 53.83  ? 335  PHE B N   1 
ATOM   6188  C CA  . PHE B 1 339 ? 44.193  14.350  57.256  1.00 56.15  ? 335  PHE B CA  1 
ATOM   6189  C C   . PHE B 1 339 ? 43.747  15.753  57.661  1.00 57.75  ? 335  PHE B C   1 
ATOM   6190  O O   . PHE B 1 339 ? 42.632  15.943  58.153  1.00 59.80  ? 335  PHE B O   1 
ATOM   6191  C CB  . PHE B 1 339 ? 44.713  13.596  58.483  1.00 57.23  ? 335  PHE B CB  1 
ATOM   6192  C CG  . PHE B 1 339 ? 44.801  12.105  58.295  1.00 56.90  ? 335  PHE B CG  1 
ATOM   6193  C CD1 . PHE B 1 339 ? 43.862  11.264  58.883  1.00 59.03  ? 335  PHE B CD1 1 
ATOM   6194  C CD2 . PHE B 1 339 ? 45.830  11.537  57.544  1.00 55.36  ? 335  PHE B CD2 1 
ATOM   6195  C CE1 . PHE B 1 339 ? 43.936  9.879   58.721  1.00 59.11  ? 335  PHE B CE1 1 
ATOM   6196  C CE2 . PHE B 1 339 ? 45.912  10.153  57.373  1.00 55.45  ? 335  PHE B CE2 1 
ATOM   6197  C CZ  . PHE B 1 339 ? 44.961  9.324   57.966  1.00 57.24  ? 335  PHE B CZ  1 
ATOM   6198  N N   . ASP B 1 340 ? 44.633  16.724  57.453  1.00 57.11  ? 336  ASP B N   1 
ATOM   6199  C CA  . ASP B 1 340 ? 44.379  18.124  57.780  1.00 58.98  ? 336  ASP B CA  1 
ATOM   6200  C C   . ASP B 1 340 ? 43.364  18.729  56.803  1.00 58.90  ? 336  ASP B C   1 
ATOM   6201  O O   . ASP B 1 340 ? 43.639  18.820  55.605  1.00 56.86  ? 336  ASP B O   1 
ATOM   6202  C CB  . ASP B 1 340 ? 45.699  18.904  57.756  1.00 58.59  ? 336  ASP B CB  1 
ATOM   6203  C CG  . ASP B 1 340 ? 45.576  20.302  58.340  1.00 61.57  ? 336  ASP B CG  1 
ATOM   6204  O OD1 . ASP B 1 340 ? 45.019  20.456  59.449  1.00 64.38  ? 336  ASP B OD1 1 
ATOM   6205  O OD2 . ASP B 1 340 ? 46.062  21.252  57.690  1.00 61.78  ? 336  ASP B OD2 1 
ATOM   6206  N N   . PRO B 1 341 ? 42.189  19.150  57.316  1.00 61.45  ? 337  PRO B N   1 
ATOM   6207  C CA  . PRO B 1 341 ? 41.043  19.604  56.506  1.00 62.00  ? 337  PRO B CA  1 
ATOM   6208  C C   . PRO B 1 341 ? 41.297  20.786  55.560  1.00 61.35  ? 337  PRO B C   1 
ATOM   6209  O O   . PRO B 1 341 ? 40.484  21.037  54.675  1.00 61.33  ? 337  PRO B O   1 
ATOM   6210  C CB  . PRO B 1 341 ? 39.997  19.996  57.563  1.00 65.63  ? 337  PRO B CB  1 
ATOM   6211  C CG  . PRO B 1 341 ? 40.769  20.217  58.810  1.00 67.03  ? 337  PRO B CG  1 
ATOM   6212  C CD  . PRO B 1 341 ? 41.890  19.231  58.756  1.00 64.40  ? 337  PRO B CD  1 
ATOM   6213  N N   . THR B 1 342 ? 42.406  21.496  55.744  1.00 61.21  ? 338  THR B N   1 
ATOM   6214  C CA  . THR B 1 342 ? 42.691  22.701  54.963  1.00 61.32  ? 338  THR B CA  1 
ATOM   6215  C C   . THR B 1 342 ? 43.451  22.415  53.670  1.00 58.18  ? 338  THR B C   1 
ATOM   6216  O O   . THR B 1 342 ? 43.422  23.224  52.741  1.00 57.99  ? 338  THR B O   1 
ATOM   6217  C CB  . THR B 1 342 ? 43.487  23.753  55.787  1.00 63.57  ? 338  THR B CB  1 
ATOM   6218  O OG1 . THR B 1 342 ? 44.706  23.173  56.273  1.00 62.33  ? 338  THR B OG1 1 
ATOM   6219  C CG2 . THR B 1 342 ? 42.661  24.269  56.962  1.00 67.37  ? 338  THR B CG2 1 
ATOM   6220  N N   . THR B 1 343 ? 44.116  21.263  53.614  1.00 56.07  ? 339  THR B N   1 
ATOM   6221  C CA  . THR B 1 343 ? 45.052  20.948  52.528  1.00 53.58  ? 339  THR B CA  1 
ATOM   6222  C C   . THR B 1 343 ? 44.368  20.536  51.225  1.00 52.13  ? 339  THR B C   1 
ATOM   6223  O O   . THR B 1 343 ? 43.444  19.721  51.228  1.00 52.10  ? 339  THR B O   1 
ATOM   6224  C CB  . THR B 1 343 ? 46.088  19.871  52.948  1.00 52.25  ? 339  THR B CB  1 
ATOM   6225  O OG1 . THR B 1 343 ? 45.452  18.593  53.044  1.00 51.64  ? 339  THR B OG1 1 
ATOM   6226  C CG2 . THR B 1 343 ? 46.730  20.230  54.292  1.00 53.97  ? 339  THR B CG2 1 
ATOM   6227  N N   . GLU B 1 344 ? 44.835  21.107  50.117  1.00 51.22  ? 340  GLU B N   1 
ATOM   6228  C CA  . GLU B 1 344 ? 44.310  20.786  48.792  1.00 50.17  ? 340  GLU B CA  1 
ATOM   6229  C C   . GLU B 1 344 ? 45.074  19.624  48.170  1.00 48.17  ? 340  GLU B C   1 
ATOM   6230  O O   . GLU B 1 344 ? 44.501  18.819  47.427  1.00 47.57  ? 340  GLU B O   1 
ATOM   6231  C CB  . GLU B 1 344 ? 44.415  21.990  47.856  1.00 50.56  ? 340  GLU B CB  1 
ATOM   6232  C CG  . GLU B 1 344 ? 43.620  23.217  48.260  1.00 53.21  ? 340  GLU B CG  1 
ATOM   6233  C CD  . GLU B 1 344 ? 43.890  24.395  47.340  1.00 54.38  ? 340  GLU B CD  1 
ATOM   6234  O OE1 . GLU B 1 344 ? 43.624  24.282  46.120  1.00 53.60  ? 340  GLU B OE1 1 
ATOM   6235  O OE2 . GLU B 1 344 ? 44.370  25.436  47.836  1.00 56.35  ? 340  GLU B OE2 1 
ATOM   6236  N N   . GLN B 1 345 ? 46.368  19.548  48.472  1.00 47.49  ? 341  GLN B N   1 
ATOM   6237  C CA  . GLN B 1 345 ? 47.255  18.589  47.826  1.00 45.92  ? 341  GLN B CA  1 
ATOM   6238  C C   . GLN B 1 345 ? 47.981  17.688  48.818  1.00 45.71  ? 341  GLN B C   1 
ATOM   6239  O O   . GLN B 1 345 ? 48.745  18.162  49.666  1.00 46.45  ? 341  GLN B O   1 
ATOM   6240  C CB  . GLN B 1 345 ? 48.279  19.321  46.954  1.00 45.57  ? 341  GLN B CB  1 
ATOM   6241  C CG  . GLN B 1 345 ? 49.073  18.412  46.022  1.00 44.51  ? 341  GLN B CG  1 
ATOM   6242  C CD  . GLN B 1 345 ? 50.110  19.163  45.216  1.00 44.92  ? 341  GLN B CD  1 
ATOM   6243  O OE1 . GLN B 1 345 ? 49.831  20.218  44.642  1.00 45.47  ? 341  GLN B OE1 1 
ATOM   6244  N NE2 . GLN B 1 345 ? 51.318  18.620  45.165  1.00 45.20  ? 341  GLN B NE2 1 
ATOM   6245  N N   . GLY B 1 346 ? 47.744  16.386  48.691  1.00 44.86  ? 342  GLY B N   1 
ATOM   6246  C CA  . GLY B 1 346 ? 48.496  15.389  49.436  1.00 44.37  ? 342  GLY B CA  1 
ATOM   6247  C C   . GLY B 1 346 ? 49.828  15.106  48.763  1.00 43.32  ? 342  GLY B C   1 
ATOM   6248  O O   . GLY B 1 346 ? 50.213  15.804  47.822  1.00 42.78  ? 342  GLY B O   1 
ATOM   6249  N N   . PRO B 1 347 ? 50.544  14.077  49.244  1.00 43.24  ? 343  PRO B N   1 
ATOM   6250  C CA  . PRO B 1 347 ? 51.830  13.705  48.667  1.00 42.92  ? 343  PRO B CA  1 
ATOM   6251  C C   . PRO B 1 347 ? 51.676  12.771  47.465  1.00 42.55  ? 343  PRO B C   1 
ATOM   6252  O O   . PRO B 1 347 ? 50.599  12.210  47.253  1.00 42.72  ? 343  PRO B O   1 
ATOM   6253  C CB  . PRO B 1 347 ? 52.509  12.966  49.816  1.00 43.57  ? 343  PRO B CB  1 
ATOM   6254  C CG  . PRO B 1 347 ? 51.379  12.328  50.549  1.00 44.05  ? 343  PRO B CG  1 
ATOM   6255  C CD  . PRO B 1 347 ? 50.200  13.242  50.410  1.00 43.96  ? 343  PRO B CD  1 
ATOM   6256  N N   . GLN B 1 348 ? 52.749  12.612  46.692  1.00 42.38  ? 344  GLN B N   1 
ATOM   6257  C CA  . GLN B 1 348 ? 52.784  11.631  45.611  1.00 42.47  ? 344  GLN B CA  1 
ATOM   6258  C C   . GLN B 1 348 ? 52.858  10.224  46.223  1.00 43.23  ? 344  GLN B C   1 
ATOM   6259  O O   . GLN B 1 348 ? 53.152  10.078  47.411  1.00 43.55  ? 344  GLN B O   1 
ATOM   6260  C CB  . GLN B 1 348 ? 53.969  11.890  44.663  1.00 42.75  ? 344  GLN B CB  1 
ATOM   6261  C CG  . GLN B 1 348 ? 54.221  13.363  44.284  1.00 42.19  ? 344  GLN B CG  1 
ATOM   6262  C CD  . GLN B 1 348 ? 53.009  14.070  43.683  1.00 41.73  ? 344  GLN B CD  1 
ATOM   6263  O OE1 . GLN B 1 348 ? 52.631  15.157  44.122  1.00 41.45  ? 344  GLN B OE1 1 
ATOM   6264  N NE2 . GLN B 1 348 ? 52.401  13.458  42.674  1.00 41.91  ? 344  GLN B NE2 1 
ATOM   6265  N N   . ILE B 1 349 ? 52.590  9.198   45.417  1.00 43.79  ? 345  ILE B N   1 
ATOM   6266  C CA  . ILE B 1 349 ? 52.472  7.826   45.919  1.00 44.83  ? 345  ILE B CA  1 
ATOM   6267  C C   . ILE B 1 349 ? 53.809  7.180   46.315  1.00 45.79  ? 345  ILE B C   1 
ATOM   6268  O O   . ILE B 1 349 ? 53.901  6.528   47.357  1.00 46.45  ? 345  ILE B O   1 
ATOM   6269  C CB  . ILE B 1 349 ? 51.695  6.912   44.913  1.00 45.87  ? 345  ILE B CB  1 
ATOM   6270  C CG1 . ILE B 1 349 ? 51.171  5.644   45.596  1.00 47.18  ? 345  ILE B CG1 1 
ATOM   6271  C CG2 . ILE B 1 349 ? 52.547  6.556   43.697  1.00 46.66  ? 345  ILE B CG2 1 
ATOM   6272  C CD1 . ILE B 1 349 ? 49.942  5.856   46.445  1.00 46.76  ? 345  ILE B CD1 1 
ATOM   6273  N N   . ASP B 1 350 ? 54.834  7.383   45.489  1.00 46.10  ? 346  ASP B N   1 
ATOM   6274  C CA  . ASP B 1 350 ? 56.082  6.621   45.568  1.00 47.48  ? 346  ASP B CA  1 
ATOM   6275  C C   . ASP B 1 350 ? 57.313  7.495   45.703  1.00 47.28  ? 346  ASP B C   1 
ATOM   6276  O O   . ASP B 1 350 ? 57.277  8.688   45.416  1.00 46.10  ? 346  ASP B O   1 
ATOM   6277  C CB  . ASP B 1 350 ? 56.259  5.787   44.294  1.00 49.02  ? 346  ASP B CB  1 
ATOM   6278  C CG  . ASP B 1 350 ? 55.686  4.395   44.409  1.00 50.69  ? 346  ASP B CG  1 
ATOM   6279  O OD1 . ASP B 1 350 ? 55.303  3.987   45.525  1.00 50.80  ? 346  ASP B OD1 1 
ATOM   6280  O OD2 . ASP B 1 350 ? 55.633  3.702   43.370  1.00 52.33  ? 346  ASP B OD2 1 
ATOM   6281  N N   . LYS B 1 351 ? 58.407  6.874   46.133  1.00 48.83  ? 347  LYS B N   1 
ATOM   6282  C CA  . LYS B 1 351 ? 59.743  7.421   45.922  1.00 49.65  ? 347  LYS B CA  1 
ATOM   6283  C C   . LYS B 1 351 ? 60.060  7.337   44.419  1.00 50.59  ? 347  LYS B C   1 
ATOM   6284  O O   . LYS B 1 351 ? 60.622  8.273   43.841  1.00 50.54  ? 347  LYS B O   1 
ATOM   6285  C CB  . LYS B 1 351 ? 60.773  6.648   46.760  1.00 51.28  ? 347  LYS B CB  1 
ATOM   6286  C CG  . LYS B 1 351 ? 62.240  7.082   46.605  1.00 52.67  ? 347  LYS B CG  1 
ATOM   6287  C CD  . LYS B 1 351 ? 62.632  8.260   47.502  1.00 51.91  ? 347  LYS B CD  1 
ATOM   6288  C CE  . LYS B 1 351 ? 62.542  9.585   46.753  1.00 51.14  ? 347  LYS B CE  1 
ATOM   6289  N NZ  . LYS B 1 351 ? 63.209  10.720  47.447  1.00 51.33  ? 347  LYS B NZ  1 
ATOM   6290  N N   . LYS B 1 352 ? 59.668  6.220   43.799  1.00 51.74  ? 348  LYS B N   1 
ATOM   6291  C CA  . LYS B 1 352 ? 59.822  5.989   42.359  1.00 53.12  ? 348  LYS B CA  1 
ATOM   6292  C C   . LYS B 1 352 ? 59.127  7.072   41.539  1.00 51.57  ? 348  LYS B C   1 
ATOM   6293  O O   . LYS B 1 352 ? 59.667  7.550   40.545  1.00 52.30  ? 348  LYS B O   1 
ATOM   6294  C CB  . LYS B 1 352 ? 59.262  4.614   41.982  1.00 54.83  ? 348  LYS B CB  1 
ATOM   6295  C CG  . LYS B 1 352 ? 59.824  4.021   40.698  1.00 57.55  ? 348  LYS B CG  1 
ATOM   6296  C CD  . LYS B 1 352 ? 59.400  2.567   40.562  1.00 60.52  ? 348  LYS B CD  1 
ATOM   6297  C CE  . LYS B 1 352 ? 60.490  1.707   39.919  1.00 64.43  ? 348  LYS B CE  1 
ATOM   6298  N NZ  . LYS B 1 352 ? 60.485  1.769   38.429  1.00 66.09  ? 348  LYS B NZ  1 
ATOM   6299  N N   . GLN B 1 353 ? 57.927  7.448   41.970  1.00 49.83  ? 349  GLN B N   1 
ATOM   6300  C CA  . GLN B 1 353 ? 57.143  8.496   41.324  1.00 48.42  ? 349  GLN B CA  1 
ATOM   6301  C C   . GLN B 1 353 ? 57.714  9.887   41.634  1.00 47.44  ? 349  GLN B C   1 
ATOM   6302  O O   . GLN B 1 353 ? 57.847  10.726  40.739  1.00 47.33  ? 349  GLN B O   1 
ATOM   6303  C CB  . GLN B 1 353 ? 55.684  8.399   41.780  1.00 47.21  ? 349  GLN B CB  1 
ATOM   6304  C CG  . GLN B 1 353 ? 54.711  9.274   41.013  1.00 46.32  ? 349  GLN B CG  1 
ATOM   6305  C CD  . GLN B 1 353 ? 54.195  8.624   39.746  1.00 47.79  ? 349  GLN B CD  1 
ATOM   6306  O OE1 . GLN B 1 353 ? 54.625  7.535   39.360  1.00 49.61  ? 349  GLN B OE1 1 
ATOM   6307  N NE2 . GLN B 1 353 ? 53.256  9.291   39.093  1.00 47.31  ? 349  GLN B NE2 1 
ATOM   6308  N N   . TYR B 1 354 ? 58.053  10.111  42.905  1.00 47.02  ? 350  TYR B N   1 
ATOM   6309  C CA  . TYR B 1 354 ? 58.606  11.381  43.376  1.00 46.58  ? 350  TYR B CA  1 
ATOM   6310  C C   . TYR B 1 354 ? 59.870  11.766  42.609  1.00 48.13  ? 350  TYR B C   1 
ATOM   6311  O O   . TYR B 1 354 ? 60.056  12.933  42.253  1.00 48.09  ? 350  TYR B O   1 
ATOM   6312  C CB  . TYR B 1 354 ? 58.877  11.316  44.888  1.00 46.50  ? 350  TYR B CB  1 
ATOM   6313  C CG  . TYR B 1 354 ? 59.493  12.568  45.479  1.00 46.42  ? 350  TYR B CG  1 
ATOM   6314  C CD1 . TYR B 1 354 ? 58.717  13.694  45.740  1.00 45.22  ? 350  TYR B CD1 1 
ATOM   6315  C CD2 . TYR B 1 354 ? 60.852  12.621  45.781  1.00 47.83  ? 350  TYR B CD2 1 
ATOM   6316  C CE1 . TYR B 1 354 ? 59.282  14.843  46.278  1.00 45.97  ? 350  TYR B CE1 1 
ATOM   6317  C CE2 . TYR B 1 354 ? 61.423  13.761  46.319  1.00 48.29  ? 350  TYR B CE2 1 
ATOM   6318  C CZ  . TYR B 1 354 ? 60.634  14.868  46.563  1.00 47.41  ? 350  TYR B CZ  1 
ATOM   6319  O OH  . TYR B 1 354 ? 61.197  16.000  47.095  1.00 48.60  ? 350  TYR B OH  1 
ATOM   6320  N N   . ASN B 1 355 ? 60.728  10.779  42.355  1.00 49.82  ? 351  ASN B N   1 
ATOM   6321  C CA  . ASN B 1 355 ? 61.947  10.986  41.579  1.00 51.78  ? 351  ASN B CA  1 
ATOM   6322  C C   . ASN B 1 355 ? 61.669  11.187  40.094  1.00 52.21  ? 351  ASN B C   1 
ATOM   6323  O O   . ASN B 1 355 ? 62.265  12.057  39.459  1.00 53.03  ? 351  ASN B O   1 
ATOM   6324  C CB  . ASN B 1 355 ? 62.913  9.818   41.780  1.00 53.85  ? 351  ASN B CB  1 
ATOM   6325  C CG  . ASN B 1 355 ? 63.407  9.708   43.212  1.00 54.03  ? 351  ASN B CG  1 
ATOM   6326  O OD1 . ASN B 1 355 ? 63.433  10.690  43.959  1.00 53.10  ? 351  ASN B OD1 1 
ATOM   6327  N ND2 . ASN B 1 355 ? 63.807  8.505   43.600  1.00 55.41  ? 351  ASN B ND2 1 
ATOM   6328  N N   . LYS B 1 356 ? 60.752  10.384  39.557  1.00 52.01  ? 352  LYS B N   1 
ATOM   6329  C CA  . LYS B 1 356 ? 60.383  10.435  38.143  1.00 52.75  ? 352  LYS B CA  1 
ATOM   6330  C C   . LYS B 1 356 ? 59.811  11.799  37.748  1.00 51.25  ? 352  LYS B C   1 
ATOM   6331  O O   . LYS B 1 356 ? 60.057  12.282  36.639  1.00 52.22  ? 352  LYS B O   1 
ATOM   6332  C CB  . LYS B 1 356 ? 59.384  9.320   37.819  1.00 52.95  ? 352  LYS B CB  1 
ATOM   6333  C CG  . LYS B 1 356 ? 59.477  8.781   36.400  1.00 55.70  ? 352  LYS B CG  1 
ATOM   6334  C CD  . LYS B 1 356 ? 58.730  7.456   36.257  1.00 57.36  ? 352  LYS B CD  1 
ATOM   6335  C CE  . LYS B 1 356 ? 58.887  6.874   34.853  1.00 60.43  ? 352  LYS B CE  1 
ATOM   6336  N NZ  . LYS B 1 356 ? 58.215  5.549   34.723  1.00 62.15  ? 352  LYS B NZ  1 
ATOM   6337  N N   . ILE B 1 357 ? 59.058  12.413  38.660  1.00 49.10  ? 353  ILE B N   1 
ATOM   6338  C CA  . ILE B 1 357 ? 58.518  13.752  38.447  1.00 48.02  ? 353  ILE B CA  1 
ATOM   6339  C C   . ILE B 1 357 ? 59.644  14.786  38.441  1.00 49.20  ? 353  ILE B C   1 
ATOM   6340  O O   . ILE B 1 357 ? 59.810  15.511  37.461  1.00 50.02  ? 353  ILE B O   1 
ATOM   6341  C CB  . ILE B 1 357 ? 57.450  14.126  39.503  1.00 46.09  ? 353  ILE B CB  1 
ATOM   6342  C CG1 . ILE B 1 357 ? 56.240  13.197  39.392  1.00 45.49  ? 353  ILE B CG1 1 
ATOM   6343  C CG2 . ILE B 1 357 ? 56.997  15.567  39.325  1.00 45.31  ? 353  ILE B CG2 1 
ATOM   6344  C CD1 . ILE B 1 357 ? 55.346  13.180  40.622  1.00 44.09  ? 353  ILE B CD1 1 
ATOM   6345  N N   . LEU B 1 358 ? 60.418  14.835  39.525  1.00 49.66  ? 354  LEU B N   1 
ATOM   6346  C CA  . LEU B 1 358 ? 61.534  15.779  39.657  1.00 51.26  ? 354  LEU B CA  1 
ATOM   6347  C C   . LEU B 1 358 ? 62.477  15.778  38.450  1.00 53.58  ? 354  LEU B C   1 
ATOM   6348  O O   . LEU B 1 358 ? 62.900  16.841  37.990  1.00 54.68  ? 354  LEU B O   1 
ATOM   6349  C CB  . LEU B 1 358 ? 62.332  15.503  40.936  1.00 51.78  ? 354  LEU B CB  1 
ATOM   6350  C CG  . LEU B 1 358 ? 61.814  16.025  42.277  1.00 50.56  ? 354  LEU B CG  1 
ATOM   6351  C CD1 . LEU B 1 358 ? 62.670  15.477  43.408  1.00 51.48  ? 354  LEU B CD1 1 
ATOM   6352  C CD2 . LEU B 1 358 ? 61.788  17.552  42.321  1.00 50.88  ? 354  LEU B CD2 1 
ATOM   6353  N N   . GLU B 1 359 ? 62.797  14.581  37.954  1.00 54.68  ? 355  GLU B N   1 
ATOM   6354  C CA  . GLU B 1 359 ? 63.619  14.396  36.756  1.00 57.31  ? 355  GLU B CA  1 
ATOM   6355  C C   . GLU B 1 359 ? 63.044  15.135  35.546  1.00 57.34  ? 355  GLU B C   1 
ATOM   6356  O O   . GLU B 1 359 ? 63.777  15.777  34.790  1.00 59.34  ? 355  GLU B O   1 
ATOM   6357  C CB  . GLU B 1 359 ? 63.791  12.894  36.459  1.00 58.49  ? 355  GLU B CB  1 
ATOM   6358  C CG  . GLU B 1 359 ? 63.962  12.491  34.976  1.00 61.11  ? 355  GLU B CG  1 
ATOM   6359  C CD  . GLU B 1 359 ? 65.152  13.153  34.285  1.00 64.73  ? 355  GLU B CD  1 
ATOM   6360  O OE1 . GLU B 1 359 ? 66.161  13.446  34.962  1.00 66.49  ? 355  GLU B OE1 1 
ATOM   6361  O OE2 . GLU B 1 359 ? 65.072  13.386  33.058  1.00 66.12  ? 355  GLU B OE2 1 
ATOM   6362  N N   . LEU B 1 360 ? 61.729  15.043  35.379  1.00 55.41  ? 356  LEU B N   1 
ATOM   6363  C CA  . LEU B 1 360 ? 61.059  15.631  34.231  1.00 55.45  ? 356  LEU B CA  1 
ATOM   6364  C C   . LEU B 1 360 ? 60.992  17.158  34.340  1.00 55.21  ? 356  LEU B C   1 
ATOM   6365  O O   . LEU B 1 360 ? 61.023  17.855  33.326  1.00 56.38  ? 356  LEU B O   1 
ATOM   6366  C CB  . LEU B 1 360 ? 59.668  15.004  34.063  1.00 53.70  ? 356  LEU B CB  1 
ATOM   6367  C CG  . LEU B 1 360 ? 59.119  14.646  32.673  1.00 54.60  ? 356  LEU B CG  1 
ATOM   6368  C CD1 . LEU B 1 360 ? 60.196  14.317  31.646  1.00 57.49  ? 356  LEU B CD1 1 
ATOM   6369  C CD2 . LEU B 1 360 ? 58.144  13.486  32.795  1.00 54.02  ? 356  LEU B CD2 1 
ATOM   6370  N N   . ILE B 1 361 ? 60.928  17.671  35.570  1.00 54.18  ? 357  ILE B N   1 
ATOM   6371  C CA  . ILE B 1 361 ? 60.897  19.119  35.815  1.00 54.43  ? 357  ILE B CA  1 
ATOM   6372  C C   . ILE B 1 361 ? 62.234  19.772  35.445  1.00 57.32  ? 357  ILE B C   1 
ATOM   6373  O O   . ILE B 1 361 ? 62.257  20.781  34.743  1.00 58.50  ? 357  ILE B O   1 
ATOM   6374  C CB  . ILE B 1 361 ? 60.512  19.461  37.285  1.00 53.03  ? 357  ILE B CB  1 
ATOM   6375  C CG1 . ILE B 1 361 ? 59.171  18.823  37.661  1.00 50.67  ? 357  ILE B CG1 1 
ATOM   6376  C CG2 . ILE B 1 361 ? 60.452  20.974  37.499  1.00 53.55  ? 357  ILE B CG2 1 
ATOM   6377  C CD1 . ILE B 1 361 ? 58.846  18.883  39.152  1.00 49.62  ? 357  ILE B CD1 1 
ATOM   6378  N N   . GLN B 1 362 ? 63.337  19.183  35.909  1.00 58.81  ? 358  GLN B N   1 
ATOM   6379  C CA  . GLN B 1 362 ? 64.688  19.664  35.592  1.00 62.14  ? 358  GLN B CA  1 
ATOM   6380  C C   . GLN B 1 362 ? 65.052  19.485  34.113  1.00 64.12  ? 358  GLN B C   1 
ATOM   6381  O O   . GLN B 1 362 ? 66.014  20.085  33.622  1.00 66.99  ? 358  GLN B O   1 
ATOM   6382  C CB  . GLN B 1 362 ? 65.722  18.987  36.493  1.00 63.27  ? 358  GLN B CB  1 
ATOM   6383  C CG  . GLN B 1 362 ? 65.748  19.544  37.913  1.00 63.58  ? 358  GLN B CG  1 
ATOM   6384  C CD  . GLN B 1 362 ? 65.878  18.461  38.984  1.00 63.81  ? 358  GLN B CD  1 
ATOM   6385  O OE1 . GLN B 1 362 ? 66.470  17.400  38.752  1.00 65.13  ? 358  GLN B OE1 1 
ATOM   6386  N NE2 . GLN B 1 362 ? 65.317  18.728  40.165  1.00 62.45  ? 358  GLN B NE2 1 
ATOM   6387  N N   . SER B 1 363 ? 64.280  18.651  33.417  1.00 62.96  ? 359  SER B N   1 
ATOM   6388  C CA  . SER B 1 363 ? 64.347  18.540  31.963  1.00 64.61  ? 359  SER B CA  1 
ATOM   6389  C C   . SER B 1 363 ? 63.743  19.788  31.337  1.00 64.46  ? 359  SER B C   1 
ATOM   6390  O O   . SER B 1 363 ? 64.371  20.436  30.500  1.00 67.05  ? 359  SER B O   1 
ATOM   6391  C CB  . SER B 1 363 ? 63.601  17.295  31.481  1.00 63.60  ? 359  SER B CB  1 
ATOM   6392  O OG  . SER B 1 363 ? 63.212  17.423  30.125  1.00 64.49  ? 359  SER B OG  1 
ATOM   6393  N N   . GLY B 1 364 ? 62.522  20.113  31.759  1.00 61.71  ? 360  GLY B N   1 
ATOM   6394  C CA  . GLY B 1 364 ? 61.820  21.311  31.311  1.00 61.45  ? 360  GLY B CA  1 
ATOM   6395  C C   . GLY B 1 364 ? 62.555  22.603  31.618  1.00 63.32  ? 360  GLY B C   1 
ATOM   6396  O O   . GLY B 1 364 ? 62.489  23.552  30.840  1.00 64.90  ? 360  GLY B O   1 
ATOM   6397  N N   . VAL B 1 365 ? 63.256  22.641  32.750  1.00 63.57  ? 361  VAL B N   1 
ATOM   6398  C CA  . VAL B 1 365 ? 64.046  23.812  33.136  1.00 65.90  ? 361  VAL B CA  1 
ATOM   6399  C C   . VAL B 1 365 ? 65.219  24.017  32.176  1.00 69.56  ? 361  VAL B C   1 
ATOM   6400  O O   . VAL B 1 365 ? 65.394  25.106  31.629  1.00 71.75  ? 361  VAL B O   1 
ATOM   6401  C CB  . VAL B 1 365 ? 64.555  23.721  34.604  1.00 65.69  ? 361  VAL B CB  1 
ATOM   6402  C CG1 . VAL B 1 365 ? 65.471  24.898  34.943  1.00 68.77  ? 361  VAL B CG1 1 
ATOM   6403  C CG2 . VAL B 1 365 ? 63.387  23.670  35.580  1.00 62.59  ? 361  VAL B CG2 1 
ATOM   6404  N N   . ALA B 1 366 ? 65.998  22.960  31.957  1.00 70.56  ? 362  ALA B N   1 
ATOM   6405  C CA  . ALA B 1 366 ? 67.196  23.034  31.123  1.00 74.45  ? 362  ALA B CA  1 
ATOM   6406  C C   . ALA B 1 366 ? 66.906  22.865  29.629  1.00 75.44  ? 362  ALA B C   1 
ATOM   6407  O O   . ALA B 1 366 ? 67.791  22.491  28.858  1.00 78.49  ? 362  ALA B O   1 
ATOM   6408  C CB  . ALA B 1 366 ? 68.224  22.012  31.592  1.00 75.74  ? 362  ALA B CB  1 
ATOM   6409  N N   . GLU B 1 367 ? 65.673  23.151  29.224  1.00 73.25  ? 363  GLU B N   1 
ATOM   6410  C CA  . GLU B 1 367 ? 65.276  23.010  27.825  1.00 74.22  ? 363  GLU B CA  1 
ATOM   6411  C C   . GLU B 1 367 ? 64.557  24.255  27.290  1.00 74.31  ? 363  GLU B C   1 
ATOM   6412  O O   . GLU B 1 367 ? 64.121  24.282  26.136  1.00 75.07  ? 363  GLU B O   1 
ATOM   6413  C CB  . GLU B 1 367 ? 64.417  21.755  27.640  1.00 71.80  ? 363  GLU B CB  1 
ATOM   6414  C CG  . GLU B 1 367 ? 64.600  21.065  26.294  1.00 74.22  ? 363  GLU B CG  1 
ATOM   6415  C CD  . GLU B 1 367 ? 64.005  19.667  26.260  1.00 73.01  ? 363  GLU B CD  1 
ATOM   6416  O OE1 . GLU B 1 367 ? 62.864  19.482  26.743  1.00 70.13  ? 363  GLU B OE1 1 
ATOM   6417  O OE2 . GLU B 1 367 ? 64.680  18.752  25.740  1.00 75.29  ? 363  GLU B OE2 1 
ATOM   6418  N N   . GLY B 1 368 ? 64.435  25.280  28.130  1.00 73.80  ? 364  GLY B N   1 
ATOM   6419  C CA  . GLY B 1 368 ? 63.924  26.572  27.682  1.00 74.70  ? 364  GLY B CA  1 
ATOM   6420  C C   . GLY B 1 368 ? 62.648  27.068  28.333  1.00 71.83  ? 364  GLY B C   1 
ATOM   6421  O O   . GLY B 1 368 ? 62.405  28.276  28.362  1.00 73.03  ? 364  GLY B O   1 
ATOM   6422  N N   . ALA B 1 369 ? 61.831  26.144  28.841  1.00 68.46  ? 365  ALA B N   1 
ATOM   6423  C CA  . ALA B 1 369 ? 60.557  26.489  29.482  1.00 65.79  ? 365  ALA B CA  1 
ATOM   6424  C C   . ALA B 1 369 ? 60.770  27.315  30.746  1.00 66.08  ? 365  ALA B C   1 
ATOM   6425  O O   . ALA B 1 369 ? 61.750  27.115  31.466  1.00 66.98  ? 365  ALA B O   1 
ATOM   6426  C CB  . ALA B 1 369 ? 59.764  25.239  29.796  1.00 62.68  ? 365  ALA B CB  1 
ATOM   6427  N N   . LYS B 1 370 ? 59.850  28.240  31.010  1.00 65.68  ? 366  LYS B N   1 
ATOM   6428  C CA  . LYS B 1 370 ? 59.997  29.162  32.133  1.00 66.70  ? 366  LYS B CA  1 
ATOM   6429  C C   . LYS B 1 370 ? 59.354  28.632  33.418  1.00 64.00  ? 366  LYS B C   1 
ATOM   6430  O O   . LYS B 1 370 ? 58.129  28.511  33.520  1.00 61.90  ? 366  LYS B O   1 
ATOM   6431  C CB  . LYS B 1 370 ? 59.457  30.555  31.779  1.00 68.61  ? 366  LYS B CB  1 
ATOM   6432  C CG  . LYS B 1 370 ? 60.124  31.685  32.560  1.00 71.70  ? 366  LYS B CG  1 
ATOM   6433  C CD  . LYS B 1 370 ? 59.340  32.982  32.475  1.00 73.22  ? 366  LYS B CD  1 
ATOM   6434  C CE  . LYS B 1 370 ? 59.899  34.011  33.442  1.00 76.34  ? 366  LYS B CE  1 
ATOM   6435  N NZ  . LYS B 1 370 ? 58.973  35.160  33.624  1.00 77.82  ? 366  LYS B NZ  1 
ATOM   6436  N N   . LEU B 1 371 ? 60.207  28.310  34.387  1.00 64.34  ? 367  LEU B N   1 
ATOM   6437  C CA  . LEU B 1 371 ? 59.778  27.848  35.701  1.00 62.33  ? 367  LEU B CA  1 
ATOM   6438  C C   . LEU B 1 371 ? 59.177  29.021  36.470  1.00 63.29  ? 367  LEU B C   1 
ATOM   6439  O O   . LEU B 1 371 ? 59.897  29.861  37.019  1.00 65.97  ? 367  LEU B O   1 
ATOM   6440  C CB  . LEU B 1 371 ? 60.968  27.244  36.458  1.00 62.98  ? 367  LEU B CB  1 
ATOM   6441  C CG  . LEU B 1 371 ? 60.781  26.651  37.858  1.00 61.19  ? 367  LEU B CG  1 
ATOM   6442  C CD1 . LEU B 1 371 ? 59.922  25.400  37.817  1.00 57.59  ? 367  LEU B CD1 1 
ATOM   6443  C CD2 . LEU B 1 371 ? 62.142  26.354  38.482  1.00 62.76  ? 367  LEU B CD2 1 
ATOM   6444  N N   . GLU B 1 372 ? 57.851  29.075  36.491  1.00 61.56  ? 368  GLU B N   1 
ATOM   6445  C CA  . GLU B 1 372 ? 57.134  30.194  37.093  1.00 62.84  ? 368  GLU B CA  1 
ATOM   6446  C C   . GLU B 1 372 ? 57.071  30.089  38.615  1.00 62.56  ? 368  GLU B C   1 
ATOM   6447  O O   . GLU B 1 372 ? 57.211  31.090  39.319  1.00 65.04  ? 368  GLU B O   1 
ATOM   6448  C CB  . GLU B 1 372 ? 55.726  30.304  36.504  1.00 61.50  ? 368  GLU B CB  1 
ATOM   6449  C CG  . GLU B 1 372 ? 55.684  30.671  35.017  1.00 62.48  ? 368  GLU B CG  1 
ATOM   6450  C CD  . GLU B 1 372 ? 55.903  32.157  34.741  1.00 65.83  ? 368  GLU B CD  1 
ATOM   6451  O OE1 . GLU B 1 372 ? 56.122  32.938  35.695  1.00 67.69  ? 368  GLU B OE1 1 
ATOM   6452  O OE2 . GLU B 1 372 ? 55.851  32.544  33.556  1.00 66.79  ? 368  GLU B OE2 1 
ATOM   6453  N N   . CYS B 1 373 ? 56.857  28.871  39.107  1.00 59.94  ? 369  CYS B N   1 
ATOM   6454  C CA  . CYS B 1 373 ? 56.798  28.591  40.539  1.00 59.51  ? 369  CYS B CA  1 
ATOM   6455  C C   . CYS B 1 373 ? 57.002  27.099  40.785  1.00 57.17  ? 369  CYS B C   1 
ATOM   6456  O O   . CYS B 1 373 ? 56.840  26.285  39.872  1.00 55.53  ? 369  CYS B O   1 
ATOM   6457  C CB  . CYS B 1 373 ? 55.461  29.051  41.134  1.00 59.20  ? 369  CYS B CB  1 
ATOM   6458  S SG  . CYS B 1 373 ? 54.003  28.310  40.367  1.00 55.79  ? 369  CYS B SG  1 
ATOM   6459  N N   . GLY B 1 374 ? 57.359  26.751  42.018  1.00 57.32  ? 370  GLY B N   1 
ATOM   6460  C CA  . GLY B 1 374 ? 57.599  25.362  42.397  1.00 55.49  ? 370  GLY B CA  1 
ATOM   6461  C C   . GLY B 1 374 ? 58.913  24.822  41.865  1.00 56.28  ? 370  GLY B C   1 
ATOM   6462  O O   . GLY B 1 374 ? 59.937  25.519  41.873  1.00 58.61  ? 370  GLY B O   1 
ATOM   6463  N N   . GLY B 1 375 ? 58.877  23.571  41.409  1.00 54.58  ? 371  GLY B N   1 
ATOM   6464  C CA  . GLY B 1 375 ? 60.037  22.930  40.793  1.00 55.52  ? 371  GLY B CA  1 
ATOM   6465  C C   . GLY B 1 375 ? 60.774  21.968  41.702  1.00 55.50  ? 371  GLY B C   1 
ATOM   6466  O O   . GLY B 1 375 ? 61.259  20.930  41.252  1.00 55.35  ? 371  GLY B O   1 
ATOM   6467  N N   . LYS B 1 376 ? 60.865  22.319  42.982  1.00 56.05  ? 372  LYS B N   1 
ATOM   6468  C CA  . LYS B 1 376 ? 61.560  21.489  43.964  1.00 56.23  ? 372  LYS B CA  1 
ATOM   6469  C C   . LYS B 1 376 ? 60.574  20.751  44.864  1.00 54.07  ? 372  LYS B C   1 
ATOM   6470  O O   . LYS B 1 376 ? 59.378  21.025  44.837  1.00 52.82  ? 372  LYS B O   1 
ATOM   6471  C CB  . LYS B 1 376 ? 62.548  22.327  44.797  1.00 58.96  ? 372  LYS B CB  1 
ATOM   6472  C CG  . LYS B 1 376 ? 61.994  23.648  45.347  1.00 60.09  ? 372  LYS B CG  1 
ATOM   6473  C CD  . LYS B 1 376 ? 62.659  24.039  46.668  1.00 62.59  ? 372  LYS B CD  1 
ATOM   6474  C CE  . LYS B 1 376 ? 64.032  24.677  46.474  1.00 65.85  ? 372  LYS B CE  1 
ATOM   6475  N NZ  . LYS B 1 376 ? 63.933  26.125  46.144  1.00 68.05  ? 372  LYS B NZ  1 
ATOM   6476  N N   . GLY B 1 377 ? 61.078  19.798  45.643  1.00 53.94  ? 373  GLY B N   1 
ATOM   6477  C CA  . GLY B 1 377 ? 60.262  19.119  46.645  1.00 52.48  ? 373  GLY B CA  1 
ATOM   6478  C C   . GLY B 1 377 ? 60.064  20.028  47.840  1.00 53.49  ? 373  GLY B C   1 
ATOM   6479  O O   . GLY B 1 377 ? 60.815  20.994  48.020  1.00 55.57  ? 373  GLY B O   1 
ATOM   6480  N N   . LEU B 1 378 ? 59.058  19.727  48.658  1.00 52.41  ? 374  LEU B N   1 
ATOM   6481  C CA  . LEU B 1 378 ? 58.753  20.562  49.820  1.00 53.68  ? 374  LEU B CA  1 
ATOM   6482  C C   . LEU B 1 378 ? 59.713  20.372  50.998  1.00 55.40  ? 374  LEU B C   1 
ATOM   6483  O O   . LEU B 1 378 ? 60.445  21.300  51.364  1.00 57.66  ? 374  LEU B O   1 
ATOM   6484  C CB  . LEU B 1 378 ? 57.299  20.392  50.263  1.00 52.46  ? 374  LEU B CB  1 
ATOM   6485  C CG  . LEU B 1 378 ? 56.287  21.359  49.645  1.00 52.28  ? 374  LEU B CG  1 
ATOM   6486  C CD1 . LEU B 1 378 ? 54.909  21.064  50.197  1.00 51.44  ? 374  LEU B CD1 1 
ATOM   6487  C CD2 . LEU B 1 378 ? 56.663  22.817  49.906  1.00 54.58  ? 374  LEU B CD2 1 
ATOM   6488  N N   . GLY B 1 379 ? 59.710  19.174  51.582  1.00 54.50  ? 375  GLY B N   1 
ATOM   6489  C CA  . GLY B 1 379 ? 60.582  18.872  52.711  1.00 56.04  ? 375  GLY B CA  1 
ATOM   6490  C C   . GLY B 1 379 ? 60.816  17.396  52.953  1.00 55.16  ? 375  GLY B C   1 
ATOM   6491  O O   . GLY B 1 379 ? 60.285  16.543  52.241  1.00 53.47  ? 375  GLY B O   1 
ATOM   6492  N N   . ARG B 1 380 ? 61.618  17.108  53.975  1.00 56.76  ? 376  ARG B N   1 
ATOM   6493  C CA  . ARG B 1 380 ? 61.950  15.747  54.384  1.00 56.61  ? 376  ARG B CA  1 
ATOM   6494  C C   . ARG B 1 380 ? 60.712  15.003  54.879  1.00 55.13  ? 376  ARG B C   1 
ATOM   6495  O O   . ARG B 1 380 ? 59.797  15.616  55.439  1.00 55.19  ? 376  ARG B O   1 
ATOM   6496  C CB  . ARG B 1 380 ? 63.019  15.801  55.476  1.00 59.06  ? 376  ARG B CB  1 
ATOM   6497  C CG  . ARG B 1 380 ? 63.565  14.451  55.945  1.00 59.97  ? 376  ARG B CG  1 
ATOM   6498  C CD  . ARG B 1 380 ? 64.759  14.615  56.898  1.00 63.16  ? 376  ARG B CD  1 
ATOM   6499  N NE  . ARG B 1 380 ? 64.725  15.885  57.629  1.00 65.25  ? 376  ARG B NE  1 
ATOM   6500  C CZ  . ARG B 1 380 ? 65.672  16.822  57.573  1.00 67.89  ? 376  ARG B CZ  1 
ATOM   6501  N NH1 . ARG B 1 380 ? 66.763  16.643  56.842  1.00 69.09  ? 376  ARG B NH1 1 
ATOM   6502  N NH2 . ARG B 1 380 ? 65.539  17.942  58.269  1.00 69.71  ? 376  ARG B NH2 1 
ATOM   6503  N N   . LYS B 1 381 ? 60.705  13.684  54.670  1.00 54.30  ? 377  LYS B N   1 
ATOM   6504  C CA  . LYS B 1 381 ? 59.569  12.791  54.980  1.00 53.10  ? 377  LYS B CA  1 
ATOM   6505  C C   . LYS B 1 381 ? 58.371  13.000  54.059  1.00 51.20  ? 377  LYS B C   1 
ATOM   6506  O O   . LYS B 1 381 ? 57.954  14.129  53.796  1.00 50.91  ? 377  LYS B O   1 
ATOM   6507  C CB  . LYS B 1 381 ? 59.146  12.856  56.458  1.00 54.20  ? 377  LYS B CB  1 
ATOM   6508  C CG  . LYS B 1 381 ? 59.923  11.914  57.384  1.00 55.85  ? 377  LYS B CG  1 
ATOM   6509  C CD  . LYS B 1 381 ? 59.111  11.575  58.634  1.00 56.83  ? 377  LYS B CD  1 
ATOM   6510  C CE  . LYS B 1 381 ? 59.716  10.405  59.401  1.00 58.14  ? 377  LYS B CE  1 
ATOM   6511  N NZ  . LYS B 1 381 ? 58.773  9.859   60.426  1.00 58.80  ? 377  LYS B NZ  1 
ATOM   6512  N N   . GLY B 1 382 ? 57.825  11.889  53.574  1.00 50.26  ? 378  GLY B N   1 
ATOM   6513  C CA  . GLY B 1 382 ? 56.739  11.915  52.600  1.00 48.80  ? 378  GLY B CA  1 
ATOM   6514  C C   . GLY B 1 382 ? 57.268  12.114  51.193  1.00 48.25  ? 378  GLY B C   1 
ATOM   6515  O O   . GLY B 1 382 ? 58.472  12.014  50.952  1.00 49.18  ? 378  GLY B O   1 
ATOM   6516  N N   . PHE B 1 383 ? 56.367  12.392  50.257  1.00 47.01  ? 379  PHE B N   1 
ATOM   6517  C CA  . PHE B 1 383 ? 56.755  12.631  48.872  1.00 46.34  ? 379  PHE B CA  1 
ATOM   6518  C C   . PHE B 1 383 ? 55.981  13.825  48.319  1.00 45.48  ? 379  PHE B C   1 
ATOM   6519  O O   . PHE B 1 383 ? 55.180  13.691  47.394  1.00 44.82  ? 379  PHE B O   1 
ATOM   6520  C CB  . PHE B 1 383 ? 56.529  11.374  48.019  1.00 46.25  ? 379  PHE B CB  1 
ATOM   6521  C CG  . PHE B 1 383 ? 56.999  10.098  48.670  1.00 46.92  ? 379  PHE B CG  1 
ATOM   6522  C CD1 . PHE B 1 383 ? 58.353  9.794   48.749  1.00 47.96  ? 379  PHE B CD1 1 
ATOM   6523  C CD2 . PHE B 1 383 ? 56.083  9.196   49.193  1.00 46.96  ? 379  PHE B CD2 1 
ATOM   6524  C CE1 . PHE B 1 383 ? 58.788  8.612   49.351  1.00 49.08  ? 379  PHE B CE1 1 
ATOM   6525  C CE2 . PHE B 1 383 ? 56.511  8.011   49.795  1.00 48.24  ? 379  PHE B CE2 1 
ATOM   6526  C CZ  . PHE B 1 383 ? 57.867  7.721   49.872  1.00 48.96  ? 379  PHE B CZ  1 
ATOM   6527  N N   . PHE B 1 384 ? 56.227  14.993  48.904  1.00 45.79  ? 380  PHE B N   1 
ATOM   6528  C CA  . PHE B 1 384 ? 55.545  16.223  48.512  1.00 45.45  ? 380  PHE B CA  1 
ATOM   6529  C C   . PHE B 1 384 ? 56.351  17.028  47.494  1.00 45.79  ? 380  PHE B C   1 
ATOM   6530  O O   . PHE B 1 384 ? 57.544  17.290  47.689  1.00 46.92  ? 380  PHE B O   1 
ATOM   6531  C CB  . PHE B 1 384 ? 55.250  17.093  49.740  1.00 46.37  ? 380  PHE B CB  1 
ATOM   6532  C CG  . PHE B 1 384 ? 54.268  16.484  50.704  1.00 46.19  ? 380  PHE B CG  1 
ATOM   6533  C CD1 . PHE B 1 384 ? 54.697  15.605  51.698  1.00 46.79  ? 380  PHE B CD1 1 
ATOM   6534  C CD2 . PHE B 1 384 ? 52.918  16.800  50.631  1.00 45.89  ? 380  PHE B CD2 1 
ATOM   6535  C CE1 . PHE B 1 384 ? 53.792  15.041  52.595  1.00 46.78  ? 380  PHE B CE1 1 
ATOM   6536  C CE2 . PHE B 1 384 ? 52.005  16.241  51.527  1.00 46.16  ? 380  PHE B CE2 1 
ATOM   6537  C CZ  . PHE B 1 384 ? 52.444  15.361  52.510  1.00 46.52  ? 380  PHE B CZ  1 
ATOM   6538  N N   . ILE B 1 385 ? 55.682  17.405  46.406  1.00 45.01  ? 381  ILE B N   1 
ATOM   6539  C CA  . ILE B 1 385 ? 56.238  18.315  45.408  1.00 45.50  ? 381  ILE B CA  1 
ATOM   6540  C C   . ILE B 1 385 ? 55.394  19.581  45.383  1.00 45.68  ? 381  ILE B C   1 
ATOM   6541  O O   . ILE B 1 385 ? 54.173  19.514  45.211  1.00 44.77  ? 381  ILE B O   1 
ATOM   6542  C CB  . ILE B 1 385 ? 56.284  17.672  44.000  1.00 44.97  ? 381  ILE B CB  1 
ATOM   6543  C CG1 . ILE B 1 385 ? 57.359  16.588  43.954  1.00 45.39  ? 381  ILE B CG1 1 
ATOM   6544  C CG2 . ILE B 1 385 ? 56.571  18.726  42.928  1.00 45.55  ? 381  ILE B CG2 1 
ATOM   6545  C CD1 . ILE B 1 385 ? 57.097  15.508  42.946  1.00 44.97  ? 381  ILE B CD1 1 
ATOM   6546  N N   . GLU B 1 386 ? 56.045  20.728  45.575  1.00 47.13  ? 382  GLU B N   1 
ATOM   6547  C CA  . GLU B 1 386 ? 55.352  22.013  45.521  1.00 47.85  ? 382  GLU B CA  1 
ATOM   6548  C C   . GLU B 1 386 ? 54.847  22.294  44.094  1.00 47.27  ? 382  GLU B C   1 
ATOM   6549  O O   . GLU B 1 386 ? 55.551  21.995  43.125  1.00 47.09  ? 382  GLU B O   1 
ATOM   6550  C CB  . GLU B 1 386 ? 56.213  23.157  46.094  1.00 50.10  ? 382  GLU B CB  1 
ATOM   6551  C CG  . GLU B 1 386 ? 57.578  23.368  45.447  1.00 51.23  ? 382  GLU B CG  1 
ATOM   6552  C CD  . GLU B 1 386 ? 58.344  24.558  46.022  1.00 53.98  ? 382  GLU B CD  1 
ATOM   6553  O OE1 . GLU B 1 386 ? 58.143  24.912  47.204  1.00 55.09  ? 382  GLU B OE1 1 
ATOM   6554  O OE2 . GLU B 1 386 ? 59.164  25.142  45.287  1.00 55.52  ? 382  GLU B OE2 1 
ATOM   6555  N N   . PRO B 1 387 ? 53.610  22.835  43.972  1.00 47.11  ? 383  PRO B N   1 
ATOM   6556  C CA  . PRO B 1 387 ? 52.929  23.090  42.697  1.00 46.64  ? 383  PRO B CA  1 
ATOM   6557  C C   . PRO B 1 387 ? 53.814  23.808  41.686  1.00 47.83  ? 383  PRO B C   1 
ATOM   6558  O O   . PRO B 1 387 ? 54.489  24.780  42.029  1.00 49.64  ? 383  PRO B O   1 
ATOM   6559  C CB  . PRO B 1 387 ? 51.762  23.988  43.103  1.00 47.38  ? 383  PRO B CB  1 
ATOM   6560  C CG  . PRO B 1 387 ? 51.457  23.578  44.487  1.00 47.39  ? 383  PRO B CG  1 
ATOM   6561  C CD  . PRO B 1 387 ? 52.779  23.259  45.115  1.00 47.72  ? 383  PRO B CD  1 
ATOM   6562  N N   . THR B 1 388 ? 53.799  23.325  40.448  1.00 47.21  ? 384  THR B N   1 
ATOM   6563  C CA  . THR B 1 388 ? 54.724  23.795  39.426  1.00 48.45  ? 384  THR B CA  1 
ATOM   6564  C C   . THR B 1 388 ? 54.003  24.216  38.148  1.00 48.61  ? 384  THR B C   1 
ATOM   6565  O O   . THR B 1 388 ? 53.189  23.465  37.605  1.00 47.30  ? 384  THR B O   1 
ATOM   6566  C CB  . THR B 1 388 ? 55.787  22.722  39.113  1.00 48.21  ? 384  THR B CB  1 
ATOM   6567  O OG1 . THR B 1 388 ? 56.365  22.256  40.338  1.00 48.18  ? 384  THR B OG1 1 
ATOM   6568  C CG2 . THR B 1 388 ? 56.885  23.286  38.227  1.00 50.04  ? 384  THR B CG2 1 
ATOM   6569  N N   . VAL B 1 389 ? 54.314  25.426  37.687  1.00 50.55  ? 385  VAL B N   1 
ATOM   6570  C CA  . VAL B 1 389 ? 53.765  25.968  36.448  1.00 51.22  ? 385  VAL B CA  1 
ATOM   6571  C C   . VAL B 1 389 ? 54.902  26.253  35.473  1.00 52.98  ? 385  VAL B C   1 
ATOM   6572  O O   . VAL B 1 389 ? 55.855  26.960  35.808  1.00 54.92  ? 385  VAL B O   1 
ATOM   6573  C CB  . VAL B 1 389 ? 52.953  27.272  36.691  1.00 52.48  ? 385  VAL B CB  1 
ATOM   6574  C CG1 . VAL B 1 389 ? 52.487  27.879  35.372  1.00 53.36  ? 385  VAL B CG1 1 
ATOM   6575  C CG2 . VAL B 1 389 ? 51.758  27.012  37.598  1.00 51.33  ? 385  VAL B CG2 1 
ATOM   6576  N N   . PHE B 1 390 ? 54.798  25.685  34.275  1.00 52.80  ? 386  PHE B N   1 
ATOM   6577  C CA  . PHE B 1 390 ? 55.747  25.961  33.203  1.00 54.80  ? 386  PHE B CA  1 
ATOM   6578  C C   . PHE B 1 390 ? 55.113  26.816  32.120  1.00 56.05  ? 386  PHE B C   1 
ATOM   6579  O O   . PHE B 1 390 ? 54.020  26.516  31.636  1.00 54.98  ? 386  PHE B O   1 
ATOM   6580  C CB  . PHE B 1 390 ? 56.288  24.666  32.597  1.00 54.31  ? 386  PHE B CB  1 
ATOM   6581  C CG  . PHE B 1 390 ? 57.458  24.091  33.340  1.00 54.58  ? 386  PHE B CG  1 
ATOM   6582  C CD1 . PHE B 1 390 ? 58.689  24.745  33.341  1.00 56.97  ? 386  PHE B CD1 1 
ATOM   6583  C CD2 . PHE B 1 390 ? 57.336  22.890  34.029  1.00 52.76  ? 386  PHE B CD2 1 
ATOM   6584  C CE1 . PHE B 1 390 ? 59.778  24.216  34.024  1.00 57.64  ? 386  PHE B CE1 1 
ATOM   6585  C CE2 . PHE B 1 390 ? 58.419  22.351  34.716  1.00 53.48  ? 386  PHE B CE2 1 
ATOM   6586  C CZ  . PHE B 1 390 ? 59.645  23.016  34.712  1.00 55.85  ? 386  PHE B CZ  1 
ATOM   6587  N N   . SER B 1 391 ? 55.814  27.882  31.749  1.00 58.75  ? 387  SER B N   1 
ATOM   6588  C CA  . SER B 1 391 ? 55.363  28.807  30.720  1.00 60.51  ? 387  SER B CA  1 
ATOM   6589  C C   . SER B 1 391 ? 56.204  28.627  29.456  1.00 62.43  ? 387  SER B C   1 
ATOM   6590  O O   . SER B 1 391 ? 57.248  27.970  29.494  1.00 62.88  ? 387  SER B O   1 
ATOM   6591  C CB  . SER B 1 391 ? 55.469  30.242  31.239  1.00 62.61  ? 387  SER B CB  1 
ATOM   6592  O OG  . SER B 1 391 ? 54.933  31.168  30.314  1.00 64.43  ? 387  SER B OG  1 
ATOM   6593  N N   . ASN B 1 392 ? 55.739  29.200  28.344  1.00 63.96  ? 388  ASN B N   1 
ATOM   6594  C CA  . ASN B 1 392 ? 56.466  29.189  27.065  1.00 66.37  ? 388  ASN B CA  1 
ATOM   6595  C C   . ASN B 1 392 ? 56.886  27.790  26.597  1.00 65.69  ? 388  ASN B C   1 
ATOM   6596  O O   . ASN B 1 392 ? 57.982  27.608  26.059  1.00 67.83  ? 388  ASN B O   1 
ATOM   6597  C CB  . ASN B 1 392 ? 57.685  30.130  27.120  1.00 69.51  ? 388  ASN B CB  1 
ATOM   6598  C CG  . ASN B 1 392 ? 57.300  31.605  27.129  1.00 71.70  ? 388  ASN B CG  1 
ATOM   6599  O OD1 . ASN B 1 392 ? 56.336  32.012  27.781  1.00 70.61  ? 388  ASN B OD1 1 
ATOM   6600  N ND2 . ASN B 1 392 ? 58.071  32.416  26.411  1.00 75.16  ? 388  ASN B ND2 1 
ATOM   6601  N N   . VAL B 1 393 ? 56.008  26.811  26.803  1.00 63.28  ? 389  VAL B N   1 
ATOM   6602  C CA  . VAL B 1 393 ? 56.294  25.417  26.461  1.00 62.84  ? 389  VAL B CA  1 
ATOM   6603  C C   . VAL B 1 393 ? 55.982  25.138  24.992  1.00 64.33  ? 389  VAL B C   1 
ATOM   6604  O O   . VAL B 1 393 ? 54.931  25.535  24.492  1.00 64.13  ? 389  VAL B O   1 
ATOM   6605  C CB  . VAL B 1 393 ? 55.507  24.441  27.379  1.00 59.93  ? 389  VAL B CB  1 
ATOM   6606  C CG1 . VAL B 1 393 ? 55.658  22.995  26.918  1.00 59.78  ? 389  VAL B CG1 1 
ATOM   6607  C CG2 . VAL B 1 393 ? 55.969  24.583  28.822  1.00 58.94  ? 389  VAL B CG2 1 
ATOM   6608  N N   . THR B 1 394 ? 56.907  24.466  24.307  1.00 66.28  ? 390  THR B N   1 
ATOM   6609  C CA  . THR B 1 394 ? 56.712  24.072  22.911  1.00 68.18  ? 390  THR B CA  1 
ATOM   6610  C C   . THR B 1 394 ? 56.492  22.563  22.768  1.00 67.71  ? 390  THR B C   1 
ATOM   6611  O O   . THR B 1 394 ? 56.789  21.790  23.685  1.00 66.20  ? 390  THR B O   1 
ATOM   6612  C CB  . THR B 1 394 ? 57.880  24.522  22.011  1.00 71.67  ? 390  THR B CB  1 
ATOM   6613  O OG1 . THR B 1 394 ? 59.117  24.054  22.559  1.00 72.43  ? 390  THR B OG1 1 
ATOM   6614  C CG2 . THR B 1 394 ? 57.915  26.041  21.891  1.00 73.05  ? 390  THR B CG2 1 
ATOM   6615  N N   . ASP B 1 395 ? 55.975  22.165  21.605  1.00 69.34  ? 391  ASP B N   1 
ATOM   6616  C CA  . ASP B 1 395 ? 55.522  20.792  21.345  1.00 69.43  ? 391  ASP B CA  1 
ATOM   6617  C C   . ASP B 1 395 ? 56.615  19.722  21.366  1.00 71.06  ? 391  ASP B C   1 
ATOM   6618  O O   . ASP B 1 395 ? 56.353  18.578  21.749  1.00 70.23  ? 391  ASP B O   1 
ATOM   6619  C CB  . ASP B 1 395 ? 54.772  20.732  20.009  1.00 71.19  ? 391  ASP B CB  1 
ATOM   6620  C CG  . ASP B 1 395 ? 53.305  21.119  20.135  1.00 69.44  ? 391  ASP B CG  1 
ATOM   6621  O OD1 . ASP B 1 395 ? 52.900  21.673  21.182  1.00 66.88  ? 391  ASP B OD1 1 
ATOM   6622  O OD2 . ASP B 1 395 ? 52.550  20.860  19.174  1.00 70.82  ? 391  ASP B OD2 1 
ATOM   6623  N N   . ASP B 1 396 ? 57.825  20.097  20.957  1.00 73.79  ? 392  ASP B N   1 
ATOM   6624  C CA  . ASP B 1 396 ? 58.939  19.151  20.816  1.00 76.26  ? 392  ASP B CA  1 
ATOM   6625  C C   . ASP B 1 396 ? 59.679  18.822  22.125  1.00 75.04  ? 392  ASP B C   1 
ATOM   6626  O O   . ASP B 1 396 ? 60.495  17.893  22.162  1.00 76.70  ? 392  ASP B O   1 
ATOM   6627  C CB  . ASP B 1 396 ? 59.924  19.634  19.738  1.00 80.14  ? 392  ASP B CB  1 
ATOM   6628  C CG  . ASP B 1 396 ? 60.329  21.091  19.916  1.00 80.38  ? 392  ASP B CG  1 
ATOM   6629  O OD1 . ASP B 1 396 ? 59.458  21.981  19.793  1.00 79.11  ? 392  ASP B OD1 1 
ATOM   6630  O OD2 . ASP B 1 396 ? 61.526  21.347  20.163  1.00 82.24  ? 392  ASP B OD2 1 
ATOM   6631  N N   . MET B 1 397 ? 59.383  19.570  23.189  1.00 72.55  ? 393  MET B N   1 
ATOM   6632  C CA  . MET B 1 397 ? 60.040  19.395  24.495  1.00 71.41  ? 393  MET B CA  1 
ATOM   6633  C C   . MET B 1 397 ? 59.683  18.070  25.171  1.00 69.91  ? 393  MET B C   1 
ATOM   6634  O O   . MET B 1 397 ? 58.577  17.551  24.997  1.00 68.60  ? 393  MET B O   1 
ATOM   6635  C CB  . MET B 1 397 ? 59.694  20.553  25.437  1.00 69.25  ? 393  MET B CB  1 
ATOM   6636  C CG  . MET B 1 397 ? 59.958  21.937  24.865  1.00 71.06  ? 393  MET B CG  1 
ATOM   6637  S SD  . MET B 1 397 ? 59.507  23.256  26.010  1.00 69.29  ? 393  MET B SD  1 
ATOM   6638  C CE  . MET B 1 397 ? 60.989  23.332  27.011  1.00 70.58  ? 393  MET B CE  1 
ATOM   6639  N N   . ARG B 1 398 ? 60.625  17.544  25.954  1.00 70.46  ? 394  ARG B N   1 
ATOM   6640  C CA  . ARG B 1 398 ? 60.455  16.268  26.656  1.00 69.60  ? 394  ARG B CA  1 
ATOM   6641  C C   . ARG B 1 398 ? 59.219  16.264  27.563  1.00 66.29  ? 394  ARG B C   1 
ATOM   6642  O O   . ARG B 1 398 ? 58.535  15.246  27.681  1.00 65.72  ? 394  ARG B O   1 
ATOM   6643  C CB  . ARG B 1 398 ? 61.721  15.912  27.455  1.00 70.57  ? 394  ARG B CB  1 
ATOM   6644  C CG  . ARG B 1 398 ? 61.765  14.473  27.986  1.00 70.60  ? 394  ARG B CG  1 
ATOM   6645  C CD  . ARG B 1 398 ? 62.906  14.249  28.987  1.00 71.42  ? 394  ARG B CD  1 
ATOM   6646  N NE  . ARG B 1 398 ? 64.164  13.853  28.346  1.00 75.70  ? 394  ARG B NE  1 
ATOM   6647  C CZ  . ARG B 1 398 ? 65.234  14.637  28.205  1.00 77.74  ? 394  ARG B CZ  1 
ATOM   6648  N NH1 . ARG B 1 398 ? 65.222  15.884  28.660  1.00 76.44  ? 394  ARG B NH1 1 
ATOM   6649  N NH2 . ARG B 1 398 ? 66.325  14.170  27.607  1.00 81.29  ? 394  ARG B NH2 1 
ATOM   6650  N N   . ILE B 1 399 ? 58.931  17.402  28.188  1.00 64.63  ? 395  ILE B N   1 
ATOM   6651  C CA  . ILE B 1 399 ? 57.764  17.516  29.066  1.00 61.95  ? 395  ILE B CA  1 
ATOM   6652  C C   . ILE B 1 399 ? 56.435  17.487  28.301  1.00 61.56  ? 395  ILE B C   1 
ATOM   6653  O O   . ILE B 1 399 ? 55.406  17.095  28.853  1.00 59.86  ? 395  ILE B O   1 
ATOM   6654  C CB  . ILE B 1 399 ? 57.828  18.765  29.990  1.00 60.73  ? 395  ILE B CB  1 
ATOM   6655  C CG1 . ILE B 1 399 ? 58.000  20.052  29.176  1.00 62.24  ? 395  ILE B CG1 1 
ATOM   6656  C CG2 . ILE B 1 399 ? 58.948  18.615  31.009  1.00 61.06  ? 395  ILE B CG2 1 
ATOM   6657  C CD1 . ILE B 1 399 ? 57.671  21.318  29.947  1.00 61.25  ? 395  ILE B CD1 1 
ATOM   6658  N N   . ALA B 1 400 ? 56.465  17.888  27.032  1.00 63.48  ? 396  ALA B N   1 
ATOM   6659  C CA  . ALA B 1 400 ? 55.262  17.904  26.207  1.00 63.47  ? 396  ALA B CA  1 
ATOM   6660  C C   . ALA B 1 400 ? 54.882  16.512  25.707  1.00 64.51  ? 396  ALA B C   1 
ATOM   6661  O O   . ALA B 1 400 ? 53.715  16.135  25.776  1.00 63.57  ? 396  ALA B O   1 
ATOM   6662  C CB  . ALA B 1 400 ? 55.423  18.870  25.043  1.00 65.37  ? 396  ALA B CB  1 
ATOM   6663  N N   . LYS B 1 401 ? 55.865  15.757  25.213  1.00 67.02  ? 397  LYS B N   1 
ATOM   6664  C CA  . LYS B 1 401 ? 55.625  14.426  24.634  1.00 69.02  ? 397  LYS B CA  1 
ATOM   6665  C C   . LYS B 1 401 ? 55.173  13.398  25.678  1.00 67.76  ? 397  LYS B C   1 
ATOM   6666  O O   . LYS B 1 401 ? 54.025  12.946  25.650  1.00 67.30  ? 397  LYS B O   1 
ATOM   6667  C CB  . LYS B 1 401 ? 56.853  13.923  23.866  1.00 72.31  ? 397  LYS B CB  1 
ATOM   6668  C CG  . LYS B 1 401 ? 57.176  14.721  22.606  1.00 74.65  ? 397  LYS B CG  1 
ATOM   6669  C CD  . LYS B 1 401 ? 58.057  13.939  21.632  1.00 78.90  ? 397  LYS B CD  1 
ATOM   6670  C CE  . LYS B 1 401 ? 59.473  13.716  22.166  1.00 80.36  ? 397  LYS B CE  1 
ATOM   6671  N NZ  . LYS B 1 401 ? 60.225  14.988  22.386  1.00 80.06  ? 397  LYS B NZ  1 
ATOM   6672  N N   . GLU B 1 402 ? 56.076  13.027  26.586  1.00 67.59  ? 398  GLU B N   1 
ATOM   6673  C CA  . GLU B 1 402 ? 55.723  12.199  27.738  1.00 66.24  ? 398  GLU B CA  1 
ATOM   6674  C C   . GLU B 1 402 ? 54.980  13.094  28.719  1.00 63.21  ? 398  GLU B C   1 
ATOM   6675  O O   . GLU B 1 402 ? 55.494  14.142  29.111  1.00 62.33  ? 398  GLU B O   1 
ATOM   6676  C CB  . GLU B 1 402 ? 56.976  11.640  28.415  1.00 66.99  ? 398  GLU B CB  1 
ATOM   6677  C CG  . GLU B 1 402 ? 57.890  10.826  27.514  1.00 70.62  ? 398  GLU B CG  1 
ATOM   6678  C CD  . GLU B 1 402 ? 59.351  10.920  27.925  1.00 71.78  ? 398  GLU B CD  1 
ATOM   6679  O OE1 . GLU B 1 402 ? 59.635  11.355  29.064  1.00 69.56  ? 398  GLU B OE1 1 
ATOM   6680  O OE2 . GLU B 1 402 ? 60.219  10.563  27.100  1.00 75.08  ? 398  GLU B OE2 1 
ATOM   6681  N N   . GLU B 1 403 ? 53.773  12.697  29.106  1.00 62.16  ? 399  GLU B N   1 
ATOM   6682  C CA  . GLU B 1 403 ? 53.022  13.483  30.080  1.00 59.73  ? 399  GLU B CA  1 
ATOM   6683  C C   . GLU B 1 403 ? 53.513  13.211  31.498  1.00 58.41  ? 399  GLU B C   1 
ATOM   6684  O O   . GLU B 1 403 ? 53.721  12.056  31.893  1.00 59.06  ? 399  GLU B O   1 
ATOM   6685  C CB  . GLU B 1 403 ? 51.510  13.245  29.974  1.00 59.39  ? 399  GLU B CB  1 
ATOM   6686  C CG  . GLU B 1 403 ? 50.687  14.403  30.548  1.00 57.79  ? 399  GLU B CG  1 
ATOM   6687  C CD  . GLU B 1 403 ? 49.207  14.087  30.693  1.00 57.89  ? 399  GLU B CD  1 
ATOM   6688  O OE1 . GLU B 1 403 ? 48.858  13.170  31.470  1.00 57.84  ? 399  GLU B OE1 1 
ATOM   6689  O OE2 . GLU B 1 403 ? 48.390  14.776  30.044  1.00 58.10  ? 399  GLU B OE2 1 
ATOM   6690  N N   . ILE B 1 404 ? 53.708  14.294  32.248  1.00 56.83  ? 400  ILE B N   1 
ATOM   6691  C CA  . ILE B 1 404 ? 54.121  14.219  33.643  1.00 55.47  ? 400  ILE B CA  1 
ATOM   6692  C C   . ILE B 1 404 ? 52.927  13.748  34.457  1.00 54.05  ? 400  ILE B C   1 
ATOM   6693  O O   . ILE B 1 404 ? 51.799  14.189  34.233  1.00 53.51  ? 400  ILE B O   1 
ATOM   6694  C CB  . ILE B 1 404 ? 54.644  15.586  34.184  1.00 54.80  ? 400  ILE B CB  1 
ATOM   6695  C CG1 . ILE B 1 404 ? 55.708  16.187  33.256  1.00 56.38  ? 400  ILE B CG1 1 
ATOM   6696  C CG2 . ILE B 1 404 ? 55.227  15.435  35.591  1.00 54.09  ? 400  ILE B CG2 1 
ATOM   6697  C CD1 . ILE B 1 404 ? 55.165  17.109  32.180  1.00 56.85  ? 400  ILE B CD1 1 
ATOM   6698  N N   . PHE B 1 405 ? 53.182  12.837  35.386  1.00 53.72  ? 401  PHE B N   1 
ATOM   6699  C CA  . PHE B 1 405 ? 52.127  12.261  36.210  1.00 52.82  ? 401  PHE B CA  1 
ATOM   6700  C C   . PHE B 1 405 ? 52.145  12.845  37.623  1.00 50.99  ? 401  PHE B C   1 
ATOM   6701  O O   . PHE B 1 405 ? 52.068  12.113  38.615  1.00 50.76  ? 401  PHE B O   1 
ATOM   6702  C CB  . PHE B 1 405 ? 52.232  10.726  36.221  1.00 54.40  ? 401  PHE B CB  1 
ATOM   6703  C CG  . PHE B 1 405 ? 53.541  10.189  35.672  1.00 56.51  ? 401  PHE B CG  1 
ATOM   6704  C CD1 . PHE B 1 405 ? 54.728  10.297  36.402  1.00 56.67  ? 401  PHE B CD1 1 
ATOM   6705  C CD2 . PHE B 1 405 ? 53.578  9.564   34.426  1.00 58.77  ? 401  PHE B CD2 1 
ATOM   6706  C CE1 . PHE B 1 405 ? 55.930  9.798   35.894  1.00 58.78  ? 401  PHE B CE1 1 
ATOM   6707  C CE2 . PHE B 1 405 ? 54.776  9.059   33.910  1.00 61.02  ? 401  PHE B CE2 1 
ATOM   6708  C CZ  . PHE B 1 405 ? 55.953  9.177   34.646  1.00 61.04  ? 401  PHE B CZ  1 
ATOM   6709  N N   . GLY B 1 406 ? 52.240  14.171  37.700  1.00 49.82  ? 402  GLY B N   1 
ATOM   6710  C CA  . GLY B 1 406 ? 52.311  14.876  38.979  1.00 48.41  ? 402  GLY B CA  1 
ATOM   6711  C C   . GLY B 1 406 ? 51.753  16.288  38.949  1.00 47.59  ? 402  GLY B C   1 
ATOM   6712  O O   . GLY B 1 406 ? 51.095  16.675  37.983  1.00 47.78  ? 402  GLY B O   1 
ATOM   6713  N N   . PRO B 1 407 ? 52.017  17.074  40.010  1.00 47.07  ? 403  PRO B N   1 
ATOM   6714  C CA  . PRO B 1 407 ? 51.462  18.420  40.144  1.00 46.90  ? 403  PRO B CA  1 
ATOM   6715  C C   . PRO B 1 407 ? 52.233  19.462  39.332  1.00 47.54  ? 403  PRO B C   1 
ATOM   6716  O O   . PRO B 1 407 ? 52.703  20.459  39.883  1.00 48.30  ? 403  PRO B O   1 
ATOM   6717  C CB  . PRO B 1 407 ? 51.584  18.696  41.644  1.00 46.81  ? 403  PRO B CB  1 
ATOM   6718  C CG  . PRO B 1 407 ? 52.763  17.902  42.076  1.00 47.04  ? 403  PRO B CG  1 
ATOM   6719  C CD  . PRO B 1 407 ? 52.875  16.715  41.156  1.00 47.11  ? 403  PRO B CD  1 
ATOM   6720  N N   . VAL B 1 408 ? 52.353  19.225  38.029  1.00 47.56  ? 404  VAL B N   1 
ATOM   6721  C CA  . VAL B 1 408 ? 53.063  20.132  37.131  1.00 48.33  ? 404  VAL B CA  1 
ATOM   6722  C C   . VAL B 1 408 ? 52.165  20.471  35.947  1.00 48.40  ? 404  VAL B C   1 
ATOM   6723  O O   . VAL B 1 408 ? 51.726  19.577  35.223  1.00 48.26  ? 404  VAL B O   1 
ATOM   6724  C CB  . VAL B 1 408 ? 54.381  19.501  36.619  1.00 49.08  ? 404  VAL B CB  1 
ATOM   6725  C CG1 . VAL B 1 408 ? 55.112  20.462  35.709  1.00 50.62  ? 404  VAL B CG1 1 
ATOM   6726  C CG2 . VAL B 1 408 ? 55.276  19.103  37.779  1.00 49.02  ? 404  VAL B CG2 1 
ATOM   6727  N N   . GLN B 1 409 ? 51.879  21.756  35.755  1.00 48.92  ? 405  GLN B N   1 
ATOM   6728  C CA  . GLN B 1 409 ? 51.067  22.169  34.610  1.00 49.34  ? 405  GLN B CA  1 
ATOM   6729  C C   . GLN B 1 409 ? 51.874  22.905  33.540  1.00 50.86  ? 405  GLN B C   1 
ATOM   6730  O O   . GLN B 1 409 ? 52.761  23.702  33.853  1.00 51.87  ? 405  GLN B O   1 
ATOM   6731  C CB  . GLN B 1 409 ? 49.814  22.954  35.039  1.00 49.21  ? 405  GLN B CB  1 
ATOM   6732  C CG  . GLN B 1 409 ? 50.027  24.393  35.502  1.00 50.30  ? 405  GLN B CG  1 
ATOM   6733  C CD  . GLN B 1 409 ? 48.713  25.132  35.768  1.00 50.84  ? 405  GLN B CD  1 
ATOM   6734  O OE1 . GLN B 1 409 ? 48.710  26.245  36.295  1.00 51.82  ? 405  GLN B OE1 1 
ATOM   6735  N NE2 . GLN B 1 409 ? 47.594  24.511  35.407  1.00 50.37  ? 405  GLN B NE2 1 
ATOM   6736  N N   . GLU B 1 410 ? 51.572  22.609  32.278  1.00 51.27  ? 406  GLU B N   1 
ATOM   6737  C CA  . GLU B 1 410 ? 52.180  23.313  31.158  1.00 52.87  ? 406  GLU B CA  1 
ATOM   6738  C C   . GLU B 1 410 ? 51.178  24.267  30.533  1.00 53.50  ? 406  GLU B C   1 
ATOM   6739  O O   . GLU B 1 410 ? 50.001  23.931  30.382  1.00 52.89  ? 406  GLU B O   1 
ATOM   6740  C CB  . GLU B 1 410 ? 52.678  22.340  30.091  1.00 53.56  ? 406  GLU B CB  1 
ATOM   6741  C CG  . GLU B 1 410 ? 53.925  21.565  30.463  1.00 53.78  ? 406  GLU B CG  1 
ATOM   6742  C CD  . GLU B 1 410 ? 53.660  20.087  30.634  1.00 52.93  ? 406  GLU B CD  1 
ATOM   6743  O OE1 . GLU B 1 410 ? 52.980  19.707  31.608  1.00 51.48  ? 406  GLU B OE1 1 
ATOM   6744  O OE2 . GLU B 1 410 ? 54.140  19.303  29.790  1.00 54.00  ? 406  GLU B OE2 1 
ATOM   6745  N N   . ILE B 1 411 ? 51.650  25.458  30.176  1.00 55.01  ? 407  ILE B N   1 
ATOM   6746  C CA  . ILE B 1 411 ? 50.829  26.430  29.460  1.00 55.99  ? 407  ILE B CA  1 
ATOM   6747  C C   . ILE B 1 411 ? 51.474  26.735  28.107  1.00 57.90  ? 407  ILE B C   1 
ATOM   6748  O O   . ILE B 1 411 ? 52.578  27.283  28.038  1.00 59.48  ? 407  ILE B O   1 
ATOM   6749  C CB  . ILE B 1 411 ? 50.592  27.723  30.283  1.00 56.72  ? 407  ILE B CB  1 
ATOM   6750  C CG1 . ILE B 1 411 ? 50.054  27.381  31.679  1.00 55.19  ? 407  ILE B CG1 1 
ATOM   6751  C CG2 . ILE B 1 411 ? 49.621  28.642  29.557  1.00 58.01  ? 407  ILE B CG2 1 
ATOM   6752  C CD1 . ILE B 1 411 ? 50.032  28.541  32.657  1.00 56.18  ? 407  ILE B CD1 1 
ATOM   6753  N N   . LEU B 1 412 ? 50.780  26.357  27.038  1.00 58.02  ? 408  LEU B N   1 
ATOM   6754  C CA  . LEU B 1 412 ? 51.292  26.514  25.683  1.00 59.91  ? 408  LEU B CA  1 
ATOM   6755  C C   . LEU B 1 412 ? 50.553  27.605  24.927  1.00 61.41  ? 408  LEU B C   1 
ATOM   6756  O O   . LEU B 1 412 ? 49.349  27.790  25.096  1.00 60.84  ? 408  LEU B O   1 
ATOM   6757  C CB  . LEU B 1 412 ? 51.197  25.198  24.907  1.00 59.72  ? 408  LEU B CB  1 
ATOM   6758  C CG  . LEU B 1 412 ? 52.043  24.016  25.389  1.00 59.01  ? 408  LEU B CG  1 
ATOM   6759  C CD1 . LEU B 1 412 ? 51.259  23.159  26.374  1.00 56.78  ? 408  LEU B CD1 1 
ATOM   6760  C CD2 . LEU B 1 412 ? 52.513  23.176  24.209  1.00 60.46  ? 408  LEU B CD2 1 
ATOM   6761  N N   . ARG B 1 413 ? 51.293  28.312  24.082  1.00 63.70  ? 409  ARG B N   1 
ATOM   6762  C CA  . ARG B 1 413 ? 50.754  29.379  23.251  1.00 65.58  ? 409  ARG B CA  1 
ATOM   6763  C C   . ARG B 1 413 ? 50.192  28.803  21.954  1.00 66.08  ? 409  ARG B C   1 
ATOM   6764  O O   . ARG B 1 413 ? 50.821  27.946  21.334  1.00 66.55  ? 409  ARG B O   1 
ATOM   6765  C CB  . ARG B 1 413 ? 51.875  30.383  22.960  1.00 68.34  ? 409  ARG B CB  1 
ATOM   6766  C CG  . ARG B 1 413 ? 51.602  31.404  21.861  1.00 71.63  ? 409  ARG B CG  1 
ATOM   6767  C CD  . ARG B 1 413 ? 52.664  32.497  21.860  1.00 75.15  ? 409  ARG B CD  1 
ATOM   6768  N NE  . ARG B 1 413 ? 52.720  33.179  23.153  1.00 75.43  ? 409  ARG B NE  1 
ATOM   6769  C CZ  . ARG B 1 413 ? 53.391  34.301  23.397  1.00 78.23  ? 409  ARG B CZ  1 
ATOM   6770  N NH1 . ARG B 1 413 ? 54.080  34.901  22.432  1.00 81.34  ? 409  ARG B NH1 1 
ATOM   6771  N NH2 . ARG B 1 413 ? 53.366  34.826  24.615  1.00 78.06  ? 409  ARG B NH2 1 
ATOM   6772  N N   . PHE B 1 414 ? 49.008  29.263  21.555  1.00 66.29  ? 410  PHE B N   1 
ATOM   6773  C CA  . PHE B 1 414 ? 48.465  28.937  20.231  1.00 67.45  ? 410  PHE B CA  1 
ATOM   6774  C C   . PHE B 1 414 ? 47.800  30.136  19.560  1.00 69.48  ? 410  PHE B C   1 
ATOM   6775  O O   . PHE B 1 414 ? 47.274  31.024  20.233  1.00 69.39  ? 410  PHE B O   1 
ATOM   6776  C CB  . PHE B 1 414 ? 47.525  27.723  20.280  1.00 65.81  ? 410  PHE B CB  1 
ATOM   6777  C CG  . PHE B 1 414 ? 46.098  28.048  20.646  1.00 64.93  ? 410  PHE B CG  1 
ATOM   6778  C CD1 . PHE B 1 414 ? 45.670  27.967  21.967  1.00 62.64  ? 410  PHE B CD1 1 
ATOM   6779  C CD2 . PHE B 1 414 ? 45.172  28.389  19.663  1.00 66.44  ? 410  PHE B CD2 1 
ATOM   6780  C CE1 . PHE B 1 414 ? 44.352  28.242  22.305  1.00 62.42  ? 410  PHE B CE1 1 
ATOM   6781  C CE2 . PHE B 1 414 ? 43.850  28.672  19.994  1.00 66.17  ? 410  PHE B CE2 1 
ATOM   6782  C CZ  . PHE B 1 414 ? 43.441  28.600  21.318  1.00 64.17  ? 410  PHE B CZ  1 
ATOM   6783  N N   . LYS B 1 415 ? 47.822  30.134  18.228  1.00 71.60  ? 411  LYS B N   1 
ATOM   6784  C CA  . LYS B 1 415 ? 47.376  31.265  17.415  1.00 74.08  ? 411  LYS B CA  1 
ATOM   6785  C C   . LYS B 1 415 ? 45.980  31.026  16.820  1.00 74.22  ? 411  LYS B C   1 
ATOM   6786  O O   . LYS B 1 415 ? 45.013  31.668  17.235  1.00 74.05  ? 411  LYS B O   1 
ATOM   6787  C CB  . LYS B 1 415 ? 48.425  31.561  16.328  1.00 76.91  ? 411  LYS B CB  1 
ATOM   6788  C CG  . LYS B 1 415 ? 48.118  32.726  15.391  1.00 80.12  ? 411  LYS B CG  1 
ATOM   6789  C CD  . LYS B 1 415 ? 49.203  32.855  14.318  1.00 83.07  ? 411  LYS B CD  1 
ATOM   6790  C CE  . LYS B 1 415 ? 48.689  33.544  13.061  1.00 85.99  ? 411  LYS B CE  1 
ATOM   6791  N NZ  . LYS B 1 415 ? 48.393  34.985  13.277  1.00 87.68  ? 411  LYS B NZ  1 
ATOM   6792  N N   . THR B 1 416 ? 45.880  30.100  15.866  1.00 74.88  ? 412  THR B N   1 
ATOM   6793  C CA  . THR B 1 416 ? 44.615  29.815  15.180  1.00 75.65  ? 412  THR B CA  1 
ATOM   6794  C C   . THR B 1 416 ? 43.934  28.570  15.743  1.00 73.51  ? 412  THR B C   1 
ATOM   6795  O O   . THR B 1 416 ? 44.534  27.819  16.514  1.00 71.60  ? 412  THR B O   1 
ATOM   6796  C CB  . THR B 1 416 ? 44.804  29.621  13.649  1.00 78.57  ? 412  THR B CB  1 
ATOM   6797  O OG1 . THR B 1 416 ? 45.403  28.345  13.388  1.00 78.39  ? 412  THR B OG1 1 
ATOM   6798  C CG2 . THR B 1 416 ? 45.666  30.731  13.044  1.00 81.14  ? 412  THR B CG2 1 
ATOM   6799  N N   . MET B 1 417 ? 42.681  28.360  15.344  1.00 74.17  ? 413  MET B N   1 
ATOM   6800  C CA  . MET B 1 417 ? 41.933  27.164  15.718  1.00 72.81  ? 413  MET B CA  1 
ATOM   6801  C C   . MET B 1 417 ? 42.446  25.942  14.959  1.00 73.67  ? 413  MET B C   1 
ATOM   6802  O O   . MET B 1 417 ? 42.565  24.854  15.527  1.00 72.26  ? 413  MET B O   1 
ATOM   6803  C CB  . MET B 1 417 ? 40.445  27.353  15.442  1.00 73.87  ? 413  MET B CB  1 
ATOM   6804  C CG  . MET B 1 417 ? 39.563  26.391  16.214  1.00 72.73  ? 413  MET B CG  1 
ATOM   6805  S SD  . MET B 1 417 ? 38.022  25.998  15.370  1.00 75.66  ? 413  MET B SD  1 
ATOM   6806  C CE  . MET B 1 417 ? 37.260  27.613  15.220  1.00 77.19  ? 413  MET B CE  1 
ATOM   6807  N N   . ASP B 1 418 ? 42.746  26.135  13.673  1.00 76.28  ? 414  ASP B N   1 
ATOM   6808  C CA  . ASP B 1 418 ? 43.291  25.079  12.822  1.00 77.80  ? 414  ASP B CA  1 
ATOM   6809  C C   . ASP B 1 418 ? 44.609  24.550  13.375  1.00 76.44  ? 414  ASP B C   1 
ATOM   6810  O O   . ASP B 1 418 ? 44.954  23.385  13.168  1.00 77.03  ? 414  ASP B O   1 
ATOM   6811  C CB  . ASP B 1 418 ? 43.492  25.590  11.389  1.00 81.28  ? 414  ASP B CB  1 
ATOM   6812  C CG  . ASP B 1 418 ? 42.177  25.793  10.640  1.00 83.31  ? 414  ASP B CG  1 
ATOM   6813  O OD1 . ASP B 1 418 ? 41.170  25.127  10.975  1.00 82.68  ? 414  ASP B OD1 1 
ATOM   6814  O OD2 . ASP B 1 418 ? 42.156  26.619  9.699   1.00 85.77  ? 414  ASP B OD2 1 
ATOM   6815  N N   . GLU B 1 419 ? 45.331  25.416  14.083  1.00 74.91  ? 415  GLU B N   1 
ATOM   6816  C CA  . GLU B 1 419 ? 46.602  25.058  14.700  1.00 73.64  ? 415  GLU B CA  1 
ATOM   6817  C C   . GLU B 1 419 ? 46.404  24.054  15.838  1.00 70.89  ? 415  GLU B C   1 
ATOM   6818  O O   . GLU B 1 419 ? 46.904  22.932  15.759  1.00 71.16  ? 415  GLU B O   1 
ATOM   6819  C CB  . GLU B 1 419 ? 47.329  26.311  15.199  1.00 73.21  ? 415  GLU B CB  1 
ATOM   6820  C CG  . GLU B 1 419 ? 48.811  26.108  15.481  1.00 73.18  ? 415  GLU B CG  1 
ATOM   6821  C CD  . GLU B 1 419 ? 49.396  27.177  16.388  1.00 72.22  ? 415  GLU B CD  1 
ATOM   6822  O OE1 . GLU B 1 419 ? 48.703  28.173  16.677  1.00 71.81  ? 415  GLU B OE1 1 
ATOM   6823  O OE2 . GLU B 1 419 ? 50.557  27.019  16.817  1.00 72.30  ? 415  GLU B OE2 1 
ATOM   6824  N N   . VAL B 1 420 ? 45.662  24.452  16.875  1.00 68.52  ? 416  VAL B N   1 
ATOM   6825  C CA  . VAL B 1 420 ? 45.465  23.609  18.067  1.00 66.00  ? 416  VAL B CA  1 
ATOM   6826  C C   . VAL B 1 420 ? 44.954  22.215  17.760  1.00 66.59  ? 416  VAL B C   1 
ATOM   6827  O O   . VAL B 1 420 ? 45.386  21.248  18.386  1.00 65.42  ? 416  VAL B O   1 
ATOM   6828  C CB  . VAL B 1 420 ? 44.521  24.237  19.133  1.00 64.13  ? 416  VAL B CB  1 
ATOM   6829  C CG1 . VAL B 1 420 ? 45.318  24.795  20.289  1.00 62.17  ? 416  VAL B CG1 1 
ATOM   6830  C CG2 . VAL B 1 420 ? 43.585  25.276  18.529  1.00 65.55  ? 416  VAL B CG2 1 
ATOM   6831  N N   . ILE B 1 421 ? 44.038  22.118  16.800  1.00 68.63  ? 417  ILE B N   1 
ATOM   6832  C CA  . ILE B 1 421 ? 43.429  20.840  16.447  1.00 69.86  ? 417  ILE B CA  1 
ATOM   6833  C C   . ILE B 1 421 ? 44.492  19.836  15.986  1.00 71.34  ? 417  ILE B C   1 
ATOM   6834  O O   . ILE B 1 421 ? 44.567  18.728  16.522  1.00 70.86  ? 417  ILE B O   1 
ATOM   6835  C CB  . ILE B 1 421 ? 42.294  21.014  15.416  1.00 72.20  ? 417  ILE B CB  1 
ATOM   6836  C CG1 . ILE B 1 421 ? 41.150  21.817  16.046  1.00 70.95  ? 417  ILE B CG1 1 
ATOM   6837  C CG2 . ILE B 1 421 ? 41.791  19.651  14.929  1.00 74.21  ? 417  ILE B CG2 1 
ATOM   6838  C CD1 . ILE B 1 421 ? 40.196  22.457  15.049  1.00 73.54  ? 417  ILE B CD1 1 
ATOM   6839  N N   . GLU B 1 422 ? 45.322  20.238  15.024  1.00 73.35  ? 418  GLU B N   1 
ATOM   6840  C CA  . GLU B 1 422 ? 46.449  19.419  14.576  1.00 75.15  ? 418  GLU B CA  1 
ATOM   6841  C C   . GLU B 1 422 ? 47.399  19.091  15.723  1.00 72.82  ? 418  GLU B C   1 
ATOM   6842  O O   . GLU B 1 422 ? 47.791  17.936  15.899  1.00 73.37  ? 418  GLU B O   1 
ATOM   6843  C CB  . GLU B 1 422 ? 47.218  20.113  13.445  1.00 77.85  ? 418  GLU B CB  1 
ATOM   6844  C CG  . GLU B 1 422 ? 47.030  19.491  12.059  1.00 82.30  ? 418  GLU B CG  1 
ATOM   6845  C CD  . GLU B 1 422 ? 45.612  19.624  11.511  1.00 84.07  ? 418  GLU B CD  1 
ATOM   6846  O OE1 . GLU B 1 422 ? 44.929  20.628  11.820  1.00 82.92  ? 418  GLU B OE1 1 
ATOM   6847  O OE2 . GLU B 1 422 ? 45.185  18.721  10.758  1.00 86.90  ? 418  GLU B OE2 1 
ATOM   6848  N N   . ARG B 1 423 ? 47.747  20.112  16.504  1.00 70.51  ? 419  ARG B N   1 
ATOM   6849  C CA  . ARG B 1 423 ? 48.712  19.975  17.592  1.00 68.52  ? 419  ARG B CA  1 
ATOM   6850  C C   . ARG B 1 423 ? 48.211  19.069  18.713  1.00 66.42  ? 419  ARG B C   1 
ATOM   6851  O O   . ARG B 1 423 ? 48.970  18.249  19.231  1.00 66.13  ? 419  ARG B O   1 
ATOM   6852  C CB  . ARG B 1 423 ? 49.106  21.347  18.151  1.00 67.11  ? 419  ARG B CB  1 
ATOM   6853  C CG  . ARG B 1 423 ? 49.840  22.246  17.160  1.00 69.26  ? 419  ARG B CG  1 
ATOM   6854  C CD  . ARG B 1 423 ? 50.870  23.129  17.858  1.00 68.47  ? 419  ARG B CD  1 
ATOM   6855  N NE  . ARG B 1 423 ? 50.273  24.221  18.624  1.00 66.38  ? 419  ARG B NE  1 
ATOM   6856  C CZ  . ARG B 1 423 ? 50.868  24.854  19.632  1.00 64.96  ? 419  ARG B CZ  1 
ATOM   6857  N NH1 . ARG B 1 423 ? 52.084  24.507  20.031  1.00 65.14  ? 419  ARG B NH1 1 
ATOM   6858  N NH2 . ARG B 1 423 ? 50.239  25.835  20.255  1.00 63.98  ? 419  ARG B NH2 1 
ATOM   6859  N N   . ALA B 1 424 ? 46.937  19.217  19.075  1.00 65.34  ? 420  ALA B N   1 
ATOM   6860  C CA  . ALA B 1 424 ? 46.320  18.402  20.125  1.00 63.70  ? 420  ALA B CA  1 
ATOM   6861  C C   . ALA B 1 424 ? 46.035  16.980  19.656  1.00 65.70  ? 420  ALA B C   1 
ATOM   6862  O O   . ALA B 1 424 ? 46.053  16.047  20.460  1.00 64.94  ? 420  ALA B O   1 
ATOM   6863  C CB  . ALA B 1 424 ? 45.048  19.056  20.639  1.00 62.35  ? 420  ALA B CB  1 
ATOM   6864  N N   . ASN B 1 425 ? 45.770  16.823  18.359  1.00 68.71  ? 421  ASN B N   1 
ATOM   6865  C CA  . ASN B 1 425 ? 45.598  15.502  17.747  1.00 71.63  ? 421  ASN B CA  1 
ATOM   6866  C C   . ASN B 1 425 ? 46.873  14.666  17.757  1.00 72.88  ? 421  ASN B C   1 
ATOM   6867  O O   . ASN B 1 425 ? 46.814  13.432  17.764  1.00 74.55  ? 421  ASN B O   1 
ATOM   6868  C CB  . ASN B 1 425 ? 45.095  15.627  16.306  1.00 74.80  ? 421  ASN B CB  1 
ATOM   6869  C CG  . ASN B 1 425 ? 43.583  15.542  16.200  1.00 75.32  ? 421  ASN B CG  1 
ATOM   6870  O OD1 . ASN B 1 425 ? 42.915  15.002  17.082  1.00 74.10  ? 421  ASN B OD1 1 
ATOM   6871  N ND2 . ASN B 1 425 ? 43.037  16.066  15.107  1.00 77.37  ? 421  ASN B ND2 1 
ATOM   6872  N N   . ASN B 1 426 ? 48.018  15.348  17.764  1.00 72.50  ? 422  ASN B N   1 
ATOM   6873  C CA  . ASN B 1 426 ? 49.323  14.705  17.647  1.00 74.14  ? 422  ASN B CA  1 
ATOM   6874  C C   . ASN B 1 426 ? 49.724  13.908  18.888  1.00 72.47  ? 422  ASN B C   1 
ATOM   6875  O O   . ASN B 1 426 ? 50.652  14.281  19.605  1.00 70.84  ? 422  ASN B O   1 
ATOM   6876  C CB  . ASN B 1 426 ? 50.396  15.743  17.293  1.00 74.41  ? 422  ASN B CB  1 
ATOM   6877  C CG  . ASN B 1 426 ? 51.544  15.153  16.485  1.00 77.79  ? 422  ASN B CG  1 
ATOM   6878  O OD1 . ASN B 1 426 ? 51.816  13.953  16.544  1.00 79.38  ? 422  ASN B OD1 1 
ATOM   6879  N ND2 . ASN B 1 426 ? 52.224  16.002  15.724  1.00 79.25  ? 422  ASN B ND2 1 
ATOM   6880  N N   . SER B 1 427 ? 49.006  12.812  19.125  1.00 73.34  ? 423  SER B N   1 
ATOM   6881  C CA  . SER B 1 427 ? 49.305  11.864  20.199  1.00 72.65  ? 423  SER B CA  1 
ATOM   6882  C C   . SER B 1 427 ? 49.110  10.446  19.680  1.00 76.24  ? 423  SER B C   1 
ATOM   6883  O O   . SER B 1 427 ? 48.421  10.238  18.678  1.00 78.84  ? 423  SER B O   1 
ATOM   6884  C CB  . SER B 1 427 ? 48.407  12.106  21.413  1.00 69.45  ? 423  SER B CB  1 
ATOM   6885  O OG  . SER B 1 427 ? 48.640  11.146  22.431  1.00 68.84  ? 423  SER B OG  1 
ATOM   6886  N N   . ASP B 1 428 ? 49.703  9.475   20.371  1.00 76.79  ? 424  ASP B N   1 
ATOM   6887  C CA  . ASP B 1 428 ? 49.735  8.099   19.869  1.00 81.02  ? 424  ASP B CA  1 
ATOM   6888  C C   . ASP B 1 428 ? 48.406  7.336   19.947  1.00 82.29  ? 424  ASP B C   1 
ATOM   6889  O O   . ASP B 1 428 ? 47.882  6.925   18.909  1.00 85.75  ? 424  ASP B O   1 
ATOM   6890  C CB  . ASP B 1 428 ? 50.905  7.308   20.471  1.00 81.71  ? 424  ASP B CB  1 
ATOM   6891  C CG  . ASP B 1 428 ? 52.206  7.516   19.702  1.00 83.81  ? 424  ASP B CG  1 
ATOM   6892  O OD1 . ASP B 1 428 ? 52.373  8.580   19.066  1.00 83.10  ? 424  ASP B OD1 1 
ATOM   6893  O OD2 . ASP B 1 428 ? 53.064  6.611   19.729  1.00 86.36  ? 424  ASP B OD2 1 
ATOM   6894  N N   . PHE B 1 429 ? 47.857  7.142   21.147  1.00 79.96  ? 425  PHE B N   1 
ATOM   6895  C CA  . PHE B 1 429 ? 46.573  6.435   21.266  1.00 81.37  ? 425  PHE B CA  1 
ATOM   6896  C C   . PHE B 1 429 ? 45.648  6.983   22.358  1.00 77.79  ? 425  PHE B C   1 
ATOM   6897  O O   . PHE B 1 429 ? 44.425  6.923   22.221  1.00 78.60  ? 425  PHE B O   1 
ATOM   6898  C CB  . PHE B 1 429 ? 46.783  4.918   21.433  1.00 84.68  ? 425  PHE B CB  1 
ATOM   6899  C CG  . PHE B 1 429 ? 45.917  4.080   20.522  1.00 89.37  ? 425  PHE B CG  1 
ATOM   6900  C CD1 . PHE B 1 429 ? 46.397  3.653   19.281  1.00 93.96  ? 425  PHE B CD1 1 
ATOM   6901  C CD2 . PHE B 1 429 ? 44.623  3.722   20.895  1.00 89.89  ? 425  PHE B CD2 1 
ATOM   6902  C CE1 . PHE B 1 429 ? 45.601  2.880   18.423  1.00 98.58  ? 425  PHE B CE1 1 
ATOM   6903  C CE2 . PHE B 1 429 ? 43.818  2.949   20.046  1.00 94.75  ? 425  PHE B CE2 1 
ATOM   6904  C CZ  . PHE B 1 429 ? 44.310  2.527   18.808  1.00 99.04  ? 425  PHE B CZ  1 
ATOM   6905  N N   . GLY B 1 430 ? 46.229  7.520   23.428  1.00 74.15  ? 426  GLY B N   1 
ATOM   6906  C CA  . GLY B 1 430 ? 45.443  8.024   24.555  1.00 70.99  ? 426  GLY B CA  1 
ATOM   6907  C C   . GLY B 1 430 ? 45.084  9.497   24.458  1.00 68.48  ? 426  GLY B C   1 
ATOM   6908  O O   . GLY B 1 430 ? 45.966  10.364  24.483  1.00 66.81  ? 426  GLY B O   1 
ATOM   6909  N N   . LEU B 1 431 ? 43.785  9.782   24.352  1.00 68.47  ? 427  LEU B N   1 
ATOM   6910  C CA  . LEU B 1 431 ? 43.302  11.163  24.309  1.00 66.25  ? 427  LEU B CA  1 
ATOM   6911  C C   . LEU B 1 431 ? 41.995  11.398  25.052  1.00 65.13  ? 427  LEU B C   1 
ATOM   6912  O O   . LEU B 1 431 ? 41.032  10.642  24.917  1.00 67.26  ? 427  LEU B O   1 
ATOM   6913  C CB  . LEU B 1 431 ? 43.146  11.661  22.870  1.00 68.23  ? 427  LEU B CB  1 
ATOM   6914  C CG  . LEU B 1 431 ? 44.334  12.312  22.169  1.00 68.14  ? 427  LEU B CG  1 
ATOM   6915  C CD1 . LEU B 1 431 ? 44.949  11.319  21.203  1.00 71.46  ? 427  LEU B CD1 1 
ATOM   6916  C CD2 . LEU B 1 431 ? 43.879  13.557  21.428  1.00 67.84  ? 427  LEU B CD2 1 
ATOM   6917  N N   . VAL B 1 432 ? 41.998  12.462  25.843  1.00 62.10  ? 428  VAL B N   1 
ATOM   6918  C CA  . VAL B 1 432 ? 40.801  13.053  26.419  1.00 61.07  ? 428  VAL B CA  1 
ATOM   6919  C C   . VAL B 1 432 ? 40.935  14.542  26.117  1.00 59.56  ? 428  VAL B C   1 
ATOM   6920  O O   . VAL B 1 432 ? 42.040  15.084  26.145  1.00 58.27  ? 428  VAL B O   1 
ATOM   6921  C CB  . VAL B 1 432 ? 40.718  12.814  27.951  1.00 59.30  ? 428  VAL B CB  1 
ATOM   6922  C CG1 . VAL B 1 432 ? 39.538  13.561  28.569  1.00 58.69  ? 428  VAL B CG1 1 
ATOM   6923  C CG2 . VAL B 1 432 ? 40.619  11.324  28.262  1.00 60.96  ? 428  VAL B CG2 1 
ATOM   6924  N N   . ALA B 1 433 ? 39.825  15.201  25.808  1.00 60.04  ? 429  ALA B N   1 
ATOM   6925  C CA  . ALA B 1 433 ? 39.867  16.617  25.455  1.00 59.05  ? 429  ALA B CA  1 
ATOM   6926  C C   . ALA B 1 433 ? 39.117  17.508  26.446  1.00 57.63  ? 429  ALA B C   1 
ATOM   6927  O O   . ALA B 1 433 ? 38.259  17.040  27.195  1.00 57.90  ? 429  ALA B O   1 
ATOM   6928  C CB  . ALA B 1 433 ? 39.337  16.819  24.046  1.00 61.37  ? 429  ALA B CB  1 
ATOM   6929  N N   . ALA B 1 434 ? 39.462  18.793  26.443  1.00 56.41  ? 430  ALA B N   1 
ATOM   6930  C CA  . ALA B 1 434 ? 38.750  19.796  27.226  1.00 55.65  ? 430  ALA B CA  1 
ATOM   6931  C C   . ALA B 1 434 ? 38.831  21.172  26.559  1.00 55.95  ? 430  ALA B C   1 
ATOM   6932  O O   . ALA B 1 434 ? 39.905  21.769  26.473  1.00 55.13  ? 430  ALA B O   1 
ATOM   6933  C CB  . ALA B 1 434 ? 39.292  19.846  28.649  1.00 53.70  ? 430  ALA B CB  1 
ATOM   6934  N N   . VAL B 1 435 ? 37.690  21.663  26.078  1.00 57.34  ? 431  VAL B N   1 
ATOM   6935  C CA  . VAL B 1 435 ? 37.604  23.003  25.486  1.00 57.94  ? 431  VAL B CA  1 
ATOM   6936  C C   . VAL B 1 435 ? 36.870  23.995  26.381  1.00 57.98  ? 431  VAL B C   1 
ATOM   6937  O O   . VAL B 1 435 ? 35.890  23.643  27.040  1.00 58.46  ? 431  VAL B O   1 
ATOM   6938  C CB  . VAL B 1 435 ? 36.924  23.008  24.089  1.00 60.19  ? 431  VAL B CB  1 
ATOM   6939  C CG1 . VAL B 1 435 ? 37.914  22.622  23.023  1.00 60.52  ? 431  VAL B CG1 1 
ATOM   6940  C CG2 . VAL B 1 435 ? 35.701  22.096  24.057  1.00 61.64  ? 431  VAL B CG2 1 
ATOM   6941  N N   . PHE B 1 436 ? 37.351  25.235  26.390  1.00 57.79  ? 432  PHE B N   1 
ATOM   6942  C CA  . PHE B 1 436 ? 36.674  26.321  27.091  1.00 58.49  ? 432  PHE B CA  1 
ATOM   6943  C C   . PHE B 1 436 ? 36.356  27.461  26.128  1.00 60.47  ? 432  PHE B C   1 
ATOM   6944  O O   . PHE B 1 436 ? 37.246  28.189  25.689  1.00 60.60  ? 432  PHE B O   1 
ATOM   6945  C CB  . PHE B 1 436 ? 37.500  26.801  28.287  1.00 57.09  ? 432  PHE B CB  1 
ATOM   6946  C CG  . PHE B 1 436 ? 37.518  25.831  29.433  1.00 55.22  ? 432  PHE B CG  1 
ATOM   6947  C CD1 . PHE B 1 436 ? 38.463  24.811  29.484  1.00 53.26  ? 432  PHE B CD1 1 
ATOM   6948  C CD2 . PHE B 1 436 ? 36.585  25.933  30.456  1.00 55.50  ? 432  PHE B CD2 1 
ATOM   6949  C CE1 . PHE B 1 436 ? 38.481  23.910  30.537  1.00 52.07  ? 432  PHE B CE1 1 
ATOM   6950  C CE2 . PHE B 1 436 ? 36.595  25.037  31.513  1.00 54.52  ? 432  PHE B CE2 1 
ATOM   6951  C CZ  . PHE B 1 436 ? 37.546  24.021  31.553  1.00 52.78  ? 432  PHE B CZ  1 
ATOM   6952  N N   . THR B 1 437 ? 35.076  27.596  25.798  1.00 62.35  ? 433  THR B N   1 
ATOM   6953  C CA  . THR B 1 437 ? 34.617  28.547  24.794  1.00 64.61  ? 433  THR B CA  1 
ATOM   6954  C C   . THR B 1 437 ? 33.204  28.998  25.127  1.00 66.80  ? 433  THR B C   1 
ATOM   6955  O O   . THR B 1 437 ? 32.497  28.345  25.900  1.00 66.63  ? 433  THR B O   1 
ATOM   6956  C CB  . THR B 1 437 ? 34.573  27.902  23.385  1.00 65.38  ? 433  THR B CB  1 
ATOM   6957  O OG1 . THR B 1 437 ? 35.478  26.793  23.323  1.00 63.72  ? 433  THR B OG1 1 
ATOM   6958  C CG2 . THR B 1 437 ? 34.924  28.910  22.301  1.00 66.64  ? 433  THR B CG2 1 
ATOM   6959  N N   . ASN B 1 438 ? 32.805  30.122  24.542  1.00 69.10  ? 434  ASN B N   1 
ATOM   6960  C CA  . ASN B 1 438 ? 31.413  30.541  24.555  1.00 71.86  ? 434  ASN B CA  1 
ATOM   6961  C C   . ASN B 1 438 ? 30.822  30.536  23.148  1.00 73.98  ? 434  ASN B C   1 
ATOM   6962  O O   . ASN B 1 438 ? 29.648  30.853  22.962  1.00 76.65  ? 434  ASN B O   1 
ATOM   6963  C CB  . ASN B 1 438 ? 31.257  31.910  25.226  1.00 73.49  ? 434  ASN B CB  1 
ATOM   6964  C CG  . ASN B 1 438 ? 31.172  31.814  26.745  1.00 72.68  ? 434  ASN B CG  1 
ATOM   6965  O OD1 . ASN B 1 438 ? 30.992  30.732  27.309  1.00 71.17  ? 434  ASN B OD1 1 
ATOM   6966  N ND2 . ASN B 1 438 ? 31.295  32.953  27.412  1.00 74.04  ? 434  ASN B ND2 1 
ATOM   6967  N N   . ASP B 1 439 ? 31.642  30.149  22.171  1.00 73.14  ? 435  ASP B N   1 
ATOM   6968  C CA  . ASP B 1 439 ? 31.232  30.079  20.767  1.00 75.25  ? 435  ASP B CA  1 
ATOM   6969  C C   . ASP B 1 439 ? 30.759  28.665  20.406  1.00 75.20  ? 435  ASP B C   1 
ATOM   6970  O O   . ASP B 1 439 ? 31.485  27.689  20.611  1.00 73.11  ? 435  ASP B O   1 
ATOM   6971  C CB  . ASP B 1 439 ? 32.384  30.522  19.855  1.00 74.92  ? 435  ASP B CB  1 
ATOM   6972  C CG  . ASP B 1 439 ? 31.947  30.776  18.412  1.00 78.04  ? 435  ASP B CG  1 
ATOM   6973  O OD1 . ASP B 1 439 ? 30.943  30.186  17.953  1.00 79.93  ? 435  ASP B OD1 1 
ATOM   6974  O OD2 . ASP B 1 439 ? 32.629  31.569  17.724  1.00 79.28  ? 435  ASP B OD2 1 
ATOM   6975  N N   . ILE B 1 440 ? 29.539  28.577  19.873  1.00 77.85  ? 436  ILE B N   1 
ATOM   6976  C CA  . ILE B 1 440 ? 28.916  27.303  19.488  1.00 78.66  ? 436  ILE B CA  1 
ATOM   6977  C C   . ILE B 1 440 ? 29.674  26.638  18.345  1.00 78.45  ? 436  ILE B C   1 
ATOM   6978  O O   . ILE B 1 440 ? 30.012  25.452  18.417  1.00 77.36  ? 436  ILE B O   1 
ATOM   6979  C CB  . ILE B 1 440 ? 27.430  27.494  19.078  1.00 82.26  ? 436  ILE B CB  1 
ATOM   6980  C CG1 . ILE B 1 440 ? 26.637  28.127  20.221  1.00 83.10  ? 436  ILE B CG1 1 
ATOM   6981  C CG2 . ILE B 1 440 ? 26.793  26.162  18.665  1.00 83.63  ? 436  ILE B CG2 1 
ATOM   6982  C CD1 . ILE B 1 440 ? 25.276  28.641  19.820  1.00 87.36  ? 436  ILE B CD1 1 
ATOM   6983  N N   . ASN B 1 441 ? 29.937  27.414  17.297  1.00 73.51  ? 437  ASN B N   1 
ATOM   6984  C CA  . ASN B 1 441 ? 30.646  26.926  16.123  1.00 73.36  ? 437  ASN B CA  1 
ATOM   6985  C C   . ASN B 1 441 ? 32.073  26.482  16.446  1.00 71.51  ? 437  ASN B C   1 
ATOM   6986  O O   . ASN B 1 441 ? 32.561  25.504  15.885  1.00 71.03  ? 437  ASN B O   1 
ATOM   6987  C CB  . ASN B 1 441 ? 30.636  27.983  15.015  1.00 75.25  ? 437  ASN B CB  1 
ATOM   6988  C CG  . ASN B 1 441 ? 29.228  28.317  14.531  1.00 77.30  ? 437  ASN B CG  1 
ATOM   6989  O OD1 . ASN B 1 441 ? 28.288  27.544  14.721  1.00 77.13  ? 437  ASN B OD1 1 
ATOM   6990  N ND2 . ASN B 1 441 ? 29.084  29.475  13.898  1.00 79.16  ? 437  ASN B ND2 1 
ATOM   6991  N N   . LYS B 1 442 ? 32.724  27.194  17.364  1.00 70.72  ? 438  LYS B N   1 
ATOM   6992  C CA  . LYS B 1 442 ? 34.077  26.849  17.799  1.00 69.21  ? 438  LYS B CA  1 
ATOM   6993  C C   . LYS B 1 442 ? 34.104  25.567  18.628  1.00 67.81  ? 438  LYS B C   1 
ATOM   6994  O O   . LYS B 1 442 ? 34.970  24.720  18.430  1.00 67.05  ? 438  LYS B O   1 
ATOM   6995  C CB  . LYS B 1 442 ? 34.716  28.000  18.584  1.00 69.07  ? 438  LYS B CB  1 
ATOM   6996  C CG  . LYS B 1 442 ? 35.098  29.212  17.738  1.00 70.41  ? 438  LYS B CG  1 
ATOM   6997  C CD  . LYS B 1 442 ? 35.937  30.210  18.527  1.00 69.96  ? 438  LYS B CD  1 
ATOM   6998  C CE  . LYS B 1 442 ? 36.412  31.347  17.639  1.00 71.19  ? 438  LYS B CE  1 
ATOM   6999  N NZ  . LYS B 1 442 ? 37.386  32.228  18.335  1.00 70.75  ? 438  LYS B NZ  1 
ATOM   7000  N N   . ALA B 1 443 ? 33.153  25.429  19.549  1.00 67.76  ? 439  ALA B N   1 
ATOM   7001  C CA  . ALA B 1 443 ? 33.097  24.269  20.442  1.00 66.66  ? 439  ALA B CA  1 
ATOM   7002  C C   . ALA B 1 443 ? 32.715  22.981  19.721  1.00 66.51  ? 439  ALA B C   1 
ATOM   7003  O O   . ALA B 1 443 ? 33.270  21.923  20.010  1.00 65.58  ? 439  ALA B O   1 
ATOM   7004  C CB  . ALA B 1 443 ? 32.147  24.529  21.594  1.00 67.03  ? 439  ALA B CB  1 
ATOM   7005  N N   . LEU B 1 444 ? 31.767  23.078  18.790  1.00 67.68  ? 440  LEU B N   1 
ATOM   7006  C CA  . LEU B 1 444 ? 31.304  21.921  18.024  1.00 67.79  ? 440  LEU B CA  1 
ATOM   7007  C C   . LEU B 1 444 ? 32.330  21.444  17.006  1.00 67.54  ? 440  LEU B C   1 
ATOM   7008  O O   . LEU B 1 444 ? 32.510  20.241  16.819  1.00 66.90  ? 440  LEU B O   1 
ATOM   7009  C CB  . LEU B 1 444 ? 29.978  22.225  17.320  1.00 69.55  ? 440  LEU B CB  1 
ATOM   7010  C CG  . LEU B 1 444 ? 28.686  21.802  18.023  1.00 69.91  ? 440  LEU B CG  1 
ATOM   7011  C CD1 . LEU B 1 444 ? 27.524  22.641  17.531  1.00 72.02  ? 440  LEU B CD1 1 
ATOM   7012  C CD2 . LEU B 1 444 ? 28.400  20.310  17.830  1.00 69.29  ? 440  LEU B CD2 1 
ATOM   7013  N N   . THR B 1 445 ? 32.997  22.390  16.351  1.00 68.22  ? 441  THR B N   1 
ATOM   7014  C CA  . THR B 1 445 ? 33.968  22.059  15.316  1.00 68.48  ? 441  THR B CA  1 
ATOM   7015  C C   . THR B 1 445 ? 35.274  21.515  15.909  1.00 67.13  ? 441  THR B C   1 
ATOM   7016  O O   . THR B 1 445 ? 36.000  20.782  15.238  1.00 67.26  ? 441  THR B O   1 
ATOM   7017  C CB  . THR B 1 445 ? 34.219  23.252  14.358  1.00 69.98  ? 441  THR B CB  1 
ATOM   7018  O OG1 . THR B 1 445 ? 34.487  22.767  13.037  1.00 71.23  ? 441  THR B OG1 1 
ATOM   7019  C CG2 . THR B 1 445 ? 35.369  24.121  14.834  1.00 69.33  ? 441  THR B CG2 1 
ATOM   7020  N N   . VAL B 1 446 ? 35.557  21.868  17.164  1.00 66.21  ? 442  VAL B N   1 
ATOM   7021  C CA  . VAL B 1 446 ? 36.726  21.348  17.876  1.00 65.13  ? 442  VAL B CA  1 
ATOM   7022  C C   . VAL B 1 446 ? 36.443  19.953  18.434  1.00 64.33  ? 442  VAL B C   1 
ATOM   7023  O O   . VAL B 1 446 ? 37.253  19.040  18.270  1.00 64.02  ? 442  VAL B O   1 
ATOM   7024  C CB  . VAL B 1 446 ? 37.197  22.301  19.005  1.00 64.73  ? 442  VAL B CB  1 
ATOM   7025  C CG1 . VAL B 1 446 ? 38.179  21.606  19.920  1.00 63.89  ? 442  VAL B CG1 1 
ATOM   7026  C CG2 . VAL B 1 446 ? 37.841  23.547  18.420  1.00 65.54  ? 442  VAL B CG2 1 
ATOM   7027  N N   . SER B 1 447 ? 35.287  19.797  19.078  1.00 64.26  ? 443  SER B N   1 
ATOM   7028  C CA  . SER B 1 447 ? 34.888  18.525  19.683  1.00 63.64  ? 443  SER B CA  1 
ATOM   7029  C C   . SER B 1 447 ? 34.702  17.412  18.653  1.00 63.88  ? 443  SER B C   1 
ATOM   7030  O O   . SER B 1 447 ? 34.966  16.249  18.946  1.00 63.29  ? 443  SER B O   1 
ATOM   7031  C CB  . SER B 1 447 ? 33.611  18.691  20.514  1.00 63.78  ? 443  SER B CB  1 
ATOM   7032  O OG  . SER B 1 447 ? 32.476  18.878  19.689  1.00 64.43  ? 443  SER B OG  1 
ATOM   7033  N N   . SER B 1 448 ? 34.245  17.772  17.456  1.00 65.03  ? 444  SER B N   1 
ATOM   7034  C CA  . SER B 1 448 ? 34.025  16.798  16.385  1.00 65.61  ? 444  SER B CA  1 
ATOM   7035  C C   . SER B 1 448 ? 35.327  16.391  15.698  1.00 65.70  ? 444  SER B C   1 
ATOM   7036  O O   . SER B 1 448 ? 35.438  15.278  15.181  1.00 65.85  ? 444  SER B O   1 
ATOM   7037  C CB  . SER B 1 448 ? 33.030  17.335  15.351  1.00 67.05  ? 444  SER B CB  1 
ATOM   7038  O OG  . SER B 1 448 ? 33.513  18.516  14.733  1.00 67.98  ? 444  SER B OG  1 
ATOM   7039  N N   . ALA B 1 449 ? 36.304  17.297  15.697  1.00 65.80  ? 445  ALA B N   1 
ATOM   7040  C CA  . ALA B 1 449 ? 37.578  17.069  15.017  1.00 66.22  ? 445  ALA B CA  1 
ATOM   7041  C C   . ALA B 1 449 ? 38.614  16.413  15.923  1.00 65.33  ? 445  ALA B C   1 
ATOM   7042  O O   . ALA B 1 449 ? 39.624  15.883  15.446  1.00 65.82  ? 445  ALA B O   1 
ATOM   7043  C CB  . ALA B 1 449 ? 38.118  18.376  14.455  1.00 67.18  ? 445  ALA B CB  1 
ATOM   7044  N N   . MET B 1 450 ? 38.353  16.450  17.227  1.00 64.33  ? 446  MET B N   1 
ATOM   7045  C CA  . MET B 1 450 ? 39.286  15.946  18.226  1.00 63.69  ? 446  MET B CA  1 
ATOM   7046  C C   . MET B 1 450 ? 39.249  14.422  18.307  1.00 63.32  ? 446  MET B C   1 
ATOM   7047  O O   . MET B 1 450 ? 38.218  13.836  18.633  1.00 62.95  ? 446  MET B O   1 
ATOM   7048  C CB  . MET B 1 450 ? 38.975  16.568  19.589  1.00 63.10  ? 446  MET B CB  1 
ATOM   7049  C CG  . MET B 1 450 ? 40.182  16.748  20.481  1.00 63.35  ? 446  MET B CG  1 
ATOM   7050  S SD  . MET B 1 450 ? 41.570  17.582  19.684  1.00 64.60  ? 446  MET B SD  1 
ATOM   7051  C CE  . MET B 1 450 ? 40.858  19.178  19.293  1.00 64.87  ? 446  MET B CE  1 
ATOM   7052  N N   . GLN B 1 451 ? 40.379  13.790  18.006  1.00 63.63  ? 447  GLN B N   1 
ATOM   7053  C CA  . GLN B 1 451 ? 40.478  12.332  18.010  1.00 63.50  ? 447  GLN B CA  1 
ATOM   7054  C C   . GLN B 1 451 ? 40.678  11.799  19.423  1.00 62.86  ? 447  GLN B C   1 
ATOM   7055  O O   . GLN B 1 451 ? 41.786  11.420  19.805  1.00 63.38  ? 447  GLN B O   1 
ATOM   7056  C CB  . GLN B 1 451 ? 41.617  11.873  17.100  1.00 64.61  ? 447  GLN B CB  1 
ATOM   7057  C CG  . GLN B 1 451 ? 41.382  12.138  15.623  1.00 65.72  ? 447  GLN B CG  1 
ATOM   7058  C CD  . GLN B 1 451 ? 42.596  11.829  14.777  1.00 67.39  ? 447  GLN B CD  1 
ATOM   7059  O OE1 . GLN B 1 451 ? 43.733  11.905  15.246  1.00 68.03  ? 447  GLN B OE1 1 
ATOM   7060  N NE2 . GLN B 1 451 ? 42.362  11.483  13.517  1.00 68.61  ? 447  GLN B NE2 1 
ATOM   7061  N N   . ALA B 1 452 ? 39.594  11.768  20.193  1.00 62.07  ? 448  ALA B N   1 
ATOM   7062  C CA  . ALA B 1 452 ? 39.651  11.381  21.599  1.00 61.70  ? 448  ALA B CA  1 
ATOM   7063  C C   . ALA B 1 452 ? 38.507  10.454  21.986  1.00 61.16  ? 448  ALA B C   1 
ATOM   7064  O O   . ALA B 1 452 ? 37.517  10.336  21.264  1.00 60.95  ? 448  ALA B O   1 
ATOM   7065  C CB  . ALA B 1 452 ? 39.652  12.621  22.487  1.00 61.70  ? 448  ALA B CB  1 
ATOM   7066  N N   . GLY B 1 453 ? 38.662  9.794   23.131  1.00 61.15  ? 449  GLY B N   1 
ATOM   7067  C CA  . GLY B 1 453 ? 37.613  8.954   23.693  1.00 60.82  ? 449  GLY B CA  1 
ATOM   7068  C C   . GLY B 1 453 ? 36.487  9.789   24.271  1.00 60.59  ? 449  GLY B C   1 
ATOM   7069  O O   . GLY B 1 453 ? 35.327  9.625   23.891  1.00 60.42  ? 449  GLY B O   1 
ATOM   7070  N N   . THR B 1 454 ? 36.830  10.681  25.198  1.00 60.79  ? 450  THR B N   1 
ATOM   7071  C CA  . THR B 1 454 ? 35.855  11.599  25.787  1.00 60.85  ? 450  THR B CA  1 
ATOM   7072  C C   . THR B 1 454 ? 36.293  13.049  25.593  1.00 60.87  ? 450  THR B C   1 
ATOM   7073  O O   . THR B 1 454 ? 37.478  13.367  25.707  1.00 61.08  ? 450  THR B O   1 
ATOM   7074  C CB  . THR B 1 454 ? 35.611  11.339  27.299  1.00 61.41  ? 450  THR B CB  1 
ATOM   7075  O OG1 . THR B 1 454 ? 36.574  12.060  28.077  1.00 62.12  ? 450  THR B OG1 1 
ATOM   7076  C CG2 . THR B 1 454 ? 35.676  9.848   27.640  1.00 61.48  ? 450  THR B CG2 1 
ATOM   7077  N N   . VAL B 1 455 ? 35.327  13.917  25.299  1.00 60.84  ? 451  VAL B N   1 
ATOM   7078  C CA  . VAL B 1 455 ? 35.579  15.345  25.104  1.00 60.86  ? 451  VAL B CA  1 
ATOM   7079  C C   . VAL B 1 455 ? 34.676  16.171  26.029  1.00 61.40  ? 451  VAL B C   1 
ATOM   7080  O O   . VAL B 1 455 ? 33.449  16.103  25.936  1.00 61.59  ? 451  VAL B O   1 
ATOM   7081  C CB  . VAL B 1 455 ? 35.376  15.765  23.621  1.00 60.70  ? 451  VAL B CB  1 
ATOM   7082  C CG1 . VAL B 1 455 ? 35.555  17.264  23.448  1.00 60.99  ? 451  VAL B CG1 1 
ATOM   7083  C CG2 . VAL B 1 455 ? 36.339  15.017  22.709  1.00 60.40  ? 451  VAL B CG2 1 
ATOM   7084  N N   . TRP B 1 456 ? 35.297  16.938  26.922  1.00 61.80  ? 452  TRP B N   1 
ATOM   7085  C CA  . TRP B 1 456 ? 34.572  17.778  27.872  1.00 62.66  ? 452  TRP B CA  1 
ATOM   7086  C C   . TRP B 1 456 ? 34.474  19.210  27.350  1.00 62.83  ? 452  TRP B C   1 
ATOM   7087  O O   . TRP B 1 456 ? 35.468  19.777  26.899  1.00 62.60  ? 452  TRP B O   1 
ATOM   7088  C CB  . TRP B 1 456 ? 35.267  17.786  29.238  1.00 63.33  ? 452  TRP B CB  1 
ATOM   7089  C CG  . TRP B 1 456 ? 35.607  16.430  29.812  1.00 63.83  ? 452  TRP B CG  1 
ATOM   7090  C CD1 . TRP B 1 456 ? 36.688  15.653  29.499  1.00 63.79  ? 452  TRP B CD1 1 
ATOM   7091  C CD2 . TRP B 1 456 ? 34.884  15.717  30.825  1.00 65.11  ? 452  TRP B CD2 1 
ATOM   7092  N NE1 . TRP B 1 456 ? 36.675  14.497  30.240  1.00 64.46  ? 452  TRP B NE1 1 
ATOM   7093  C CE2 . TRP B 1 456 ? 35.579  14.510  31.063  1.00 65.40  ? 452  TRP B CE2 1 
ATOM   7094  C CE3 . TRP B 1 456 ? 33.715  15.979  31.554  1.00 66.46  ? 452  TRP B CE3 1 
ATOM   7095  C CZ2 . TRP B 1 456 ? 35.140  13.561  31.999  1.00 66.56  ? 452  TRP B CZ2 1 
ATOM   7096  C CZ3 . TRP B 1 456 ? 33.276  15.032  32.485  1.00 67.51  ? 452  TRP B CZ3 1 
ATOM   7097  C CH2 . TRP B 1 456 ? 33.990  13.840  32.697  1.00 67.50  ? 452  TRP B CH2 1 
ATOM   7098  N N   . ILE B 1 457 ? 33.280  19.791  27.412  1.00 63.50  ? 453  ILE B N   1 
ATOM   7099  C CA  . ILE B 1 457 ? 33.080  21.180  26.995  1.00 63.95  ? 453  ILE B CA  1 
ATOM   7100  C C   . ILE B 1 457 ? 32.751  22.059  28.199  1.00 65.12  ? 453  ILE B C   1 
ATOM   7101  O O   . ILE B 1 457 ? 31.732  21.864  28.859  1.00 65.93  ? 453  ILE B O   1 
ATOM   7102  C CB  . ILE B 1 457 ? 31.987  21.315  25.903  1.00 64.25  ? 453  ILE B CB  1 
ATOM   7103  C CG1 . ILE B 1 457 ? 32.382  20.515  24.658  1.00 63.29  ? 453  ILE B CG1 1 
ATOM   7104  C CG2 . ILE B 1 457 ? 31.745  22.789  25.554  1.00 64.82  ? 453  ILE B CG2 1 
ATOM   7105  C CD1 . ILE B 1 457 ? 31.331  20.481  23.566  1.00 63.71  ? 453  ILE B CD1 1 
ATOM   7106  N N   . ASN B 1 458 ? 33.633  23.021  28.466  1.00 65.46  ? 454  ASN B N   1 
ATOM   7107  C CA  . ASN B 1 458 ? 33.509  23.966  29.584  1.00 66.83  ? 454  ASN B CA  1 
ATOM   7108  C C   . ASN B 1 458 ? 33.502  23.321  30.978  1.00 67.82  ? 454  ASN B C   1 
ATOM   7109  O O   . ASN B 1 458 ? 32.847  23.823  31.899  1.00 69.13  ? 454  ASN B O   1 
ATOM   7110  C CB  . ASN B 1 458 ? 32.291  24.890  29.396  1.00 67.80  ? 454  ASN B CB  1 
ATOM   7111  C CG  . ASN B 1 458 ? 32.501  25.926  28.305  1.00 67.38  ? 454  ASN B CG  1 
ATOM   7112  O OD1 . ASN B 1 458 ? 33.527  26.603  28.260  1.00 66.87  ? 454  ASN B OD1 1 
ATOM   7113  N ND2 . ASN B 1 458 ? 31.515  26.067  27.430  1.00 67.58  ? 454  ASN B ND2 1 
ATOM   7114  N N   . CYS B 1 459 ? 34.244  22.220  31.126  1.00 67.56  ? 455  CYS B N   1 
ATOM   7115  C CA  . CYS B 1 459 ? 34.268  21.440  32.370  1.00 68.84  ? 455  CYS B CA  1 
ATOM   7116  C C   . CYS B 1 459 ? 35.393  20.402  32.403  1.00 68.59  ? 455  CYS B C   1 
ATOM   7117  O O   . CYS B 1 459 ? 36.116  20.231  31.420  1.00 67.56  ? 455  CYS B O   1 
ATOM   7118  C CB  . CYS B 1 459 ? 32.924  20.736  32.580  1.00 69.37  ? 455  CYS B CB  1 
ATOM   7119  S SG  . CYS B 1 459 ? 32.449  19.640  31.226  1.00 67.94  ? 455  CYS B SG  1 
ATOM   7120  N N   . TYR B 1 460 ? 35.531  19.717  33.541  1.00 70.02  ? 456  TYR B N   1 
ATOM   7121  C CA  . TYR B 1 460 ? 36.495  18.624  33.696  1.00 70.27  ? 456  TYR B CA  1 
ATOM   7122  C C   . TYR B 1 460 ? 36.082  17.652  34.805  1.00 71.50  ? 456  TYR B C   1 
ATOM   7123  O O   . TYR B 1 460 ? 36.512  16.495  34.831  1.00 71.38  ? 456  TYR B O   1 
ATOM   7124  C CB  . TYR B 1 460 ? 37.896  19.175  33.975  1.00 70.88  ? 456  TYR B CB  1 
ATOM   7125  C CG  . TYR B 1 460 ? 39.003  18.335  33.379  1.00 70.95  ? 456  TYR B CG  1 
ATOM   7126  C CD1 . TYR B 1 460 ? 39.353  18.467  32.035  1.00 70.12  ? 456  TYR B CD1 1 
ATOM   7127  C CD2 . TYR B 1 460 ? 39.698  17.404  34.152  1.00 72.43  ? 456  TYR B CD2 1 
ATOM   7128  C CE1 . TYR B 1 460 ? 40.367  17.699  31.473  1.00 70.14  ? 456  TYR B CE1 1 
ATOM   7129  C CE2 . TYR B 1 460 ? 40.719  16.631  33.600  1.00 72.48  ? 456  TYR B CE2 1 
ATOM   7130  C CZ  . TYR B 1 460 ? 41.046  16.785  32.259  1.00 71.28  ? 456  TYR B CZ  1 
ATOM   7131  O OH  . TYR B 1 460 ? 42.048  16.030  31.698  1.00 71.39  ? 456  TYR B OH  1 
ATOM   7132  N N   . GLY B 1 482 ? 29.049  3.797   31.587  1.00 71.33  ? 478  GLY B N   1 
ATOM   7133  C CA  . GLY B 1 482 ? 27.603  3.842   31.219  1.00 71.71  ? 478  GLY B CA  1 
ATOM   7134  C C   . GLY B 1 482 ? 27.122  2.548   30.590  1.00 71.45  ? 478  GLY B C   1 
ATOM   7135  O O   . GLY B 1 482 ? 27.593  1.463   30.948  1.00 71.54  ? 478  GLY B O   1 
ATOM   7136  N N   . GLU B 1 483 ? 26.180  2.672   29.652  1.00 71.30  ? 479  GLU B N   1 
ATOM   7137  C CA  . GLU B 1 483 ? 25.626  1.534   28.902  1.00 71.10  ? 479  GLU B CA  1 
ATOM   7138  C C   . GLU B 1 483 ? 26.708  0.762   28.136  1.00 69.89  ? 479  GLU B C   1 
ATOM   7139  O O   . GLU B 1 483 ? 26.727  -0.473  28.150  1.00 70.04  ? 479  GLU B O   1 
ATOM   7140  C CB  . GLU B 1 483 ? 24.502  2.011   27.958  1.00 71.36  ? 479  GLU B CB  1 
ATOM   7141  C CG  . GLU B 1 483 ? 24.278  1.180   26.672  1.00 70.97  ? 479  GLU B CG  1 
ATOM   7142  C CD  . GLU B 1 483 ? 23.278  0.041   26.834  1.00 71.89  ? 479  GLU B CD  1 
ATOM   7143  O OE1 . GLU B 1 483 ? 23.550  -0.904  27.605  1.00 72.05  ? 479  GLU B OE1 1 
ATOM   7144  O OE2 . GLU B 1 483 ? 22.222  0.082   26.166  1.00 72.61  ? 479  GLU B OE2 1 
ATOM   7145  N N   . PHE B 1 484 ? 27.610  1.495   27.484  1.00 68.88  ? 480  PHE B N   1 
ATOM   7146  C CA  . PHE B 1 484 ? 28.683  0.882   26.704  1.00 67.88  ? 480  PHE B CA  1 
ATOM   7147  C C   . PHE B 1 484 ? 29.725  0.198   27.594  1.00 67.88  ? 480  PHE B C   1 
ATOM   7148  O O   . PHE B 1 484 ? 30.564  -0.566  27.101  1.00 67.58  ? 480  PHE B O   1 
ATOM   7149  C CB  . PHE B 1 484 ? 29.348  1.919   25.792  1.00 67.32  ? 480  PHE B CB  1 
ATOM   7150  C CG  . PHE B 1 484 ? 28.404  2.567   24.812  1.00 67.75  ? 480  PHE B CG  1 
ATOM   7151  C CD1 . PHE B 1 484 ? 28.073  3.911   24.932  1.00 68.32  ? 480  PHE B CD1 1 
ATOM   7152  C CD2 . PHE B 1 484 ? 27.848  1.833   23.766  1.00 68.13  ? 480  PHE B CD2 1 
ATOM   7153  C CE1 . PHE B 1 484 ? 27.203  4.518   24.024  1.00 68.93  ? 480  PHE B CE1 1 
ATOM   7154  C CE2 . PHE B 1 484 ? 26.974  2.431   22.854  1.00 68.69  ? 480  PHE B CE2 1 
ATOM   7155  C CZ  . PHE B 1 484 ? 26.652  3.776   22.983  1.00 69.17  ? 480  PHE B CZ  1 
ATOM   7156  N N   . GLY B 1 485 ? 29.656  0.472   28.898  1.00 68.34  ? 481  GLY B N   1 
ATOM   7157  C CA  . GLY B 1 485 ? 30.571  -0.107  29.882  1.00 68.51  ? 481  GLY B CA  1 
ATOM   7158  C C   . GLY B 1 485 ? 30.436  -1.610  30.050  1.00 68.56  ? 481  GLY B C   1 
ATOM   7159  O O   . GLY B 1 485 ? 31.435  -2.319  30.147  1.00 68.72  ? 481  GLY B O   1 
ATOM   7160  N N   . LEU B 1 486 ? 29.198  -2.097  30.067  1.00 68.55  ? 482  LEU B N   1 
ATOM   7161  C CA  . LEU B 1 486 ? 28.921  -3.516  30.316  1.00 68.74  ? 482  LEU B CA  1 
ATOM   7162  C C   . LEU B 1 486 ? 28.918  -4.393  29.058  1.00 67.57  ? 482  LEU B C   1 
ATOM   7163  O O   . LEU B 1 486 ? 28.694  -5.602  29.142  1.00 67.93  ? 482  LEU B O   1 
ATOM   7164  C CB  . LEU B 1 486 ? 27.611  -3.680  31.107  1.00 69.86  ? 482  LEU B CB  1 
ATOM   7165  C CG  . LEU B 1 486 ? 26.320  -3.051  30.575  1.00 69.53  ? 482  LEU B CG  1 
ATOM   7166  C CD1 . LEU B 1 486 ? 25.570  -4.004  29.654  1.00 69.21  ? 482  LEU B CD1 1 
ATOM   7167  C CD2 . LEU B 1 486 ? 25.439  -2.645  31.731  1.00 70.94  ? 482  LEU B CD2 1 
ATOM   7168  N N   . ARG B 1 487 ? 29.169  -3.786  27.900  1.00 66.26  ? 483  ARG B N   1 
ATOM   7169  C CA  . ARG B 1 487 ? 29.241  -4.530  26.638  1.00 65.33  ? 483  ARG B CA  1 
ATOM   7170  C C   . ARG B 1 487 ? 30.481  -5.421  26.565  1.00 64.96  ? 483  ARG B C   1 
ATOM   7171  O O   . ARG B 1 487 ? 30.476  -6.443  25.879  1.00 64.85  ? 483  ARG B O   1 
ATOM   7172  C CB  . ARG B 1 487 ? 29.194  -3.583  25.432  1.00 64.70  ? 483  ARG B CB  1 
ATOM   7173  C CG  . ARG B 1 487 ? 27.883  -2.830  25.302  1.00 65.61  ? 483  ARG B CG  1 
ATOM   7174  C CD  . ARG B 1 487 ? 27.708  -2.195  23.933  1.00 66.24  ? 483  ARG B CD  1 
ATOM   7175  N NE  . ARG B 1 487 ? 26.420  -1.507  23.841  1.00 67.78  ? 483  ARG B NE  1 
ATOM   7176  C CZ  . ARG B 1 487 ? 25.922  -0.965  22.732  1.00 68.35  ? 483  ARG B CZ  1 
ATOM   7177  N NH1 . ARG B 1 487 ? 26.599  -1.021  21.591  1.00 68.15  ? 483  ARG B NH1 1 
ATOM   7178  N NH2 . ARG B 1 487 ? 24.739  -0.361  22.766  1.00 69.24  ? 483  ARG B NH2 1 
ATOM   7179  N N   . GLU B 1 488 ? 31.532  -5.030  27.283  1.00 64.83  ? 484  GLU B N   1 
ATOM   7180  C CA  . GLU B 1 488 ? 32.791  -5.775  27.301  1.00 64.74  ? 484  GLU B CA  1 
ATOM   7181  C C   . GLU B 1 488 ? 32.779  -6.956  28.273  1.00 65.37  ? 484  GLU B C   1 
ATOM   7182  O O   . GLU B 1 488 ? 33.678  -7.797  28.238  1.00 65.90  ? 484  GLU B O   1 
ATOM   7183  C CB  . GLU B 1 488 ? 33.974  -4.841  27.607  1.00 65.06  ? 484  GLU B CB  1 
ATOM   7184  C CG  . GLU B 1 488 ? 34.047  -4.331  29.048  1.00 66.28  ? 484  GLU B CG  1 
ATOM   7185  C CD  . GLU B 1 488 ? 35.319  -3.547  29.341  1.00 67.21  ? 484  GLU B CD  1 
ATOM   7186  O OE1 . GLU B 1 488 ? 35.495  -2.451  28.765  1.00 66.95  ? 484  GLU B OE1 1 
ATOM   7187  O OE2 . GLU B 1 488 ? 36.138  -4.021  30.157  1.00 68.34  ? 484  GLU B OE2 1 
ATOM   7188  N N   . TYR B 1 489 ? 31.766  -7.014  29.135  1.00 65.35  ? 485  TYR B N   1 
ATOM   7189  C CA  . TYR B 1 489 ? 31.691  -8.051  30.165  1.00 66.17  ? 485  TYR B CA  1 
ATOM   7190  C C   . TYR B 1 489 ? 30.653  -9.138  29.892  1.00 65.90  ? 485  TYR B C   1 
ATOM   7191  O O   . TYR B 1 489 ? 30.499  -10.069 30.681  1.00 67.07  ? 485  TYR B O   1 
ATOM   7192  C CB  . TYR B 1 489 ? 31.484  -7.426  31.547  1.00 67.29  ? 485  TYR B CB  1 
ATOM   7193  C CG  . TYR B 1 489 ? 32.760  -6.895  32.158  1.00 67.66  ? 485  TYR B CG  1 
ATOM   7194  C CD1 . TYR B 1 489 ? 33.743  -7.764  32.632  1.00 68.78  ? 485  TYR B CD1 1 
ATOM   7195  C CD2 . TYR B 1 489 ? 32.988  -5.526  32.263  1.00 66.94  ? 485  TYR B CD2 1 
ATOM   7196  C CE1 . TYR B 1 489 ? 34.921  -7.284  33.193  1.00 69.75  ? 485  TYR B CE1 1 
ATOM   7197  C CE2 . TYR B 1 489 ? 34.163  -5.035  32.822  1.00 67.89  ? 485  TYR B CE2 1 
ATOM   7198  C CZ  . TYR B 1 489 ? 35.125  -5.920  33.285  1.00 69.23  ? 485  TYR B CZ  1 
ATOM   7199  O OH  . TYR B 1 489 ? 36.288  -5.442  33.841  1.00 70.32  ? 485  TYR B OH  1 
ATOM   7200  N N   . SER B 1 490 ? 29.956  -9.020  28.766  1.00 64.50  ? 486  SER B N   1 
ATOM   7201  C CA  . SER B 1 490 ? 29.003  -10.036 28.325  1.00 64.21  ? 486  SER B CA  1 
ATOM   7202  C C   . SER B 1 490 ? 29.294  -10.465 26.889  1.00 63.06  ? 486  SER B C   1 
ATOM   7203  O O   . SER B 1 490 ? 29.811  -9.676  26.097  1.00 62.36  ? 486  SER B O   1 
ATOM   7204  C CB  . SER B 1 490 ? 27.573  -9.505  28.433  1.00 64.28  ? 486  SER B CB  1 
ATOM   7205  O OG  . SER B 1 490 ? 27.418  -8.311  27.687  1.00 63.44  ? 486  SER B OG  1 
ATOM   7206  N N   . GLU B 1 491 ? 28.970  -11.712 26.558  1.00 62.97  ? 487  GLU B N   1 
ATOM   7207  C CA  . GLU B 1 491 ? 29.123  -12.195 25.183  1.00 62.13  ? 487  GLU B CA  1 
ATOM   7208  C C   . GLU B 1 491 ? 27.795  -12.571 24.525  1.00 61.67  ? 487  GLU B C   1 
ATOM   7209  O O   . GLU B 1 491 ? 26.939  -13.206 25.144  1.00 62.21  ? 487  GLU B O   1 
ATOM   7210  C CB  . GLU B 1 491 ? 30.145  -13.335 25.088  1.00 62.75  ? 487  GLU B CB  1 
ATOM   7211  C CG  . GLU B 1 491 ? 29.839  -14.575 25.918  1.00 63.99  ? 487  GLU B CG  1 
ATOM   7212  C CD  . GLU B 1 491 ? 30.892  -15.657 25.750  1.00 65.17  ? 487  GLU B CD  1 
ATOM   7213  O OE1 . GLU B 1 491 ? 31.737  -15.537 24.835  1.00 64.91  ? 487  GLU B OE1 1 
ATOM   7214  O OE2 . GLU B 1 491 ? 30.876  -16.630 26.534  1.00 66.41  ? 487  GLU B OE2 1 
ATOM   7215  N N   . VAL B 1 492 ? 27.643  -12.171 23.266  1.00 60.72  ? 488  VAL B N   1 
ATOM   7216  C CA  . VAL B 1 492 ? 26.435  -12.448 22.495  1.00 60.46  ? 488  VAL B CA  1 
ATOM   7217  C C   . VAL B 1 492 ? 26.385  -13.915 22.082  1.00 60.60  ? 488  VAL B C   1 
ATOM   7218  O O   . VAL B 1 492 ? 27.368  -14.475 21.591  1.00 60.55  ? 488  VAL B O   1 
ATOM   7219  C CB  . VAL B 1 492 ? 26.336  -11.551 21.232  1.00 60.12  ? 488  VAL B CB  1 
ATOM   7220  C CG1 . VAL B 1 492 ? 24.996  -11.749 20.522  1.00 60.47  ? 488  VAL B CG1 1 
ATOM   7221  C CG2 . VAL B 1 492 ? 26.532  -10.081 21.595  1.00 59.90  ? 488  VAL B CG2 1 
ATOM   7222  N N   . LYS B 1 493 ? 25.228  -14.527 22.297  1.00 60.84  ? 489  LYS B N   1 
ATOM   7223  C CA  . LYS B 1 493 ? 24.971  -15.889 21.864  1.00 61.01  ? 489  LYS B CA  1 
ATOM   7224  C C   . LYS B 1 493 ? 23.695  -15.895 21.029  1.00 61.13  ? 489  LYS B C   1 
ATOM   7225  O O   . LYS B 1 493 ? 22.587  -15.893 21.571  1.00 61.69  ? 489  LYS B O   1 
ATOM   7226  C CB  . LYS B 1 493 ? 24.839  -16.806 23.079  1.00 61.71  ? 489  LYS B CB  1 
ATOM   7227  C CG  . LYS B 1 493 ? 24.581  -18.261 22.757  1.00 62.15  ? 489  LYS B CG  1 
ATOM   7228  C CD  . LYS B 1 493 ? 24.672  -19.077 24.018  1.00 63.13  ? 489  LYS B CD  1 
ATOM   7229  C CE  . LYS B 1 493 ? 23.978  -20.402 23.858  1.00 63.98  ? 489  LYS B CE  1 
ATOM   7230  N NZ  . LYS B 1 493 ? 23.750  -21.033 25.186  1.00 64.97  ? 489  LYS B NZ  1 
ATOM   7231  N N   . THR B 1 494 ? 23.861  -15.885 19.709  1.00 60.73  ? 490  THR B N   1 
ATOM   7232  C CA  . THR B 1 494 ? 22.725  -15.822 18.788  1.00 61.07  ? 490  THR B CA  1 
ATOM   7233  C C   . THR B 1 494 ? 22.172  -17.215 18.466  1.00 61.61  ? 490  THR B C   1 
ATOM   7234  O O   . THR B 1 494 ? 22.901  -18.089 18.007  1.00 61.60  ? 490  THR B O   1 
ATOM   7235  C CB  . THR B 1 494 ? 23.050  -14.991 17.501  1.00 60.97  ? 490  THR B CB  1 
ATOM   7236  O OG1 . THR B 1 494 ? 22.206  -15.405 16.421  1.00 61.83  ? 490  THR B OG1 1 
ATOM   7237  C CG2 . THR B 1 494 ? 24.504  -15.143 17.089  1.00 60.61  ? 490  THR B CG2 1 
ATOM   7238  N N   . VAL B 1 495 ? 20.881  -17.409 18.730  1.00 62.15  ? 491  VAL B N   1 
ATOM   7239  C CA  . VAL B 1 495 ? 20.208  -18.689 18.498  1.00 62.77  ? 491  VAL B CA  1 
ATOM   7240  C C   . VAL B 1 495 ? 19.112  -18.533 17.440  1.00 63.72  ? 491  VAL B C   1 
ATOM   7241  O O   . VAL B 1 495 ? 18.311  -17.599 17.509  1.00 64.09  ? 491  VAL B O   1 
ATOM   7242  C CB  . VAL B 1 495 ? 19.608  -19.257 19.811  1.00 63.16  ? 491  VAL B CB  1 
ATOM   7243  C CG1 . VAL B 1 495 ? 18.863  -20.563 19.556  1.00 64.04  ? 491  VAL B CG1 1 
ATOM   7244  C CG2 . VAL B 1 495 ? 20.701  -19.464 20.856  1.00 62.61  ? 491  VAL B CG2 1 
ATOM   7245  N N   . THR B 1 496 ? 19.089  -19.445 16.466  1.00 64.19  ? 492  THR B N   1 
ATOM   7246  C CA  . THR B 1 496 ? 18.117  -19.398 15.360  1.00 65.46  ? 492  THR B CA  1 
ATOM   7247  C C   . THR B 1 496 ? 17.220  -20.645 15.334  1.00 66.41  ? 492  THR B C   1 
ATOM   7248  O O   . THR B 1 496 ? 17.715  -21.774 15.391  1.00 66.15  ? 492  THR B O   1 
ATOM   7249  C CB  . THR B 1 496 ? 18.807  -19.226 13.973  1.00 65.68  ? 492  THR B CB  1 
ATOM   7250  O OG1 . THR B 1 496 ? 19.094  -20.507 13.403  1.00 66.37  ? 492  THR B OG1 1 
ATOM   7251  C CG2 . THR B 1 496 ? 20.098  -18.415 14.079  1.00 64.51  ? 492  THR B CG2 1 
ATOM   7252  N N   . VAL B 1 497 ? 15.908  -20.433 15.238  1.00 67.60  ? 493  VAL B N   1 
ATOM   7253  C CA  . VAL B 1 497 ? 14.937  -21.531 15.257  1.00 68.74  ? 493  VAL B CA  1 
ATOM   7254  C C   . VAL B 1 497 ? 14.237  -21.682 13.907  1.00 70.53  ? 493  VAL B C   1 
ATOM   7255  O O   . VAL B 1 497 ? 13.887  -20.689 13.268  1.00 71.28  ? 493  VAL B O   1 
ATOM   7256  C CB  . VAL B 1 497 ? 13.866  -21.341 16.362  1.00 69.32  ? 493  VAL B CB  1 
ATOM   7257  C CG1 . VAL B 1 497 ? 13.131  -22.646 16.623  1.00 70.22  ? 493  VAL B CG1 1 
ATOM   7258  C CG2 . VAL B 1 497 ? 14.494  -20.840 17.650  1.00 67.98  ? 493  VAL B CG2 1 
ATOM   7259  N N   . LYS B 1 498 ? 14.041  -22.930 13.484  1.00 71.34  ? 494  LYS B N   1 
ATOM   7260  C CA  . LYS B 1 498 ? 13.300  -23.237 12.264  1.00 73.42  ? 494  LYS B CA  1 
ATOM   7261  C C   . LYS B 1 498 ? 11.804  -23.315 12.562  1.00 75.26  ? 494  LYS B C   1 
ATOM   7262  O O   . LYS B 1 498 ? 11.358  -24.175 13.326  1.00 75.30  ? 494  LYS B O   1 
ATOM   7263  C CB  . LYS B 1 498 ? 13.798  -24.554 11.654  1.00 73.57  ? 494  LYS B CB  1 
ATOM   7264  C CG  . LYS B 1 498 ? 13.081  -25.004 10.379  1.00 75.72  ? 494  LYS B CG  1 
ATOM   7265  C CD  . LYS B 1 498 ? 13.606  -24.286 9.143   1.00 76.31  ? 494  LYS B CD  1 
ATOM   7266  C CE  . LYS B 1 498 ? 12.946  -24.800 7.877   1.00 78.68  ? 494  LYS B CE  1 
ATOM   7267  N NZ  . LYS B 1 498 ? 11.505  -24.442 7.817   1.00 80.80  ? 494  LYS B NZ  1 
ATOM   7268  N N   . ILE B 1 499 ? 11.042  -22.407 11.955  1.00 77.04  ? 495  ILE B N   1 
ATOM   7269  C CA  . ILE B 1 499 ? 9.588   -22.329 12.148  1.00 79.32  ? 495  ILE B CA  1 
ATOM   7270  C C   . ILE B 1 499 ? 8.811   -22.892 10.948  1.00 81.95  ? 495  ILE B C   1 
ATOM   7271  O O   . ILE B 1 499 ? 9.282   -22.800 9.812   1.00 82.44  ? 495  ILE B O   1 
ATOM   7272  C CB  . ILE B 1 499 ? 9.120   -20.878 12.463  1.00 79.83  ? 495  ILE B CB  1 
ATOM   7273  C CG1 . ILE B 1 499 ? 9.743   -19.874 11.485  1.00 79.81  ? 495  ILE B CG1 1 
ATOM   7274  C CG2 . ILE B 1 499 ? 9.449   -20.518 13.909  1.00 78.07  ? 495  ILE B CG2 1 
ATOM   7275  C CD1 . ILE B 1 499 ? 9.188   -18.464 11.583  1.00 80.94  ? 495  ILE B CD1 1 
ATOM   7276  N N   . PRO B 1 500 ? 7.622   -23.483 11.200  1.00 83.90  ? 496  PRO B N   1 
ATOM   7277  C CA  . PRO B 1 500 ? 6.801   -24.101 10.150  1.00 86.63  ? 496  PRO B CA  1 
ATOM   7278  C C   . PRO B 1 500 ? 6.381   -23.140 9.036   1.00 88.96  ? 496  PRO B C   1 
ATOM   7279  O O   . PRO B 1 500 ? 6.407   -23.515 7.863   1.00 90.43  ? 496  PRO B O   1 
ATOM   7280  C CB  . PRO B 1 500 ? 5.571   -24.597 10.919  1.00 88.10  ? 496  PRO B CB  1 
ATOM   7281  C CG  . PRO B 1 500 ? 6.066   -24.814 12.295  1.00 85.75  ? 496  PRO B CG  1 
ATOM   7282  C CD  . PRO B 1 500 ? 7.030   -23.697 12.533  1.00 83.72  ? 496  PRO B CD  1 
ATOM   7283  N N   . GLN B 1 501 ? 5.992   -21.922 9.407   1.00 89.57  ? 497  GLN B N   1 
ATOM   7284  C CA  . GLN B 1 501 ? 5.645   -20.882 8.441   1.00 91.87  ? 497  GLN B CA  1 
ATOM   7285  C C   . GLN B 1 501 ? 5.911   -19.516 9.054   1.00 90.88  ? 497  GLN B C   1 
ATOM   7286  O O   . GLN B 1 501 ? 5.549   -19.269 10.206  1.00 90.31  ? 497  GLN B O   1 
ATOM   7287  C CB  . GLN B 1 501 ? 4.178   -20.991 8.010   1.00 95.59  ? 497  GLN B CB  1 
ATOM   7288  C CG  . GLN B 1 501 ? 3.799   -20.073 6.846   1.00 98.63  ? 497  GLN B CG  1 
ATOM   7289  C CD  . GLN B 1 501 ? 2.347   -20.212 6.408   1.00 102.93 ? 497  GLN B CD  1 
ATOM   7290  O OE1 . GLN B 1 501 ? 1.748   -21.284 6.511   1.00 103.90 ? 497  GLN B OE1 1 
ATOM   7291  N NE2 . GLN B 1 501 ? 1.779   -19.123 5.902   1.00 105.61 ? 497  GLN B NE2 1 
ATOM   7292  N N   . LYS B 1 502 ? 6.547   -18.636 8.284   1.00 90.89  ? 498  LYS B N   1 
ATOM   7293  C CA  . LYS B 1 502 ? 6.846   -17.293 8.763   1.00 89.99  ? 498  LYS B CA  1 
ATOM   7294  C C   . LYS B 1 502 ? 5.783   -16.289 8.346   1.00 93.16  ? 498  LYS B C   1 
ATOM   7295  O O   . LYS B 1 502 ? 5.439   -16.178 7.166   1.00 95.72  ? 498  LYS B O   1 
ATOM   7296  C CB  . LYS B 1 502 ? 8.229   -16.818 8.302   1.00 87.99  ? 498  LYS B CB  1 
ATOM   7297  C CG  . LYS B 1 502 ? 8.681   -15.530 8.999   1.00 86.52  ? 498  LYS B CG  1 
ATOM   7298  C CD  . LYS B 1 502 ? 10.059  -15.062 8.560   1.00 84.64  ? 498  LYS B CD  1 
ATOM   7299  C CE  . LYS B 1 502 ? 10.000  -14.215 7.301   1.00 86.68  ? 498  LYS B CE  1 
ATOM   7300  N NZ  . LYS B 1 502 ? 11.318  -13.580 7.025   1.00 84.92  ? 498  LYS B NZ  1 
ATOM   7301  N N   . ASN B 1 503 ? 5.267   -15.574 9.341   1.00 93.23  ? 499  ASN B N   1 
ATOM   7302  C CA  . ASN B 1 503 ? 4.407   -14.420 9.128   1.00 95.95  ? 499  ASN B CA  1 
ATOM   7303  C C   . ASN B 1 503 ? 4.996   -13.226 9.869   1.00 94.06  ? 499  ASN B C   1 
ATOM   7304  O O   . ASN B 1 503 ? 5.567   -13.385 10.949  1.00 91.31  ? 499  ASN B O   1 
ATOM   7305  C CB  . ASN B 1 503 ? 2.981   -14.706 9.603   1.00 98.68  ? 499  ASN B CB  1 
ATOM   7306  C CG  . ASN B 1 503 ? 2.308   -15.820 8.809   1.00 101.09 ? 499  ASN B CG  1 
ATOM   7307  O OD1 . ASN B 1 503 ? 2.211   -15.760 7.581   1.00 103.14 ? 499  ASN B OD1 1 
ATOM   7308  N ND2 . ASN B 1 503 ? 1.834   -16.841 9.514   1.00 101.06 ? 499  ASN B ND2 1 
ATOM   7309  N N   . SER B 1 504 ? 4.863   -12.041 9.277   1.00 95.70  ? 500  SER B N   1 
ATOM   7310  C CA  . SER B 1 504 ? 5.444   -10.814 9.827   1.00 94.17  ? 500  SER B CA  1 
ATOM   7311  C C   . SER B 1 504 ? 4.945   -10.493 11.237  1.00 93.75  ? 500  SER B C   1 
ATOM   7312  O O   . SER B 1 504 ? 3.769   -10.670 11.552  1.00 96.18  ? 500  SER B O   1 
ATOM   7313  C CB  . SER B 1 504 ? 5.197   -9.629  8.885   1.00 96.69  ? 500  SER B CB  1 
ATOM   7314  O OG  . SER B 1 504 ? 3.831   -9.525  8.522   1.00 100.79 ? 500  SER B OG  1 
ATOM   7315  O OXT . SER B 1 504 ? 5.715   -10.063 12.098  1.00 91.08  ? 500  SER B OXT 1 
ATOM   7316  N N   . LEU C 1 12  ? 19.771  21.844  -14.723 1.00 165.27 ? 8    LEU C N   1 
ATOM   7317  C CA  . LEU C 1 12  ? 18.882  22.767  -15.506 1.00 167.23 ? 8    LEU C CA  1 
ATOM   7318  C C   . LEU C 1 12  ? 17.567  22.084  -15.916 1.00 164.63 ? 8    LEU C C   1 
ATOM   7319  O O   . LEU C 1 12  ? 17.213  22.086  -17.097 1.00 167.74 ? 8    LEU C O   1 
ATOM   7320  C CB  . LEU C 1 12  ? 19.626  23.291  -16.753 1.00 173.78 ? 8    LEU C CB  1 
ATOM   7321  C CG  . LEU C 1 12  ? 20.965  24.009  -16.552 1.00 177.65 ? 8    LEU C CG  1 
ATOM   7322  C CD1 . LEU C 1 12  ? 21.812  23.918  -17.814 1.00 183.86 ? 8    LEU C CD1 1 
ATOM   7323  C CD2 . LEU C 1 12  ? 20.766  25.467  -16.133 1.00 178.52 ? 8    LEU C CD2 1 
ATOM   7324  N N   . PRO C 1 13  ? 16.832  21.502  -14.943 1.00 159.36 ? 9    PRO C N   1 
ATOM   7325  C CA  . PRO C 1 13  ? 15.592  20.809  -15.290 1.00 157.17 ? 9    PRO C CA  1 
ATOM   7326  C C   . PRO C 1 13  ? 14.406  21.760  -15.456 1.00 157.60 ? 9    PRO C C   1 
ATOM   7327  O O   . PRO C 1 13  ? 14.358  22.812  -14.814 1.00 157.42 ? 9    PRO C O   1 
ATOM   7328  C CB  . PRO C 1 13  ? 15.369  19.879  -14.099 1.00 151.93 ? 9    PRO C CB  1 
ATOM   7329  C CG  . PRO C 1 13  ? 15.986  20.589  -12.950 1.00 150.93 ? 9    PRO C CG  1 
ATOM   7330  C CD  . PRO C 1 13  ? 17.097  21.455  -13.490 1.00 155.65 ? 9    PRO C CD  1 
ATOM   7331  N N   . SER C 1 14  ? 13.462  21.378  -16.312 1.00 158.42 ? 10   SER C N   1 
ATOM   7332  C CA  . SER C 1 14  ? 12.285  22.195  -16.606 1.00 159.59 ? 10   SER C CA  1 
ATOM   7333  C C   . SER C 1 14  ? 11.009  21.346  -16.647 1.00 157.12 ? 10   SER C C   1 
ATOM   7334  O O   . SER C 1 14  ? 11.071  20.158  -16.976 1.00 156.09 ? 10   SER C O   1 
ATOM   7335  C CB  . SER C 1 14  ? 12.476  22.944  -17.928 1.00 165.52 ? 10   SER C CB  1 
ATOM   7336  O OG  . SER C 1 14  ? 12.771  22.049  -18.984 1.00 167.78 ? 10   SER C OG  1 
ATOM   7337  N N   . PRO C 1 15  ? 9.848   21.954  -16.314 1.00 156.47 ? 11   PRO C N   1 
ATOM   7338  C CA  . PRO C 1 15  ? 8.580   21.218  -16.249 1.00 154.48 ? 11   PRO C CA  1 
ATOM   7339  C C   . PRO C 1 15  ? 8.180   20.611  -17.586 1.00 157.58 ? 11   PRO C C   1 
ATOM   7340  O O   . PRO C 1 15  ? 8.447   21.200  -18.635 1.00 162.26 ? 11   PRO C O   1 
ATOM   7341  C CB  . PRO C 1 15  ? 7.567   22.293  -15.837 1.00 154.86 ? 11   PRO C CB  1 
ATOM   7342  C CG  . PRO C 1 15  ? 8.201   23.585  -16.202 1.00 158.42 ? 11   PRO C CG  1 
ATOM   7343  C CD  . PRO C 1 15  ? 9.662   23.380  -15.987 1.00 157.90 ? 11   PRO C CD  1 
ATOM   7344  N N   . THR C 1 16  ? 7.550   19.439  -17.542 1.00 155.35 ? 12   THR C N   1 
ATOM   7345  C CA  . THR C 1 16  ? 7.105   18.763  -18.758 1.00 158.09 ? 12   THR C CA  1 
ATOM   7346  C C   . THR C 1 16  ? 5.858   19.450  -19.316 1.00 161.28 ? 12   THR C C   1 
ATOM   7347  O O   . THR C 1 16  ? 4.826   19.507  -18.642 1.00 159.40 ? 12   THR C O   1 
ATOM   7348  C CB  . THR C 1 16  ? 6.834   17.255  -18.531 1.00 154.76 ? 12   THR C CB  1 
ATOM   7349  O OG1 . THR C 1 16  ? 5.643   17.084  -17.755 1.00 152.27 ? 12   THR C OG1 1 
ATOM   7350  C CG2 . THR C 1 16  ? 8.011   16.592  -17.820 1.00 151.60 ? 12   THR C CG2 1 
ATOM   7351  N N   . PRO C 1 17  ? 5.956   19.984  -20.548 1.00 166.58 ? 13   PRO C N   1 
ATOM   7352  C CA  . PRO C 1 17  ? 4.848   20.703  -21.172 1.00 170.55 ? 13   PRO C CA  1 
ATOM   7353  C C   . PRO C 1 17  ? 3.683   19.776  -21.496 1.00 170.44 ? 13   PRO C C   1 
ATOM   7354  O O   . PRO C 1 17  ? 3.877   18.564  -21.622 1.00 168.38 ? 13   PRO C O   1 
ATOM   7355  C CB  . PRO C 1 17  ? 5.468   21.244  -22.463 1.00 176.37 ? 13   PRO C CB  1 
ATOM   7356  C CG  . PRO C 1 17  ? 6.570   20.301  -22.773 1.00 175.44 ? 13   PRO C CG  1 
ATOM   7357  C CD  . PRO C 1 17  ? 7.122   19.887  -21.446 1.00 169.60 ? 13   PRO C CD  1 
ATOM   7358  N N   . ASN C 1 18  ? 2.489   20.354  -21.624 1.00 172.93 ? 14   ASN C N   1 
ATOM   7359  C CA  . ASN C 1 18  ? 1.262   19.608  -21.929 1.00 173.71 ? 14   ASN C CA  1 
ATOM   7360  C C   . ASN C 1 18  ? 1.053   18.414  -20.995 1.00 168.27 ? 14   ASN C C   1 
ATOM   7361  O O   . ASN C 1 18  ? 0.814   17.291  -21.448 1.00 168.07 ? 14   ASN C O   1 
ATOM   7362  C CB  . ASN C 1 18  ? 1.238   19.162  -23.400 1.00 178.40 ? 14   ASN C CB  1 
ATOM   7363  C CG  . ASN C 1 18  ? 1.357   20.324  -24.373 1.00 184.63 ? 14   ASN C CG  1 
ATOM   7364  O OD1 . ASN C 1 18  ? 2.210   21.199  -24.222 1.00 185.16 ? 14   ASN C OD1 1 
ATOM   7365  N ND2 . ASN C 1 18  ? 0.503   20.327  -25.388 1.00 189.82 ? 14   ASN C ND2 1 
ATOM   7366  N N   . LEU C 1 19  ? 1.151   18.670  -19.692 1.00 164.18 ? 15   LEU C N   1 
ATOM   7367  C CA  . LEU C 1 19  ? 1.027   17.624  -18.681 1.00 159.15 ? 15   LEU C CA  1 
ATOM   7368  C C   . LEU C 1 19  ? -0.373  17.017  -18.660 1.00 159.65 ? 15   LEU C C   1 
ATOM   7369  O O   . LEU C 1 19  ? -1.365  17.717  -18.449 1.00 161.52 ? 15   LEU C O   1 
ATOM   7370  C CB  . LEU C 1 19  ? 1.394   18.162  -17.292 1.00 155.44 ? 15   LEU C CB  1 
ATOM   7371  C CG  . LEU C 1 19  ? 1.415   17.156  -16.135 1.00 150.43 ? 15   LEU C CG  1 
ATOM   7372  C CD1 . LEU C 1 19  ? 2.751   16.429  -16.052 1.00 147.88 ? 15   LEU C CD1 1 
ATOM   7373  C CD2 . LEU C 1 19  ? 1.103   17.848  -14.821 1.00 148.29 ? 15   LEU C CD2 1 
ATOM   7374  N N   . GLU C 1 20  ? -0.436  15.709  -18.891 1.00 158.27 ? 16   GLU C N   1 
ATOM   7375  C CA  . GLU C 1 20  ? -1.687  14.967  -18.831 1.00 158.66 ? 16   GLU C CA  1 
ATOM   7376  C C   . GLU C 1 20  ? -1.946  14.416  -17.440 1.00 154.11 ? 16   GLU C C   1 
ATOM   7377  O O   . GLU C 1 20  ? -1.041  13.885  -16.792 1.00 150.23 ? 16   GLU C O   1 
ATOM   7378  C CB  . GLU C 1 20  ? -1.676  13.808  -19.825 1.00 159.87 ? 16   GLU C CB  1 
ATOM   7379  C CG  . GLU C 1 20  ? -2.490  14.046  -21.075 1.00 165.72 ? 16   GLU C CG  1 
ATOM   7380  C CD  . GLU C 1 20  ? -3.074  12.764  -21.641 1.00 166.69 ? 16   GLU C CD  1 
ATOM   7381  O OE1 . GLU C 1 20  ? -4.133  12.837  -22.301 1.00 170.91 ? 16   GLU C OE1 1 
ATOM   7382  O OE2 . GLU C 1 20  ? -2.481  11.683  -21.426 1.00 163.20 ? 16   GLU C OE2 1 
ATOM   7383  N N   . ILE C 1 21  ? -3.188  14.544  -16.988 1.00 155.06 ? 17   ILE C N   1 
ATOM   7384  C CA  . ILE C 1 21  ? -3.625  13.887  -15.767 1.00 151.62 ? 17   ILE C CA  1 
ATOM   7385  C C   . ILE C 1 21  ? -4.295  12.573  -16.170 1.00 152.15 ? 17   ILE C C   1 
ATOM   7386  O O   . ILE C 1 21  ? -5.496  12.533  -16.459 1.00 155.27 ? 17   ILE C O   1 
ATOM   7387  C CB  . ILE C 1 21  ? -4.590  14.770  -14.929 1.00 152.57 ? 17   ILE C CB  1 
ATOM   7388  C CG1 . ILE C 1 21  ? -4.128  16.240  -14.891 1.00 153.59 ? 17   ILE C CG1 1 
ATOM   7389  C CG2 . ILE C 1 21  ? -4.778  14.177  -13.530 1.00 148.89 ? 17   ILE C CG2 1 
ATOM   7390  C CD1 . ILE C 1 21  ? -2.774  16.500  -14.224 1.00 150.02 ? 17   ILE C CD1 1 
ATOM   7391  N N   . LYS C 1 22  ? -3.499  11.507  -16.205 1.00 149.31 ? 18   LYS C N   1 
ATOM   7392  C CA  . LYS C 1 22  ? -3.953  10.209  -16.707 1.00 149.70 ? 18   LYS C CA  1 
ATOM   7393  C C   . LYS C 1 22  ? -4.703  9.401   -15.648 1.00 147.64 ? 18   LYS C C   1 
ATOM   7394  O O   . LYS C 1 22  ? -5.600  8.624   -15.980 1.00 149.38 ? 18   LYS C O   1 
ATOM   7395  C CB  . LYS C 1 22  ? -2.765  9.408   -17.259 1.00 147.97 ? 18   LYS C CB  1 
ATOM   7396  C CG  . LYS C 1 22  ? -3.143  8.200   -18.113 1.00 149.23 ? 18   LYS C CG  1 
ATOM   7397  C CD  . LYS C 1 22  ? -1.912  7.577   -18.753 1.00 148.07 ? 18   LYS C CD  1 
ATOM   7398  C CE  . LYS C 1 22  ? -2.220  6.218   -19.361 1.00 148.46 ? 18   LYS C CE  1 
ATOM   7399  N NZ  . LYS C 1 22  ? -2.242  5.136   -18.339 1.00 144.66 ? 18   LYS C NZ  1 
ATOM   7400  N N   . TYR C 1 23  ? -4.341  9.594   -14.381 1.00 144.21 ? 19   TYR C N   1 
ATOM   7401  C CA  . TYR C 1 23  ? -4.907  8.794   -13.294 1.00 142.22 ? 19   TYR C CA  1 
ATOM   7402  C C   . TYR C 1 23  ? -5.911  9.570   -12.446 1.00 143.50 ? 19   TYR C C   1 
ATOM   7403  O O   . TYR C 1 23  ? -5.536  10.386  -11.599 1.00 141.81 ? 19   TYR C O   1 
ATOM   7404  C CB  . TYR C 1 23  ? -3.792  8.168   -12.449 1.00 137.81 ? 19   TYR C CB  1 
ATOM   7405  C CG  . TYR C 1 23  ? -2.800  7.392   -13.287 1.00 136.80 ? 19   TYR C CG  1 
ATOM   7406  C CD1 . TYR C 1 23  ? -3.089  6.100   -13.725 1.00 136.89 ? 19   TYR C CD1 1 
ATOM   7407  C CD2 . TYR C 1 23  ? -1.585  7.960   -13.667 1.00 136.16 ? 19   TYR C CD2 1 
ATOM   7408  C CE1 . TYR C 1 23  ? -2.187  5.387   -14.508 1.00 136.22 ? 19   TYR C CE1 1 
ATOM   7409  C CE2 . TYR C 1 23  ? -0.676  7.256   -14.450 1.00 135.70 ? 19   TYR C CE2 1 
ATOM   7410  C CZ  . TYR C 1 23  ? -0.985  5.972   -14.867 1.00 135.72 ? 19   TYR C CZ  1 
ATOM   7411  O OH  . TYR C 1 23  ? -0.089  5.273   -15.641 1.00 135.66 ? 19   TYR C OH  1 
ATOM   7412  N N   . THR C 1 24  ? -7.192  9.305   -12.701 1.00 146.74 ? 20   THR C N   1 
ATOM   7413  C CA  . THR C 1 24  ? -8.298  10.036  -12.078 1.00 149.12 ? 20   THR C CA  1 
ATOM   7414  C C   . THR C 1 24  ? -9.251  9.130   -11.288 1.00 149.51 ? 20   THR C C   1 
ATOM   7415  O O   . THR C 1 24  ? -10.124 9.621   -10.565 1.00 151.33 ? 20   THR C O   1 
ATOM   7416  C CB  . THR C 1 24  ? -9.121  10.834  -13.128 1.00 154.23 ? 20   THR C CB  1 
ATOM   7417  O OG1 . THR C 1 24  ? -9.614  9.947   -14.140 1.00 156.66 ? 20   THR C OG1 1 
ATOM   7418  C CG2 . THR C 1 24  ? -8.275  11.924  -13.779 1.00 154.46 ? 20   THR C CG2 1 
ATOM   7419  N N   . LYS C 1 25  ? -9.080  7.816   -11.430 1.00 148.04 ? 21   LYS C N   1 
ATOM   7420  C CA  . LYS C 1 25  ? -9.955  6.837   -10.776 1.00 148.72 ? 21   LYS C CA  1 
ATOM   7421  C C   . LYS C 1 25  ? -9.467  6.448   -9.371  1.00 144.96 ? 21   LYS C C   1 
ATOM   7422  O O   . LYS C 1 25  ? -8.331  6.748   -8.993  1.00 141.43 ? 21   LYS C O   1 
ATOM   7423  C CB  . LYS C 1 25  ? -10.131 5.595   -11.664 1.00 149.70 ? 21   LYS C CB  1 
ATOM   7424  C CG  . LYS C 1 25  ? -10.874 5.869   -12.977 1.00 154.54 ? 21   LYS C CG  1 
ATOM   7425  C CD  . LYS C 1 25  ? -10.986 4.632   -13.866 1.00 155.67 ? 21   LYS C CD  1 
ATOM   7426  C CE  . LYS C 1 25  ? -12.204 3.786   -13.518 1.00 158.47 ? 21   LYS C CE  1 
ATOM   7427  N NZ  . LYS C 1 25  ? -12.391 2.660   -14.471 1.00 159.85 ? 21   LYS C NZ  1 
ATOM   7428  N N   . ILE C 1 26  ? -10.340 5.794   -8.604  1.00 146.08 ? 22   ILE C N   1 
ATOM   7429  C CA  . ILE C 1 26  ? -10.011 5.327   -7.254  1.00 143.29 ? 22   ILE C CA  1 
ATOM   7430  C C   . ILE C 1 26  ? -9.169  4.049   -7.320  1.00 140.32 ? 22   ILE C C   1 
ATOM   7431  O O   . ILE C 1 26  ? -9.485  3.123   -8.072  1.00 141.59 ? 22   ILE C O   1 
ATOM   7432  C CB  . ILE C 1 26  ? -11.286 5.091   -6.399  1.00 146.36 ? 22   ILE C CB  1 
ATOM   7433  C CG1 . ILE C 1 26  ? -12.171 6.342   -6.401  1.00 149.78 ? 22   ILE C CG1 1 
ATOM   7434  C CG2 . ILE C 1 26  ? -10.919 4.711   -4.965  1.00 144.01 ? 22   ILE C CG2 1 
ATOM   7435  C CD1 . ILE C 1 26  ? -13.618 6.088   -6.015  1.00 154.41 ? 22   ILE C CD1 1 
ATOM   7436  N N   . PHE C 1 27  ? -8.099  4.014   -6.528  1.00 136.59 ? 23   PHE C N   1 
ATOM   7437  C CA  . PHE C 1 27  ? -7.167  2.890   -6.509  1.00 133.73 ? 23   PHE C CA  1 
ATOM   7438  C C   . PHE C 1 27  ? -7.453  1.938   -5.344  1.00 133.53 ? 23   PHE C C   1 
ATOM   7439  O O   . PHE C 1 27  ? -7.078  2.209   -4.200  1.00 132.20 ? 23   PHE C O   1 
ATOM   7440  C CB  . PHE C 1 27  ? -5.724  3.409   -6.455  1.00 130.40 ? 23   PHE C CB  1 
ATOM   7441  C CG  . PHE C 1 27  ? -4.678  2.337   -6.608  1.00 127.88 ? 23   PHE C CG  1 
ATOM   7442  C CD1 . PHE C 1 27  ? -4.374  1.815   -7.863  1.00 128.03 ? 23   PHE C CD1 1 
ATOM   7443  C CD2 . PHE C 1 27  ? -3.985  1.861   -5.500  1.00 125.54 ? 23   PHE C CD2 1 
ATOM   7444  C CE1 . PHE C 1 27  ? -3.403  0.826   -8.009  1.00 125.80 ? 23   PHE C CE1 1 
ATOM   7445  C CE2 . PHE C 1 27  ? -3.014  0.873   -5.637  1.00 123.52 ? 23   PHE C CE2 1 
ATOM   7446  C CZ  . PHE C 1 27  ? -2.721  0.357   -6.893  1.00 123.56 ? 23   PHE C CZ  1 
ATOM   7447  N N   . ILE C 1 28  ? -8.126  0.830   -5.646  1.00 135.21 ? 24   ILE C N   1 
ATOM   7448  C CA  . ILE C 1 28  ? -8.422  -0.207  -4.656  1.00 135.56 ? 24   ILE C CA  1 
ATOM   7449  C C   . ILE C 1 28  ? -7.987  -1.574  -5.184  1.00 134.56 ? 24   ILE C C   1 
ATOM   7450  O O   . ILE C 1 28  ? -8.319  -1.941  -6.315  1.00 135.78 ? 24   ILE C O   1 
ATOM   7451  C CB  . ILE C 1 28  ? -9.935  -0.254  -4.286  1.00 139.82 ? 24   ILE C CB  1 
ATOM   7452  C CG1 . ILE C 1 28  ? -10.418 1.100   -3.748  1.00 141.21 ? 24   ILE C CG1 1 
ATOM   7453  C CG2 . ILE C 1 28  ? -10.214 -1.367  -3.269  1.00 140.56 ? 24   ILE C CG2 1 
ATOM   7454  C CD1 . ILE C 1 28  ? -11.938 1.260   -3.719  1.00 146.03 ? 24   ILE C CD1 1 
ATOM   7455  N N   . ASN C 1 29  ? -7.239  -2.311  -4.361  1.00 132.59 ? 25   ASN C N   1 
ATOM   7456  C CA  . ASN C 1 29  ? -6.830  -3.688  -4.660  1.00 131.85 ? 25   ASN C CA  1 
ATOM   7457  C C   . ASN C 1 29  ? -6.075  -3.801  -5.990  1.00 130.32 ? 25   ASN C C   1 
ATOM   7458  O O   . ASN C 1 29  ? -6.324  -4.710  -6.788  1.00 131.18 ? 25   ASN C O   1 
ATOM   7459  C CB  . ASN C 1 29  ? -8.056  -4.618  -4.634  1.00 135.14 ? 25   ASN C CB  1 
ATOM   7460  C CG  . ASN C 1 29  ? -7.753  -5.983  -4.039  1.00 134.72 ? 25   ASN C CG  1 
ATOM   7461  O OD1 . ASN C 1 29  ? -6.779  -6.158  -3.304  1.00 132.36 ? 25   ASN C OD1 1 
ATOM   7462  N ND2 . ASN C 1 29  ? -8.604  -6.957  -4.342  1.00 137.18 ? 25   ASN C ND2 1 
ATOM   7463  N N   . ASN C 1 30  ? -5.155  -2.860  -6.212  1.00 128.34 ? 26   ASN C N   1 
ATOM   7464  C CA  . ASN C 1 30  ? -4.393  -2.731  -7.465  1.00 127.31 ? 26   ASN C CA  1 
ATOM   7465  C C   . ASN C 1 30  ? -5.228  -2.442  -8.722  1.00 129.92 ? 26   ASN C C   1 
ATOM   7466  O O   . ASN C 1 30  ? -4.696  -2.418  -9.835  1.00 129.65 ? 26   ASN C O   1 
ATOM   7467  C CB  . ASN C 1 30  ? -3.450  -3.926  -7.681  1.00 125.54 ? 26   ASN C CB  1 
ATOM   7468  C CG  . ASN C 1 30  ? -2.179  -3.828  -6.851  1.00 122.75 ? 26   ASN C CG  1 
ATOM   7469  O OD1 . ASN C 1 30  ? -1.955  -2.847  -6.142  1.00 121.93 ? 26   ASN C OD1 1 
ATOM   7470  N ND2 . ASN C 1 30  ? -1.336  -4.850  -6.942  1.00 121.20 ? 26   ASN C ND2 1 
ATOM   7471  N N   . GLU C 1 31  ? -6.525  -2.212  -8.533  1.00 132.92 ? 27   GLU C N   1 
ATOM   7472  C CA  . GLU C 1 31  ? -7.452  -1.983  -9.641  1.00 136.23 ? 27   GLU C CA  1 
ATOM   7473  C C   . GLU C 1 31  ? -7.983  -0.556  -9.650  1.00 138.05 ? 27   GLU C C   1 
ATOM   7474  O O   . GLU C 1 31  ? -8.275  0.012   -8.596  1.00 138.15 ? 27   GLU C O   1 
ATOM   7475  C CB  . GLU C 1 31  ? -8.628  -2.964  -9.572  1.00 139.10 ? 27   GLU C CB  1 
ATOM   7476  C CG  . GLU C 1 31  ? -8.254  -4.427  -9.787  1.00 138.24 ? 27   GLU C CG  1 
ATOM   7477  C CD  . GLU C 1 31  ? -7.703  -4.704  -11.176 1.00 138.18 ? 27   GLU C CD  1 
ATOM   7478  O OE1 . GLU C 1 31  ? -8.260  -4.176  -12.164 1.00 141.01 ? 27   GLU C OE1 1 
ATOM   7479  O OE2 . GLU C 1 31  ? -6.713  -5.456  -11.280 1.00 135.65 ? 27   GLU C OE2 1 
ATOM   7480  N N   . TRP C 1 32  ? -8.107  0.018   -10.844 1.00 139.83 ? 28   TRP C N   1 
ATOM   7481  C CA  . TRP C 1 32  ? -8.707  1.337   -11.001 1.00 142.29 ? 28   TRP C CA  1 
ATOM   7482  C C   . TRP C 1 32  ? -10.219 1.194   -11.081 1.00 146.72 ? 28   TRP C C   1 
ATOM   7483  O O   . TRP C 1 32  ? -10.747 0.639   -12.045 1.00 149.33 ? 28   TRP C O   1 
ATOM   7484  C CB  . TRP C 1 32  ? -8.161  2.044   -12.242 1.00 142.79 ? 28   TRP C CB  1 
ATOM   7485  C CG  . TRP C 1 32  ? -6.698  2.349   -12.157 1.00 139.34 ? 28   TRP C CG  1 
ATOM   7486  C CD1 . TRP C 1 32  ? -5.687  1.703   -12.810 1.00 137.67 ? 28   TRP C CD1 1 
ATOM   7487  C CD2 . TRP C 1 32  ? -6.077  3.371   -11.367 1.00 137.58 ? 28   TRP C CD2 1 
ATOM   7488  N NE1 . TRP C 1 32  ? -4.477  2.263   -12.481 1.00 134.95 ? 28   TRP C NE1 1 
ATOM   7489  C CE2 . TRP C 1 32  ? -4.686  3.288   -11.597 1.00 134.84 ? 28   TRP C CE2 1 
ATOM   7490  C CE3 . TRP C 1 32  ? -6.560  4.351   -10.489 1.00 138.27 ? 28   TRP C CE3 1 
ATOM   7491  C CZ2 . TRP C 1 32  ? -3.772  4.147   -10.979 1.00 132.79 ? 28   TRP C CZ2 1 
ATOM   7492  C CZ3 . TRP C 1 32  ? -5.648  5.206   -9.876  1.00 135.88 ? 28   TRP C CZ3 1 
ATOM   7493  C CH2 . TRP C 1 32  ? -4.272  5.098   -10.126 1.00 133.19 ? 28   TRP C CH2 1 
ATOM   7494  N N   . GLN C 1 33  ? -10.906 1.685   -10.053 1.00 147.93 ? 29   GLN C N   1 
ATOM   7495  C CA  . GLN C 1 33  ? -12.360 1.570   -9.960  1.00 152.62 ? 29   GLN C CA  1 
ATOM   7496  C C   . GLN C 1 33  ? -13.040 2.933   -9.872  1.00 155.51 ? 29   GLN C C   1 
ATOM   7497  O O   . GLN C 1 33  ? -12.472 3.887   -9.336  1.00 153.39 ? 29   GLN C O   1 
ATOM   7498  C CB  . GLN C 1 33  ? -12.756 0.713   -8.751  1.00 152.53 ? 29   GLN C CB  1 
ATOM   7499  C CG  . GLN C 1 33  ? -12.492 -0.785  -8.910  1.00 151.46 ? 29   GLN C CG  1 
ATOM   7500  C CD  . GLN C 1 33  ? -13.487 -1.485  -9.832  1.00 155.78 ? 29   GLN C CD  1 
ATOM   7501  O OE1 . GLN C 1 33  ? -14.628 -1.047  -9.995  1.00 160.23 ? 29   GLN C OE1 1 
ATOM   7502  N NE2 . GLN C 1 33  ? -13.054 -2.588  -10.430 1.00 154.55 ? 29   GLN C NE2 1 
ATOM   7503  N N   . ASN C 1 34  ? -14.257 3.012   -10.408 1.00 160.62 ? 30   ASN C N   1 
ATOM   7504  C CA  . ASN C 1 34  ? -15.094 4.205   -10.289 1.00 164.33 ? 30   ASN C CA  1 
ATOM   7505  C C   . ASN C 1 34  ? -15.693 4.330   -8.890  1.00 165.21 ? 30   ASN C C   1 
ATOM   7506  O O   . ASN C 1 34  ? -15.547 3.427   -8.062  1.00 163.41 ? 30   ASN C O   1 
ATOM   7507  C CB  . ASN C 1 34  ? -16.211 4.183   -11.339 1.00 170.10 ? 30   ASN C CB  1 
ATOM   7508  C CG  . ASN C 1 34  ? -15.715 4.526   -12.731 1.00 170.30 ? 30   ASN C CG  1 
ATOM   7509  O OD1 . ASN C 1 34  ? -14.933 5.459   -12.916 1.00 168.20 ? 30   ASN C OD1 1 
ATOM   7510  N ND2 . ASN C 1 34  ? -16.183 3.779   -13.722 1.00 173.08 ? 30   ASN C ND2 1 
ATOM   7511  N N   . SER C 1 35  ? -16.359 5.452   -8.629  1.00 168.28 ? 31   SER C N   1 
ATOM   7512  C CA  . SER C 1 35  ? -17.058 5.657   -7.362  1.00 170.07 ? 31   SER C CA  1 
ATOM   7513  C C   . SER C 1 35  ? -18.389 4.910   -7.348  1.00 175.64 ? 31   SER C C   1 
ATOM   7514  O O   . SER C 1 35  ? -19.045 4.777   -8.384  1.00 179.58 ? 31   SER C O   1 
ATOM   7515  C CB  . SER C 1 35  ? -17.267 7.148   -7.085  1.00 171.38 ? 31   SER C CB  1 
ATOM   7516  O OG  . SER C 1 35  ? -17.837 7.809   -8.200  1.00 175.33 ? 31   SER C OG  1 
ATOM   7517  N N   . GLU C 1 36  ? -18.771 4.419   -6.170  1.00 176.36 ? 32   GLU C N   1 
ATOM   7518  C CA  . GLU C 1 36  ? -20.001 3.641   -6.000  1.00 181.90 ? 32   GLU C CA  1 
ATOM   7519  C C   . GLU C 1 36  ? -21.265 4.462   -6.255  1.00 188.60 ? 32   GLU C C   1 
ATOM   7520  O O   . GLU C 1 36  ? -22.218 3.972   -6.863  1.00 193.69 ? 32   GLU C O   1 
ATOM   7521  C CB  . GLU C 1 36  ? -20.048 3.003   -4.608  1.00 181.23 ? 32   GLU C CB  1 
ATOM   7522  C CG  . GLU C 1 36  ? -19.234 1.719   -4.482  1.00 177.19 ? 32   GLU C CG  1 
ATOM   7523  C CD  . GLU C 1 36  ? -19.805 0.569   -5.302  1.00 180.14 ? 32   GLU C CD  1 
ATOM   7524  O OE1 . GLU C 1 36  ? -21.046 0.455   -5.398  1.00 186.28 ? 32   GLU C OE1 1 
ATOM   7525  O OE2 . GLU C 1 36  ? -19.009 -0.225  -5.847  1.00 176.46 ? 32   GLU C OE2 1 
ATOM   7526  N N   . SER C 1 37  ? -21.259 5.708   -5.786  1.00 188.85 ? 33   SER C N   1 
ATOM   7527  C CA  . SER C 1 37  ? -22.352 6.645   -6.030  1.00 195.14 ? 33   SER C CA  1 
ATOM   7528  C C   . SER C 1 37  ? -22.360 7.113   -7.483  1.00 196.90 ? 33   SER C C   1 
ATOM   7529  O O   . SER C 1 37  ? -23.412 7.448   -8.032  1.00 203.26 ? 33   SER C O   1 
ATOM   7530  C CB  . SER C 1 37  ? -22.241 7.849   -5.091  1.00 194.37 ? 33   SER C CB  1 
ATOM   7531  O OG  . SER C 1 37  ? -20.986 8.494   -5.226  1.00 188.32 ? 33   SER C OG  1 
ATOM   7532  N N   . GLY C 1 38  ? -21.178 7.127   -8.095  1.00 191.71 ? 34   GLY C N   1 
ATOM   7533  C CA  . GLY C 1 38  ? -21.006 7.592   -9.467  1.00 193.09 ? 34   GLY C CA  1 
ATOM   7534  C C   . GLY C 1 38  ? -20.542 9.035   -9.541  1.00 192.17 ? 34   GLY C C   1 
ATOM   7535  O O   . GLY C 1 38  ? -20.246 9.541   -10.625 1.00 192.78 ? 34   GLY C O   1 
ATOM   7536  N N   . ARG C 1 39  ? -20.468 9.691   -8.383  1.00 104.68 ? 35   ARG C N   1 
ATOM   7537  C CA  . ARG C 1 39  ? -20.117 11.109  -8.302  1.00 104.60 ? 35   ARG C CA  1 
ATOM   7538  C C   . ARG C 1 39  ? -18.641 11.403  -8.554  1.00 101.66 ? 35   ARG C C   1 
ATOM   7539  O O   . ARG C 1 39  ? -17.770 10.583  -8.260  1.00 98.82  ? 35   ARG C O   1 
ATOM   7540  C CB  . ARG C 1 39  ? -20.560 11.705  -6.964  1.00 103.98 ? 35   ARG C CB  1 
ATOM   7541  C CG  . ARG C 1 39  ? -21.932 12.357  -7.022  1.00 108.38 ? 35   ARG C CG  1 
ATOM   7542  C CD  . ARG C 1 39  ? -22.382 12.836  -5.658  1.00 108.49 ? 35   ARG C CD  1 
ATOM   7543  N NE  . ARG C 1 39  ? -22.705 11.719  -4.775  1.00 107.91 ? 35   ARG C NE  1 
ATOM   7544  C CZ  . ARG C 1 39  ? -23.324 11.835  -3.604  1.00 108.39 ? 35   ARG C CZ  1 
ATOM   7545  N NH1 . ARG C 1 39  ? -23.698 13.025  -3.151  1.00 109.66 ? 35   ARG C NH1 1 
ATOM   7546  N NH2 . ARG C 1 39  ? -23.571 10.754  -2.880  1.00 107.67 ? 35   ARG C NH2 1 
ATOM   7547  N N   . VAL C 1 40  ? -18.386 12.588  -9.105  1.00 102.79 ? 36   VAL C N   1 
ATOM   7548  C CA  . VAL C 1 40  ? -17.048 13.034  -9.495  1.00 100.79 ? 36   VAL C CA  1 
ATOM   7549  C C   . VAL C 1 40  ? -16.848 14.485  -9.033  1.00 100.64 ? 36   VAL C C   1 
ATOM   7550  O O   . VAL C 1 40  ? -17.719 15.331  -9.252  1.00 103.66 ? 36   VAL C O   1 
ATOM   7551  C CB  . VAL C 1 40  ? -16.850 12.920  -11.040 1.00 102.96 ? 36   VAL C CB  1 
ATOM   7552  C CG1 . VAL C 1 40  ? -15.480 13.421  -11.463 1.00 101.13 ? 36   VAL C CG1 1 
ATOM   7553  C CG2 . VAL C 1 40  ? -17.051 11.482  -11.520 1.00 103.45 ? 36   VAL C CG2 1 
ATOM   7554  N N   . PHE C 1 41  ? -15.713 14.767  -8.391  1.00 97.42  ? 37   PHE C N   1 
ATOM   7555  C CA  . PHE C 1 41  ? -15.411 16.123  -7.910  1.00 97.12  ? 37   PHE C CA  1 
ATOM   7556  C C   . PHE C 1 41  ? -14.341 16.833  -8.758  1.00 96.89  ? 37   PHE C C   1 
ATOM   7557  O O   . PHE C 1 41  ? -13.543 16.169  -9.428  1.00 95.84  ? 37   PHE C O   1 
ATOM   7558  C CB  . PHE C 1 41  ? -15.036 16.113  -6.416  1.00 94.09  ? 37   PHE C CB  1 
ATOM   7559  C CG  . PHE C 1 41  ? -13.669 15.548  -6.119  1.00 90.32  ? 37   PHE C CG  1 
ATOM   7560  C CD1 . PHE C 1 41  ? -13.504 14.192  -5.856  1.00 88.64  ? 37   PHE C CD1 1 
ATOM   7561  C CD2 . PHE C 1 41  ? -12.550 16.378  -6.075  1.00 88.70  ? 37   PHE C CD2 1 
ATOM   7562  C CE1 . PHE C 1 41  ? -12.242 13.666  -5.571  1.00 85.37  ? 37   PHE C CE1 1 
ATOM   7563  C CE2 . PHE C 1 41  ? -11.285 15.863  -5.794  1.00 85.32  ? 37   PHE C CE2 1 
ATOM   7564  C CZ  . PHE C 1 41  ? -11.132 14.506  -5.539  1.00 83.64  ? 37   PHE C CZ  1 
ATOM   7565  N N   . PRO C 1 42  ? -14.328 18.183  -8.738  1.00 98.10  ? 38   PRO C N   1 
ATOM   7566  C CA  . PRO C 1 42  ? -13.347 18.926  -9.529  1.00 98.22  ? 38   PRO C CA  1 
ATOM   7567  C C   . PRO C 1 42  ? -12.053 19.248  -8.779  1.00 94.88  ? 38   PRO C C   1 
ATOM   7568  O O   . PRO C 1 42  ? -12.059 19.393  -7.553  1.00 93.11  ? 38   PRO C O   1 
ATOM   7569  C CB  . PRO C 1 42  ? -14.091 20.218  -9.874  1.00 101.61 ? 38   PRO C CB  1 
ATOM   7570  C CG  . PRO C 1 42  ? -15.049 20.421  -8.744  1.00 101.96 ? 38   PRO C CG  1 
ATOM   7571  C CD  . PRO C 1 42  ? -15.300 19.085  -8.088  1.00 99.99  ? 38   PRO C CD  1 
ATOM   7572  N N   . VAL C 1 43  ? -10.959 19.353  -9.531  1.00 94.27  ? 39   VAL C N   1 
ATOM   7573  C CA  . VAL C 1 43  ? -9.662  19.777  -9.003  1.00 91.56  ? 39   VAL C CA  1 
ATOM   7574  C C   . VAL C 1 43  ? -9.190  21.015  -9.767  1.00 93.39  ? 39   VAL C C   1 
ATOM   7575  O O   . VAL C 1 43  ? -9.105  21.000  -10.998 1.00 95.38  ? 39   VAL C O   1 
ATOM   7576  C CB  . VAL C 1 43  ? -8.606  18.648  -9.097  1.00 88.80  ? 39   VAL C CB  1 
ATOM   7577  C CG1 . VAL C 1 43  ? -7.219  19.170  -8.747  1.00 86.57  ? 39   VAL C CG1 1 
ATOM   7578  C CG2 . VAL C 1 43  ? -8.980  17.490  -8.184  1.00 86.88  ? 39   VAL C CG2 1 
ATOM   7579  N N   . TYR C 1 44  ? -8.888  22.080  -9.030  1.00 92.89  ? 40   TYR C N   1 
ATOM   7580  C CA  . TYR C 1 44  ? -8.532  23.360  -9.635  1.00 94.90  ? 40   TYR C CA  1 
ATOM   7581  C C   . TYR C 1 44  ? -7.043  23.668  -9.556  1.00 92.77  ? 40   TYR C C   1 
ATOM   7582  O O   . TYR C 1 44  ? -6.373  23.311  -8.587  1.00 89.70  ? 40   TYR C O   1 
ATOM   7583  C CB  . TYR C 1 44  ? -9.316  24.503  -8.980  1.00 96.70  ? 40   TYR C CB  1 
ATOM   7584  C CG  . TYR C 1 44  ? -10.818 24.405  -9.127  1.00 99.56  ? 40   TYR C CG  1 
ATOM   7585  C CD1 . TYR C 1 44  ? -11.439 24.693  -10.339 1.00 103.24 ? 40   TYR C CD1 1 
ATOM   7586  C CD2 . TYR C 1 44  ? -11.619 24.040  -8.048  1.00 99.06  ? 40   TYR C CD2 1 
ATOM   7587  C CE1 . TYR C 1 44  ? -12.820 24.609  -10.475 1.00 106.24 ? 40   TYR C CE1 1 
ATOM   7588  C CE2 . TYR C 1 44  ? -13.001 23.953  -8.174  1.00 101.90 ? 40   TYR C CE2 1 
ATOM   7589  C CZ  . TYR C 1 44  ? -13.594 24.239  -9.389  1.00 105.54 ? 40   TYR C CZ  1 
ATOM   7590  O OH  . TYR C 1 44  ? -14.962 24.158  -9.523  1.00 108.73 ? 40   TYR C OH  1 
ATOM   7591  N N   . ASN C 1 45  ? -6.544  24.333  -10.594 1.00 94.61  ? 41   ASN C N   1 
ATOM   7592  C CA  . ASN C 1 45  ? -5.223  24.944  -10.580 1.00 93.52  ? 41   ASN C CA  1 
ATOM   7593  C C   . ASN C 1 45  ? -5.308  26.244  -9.781  1.00 94.17  ? 41   ASN C C   1 
ATOM   7594  O O   . ASN C 1 45  ? -6.033  27.158  -10.174 1.00 97.28  ? 41   ASN C O   1 
ATOM   7595  C CB  . ASN C 1 45  ? -4.758  25.219  -12.017 1.00 95.81  ? 41   ASN C CB  1 
ATOM   7596  C CG  . ASN C 1 45  ? -3.374  25.859  -12.092 1.00 94.99  ? 41   ASN C CG  1 
ATOM   7597  O OD1 . ASN C 1 45  ? -2.684  26.028  -11.087 1.00 92.55  ? 41   ASN C OD1 1 
ATOM   7598  N ND2 . ASN C 1 45  ? -2.965  26.213  -13.302 1.00 97.19  ? 41   ASN C ND2 1 
ATOM   7599  N N   . PRO C 1 46  ? -4.583  26.327  -8.647  1.00 91.43  ? 42   PRO C N   1 
ATOM   7600  C CA  . PRO C 1 46  ? -4.623  27.524  -7.803  1.00 92.00  ? 42   PRO C CA  1 
ATOM   7601  C C   . PRO C 1 46  ? -3.865  28.718  -8.393  1.00 93.91  ? 42   PRO C C   1 
ATOM   7602  O O   . PRO C 1 46  ? -4.013  29.839  -7.903  1.00 95.16  ? 42   PRO C O   1 
ATOM   7603  C CB  . PRO C 1 46  ? -3.952  27.056  -6.509  1.00 88.38  ? 42   PRO C CB  1 
ATOM   7604  C CG  . PRO C 1 46  ? -3.033  25.983  -6.938  1.00 86.23  ? 42   PRO C CG  1 
ATOM   7605  C CD  . PRO C 1 46  ? -3.727  25.278  -8.063  1.00 87.86  ? 42   PRO C CD  1 
ATOM   7606  N N   . ALA C 1 47  ? -3.066  28.472  -9.429  1.00 94.26  ? 43   ALA C N   1 
ATOM   7607  C CA  . ALA C 1 47  ? -2.273  29.517  -10.078 1.00 96.26  ? 43   ALA C CA  1 
ATOM   7608  C C   . ALA C 1 47  ? -3.096  30.390  -11.025 1.00 100.41 ? 43   ALA C C   1 
ATOM   7609  O O   . ALA C 1 47  ? -2.745  31.544  -11.285 1.00 102.50 ? 43   ALA C O   1 
ATOM   7610  C CB  . ALA C 1 47  ? -1.100  28.900  -10.817 1.00 95.27  ? 43   ALA C CB  1 
ATOM   7611  N N   . THR C 1 48  ? -4.186  29.828  -11.538 1.00 101.76 ? 44   THR C N   1 
ATOM   7612  C CA  . THR C 1 48  ? -5.029  30.510  -12.516 1.00 105.89 ? 44   THR C CA  1 
ATOM   7613  C C   . THR C 1 48  ? -6.512  30.449  -12.145 1.00 107.26 ? 44   THR C C   1 
ATOM   7614  O O   . THR C 1 48  ? -7.313  31.266  -12.616 1.00 110.73 ? 44   THR C O   1 
ATOM   7615  C CB  . THR C 1 48  ? -4.832  29.920  -13.932 1.00 107.32 ? 44   THR C CB  1 
ATOM   7616  O OG1 . THR C 1 48  ? -4.875  28.489  -13.867 1.00 104.77 ? 44   THR C OG1 1 
ATOM   7617  C CG2 . THR C 1 48  ? -3.494  30.355  -14.523 1.00 107.52 ? 44   THR C CG2 1 
ATOM   7618  N N   . GLY C 1 49  ? -6.868  29.479  -11.303 1.00 104.69 ? 45   GLY C N   1 
ATOM   7619  C CA  . GLY C 1 49  ? -8.260  29.248  -10.914 1.00 105.90 ? 45   GLY C CA  1 
ATOM   7620  C C   . GLY C 1 49  ? -8.959  28.233  -11.804 1.00 107.03 ? 45   GLY C C   1 
ATOM   7621  O O   . GLY C 1 49  ? -10.003 27.688  -11.434 1.00 107.26 ? 45   GLY C O   1 
ATOM   7622  N N   . GLU C 1 50  ? -8.373  27.981  -12.975 1.00 107.91 ? 46   GLU C N   1 
ATOM   7623  C CA  . GLU C 1 50  ? -8.936  27.078  -13.982 1.00 109.39 ? 46   GLU C CA  1 
ATOM   7624  C C   . GLU C 1 50  ? -8.964  25.608  -13.543 1.00 106.38 ? 46   GLU C C   1 
ATOM   7625  O O   . GLU C 1 50  ? -8.075  25.144  -12.824 1.00 103.02 ? 46   GLU C O   1 
ATOM   7626  C CB  . GLU C 1 50  ? -8.221  27.283  -15.334 1.00 111.33 ? 46   GLU C CB  1 
ATOM   7627  C CG  . GLU C 1 50  ? -7.604  26.039  -15.983 1.00 110.24 ? 46   GLU C CG  1 
ATOM   7628  C CD  . GLU C 1 50  ? -6.132  25.856  -15.635 1.00 107.44 ? 46   GLU C CD  1 
ATOM   7629  O OE1 . GLU C 1 50  ? -5.353  26.820  -15.802 1.00 108.25 ? 46   GLU C OE1 1 
ATOM   7630  O OE2 . GLU C 1 50  ? -5.750  24.743  -15.210 1.00 104.38 ? 46   GLU C OE2 1 
ATOM   7631  N N   . GLN C 1 51  ? -10.009 24.898  -13.968 1.00 107.87 ? 47   GLN C N   1 
ATOM   7632  C CA  . GLN C 1 51  ? -10.180 23.480  -13.661 1.00 105.61 ? 47   GLN C CA  1 
ATOM   7633  C C   . GLN C 1 51  ? -9.268  22.629  -14.535 1.00 104.69 ? 47   GLN C C   1 
ATOM   7634  O O   . GLN C 1 51  ? -9.347  22.674  -15.765 1.00 107.39 ? 47   GLN C O   1 
ATOM   7635  C CB  . GLN C 1 51  ? -11.641 23.059  -13.853 1.00 108.04 ? 47   GLN C CB  1 
ATOM   7636  C CG  . GLN C 1 51  ? -11.943 21.621  -13.435 1.00 106.18 ? 47   GLN C CG  1 
ATOM   7637  C CD  . GLN C 1 51  ? -13.313 21.143  -13.886 1.00 109.27 ? 47   GLN C CD  1 
ATOM   7638  O OE1 . GLN C 1 51  ? -13.440 20.074  -14.481 1.00 109.61 ? 47   GLN C OE1 1 
ATOM   7639  N NE2 . GLN C 1 51  ? -14.345 21.933  -13.605 1.00 111.66 ? 47   GLN C NE2 1 
ATOM   7640  N N   . VAL C 1 52  ? -8.406  21.855  -13.885 1.00 101.00 ? 48   VAL C N   1 
ATOM   7641  C CA  . VAL C 1 52  ? -7.455  20.996  -14.581 1.00 99.91  ? 48   VAL C CA  1 
ATOM   7642  C C   . VAL C 1 52  ? -8.141  19.723  -15.064 1.00 100.56 ? 48   VAL C C   1 
ATOM   7643  O O   . VAL C 1 52  ? -7.993  19.328  -16.224 1.00 102.38 ? 48   VAL C O   1 
ATOM   7644  C CB  . VAL C 1 52  ? -6.259  20.616  -13.671 1.00 95.96  ? 48   VAL C CB  1 
ATOM   7645  C CG1 . VAL C 1 52  ? -5.196  19.863  -14.465 1.00 95.36  ? 48   VAL C CG1 1 
ATOM   7646  C CG2 . VAL C 1 52  ? -5.663  21.854  -13.019 1.00 95.15  ? 48   VAL C CG2 1 
ATOM   7647  N N   . CYS C 1 53  ? -8.894  19.095  -14.164 1.00 99.25  ? 49   CYS C N   1 
ATOM   7648  C CA  . CYS C 1 53  ? -9.488  17.784  -14.405 1.00 99.46  ? 49   CYS C CA  1 
ATOM   7649  C C   . CYS C 1 53  ? -10.537 17.441  -13.349 1.00 98.81  ? 49   CYS C C   1 
ATOM   7650  O O   . CYS C 1 53  ? -10.819 18.238  -12.450 1.00 98.25  ? 49   CYS C O   1 
ATOM   7651  C CB  . CYS C 1 53  ? -8.396  16.708  -14.414 1.00 96.83  ? 49   CYS C CB  1 
ATOM   7652  S SG  . CYS C 1 53  ? -7.334  16.741  -12.955 1.00 92.05  ? 49   CYS C SG  1 
ATOM   7653  N N   . GLU C 1 54  ? -11.106 16.245  -13.471 1.00 99.07  ? 50   GLU C N   1 
ATOM   7654  C CA  . GLU C 1 54  ? -12.100 15.747  -12.529 1.00 98.66  ? 50   GLU C CA  1 
ATOM   7655  C C   . GLU C 1 54  ? -11.670 14.399  -11.955 1.00 95.78  ? 50   GLU C C   1 
ATOM   7656  O O   . GLU C 1 54  ? -11.062 13.580  -12.651 1.00 95.46  ? 50   GLU C O   1 
ATOM   7657  C CB  . GLU C 1 54  ? -13.468 15.636  -13.206 1.00 102.50 ? 50   GLU C CB  1 
ATOM   7658  C CG  . GLU C 1 54  ? -14.164 16.974  -13.423 1.00 105.48 ? 50   GLU C CG  1 
ATOM   7659  C CD  . GLU C 1 54  ? -15.528 16.833  -14.072 1.00 109.69 ? 50   GLU C CD  1 
ATOM   7660  O OE1 . GLU C 1 54  ? -15.623 16.197  -15.142 1.00 111.70 ? 50   GLU C OE1 1 
ATOM   7661  O OE2 . GLU C 1 54  ? -16.508 17.371  -13.514 1.00 111.30 ? 50   GLU C OE2 1 
ATOM   7662  N N   . VAL C 1 55  ? -11.985 14.183  -10.680 1.00 93.84  ? 51   VAL C N   1 
ATOM   7663  C CA  . VAL C 1 55  ? -11.581 12.975  -9.960  1.00 90.96  ? 51   VAL C CA  1 
ATOM   7664  C C   . VAL C 1 55  ? -12.797 12.311  -9.311  1.00 91.67  ? 51   VAL C C   1 
ATOM   7665  O O   . VAL C 1 55  ? -13.697 12.998  -8.826  1.00 92.96  ? 51   VAL C O   1 
ATOM   7666  C CB  . VAL C 1 55  ? -10.509 13.293  -8.876  1.00 87.36  ? 51   VAL C CB  1 
ATOM   7667  C CG1 . VAL C 1 55  ? -10.074 12.034  -8.144  1.00 84.62  ? 51   VAL C CG1 1 
ATOM   7668  C CG2 . VAL C 1 55  ? -9.295  13.981  -9.491  1.00 86.80  ? 51   VAL C CG2 1 
ATOM   7669  N N   . GLN C 1 56  ? -12.813 10.979  -9.312  1.00 90.95  ? 52   GLN C N   1 
ATOM   7670  C CA  . GLN C 1 56  ? -13.881 10.196  -8.683  1.00 91.64  ? 52   GLN C CA  1 
ATOM   7671  C C   . GLN C 1 56  ? -13.985 10.493  -7.186  1.00 89.63  ? 52   GLN C C   1 
ATOM   7672  O O   . GLN C 1 56  ? -12.969 10.562  -6.488  1.00 86.58  ? 52   GLN C O   1 
ATOM   7673  C CB  . GLN C 1 56  ? -13.650 8.696   -8.900  1.00 90.91  ? 52   GLN C CB  1 
ATOM   7674  C CG  . GLN C 1 56  ? -13.490 8.269   -10.358 1.00 92.97  ? 52   GLN C CG  1 
ATOM   7675  C CD  . GLN C 1 56  ? -14.801 8.242   -11.125 1.00 96.94  ? 52   GLN C CD  1 
ATOM   7676  O OE1 . GLN C 1 56  ? -15.792 7.664   -10.674 1.00 98.11  ? 52   GLN C OE1 1 
ATOM   7677  N NE2 . GLN C 1 56  ? -14.808 8.859   -12.301 1.00 99.33  ? 52   GLN C NE2 1 
ATOM   7678  N N   . GLU C 1 57  ? -15.213 10.668  -6.701  1.00 91.54  ? 53   GLU C N   1 
ATOM   7679  C CA  . GLU C 1 57  ? -15.455 11.013  -5.298  1.00 90.20  ? 53   GLU C CA  1 
ATOM   7680  C C   . GLU C 1 57  ? -15.796 9.790   -4.451  1.00 89.13  ? 53   GLU C C   1 
ATOM   7681  O O   . GLU C 1 57  ? -16.884 9.221   -4.569  1.00 91.48  ? 53   GLU C O   1 
ATOM   7682  C CB  . GLU C 1 57  ? -16.563 12.064  -5.183  1.00 93.11  ? 53   GLU C CB  1 
ATOM   7683  C CG  . GLU C 1 57  ? -16.717 12.657  -3.785  1.00 92.24  ? 53   GLU C CG  1 
ATOM   7684  C CD  . GLU C 1 57  ? -18.073 13.302  -3.554  1.00 96.08  ? 53   GLU C CD  1 
ATOM   7685  O OE1 . GLU C 1 57  ? -18.730 13.713  -4.536  1.00 99.38  ? 53   GLU C OE1 1 
ATOM   7686  O OE2 . GLU C 1 57  ? -18.482 13.400  -2.378  1.00 95.85  ? 53   GLU C OE2 1 
ATOM   7687  N N   . ALA C 1 58  ? -14.859 9.400   -3.591  1.00 85.76  ? 54   ALA C N   1 
ATOM   7688  C CA  . ALA C 1 58  ? -15.045 8.262   -2.694  1.00 84.56  ? 54   ALA C CA  1 
ATOM   7689  C C   . ALA C 1 58  ? -15.970 8.613   -1.531  1.00 85.30  ? 54   ALA C C   1 
ATOM   7690  O O   . ALA C 1 58  ? -16.028 9.767   -1.100  1.00 85.44  ? 54   ALA C O   1 
ATOM   7691  C CB  . ALA C 1 58  ? -13.704 7.768   -2.176  1.00 80.88  ? 54   ALA C CB  1 
ATOM   7692  N N   . ASP C 1 59  ? -16.694 7.611   -1.039  1.00 85.98  ? 55   ASP C N   1 
ATOM   7693  C CA  . ASP C 1 59  ? -17.607 7.780   0.090   1.00 86.89  ? 55   ASP C CA  1 
ATOM   7694  C C   . ASP C 1 59  ? -17.555 6.538   0.982   1.00 85.44  ? 55   ASP C C   1 
ATOM   7695  O O   . ASP C 1 59  ? -16.701 5.672   0.787   1.00 83.38  ? 55   ASP C O   1 
ATOM   7696  C CB  . ASP C 1 59  ? -19.036 8.047   -0.408  1.00 90.98  ? 55   ASP C CB  1 
ATOM   7697  C CG  . ASP C 1 59  ? -19.837 8.939   0.536   1.00 92.36  ? 55   ASP C CG  1 
ATOM   7698  O OD1 . ASP C 1 59  ? -19.514 9.000   1.742   1.00 90.53  ? 55   ASP C OD1 1 
ATOM   7699  O OD2 . ASP C 1 59  ? -20.799 9.580   0.066   1.00 95.50  ? 55   ASP C OD2 1 
ATOM   7700  N N   . LYS C 1 60  ? -18.466 6.457   1.952   1.00 86.68  ? 56   LYS C N   1 
ATOM   7701  C CA  . LYS C 1 60  ? -18.514 5.350   2.913   1.00 85.75  ? 56   LYS C CA  1 
ATOM   7702  C C   . LYS C 1 60  ? -18.491 3.975   2.233   1.00 86.13  ? 56   LYS C C   1 
ATOM   7703  O O   . LYS C 1 60  ? -17.802 3.063   2.700   1.00 84.04  ? 56   LYS C O   1 
ATOM   7704  C CB  . LYS C 1 60  ? -19.739 5.484   3.830   1.00 88.09  ? 56   LYS C CB  1 
ATOM   7705  C CG  . LYS C 1 60  ? -19.567 4.893   5.235   1.00 86.48  ? 56   LYS C CG  1 
ATOM   7706  C CD  . LYS C 1 60  ? -19.939 3.412   5.300   1.00 87.15  ? 56   LYS C CD  1 
ATOM   7707  C CE  . LYS C 1 60  ? -19.650 2.818   6.673   1.00 85.62  ? 56   LYS C CE  1 
ATOM   7708  N NZ  . LYS C 1 60  ? -18.186 2.688   6.955   1.00 81.93  ? 56   LYS C NZ  1 
ATOM   7709  N N   . ALA C 1 61  ? -19.235 3.841   1.134   1.00 89.01  ? 57   ALA C N   1 
ATOM   7710  C CA  . ALA C 1 61  ? -19.268 2.605   0.344   1.00 89.78  ? 57   ALA C CA  1 
ATOM   7711  C C   . ALA C 1 61  ? -17.898 2.257   -0.249  1.00 87.04  ? 57   ALA C C   1 
ATOM   7712  O O   . ALA C 1 61  ? -17.514 1.085   -0.292  1.00 86.24  ? 57   ALA C O   1 
ATOM   7713  C CB  . ALA C 1 61  ? -20.320 2.704   -0.760  1.00 93.59  ? 57   ALA C CB  1 
ATOM   7714  N N   . ASP C 1 62  ? -17.173 3.284   -0.694  1.00 85.76  ? 58   ASP C N   1 
ATOM   7715  C CA  . ASP C 1 62  ? -15.848 3.126   -1.295  1.00 83.36  ? 58   ASP C CA  1 
ATOM   7716  C C   . ASP C 1 62  ? -14.799 2.722   -0.256  1.00 79.77  ? 58   ASP C C   1 
ATOM   7717  O O   . ASP C 1 62  ? -13.917 1.903   -0.535  1.00 78.15  ? 58   ASP C O   1 
ATOM   7718  C CB  . ASP C 1 62  ? -15.426 4.421   -1.996  1.00 83.38  ? 58   ASP C CB  1 
ATOM   7719  C CG  . ASP C 1 62  ? -16.337 4.784   -3.154  1.00 86.97  ? 58   ASP C CG  1 
ATOM   7720  O OD1 . ASP C 1 62  ? -16.192 4.183   -4.240  1.00 88.30  ? 58   ASP C OD1 1 
ATOM   7721  O OD2 . ASP C 1 62  ? -17.190 5.679   -2.981  1.00 88.79  ? 58   ASP C OD2 1 
ATOM   7722  N N   . ILE C 1 63  ? -14.906 3.310   0.934   1.00 78.68  ? 59   ILE C N   1 
ATOM   7723  C CA  . ILE C 1 63  ? -14.031 2.994   2.063   1.00 75.59  ? 59   ILE C CA  1 
ATOM   7724  C C   . ILE C 1 63  ? -14.176 1.519   2.457   1.00 75.56  ? 59   ILE C C   1 
ATOM   7725  O O   . ILE C 1 63  ? -13.178 0.817   2.634   1.00 73.32  ? 59   ILE C O   1 
ATOM   7726  C CB  . ILE C 1 63  ? -14.325 3.916   3.289   1.00 75.13  ? 59   ILE C CB  1 
ATOM   7727  C CG1 . ILE C 1 63  ? -14.152 5.404   2.931   1.00 75.11  ? 59   ILE C CG1 1 
ATOM   7728  C CG2 . ILE C 1 63  ? -13.485 3.510   4.513   1.00 72.30  ? 59   ILE C CG2 1 
ATOM   7729  C CD1 . ILE C 1 63  ? -12.727 5.855   2.624   1.00 72.11  ? 59   ILE C CD1 1 
ATOM   7730  N N   . ASP C 1 64  ? -15.423 1.063   2.569   1.00 78.23  ? 60   ASP C N   1 
ATOM   7731  C CA  . ASP C 1 64  ? -15.733 -0.323  2.931   1.00 78.75  ? 60   ASP C CA  1 
ATOM   7732  C C   . ASP C 1 64  ? -15.105 -1.351  1.985   1.00 78.47  ? 60   ASP C C   1 
ATOM   7733  O O   . ASP C 1 64  ? -14.665 -2.411  2.433   1.00 77.42  ? 60   ASP C O   1 
ATOM   7734  C CB  . ASP C 1 64  ? -17.250 -0.533  3.024   1.00 82.20  ? 60   ASP C CB  1 
ATOM   7735  C CG  . ASP C 1 64  ? -17.842 -0.001  4.324   1.00 82.40  ? 60   ASP C CG  1 
ATOM   7736  O OD1 . ASP C 1 64  ? -17.260 0.926   4.926   1.00 80.48  ? 60   ASP C OD1 1 
ATOM   7737  O OD2 . ASP C 1 64  ? -18.902 -0.511  4.744   1.00 84.72  ? 60   ASP C OD2 1 
ATOM   7738  N N   . LYS C 1 65  ? -15.065 -1.036  0.689   1.00 79.57  ? 61   LYS C N   1 
ATOM   7739  C CA  . LYS C 1 65  ? -14.388 -1.886  -0.294  1.00 79.37  ? 61   LYS C CA  1 
ATOM   7740  C C   . LYS C 1 65  ? -12.876 -1.879  -0.076  1.00 75.98  ? 61   LYS C C   1 
ATOM   7741  O O   . LYS C 1 65  ? -12.216 -2.913  -0.210  1.00 75.15  ? 61   LYS C O   1 
ATOM   7742  C CB  . LYS C 1 65  ? -14.701 -1.440  -1.725  1.00 81.61  ? 61   LYS C CB  1 
ATOM   7743  C CG  . LYS C 1 65  ? -16.110 -1.771  -2.204  1.00 85.45  ? 61   LYS C CG  1 
ATOM   7744  C CD  . LYS C 1 65  ? -16.189 -1.828  -3.728  1.00 87.60  ? 61   LYS C CD  1 
ATOM   7745  C CE  . LYS C 1 65  ? -15.985 -0.460  -4.368  1.00 87.55  ? 61   LYS C CE  1 
ATOM   7746  N NZ  . LYS C 1 65  ? -15.850 -0.567  -5.845  1.00 89.36  ? 61   LYS C NZ  1 
ATOM   7747  N N   . ALA C 1 66  ? -12.343 -0.707  0.267   1.00 74.19  ? 62   ALA C N   1 
ATOM   7748  C CA  . ALA C 1 66  ? -10.906 -0.520  0.460   1.00 71.07  ? 62   ALA C CA  1 
ATOM   7749  C C   . ALA C 1 66  ? -10.393 -1.182  1.732   1.00 68.78  ? 62   ALA C C   1 
ATOM   7750  O O   . ALA C 1 66  ? -9.249  -1.636  1.777   1.00 66.79  ? 62   ALA C O   1 
ATOM   7751  C CB  . ALA C 1 66  ? -10.561 0.953   0.458   1.00 70.22  ? 62   ALA C CB  1 
ATOM   7752  N N   . VAL C 1 67  ? -11.236 -1.227  2.761   1.00 69.23  ? 63   VAL C N   1 
ATOM   7753  C CA  . VAL C 1 67  ? -10.888 -1.890  4.017   1.00 67.52  ? 63   VAL C CA  1 
ATOM   7754  C C   . VAL C 1 67  ? -10.883 -3.408  3.833   1.00 68.21  ? 63   VAL C C   1 
ATOM   7755  O O   . VAL C 1 67  ? -9.980  -4.090  4.325   1.00 66.33  ? 63   VAL C O   1 
ATOM   7756  C CB  . VAL C 1 67  ? -11.826 -1.471  5.175   1.00 68.24  ? 63   VAL C CB  1 
ATOM   7757  C CG1 . VAL C 1 67  ? -11.557 -2.298  6.432   1.00 66.93  ? 63   VAL C CG1 1 
ATOM   7758  C CG2 . VAL C 1 67  ? -11.658 0.006   5.478   1.00 67.40  ? 63   VAL C CG2 1 
ATOM   7759  N N   . GLN C 1 68  ? -11.883 -3.923  3.116   1.00 71.04  ? 64   GLN C N   1 
ATOM   7760  C CA  . GLN C 1 68  ? -11.953 -5.347  2.783   1.00 72.20  ? 64   GLN C CA  1 
ATOM   7761  C C   . GLN C 1 68  ? -10.715 -5.794  2.009   1.00 70.84  ? 64   GLN C C   1 
ATOM   7762  O O   . GLN C 1 68  ? -10.177 -6.874  2.257   1.00 70.23  ? 64   GLN C O   1 
ATOM   7763  C CB  . GLN C 1 68  ? -13.215 -5.662  1.975   1.00 75.77  ? 64   GLN C CB  1 
ATOM   7764  C CG  . GLN C 1 68  ? -14.490 -5.771  2.804   1.00 77.91  ? 64   GLN C CG  1 
ATOM   7765  C CD  . GLN C 1 68  ? -15.689 -6.241  1.988   1.00 81.89  ? 64   GLN C CD  1 
ATOM   7766  O OE1 . GLN C 1 68  ? -15.664 -7.312  1.377   1.00 83.13  ? 64   GLN C OE1 1 
ATOM   7767  N NE2 . GLN C 1 68  ? -16.750 -5.442  1.985   1.00 83.91  ? 64   GLN C NE2 1 
ATOM   7768  N N   . ALA C 1 69  ? -10.268 -4.947  1.082   1.00 70.56  ? 65   ALA C N   1 
ATOM   7769  C CA  . ALA C 1 69  ? -9.085  -5.222  0.273   1.00 69.50  ? 65   ALA C CA  1 
ATOM   7770  C C   . ALA C 1 69  ? -7.815  -5.225  1.115   1.00 66.36  ? 65   ALA C C   1 
ATOM   7771  O O   . ALA C 1 69  ? -6.938  -6.065  0.917   1.00 65.66  ? 65   ALA C O   1 
ATOM   7772  C CB  . ALA C 1 69  ? -8.971  -4.214  -0.861  1.00 70.25  ? 65   ALA C CB  1 
ATOM   7773  N N   . ALA C 1 70  ? -7.731  -4.287  2.054   1.00 64.78  ? 66   ALA C N   1 
ATOM   7774  C CA  . ALA C 1 70  ? -6.567  -4.164  2.930   1.00 62.00  ? 66   ALA C CA  1 
ATOM   7775  C C   . ALA C 1 70  ? -6.533  -5.248  4.006   1.00 61.42  ? 66   ALA C C   1 
ATOM   7776  O O   . ALA C 1 70  ? -5.455  -5.730  4.370   1.00 59.70  ? 66   ALA C O   1 
ATOM   7777  C CB  . ALA C 1 70  ? -6.513  -2.776  3.561   1.00 60.73  ? 66   ALA C CB  1 
ATOM   7778  N N   . ARG C 1 71  ? -7.711  -5.623  4.507   1.00 63.04  ? 67   ARG C N   1 
ATOM   7779  C CA  . ARG C 1 71  ? -7.833  -6.665  5.524   1.00 62.93  ? 67   ARG C CA  1 
ATOM   7780  C C   . ARG C 1 71  ? -7.402  -8.016  4.960   1.00 63.65  ? 67   ARG C C   1 
ATOM   7781  O O   . ARG C 1 71  ? -6.679  -8.771  5.622   1.00 62.41  ? 67   ARG C O   1 
ATOM   7782  C CB  . ARG C 1 71  ? -9.273  -6.745  6.037   1.00 65.06  ? 67   ARG C CB  1 
ATOM   7783  C CG  . ARG C 1 71  ? -9.489  -7.688  7.218   1.00 65.06  ? 67   ARG C CG  1 
ATOM   7784  C CD  . ARG C 1 71  ? -9.321  -6.974  8.553   1.00 63.36  ? 67   ARG C CD  1 
ATOM   7785  N NE  . ARG C 1 71  ? -7.943  -6.998  9.033   1.00 60.45  ? 67   ARG C NE  1 
ATOM   7786  C CZ  . ARG C 1 71  ? -7.505  -6.321  10.092  1.00 58.76  ? 67   ARG C CZ  1 
ATOM   7787  N NH1 . ARG C 1 71  ? -8.335  -5.551  10.786  1.00 59.36  ? 67   ARG C NH1 1 
ATOM   7788  N NH2 . ARG C 1 71  ? -6.231  -6.407  10.458  1.00 56.32  ? 67   ARG C NH2 1 
ATOM   7789  N N   . LEU C 1 72  ? -7.853  -8.303  3.737   1.00 65.79  ? 68   LEU C N   1 
ATOM   7790  C CA  . LEU C 1 72  ? -7.515  -9.537  3.029   1.00 66.90  ? 68   LEU C CA  1 
ATOM   7791  C C   . LEU C 1 72  ? -6.017  -9.624  2.738   1.00 64.97  ? 68   LEU C C   1 
ATOM   7792  O O   . LEU C 1 72  ? -5.401  -10.673 2.933   1.00 64.66  ? 68   LEU C O   1 
ATOM   7793  C CB  . LEU C 1 72  ? -8.321  -9.644  1.728   1.00 69.74  ? 68   LEU C CB  1 
ATOM   7794  C CG  . LEU C 1 72  ? -8.040  -10.802 0.761   1.00 71.35  ? 68   LEU C CG  1 
ATOM   7795  C CD1 . LEU C 1 72  ? -8.430  -12.150 1.365   1.00 72.43  ? 68   LEU C CD1 1 
ATOM   7796  C CD2 . LEU C 1 72  ? -8.757  -10.578 -0.566  1.00 74.03  ? 68   LEU C CD2 1 
ATOM   7797  N N   . ALA C 1 73  ? -5.442  -8.511  2.285   1.00 63.86  ? 69   ALA C N   1 
ATOM   7798  C CA  . ALA C 1 73  ? -4.018  -8.426  1.969   1.00 62.18  ? 69   ALA C CA  1 
ATOM   7799  C C   . ALA C 1 73  ? -3.135  -8.574  3.209   1.00 59.83  ? 69   ALA C C   1 
ATOM   7800  O O   . ALA C 1 73  ? -1.906  -8.551  3.109   1.00 58.39  ? 69   ALA C O   1 
ATOM   7801  C CB  . ALA C 1 73  ? -3.718  -7.112  1.264   1.00 61.64  ? 69   ALA C CB  1 
ATOM   7802  N N   . PHE C 1 74  ? -3.770  -8.735  4.369   1.00 59.80  ? 70   PHE C N   1 
ATOM   7803  C CA  . PHE C 1 74  ? -3.067  -8.777  5.649   1.00 57.78  ? 70   PHE C CA  1 
ATOM   7804  C C   . PHE C 1 74  ? -3.271  -10.099 6.398   1.00 58.53  ? 70   PHE C C   1 
ATOM   7805  O O   . PHE C 1 74  ? -2.554  -10.383 7.360   1.00 56.98  ? 70   PHE C O   1 
ATOM   7806  C CB  . PHE C 1 74  ? -3.494  -7.583  6.518   1.00 56.81  ? 70   PHE C CB  1 
ATOM   7807  C CG  . PHE C 1 74  ? -2.673  -7.408  7.769   1.00 54.37  ? 70   PHE C CG  1 
ATOM   7808  C CD1 . PHE C 1 74  ? -1.448  -6.756  7.726   1.00 52.40  ? 70   PHE C CD1 1 
ATOM   7809  C CD2 . PHE C 1 74  ? -3.129  -7.890  8.991   1.00 54.21  ? 70   PHE C CD2 1 
ATOM   7810  C CE1 . PHE C 1 74  ? -0.686  -6.594  8.877   1.00 50.55  ? 70   PHE C CE1 1 
ATOM   7811  C CE2 . PHE C 1 74  ? -2.373  -7.735  10.147  1.00 52.52  ? 70   PHE C CE2 1 
ATOM   7812  C CZ  . PHE C 1 74  ? -1.149  -7.085  10.091  1.00 50.61  ? 70   PHE C CZ  1 
ATOM   7813  N N   . SER C 1 75  ? -4.236  -10.907 5.956   1.00 61.09  ? 71   SER C N   1 
ATOM   7814  C CA  . SER C 1 75  ? -4.557  -12.178 6.625   1.00 62.37  ? 71   SER C CA  1 
ATOM   7815  C C   . SER C 1 75  ? -3.345  -13.113 6.764   1.00 61.54  ? 71   SER C C   1 
ATOM   7816  O O   . SER C 1 75  ? -2.338  -12.944 6.078   1.00 60.65  ? 71   SER C O   1 
ATOM   7817  C CB  . SER C 1 75  ? -5.741  -12.881 5.944   1.00 65.45  ? 71   SER C CB  1 
ATOM   7818  O OG  . SER C 1 75  ? -5.602  -12.920 4.533   1.00 66.80  ? 71   SER C OG  1 
ATOM   7819  N N   . LEU C 1 76  ? -3.455  -14.102 7.648   1.00 62.21  ? 72   LEU C N   1 
ATOM   7820  C CA  . LEU C 1 76  ? -2.301  -14.905 8.085   1.00 61.43  ? 72   LEU C CA  1 
ATOM   7821  C C   . LEU C 1 76  ? -1.724  -15.926 7.080   1.00 62.80  ? 72   LEU C C   1 
ATOM   7822  O O   . LEU C 1 76  ? -1.000  -16.849 7.465   1.00 62.78  ? 72   LEU C O   1 
ATOM   7823  C CB  . LEU C 1 76  ? -2.605  -15.570 9.436   1.00 61.57  ? 72   LEU C CB  1 
ATOM   7824  C CG  . LEU C 1 76  ? -2.569  -14.627 10.647  1.00 59.98  ? 72   LEU C CG  1 
ATOM   7825  C CD1 . LEU C 1 76  ? -3.587  -15.032 11.711  1.00 61.49  ? 72   LEU C CD1 1 
ATOM   7826  C CD2 . LEU C 1 76  ? -1.161  -14.527 11.237  1.00 57.57  ? 72   LEU C CD2 1 
ATOM   7827  N N   . GLY C 1 77  ? -2.029  -15.749 5.799   1.00 64.28  ? 73   GLY C N   1 
ATOM   7828  C CA  . GLY C 1 77  ? -1.421  -16.553 4.740   1.00 65.69  ? 73   GLY C CA  1 
ATOM   7829  C C   . GLY C 1 77  ? -1.079  -15.683 3.548   1.00 65.70  ? 73   GLY C C   1 
ATOM   7830  O O   . GLY C 1 77  ? -0.787  -16.187 2.461   1.00 67.20  ? 73   GLY C O   1 
ATOM   7831  N N   . SER C 1 78  ? -1.103  -14.370 3.769   1.00 64.17  ? 74   SER C N   1 
ATOM   7832  C CA  . SER C 1 78  ? -0.983  -13.374 2.706   1.00 64.36  ? 74   SER C CA  1 
ATOM   7833  C C   . SER C 1 78  ? 0.405   -13.306 2.081   1.00 63.58  ? 74   SER C C   1 
ATOM   7834  O O   . SER C 1 78  ? 1.407   -13.628 2.724   1.00 62.16  ? 74   SER C O   1 
ATOM   7835  C CB  . SER C 1 78  ? -1.373  -11.990 3.237   1.00 62.89  ? 74   SER C CB  1 
ATOM   7836  O OG  . SER C 1 78  ? -1.219  -10.988 2.246   1.00 63.07  ? 74   SER C OG  1 
ATOM   7837  N N   . VAL C 1 79  ? 0.439   -12.871 0.821   1.00 64.77  ? 75   VAL C N   1 
ATOM   7838  C CA  . VAL C 1 79  ? 1.678   -12.559 0.106   1.00 64.25  ? 75   VAL C CA  1 
ATOM   7839  C C   . VAL C 1 79  ? 2.488   -11.501 0.873   1.00 61.61  ? 75   VAL C C   1 
ATOM   7840  O O   . VAL C 1 79  ? 3.718   -11.574 0.935   1.00 60.60  ? 75   VAL C O   1 
ATOM   7841  C CB  . VAL C 1 79  ? 1.381   -12.064 -1.344  1.00 66.03  ? 75   VAL C CB  1 
ATOM   7842  C CG1 . VAL C 1 79  ? 2.669   -11.855 -2.130  1.00 65.77  ? 75   VAL C CG1 1 
ATOM   7843  C CG2 . VAL C 1 79  ? 0.467   -13.043 -2.080  1.00 68.82  ? 75   VAL C CG2 1 
ATOM   7844  N N   . TRP C 1 80  ? 1.781   -10.540 1.470   1.00 60.84  ? 76   TRP C N   1 
ATOM   7845  C CA  . TRP C 1 80  ? 2.385   -9.434  2.222   1.00 58.54  ? 76   TRP C CA  1 
ATOM   7846  C C   . TRP C 1 80  ? 2.856   -9.851  3.624   1.00 57.06  ? 76   TRP C C   1 
ATOM   7847  O O   . TRP C 1 80  ? 3.702   -9.185  4.232   1.00 55.22  ? 76   TRP C O   1 
ATOM   7848  C CB  . TRP C 1 80  ? 1.399   -8.258  2.295   1.00 58.41  ? 76   TRP C CB  1 
ATOM   7849  C CG  . TRP C 1 80  ? 1.939   -7.009  2.948   1.00 56.14  ? 76   TRP C CG  1 
ATOM   7850  C CD1 . TRP C 1 80  ? 1.572   -6.498  4.161   1.00 54.66  ? 76   TRP C CD1 1 
ATOM   7851  C CD2 . TRP C 1 80  ? 2.935   -6.118  2.424   1.00 55.06  ? 76   TRP C CD2 1 
ATOM   7852  N NE1 . TRP C 1 80  ? 2.273   -5.348  4.423   1.00 52.77  ? 76   TRP C NE1 1 
ATOM   7853  C CE2 . TRP C 1 80  ? 3.120   -5.092  3.377   1.00 53.08  ? 76   TRP C CE2 1 
ATOM   7854  C CE3 . TRP C 1 80  ? 3.692   -6.087  1.243   1.00 55.67  ? 76   TRP C CE3 1 
ATOM   7855  C CZ2 . TRP C 1 80  ? 4.030   -4.046  3.188   1.00 51.93  ? 76   TRP C CZ2 1 
ATOM   7856  C CZ3 . TRP C 1 80  ? 4.597   -5.045  1.056   1.00 54.44  ? 76   TRP C CZ3 1 
ATOM   7857  C CH2 . TRP C 1 80  ? 4.756   -4.040  2.025   1.00 52.56  ? 76   TRP C CH2 1 
ATOM   7858  N N   . ARG C 1 81  ? 2.314   -10.957 4.129   1.00 58.12  ? 77   ARG C N   1 
ATOM   7859  C CA  . ARG C 1 81  ? 2.711   -11.470 5.442   1.00 57.07  ? 77   ARG C CA  1 
ATOM   7860  C C   . ARG C 1 81  ? 3.784   -12.554 5.341   1.00 57.33  ? 77   ARG C C   1 
ATOM   7861  O O   . ARG C 1 81  ? 4.661   -12.640 6.201   1.00 55.94  ? 77   ARG C O   1 
ATOM   7862  C CB  . ARG C 1 81  ? 1.496   -11.971 6.228   1.00 57.90  ? 77   ARG C CB  1 
ATOM   7863  C CG  . ARG C 1 81  ? 0.411   -10.921 6.404   1.00 58.12  ? 77   ARG C CG  1 
ATOM   7864  C CD  . ARG C 1 81  ? 0.729   -9.928  7.512   1.00 56.07  ? 77   ARG C CD  1 
ATOM   7865  N NE  . ARG C 1 81  ? 0.032   -10.260 8.751   1.00 56.51  ? 77   ARG C NE  1 
ATOM   7866  C CZ  . ARG C 1 81  ? 0.575   -10.914 9.774   1.00 56.24  ? 77   ARG C CZ  1 
ATOM   7867  N NH1 . ARG C 1 81  ? 1.840   -11.313 9.722   1.00 55.53  ? 77   ARG C NH1 1 
ATOM   7868  N NH2 . ARG C 1 81  ? -0.150  -11.169 10.856  1.00 56.81  ? 77   ARG C NH2 1 
ATOM   7869  N N   . ARG C 1 82  ? 3.714   -13.373 4.291   1.00 59.47  ? 78   ARG C N   1 
ATOM   7870  C CA  . ARG C 1 82  ? 4.729   -14.401 4.035   1.00 60.19  ? 78   ARG C CA  1 
ATOM   7871  C C   . ARG C 1 82  ? 6.046   -13.785 3.568   1.00 59.12  ? 78   ARG C C   1 
ATOM   7872  O O   . ARG C 1 82  ? 7.106   -14.410 3.671   1.00 59.06  ? 78   ARG C O   1 
ATOM   7873  C CB  . ARG C 1 82  ? 4.239   -15.427 3.003   1.00 62.92  ? 78   ARG C CB  1 
ATOM   7874  C CG  . ARG C 1 82  ? 3.207   -16.412 3.537   1.00 64.70  ? 78   ARG C CG  1 
ATOM   7875  C CD  . ARG C 1 82  ? 3.226   -17.729 2.770   1.00 67.93  ? 78   ARG C CD  1 
ATOM   7876  N NE  . ARG C 1 82  ? 4.386   -18.552 3.120   1.00 68.21  ? 78   ARG C NE  1 
ATOM   7877  C CZ  . ARG C 1 82  ? 4.518   -19.845 2.827   1.00 70.51  ? 78   ARG C CZ  1 
ATOM   7878  N NH1 . ARG C 1 82  ? 3.559   -20.494 2.176   1.00 73.17  ? 78   ARG C NH1 1 
ATOM   7879  N NH2 . ARG C 1 82  ? 5.613   -20.497 3.193   1.00 70.28  ? 78   ARG C NH2 1 
ATOM   7880  N N   . MET C 1 83  ? 5.962   -12.557 3.059   1.00 58.52  ? 79   MET C N   1 
ATOM   7881  C CA  . MET C 1 83  ? 7.113   -11.832 2.533   1.00 57.76  ? 79   MET C CA  1 
ATOM   7882  C C   . MET C 1 83  ? 8.194   -11.658 3.591   1.00 55.68  ? 79   MET C C   1 
ATOM   7883  O O   . MET C 1 83  ? 7.896   -11.353 4.749   1.00 54.33  ? 79   MET C O   1 
ATOM   7884  C CB  . MET C 1 83  ? 6.670   -10.466 1.998   1.00 57.52  ? 79   MET C CB  1 
ATOM   7885  C CG  . MET C 1 83  ? 7.733   -9.712  1.211   1.00 57.63  ? 79   MET C CG  1 
ATOM   7886  S SD  . MET C 1 83  ? 7.073   -8.334  0.243   1.00 59.15  ? 79   MET C SD  1 
ATOM   7887  C CE  . MET C 1 83  ? 6.333   -9.198  -1.144  1.00 61.72  ? 79   MET C CE  1 
ATOM   7888  N N   . ASP C 1 84  ? 9.443   -11.879 3.188   1.00 55.72  ? 80   ASP C N   1 
ATOM   7889  C CA  . ASP C 1 84  ? 10.596  -11.571 4.030   1.00 54.01  ? 80   ASP C CA  1 
ATOM   7890  C C   . ASP C 1 84  ? 10.642  -10.067 4.260   1.00 52.50  ? 80   ASP C C   1 
ATOM   7891  O O   . ASP C 1 84  ? 10.406  -9.290  3.333   1.00 53.11  ? 80   ASP C O   1 
ATOM   7892  C CB  . ASP C 1 84  ? 11.895  -12.032 3.364   1.00 54.75  ? 80   ASP C CB  1 
ATOM   7893  C CG  . ASP C 1 84  ? 11.998  -13.541 3.264   1.00 56.23  ? 80   ASP C CG  1 
ATOM   7894  O OD1 . ASP C 1 84  ? 11.820  -14.227 4.294   1.00 55.63  ? 80   ASP C OD1 1 
ATOM   7895  O OD2 . ASP C 1 84  ? 12.271  -14.041 2.154   1.00 58.16  ? 80   ASP C OD2 1 
ATOM   7896  N N   . ALA C 1 85  ? 10.936  -9.662  5.493   1.00 50.79  ? 81   ALA C N   1 
ATOM   7897  C CA  . ALA C 1 85  ? 10.990  -8.241  5.847   1.00 49.51  ? 81   ALA C CA  1 
ATOM   7898  C C   . ALA C 1 85  ? 11.929  -7.451  4.927   1.00 49.73  ? 81   ALA C C   1 
ATOM   7899  O O   . ALA C 1 85  ? 11.644  -6.302  4.576   1.00 49.56  ? 81   ALA C O   1 
ATOM   7900  C CB  . ALA C 1 85  ? 11.386  -8.067  7.312   1.00 47.91  ? 81   ALA C CB  1 
ATOM   7901  N N   . SER C 1 86  ? 13.030  -8.089  4.529   1.00 50.36  ? 82   SER C N   1 
ATOM   7902  C CA  . SER C 1 86  ? 14.037  -7.489  3.650   1.00 50.92  ? 82   SER C CA  1 
ATOM   7903  C C   . SER C 1 86  ? 13.482  -7.100  2.287   1.00 52.32  ? 82   SER C C   1 
ATOM   7904  O O   . SER C 1 86  ? 13.977  -6.171  1.654   1.00 52.44  ? 82   SER C O   1 
ATOM   7905  C CB  . SER C 1 86  ? 15.213  -8.450  3.467   1.00 51.73  ? 82   SER C CB  1 
ATOM   7906  O OG  . SER C 1 86  ? 14.788  -9.662  2.865   1.00 53.51  ? 82   SER C OG  1 
ATOM   7907  N N   . GLU C 1 87  ? 12.457  -7.824  1.850   1.00 53.63  ? 83   GLU C N   1 
ATOM   7908  C CA  . GLU C 1 87  ? 11.828  -7.596  0.551   1.00 55.53  ? 83   GLU C CA  1 
ATOM   7909  C C   . GLU C 1 87  ? 10.770  -6.490  0.605   1.00 54.86  ? 83   GLU C C   1 
ATOM   7910  O O   . GLU C 1 87  ? 10.494  -5.842  -0.405  1.00 55.92  ? 83   GLU C O   1 
ATOM   7911  C CB  . GLU C 1 87  ? 11.224  -8.896  0.022   1.00 57.37  ? 83   GLU C CB  1 
ATOM   7912  C CG  . GLU C 1 87  ? 11.131  -8.970  -1.488  1.00 60.51  ? 83   GLU C CG  1 
ATOM   7913  C CD  . GLU C 1 87  ? 10.787  -10.363 -1.980  1.00 63.92  ? 83   GLU C CD  1 
ATOM   7914  O OE1 . GLU C 1 87  ? 10.371  -11.208 -1.153  1.00 64.09  ? 83   GLU C OE1 1 
ATOM   7915  O OE2 . GLU C 1 87  ? 10.932  -10.616 -3.196  1.00 66.46  ? 83   GLU C OE2 1 
ATOM   7916  N N   . ARG C 1 88  ? 10.180  -6.288  1.783   1.00 53.34  ? 84   ARG C N   1 
ATOM   7917  C CA  . ARG C 1 88  ? 9.257   -5.173  2.015   1.00 52.70  ? 84   ARG C CA  1 
ATOM   7918  C C   . ARG C 1 88  ? 9.997   -3.847  1.855   1.00 52.07  ? 84   ARG C C   1 
ATOM   7919  O O   . ARG C 1 88  ? 9.429   -2.854  1.389   1.00 52.48  ? 84   ARG C O   1 
ATOM   7920  C CB  . ARG C 1 88  ? 8.604   -5.273  3.398   1.00 51.30  ? 84   ARG C CB  1 
ATOM   7921  C CG  . ARG C 1 88  ? 7.581   -6.395  3.502   1.00 52.14  ? 84   ARG C CG  1 
ATOM   7922  C CD  . ARG C 1 88  ? 6.649   -6.224  4.686   1.00 50.84  ? 84   ARG C CD  1 
ATOM   7923  N NE  . ARG C 1 88  ? 7.170   -6.835  5.907   1.00 49.70  ? 84   ARG C NE  1 
ATOM   7924  C CZ  . ARG C 1 88  ? 7.763   -6.165  6.893   1.00 48.12  ? 84   ARG C CZ  1 
ATOM   7925  N NH1 . ARG C 1 88  ? 7.922   -4.851  6.809   1.00 47.46  ? 84   ARG C NH1 1 
ATOM   7926  N NH2 . ARG C 1 88  ? 8.197   -6.810  7.967   1.00 46.97  ? 84   ARG C NH2 1 
ATOM   7927  N N   . GLY C 1 89  ? 11.273  -3.850  2.238   1.00 51.15  ? 85   GLY C N   1 
ATOM   7928  C CA  . GLY C 1 89  ? 12.168  -2.730  1.982   1.00 50.66  ? 85   GLY C CA  1 
ATOM   7929  C C   . GLY C 1 89  ? 12.531  -2.650  0.514   1.00 52.35  ? 85   GLY C C   1 
ATOM   7930  O O   . GLY C 1 89  ? 12.686  -1.560  -0.030  1.00 52.80  ? 85   GLY C O   1 
ATOM   7931  N N   . ARG C 1 90  ? 12.659  -3.811  -0.128  1.00 53.52  ? 86   ARG C N   1 
ATOM   7932  C CA  . ARG C 1 90  ? 13.020  -3.881  -1.546  1.00 55.46  ? 86   ARG C CA  1 
ATOM   7933  C C   . ARG C 1 90  ? 11.947  -3.250  -2.428  1.00 56.48  ? 86   ARG C C   1 
ATOM   7934  O O   . ARG C 1 90  ? 12.260  -2.572  -3.408  1.00 57.62  ? 86   ARG C O   1 
ATOM   7935  C CB  . ARG C 1 90  ? 13.300  -5.328  -1.975  1.00 56.82  ? 86   ARG C CB  1 
ATOM   7936  C CG  . ARG C 1 90  ? 14.665  -5.860  -1.543  1.00 56.71  ? 86   ARG C CG  1 
ATOM   7937  C CD  . ARG C 1 90  ? 15.718  -5.699  -2.636  1.00 59.47  ? 86   ARG C CD  1 
ATOM   7938  N NE  . ARG C 1 90  ? 15.909  -4.307  -3.042  1.00 60.20  ? 86   ARG C NE  1 
ATOM   7939  C CZ  . ARG C 1 90  ? 16.346  -3.921  -4.239  1.00 62.49  ? 86   ARG C CZ  1 
ATOM   7940  N NH1 . ARG C 1 90  ? 16.645  -4.819  -5.174  1.00 64.39  ? 86   ARG C NH1 1 
ATOM   7941  N NH2 . ARG C 1 90  ? 16.479  -2.627  -4.505  1.00 62.66  ? 86   ARG C NH2 1 
ATOM   7942  N N   . LEU C 1 91  ? 10.685  -3.468  -2.061  1.00 56.11  ? 87   LEU C N   1 
ATOM   7943  C CA  . LEU C 1 91  ? 9.558   -2.861  -2.767  1.00 57.12  ? 87   LEU C CA  1 
ATOM   7944  C C   . LEU C 1 91  ? 9.449   -1.372  -2.447  1.00 56.16  ? 87   LEU C C   1 
ATOM   7945  O O   . LEU C 1 91  ? 8.892   -0.605  -3.237  1.00 57.35  ? 87   LEU C O   1 
ATOM   7946  C CB  . LEU C 1 91  ? 8.243   -3.587  -2.454  1.00 57.36  ? 87   LEU C CB  1 
ATOM   7947  C CG  . LEU C 1 91  ? 8.097   -5.056  -2.880  1.00 58.60  ? 87   LEU C CG  1 
ATOM   7948  C CD1 . LEU C 1 91  ? 6.758   -5.603  -2.414  1.00 58.73  ? 87   LEU C CD1 1 
ATOM   7949  C CD2 . LEU C 1 91  ? 8.257   -5.253  -4.386  1.00 60.74  ? 87   LEU C CD2 1 
ATOM   7950  N N   . LEU C 1 92  ? 9.985   -0.972  -1.292  1.00 54.07  ? 88   LEU C N   1 
ATOM   7951  C CA  . LEU C 1 92  ? 10.106  0.443   -0.947  1.00 53.18  ? 88   LEU C CA  1 
ATOM   7952  C C   . LEU C 1 92  ? 11.261  1.099   -1.704  1.00 53.78  ? 88   LEU C C   1 
ATOM   7953  O O   . LEU C 1 92  ? 11.164  2.260   -2.112  1.00 54.32  ? 88   LEU C O   1 
ATOM   7954  C CB  . LEU C 1 92  ? 10.276  0.633   0.563   1.00 51.07  ? 88   LEU C CB  1 
ATOM   7955  C CG  . LEU C 1 92  ? 9.019   0.769   1.430   1.00 50.58  ? 88   LEU C CG  1 
ATOM   7956  C CD1 . LEU C 1 92  ? 9.382   0.708   2.910   1.00 48.79  ? 88   LEU C CD1 1 
ATOM   7957  C CD2 . LEU C 1 92  ? 8.254   2.055   1.128   1.00 51.03  ? 88   LEU C CD2 1 
ATOM   7958  N N   . ASP C 1 93  ? 12.341  0.345   -1.898  1.00 53.87  ? 89   ASP C N   1 
ATOM   7959  C CA  . ASP C 1 93  ? 13.512  0.830   -2.625  1.00 54.79  ? 89   ASP C CA  1 
ATOM   7960  C C   . ASP C 1 93  ? 13.224  0.977   -4.122  1.00 57.15  ? 89   ASP C C   1 
ATOM   7961  O O   . ASP C 1 93  ? 13.658  1.946   -4.745  1.00 58.18  ? 89   ASP C O   1 
ATOM   7962  C CB  . ASP C 1 93  ? 14.710  -0.096  -2.395  1.00 54.60  ? 89   ASP C CB  1 
ATOM   7963  C CG  . ASP C 1 93  ? 16.047  0.620   -2.539  1.00 54.99  ? 89   ASP C CG  1 
ATOM   7964  O OD1 . ASP C 1 93  ? 16.104  1.849   -2.324  1.00 54.50  ? 89   ASP C OD1 1 
ATOM   7965  O OD2 . ASP C 1 93  ? 17.051  -0.054  -2.853  1.00 56.30  ? 89   ASP C OD2 1 
ATOM   7966  N N   . LYS C 1 94  ? 12.490  0.020   -4.689  1.00 58.13  ? 90   LYS C N   1 
ATOM   7967  C CA  . LYS C 1 94  ? 12.089  0.087   -6.093  1.00 60.49  ? 90   LYS C CA  1 
ATOM   7968  C C   . LYS C 1 94  ? 11.049  1.190   -6.327  1.00 60.78  ? 90   LYS C C   1 
ATOM   7969  O O   . LYS C 1 94  ? 10.966  1.745   -7.424  1.00 62.79  ? 90   LYS C O   1 
ATOM   7970  C CB  . LYS C 1 94  ? 11.588  -1.281  -6.589  1.00 61.86  ? 90   LYS C CB  1 
ATOM   7971  C CG  . LYS C 1 94  ? 10.962  -1.290  -7.998  1.00 65.08  ? 90   LYS C CG  1 
ATOM   7972  C CD  . LYS C 1 94  ? 11.965  -0.977  -9.117  1.00 67.58  ? 90   LYS C CD  1 
ATOM   7973  C CE  . LYS C 1 94  ? 12.414  -2.231  -9.858  1.00 69.95  ? 90   LYS C CE  1 
ATOM   7974  N NZ  . LYS C 1 94  ? 13.288  -3.108  -9.033  1.00 69.35  ? 90   LYS C NZ  1 
ATOM   7975  N N   . LEU C 1 95  ? 10.267  1.510   -5.297  1.00 58.98  ? 91   LEU C N   1 
ATOM   7976  C CA  . LEU C 1 95  ? 9.311   2.619   -5.376  1.00 59.21  ? 91   LEU C CA  1 
ATOM   7977  C C   . LEU C 1 95  ? 10.052  3.941   -5.528  1.00 59.23  ? 91   LEU C C   1 
ATOM   7978  O O   . LEU C 1 95  ? 9.609   4.832   -6.256  1.00 60.70  ? 91   LEU C O   1 
ATOM   7979  C CB  . LEU C 1 95  ? 8.395   2.655   -4.144  1.00 57.52  ? 91   LEU C CB  1 
ATOM   7980  C CG  . LEU C 1 95  ? 7.254   3.683   -4.079  1.00 57.61  ? 91   LEU C CG  1 
ATOM   7981  C CD1 . LEU C 1 95  ? 6.311   3.568   -5.272  1.00 59.73  ? 91   LEU C CD1 1 
ATOM   7982  C CD2 . LEU C 1 95  ? 6.480   3.534   -2.779  1.00 55.75  ? 91   LEU C CD2 1 
ATOM   7983  N N   . ALA C 1 96  ? 11.189  4.046   -4.843  1.00 57.73  ? 92   ALA C N   1 
ATOM   7984  C CA  . ALA C 1 96  ? 12.040  5.228   -4.908  1.00 57.76  ? 92   ALA C CA  1 
ATOM   7985  C C   . ALA C 1 96  ? 12.634  5.420   -6.302  1.00 59.99  ? 92   ALA C C   1 
ATOM   7986  O O   . ALA C 1 96  ? 12.739  6.550   -6.781  1.00 61.00  ? 92   ALA C O   1 
ATOM   7987  C CB  . ALA C 1 96  ? 13.135  5.142   -3.861  1.00 56.00  ? 92   ALA C CB  1 
ATOM   7988  N N   . ASP C 1 97  ? 13.010  4.309   -6.941  1.00 60.90  ? 93   ASP C N   1 
ATOM   7989  C CA  . ASP C 1 97  ? 13.521  4.309   -8.314  1.00 63.32  ? 93   ASP C CA  1 
ATOM   7990  C C   . ASP C 1 97  ? 12.531  4.957   -9.268  1.00 65.17  ? 93   ASP C C   1 
ATOM   7991  O O   . ASP C 1 97  ? 12.920  5.723   -10.154 1.00 67.11  ? 93   ASP C O   1 
ATOM   7992  C CB  . ASP C 1 97  ? 13.791  2.877   -8.795  1.00 64.24  ? 93   ASP C CB  1 
ATOM   7993  C CG  . ASP C 1 97  ? 15.065  2.286   -8.225  1.00 63.30  ? 93   ASP C CG  1 
ATOM   7994  O OD1 . ASP C 1 97  ? 15.994  3.047   -7.885  1.00 63.03  ? 93   ASP C OD1 1 
ATOM   7995  O OD2 . ASP C 1 97  ? 15.140  1.042   -8.139  1.00 63.41  ? 93   ASP C OD2 1 
ATOM   7996  N N   . LEU C 1 98  ? 11.253  4.641   -9.078  1.00 64.71  ? 94   LEU C N   1 
ATOM   7997  C CA  . LEU C 1 98  ? 10.199  5.106   -9.969  1.00 66.56  ? 94   LEU C CA  1 
ATOM   7998  C C   . LEU C 1 98  ? 9.893   6.579   -9.745  1.00 66.32  ? 94   LEU C C   1 
ATOM   7999  O O   . LEU C 1 98  ? 9.658   7.319   -10.700 1.00 68.43  ? 94   LEU C O   1 
ATOM   8000  C CB  . LEU C 1 98  ? 8.940   4.248   -9.814  1.00 66.48  ? 94   LEU C CB  1 
ATOM   8001  C CG  . LEU C 1 98  ? 9.099   2.758   -10.148 1.00 66.97  ? 94   LEU C CG  1 
ATOM   8002  C CD1 . LEU C 1 98  ? 7.809   2.010   -9.885  1.00 66.84  ? 94   LEU C CD1 1 
ATOM   8003  C CD2 . LEU C 1 98  ? 9.558   2.539   -11.587 1.00 69.66  ? 94   LEU C CD2 1 
ATOM   8004  N N   . VAL C 1 99  ? 9.913   6.999   -8.484  1.00 63.87  ? 95   VAL C N   1 
ATOM   8005  C CA  . VAL C 1 99  ? 9.752   8.408   -8.140  1.00 63.53  ? 95   VAL C CA  1 
ATOM   8006  C C   . VAL C 1 99  ? 10.935  9.208   -8.690  1.00 64.54  ? 95   VAL C C   1 
ATOM   8007  O O   . VAL C 1 99  ? 10.770  10.350  -9.109  1.00 65.91  ? 95   VAL C O   1 
ATOM   8008  C CB  . VAL C 1 99  ? 9.585   8.615   -6.612  1.00 60.89  ? 95   VAL C CB  1 
ATOM   8009  C CG1 . VAL C 1 99  ? 9.478   10.093  -6.263  1.00 60.86  ? 95   VAL C CG1 1 
ATOM   8010  C CG2 . VAL C 1 99  ? 8.355   7.877   -6.111  1.00 59.99  ? 95   VAL C CG2 1 
ATOM   8011  N N   . GLU C 1 100 ? 12.117  8.595   -8.703  1.00 64.15  ? 96   GLU C N   1 
ATOM   8012  C CA  . GLU C 1 100 ? 13.314  9.220   -9.273  1.00 65.48  ? 96   GLU C CA  1 
ATOM   8013  C C   . GLU C 1 100 ? 13.233  9.314   -10.797 1.00 68.49  ? 96   GLU C C   1 
ATOM   8014  O O   . GLU C 1 100 ? 13.596  10.340  -11.378 1.00 70.11  ? 96   GLU C O   1 
ATOM   8015  C CB  . GLU C 1 100 ? 14.581  8.463   -8.852  1.00 64.51  ? 96   GLU C CB  1 
ATOM   8016  C CG  . GLU C 1 100 ? 15.885  9.001   -9.453  1.00 66.25  ? 96   GLU C CG  1 
ATOM   8017  C CD  . GLU C 1 100 ? 16.335  10.314  -8.830  1.00 65.92  ? 96   GLU C CD  1 
ATOM   8018  O OE1 . GLU C 1 100 ? 16.807  10.293  -7.672  1.00 63.85  ? 96   GLU C OE1 1 
ATOM   8019  O OE2 . GLU C 1 100 ? 16.229  11.362  -9.505  1.00 67.68  ? 96   GLU C OE2 1 
ATOM   8020  N N   . ARG C 1 101 ? 12.766  8.240   -11.432 1.00 69.39  ? 97   ARG C N   1 
ATOM   8021  C CA  . ARG C 1 101 ? 12.602  8.198   -12.885 1.00 72.41  ? 97   ARG C CA  1 
ATOM   8022  C C   . ARG C 1 101 ? 11.581  9.239   -13.339 1.00 73.88  ? 97   ARG C C   1 
ATOM   8023  O O   . ARG C 1 101 ? 11.790  9.938   -14.334 1.00 76.42  ? 97   ARG C O   1 
ATOM   8024  C CB  . ARG C 1 101 ? 12.167  6.801   -13.334 1.00 73.01  ? 97   ARG C CB  1 
ATOM   8025  C CG  . ARG C 1 101 ? 11.979  6.648   -14.844 1.00 75.99  ? 97   ARG C CG  1 
ATOM   8026  C CD  . ARG C 1 101 ? 11.142  5.423   -15.177 1.00 75.85  ? 97   ARG C CD  1 
ATOM   8027  N NE  . ARG C 1 101 ? 9.759   5.559   -14.721 1.00 74.57  ? 97   ARG C NE  1 
ATOM   8028  C CZ  . ARG C 1 101 ? 8.886   4.558   -14.635 1.00 74.31  ? 97   ARG C CZ  1 
ATOM   8029  N NH1 . ARG C 1 101 ? 9.239   3.323   -14.968 1.00 74.84  ? 97   ARG C NH1 1 
ATOM   8030  N NH2 . ARG C 1 101 ? 7.652   4.791   -14.209 1.00 73.62  ? 97   ARG C NH2 1 
ATOM   8031  N N   . ASP C 1 102 ? 10.485  9.333   -12.593 1.00 72.51  ? 98   ASP C N   1 
ATOM   8032  C CA  . ASP C 1 102 ? 9.412   10.274  -12.887 1.00 73.80  ? 98   ASP C CA  1 
ATOM   8033  C C   . ASP C 1 102 ? 9.491   11.499  -11.975 1.00 72.44  ? 98   ASP C C   1 
ATOM   8034  O O   . ASP C 1 102 ? 8.466   12.018  -11.525 1.00 72.10  ? 98   ASP C O   1 
ATOM   8035  C CB  . ASP C 1 102 ? 8.049   9.583   -12.749 1.00 73.64  ? 98   ASP C CB  1 
ATOM   8036  C CG  . ASP C 1 102 ? 7.924   8.344   -13.623 1.00 75.22  ? 98   ASP C CG  1 
ATOM   8037  O OD1 . ASP C 1 102 ? 8.771   8.141   -14.520 1.00 77.10  ? 98   ASP C OD1 1 
ATOM   8038  O OD2 . ASP C 1 102 ? 6.969   7.569   -13.408 1.00 74.89  ? 98   ASP C OD2 1 
ATOM   8039  N N   . ARG C 1 103 ? 10.715  11.954  -11.709 1.00 71.89  ? 99   ARG C N   1 
ATOM   8040  C CA  . ARG C 1 103 ? 10.948  13.135  -10.879 1.00 70.91  ? 99   ARG C CA  1 
ATOM   8041  C C   . ARG C 1 103 ? 10.453  14.397  -11.578 1.00 73.25  ? 99   ARG C C   1 
ATOM   8042  O O   . ARG C 1 103 ? 9.923   15.305  -10.932 1.00 72.74  ? 99   ARG C O   1 
ATOM   8043  C CB  . ARG C 1 103 ? 12.433  13.261  -10.522 1.00 70.15  ? 99   ARG C CB  1 
ATOM   8044  C CG  . ARG C 1 103 ? 12.725  14.210  -9.365  1.00 68.76  ? 99   ARG C CG  1 
ATOM   8045  C CD  . ARG C 1 103 ? 14.174  14.118  -8.909  1.00 68.22  ? 99   ARG C CD  1 
ATOM   8046  N NE  . ARG C 1 103 ? 14.492  15.158  -7.932  1.00 67.76  ? 99   ARG C NE  1 
ATOM   8047  C CZ  . ARG C 1 103 ? 15.517  15.116  -7.084  1.00 66.89  ? 99   ARG C CZ  1 
ATOM   8048  N NH1 . ARG C 1 103 ? 16.342  14.077  -7.067  1.00 66.51  ? 99   ARG C NH1 1 
ATOM   8049  N NH2 . ARG C 1 103 ? 15.715  16.118  -6.240  1.00 66.80  ? 99   ARG C NH2 1 
ATOM   8050  N N   . ALA C 1 104 ? 10.620  14.434  -12.899 1.00 76.02  ? 100  ALA C N   1 
ATOM   8051  C CA  . ALA C 1 104 ? 10.192  15.564  -13.718 1.00 78.69  ? 100  ALA C CA  1 
ATOM   8052  C C   . ALA C 1 104 ? 8.674   15.771  -13.696 1.00 79.20  ? 100  ALA C C   1 
ATOM   8053  O O   . ALA C 1 104 ? 8.205   16.893  -13.506 1.00 79.83  ? 100  ALA C O   1 
ATOM   8054  C CB  . ALA C 1 104 ? 10.699  15.404  -15.152 1.00 81.63  ? 100  ALA C CB  1 
ATOM   8055  N N   . VAL C 1 105 ? 7.918   14.687  -13.872 1.00 79.08  ? 101  VAL C N   1 
ATOM   8056  C CA  . VAL C 1 105 ? 6.455   14.763  -13.991 1.00 80.05  ? 101  VAL C CA  1 
ATOM   8057  C C   . VAL C 1 105 ? 5.708   14.877  -12.653 1.00 77.74  ? 101  VAL C C   1 
ATOM   8058  O O   . VAL C 1 105 ? 4.654   15.515  -12.588 1.00 78.76  ? 101  VAL C O   1 
ATOM   8059  C CB  . VAL C 1 105 ? 5.863   13.602  -14.850 1.00 81.42  ? 101  VAL C CB  1 
ATOM   8060  C CG1 . VAL C 1 105 ? 6.284   13.738  -16.303 1.00 84.69  ? 101  VAL C CG1 1 
ATOM   8061  C CG2 . VAL C 1 105 ? 6.271   12.241  -14.311 1.00 79.29  ? 101  VAL C CG2 1 
ATOM   8062  N N   . LEU C 1 106 ? 6.246   14.264  -11.598 1.00 74.91  ? 102  LEU C N   1 
ATOM   8063  C CA  . LEU C 1 106 ? 5.636   14.335  -10.267 1.00 72.75  ? 102  LEU C CA  1 
ATOM   8064  C C   . LEU C 1 106 ? 5.741   15.727  -9.658  1.00 72.75  ? 102  LEU C C   1 
ATOM   8065  O O   . LEU C 1 106 ? 4.822   16.180  -8.975  1.00 72.50  ? 102  LEU C O   1 
ATOM   8066  C CB  . LEU C 1 106 ? 6.252   13.305  -9.315  1.00 69.90  ? 102  LEU C CB  1 
ATOM   8067  C CG  . LEU C 1 106 ? 5.616   11.915  -9.205  1.00 69.13  ? 102  LEU C CG  1 
ATOM   8068  C CD1 . LEU C 1 106 ? 6.600   10.929  -8.588  1.00 66.74  ? 102  LEU C CD1 1 
ATOM   8069  C CD2 . LEU C 1 106 ? 4.317   11.949  -8.403  1.00 68.17  ? 102  LEU C CD2 1 
ATOM   8070  N N   . ALA C 1 107 ? 6.866   16.397  -9.902  1.00 73.32  ? 103  ALA C N   1 
ATOM   8071  C CA  . ALA C 1 107 ? 7.054   17.774  -9.457  1.00 73.84  ? 103  ALA C CA  1 
ATOM   8072  C C   . ALA C 1 107 ? 6.187   18.735  -10.270 1.00 76.92  ? 103  ALA C C   1 
ATOM   8073  O O   . ALA C 1 107 ? 5.751   19.766  -9.753  1.00 77.32  ? 103  ALA C O   1 
ATOM   8074  C CB  . ALA C 1 107 ? 8.521   18.170  -9.534  1.00 73.71  ? 103  ALA C CB  1 
ATOM   8075  N N   . THR C 1 108 ? 5.939   18.384  -11.535 1.00 79.31  ? 104  THR C N   1 
ATOM   8076  C CA  . THR C 1 108 ? 5.056   19.158  -12.417 1.00 82.53  ? 104  THR C CA  1 
ATOM   8077  C C   . THR C 1 108 ? 3.609   19.135  -11.905 1.00 82.57  ? 104  THR C C   1 
ATOM   8078  O O   . THR C 1 108 ? 2.927   20.164  -11.913 1.00 84.15  ? 104  THR C O   1 
ATOM   8079  C CB  . THR C 1 108 ? 5.115   18.659  -13.889 1.00 85.05  ? 104  THR C CB  1 
ATOM   8080  O OG1 . THR C 1 108 ? 6.480   18.513  -14.300 1.00 85.17  ? 104  THR C OG1 1 
ATOM   8081  C CG2 . THR C 1 108 ? 4.419   19.640  -14.831 1.00 88.41  ? 104  THR C CG2 1 
ATOM   8082  N N   . MET C 1 109 ? 3.156   17.960  -11.463 1.00 80.97  ? 105  MET C N   1 
ATOM   8083  C CA  . MET C 1 109 ? 1.849   17.819  -10.824 1.00 80.75  ? 105  MET C CA  1 
ATOM   8084  C C   . MET C 1 109 ? 1.784   18.608  -9.524  1.00 79.12  ? 105  MET C C   1 
ATOM   8085  O O   . MET C 1 109 ? 0.822   19.338  -9.290  1.00 80.32  ? 105  MET C O   1 
ATOM   8086  C CB  . MET C 1 109 ? 1.527   16.348  -10.556 1.00 79.31  ? 105  MET C CB  1 
ATOM   8087  C CG  . MET C 1 109 ? 0.474   15.767  -11.480 1.00 82.12  ? 105  MET C CG  1 
ATOM   8088  S SD  . MET C 1 109 ? 0.225   14.000  -11.215 1.00 81.79  ? 105  MET C SD  1 
ATOM   8089  C CE  . MET C 1 109 ? 1.582   13.321  -12.166 1.00 81.74  ? 105  MET C CE  1 
ATOM   8090  N N   . GLU C 1 110 ? 2.820   18.465  -8.697  1.00 76.58  ? 106  GLU C N   1 
ATOM   8091  C CA  . GLU C 1 110 ? 2.903   19.140  -7.402  1.00 75.02  ? 106  GLU C CA  1 
ATOM   8092  C C   . GLU C 1 110 ? 3.000   20.659  -7.549  1.00 76.74  ? 106  GLU C C   1 
ATOM   8093  O O   . GLU C 1 110 ? 2.564   21.403  -6.666  1.00 76.51  ? 106  GLU C O   1 
ATOM   8094  C CB  . GLU C 1 110 ? 4.093   18.609  -6.596  1.00 72.35  ? 106  GLU C CB  1 
ATOM   8095  C CG  . GLU C 1 110 ? 4.022   18.889  -5.092  1.00 70.77  ? 106  GLU C CG  1 
ATOM   8096  C CD  . GLU C 1 110 ? 3.233   17.841  -4.314  1.00 69.81  ? 106  GLU C CD  1 
ATOM   8097  O OE1 . GLU C 1 110 ? 2.336   17.190  -4.890  1.00 70.62  ? 106  GLU C OE1 1 
ATOM   8098  O OE2 . GLU C 1 110 ? 3.516   17.670  -3.109  1.00 68.37  ? 106  GLU C OE2 1 
ATOM   8099  N N   . SER C 1 111 ? 3.577   21.109  -8.661  1.00 78.57  ? 107  SER C N   1 
ATOM   8100  C CA  . SER C 1 111 ? 3.638   22.532  -8.983  1.00 80.71  ? 107  SER C CA  1 
ATOM   8101  C C   . SER C 1 111 ? 2.311   23.020  -9.562  1.00 83.24  ? 107  SER C C   1 
ATOM   8102  O O   . SER C 1 111 ? 1.883   24.145  -9.296  1.00 84.59  ? 107  SER C O   1 
ATOM   8103  C CB  . SER C 1 111 ? 4.779   22.816  -9.965  1.00 82.06  ? 107  SER C CB  1 
ATOM   8104  O OG  . SER C 1 111 ? 4.897   24.203  -10.233 1.00 84.35  ? 107  SER C OG  1 
ATOM   8105  N N   . LEU C 1 112 ? 1.670   22.160  -10.349 1.00 83.97  ? 108  LEU C N   1 
ATOM   8106  C CA  . LEU C 1 112 ? 0.416   22.489  -11.019 1.00 86.62  ? 108  LEU C CA  1 
ATOM   8107  C C   . LEU C 1 112 ? -0.761  22.435  -10.045 1.00 85.83  ? 108  LEU C C   1 
ATOM   8108  O O   . LEU C 1 112 ? -1.506  23.408  -9.908  1.00 87.56  ? 108  LEU C O   1 
ATOM   8109  C CB  . LEU C 1 112 ? 0.202   21.545  -12.214 1.00 88.00  ? 108  LEU C CB  1 
ATOM   8110  C CG  . LEU C 1 112 ? -0.918  21.681  -13.257 1.00 91.22  ? 108  LEU C CG  1 
ATOM   8111  C CD1 . LEU C 1 112 ? -2.180  20.967  -12.802 1.00 90.88  ? 108  LEU C CD1 1 
ATOM   8112  C CD2 . LEU C 1 112 ? -1.206  23.128  -13.642 1.00 94.10  ? 108  LEU C CD2 1 
ATOM   8113  N N   . ASN C 1 113 ? -0.911  21.299  -9.367  1.00 83.30  ? 109  ASN C N   1 
ATOM   8114  C CA  . ASN C 1 113 ? -2.013  21.079  -8.433  1.00 82.52  ? 109  ASN C CA  1 
ATOM   8115  C C   . ASN C 1 113 ? -1.818  21.815  -7.106  1.00 80.98  ? 109  ASN C C   1 
ATOM   8116  O O   . ASN C 1 113 ? -2.715  22.527  -6.652  1.00 82.20  ? 109  ASN C O   1 
ATOM   8117  C CB  . ASN C 1 113 ? -2.220  19.575  -8.198  1.00 80.68  ? 109  ASN C CB  1 
ATOM   8118  C CG  . ASN C 1 113 ? -3.512  19.259  -7.452  1.00 80.59  ? 109  ASN C CG  1 
ATOM   8119  O OD1 . ASN C 1 113 ? -3.672  17.999  -7.069  1.00 78.88  ? 109  ASN C OD1 1 
ATOM   8120  N ND2 . ASN C 1 113 ? -4.354  20.130  -7.229  1.00 82.05  ? 109  ASN C ND2 1 
ATOM   8121  N N   . GLY C 1 114 ? -0.647  21.638  -6.495  1.00 78.45  ? 110  GLY C N   1 
ATOM   8122  C CA  . GLY C 1 114 ? -0.330  22.264  -5.209  1.00 76.80  ? 110  GLY C CA  1 
ATOM   8123  C C   . GLY C 1 114 ? -0.172  23.775  -5.271  1.00 78.60  ? 110  GLY C C   1 
ATOM   8124  O O   . GLY C 1 114 ? -0.616  24.485  -4.368  1.00 78.73  ? 110  GLY C O   1 
ATOM   8125  N N   . GLY C 1 115 ? 0.459   24.263  -6.338  1.00 80.13  ? 111  GLY C N   1 
ATOM   8126  C CA  . GLY C 1 115 ? 0.708   25.694  -6.514  1.00 82.08  ? 111  GLY C CA  1 
ATOM   8127  C C   . GLY C 1 115 ? 2.153   26.095  -6.276  1.00 80.97  ? 111  GLY C C   1 
ATOM   8128  O O   . GLY C 1 115 ? 2.603   27.132  -6.764  1.00 82.96  ? 111  GLY C O   1 
ATOM   8129  N N   . LYS C 1 116 ? 2.875   25.266  -5.525  1.00 77.98  ? 112  LYS C N   1 
ATOM   8130  C CA  . LYS C 1 116 ? 4.280   25.506  -5.196  1.00 76.78  ? 112  LYS C CA  1 
ATOM   8131  C C   . LYS C 1 116 ? 5.140   25.627  -6.460  1.00 78.14  ? 112  LYS C C   1 
ATOM   8132  O O   . LYS C 1 116 ? 4.907   24.904  -7.427  1.00 78.62  ? 112  LYS C O   1 
ATOM   8133  C CB  . LYS C 1 116 ? 4.803   24.379  -4.293  1.00 73.57  ? 112  LYS C CB  1 
ATOM   8134  C CG  . LYS C 1 116 ? 6.055   24.734  -3.514  1.00 72.43  ? 112  LYS C CG  1 
ATOM   8135  C CD  . LYS C 1 116 ? 6.443   23.644  -2.546  1.00 70.13  ? 112  LYS C CD  1 
ATOM   8136  C CE  . LYS C 1 116 ? 7.668   24.056  -1.747  1.00 69.49  ? 112  LYS C CE  1 
ATOM   8137  N NZ  . LYS C 1 116 ? 8.003   23.065  -0.688  1.00 66.81  ? 112  LYS C NZ  1 
ATOM   8138  N N   . PRO C 1 117 ? 6.123   26.555  -6.460  1.00 78.95  ? 113  PRO C N   1 
ATOM   8139  C CA  . PRO C 1 117 ? 7.065   26.710  -7.576  1.00 80.49  ? 113  PRO C CA  1 
ATOM   8140  C C   . PRO C 1 117 ? 7.686   25.379  -7.989  1.00 78.89  ? 113  PRO C C   1 
ATOM   8141  O O   . PRO C 1 117 ? 7.906   24.512  -7.137  1.00 76.15  ? 113  PRO C O   1 
ATOM   8142  C CB  . PRO C 1 117 ? 8.144   27.623  -6.994  1.00 80.55  ? 113  PRO C CB  1 
ATOM   8143  C CG  . PRO C 1 117 ? 7.437   28.437  -5.988  1.00 80.63  ? 113  PRO C CG  1 
ATOM   8144  C CD  . PRO C 1 117 ? 6.331   27.589  -5.428  1.00 78.89  ? 113  PRO C CD  1 
ATOM   8145  N N   . PHE C 1 118 ? 7.968   25.228  -9.282  1.00 80.72  ? 114  PHE C N   1 
ATOM   8146  C CA  . PHE C 1 118 ? 8.444   23.951  -9.821  1.00 79.68  ? 114  PHE C CA  1 
ATOM   8147  C C   . PHE C 1 118 ? 9.819   23.520  -9.296  1.00 77.67  ? 114  PHE C C   1 
ATOM   8148  O O   . PHE C 1 118 ? 10.003  22.362  -8.913  1.00 75.42  ? 114  PHE C O   1 
ATOM   8149  C CB  . PHE C 1 118 ? 8.434   23.956  -11.355 1.00 82.55  ? 114  PHE C CB  1 
ATOM   8150  C CG  . PHE C 1 118 ? 8.938   22.675  -11.962 1.00 82.03  ? 114  PHE C CG  1 
ATOM   8151  C CD1 . PHE C 1 118 ? 8.125   21.546  -12.013 1.00 81.06  ? 114  PHE C CD1 1 
ATOM   8152  C CD2 . PHE C 1 118 ? 10.232  22.592  -12.466 1.00 82.80  ? 114  PHE C CD2 1 
ATOM   8153  C CE1 . PHE C 1 118 ? 8.590   20.356  -12.565 1.00 80.70  ? 114  PHE C CE1 1 
ATOM   8154  C CE2 . PHE C 1 118 ? 10.708  21.405  -13.021 1.00 82.51  ? 114  PHE C CE2 1 
ATOM   8155  C CZ  . PHE C 1 118 ? 9.884   20.285  -13.069 1.00 81.46  ? 114  PHE C CZ  1 
ATOM   8156  N N   . LEU C 1 119 ? 10.772  24.450  -9.286  1.00 78.60  ? 115  LEU C N   1 
ATOM   8157  C CA  . LEU C 1 119 ? 12.140  24.159  -8.860  1.00 77.20  ? 115  LEU C CA  1 
ATOM   8158  C C   . LEU C 1 119 ? 12.213  23.736  -7.391  1.00 74.17  ? 115  LEU C C   1 
ATOM   8159  O O   . LEU C 1 119 ? 13.035  22.890  -7.027  1.00 72.38  ? 115  LEU C O   1 
ATOM   8160  C CB  . LEU C 1 119 ? 13.062  25.355  -9.130  1.00 79.29  ? 115  LEU C CB  1 
ATOM   8161  C CG  . LEU C 1 119 ? 13.284  25.800  -10.583 1.00 82.47  ? 115  LEU C CG  1 
ATOM   8162  C CD1 . LEU C 1 119 ? 14.077  27.096  -10.634 1.00 84.23  ? 115  LEU C CD1 1 
ATOM   8163  C CD2 . LEU C 1 119 ? 13.977  24.721  -11.411 1.00 82.51  ? 115  LEU C CD2 1 
ATOM   8164  N N   . GLN C 1 120 ? 11.350  24.324  -6.562  1.00 73.78  ? 116  GLN C N   1 
ATOM   8165  C CA  . GLN C 1 120 ? 11.207  23.926  -5.157  1.00 71.08  ? 116  GLN C CA  1 
ATOM   8166  C C   . GLN C 1 120 ? 10.622  22.521  -5.043  1.00 69.15  ? 116  GLN C C   1 
ATOM   8167  O O   . GLN C 1 120 ? 11.020  21.749  -4.173  1.00 66.89  ? 116  GLN C O   1 
ATOM   8168  C CB  . GLN C 1 120 ? 10.323  24.917  -4.391  1.00 71.56  ? 116  GLN C CB  1 
ATOM   8169  C CG  . GLN C 1 120 ? 11.023  26.207  -3.970  1.00 72.92  ? 116  GLN C CG  1 
ATOM   8170  C CD  . GLN C 1 120 ? 10.053  27.350  -3.690  1.00 74.79  ? 116  GLN C CD  1 
ATOM   8171  O OE1 . GLN C 1 120 ? 8.933   27.138  -3.220  1.00 74.35  ? 116  GLN C OE1 1 
ATOM   8172  N NE2 . GLN C 1 120 ? 10.485  28.570  -3.978  1.00 76.95  ? 116  GLN C NE2 1 
ATOM   8173  N N   . ALA C 1 121 ? 9.680   22.198  -5.926  1.00 70.33  ? 117  ALA C N   1 
ATOM   8174  C CA  . ALA C 1 121 ? 9.064   20.873  -5.954  1.00 68.98  ? 117  ALA C CA  1 
ATOM   8175  C C   . ALA C 1 121 ? 10.048  19.796  -6.418  1.00 68.21  ? 117  ALA C C   1 
ATOM   8176  O O   . ALA C 1 121 ? 9.939   18.633  -6.020  1.00 66.32  ? 117  ALA C O   1 
ATOM   8177  C CB  . ALA C 1 121 ? 7.825   20.883  -6.836  1.00 70.88  ? 117  ALA C CB  1 
ATOM   8178  N N   . PHE C 1 122 ? 11.006  20.193  -7.253  1.00 69.82  ? 118  PHE C N   1 
ATOM   8179  C CA  . PHE C 1 122 ? 12.005  19.271  -7.791  1.00 69.57  ? 118  PHE C CA  1 
ATOM   8180  C C   . PHE C 1 122 ? 13.181  19.072  -6.835  1.00 67.78  ? 118  PHE C C   1 
ATOM   8181  O O   . PHE C 1 122 ? 13.602  17.936  -6.598  1.00 66.19  ? 118  PHE C O   1 
ATOM   8182  C CB  . PHE C 1 122 ? 12.509  19.762  -9.153  1.00 72.36  ? 118  PHE C CB  1 
ATOM   8183  C CG  . PHE C 1 122 ? 13.184  18.696  -9.979  1.00 72.40  ? 118  PHE C CG  1 
ATOM   8184  C CD1 . PHE C 1 122 ? 12.462  17.962  -10.915 1.00 73.16  ? 118  PHE C CD1 1 
ATOM   8185  C CD2 . PHE C 1 122 ? 14.545  18.434  -9.831  1.00 71.71  ? 118  PHE C CD2 1 
ATOM   8186  C CE1 . PHE C 1 122 ? 13.081  16.978  -11.690 1.00 73.67  ? 118  PHE C CE1 1 
ATOM   8187  C CE2 . PHE C 1 122 ? 15.173  17.450  -10.599 1.00 72.22  ? 118  PHE C CE2 1 
ATOM   8188  C CZ  . PHE C 1 122 ? 14.438  16.722  -11.531 1.00 73.19  ? 118  PHE C CZ  1 
ATOM   8189  N N   . TYR C 1 123 ? 13.701  20.174  -6.290  1.00 68.23  ? 119  TYR C N   1 
ATOM   8190  C CA  . TYR C 1 123 ? 14.908  20.145  -5.452  1.00 67.06  ? 119  TYR C CA  1 
ATOM   8191  C C   . TYR C 1 123 ? 14.671  19.936  -3.947  1.00 64.52  ? 119  TYR C C   1 
ATOM   8192  O O   . TYR C 1 123 ? 15.591  19.537  -3.226  1.00 63.20  ? 119  TYR C O   1 
ATOM   8193  C CB  . TYR C 1 123 ? 15.758  21.403  -5.680  1.00 69.02  ? 119  TYR C CB  1 
ATOM   8194  C CG  . TYR C 1 123 ? 16.559  21.387  -6.966  1.00 71.68  ? 119  TYR C CG  1 
ATOM   8195  C CD1 . TYR C 1 123 ? 17.833  20.817  -7.011  1.00 71.64  ? 119  TYR C CD1 1 
ATOM   8196  C CD2 . TYR C 1 123 ? 16.049  21.951  -8.137  1.00 74.62  ? 119  TYR C CD2 1 
ATOM   8197  C CE1 . TYR C 1 123 ? 18.577  20.803  -8.192  1.00 74.08  ? 119  TYR C CE1 1 
ATOM   8198  C CE2 . TYR C 1 123 ? 16.787  21.942  -9.324  1.00 77.02  ? 119  TYR C CE2 1 
ATOM   8199  C CZ  . TYR C 1 123 ? 18.048  21.366  -9.342  1.00 76.76  ? 119  TYR C CZ  1 
ATOM   8200  O OH  . TYR C 1 123 ? 18.779  21.353  -10.510 1.00 79.50  ? 119  TYR C OH  1 
ATOM   8201  N N   . VAL C 1 124 ? 13.456  20.205  -3.473  1.00 64.07  ? 120  VAL C N   1 
ATOM   8202  C CA  . VAL C 1 124 ? 13.146  20.041  -2.050  1.00 61.84  ? 120  VAL C CA  1 
ATOM   8203  C C   . VAL C 1 124 ? 12.131  18.922  -1.819  1.00 60.40  ? 120  VAL C C   1 
ATOM   8204  O O   . VAL C 1 124 ? 12.481  17.872  -1.279  1.00 58.54  ? 120  VAL C O   1 
ATOM   8205  C CB  . VAL C 1 124 ? 12.650  21.359  -1.394  1.00 62.61  ? 120  VAL C CB  1 
ATOM   8206  C CG1 . VAL C 1 124 ? 12.656  21.234  0.129   1.00 60.60  ? 120  VAL C CG1 1 
ATOM   8207  C CG2 . VAL C 1 124 ? 13.503  22.545  -1.836  1.00 64.52  ? 120  VAL C CG2 1 
ATOM   8208  N N   . ASP C 1 125 ? 10.886  19.151  -2.240  1.00 61.47  ? 121  ASP C N   1 
ATOM   8209  C CA  . ASP C 1 125 ? 9.779   18.212  -2.021  1.00 60.53  ? 121  ASP C CA  1 
ATOM   8210  C C   . ASP C 1 125 ? 10.070  16.781  -2.463  1.00 59.56  ? 121  ASP C C   1 
ATOM   8211  O O   . ASP C 1 125 ? 10.021  15.866  -1.648  1.00 57.72  ? 121  ASP C O   1 
ATOM   8212  C CB  . ASP C 1 125 ? 8.492   18.718  -2.684  1.00 62.48  ? 121  ASP C CB  1 
ATOM   8213  C CG  . ASP C 1 125 ? 7.738   19.709  -1.819  1.00 63.12  ? 121  ASP C CG  1 
ATOM   8214  O OD1 . ASP C 1 125 ? 8.375   20.380  -0.980  1.00 63.05  ? 121  ASP C OD1 1 
ATOM   8215  O OD2 . ASP C 1 125 ? 6.504   19.818  -1.979  1.00 64.57  ? 121  ASP C OD2 1 
ATOM   8216  N N   . LEU C 1 126 ? 10.372  16.590  -3.745  1.00 61.07  ? 122  LEU C N   1 
ATOM   8217  C CA  . LEU C 1 126 ? 10.632  15.250  -4.267  1.00 60.56  ? 122  LEU C CA  1 
ATOM   8218  C C   . LEU C 1 126 ? 11.947  14.663  -3.787  1.00 59.16  ? 122  LEU C C   1 
ATOM   8219  O O   . LEU C 1 126 ? 12.037  13.453  -3.574  1.00 57.96  ? 122  LEU C O   1 
ATOM   8220  C CB  . LEU C 1 126 ? 10.552  15.203  -5.792  1.00 62.89  ? 122  LEU C CB  1 
ATOM   8221  C CG  . LEU C 1 126 ? 9.236   14.610  -6.289  1.00 63.42  ? 122  LEU C CG  1 
ATOM   8222  C CD1 . LEU C 1 126 ? 8.238   15.712  -6.594  1.00 65.18  ? 122  LEU C CD1 1 
ATOM   8223  C CD2 . LEU C 1 126 ? 9.478   13.744  -7.506  1.00 64.72  ? 122  LEU C CD2 1 
ATOM   8224  N N   . GLN C 1 127 ? 12.960  15.511  -3.616  1.00 59.52  ? 123  GLN C N   1 
ATOM   8225  C CA  . GLN C 1 127 ? 14.210  15.061  -3.021  1.00 58.30  ? 123  GLN C CA  1 
ATOM   8226  C C   . GLN C 1 127 ? 13.864  14.372  -1.709  1.00 55.88  ? 123  GLN C C   1 
ATOM   8227  O O   . GLN C 1 127 ? 14.229  13.218  -1.501  1.00 54.74  ? 123  GLN C O   1 
ATOM   8228  C CB  . GLN C 1 127 ? 15.176  16.220  -2.784  1.00 59.06  ? 123  GLN C CB  1 
ATOM   8229  C CG  . GLN C 1 127 ? 16.638  15.789  -2.769  1.00 59.34  ? 123  GLN C CG  1 
ATOM   8230  C CD  . GLN C 1 127 ? 17.531  16.726  -1.976  1.00 59.81  ? 123  GLN C CD  1 
ATOM   8231  O OE1 . GLN C 1 127 ? 17.525  16.712  -0.744  1.00 57.99  ? 123  GLN C OE1 1 
ATOM   8232  N NE2 . GLN C 1 127 ? 18.321  17.531  -2.682  1.00 61.88  ? 123  GLN C NE2 1 
ATOM   8233  N N   . GLY C 1 128 ? 13.120  15.079  -0.857  1.00 55.31  ? 124  GLY C N   1 
ATOM   8234  C CA  . GLY C 1 128 ? 12.587  14.526  0.383   1.00 53.34  ? 124  GLY C CA  1 
ATOM   8235  C C   . GLY C 1 128 ? 11.826  13.226  0.185   1.00 52.70  ? 124  GLY C C   1 
ATOM   8236  O O   . GLY C 1 128 ? 12.118  12.228  0.848   1.00 51.27  ? 124  GLY C O   1 
ATOM   8237  N N   . VAL C 1 129 ? 10.861  13.238  -0.734  1.00 54.05  ? 125  VAL C N   1 
ATOM   8238  C CA  . VAL C 1 129 ? 10.046  12.058  -1.045  1.00 53.95  ? 125  VAL C CA  1 
ATOM   8239  C C   . VAL C 1 129 ? 10.927  10.842  -1.350  1.00 53.48  ? 125  VAL C C   1 
ATOM   8240  O O   . VAL C 1 129 ? 10.740  9.773   -0.766  1.00 52.11  ? 125  VAL C O   1 
ATOM   8241  C CB  . VAL C 1 129 ? 9.066   12.323  -2.228  1.00 56.05  ? 125  VAL C CB  1 
ATOM   8242  C CG1 . VAL C 1 129 ? 8.293   11.060  -2.592  1.00 56.16  ? 125  VAL C CG1 1 
ATOM   8243  C CG2 . VAL C 1 129 ? 8.093   13.448  -1.891  1.00 56.67  ? 125  VAL C CG2 1 
ATOM   8244  N N   . ILE C 1 130 ? 11.888  11.023  -2.255  1.00 54.84  ? 126  ILE C N   1 
ATOM   8245  C CA  . ILE C 1 130 ? 12.841  9.971   -2.623  1.00 54.83  ? 126  ILE C CA  1 
ATOM   8246  C C   . ILE C 1 130 ? 13.684  9.535   -1.420  1.00 53.01  ? 126  ILE C C   1 
ATOM   8247  O O   . ILE C 1 130 ? 13.777  8.343   -1.126  1.00 52.12  ? 126  ILE C O   1 
ATOM   8248  C CB  . ILE C 1 130 ? 13.757  10.408  -3.795  1.00 56.62  ? 126  ILE C CB  1 
ATOM   8249  C CG1 . ILE C 1 130 ? 12.918  10.764  -5.023  1.00 58.69  ? 126  ILE C CG1 1 
ATOM   8250  C CG2 . ILE C 1 130 ? 14.751  9.302   -4.143  1.00 56.61  ? 126  ILE C CG2 1 
ATOM   8251  C CD1 . ILE C 1 130 ? 13.615  11.680  -6.009  1.00 60.65  ? 126  ILE C CD1 1 
ATOM   8252  N N   . LYS C 1 131 ? 14.275  10.510  -0.728  1.00 52.77  ? 127  LYS C N   1 
ATOM   8253  C CA  . LYS C 1 131 ? 15.097  10.266  0.458   1.00 51.33  ? 127  LYS C CA  1 
ATOM   8254  C C   . LYS C 1 131 ? 14.411  9.360   1.473   1.00 49.72  ? 127  LYS C C   1 
ATOM   8255  O O   . LYS C 1 131 ? 15.002  8.376   1.925   1.00 48.75  ? 127  LYS C O   1 
ATOM   8256  C CB  . LYS C 1 131 ? 15.484  11.587  1.139   1.00 51.33  ? 127  LYS C CB  1 
ATOM   8257  C CG  . LYS C 1 131 ? 16.524  12.427  0.396   1.00 53.19  ? 127  LYS C CG  1 
ATOM   8258  C CD  . LYS C 1 131 ? 17.951  11.979  0.683   1.00 53.54  ? 127  LYS C CD  1 
ATOM   8259  C CE  . LYS C 1 131 ? 18.969  12.990  0.166   1.00 55.46  ? 127  LYS C CE  1 
ATOM   8260  N NZ  . LYS C 1 131 ? 18.963  14.260  0.951   1.00 55.50  ? 127  LYS C NZ  1 
ATOM   8261  N N   . THR C 1 132 ? 13.166  9.686   1.819   1.00 49.71  ? 128  THR C N   1 
ATOM   8262  C CA  . THR C 1 132 ? 12.459  8.972   2.887   1.00 48.51  ? 128  THR C CA  1 
ATOM   8263  C C   . THR C 1 132 ? 12.115  7.533   2.511   1.00 48.46  ? 128  THR C C   1 
ATOM   8264  O O   . THR C 1 132 ? 12.198  6.640   3.360   1.00 47.46  ? 128  THR C O   1 
ATOM   8265  C CB  . THR C 1 132 ? 11.198  9.730   3.406   1.00 48.56  ? 128  THR C CB  1 
ATOM   8266  O OG1 . THR C 1 132 ? 10.164  9.708   2.420   1.00 50.09  ? 128  THR C OG1 1 
ATOM   8267  C CG2 . THR C 1 132 ? 11.533  11.173  3.754   1.00 49.06  ? 128  THR C CG2 1 
ATOM   8268  N N   . PHE C 1 133 ? 11.750  7.303   1.250   1.00 49.80  ? 129  PHE C N   1 
ATOM   8269  C CA  . PHE C 1 133 ? 11.445  5.950   0.782   1.00 49.99  ? 129  PHE C CA  1 
ATOM   8270  C C   . PHE C 1 133 ? 12.654  5.019   0.885   1.00 49.55  ? 129  PHE C C   1 
ATOM   8271  O O   . PHE C 1 133 ? 12.527  3.879   1.334   1.00 48.83  ? 129  PHE C O   1 
ATOM   8272  C CB  . PHE C 1 133 ? 10.889  5.966   -0.644  1.00 51.87  ? 129  PHE C CB  1 
ATOM   8273  C CG  . PHE C 1 133 ? 9.424   6.282   -0.719  1.00 52.40  ? 129  PHE C CG  1 
ATOM   8274  C CD1 . PHE C 1 133 ? 8.522   5.678   0.146   1.00 51.54  ? 129  PHE C CD1 1 
ATOM   8275  C CD2 . PHE C 1 133 ? 8.941   7.167   -1.667  1.00 54.28  ? 129  PHE C CD2 1 
ATOM   8276  C CE1 . PHE C 1 133 ? 7.164   5.963   0.081   1.00 52.32  ? 129  PHE C CE1 1 
ATOM   8277  C CE2 . PHE C 1 133 ? 7.583   7.459   -1.744  1.00 55.16  ? 129  PHE C CE2 1 
ATOM   8278  C CZ  . PHE C 1 133 ? 6.693   6.854   -0.868  1.00 54.29  ? 129  PHE C CZ  1 
ATOM   8279  N N   . ARG C 1 134 ? 13.817  5.525   0.474   1.00 50.18  ? 130  ARG C N   1 
ATOM   8280  C CA  . ARG C 1 134 ? 15.092  4.816   0.592   1.00 49.92  ? 130  ARG C CA  1 
ATOM   8281  C C   . ARG C 1 134 ? 15.452  4.601   2.061   1.00 48.22  ? 130  ARG C C   1 
ATOM   8282  O O   . ARG C 1 134 ? 16.013  3.563   2.426   1.00 47.84  ? 130  ARG C O   1 
ATOM   8283  C CB  . ARG C 1 134 ? 16.206  5.617   -0.091  1.00 51.08  ? 130  ARG C CB  1 
ATOM   8284  C CG  . ARG C 1 134 ? 16.028  5.820   -1.589  1.00 53.28  ? 130  ARG C CG  1 
ATOM   8285  C CD  . ARG C 1 134 ? 17.037  5.006   -2.387  1.00 54.81  ? 130  ARG C CD  1 
ATOM   8286  N NE  . ARG C 1 134 ? 16.572  4.720   -3.745  1.00 56.71  ? 130  ARG C NE  1 
ATOM   8287  C CZ  . ARG C 1 134 ? 16.644  5.565   -4.769  1.00 58.58  ? 130  ARG C CZ  1 
ATOM   8288  N NH1 . ARG C 1 134 ? 17.162  6.778   -4.613  1.00 59.00  ? 130  ARG C NH1 1 
ATOM   8289  N NH2 . ARG C 1 134 ? 16.188  5.197   -5.957  1.00 60.36  ? 130  ARG C NH2 1 
ATOM   8290  N N   . TYR C 1 135 ? 15.133  5.587   2.899   1.00 47.40  ? 131  TYR C N   1 
ATOM   8291  C CA  . TYR C 1 135 ? 15.387  5.494   4.330   1.00 45.86  ? 131  TYR C CA  1 
ATOM   8292  C C   . TYR C 1 135 ? 14.599  4.341   4.953   1.00 44.97  ? 131  TYR C C   1 
ATOM   8293  O O   . TYR C 1 135 ? 15.178  3.476   5.614   1.00 44.31  ? 131  TYR C O   1 
ATOM   8294  C CB  . TYR C 1 135 ? 15.065  6.820   5.035   1.00 45.58  ? 131  TYR C CB  1 
ATOM   8295  C CG  . TYR C 1 135 ? 15.394  6.821   6.514   1.00 44.28  ? 131  TYR C CG  1 
ATOM   8296  C CD1 . TYR C 1 135 ? 16.704  6.992   6.953   1.00 44.24  ? 131  TYR C CD1 1 
ATOM   8297  C CD2 . TYR C 1 135 ? 14.395  6.647   7.473   1.00 43.76  ? 131  TYR C CD2 1 
ATOM   8298  C CE1 . TYR C 1 135 ? 17.019  6.991   8.311   1.00 43.62  ? 131  TYR C CE1 1 
ATOM   8299  C CE2 . TYR C 1 135 ? 14.698  6.645   8.838   1.00 43.04  ? 131  TYR C CE2 1 
ATOM   8300  C CZ  . TYR C 1 135 ? 16.013  6.817   9.249   1.00 42.84  ? 131  TYR C CZ  1 
ATOM   8301  O OH  . TYR C 1 135 ? 16.327  6.816   10.589  1.00 42.05  ? 131  TYR C OH  1 
ATOM   8302  N N   . TYR C 1 136 ? 13.287  4.323   4.730   1.00 45.10  ? 132  TYR C N   1 
ATOM   8303  C CA  . TYR C 1 136 ? 12.433  3.294   5.324   1.00 44.51  ? 132  TYR C CA  1 
ATOM   8304  C C   . TYR C 1 136 ? 12.578  1.930   4.648   1.00 44.98  ? 132  TYR C C   1 
ATOM   8305  O O   . TYR C 1 136 ? 12.204  0.904   5.223   1.00 44.54  ? 132  TYR C O   1 
ATOM   8306  C CB  . TYR C 1 136 ? 10.972  3.759   5.396   1.00 44.86  ? 132  TYR C CB  1 
ATOM   8307  C CG  . TYR C 1 136 ? 10.742  4.766   6.502   1.00 44.41  ? 132  TYR C CG  1 
ATOM   8308  C CD1 . TYR C 1 136 ? 10.541  4.348   7.818   1.00 43.53  ? 132  TYR C CD1 1 
ATOM   8309  C CD2 . TYR C 1 136 ? 10.754  6.135   6.240   1.00 45.34  ? 132  TYR C CD2 1 
ATOM   8310  C CE1 . TYR C 1 136 ? 10.343  5.267   8.842   1.00 43.31  ? 132  TYR C CE1 1 
ATOM   8311  C CE2 . TYR C 1 136 ? 10.557  7.064   7.258   1.00 45.08  ? 132  TYR C CE2 1 
ATOM   8312  C CZ  . TYR C 1 136 ? 10.354  6.623   8.557   1.00 44.23  ? 132  TYR C CZ  1 
ATOM   8313  O OH  . TYR C 1 136 ? 10.155  7.535   9.573   1.00 44.69  ? 132  TYR C OH  1 
ATOM   8314  N N   . ALA C 1 137 ? 13.136  1.925   3.439   1.00 46.04  ? 133  ALA C N   1 
ATOM   8315  C CA  . ALA C 1 137 ? 13.544  0.689   2.774   1.00 46.66  ? 133  ALA C CA  1 
ATOM   8316  C C   . ALA C 1 137 ? 14.666  0.030   3.572   1.00 45.69  ? 133  ALA C C   1 
ATOM   8317  O O   . ALA C 1 137 ? 14.729  -1.197  3.684   1.00 45.75  ? 133  ALA C O   1 
ATOM   8318  C CB  . ALA C 1 137 ? 14.002  0.977   1.357   1.00 48.33  ? 133  ALA C CB  1 
ATOM   8319  N N   . GLY C 1 138 ? 15.540  0.864   4.132   1.00 44.90  ? 134  GLY C N   1 
ATOM   8320  C CA  . GLY C 1 138 ? 16.630  0.410   4.982   1.00 44.05  ? 134  GLY C CA  1 
ATOM   8321  C C   . GLY C 1 138 ? 16.165  -0.166  6.305   1.00 42.73  ? 134  GLY C C   1 
ATOM   8322  O O   . GLY C 1 138 ? 16.747  -1.128  6.794   1.00 42.46  ? 134  GLY C O   1 
ATOM   8323  N N   . TRP C 1 139 ? 15.111  0.413   6.878   1.00 42.12  ? 135  TRP C N   1 
ATOM   8324  C CA  . TRP C 1 139 ? 14.613  -0.020  8.188   1.00 41.09  ? 135  TRP C CA  1 
ATOM   8325  C C   . TRP C 1 139 ? 13.904  -1.373  8.190   1.00 41.32  ? 135  TRP C C   1 
ATOM   8326  O O   . TRP C 1 139 ? 14.055  -2.140  9.140   1.00 40.84  ? 135  TRP C O   1 
ATOM   8327  C CB  . TRP C 1 139 ? 13.699  1.039   8.824   1.00 40.62  ? 135  TRP C CB  1 
ATOM   8328  C CG  . TRP C 1 139 ? 14.382  1.961   9.817   1.00 39.95  ? 135  TRP C CG  1 
ATOM   8329  C CD1 . TRP C 1 139 ? 14.459  3.324   9.747   1.00 40.00  ? 135  TRP C CD1 1 
ATOM   8330  C CD2 . TRP C 1 139 ? 15.063  1.585   11.026  1.00 38.85  ? 135  TRP C CD2 1 
ATOM   8331  N NE1 . TRP C 1 139 ? 15.153  3.817   10.824  1.00 39.20  ? 135  TRP C NE1 1 
ATOM   8332  C CE2 . TRP C 1 139 ? 15.535  2.772   11.625  1.00 38.59  ? 135  TRP C CE2 1 
ATOM   8333  C CE3 . TRP C 1 139 ? 15.322  0.360   11.658  1.00 38.48  ? 135  TRP C CE3 1 
ATOM   8334  C CZ2 . TRP C 1 139 ? 16.255  2.772   12.826  1.00 37.88  ? 135  TRP C CZ2 1 
ATOM   8335  C CZ3 . TRP C 1 139 ? 16.040  0.362   12.852  1.00 37.72  ? 135  TRP C CZ3 1 
ATOM   8336  C CH2 . TRP C 1 139 ? 16.497  1.560   13.421  1.00 37.41  ? 135  TRP C CH2 1 
ATOM   8337  N N   . ALA C 1 140 ? 13.146  -1.667  7.132   1.00 42.26  ? 136  ALA C N   1 
ATOM   8338  C CA  . ALA C 1 140 ? 12.241  -2.831  7.103   1.00 42.60  ? 136  ALA C CA  1 
ATOM   8339  C C   . ALA C 1 140 ? 12.749  -4.093  7.813   1.00 42.23  ? 136  ALA C C   1 
ATOM   8340  O O   . ALA C 1 140 ? 12.027  -4.675  8.621   1.00 42.07  ? 136  ALA C O   1 
ATOM   8341  C CB  . ALA C 1 140 ? 11.813  -3.148  5.678   1.00 44.05  ? 136  ALA C CB  1 
ATOM   8342  N N   . ASP C 1 141 ? 13.983  -4.499  7.523   1.00 42.43  ? 137  ASP C N   1 
ATOM   8343  C CA  . ASP C 1 141 ? 14.553  -5.722  8.100   1.00 42.43  ? 137  ASP C CA  1 
ATOM   8344  C C   . ASP C 1 141 ? 15.520  -5.453  9.255   1.00 41.35  ? 137  ASP C C   1 
ATOM   8345  O O   . ASP C 1 141 ? 16.483  -6.193  9.467   1.00 41.58  ? 137  ASP C O   1 
ATOM   8346  C CB  . ASP C 1 141 ? 15.215  -6.586  7.014   1.00 43.81  ? 137  ASP C CB  1 
ATOM   8347  C CG  . ASP C 1 141 ? 16.403  -5.899  6.337   1.00 44.31  ? 137  ASP C CG  1 
ATOM   8348  O OD1 . ASP C 1 141 ? 16.419  -4.651  6.242   1.00 44.15  ? 137  ASP C OD1 1 
ATOM   8349  O OD2 . ASP C 1 141 ? 17.320  -6.621  5.884   1.00 44.89  ? 137  ASP C OD2 1 
ATOM   8350  N N   . LYS C 1 142 ? 15.243  -4.393  10.006  1.00 40.45  ? 138  LYS C N   1 
ATOM   8351  C CA  . LYS C 1 142 ? 16.090  -3.985  11.122  1.00 39.65  ? 138  LYS C CA  1 
ATOM   8352  C C   . LYS C 1 142 ? 15.273  -3.626  12.369  1.00 38.94  ? 138  LYS C C   1 
ATOM   8353  O O   . LYS C 1 142 ? 15.834  -3.237  13.397  1.00 38.42  ? 138  LYS C O   1 
ATOM   8354  C CB  . LYS C 1 142 ? 16.977  -2.809  10.707  1.00 39.57  ? 138  LYS C CB  1 
ATOM   8355  C CG  . LYS C 1 142 ? 18.056  -3.163  9.701   1.00 40.50  ? 138  LYS C CG  1 
ATOM   8356  C CD  . LYS C 1 142 ? 18.785  -1.917  9.226   1.00 40.82  ? 138  LYS C CD  1 
ATOM   8357  C CE  . LYS C 1 142 ? 19.690  -2.204  8.031   1.00 41.95  ? 138  LYS C CE  1 
ATOM   8358  N NZ  . LYS C 1 142 ? 18.965  -2.669  6.813   1.00 42.81  ? 138  LYS C NZ  1 
ATOM   8359  N N   . ILE C 1 143 ? 13.952  -3.760  12.274  1.00 39.21  ? 139  ILE C N   1 
ATOM   8360  C CA  . ILE C 1 143 ? 13.063  -3.507  13.405  1.00 38.80  ? 139  ILE C CA  1 
ATOM   8361  C C   . ILE C 1 143 ? 13.175  -4.671  14.392  1.00 38.84  ? 139  ILE C C   1 
ATOM   8362  O O   . ILE C 1 143 ? 12.552  -5.721  14.204  1.00 39.49  ? 139  ILE C O   1 
ATOM   8363  C CB  . ILE C 1 143 ? 11.587  -3.324  12.955  1.00 39.32  ? 139  ILE C CB  1 
ATOM   8364  C CG1 . ILE C 1 143 ? 11.490  -2.383  11.749  1.00 39.67  ? 139  ILE C CG1 1 
ATOM   8365  C CG2 . ILE C 1 143 ? 10.736  -2.802  14.108  1.00 39.05  ? 139  ILE C CG2 1 
ATOM   8366  C CD1 . ILE C 1 143 ? 10.196  -2.518  10.958  1.00 40.57  ? 139  ILE C CD1 1 
ATOM   8367  N N   . HIS C 1 144 ? 13.976  -4.478  15.438  1.00 38.33  ? 140  HIS C N   1 
ATOM   8368  C CA  . HIS C 1 144 ? 14.252  -5.543  16.402  1.00 38.50  ? 140  HIS C CA  1 
ATOM   8369  C C   . HIS C 1 144 ? 13.388  -5.463  17.656  1.00 38.37  ? 140  HIS C C   1 
ATOM   8370  O O   . HIS C 1 144 ? 13.026  -4.372  18.109  1.00 38.01  ? 140  HIS C O   1 
ATOM   8371  C CB  . HIS C 1 144 ? 15.725  -5.535  16.817  1.00 38.38  ? 140  HIS C CB  1 
ATOM   8372  C CG  . HIS C 1 144 ? 16.682  -5.640  15.673  1.00 39.07  ? 140  HIS C CG  1 
ATOM   8373  N ND1 . HIS C 1 144 ? 16.837  -6.592  14.724  1.00 40.24  ? 140  HIS C ND1 1 
ATOM   8374  C CD2 . HIS C 1 144 ? 17.632  -4.678  15.409  1.00 39.28  ? 140  HIS C CD2 1 
ATOM   8375  C CE1 . HIS C 1 144 ? 17.868  -6.189  13.910  1.00 40.96  ? 140  HIS C CE1 1 
ATOM   8376  N NE2 . HIS C 1 144 ? 18.331  -5.032  14.346  1.00 40.54  ? 140  HIS C NE2 1 
ATOM   8377  N N   . GLY C 1 145 ? 13.071  -6.633  18.209  1.00 38.82  ? 141  GLY C N   1 
ATOM   8378  C CA  . GLY C 1 145 ? 12.459  -6.737  19.530  1.00 38.93  ? 141  GLY C CA  1 
ATOM   8379  C C   . GLY C 1 145 ? 13.561  -6.858  20.564  1.00 38.73  ? 141  GLY C C   1 
ATOM   8380  O O   . GLY C 1 145 ? 14.626  -6.250  20.414  1.00 38.46  ? 141  GLY C O   1 
ATOM   8381  N N   . MET C 1 146 ? 13.315  -7.638  21.613  1.00 39.10  ? 142  MET C N   1 
ATOM   8382  C CA  . MET C 1 146 ? 14.333  -7.890  22.639  1.00 39.06  ? 142  MET C CA  1 
ATOM   8383  C C   . MET C 1 146 ? 14.094  -9.176  23.432  1.00 39.63  ? 142  MET C C   1 
ATOM   8384  O O   . MET C 1 146 ? 12.984  -9.709  23.440  1.00 40.11  ? 142  MET C O   1 
ATOM   8385  C CB  . MET C 1 146 ? 14.523  -6.675  23.580  1.00 38.86  ? 142  MET C CB  1 
ATOM   8386  C CG  . MET C 1 146 ? 13.260  -5.876  23.949  1.00 39.59  ? 142  MET C CG  1 
ATOM   8387  S SD  . MET C 1 146 ? 13.553  -4.441  25.044  1.00 41.41  ? 142  MET C SD  1 
ATOM   8388  C CE  . MET C 1 146 ? 14.431  -3.302  23.965  1.00 39.62  ? 142  MET C CE  1 
ATOM   8389  N N   . THR C 1 147 ? 15.156  -9.682  24.061  1.00 39.60  ? 143  THR C N   1 
ATOM   8390  C CA  . THR C 1 147 ? 15.056  -10.780 25.028  1.00 40.25  ? 143  THR C CA  1 
ATOM   8391  C C   . THR C 1 147 ? 15.328  -10.227 26.425  1.00 40.28  ? 143  THR C C   1 
ATOM   8392  O O   . THR C 1 147 ? 16.317  -9.522  26.642  1.00 39.85  ? 143  THR C O   1 
ATOM   8393  C CB  . THR C 1 147 ? 16.027  -11.955 24.722  1.00 40.82  ? 143  THR C CB  1 
ATOM   8394  O OG1 . THR C 1 147 ? 17.355  -11.456 24.530  1.00 40.08  ? 143  THR C OG1 1 
ATOM   8395  C CG2 . THR C 1 147 ? 15.594  -12.715 23.479  1.00 40.92  ? 143  THR C CG2 1 
ATOM   8396  N N   . ILE C 1 148 ? 14.441  -10.550 27.363  1.00 40.87  ? 144  ILE C N   1 
ATOM   8397  C CA  . ILE C 1 148 ? 14.463  -9.968  28.704  1.00 41.03  ? 144  ILE C CA  1 
ATOM   8398  C C   . ILE C 1 148 ? 14.744  -11.045 29.758  1.00 42.20  ? 144  ILE C C   1 
ATOM   8399  O O   . ILE C 1 148 ? 14.062  -12.075 29.791  1.00 43.10  ? 144  ILE C O   1 
ATOM   8400  C CB  . ILE C 1 148 ? 13.122  -9.252  29.020  1.00 41.14  ? 144  ILE C CB  1 
ATOM   8401  C CG1 . ILE C 1 148 ? 12.680  -8.408  27.823  1.00 39.99  ? 144  ILE C CG1 1 
ATOM   8402  C CG2 . ILE C 1 148 ? 13.241  -8.384  30.276  1.00 41.65  ? 144  ILE C CG2 1 
ATOM   8403  C CD1 . ILE C 1 148 ? 11.196  -8.305  27.661  1.00 40.90  ? 144  ILE C CD1 1 
ATOM   8404  N N   . PRO C 1 149 ? 15.752  -10.812 30.621  1.00 42.28  ? 145  PRO C N   1 
ATOM   8405  C CA  . PRO C 1 149 ? 16.093  -11.760 31.680  1.00 43.52  ? 145  PRO C CA  1 
ATOM   8406  C C   . PRO C 1 149 ? 15.185  -11.649 32.911  1.00 44.51  ? 145  PRO C C   1 
ATOM   8407  O O   . PRO C 1 149 ? 15.669  -11.395 34.015  1.00 45.40  ? 145  PRO C O   1 
ATOM   8408  C CB  . PRO C 1 149 ? 17.533  -11.378 32.030  1.00 43.33  ? 145  PRO C CB  1 
ATOM   8409  C CG  . PRO C 1 149 ? 17.601  -9.928  31.753  1.00 42.37  ? 145  PRO C CG  1 
ATOM   8410  C CD  . PRO C 1 149 ? 16.700  -9.683  30.573  1.00 41.47  ? 145  PRO C CD  1 
ATOM   8411  N N   . VAL C 1 150 ? 13.885  -11.864 32.720  1.00 44.69  ? 146  VAL C N   1 
ATOM   8412  C CA  . VAL C 1 150 ? 12.900  -11.770 33.805  1.00 45.93  ? 146  VAL C CA  1 
ATOM   8413  C C   . VAL C 1 150 ? 13.165  -12.804 34.912  1.00 47.53  ? 146  VAL C C   1 
ATOM   8414  O O   . VAL C 1 150 ? 13.912  -13.759 34.707  1.00 47.89  ? 146  VAL C O   1 
ATOM   8415  C CB  . VAL C 1 150 ? 11.454  -11.901 33.261  1.00 46.20  ? 146  VAL C CB  1 
ATOM   8416  C CG1 . VAL C 1 150 ? 10.430  -11.416 34.295  1.00 47.72  ? 146  VAL C CG1 1 
ATOM   8417  C CG2 . VAL C 1 150 ? 11.302  -11.101 31.981  1.00 44.60  ? 146  VAL C CG2 1 
ATOM   8418  N N   . ASP C 1 151 ? 12.564  -12.597 36.083  1.00 48.79  ? 147  ASP C N   1 
ATOM   8419  C CA  . ASP C 1 151 ? 12.757  -13.479 37.239  1.00 50.63  ? 147  ASP C CA  1 
ATOM   8420  C C   . ASP C 1 151 ? 12.204  -14.889 37.026  1.00 51.79  ? 147  ASP C C   1 
ATOM   8421  O O   . ASP C 1 151 ? 11.318  -15.106 36.195  1.00 51.58  ? 147  ASP C O   1 
ATOM   8422  C CB  . ASP C 1 151 ? 12.133  -12.862 38.497  1.00 51.89  ? 147  ASP C CB  1 
ATOM   8423  C CG  . ASP C 1 151 ? 12.860  -11.611 38.969  1.00 51.27  ? 147  ASP C CG  1 
ATOM   8424  O OD1 . ASP C 1 151 ? 13.899  -11.239 38.377  1.00 49.63  ? 147  ASP C OD1 1 
ATOM   8425  O OD2 . ASP C 1 151 ? 12.385  -10.996 39.947  1.00 52.42  ? 147  ASP C OD2 1 
ATOM   8426  N N   . GLY C 1 152 ? 12.743  -15.842 37.782  1.00 53.29  ? 148  GLY C N   1 
ATOM   8427  C CA  . GLY C 1 152 ? 12.272  -17.226 37.764  1.00 54.84  ? 148  GLY C CA  1 
ATOM   8428  C C   . GLY C 1 152 ? 12.716  -18.034 36.559  1.00 54.12  ? 148  GLY C C   1 
ATOM   8429  O O   . GLY C 1 152 ? 13.426  -17.529 35.685  1.00 52.36  ? 148  GLY C O   1 
ATOM   8430  N N   . ASP C 1 153 ? 12.284  -19.295 36.516  1.00 55.65  ? 149  ASP C N   1 
ATOM   8431  C CA  . ASP C 1 153 ? 12.606  -20.201 35.414  1.00 55.52  ? 149  ASP C CA  1 
ATOM   8432  C C   . ASP C 1 153 ? 11.772  -19.904 34.161  1.00 54.41  ? 149  ASP C C   1 
ATOM   8433  O O   . ASP C 1 153 ? 10.935  -20.713 33.745  1.00 55.43  ? 149  ASP C O   1 
ATOM   8434  C CB  . ASP C 1 153 ? 12.434  -21.664 35.849  1.00 57.84  ? 149  ASP C CB  1 
ATOM   8435  C CG  . ASP C 1 153 ? 13.401  -22.072 36.953  1.00 59.27  ? 149  ASP C CG  1 
ATOM   8436  O OD1 . ASP C 1 153 ? 14.514  -21.503 37.031  1.00 58.26  ? 149  ASP C OD1 1 
ATOM   8437  O OD2 . ASP C 1 153 ? 13.044  -22.975 37.740  1.00 61.34  ? 149  ASP C OD2 1 
ATOM   8438  N N   . TYR C 1 154 ? 12.014  -18.739 33.564  1.00 52.47  ? 150  TYR C N   1 
ATOM   8439  C CA  . TYR C 1 154 ? 11.298  -18.312 32.366  1.00 51.47  ? 150  TYR C CA  1 
ATOM   8440  C C   . TYR C 1 154 ? 12.249  -17.683 31.353  1.00 49.76  ? 150  TYR C C   1 
ATOM   8441  O O   . TYR C 1 154 ? 13.369  -17.287 31.688  1.00 49.29  ? 150  TYR C O   1 
ATOM   8442  C CB  . TYR C 1 154 ? 10.188  -17.310 32.715  1.00 51.24  ? 150  TYR C CB  1 
ATOM   8443  C CG  . TYR C 1 154 ? 9.154   -17.814 33.701  1.00 53.22  ? 150  TYR C CG  1 
ATOM   8444  C CD1 . TYR C 1 154 ? 8.081   -18.598 33.280  1.00 54.40  ? 150  TYR C CD1 1 
ATOM   8445  C CD2 . TYR C 1 154 ? 9.243   -17.494 35.057  1.00 54.14  ? 150  TYR C CD2 1 
ATOM   8446  C CE1 . TYR C 1 154 ? 7.127   -19.062 34.187  1.00 56.26  ? 150  TYR C CE1 1 
ATOM   8447  C CE2 . TYR C 1 154 ? 8.293   -17.952 35.970  1.00 56.01  ? 150  TYR C CE2 1 
ATOM   8448  C CZ  . TYR C 1 154 ? 7.240   -18.734 35.526  1.00 57.06  ? 150  TYR C CZ  1 
ATOM   8449  O OH  . TYR C 1 154 ? 6.303   -19.187 36.423  1.00 59.42  ? 150  TYR C OH  1 
ATOM   8450  N N   . PHE C 1 155 ? 11.795  -17.601 30.109  1.00 49.21  ? 151  PHE C N   1 
ATOM   8451  C CA  . PHE C 1 155 ? 12.526  -16.910 29.061  1.00 47.74  ? 151  PHE C CA  1 
ATOM   8452  C C   . PHE C 1 155 ? 11.537  -16.130 28.210  1.00 46.95  ? 151  PHE C C   1 
ATOM   8453  O O   . PHE C 1 155 ? 10.691  -16.720 27.531  1.00 47.62  ? 151  PHE C O   1 
ATOM   8454  C CB  . PHE C 1 155 ? 13.324  -17.901 28.212  1.00 48.12  ? 151  PHE C CB  1 
ATOM   8455  C CG  . PHE C 1 155 ? 13.798  -17.337 26.902  1.00 47.22  ? 151  PHE C CG  1 
ATOM   8456  C CD1 . PHE C 1 155 ? 14.756  -16.322 26.867  1.00 46.38  ? 151  PHE C CD1 1 
ATOM   8457  C CD2 . PHE C 1 155 ? 13.292  -17.825 25.699  1.00 47.78  ? 151  PHE C CD2 1 
ATOM   8458  C CE1 . PHE C 1 155 ? 15.198  -15.799 25.651  1.00 45.74  ? 151  PHE C CE1 1 
ATOM   8459  C CE2 . PHE C 1 155 ? 13.727  -17.310 24.476  1.00 46.99  ? 151  PHE C CE2 1 
ATOM   8460  C CZ  . PHE C 1 155 ? 14.681  -16.295 24.452  1.00 45.83  ? 151  PHE C CZ  1 
ATOM   8461  N N   . THR C 1 156 ? 11.642  -14.804 28.262  1.00 45.71  ? 152  THR C N   1 
ATOM   8462  C CA  . THR C 1 156 ? 10.696  -13.934 27.569  1.00 45.08  ? 152  THR C CA  1 
ATOM   8463  C C   . THR C 1 156 ? 11.367  -13.151 26.449  1.00 43.70  ? 152  THR C C   1 
ATOM   8464  O O   . THR C 1 156 ? 12.513  -12.725 26.575  1.00 42.90  ? 152  THR C O   1 
ATOM   8465  C CB  . THR C 1 156 ? 9.983   -12.951 28.534  1.00 45.11  ? 152  THR C CB  1 
ATOM   8466  O OG1 . THR C 1 156 ? 10.759  -11.758 28.677  1.00 43.73  ? 152  THR C OG1 1 
ATOM   8467  C CG2 . THR C 1 156 ? 9.765   -13.587 29.906  1.00 46.60  ? 152  THR C CG2 1 
ATOM   8468  N N   . PHE C 1 157 ? 10.638  -12.977 25.351  1.00 43.77  ? 153  PHE C N   1 
ATOM   8469  C CA  . PHE C 1 157 ? 11.093  -12.163 24.223  1.00 42.92  ? 153  PHE C CA  1 
ATOM   8470  C C   . PHE C 1 157 ? 9.934   -11.398 23.590  1.00 43.06  ? 153  PHE C C   1 
ATOM   8471  O O   . PHE C 1 157 ? 8.772   -11.708 23.839  1.00 44.08  ? 153  PHE C O   1 
ATOM   8472  C CB  . PHE C 1 157 ? 11.823  -13.013 23.175  1.00 42.90  ? 153  PHE C CB  1 
ATOM   8473  C CG  . PHE C 1 157 ? 11.003  -14.144 22.618  1.00 43.95  ? 153  PHE C CG  1 
ATOM   8474  C CD1 . PHE C 1 157 ? 10.150  -13.940 21.536  1.00 43.88  ? 153  PHE C CD1 1 
ATOM   8475  C CD2 . PHE C 1 157 ? 11.102  -15.422 23.159  1.00 44.93  ? 153  PHE C CD2 1 
ATOM   8476  C CE1 . PHE C 1 157 ? 9.397   -14.986 21.016  1.00 45.12  ? 153  PHE C CE1 1 
ATOM   8477  C CE2 . PHE C 1 157 ? 10.356  -16.472 22.645  1.00 46.17  ? 153  PHE C CE2 1 
ATOM   8478  C CZ  . PHE C 1 157 ? 9.503   -16.256 21.571  1.00 46.35  ? 153  PHE C CZ  1 
ATOM   8479  N N   . THR C 1 158 ? 10.256  -10.399 22.776  1.00 42.50  ? 154  THR C N   1 
ATOM   8480  C CA  . THR C 1 158 ? 9.235   -9.567  22.146  1.00 42.81  ? 154  THR C CA  1 
ATOM   8481  C C   . THR C 1 158 ? 9.430   -9.495  20.639  1.00 42.83  ? 154  THR C C   1 
ATOM   8482  O O   . THR C 1 158 ? 10.564  -9.491  20.151  1.00 42.26  ? 154  THR C O   1 
ATOM   8483  C CB  . THR C 1 158 ? 9.225   -8.127  22.714  1.00 42.07  ? 154  THR C CB  1 
ATOM   8484  O OG1 . THR C 1 158 ? 10.429  -7.452  22.334  1.00 41.21  ? 154  THR C OG1 1 
ATOM   8485  C CG2 . THR C 1 158 ? 9.107   -8.132  24.236  1.00 42.40  ? 154  THR C CG2 1 
ATOM   8486  N N   . ARG C 1 159 ? 8.315   -9.445  19.911  1.00 43.91  ? 155  ARG C N   1 
ATOM   8487  C CA  . ARG C 1 159 ? 8.334   -9.201  18.469  1.00 44.22  ? 155  ARG C CA  1 
ATOM   8488  C C   . ARG C 1 159 ? 7.638   -7.890  18.166  1.00 43.96  ? 155  ARG C C   1 
ATOM   8489  O O   . ARG C 1 159 ? 6.551   -7.620  18.688  1.00 44.59  ? 155  ARG C O   1 
ATOM   8490  C CB  . ARG C 1 159 ? 7.601   -10.296 17.699  1.00 45.61  ? 155  ARG C CB  1 
ATOM   8491  C CG  . ARG C 1 159 ? 7.766   -11.707 18.212  1.00 47.72  ? 155  ARG C CG  1 
ATOM   8492  C CD  . ARG C 1 159 ? 6.656   -12.565 17.642  1.00 51.11  ? 155  ARG C CD  1 
ATOM   8493  N NE  . ARG C 1 159 ? 7.094   -13.932 17.392  1.00 53.91  ? 155  ARG C NE  1 
ATOM   8494  C CZ  . ARG C 1 159 ? 6.642   -14.690 16.398  1.00 56.22  ? 155  ARG C CZ  1 
ATOM   8495  N NH1 . ARG C 1 159 ? 5.737   -14.208 15.548  1.00 56.91  ? 155  ARG C NH1 1 
ATOM   8496  N NH2 . ARG C 1 159 ? 7.107   -15.927 16.246  1.00 57.74  ? 155  ARG C NH2 1 
ATOM   8497  N N   . HIS C 1 160 ? 8.264   -7.077  17.323  1.00 43.31  ? 156  HIS C N   1 
ATOM   8498  C CA  . HIS C 1 160 ? 7.576   -5.946  16.718  1.00 43.35  ? 156  HIS C CA  1 
ATOM   8499  C C   . HIS C 1 160 ? 6.787   -6.484  15.522  1.00 44.17  ? 156  HIS C C   1 
ATOM   8500  O O   . HIS C 1 160 ? 7.360   -7.046  14.587  1.00 44.21  ? 156  HIS C O   1 
ATOM   8501  C CB  . HIS C 1 160 ? 8.568   -4.860  16.287  1.00 42.55  ? 156  HIS C CB  1 
ATOM   8502  C CG  . HIS C 1 160 ? 8.978   -3.928  17.389  1.00 42.23  ? 156  HIS C CG  1 
ATOM   8503  N ND1 . HIS C 1 160 ? 9.610   -4.357  18.537  1.00 42.40  ? 156  HIS C ND1 1 
ATOM   8504  C CD2 . HIS C 1 160 ? 8.869   -2.582  17.503  1.00 42.20  ? 156  HIS C CD2 1 
ATOM   8505  C CE1 . HIS C 1 160 ? 9.861   -3.318  19.315  1.00 41.90  ? 156  HIS C CE1 1 
ATOM   8506  N NE2 . HIS C 1 160 ? 9.422   -2.229  18.711  1.00 41.70  ? 156  HIS C NE2 1 
ATOM   8507  N N   . GLU C 1 161 ? 5.469   -6.333  15.582  1.00 44.96  ? 157  GLU C N   1 
ATOM   8508  C CA  . GLU C 1 161 ? 4.570   -6.825  14.542  1.00 46.23  ? 157  GLU C CA  1 
ATOM   8509  C C   . GLU C 1 161 ? 3.700   -5.696  13.987  1.00 46.50  ? 157  GLU C C   1 
ATOM   8510  O O   . GLU C 1 161 ? 3.399   -4.738  14.703  1.00 46.27  ? 157  GLU C O   1 
ATOM   8511  C CB  . GLU C 1 161 ? 3.686   -7.950  15.093  1.00 47.52  ? 157  GLU C CB  1 
ATOM   8512  C CG  . GLU C 1 161 ? 4.425   -9.266  15.331  1.00 48.26  ? 157  GLU C CG  1 
ATOM   8513  C CD  . GLU C 1 161 ? 3.525   -10.381 15.843  1.00 50.38  ? 157  GLU C CD  1 
ATOM   8514  O OE1 . GLU C 1 161 ? 2.417   -10.084 16.344  1.00 51.29  ? 157  GLU C OE1 1 
ATOM   8515  O OE2 . GLU C 1 161 ? 3.936   -11.560 15.748  1.00 51.05  ? 157  GLU C OE2 1 
ATOM   8516  N N   . PRO C 1 162 ? 3.289   -5.801  12.708  1.00 47.20  ? 158  PRO C N   1 
ATOM   8517  C CA  . PRO C 1 162 ? 2.403   -4.794  12.123  1.00 47.80  ? 158  PRO C CA  1 
ATOM   8518  C C   . PRO C 1 162 ? 1.077   -4.669  12.879  1.00 48.66  ? 158  PRO C C   1 
ATOM   8519  O O   . PRO C 1 162 ? 0.567   -5.665  13.399  1.00 49.40  ? 158  PRO C O   1 
ATOM   8520  C CB  . PRO C 1 162 ? 2.156   -5.324  10.705  1.00 48.87  ? 158  PRO C CB  1 
ATOM   8521  C CG  . PRO C 1 162 ? 2.504   -6.764  10.762  1.00 49.15  ? 158  PRO C CG  1 
ATOM   8522  C CD  . PRO C 1 162 ? 3.630   -6.846  11.729  1.00 47.80  ? 158  PRO C CD  1 
ATOM   8523  N N   . ILE C 1 163 ? 0.542   -3.450  12.936  1.00 48.64  ? 159  ILE C N   1 
ATOM   8524  C CA  . ILE C 1 163 ? -0.732  -3.175  13.610  1.00 49.68  ? 159  ILE C CA  1 
ATOM   8525  C C   . ILE C 1 163 ? -1.920  -3.777  12.847  1.00 51.53  ? 159  ILE C C   1 
ATOM   8526  O O   . ILE C 1 163 ? -2.783  -4.428  13.441  1.00 52.63  ? 159  ILE C O   1 
ATOM   8527  C CB  . ILE C 1 163 ? -0.945  -1.653  13.834  1.00 49.48  ? 159  ILE C CB  1 
ATOM   8528  C CG1 . ILE C 1 163 ? 0.199   -1.078  14.680  1.00 47.87  ? 159  ILE C CG1 1 
ATOM   8529  C CG2 . ILE C 1 163 ? -2.302  -1.384  14.486  1.00 50.96  ? 159  ILE C CG2 1 
ATOM   8530  C CD1 . ILE C 1 163 ? 0.087   0.403   14.992  1.00 47.68  ? 159  ILE C CD1 1 
ATOM   8531  N N   . GLY C 1 164 ? -1.944  -3.565  11.534  1.00 51.88  ? 160  GLY C N   1 
ATOM   8532  C CA  . GLY C 1 164 ? -3.033  -4.032  10.687  1.00 53.72  ? 160  GLY C CA  1 
ATOM   8533  C C   . GLY C 1 164 ? -3.403  -3.003  9.640   1.00 54.40  ? 160  GLY C C   1 
ATOM   8534  O O   . GLY C 1 164 ? -2.524  -2.392  9.021   1.00 53.42  ? 160  GLY C O   1 
ATOM   8535  N N   . VAL C 1 165 ? -4.706  -2.812  9.444   1.00 56.19  ? 161  VAL C N   1 
ATOM   8536  C CA  . VAL C 1 165 ? -5.215  -1.841  8.478   1.00 57.16  ? 161  VAL C CA  1 
ATOM   8537  C C   . VAL C 1 165 ? -5.127  -0.429  9.061   1.00 56.39  ? 161  VAL C C   1 
ATOM   8538  O O   . VAL C 1 165 ? -5.743  -0.126  10.090  1.00 56.72  ? 161  VAL C O   1 
ATOM   8539  C CB  . VAL C 1 165 ? -6.663  -2.171  8.040   1.00 59.88  ? 161  VAL C CB  1 
ATOM   8540  C CG1 . VAL C 1 165 ? -7.138  -1.199  6.963   1.00 61.12  ? 161  VAL C CG1 1 
ATOM   8541  C CG2 . VAL C 1 165 ? -6.760  -3.611  7.540   1.00 60.75  ? 161  VAL C CG2 1 
ATOM   8542  N N   . CYS C 1 166 ? -4.354  0.425   8.393   1.00 55.44  ? 162  CYS C N   1 
ATOM   8543  C CA  . CYS C 1 166 ? -4.073  1.769   8.888   1.00 54.66  ? 162  CYS C CA  1 
ATOM   8544  C C   . CYS C 1 166 ? -4.732  2.854   8.049   1.00 56.01  ? 162  CYS C C   1 
ATOM   8545  O O   . CYS C 1 166 ? -4.430  3.012   6.864   1.00 56.41  ? 162  CYS C O   1 
ATOM   8546  C CB  . CYS C 1 166 ? -2.566  2.009   8.956   1.00 52.52  ? 162  CYS C CB  1 
ATOM   8547  S SG  . CYS C 1 166 ? -1.681  0.751   9.888   1.00 51.65  ? 162  CYS C SG  1 
ATOM   8548  N N   . GLY C 1 167 ? -5.638  3.593   8.678   1.00 56.92  ? 163  GLY C N   1 
ATOM   8549  C CA  . GLY C 1 167 ? -6.258  4.752   8.055   1.00 58.21  ? 163  GLY C CA  1 
ATOM   8550  C C   . GLY C 1 167 ? -5.319  5.936   8.120   1.00 56.84  ? 163  GLY C C   1 
ATOM   8551  O O   . GLY C 1 167 ? -4.755  6.228   9.174   1.00 55.51  ? 163  GLY C O   1 
ATOM   8552  N N   . GLN C 1 168 ? -5.141  6.610   6.989   1.00 57.34  ? 164  GLN C N   1 
ATOM   8553  C CA  . GLN C 1 168 ? -4.239  7.753   6.909   1.00 56.35  ? 164  GLN C CA  1 
ATOM   8554  C C   . GLN C 1 168 ? -4.896  8.913   6.177   1.00 58.31  ? 164  GLN C C   1 
ATOM   8555  O O   . GLN C 1 168 ? -5.329  8.772   5.031   1.00 59.71  ? 164  GLN C O   1 
ATOM   8556  C CB  . GLN C 1 168 ? -2.927  7.357   6.223   1.00 54.82  ? 164  GLN C CB  1 
ATOM   8557  C CG  . GLN C 1 168 ? -2.002  6.506   7.088   1.00 52.62  ? 164  GLN C CG  1 
ATOM   8558  C CD  . GLN C 1 168 ? -0.803  5.960   6.331   1.00 51.31  ? 164  GLN C CD  1 
ATOM   8559  O OE1 . GLN C 1 168 ? -0.627  6.226   5.142   1.00 52.08  ? 164  GLN C OE1 1 
ATOM   8560  N NE2 . GLN C 1 168 ? 0.031   5.188   7.022   1.00 49.49  ? 164  GLN C NE2 1 
ATOM   8561  N N   . ILE C 1 169 ? -4.978  10.056  6.853   1.00 58.55  ? 165  ILE C N   1 
ATOM   8562  C CA  . ILE C 1 169 ? -5.568  11.263  6.271   1.00 60.59  ? 165  ILE C CA  1 
ATOM   8563  C C   . ILE C 1 169 ? -4.536  12.389  6.282   1.00 59.92  ? 165  ILE C C   1 
ATOM   8564  O O   . ILE C 1 169 ? -3.975  12.705  7.331   1.00 58.80  ? 165  ILE C O   1 
ATOM   8565  C CB  . ILE C 1 169 ? -6.859  11.698  7.023   1.00 62.30  ? 165  ILE C CB  1 
ATOM   8566  C CG1 . ILE C 1 169 ? -7.913  10.587  6.975   1.00 63.17  ? 165  ILE C CG1 1 
ATOM   8567  C CG2 . ILE C 1 169 ? -7.427  12.982  6.426   1.00 64.55  ? 165  ILE C CG2 1 
ATOM   8568  C CD1 . ILE C 1 169 ? -9.032  10.736  7.986   1.00 64.32  ? 165  ILE C CD1 1 
ATOM   8569  N N   . ILE C 1 170 ? -4.284  12.979  5.113   1.00 60.90  ? 166  ILE C N   1 
ATOM   8570  C CA  . ILE C 1 170 ? -3.298  14.064  4.984   1.00 60.61  ? 166  ILE C CA  1 
ATOM   8571  C C   . ILE C 1 170 ? -3.909  15.380  4.466   1.00 63.04  ? 166  ILE C C   1 
ATOM   8572  O O   . ILE C 1 170 ? -5.022  15.374  3.933   1.00 65.02  ? 166  ILE C O   1 
ATOM   8573  C CB  . ILE C 1 170 ? -2.054  13.650  4.122   1.00 59.35  ? 166  ILE C CB  1 
ATOM   8574  C CG1 . ILE C 1 170 ? -2.429  13.388  2.653   1.00 60.93  ? 166  ILE C CG1 1 
ATOM   8575  C CG2 . ILE C 1 170 ? -1.304  12.483  4.772   1.00 57.12  ? 166  ILE C CG2 1 
ATOM   8576  C CD1 . ILE C 1 170 ? -2.809  11.956  2.327   1.00 60.79  ? 166  ILE C CD1 1 
ATOM   8577  N N   . PRO C 1 171 ? -3.189  16.512  4.638   1.00 63.07  ? 167  PRO C N   1 
ATOM   8578  C CA  . PRO C 1 171 ? -3.684  17.793  4.149   1.00 65.51  ? 167  PRO C CA  1 
ATOM   8579  C C   . PRO C 1 171 ? -3.156  18.168  2.755   1.00 66.53  ? 167  PRO C C   1 
ATOM   8580  O O   . PRO C 1 171 ? -2.572  17.329  2.059   1.00 65.50  ? 167  PRO C O   1 
ATOM   8581  C CB  . PRO C 1 171 ? -3.165  18.775  5.202   1.00 65.09  ? 167  PRO C CB  1 
ATOM   8582  C CG  . PRO C 1 171 ? -1.875  18.180  5.656   1.00 62.35  ? 167  PRO C CG  1 
ATOM   8583  C CD  . PRO C 1 171 ? -1.948  16.685  5.419   1.00 61.09  ? 167  PRO C CD  1 
ATOM   8584  N N   . TRP C 1 172 ? -3.374  19.425  2.368   1.00 68.68  ? 168  TRP C N   1 
ATOM   8585  C CA  . TRP C 1 172 ? -2.971  19.950  1.060   1.00 70.15  ? 168  TRP C CA  1 
ATOM   8586  C C   . TRP C 1 172 ? -1.617  20.666  1.083   1.00 69.45  ? 168  TRP C C   1 
ATOM   8587  O O   . TRP C 1 172 ? -1.200  21.250  0.078   1.00 70.67  ? 168  TRP C O   1 
ATOM   8588  C CB  . TRP C 1 172 ? -4.049  20.897  0.526   1.00 73.20  ? 168  TRP C CB  1 
ATOM   8589  C CG  . TRP C 1 172 ? -4.575  21.868  1.555   1.00 74.16  ? 168  TRP C CG  1 
ATOM   8590  C CD1 . TRP C 1 172 ? -5.740  21.761  2.260   1.00 75.08  ? 168  TRP C CD1 1 
ATOM   8591  C CD2 . TRP C 1 172 ? -3.953  23.083  1.994   1.00 74.38  ? 168  TRP C CD2 1 
ATOM   8592  N NE1 . TRP C 1 172 ? -5.887  22.834  3.106   1.00 75.83  ? 168  TRP C NE1 1 
ATOM   8593  C CE2 . TRP C 1 172 ? -4.804  23.661  2.964   1.00 75.40  ? 168  TRP C CE2 1 
ATOM   8594  C CE3 . TRP C 1 172 ? -2.761  23.742  1.662   1.00 73.88  ? 168  TRP C CE3 1 
ATOM   8595  C CZ2 . TRP C 1 172 ? -4.500  24.864  3.607   1.00 76.09  ? 168  TRP C CZ2 1 
ATOM   8596  C CZ3 . TRP C 1 172 ? -2.460  24.936  2.301   1.00 74.48  ? 168  TRP C CZ3 1 
ATOM   8597  C CH2 . TRP C 1 172 ? -3.327  25.485  3.263   1.00 75.69  ? 168  TRP C CH2 1 
ATOM   8598  N N   . ASN C 1 173 ? -0.941  20.612  2.229   1.00 67.77  ? 169  ASN C N   1 
ATOM   8599  C CA  . ASN C 1 173 ? 0.304   21.349  2.459   1.00 67.34  ? 169  ASN C CA  1 
ATOM   8600  C C   . ASN C 1 173 ? 1.476   20.825  1.634   1.00 66.32  ? 169  ASN C C   1 
ATOM   8601  O O   . ASN C 1 173 ? 2.058   21.556  0.831   1.00 67.58  ? 169  ASN C O   1 
ATOM   8602  C CB  . ASN C 1 173 ? 0.658   21.347  3.953   1.00 65.75  ? 169  ASN C CB  1 
ATOM   8603  C CG  . ASN C 1 173 ? -0.206  22.308  4.766   1.00 67.87  ? 169  ASN C CG  1 
ATOM   8604  O OD1 . ASN C 1 173 ? 0.303   23.028  5.624   1.00 68.45  ? 169  ASN C OD1 1 
ATOM   8605  N ND2 . ASN C 1 173 ? -1.513  22.322  4.502   1.00 69.76  ? 169  ASN C ND2 1 
ATOM   8606  N N   . PHE C 1 174 ? 1.818   19.560  1.846   1.00 64.32  ? 170  PHE C N   1 
ATOM   8607  C CA  . PHE C 1 174 ? 2.841   18.889  1.058   1.00 63.51  ? 170  PHE C CA  1 
ATOM   8608  C C   . PHE C 1 174 ? 2.274   17.545  0.613   1.00 63.04  ? 170  PHE C C   1 
ATOM   8609  O O   . PHE C 1 174 ? 2.656   16.502  1.148   1.00 61.27  ? 170  PHE C O   1 
ATOM   8610  C CB  . PHE C 1 174 ? 4.117   18.694  1.882   1.00 61.46  ? 170  PHE C CB  1 
ATOM   8611  C CG  . PHE C 1 174 ? 4.792   19.976  2.272   1.00 62.31  ? 170  PHE C CG  1 
ATOM   8612  C CD1 . PHE C 1 174 ? 5.811   20.506  1.488   1.00 63.44  ? 170  PHE C CD1 1 
ATOM   8613  C CD2 . PHE C 1 174 ? 4.417   20.652  3.429   1.00 62.52  ? 170  PHE C CD2 1 
ATOM   8614  C CE1 . PHE C 1 174 ? 6.442   21.694  1.848   1.00 64.41  ? 170  PHE C CE1 1 
ATOM   8615  C CE2 . PHE C 1 174 ? 5.039   21.838  3.794   1.00 63.40  ? 170  PHE C CE2 1 
ATOM   8616  C CZ  . PHE C 1 174 ? 6.055   22.360  3.004   1.00 64.37  ? 170  PHE C CZ  1 
ATOM   8617  N N   . PRO C 1 175 ? 1.352   17.568  -0.370  1.00 64.86  ? 171  PRO C N   1 
ATOM   8618  C CA  . PRO C 1 175 ? 0.570   16.394  -0.773  1.00 64.88  ? 171  PRO C CA  1 
ATOM   8619  C C   . PRO C 1 175 ? 1.406   15.125  -0.949  1.00 63.07  ? 171  PRO C C   1 
ATOM   8620  O O   . PRO C 1 175 ? 1.009   14.056  -0.479  1.00 61.98  ? 171  PRO C O   1 
ATOM   8621  C CB  . PRO C 1 175 ? -0.035  16.824  -2.111  1.00 67.57  ? 171  PRO C CB  1 
ATOM   8622  C CG  . PRO C 1 175 ? -0.115  18.300  -2.019  1.00 68.99  ? 171  PRO C CG  1 
ATOM   8623  C CD  . PRO C 1 175 ? 1.076   18.731  -1.235  1.00 67.31  ? 171  PRO C CD  1 
ATOM   8624  N N   . LEU C 1 176 ? 2.559   15.256  -1.602  1.00 62.83  ? 172  LEU C N   1 
ATOM   8625  C CA  . LEU C 1 176 ? 3.428   14.120  -1.878  1.00 61.45  ? 172  LEU C CA  1 
ATOM   8626  C C   . LEU C 1 176 ? 4.330   13.783  -0.692  1.00 59.03  ? 172  LEU C C   1 
ATOM   8627  O O   . LEU C 1 176 ? 4.473   12.614  -0.335  1.00 57.66  ? 172  LEU C O   1 
ATOM   8628  C CB  . LEU C 1 176 ? 4.259   14.377  -3.140  1.00 62.71  ? 172  LEU C CB  1 
ATOM   8629  C CG  . LEU C 1 176 ? 4.816   13.170  -3.905  1.00 62.41  ? 172  LEU C CG  1 
ATOM   8630  C CD1 . LEU C 1 176 ? 3.709   12.223  -4.349  1.00 63.02  ? 172  LEU C CD1 1 
ATOM   8631  C CD2 . LEU C 1 176 ? 5.616   13.636  -5.105  1.00 63.99  ? 172  LEU C CD2 1 
ATOM   8632  N N   . LEU C 1 177 ? 4.939   14.802  -0.087  1.00 58.68  ? 173  LEU C N   1 
ATOM   8633  C CA  . LEU C 1 177 ? 5.765   14.600  1.103   1.00 56.68  ? 173  LEU C CA  1 
ATOM   8634  C C   . LEU C 1 177 ? 4.964   14.014  2.262   1.00 55.67  ? 173  LEU C C   1 
ATOM   8635  O O   . LEU C 1 177 ? 5.455   13.132  2.970   1.00 54.04  ? 173  LEU C O   1 
ATOM   8636  C CB  . LEU C 1 177 ? 6.448   15.898  1.545   1.00 56.85  ? 173  LEU C CB  1 
ATOM   8637  C CG  . LEU C 1 177 ? 7.928   16.107  1.227   1.00 56.40  ? 173  LEU C CG  1 
ATOM   8638  C CD1 . LEU C 1 177 ? 8.374   17.475  1.710   1.00 57.07  ? 173  LEU C CD1 1 
ATOM   8639  C CD2 . LEU C 1 177 ? 8.779   15.022  1.862   1.00 54.38  ? 173  LEU C CD2 1 
ATOM   8640  N N   . MET C 1 178 ? 3.740   14.505  2.453   1.00 56.84  ? 174  MET C N   1 
ATOM   8641  C CA  . MET C 1 178 ? 2.840   13.949  3.460   1.00 56.33  ? 174  MET C CA  1 
ATOM   8642  C C   . MET C 1 178 ? 2.473   12.508  3.112   1.00 55.80  ? 174  MET C C   1 
ATOM   8643  O O   . MET C 1 178 ? 2.396   11.655  3.997   1.00 54.63  ? 174  MET C O   1 
ATOM   8644  C CB  . MET C 1 178 ? 1.577   14.806  3.628   1.00 58.21  ? 174  MET C CB  1 
ATOM   8645  C CG  . MET C 1 178 ? 1.786   16.145  4.343   1.00 59.39  ? 174  MET C CG  1 
ATOM   8646  S SD  . MET C 1 178 ? 2.829   16.079  5.827   1.00 59.28  ? 174  MET C SD  1 
ATOM   8647  C CE  . MET C 1 178 ? 1.895   14.991  6.900   1.00 58.41  ? 174  MET C CE  1 
ATOM   8648  N N   . PHE C 1 179 ? 2.261   12.245  1.821   1.00 56.88  ? 175  PHE C N   1 
ATOM   8649  C CA  . PHE C 1 179 ? 2.007   10.894  1.329   1.00 56.54  ? 175  PHE C CA  1 
ATOM   8650  C C   . PHE C 1 179 ? 3.206   10.005  1.631   1.00 54.56  ? 175  PHE C C   1 
ATOM   8651  O O   . PHE C 1 179 ? 3.048   8.912   2.168   1.00 53.60  ? 175  PHE C O   1 
ATOM   8652  C CB  . PHE C 1 179 ? 1.710   10.915  -0.176  1.00 58.54  ? 175  PHE C CB  1 
ATOM   8653  C CG  . PHE C 1 179 ? 1.264   9.587   -0.739  1.00 58.89  ? 175  PHE C CG  1 
ATOM   8654  C CD1 . PHE C 1 179 ? 2.168   8.756   -1.400  1.00 58.44  ? 175  PHE C CD1 1 
ATOM   8655  C CD2 . PHE C 1 179 ? -0.063  9.177   -0.630  1.00 59.71  ? 175  PHE C CD2 1 
ATOM   8656  C CE1 . PHE C 1 179 ? 1.760   7.530   -1.930  1.00 58.85  ? 175  PHE C CE1 1 
ATOM   8657  C CE2 . PHE C 1 179 ? -0.481  7.954   -1.158  1.00 60.30  ? 175  PHE C CE2 1 
ATOM   8658  C CZ  . PHE C 1 179 ? 0.434   7.130   -1.811  1.00 59.95  ? 175  PHE C CZ  1 
ATOM   8659  N N   . ALA C 1 180 ? 4.401   10.495  1.308   1.00 54.11  ? 176  ALA C N   1 
ATOM   8660  C CA  . ALA C 1 180 ? 5.642   9.751   1.521   1.00 52.56  ? 176  ALA C CA  1 
ATOM   8661  C C   . ALA C 1 180 ? 5.939   9.507   2.999   1.00 50.70  ? 176  ALA C C   1 
ATOM   8662  O O   . ALA C 1 180 ? 6.369   8.416   3.371   1.00 49.52  ? 176  ALA C O   1 
ATOM   8663  C CB  . ALA C 1 180 ? 6.809   10.465  0.857   1.00 52.99  ? 176  ALA C CB  1 
ATOM   8664  N N   . TRP C 1 181 ? 5.701   10.523  3.830   1.00 50.64  ? 177  TRP C N   1 
ATOM   8665  C CA  . TRP C 1 181 ? 5.976   10.451  5.268   1.00 49.05  ? 177  TRP C CA  1 
ATOM   8666  C C   . TRP C 1 181 ? 4.991   9.568   6.021   1.00 48.53  ? 177  TRP C C   1 
ATOM   8667  O O   . TRP C 1 181 ? 5.205   9.266   7.197   1.00 47.35  ? 177  TRP C O   1 
ATOM   8668  C CB  . TRP C 1 181 ? 5.985   11.848  5.899   1.00 49.47  ? 177  TRP C CB  1 
ATOM   8669  C CG  . TRP C 1 181 ? 7.230   12.648  5.635   1.00 50.10  ? 177  TRP C CG  1 
ATOM   8670  C CD1 . TRP C 1 181 ? 8.450   12.170  5.249   1.00 49.74  ? 177  TRP C CD1 1 
ATOM   8671  C CD2 . TRP C 1 181 ? 7.384   14.066  5.777   1.00 51.78  ? 177  TRP C CD2 1 
ATOM   8672  N NE1 . TRP C 1 181 ? 9.347   13.202  5.121   1.00 50.47  ? 177  TRP C NE1 1 
ATOM   8673  C CE2 . TRP C 1 181 ? 8.722   14.377  5.441   1.00 51.71  ? 177  TRP C CE2 1 
ATOM   8674  C CE3 . TRP C 1 181 ? 6.520   15.107  6.145   1.00 53.54  ? 177  TRP C CE3 1 
ATOM   8675  C CZ2 . TRP C 1 181 ? 9.218   15.687  5.462   1.00 53.02  ? 177  TRP C CZ2 1 
ATOM   8676  C CZ3 . TRP C 1 181 ? 7.016   16.413  6.166   1.00 54.75  ? 177  TRP C CZ3 1 
ATOM   8677  C CH2 . TRP C 1 181 ? 8.353   16.688  5.825   1.00 54.31  ? 177  TRP C CH2 1 
ATOM   8678  N N   . LYS C 1 182 ? 3.912   9.166   5.351   1.00 49.54  ? 178  LYS C N   1 
ATOM   8679  C CA  . LYS C 1 182 ? 2.895   8.319   5.972   1.00 49.40  ? 178  LYS C CA  1 
ATOM   8680  C C   . LYS C 1 182 ? 2.878   6.898   5.418   1.00 49.19  ? 178  LYS C C   1 
ATOM   8681  O O   . LYS C 1 182 ? 2.660   5.941   6.167   1.00 48.53  ? 178  LYS C O   1 
ATOM   8682  C CB  . LYS C 1 182 ? 1.508   8.968   5.892   1.00 51.02  ? 178  LYS C CB  1 
ATOM   8683  C CG  . LYS C 1 182 ? 1.345   10.136  6.856   1.00 51.07  ? 178  LYS C CG  1 
ATOM   8684  C CD  . LYS C 1 182 ? -0.079  10.264  7.357   1.00 52.38  ? 178  LYS C CD  1 
ATOM   8685  C CE  . LYS C 1 182 ? -0.125  10.500  8.870   1.00 51.83  ? 178  LYS C CE  1 
ATOM   8686  N NZ  . LYS C 1 182 ? 0.679   11.658  9.356   1.00 51.49  ? 178  LYS C NZ  1 
ATOM   8687  N N   . ILE C 1 183 ? 3.121   6.768   4.115   1.00 49.90  ? 179  ILE C N   1 
ATOM   8688  C CA  . ILE C 1 183 ? 3.148   5.465   3.447   1.00 50.00  ? 179  ILE C CA  1 
ATOM   8689  C C   . ILE C 1 183 ? 4.407   4.679   3.821   1.00 48.40  ? 179  ILE C C   1 
ATOM   8690  O O   . ILE C 1 183 ? 4.326   3.500   4.172   1.00 47.92  ? 179  ILE C O   1 
ATOM   8691  C CB  . ILE C 1 183 ? 3.033   5.611   1.895   1.00 51.76  ? 179  ILE C CB  1 
ATOM   8692  C CG1 . ILE C 1 183 ? 1.693   6.247   1.495   1.00 53.58  ? 179  ILE C CG1 1 
ATOM   8693  C CG2 . ILE C 1 183 ? 3.233   4.275   1.185   1.00 51.90  ? 179  ILE C CG2 1 
ATOM   8694  C CD1 . ILE C 1 183 ? 0.457   5.405   1.783   1.00 54.53  ? 179  ILE C CD1 1 
ATOM   8695  N N   . ALA C 1 184 ? 5.559   5.345   3.759   1.00 47.64  ? 180  ALA C N   1 
ATOM   8696  C CA  . ALA C 1 184 ? 6.854   4.705   4.007   1.00 46.36  ? 180  ALA C CA  1 
ATOM   8697  C C   . ALA C 1 184 ? 6.990   4.013   5.377   1.00 44.78  ? 180  ALA C C   1 
ATOM   8698  O O   . ALA C 1 184 ? 7.418   2.861   5.428   1.00 44.40  ? 180  ALA C O   1 
ATOM   8699  C CB  . ALA C 1 184 ? 8.007   5.690   3.770   1.00 46.19  ? 180  ALA C CB  1 
ATOM   8700  N N   . PRO C 1 185 ? 6.627   4.700   6.484   1.00 44.03  ? 181  PRO C N   1 
ATOM   8701  C CA  . PRO C 1 185 ? 6.771   4.039   7.782   1.00 42.69  ? 181  PRO C CA  1 
ATOM   8702  C C   . PRO C 1 185 ? 5.846   2.841   7.935   1.00 42.93  ? 181  PRO C C   1 
ATOM   8703  O O   . PRO C 1 185 ? 6.260   1.808   8.461   1.00 42.17  ? 181  PRO C O   1 
ATOM   8704  C CB  . PRO C 1 185 ? 6.377   5.133   8.780   1.00 42.53  ? 181  PRO C CB  1 
ATOM   8705  C CG  . PRO C 1 185 ? 6.547   6.407   8.036   1.00 43.41  ? 181  PRO C CG  1 
ATOM   8706  C CD  . PRO C 1 185 ? 6.151   6.086   6.640   1.00 44.51  ? 181  PRO C CD  1 
ATOM   8707  N N   . ALA C 1 186 ? 4.610   2.984   7.463   1.00 44.21  ? 182  ALA C N   1 
ATOM   8708  C CA  . ALA C 1 186 ? 3.590   1.941   7.580   1.00 44.90  ? 182  ALA C CA  1 
ATOM   8709  C C   . ALA C 1 186 ? 4.001   0.626   6.913   1.00 45.06  ? 182  ALA C C   1 
ATOM   8710  O O   . ALA C 1 186 ? 3.933   -0.437  7.534   1.00 44.76  ? 182  ALA C O   1 
ATOM   8711  C CB  . ALA C 1 186 ? 2.261   2.439   7.024   1.00 46.40  ? 182  ALA C CB  1 
ATOM   8712  N N   . LEU C 1 187 ? 4.441   0.715   5.658   1.00 45.77  ? 183  LEU C N   1 
ATOM   8713  C CA  . LEU C 1 187 ? 4.836   -0.454  4.863   1.00 46.31  ? 183  LEU C CA  1 
ATOM   8714  C C   . LEU C 1 187 ? 6.127   -1.090  5.373   1.00 45.14  ? 183  LEU C C   1 
ATOM   8715  O O   . LEU C 1 187 ? 6.311   -2.311  5.299   1.00 45.39  ? 183  LEU C O   1 
ATOM   8716  C CB  . LEU C 1 187 ? 5.010   -0.064  3.396   1.00 47.45  ? 183  LEU C CB  1 
ATOM   8717  C CG  . LEU C 1 187 ? 3.890   0.717   2.715   1.00 48.69  ? 183  LEU C CG  1 
ATOM   8718  C CD1 . LEU C 1 187 ? 4.334   1.092   1.320   1.00 49.89  ? 183  LEU C CD1 1 
ATOM   8719  C CD2 . LEU C 1 187 ? 2.599   -0.084  2.686   1.00 49.62  ? 183  LEU C CD2 1 
ATOM   8720  N N   . CYS C 1 188 ? 7.019   -0.244  5.877   1.00 44.06  ? 184  CYS C N   1 
ATOM   8721  C CA  . CYS C 1 188 ? 8.251   -0.680  6.509   1.00 42.95  ? 184  CYS C CA  1 
ATOM   8722  C C   . CYS C 1 188 ? 7.957   -1.688  7.617   1.00 42.42  ? 184  CYS C C   1 
ATOM   8723  O O   . CYS C 1 188 ? 8.713   -2.643  7.810   1.00 42.17  ? 184  CYS C O   1 
ATOM   8724  C CB  . CYS C 1 188 ? 8.982   0.535   7.076   1.00 41.96  ? 184  CYS C CB  1 
ATOM   8725  S SG  . CYS C 1 188 ? 10.442  0.178   8.048   1.00 40.85  ? 184  CYS C SG  1 
ATOM   8726  N N   . CYS C 1 189 ? 6.845   -1.475  8.322   1.00 42.41  ? 185  CYS C N   1 
ATOM   8727  C CA  . CYS C 1 189 ? 6.456   -2.309  9.455   1.00 41.97  ? 185  CYS C CA  1 
ATOM   8728  C C   . CYS C 1 189 ? 5.492   -3.438  9.092   1.00 43.24  ? 185  CYS C C   1 
ATOM   8729  O O   . CYS C 1 189 ? 5.129   -4.245  9.947   1.00 43.38  ? 185  CYS C O   1 
ATOM   8730  C CB  . CYS C 1 189 ? 5.869   -1.437  10.559  1.00 41.50  ? 185  CYS C CB  1 
ATOM   8731  S SG  . CYS C 1 189 ? 7.055   -0.251  11.201  1.00 40.28  ? 185  CYS C SG  1 
ATOM   8732  N N   . GLY C 1 190 ? 5.087   -3.496  7.826   1.00 44.47  ? 186  GLY C N   1 
ATOM   8733  C CA  . GLY C 1 190 ? 4.278   -4.603  7.321   1.00 45.81  ? 186  GLY C CA  1 
ATOM   8734  C C   . GLY C 1 190 ? 2.778   -4.372  7.332   1.00 47.06  ? 186  GLY C C   1 
ATOM   8735  O O   . GLY C 1 190 ? 2.000   -5.331  7.306   1.00 48.31  ? 186  GLY C O   1 
ATOM   8736  N N   . ASN C 1 191 ? 2.368   -3.106  7.355   1.00 46.87  ? 187  ASN C N   1 
ATOM   8737  C CA  . ASN C 1 191 ? 0.953   -2.754  7.387   1.00 48.10  ? 187  ASN C CA  1 
ATOM   8738  C C   . ASN C 1 191 ? 0.307   -2.692  6.004   1.00 49.88  ? 187  ASN C C   1 
ATOM   8739  O O   . ASN C 1 191 ? 0.996   -2.714  4.980   1.00 50.12  ? 187  ASN C O   1 
ATOM   8740  C CB  . ASN C 1 191 ? 0.759   -1.421  8.111   1.00 47.50  ? 187  ASN C CB  1 
ATOM   8741  C CG  . ASN C 1 191 ? 0.893   -1.549  9.616   1.00 46.64  ? 187  ASN C CG  1 
ATOM   8742  O OD1 . ASN C 1 191 ? 0.402   -2.506  10.218  1.00 47.17  ? 187  ASN C OD1 1 
ATOM   8743  N ND2 . ASN C 1 191 ? 1.542   -0.567  10.237  1.00 45.53  ? 187  ASN C ND2 1 
ATOM   8744  N N   . THR C 1 192 ? -1.024  -2.638  5.982   1.00 51.25  ? 188  THR C N   1 
ATOM   8745  C CA  . THR C 1 192 ? -1.758  -2.330  4.759   1.00 52.95  ? 188  THR C CA  1 
ATOM   8746  C C   . THR C 1 192 ? -2.454  -0.989  4.943   1.00 53.18  ? 188  THR C C   1 
ATOM   8747  O O   . THR C 1 192 ? -3.079  -0.740  5.976   1.00 53.03  ? 188  THR C O   1 
ATOM   8748  C CB  . THR C 1 192 ? -2.768  -3.432  4.362   1.00 54.97  ? 188  THR C CB  1 
ATOM   8749  O OG1 . THR C 1 192 ? -3.688  -3.661  5.434   1.00 55.51  ? 188  THR C OG1 1 
ATOM   8750  C CG2 . THR C 1 192 ? -2.044  -4.732  4.032   1.00 54.86  ? 188  THR C CG2 1 
ATOM   8751  N N   . VAL C 1 193 ? -2.333  -0.131  3.935   1.00 53.67  ? 189  VAL C N   1 
ATOM   8752  C CA  . VAL C 1 193 ? -2.721  1.272   4.063   1.00 53.84  ? 189  VAL C CA  1 
ATOM   8753  C C   . VAL C 1 193 ? -4.000  1.652   3.315   1.00 56.08  ? 189  VAL C C   1 
ATOM   8754  O O   . VAL C 1 193 ? -4.156  1.363   2.125   1.00 57.43  ? 189  VAL C O   1 
ATOM   8755  C CB  . VAL C 1 193 ? -1.567  2.209   3.628   1.00 52.83  ? 189  VAL C CB  1 
ATOM   8756  C CG1 . VAL C 1 193 ? -2.043  3.654   3.519   1.00 53.71  ? 189  VAL C CG1 1 
ATOM   8757  C CG2 . VAL C 1 193 ? -0.415  2.106   4.603   1.00 50.57  ? 189  VAL C CG2 1 
ATOM   8758  N N   . VAL C 1 194 ? -4.905  2.301   4.042   1.00 56.45  ? 190  VAL C N   1 
ATOM   8759  C CA  . VAL C 1 194 ? -6.047  2.981   3.454   1.00 58.60  ? 190  VAL C CA  1 
ATOM   8760  C C   . VAL C 1 194 ? -5.802  4.478   3.656   1.00 58.12  ? 190  VAL C C   1 
ATOM   8761  O O   . VAL C 1 194 ? -5.934  4.992   4.768   1.00 57.43  ? 190  VAL C O   1 
ATOM   8762  C CB  . VAL C 1 194 ? -7.390  2.526   4.096   1.00 60.10  ? 190  VAL C CB  1 
ATOM   8763  C CG1 . VAL C 1 194 ? -8.567  3.303   3.518   1.00 62.53  ? 190  VAL C CG1 1 
ATOM   8764  C CG2 . VAL C 1 194 ? -7.599  1.029   3.897   1.00 60.53  ? 190  VAL C CG2 1 
ATOM   8765  N N   . ILE C 1 195 ? -5.415  5.163   2.582   1.00 58.59  ? 191  ILE C N   1 
ATOM   8766  C CA  . ILE C 1 195 ? -5.061  6.583   2.659   1.00 58.19  ? 191  ILE C CA  1 
ATOM   8767  C C   . ILE C 1 195 ? -6.077  7.484   1.946   1.00 60.68  ? 191  ILE C C   1 
ATOM   8768  O O   . ILE C 1 195 ? -6.683  7.082   0.946   1.00 62.54  ? 191  ILE C O   1 
ATOM   8769  C CB  . ILE C 1 195 ? -3.603  6.849   2.163   1.00 56.68  ? 191  ILE C CB  1 
ATOM   8770  C CG1 . ILE C 1 195 ? -3.145  8.264   2.540   1.00 55.97  ? 191  ILE C CG1 1 
ATOM   8771  C CG2 . ILE C 1 195 ? -3.466  6.583   0.661   1.00 57.90  ? 191  ILE C CG2 1 
ATOM   8772  C CD1 . ILE C 1 195 ? -1.649  8.428   2.665   1.00 53.73  ? 191  ILE C CD1 1 
ATOM   8773  N N   . LYS C 1 196 ? -6.254  8.694   2.479   1.00 60.80  ? 192  LYS C N   1 
ATOM   8774  C CA  . LYS C 1 196 ? -7.192  9.673   1.932   1.00 63.21  ? 192  LYS C CA  1 
ATOM   8775  C C   . LYS C 1 196 ? -6.504  11.031  1.738   1.00 62.97  ? 192  LYS C C   1 
ATOM   8776  O O   . LYS C 1 196 ? -6.342  11.789  2.697   1.00 62.24  ? 192  LYS C O   1 
ATOM   8777  C CB  . LYS C 1 196 ? -8.404  9.812   2.863   1.00 64.41  ? 192  LYS C CB  1 
ATOM   8778  C CG  . LYS C 1 196 ? -9.733  10.194  2.192   1.00 67.58  ? 192  LYS C CG  1 
ATOM   8779  C CD  . LYS C 1 196 ? -9.789  11.650  1.722   1.00 69.03  ? 192  LYS C CD  1 
ATOM   8780  C CE  . LYS C 1 196 ? -9.665  12.637  2.874   1.00 68.52  ? 192  LYS C CE  1 
ATOM   8781  N NZ  . LYS C 1 196 ? -9.287  13.990  2.386   1.00 69.47  ? 192  LYS C NZ  1 
ATOM   8782  N N   . PRO C 1 197 ? -6.092  11.342  0.494   1.00 63.81  ? 193  PRO C N   1 
ATOM   8783  C CA  . PRO C 1 197 ? -5.440  12.624  0.229   1.00 64.03  ? 193  PRO C CA  1 
ATOM   8784  C C   . PRO C 1 197 ? -6.435  13.777  0.200   1.00 66.48  ? 193  PRO C C   1 
ATOM   8785  O O   . PRO C 1 197 ? -7.631  13.551  0.015   1.00 68.52  ? 193  PRO C O   1 
ATOM   8786  C CB  . PRO C 1 197 ? -4.802  12.417  -1.146  1.00 64.51  ? 193  PRO C CB  1 
ATOM   8787  C CG  . PRO C 1 197 ? -5.634  11.385  -1.799  1.00 65.84  ? 193  PRO C CG  1 
ATOM   8788  C CD  . PRO C 1 197 ? -6.155  10.494  -0.710  1.00 64.81  ? 193  PRO C CD  1 
ATOM   8789  N N   . ALA C 1 198 ? -5.933  14.997  0.380   1.00 66.63  ? 194  ALA C N   1 
ATOM   8790  C CA  . ALA C 1 198 ? -6.770  16.198  0.441   1.00 69.05  ? 194  ALA C CA  1 
ATOM   8791  C C   . ALA C 1 198 ? -7.694  16.337  -0.765  1.00 72.10  ? 194  ALA C C   1 
ATOM   8792  O O   . ALA C 1 198 ? -7.355  15.910  -1.873  1.00 72.49  ? 194  ALA C O   1 
ATOM   8793  C CB  . ALA C 1 198 ? -5.906  17.441  0.587   1.00 68.75  ? 194  ALA C CB  1 
ATOM   8794  N N   . GLU C 1 199 ? -8.857  16.943  -0.534  1.00 74.48  ? 195  GLU C N   1 
ATOM   8795  C CA  . GLU C 1 199 ? -9.872  17.133  -1.574  1.00 77.74  ? 195  GLU C CA  1 
ATOM   8796  C C   . GLU C 1 199 ? -9.430  18.083  -2.689  1.00 79.33  ? 195  GLU C C   1 
ATOM   8797  O O   . GLU C 1 199 ? -10.015 18.096  -3.776  1.00 81.75  ? 195  GLU C O   1 
ATOM   8798  C CB  . GLU C 1 199 ? -11.210 17.586  -0.967  1.00 79.94  ? 195  GLU C CB  1 
ATOM   8799  C CG  . GLU C 1 199 ? -11.130 18.738  0.038   1.00 80.06  ? 195  GLU C CG  1 
ATOM   8800  C CD  . GLU C 1 199 ? -10.969 18.266  1.477   1.00 78.17  ? 195  GLU C CD  1 
ATOM   8801  O OE1 . GLU C 1 199 ? -11.909 18.472  2.274   1.00 79.63  ? 195  GLU C OE1 1 
ATOM   8802  O OE2 . GLU C 1 199 ? -9.911  17.687  1.813   1.00 75.07  ? 195  GLU C OE2 1 
ATOM   8803  N N   . GLN C 1 200 ? -8.394  18.871  -2.414  1.00 78.18  ? 196  GLN C N   1 
ATOM   8804  C CA  . GLN C 1 200 ? -7.840  19.798  -3.401  1.00 79.66  ? 196  GLN C CA  1 
ATOM   8805  C C   . GLN C 1 200 ? -6.615  19.238  -4.124  1.00 78.18  ? 196  GLN C C   1 
ATOM   8806  O O   . GLN C 1 200 ? -6.372  19.579  -5.282  1.00 79.80  ? 196  GLN C O   1 
ATOM   8807  C CB  . GLN C 1 200 ? -7.520  21.165  -2.776  1.00 79.91  ? 196  GLN C CB  1 
ATOM   8808  C CG  . GLN C 1 200 ? -7.283  21.160  -1.263  1.00 77.61  ? 196  GLN C CG  1 
ATOM   8809  C CD  . GLN C 1 200 ? -8.569  21.308  -0.458  1.00 78.92  ? 196  GLN C CD  1 
ATOM   8810  O OE1 . GLN C 1 200 ? -9.647  21.525  -1.013  1.00 81.75  ? 196  GLN C OE1 1 
ATOM   8811  N NE2 . GLN C 1 200 ? -8.458  21.194  0.858   1.00 77.06  ? 196  GLN C NE2 1 
ATOM   8812  N N   . THR C 1 201 ? -5.858  18.371  -3.450  1.00 75.37  ? 197  THR C N   1 
ATOM   8813  C CA  . THR C 1 201 ? -4.588  17.875  -3.994  1.00 73.97  ? 197  THR C CA  1 
ATOM   8814  C C   . THR C 1 201 ? -4.447  16.344  -4.065  1.00 72.54  ? 197  THR C C   1 
ATOM   8815  O O   . THR C 1 201 ? -3.496  15.783  -3.511  1.00 70.02  ? 197  THR C O   1 
ATOM   8816  C CB  . THR C 1 201 ? -3.387  18.446  -3.212  1.00 71.91  ? 197  THR C CB  1 
ATOM   8817  O OG1 . THR C 1 201 ? -3.576  18.218  -1.810  1.00 70.07  ? 197  THR C OG1 1 
ATOM   8818  C CG2 . THR C 1 201 ? -3.226  19.939  -3.471  1.00 73.80  ? 197  THR C CG2 1 
ATOM   8819  N N   . PRO C 1 202 ? -5.369  15.661  -4.773  1.00 74.34  ? 198  PRO C N   1 
ATOM   8820  C CA  . PRO C 1 202 ? -5.267  14.205  -4.819  1.00 73.19  ? 198  PRO C CA  1 
ATOM   8821  C C   . PRO C 1 202 ? -4.415  13.662  -5.979  1.00 73.45  ? 198  PRO C C   1 
ATOM   8822  O O   . PRO C 1 202 ? -4.099  12.471  -5.995  1.00 72.35  ? 198  PRO C O   1 
ATOM   8823  C CB  . PRO C 1 202 ? -6.727  13.766  -4.975  1.00 75.19  ? 198  PRO C CB  1 
ATOM   8824  C CG  . PRO C 1 202 ? -7.432  14.945  -5.623  1.00 78.07  ? 198  PRO C CG  1 
ATOM   8825  C CD  . PRO C 1 202 ? -6.522  16.147  -5.558  1.00 77.56  ? 198  PRO C CD  1 
ATOM   8826  N N   . LEU C 1 203 ? -4.035  14.526  -6.920  1.00 75.10  ? 199  LEU C N   1 
ATOM   8827  C CA  . LEU C 1 203 ? -3.386  14.096  -8.165  1.00 76.00  ? 199  LEU C CA  1 
ATOM   8828  C C   . LEU C 1 203 ? -2.021  13.435  -7.958  1.00 73.61  ? 199  LEU C C   1 
ATOM   8829  O O   . LEU C 1 203 ? -1.764  12.359  -8.506  1.00 73.61  ? 199  LEU C O   1 
ATOM   8830  C CB  . LEU C 1 203 ? -3.275  15.258  -9.164  1.00 78.44  ? 199  LEU C CB  1 
ATOM   8831  C CG  . LEU C 1 203 ? -4.531  16.060  -9.539  1.00 81.27  ? 199  LEU C CG  1 
ATOM   8832  C CD1 . LEU C 1 203 ? -4.187  17.121  -10.572 1.00 83.41  ? 199  LEU C CD1 1 
ATOM   8833  C CD2 . LEU C 1 203 ? -5.670  15.173  -10.039 1.00 82.91  ? 199  LEU C CD2 1 
ATOM   8834  N N   . SER C 1 204 ? -1.158  14.077  -7.170  1.00 71.74  ? 200  SER C N   1 
ATOM   8835  C CA  . SER C 1 204 ? 0.180   13.548  -6.894  1.00 69.52  ? 200  SER C CA  1 
ATOM   8836  C C   . SER C 1 204 ? 0.118   12.208  -6.166  1.00 67.53  ? 200  SER C C   1 
ATOM   8837  O O   . SER C 1 204 ? 0.925   11.314  -6.430  1.00 66.69  ? 200  SER C O   1 
ATOM   8838  C CB  . SER C 1 204 ? 1.018   14.551  -6.099  1.00 68.15  ? 200  SER C CB  1 
ATOM   8839  O OG  . SER C 1 204 ? 0.387   14.903  -4.882  1.00 67.27  ? 200  SER C OG  1 
ATOM   8840  N N   . ALA C 1 205 ? -0.850  12.077  -5.262  1.00 67.01  ? 201  ALA C N   1 
ATOM   8841  C CA  . ALA C 1 205 ? -1.095  10.826  -4.554  1.00 65.52  ? 201  ALA C CA  1 
ATOM   8842  C C   . ALA C 1 205 ? -1.639  9.747   -5.490  1.00 67.07  ? 201  ALA C C   1 
ATOM   8843  O O   . ALA C 1 205 ? -1.330  8.564   -5.325  1.00 66.00  ? 201  ALA C O   1 
ATOM   8844  C CB  . ALA C 1 205 ? -2.050  11.057  -3.400  1.00 65.10  ? 201  ALA C CB  1 
ATOM   8845  N N   . LEU C 1 206 ? -2.439  10.164  -6.472  1.00 69.77  ? 202  LEU C N   1 
ATOM   8846  C CA  . LEU C 1 206 ? -3.043  9.244   -7.440  1.00 71.66  ? 202  LEU C CA  1 
ATOM   8847  C C   . LEU C 1 206 ? -2.033  8.642   -8.410  1.00 71.86  ? 202  LEU C C   1 
ATOM   8848  O O   . LEU C 1 206 ? -2.132  7.463   -8.757  1.00 72.19  ? 202  LEU C O   1 
ATOM   8849  C CB  . LEU C 1 206 ? -4.178  9.923   -8.214  1.00 74.70  ? 202  LEU C CB  1 
ATOM   8850  C CG  . LEU C 1 206 ? -5.524  10.098  -7.501  1.00 75.61  ? 202  LEU C CG  1 
ATOM   8851  C CD1 . LEU C 1 206 ? -6.488  10.889  -8.373  1.00 78.98  ? 202  LEU C CD1 1 
ATOM   8852  C CD2 . LEU C 1 206 ? -6.138  8.759   -7.096  1.00 75.57  ? 202  LEU C CD2 1 
ATOM   8853  N N   . TYR C 1 207 ? -1.068  9.454   -8.844  1.00 71.85  ? 203  TYR C N   1 
ATOM   8854  C CA  . TYR C 1 207 ? -0.003  8.983   -9.729  1.00 72.26  ? 203  TYR C CA  1 
ATOM   8855  C C   . TYR C 1 207 ? 0.879   7.951   -9.029  1.00 69.79  ? 203  TYR C C   1 
ATOM   8856  O O   . TYR C 1 207 ? 1.393   7.026   -9.667  1.00 70.32  ? 203  TYR C O   1 
ATOM   8857  C CB  . TYR C 1 207 ? 0.850   10.147  -10.243 1.00 72.87  ? 203  TYR C CB  1 
ATOM   8858  C CG  . TYR C 1 207 ? 1.852   9.746   -11.312 1.00 74.06  ? 203  TYR C CG  1 
ATOM   8859  C CD1 . TYR C 1 207 ? 3.165   9.409   -10.975 1.00 72.42  ? 203  TYR C CD1 1 
ATOM   8860  C CD2 . TYR C 1 207 ? 1.487   9.702   -12.659 1.00 77.08  ? 203  TYR C CD2 1 
ATOM   8861  C CE1 . TYR C 1 207 ? 4.088   9.036   -11.951 1.00 73.68  ? 203  TYR C CE1 1 
ATOM   8862  C CE2 . TYR C 1 207 ? 2.404   9.334   -13.643 1.00 78.31  ? 203  TYR C CE2 1 
ATOM   8863  C CZ  . TYR C 1 207 ? 3.701   9.002   -13.280 1.00 76.65  ? 203  TYR C CZ  1 
ATOM   8864  O OH  . TYR C 1 207 ? 4.613   8.637   -14.244 1.00 78.13  ? 203  TYR C OH  1 
ATOM   8865  N N   . MET C 1 208 ? 1.047   8.118   -7.718  1.00 67.29  ? 204  MET C N   1 
ATOM   8866  C CA  . MET C 1 208 ? 1.787   7.166   -6.895  1.00 64.86  ? 204  MET C CA  1 
ATOM   8867  C C   . MET C 1 208 ? 1.180   5.767   -6.957  1.00 65.14  ? 204  MET C C   1 
ATOM   8868  O O   . MET C 1 208 ? 1.895   4.772   -6.830  1.00 64.12  ? 204  MET C O   1 
ATOM   8869  C CB  . MET C 1 208 ? 1.846   7.644   -5.445  1.00 62.62  ? 204  MET C CB  1 
ATOM   8870  C CG  . MET C 1 208 ? 2.872   8.737   -5.184  1.00 61.75  ? 204  MET C CG  1 
ATOM   8871  S SD  . MET C 1 208 ? 4.584   8.219   -5.437  1.00 60.85  ? 204  MET C SD  1 
ATOM   8872  C CE  . MET C 1 208 ? 4.796   7.018   -4.121  1.00 58.11  ? 204  MET C CE  1 
ATOM   8873  N N   . GLY C 1 209 ? -0.137  5.706   -7.152  1.00 66.67  ? 205  GLY C N   1 
ATOM   8874  C CA  . GLY C 1 209 ? -0.850  4.443   -7.323  1.00 67.46  ? 205  GLY C CA  1 
ATOM   8875  C C   . GLY C 1 209 ? -0.306  3.623   -8.476  1.00 68.85  ? 205  GLY C C   1 
ATOM   8876  O O   . GLY C 1 209 ? -0.194  2.402   -8.374  1.00 68.59  ? 205  GLY C O   1 
ATOM   8877  N N   . ALA C 1 210 ? 0.040   4.302   -9.568  1.00 70.54  ? 206  ALA C N   1 
ATOM   8878  C CA  . ALA C 1 210 ? 0.598   3.651   -10.752 1.00 72.27  ? 206  ALA C CA  1 
ATOM   8879  C C   . ALA C 1 210 ? 1.996   3.103   -10.485 1.00 70.53  ? 206  ALA C C   1 
ATOM   8880  O O   . ALA C 1 210 ? 2.349   2.030   -10.978 1.00 71.39  ? 206  ALA C O   1 
ATOM   8881  C CB  . ALA C 1 210 ? 0.614   4.608   -11.934 1.00 74.59  ? 206  ALA C CB  1 
ATOM   8882  N N   . LEU C 1 211 ? 2.781   3.839   -9.700  1.00 68.31  ? 207  LEU C N   1 
ATOM   8883  C CA  . LEU C 1 211 ? 4.138   3.418   -9.347  1.00 66.59  ? 207  LEU C CA  1 
ATOM   8884  C C   . LEU C 1 211 ? 4.141   2.276   -8.330  1.00 64.71  ? 207  LEU C C   1 
ATOM   8885  O O   . LEU C 1 211 ? 5.036   1.434   -8.340  1.00 64.18  ? 207  LEU C O   1 
ATOM   8886  C CB  . LEU C 1 211 ? 4.963   4.600   -8.823  1.00 65.10  ? 207  LEU C CB  1 
ATOM   8887  C CG  . LEU C 1 211 ? 5.023   5.907   -9.624  1.00 66.77  ? 207  LEU C CG  1 
ATOM   8888  C CD1 . LEU C 1 211 ? 6.004   6.870   -8.973  1.00 65.19  ? 207  LEU C CD1 1 
ATOM   8889  C CD2 . LEU C 1 211 ? 5.397   5.674   -11.084 1.00 69.53  ? 207  LEU C CD2 1 
ATOM   8890  N N   . ILE C 1 212 ? 3.136   2.256   -7.457  1.00 63.90  ? 208  ILE C N   1 
ATOM   8891  C CA  . ILE C 1 212 ? 2.968   1.185   -6.472  1.00 62.42  ? 208  ILE C CA  1 
ATOM   8892  C C   . ILE C 1 212 ? 2.634   -0.149  -7.151  1.00 64.19  ? 208  ILE C C   1 
ATOM   8893  O O   . ILE C 1 212 ? 3.204   -1.189  -6.803  1.00 63.42  ? 208  ILE C O   1 
ATOM   8894  C CB  . ILE C 1 212 ? 1.926   1.580   -5.392  1.00 61.43  ? 208  ILE C CB  1 
ATOM   8895  C CG1 . ILE C 1 212 ? 2.582   2.507   -4.362  1.00 59.23  ? 208  ILE C CG1 1 
ATOM   8896  C CG2 . ILE C 1 212 ? 1.330   0.351   -4.706  1.00 60.95  ? 208  ILE C CG2 1 
ATOM   8897  C CD1 . ILE C 1 212 ? 1.611   3.314   -3.521  1.00 59.13  ? 208  ILE C CD1 1 
ATOM   8898  N N   . LYS C 1 213 ? 1.729   -0.107  -8.128  1.00 66.75  ? 209  LYS C N   1 
ATOM   8899  C CA  . LYS C 1 213 ? 1.405   -1.276  -8.949  1.00 68.86  ? 209  LYS C CA  1 
ATOM   8900  C C   . LYS C 1 213 ? 2.631   -1.737  -9.739  1.00 69.43  ? 209  LYS C C   1 
ATOM   8901  O O   . LYS C 1 213 ? 2.913   -2.936  -9.821  1.00 69.80  ? 209  LYS C O   1 
ATOM   8902  C CB  . LYS C 1 213 ? 0.247   -0.958  -9.904  1.00 71.70  ? 209  LYS C CB  1 
ATOM   8903  C CG  . LYS C 1 213 ? -0.302  -2.160  -10.661 1.00 74.24  ? 209  LYS C CG  1 
ATOM   8904  C CD  . LYS C 1 213 ? -1.412  -1.750  -11.613 1.00 77.43  ? 209  LYS C CD  1 
ATOM   8905  C CE  . LYS C 1 213 ? -2.001  -2.955  -12.331 1.00 80.16  ? 209  LYS C CE  1 
ATOM   8906  N NZ  . LYS C 1 213 ? -2.988  -2.559  -13.376 1.00 83.30  ? 209  LYS C NZ  1 
ATOM   8907  N N   . GLU C 1 214 ? 3.356   -0.772  -10.303 1.00 69.62  ? 210  GLU C N   1 
ATOM   8908  C CA  . GLU C 1 214 ? 4.526   -1.043  -11.135 1.00 70.52  ? 210  GLU C CA  1 
ATOM   8909  C C   . GLU C 1 214 ? 5.704   -1.597  -10.327 1.00 68.34  ? 210  GLU C C   1 
ATOM   8910  O O   . GLU C 1 214 ? 6.438   -2.460  -10.815 1.00 69.29  ? 210  GLU C O   1 
ATOM   8911  C CB  . GLU C 1 214 ? 4.947   0.220   -11.892 1.00 71.42  ? 210  GLU C CB  1 
ATOM   8912  C CG  . GLU C 1 214 ? 5.807   -0.042  -13.119 1.00 73.40  ? 210  GLU C CG  1 
ATOM   8913  C CD  . GLU C 1 214 ? 6.677   1.143   -13.493 1.00 73.37  ? 210  GLU C CD  1 
ATOM   8914  O OE1 . GLU C 1 214 ? 6.266   2.298   -13.252 1.00 72.80  ? 210  GLU C OE1 1 
ATOM   8915  O OE2 . GLU C 1 214 ? 7.779   0.918   -14.032 1.00 74.05  ? 210  GLU C OE2 1 
ATOM   8916  N N   . ALA C 1 215 ? 5.875   -1.104  -9.099  1.00 65.57  ? 211  ALA C N   1 
ATOM   8917  C CA  . ALA C 1 215 ? 6.949   -1.563  -8.219  1.00 63.39  ? 211  ALA C CA  1 
ATOM   8918  C C   . ALA C 1 215 ? 6.713   -2.991  -7.731  1.00 63.14  ? 211  ALA C C   1 
ATOM   8919  O O   . ALA C 1 215 ? 7.648   -3.665  -7.299  1.00 62.25  ? 211  ALA C O   1 
ATOM   8920  C CB  . ALA C 1 215 ? 7.126   -0.617  -7.044  1.00 60.83  ? 211  ALA C CB  1 
ATOM   8921  N N   . GLY C 1 216 ? 5.462   -3.440  -7.798  1.00 64.19  ? 212  GLY C N   1 
ATOM   8922  C CA  . GLY C 1 216 ? 5.111   -4.825  -7.494  1.00 64.58  ? 212  GLY C CA  1 
ATOM   8923  C C   . GLY C 1 216 ? 4.532   -5.066  -6.111  1.00 62.71  ? 212  GLY C C   1 
ATOM   8924  O O   . GLY C 1 216 ? 4.732   -6.136  -5.529  1.00 62.23  ? 212  GLY C O   1 
ATOM   8925  N N   . PHE C 1 217 ? 3.815   -4.075  -5.584  1.00 61.85  ? 213  PHE C N   1 
ATOM   8926  C CA  . PHE C 1 217 ? 3.141   -4.206  -4.295  1.00 60.25  ? 213  PHE C CA  1 
ATOM   8927  C C   . PHE C 1 217 ? 1.925   -5.121  -4.409  1.00 62.03  ? 213  PHE C C   1 
ATOM   8928  O O   . PHE C 1 217 ? 1.062   -4.887  -5.258  1.00 64.20  ? 213  PHE C O   1 
ATOM   8929  C CB  . PHE C 1 217 ? 2.710   -2.838  -3.771  1.00 59.10  ? 213  PHE C CB  1 
ATOM   8930  C CG  . PHE C 1 217 ? 3.814   -2.061  -3.119  1.00 56.76  ? 213  PHE C CG  1 
ATOM   8931  C CD1 . PHE C 1 217 ? 4.101   -2.237  -1.765  1.00 54.51  ? 213  PHE C CD1 1 
ATOM   8932  C CD2 . PHE C 1 217 ? 4.561   -1.144  -3.849  1.00 56.74  ? 213  PHE C CD2 1 
ATOM   8933  C CE1 . PHE C 1 217 ? 5.120   -1.519  -1.150  1.00 52.56  ? 213  PHE C CE1 1 
ATOM   8934  C CE2 . PHE C 1 217 ? 5.582   -0.417  -3.243  1.00 55.18  ? 213  PHE C CE2 1 
ATOM   8935  C CZ  . PHE C 1 217 ? 5.862   -0.605  -1.890  1.00 53.06  ? 213  PHE C CZ  1 
ATOM   8936  N N   . PRO C 1 218 ? 1.854   -6.168  -3.560  1.00 61.42  ? 214  PRO C N   1 
ATOM   8937  C CA  . PRO C 1 218 ? 0.725   -7.105  -3.534  1.00 63.08  ? 214  PRO C CA  1 
ATOM   8938  C C   . PRO C 1 218 ? -0.621  -6.387  -3.466  1.00 63.95  ? 214  PRO C C   1 
ATOM   8939  O O   . PRO C 1 218 ? -0.729  -5.364  -2.784  1.00 62.43  ? 214  PRO C O   1 
ATOM   8940  C CB  . PRO C 1 218 ? 0.958   -7.896  -2.246  1.00 61.45  ? 214  PRO C CB  1 
ATOM   8941  C CG  . PRO C 1 218 ? 2.429   -7.883  -2.071  1.00 59.84  ? 214  PRO C CG  1 
ATOM   8942  C CD  . PRO C 1 218 ? 2.904   -6.555  -2.598  1.00 59.29  ? 214  PRO C CD  1 
ATOM   8943  N N   . PRO C 1 219 ? -1.640  -6.912  -4.178  1.00 66.53  ? 215  PRO C N   1 
ATOM   8944  C CA  . PRO C 1 219 ? -2.969  -6.291  -4.228  1.00 67.80  ? 215  PRO C CA  1 
ATOM   8945  C C   . PRO C 1 219 ? -3.564  -6.038  -2.841  1.00 66.27  ? 215  PRO C C   1 
ATOM   8946  O O   . PRO C 1 219 ? -3.508  -6.912  -1.970  1.00 65.42  ? 215  PRO C O   1 
ATOM   8947  C CB  . PRO C 1 219 ? -3.815  -7.320  -4.994  1.00 70.74  ? 215  PRO C CB  1 
ATOM   8948  C CG  . PRO C 1 219 ? -3.022  -8.590  -4.967  1.00 70.65  ? 215  PRO C CG  1 
ATOM   8949  C CD  . PRO C 1 219 ? -1.596  -8.156  -4.965  1.00 68.61  ? 215  PRO C CD  1 
ATOM   8950  N N   . GLY C 1 220 ? -4.105  -4.837  -2.649  1.00 65.98  ? 216  GLY C N   1 
ATOM   8951  C CA  . GLY C 1 220 ? -4.766  -4.468  -1.404  1.00 64.89  ? 216  GLY C CA  1 
ATOM   8952  C C   . GLY C 1 220 ? -3.877  -3.838  -0.347  1.00 61.92  ? 216  GLY C C   1 
ATOM   8953  O O   . GLY C 1 220 ? -4.385  -3.261  0.618   1.00 61.24  ? 216  GLY C O   1 
ATOM   8954  N N   . VAL C 1 221 ? -2.560  -3.945  -0.524  1.00 60.34  ? 217  VAL C N   1 
ATOM   8955  C CA  . VAL C 1 221 ? -1.587  -3.426  0.452   1.00 57.54  ? 217  VAL C CA  1 
ATOM   8956  C C   . VAL C 1 221 ? -1.734  -1.919  0.668   1.00 56.86  ? 217  VAL C C   1 
ATOM   8957  O O   . VAL C 1 221 ? -1.740  -1.452  1.805   1.00 55.42  ? 217  VAL C O   1 
ATOM   8958  C CB  . VAL C 1 221 ? -0.123  -3.813  0.078   1.00 56.52  ? 217  VAL C CB  1 
ATOM   8959  C CG1 . VAL C 1 221 ? 0.899   -2.981  0.849   1.00 54.23  ? 217  VAL C CG1 1 
ATOM   8960  C CG2 . VAL C 1 221 ? 0.115   -5.293  0.333   1.00 56.61  ? 217  VAL C CG2 1 
ATOM   8961  N N   . ILE C 1 222 ? -1.866  -1.168  -0.424  1.00 58.07  ? 218  ILE C N   1 
ATOM   8962  C CA  . ILE C 1 222 ? -2.080  0.280   -0.352  1.00 57.79  ? 218  ILE C CA  1 
ATOM   8963  C C   . ILE C 1 222 ? -3.302  0.666   -1.181  1.00 60.27  ? 218  ILE C C   1 
ATOM   8964  O O   . ILE C 1 222 ? -3.334  0.446   -2.393  1.00 61.98  ? 218  ILE C O   1 
ATOM   8965  C CB  . ILE C 1 222 ? -0.837  1.078   -0.834  1.00 56.83  ? 218  ILE C CB  1 
ATOM   8966  C CG1 . ILE C 1 222 ? 0.419   0.622   -0.090  1.00 54.35  ? 218  ILE C CG1 1 
ATOM   8967  C CG2 . ILE C 1 222 ? -1.047  2.584   -0.646  1.00 56.67  ? 218  ILE C CG2 1 
ATOM   8968  C CD1 . ILE C 1 222 ? 1.655   0.551   -0.953  1.00 54.08  ? 218  ILE C CD1 1 
ATOM   8969  N N   . ASN C 1 223 ? -4.306  1.230   -0.517  1.00 60.65  ? 219  ASN C N   1 
ATOM   8970  C CA  . ASN C 1 223 ? -5.512  1.703   -1.188  1.00 63.12  ? 219  ASN C CA  1 
ATOM   8971  C C   . ASN C 1 223 ? -5.627  3.214   -1.075  1.00 63.07  ? 219  ASN C C   1 
ATOM   8972  O O   . ASN C 1 223 ? -5.714  3.757   0.029   1.00 61.93  ? 219  ASN C O   1 
ATOM   8973  C CB  . ASN C 1 223 ? -6.756  1.032   -0.603  1.00 64.39  ? 219  ASN C CB  1 
ATOM   8974  C CG  . ASN C 1 223 ? -6.709  -0.481  -0.708  1.00 64.95  ? 219  ASN C CG  1 
ATOM   8975  O OD1 . ASN C 1 223 ? -6.671  -1.040  -1.804  1.00 66.97  ? 219  ASN C OD1 1 
ATOM   8976  N ND2 . ASN C 1 223 ? -6.718  -1.154  0.438   1.00 64.00  ? 219  ASN C ND2 1 
ATOM   8977  N N   . ILE C 1 224 ? -5.614  3.889   -2.218  1.00 64.45  ? 220  ILE C N   1 
ATOM   8978  C CA  . ILE C 1 224 ? -5.705  5.344   -2.244  1.00 64.78  ? 220  ILE C CA  1 
ATOM   8979  C C   . ILE C 1 224 ? -7.125  5.781   -2.600  1.00 67.62  ? 220  ILE C C   1 
ATOM   8980  O O   . ILE C 1 224 ? -7.665  5.395   -3.640  1.00 69.89  ? 220  ILE C O   1 
ATOM   8981  C CB  . ILE C 1 224 ? -4.681  5.967   -3.216  1.00 64.65  ? 220  ILE C CB  1 
ATOM   8982  C CG1 . ILE C 1 224 ? -3.285  5.397   -2.947  1.00 62.11  ? 220  ILE C CG1 1 
ATOM   8983  C CG2 . ILE C 1 224 ? -4.683  7.492   -3.088  1.00 64.84  ? 220  ILE C CG2 1 
ATOM   8984  C CD1 . ILE C 1 224 ? -2.292  5.624   -4.062  1.00 62.51  ? 220  ILE C CD1 1 
ATOM   8985  N N   . LEU C 1 225 ? -7.725  6.581   -1.723  1.00 67.71  ? 221  LEU C N   1 
ATOM   8986  C CA  . LEU C 1 225 ? -9.105  7.020   -1.907  1.00 70.43  ? 221  LEU C CA  1 
ATOM   8987  C C   . LEU C 1 225 ? -9.222  8.541   -1.863  1.00 71.22  ? 221  LEU C C   1 
ATOM   8988  O O   . LEU C 1 225 ? -9.212  9.135   -0.782  1.00 70.17  ? 221  LEU C O   1 
ATOM   8989  C CB  . LEU C 1 225 ? -10.031 6.374   -0.869  1.00 70.57  ? 221  LEU C CB  1 
ATOM   8990  C CG  . LEU C 1 225 ? -10.182 4.852   -0.924  1.00 70.60  ? 221  LEU C CG  1 
ATOM   8991  C CD1 . LEU C 1 225 ? -9.133  4.169   -0.055  1.00 67.52  ? 221  LEU C CD1 1 
ATOM   8992  C CD2 . LEU C 1 225 ? -11.578 4.439   -0.498  1.00 72.58  ? 221  LEU C CD2 1 
ATOM   8993  N N   . PRO C 1 226 ? -9.318  9.178   -3.045  1.00 73.26  ? 222  PRO C N   1 
ATOM   8994  C CA  . PRO C 1 226 ? -9.507  10.627  -3.137  1.00 74.49  ? 222  PRO C CA  1 
ATOM   8995  C C   . PRO C 1 226 ? -10.945 11.053  -2.829  1.00 76.99  ? 222  PRO C C   1 
ATOM   8996  O O   . PRO C 1 226 ? -11.893 10.344  -3.177  1.00 78.87  ? 222  PRO C O   1 
ATOM   8997  C CB  . PRO C 1 226 ? -9.159  10.933  -4.597  1.00 76.06  ? 222  PRO C CB  1 
ATOM   8998  C CG  . PRO C 1 226 ? -9.427  9.664   -5.326  1.00 76.89  ? 222  PRO C CG  1 
ATOM   8999  C CD  . PRO C 1 226 ? -9.127  8.554   -4.369  1.00 74.47  ? 222  PRO C CD  1 
ATOM   9000  N N   . GLY C 1 227 ? -11.096 12.206  -2.182  1.00 77.22  ? 223  GLY C N   1 
ATOM   9001  C CA  . GLY C 1 227 ? -12.415 12.735  -1.834  1.00 79.70  ? 223  GLY C CA  1 
ATOM   9002  C C   . GLY C 1 227 ? -12.386 13.759  -0.714  1.00 79.13  ? 223  GLY C C   1 
ATOM   9003  O O   . GLY C 1 227 ? -11.319 14.231  -0.317  1.00 77.06  ? 223  GLY C O   1 
ATOM   9004  N N   . TYR C 1 228 ? -13.568 14.092  -0.204  1.00 81.27  ? 224  TYR C N   1 
ATOM   9005  C CA  . TYR C 1 228 ? -13.719 15.113  0.835   1.00 81.39  ? 224  TYR C CA  1 
ATOM   9006  C C   . TYR C 1 228 ? -13.502 14.558  2.247   1.00 79.26  ? 224  TYR C C   1 
ATOM   9007  O O   . TYR C 1 228 ? -13.413 13.342  2.440   1.00 78.00  ? 224  TYR C O   1 
ATOM   9008  C CB  . TYR C 1 228 ? -15.081 15.811  0.709   1.00 84.92  ? 224  TYR C CB  1 
ATOM   9009  C CG  . TYR C 1 228 ? -15.213 16.657  -0.543  1.00 87.22  ? 224  TYR C CG  1 
ATOM   9010  C CD1 . TYR C 1 228 ? -15.661 16.102  -1.739  1.00 88.95  ? 224  TYR C CD1 1 
ATOM   9011  C CD2 . TYR C 1 228 ? -14.881 18.011  -0.532  1.00 87.90  ? 224  TYR C CD2 1 
ATOM   9012  C CE1 . TYR C 1 228 ? -15.776 16.874  -2.893  1.00 91.38  ? 224  TYR C CE1 1 
ATOM   9013  C CE2 . TYR C 1 228 ? -14.995 18.792  -1.682  1.00 90.21  ? 224  TYR C CE2 1 
ATOM   9014  C CZ  . TYR C 1 228 ? -15.443 18.217  -2.857  1.00 92.04  ? 224  TYR C CZ  1 
ATOM   9015  O OH  . TYR C 1 228 ? -15.559 18.981  -3.996  1.00 94.79  ? 224  TYR C OH  1 
ATOM   9016  N N   . GLY C 1 229 ? -13.410 15.459  3.222   1.00 79.10  ? 225  GLY C N   1 
ATOM   9017  C CA  . GLY C 1 229 ? -13.086 15.102  4.603   1.00 77.12  ? 225  GLY C CA  1 
ATOM   9018  C C   . GLY C 1 229 ? -14.222 14.537  5.440   1.00 78.52  ? 225  GLY C C   1 
ATOM   9019  O O   . GLY C 1 229 ? -14.106 13.425  5.957   1.00 77.00  ? 225  GLY C O   1 
ATOM   9020  N N   . PRO C 1 230 ? -15.321 15.306  5.606   1.00 81.58  ? 226  PRO C N   1 
ATOM   9021  C CA  . PRO C 1 230 ? -16.493 14.828  6.357   1.00 83.45  ? 226  PRO C CA  1 
ATOM   9022  C C   . PRO C 1 230 ? -17.192 13.612  5.739   1.00 84.54  ? 226  PRO C C   1 
ATOM   9023  O O   . PRO C 1 230 ? -18.024 12.987  6.403   1.00 85.61  ? 226  PRO C O   1 
ATOM   9024  C CB  . PRO C 1 230 ? -17.435 16.038  6.342   1.00 86.71  ? 226  PRO C CB  1 
ATOM   9025  C CG  . PRO C 1 230 ? -16.536 17.208  6.180   1.00 85.77  ? 226  PRO C CG  1 
ATOM   9026  C CD  . PRO C 1 230 ? -15.451 16.736  5.261   1.00 83.37  ? 226  PRO C CD  1 
ATOM   9027  N N   . THR C 1 231 ? -16.858 13.286  4.490   1.00 84.46  ? 227  THR C N   1 
ATOM   9028  C CA  . THR C 1 231 ? -17.432 12.124  3.807   1.00 85.61  ? 227  THR C CA  1 
ATOM   9029  C C   . THR C 1 231 ? -16.494 10.915  3.854   1.00 82.77  ? 227  THR C C   1 
ATOM   9030  O O   . THR C 1 231 ? -16.734 9.973   4.611   1.00 82.31  ? 227  THR C O   1 
ATOM   9031  C CB  . THR C 1 231 ? -17.837 12.439  2.344   1.00 87.93  ? 227  THR C CB  1 
ATOM   9032  O OG1 . THR C 1 231 ? -16.704 12.934  1.621   1.00 86.20  ? 227  THR C OG1 1 
ATOM   9033  C CG2 . THR C 1 231 ? -18.959 13.474  2.303   1.00 91.37  ? 227  THR C CG2 1 
ATOM   9034  N N   . ALA C 1 232 ? -15.426 10.953  3.060   1.00 81.12  ? 228  ALA C N   1 
ATOM   9035  C CA  . ALA C 1 232 ? -14.489 9.833   2.967   1.00 78.68  ? 228  ALA C CA  1 
ATOM   9036  C C   . ALA C 1 232 ? -13.584 9.719   4.193   1.00 75.83  ? 228  ALA C C   1 
ATOM   9037  O O   . ALA C 1 232 ? -13.309 8.612   4.660   1.00 74.47  ? 228  ALA C O   1 
ATOM   9038  C CB  . ALA C 1 232 ? -13.660 9.936   1.694   1.00 78.11  ? 228  ALA C CB  1 
ATOM   9039  N N   . GLY C 1 233 ? -13.127 10.862  4.704   1.00 75.23  ? 229  GLY C N   1 
ATOM   9040  C CA  . GLY C 1 233 ? -12.237 10.905  5.864   1.00 72.79  ? 229  GLY C CA  1 
ATOM   9041  C C   . GLY C 1 233 ? -12.910 10.495  7.162   1.00 73.26  ? 229  GLY C C   1 
ATOM   9042  O O   . GLY C 1 233 ? -12.332 9.752   7.960   1.00 71.26  ? 229  GLY C O   1 
ATOM   9043  N N   . ALA C 1 234 ? -14.132 10.983  7.376   1.00 76.10  ? 230  ALA C N   1 
ATOM   9044  C CA  . ALA C 1 234 ? -14.906 10.644  8.571   1.00 77.14  ? 230  ALA C CA  1 
ATOM   9045  C C   . ALA C 1 234 ? -15.362 9.187   8.553   1.00 77.46  ? 230  ALA C C   1 
ATOM   9046  O O   . ALA C 1 234 ? -15.646 8.608   9.603   1.00 77.49  ? 230  ALA C O   1 
ATOM   9047  C CB  . ALA C 1 234 ? -16.098 11.580  8.727   1.00 80.33  ? 230  ALA C CB  1 
ATOM   9048  N N   . ALA C 1 235 ? -15.426 8.606   7.355   1.00 78.01  ? 231  ALA C N   1 
ATOM   9049  C CA  . ALA C 1 235 ? -15.738 7.186   7.185   1.00 78.27  ? 231  ALA C CA  1 
ATOM   9050  C C   . ALA C 1 235 ? -14.583 6.290   7.640   1.00 75.14  ? 231  ALA C C   1 
ATOM   9051  O O   . ALA C 1 235 ? -14.810 5.187   8.140   1.00 75.15  ? 231  ALA C O   1 
ATOM   9052  C CB  . ALA C 1 235 ? -16.102 6.890   5.741   1.00 79.89  ? 231  ALA C CB  1 
ATOM   9053  N N   . ILE C 1 236 ? -13.353 6.770   7.458   1.00 72.69  ? 232  ILE C N   1 
ATOM   9054  C CA  . ILE C 1 236 ? -12.153 6.069   7.923   1.00 69.72  ? 232  ILE C CA  1 
ATOM   9055  C C   . ILE C 1 236 ? -12.075 6.108   9.451   1.00 68.81  ? 232  ILE C C   1 
ATOM   9056  O O   . ILE C 1 236 ? -11.738 5.110   10.096  1.00 67.51  ? 232  ILE C O   1 
ATOM   9057  C CB  . ILE C 1 236 ? -10.863 6.680   7.301   1.00 67.75  ? 232  ILE C CB  1 
ATOM   9058  C CG1 . ILE C 1 236 ? -10.842 6.466   5.785   1.00 68.55  ? 232  ILE C CG1 1 
ATOM   9059  C CG2 . ILE C 1 236 ? -9.603  6.086   7.934   1.00 64.82  ? 232  ILE C CG2 1 
ATOM   9060  C CD1 . ILE C 1 236 ? -9.812  7.300   5.052   1.00 67.10  ? 232  ILE C CD1 1 
ATOM   9061  N N   . ALA C 1 237 ? -12.409 7.266   10.016  1.00 69.66  ? 233  ALA C N   1 
ATOM   9062  C CA  . ALA C 1 237 ? -12.344 7.492   11.457  1.00 69.13  ? 233  ALA C CA  1 
ATOM   9063  C C   . ALA C 1 237 ? -13.356 6.659   12.240  1.00 70.73  ? 233  ALA C C   1 
ATOM   9064  O O   . ALA C 1 237 ? -13.093 6.261   13.377  1.00 69.88  ? 233  ALA C O   1 
ATOM   9065  C CB  . ALA C 1 237 ? -12.526 8.973   11.760  1.00 70.10  ? 233  ALA C CB  1 
ATOM   9066  N N   . SER C 1 238 ? -14.509 6.398   11.630  1.00 73.21  ? 234  SER C N   1 
ATOM   9067  C CA  . SER C 1 238 ? -15.581 5.663   12.295  1.00 75.19  ? 234  SER C CA  1 
ATOM   9068  C C   . SER C 1 238 ? -15.699 4.213   11.822  1.00 75.16  ? 234  SER C C   1 
ATOM   9069  O O   . SER C 1 238 ? -16.659 3.521   12.165  1.00 77.29  ? 234  SER C O   1 
ATOM   9070  C CB  . SER C 1 238 ? -16.911 6.395   12.106  1.00 78.59  ? 234  SER C CB  1 
ATOM   9071  O OG  . SER C 1 238 ? -16.839 7.707   12.635  1.00 78.98  ? 234  SER C OG  1 
ATOM   9072  N N   . HIS C 1 239 ? -14.717 3.752   11.049  1.00 72.97  ? 235  HIS C N   1 
ATOM   9073  C CA  . HIS C 1 239 ? -14.744 2.399   10.501  1.00 72.91  ? 235  HIS C CA  1 
ATOM   9074  C C   . HIS C 1 239 ? -14.348 1.351   11.535  1.00 71.47  ? 235  HIS C C   1 
ATOM   9075  O O   . HIS C 1 239 ? -13.307 1.460   12.182  1.00 68.97  ? 235  HIS C O   1 
ATOM   9076  C CB  . HIS C 1 239 ? -13.852 2.286   9.265   1.00 71.54  ? 235  HIS C CB  1 
ATOM   9077  C CG  . HIS C 1 239 ? -14.305 1.242   8.295   1.00 73.16  ? 235  HIS C CG  1 
ATOM   9078  N ND1 . HIS C 1 239 ? -14.027 -0.097  8.459   1.00 72.69  ? 235  HIS C ND1 1 
ATOM   9079  C CD2 . HIS C 1 239 ? -15.030 1.339   7.155   1.00 75.62  ? 235  HIS C CD2 1 
ATOM   9080  C CE1 . HIS C 1 239 ? -14.560 -0.781  7.462   1.00 74.79  ? 235  HIS C CE1 1 
ATOM   9081  N NE2 . HIS C 1 239 ? -15.171 0.068   6.654   1.00 76.52  ? 235  HIS C NE2 1 
ATOM   9082  N N   . ILE C 1 240 ? -15.192 0.333   11.670  1.00 73.19  ? 236  ILE C N   1 
ATOM   9083  C CA  . ILE C 1 240 ? -15.014 -0.733  12.659  1.00 72.38  ? 236  ILE C CA  1 
ATOM   9084  C C   . ILE C 1 240 ? -13.919 -1.736  12.251  1.00 69.90  ? 236  ILE C C   1 
ATOM   9085  O O   . ILE C 1 240 ? -13.334 -2.408  13.104  1.00 68.51  ? 236  ILE C O   1 
ATOM   9086  C CB  . ILE C 1 240 ? -16.384 -1.445  12.966  1.00 75.67  ? 236  ILE C CB  1 
ATOM   9087  C CG1 . ILE C 1 240 ? -16.284 -2.392  14.171  1.00 75.52  ? 236  ILE C CG1 1 
ATOM   9088  C CG2 . ILE C 1 240 ? -16.958 -2.142  11.720  1.00 77.49  ? 236  ILE C CG2 1 
ATOM   9089  C CD1 . ILE C 1 240 ? -16.660 -1.754  15.496  1.00 76.42  ? 236  ILE C CD1 1 
ATOM   9090  N N   . GLY C 1 241 ? -13.639 -1.813  10.950  1.00 69.44  ? 237  GLY C N   1 
ATOM   9091  C CA  . GLY C 1 241 ? -12.660 -2.760  10.409  1.00 67.42  ? 237  GLY C CA  1 
ATOM   9092  C C   . GLY C 1 241 ? -11.251 -2.215  10.255  1.00 64.18  ? 237  GLY C C   1 
ATOM   9093  O O   . GLY C 1 241 ? -10.372 -2.897  9.722   1.00 62.93  ? 237  GLY C O   1 
ATOM   9094  N N   . ILE C 1 242 ? -11.040 -0.983  10.718  1.00 62.97  ? 238  ILE C N   1 
ATOM   9095  C CA  . ILE C 1 242 ? -9.726  -0.341  10.691  1.00 59.93  ? 238  ILE C CA  1 
ATOM   9096  C C   . ILE C 1 242 ? -9.086  -0.401  12.080  1.00 57.93  ? 238  ILE C C   1 
ATOM   9097  O O   . ILE C 1 242 ? -9.737  -0.105  13.083  1.00 58.85  ? 238  ILE C O   1 
ATOM   9098  C CB  . ILE C 1 242 ? -9.813  1.123   10.174  1.00 60.23  ? 238  ILE C CB  1 
ATOM   9099  C CG1 . ILE C 1 242 ? -10.264 1.136   8.709   1.00 61.62  ? 238  ILE C CG1 1 
ATOM   9100  C CG2 . ILE C 1 242 ? -8.472  1.846   10.333  1.00 57.86  ? 238  ILE C CG2 1 
ATOM   9101  C CD1 . ILE C 1 242 ? -10.353 2.511   8.077   1.00 62.03  ? 238  ILE C CD1 1 
ATOM   9102  N N   . ASP C 1 243 ? -7.813  -0.790  12.123  1.00 74.06  ? 239  ASP C N   1 
ATOM   9103  C CA  . ASP C 1 243 ? -7.091  -0.987  13.379  1.00 74.27  ? 239  ASP C CA  1 
ATOM   9104  C C   . ASP C 1 243 ? -6.487  0.295   13.954  1.00 73.10  ? 239  ASP C C   1 
ATOM   9105  O O   . ASP C 1 243 ? -6.346  0.427   15.174  1.00 74.83  ? 239  ASP C O   1 
ATOM   9106  C CB  . ASP C 1 243 ? -5.985  -2.029  13.192  1.00 72.89  ? 239  ASP C CB  1 
ATOM   9107  C CG  . ASP C 1 243 ? -6.525  -3.435  13.018  1.00 74.55  ? 239  ASP C CG  1 
ATOM   9108  O OD1 . ASP C 1 243 ? -7.171  -3.950  13.953  1.00 77.64  ? 239  ASP C OD1 1 
ATOM   9109  O OD2 . ASP C 1 243 ? -6.290  -4.034  11.950  1.00 73.18  ? 239  ASP C OD2 1 
ATOM   9110  N N   . LYS C 1 244 ? -6.132  1.230   13.073  1.00 70.42  ? 240  LYS C N   1 
ATOM   9111  C CA  . LYS C 1 244 ? -5.360  2.413   13.451  1.00 68.86  ? 240  LYS C CA  1 
ATOM   9112  C C   . LYS C 1 244 ? -5.631  3.569   12.492  1.00 67.74  ? 240  LYS C C   1 
ATOM   9113  O O   . LYS C 1 244 ? -5.691  3.371   11.280  1.00 66.83  ? 240  LYS C O   1 
ATOM   9114  C CB  . LYS C 1 244 ? -3.862  2.062   13.454  1.00 66.90  ? 240  LYS C CB  1 
ATOM   9115  C CG  . LYS C 1 244 ? -2.914  3.137   13.981  1.00 65.83  ? 240  LYS C CG  1 
ATOM   9116  C CD  . LYS C 1 244 ? -2.335  3.991   12.857  1.00 63.52  ? 240  LYS C CD  1 
ATOM   9117  C CE  . LYS C 1 244 ? -1.160  4.827   13.338  1.00 62.57  ? 240  LYS C CE  1 
ATOM   9118  N NZ  . LYS C 1 244 ? -1.531  5.743   14.449  1.00 63.83  ? 240  LYS C NZ  1 
ATOM   9119  N N   . ILE C 1 245 ? -5.797  4.770   13.040  1.00 68.25  ? 241  ILE C N   1 
ATOM   9120  C CA  . ILE C 1 245 ? -5.871  5.980   12.221  1.00 67.60  ? 241  ILE C CA  1 
ATOM   9121  C C   . ILE C 1 245 ? -4.697  6.907   12.509  1.00 65.81  ? 241  ILE C C   1 
ATOM   9122  O O   . ILE C 1 245 ? -4.300  7.090   13.660  1.00 66.13  ? 241  ILE C O   1 
ATOM   9123  C CB  . ILE C 1 245 ? -7.225  6.742   12.364  1.00 70.69  ? 241  ILE C CB  1 
ATOM   9124  C CG1 . ILE C 1 245 ? -7.331  7.847   11.302  1.00 70.65  ? 241  ILE C CG1 1 
ATOM   9125  C CG2 . ILE C 1 245 ? -7.411  7.298   13.785  1.00 72.62  ? 241  ILE C CG2 1 
ATOM   9126  C CD1 . ILE C 1 245 ? -8.722  8.392   11.084  1.00 74.21  ? 241  ILE C CD1 1 
ATOM   9127  N N   . ALA C 1 246 ? -4.141  7.473   11.445  1.00 64.42  ? 242  ALA C N   1 
ATOM   9128  C CA  . ALA C 1 246 ? -3.109  8.485   11.559  1.00 63.22  ? 242  ALA C CA  1 
ATOM   9129  C C   . ALA C 1 246 ? -3.558  9.725   10.800  1.00 64.41  ? 242  ALA C C   1 
ATOM   9130  O O   . ALA C 1 246 ? -3.594  9.742   9.564   1.00 64.69  ? 242  ALA C O   1 
ATOM   9131  C CB  . ALA C 1 246 ? -1.789  7.963   11.027  1.00 61.37  ? 242  ALA C CB  1 
ATOM   9132  N N   . PHE C 1 247 ? -3.930  10.750  11.557  1.00 65.68  ? 243  PHE C N   1 
ATOM   9133  C CA  . PHE C 1 247 ? -4.399  12.006  10.992  1.00 67.51  ? 243  PHE C CA  1 
ATOM   9134  C C   . PHE C 1 247 ? -3.299  13.060  11.046  1.00 66.52  ? 243  PHE C C   1 
ATOM   9135  O O   . PHE C 1 247 ? -2.447  13.040  11.935  1.00 65.07  ? 243  PHE C O   1 
ATOM   9136  C CB  . PHE C 1 247 ? -5.654  12.491  11.735  1.00 70.46  ? 243  PHE C CB  1 
ATOM   9137  C CG  . PHE C 1 247 ? -6.092  13.886  11.359  1.00 72.92  ? 243  PHE C CG  1 
ATOM   9138  C CD1 . PHE C 1 247 ? -6.910  14.100  10.256  1.00 75.40  ? 243  PHE C CD1 1 
ATOM   9139  C CD2 . PHE C 1 247 ? -5.684  14.986  12.109  1.00 73.05  ? 243  PHE C CD2 1 
ATOM   9140  C CE1 . PHE C 1 247 ? -7.313  15.389  9.907   1.00 78.46  ? 243  PHE C CE1 1 
ATOM   9141  C CE2 . PHE C 1 247 ? -6.080  16.276  11.764  1.00 75.78  ? 243  PHE C CE2 1 
ATOM   9142  C CZ  . PHE C 1 247 ? -6.897  16.477  10.662  1.00 78.58  ? 243  PHE C CZ  1 
ATOM   9143  N N   . THR C 1 248 ? -3.326  13.970  10.077  1.00 67.94  ? 244  THR C N   1 
ATOM   9144  C CA  . THR C 1 248 ? -2.464  15.147  10.075  1.00 67.97  ? 244  THR C CA  1 
ATOM   9145  C C   . THR C 1 248 ? -3.185  16.317  9.387   1.00 71.36  ? 244  THR C C   1 
ATOM   9146  O O   . THR C 1 248 ? -3.602  16.210  8.230   1.00 73.13  ? 244  THR C O   1 
ATOM   9147  C CB  . THR C 1 248 ? -1.066  14.845  9.454   1.00 66.09  ? 244  THR C CB  1 
ATOM   9148  O OG1 . THR C 1 248 ? -0.350  16.065  9.235   1.00 66.91  ? 244  THR C OG1 1 
ATOM   9149  C CG2 . THR C 1 248 ? -1.192  14.095  8.145   1.00 66.74  ? 244  THR C CG2 1 
ATOM   9150  N N   . GLY C 1 249 ? -3.356  17.415  10.123  1.00 72.80  ? 245  GLY C N   1 
ATOM   9151  C CA  . GLY C 1 249 ? -4.074  18.591  9.630   1.00 76.70  ? 245  GLY C CA  1 
ATOM   9152  C C   . GLY C 1 249 ? -4.386  19.610  10.712  1.00 78.35  ? 245  GLY C C   1 
ATOM   9153  O O   . GLY C 1 249 ? -3.516  19.965  11.511  1.00 76.44  ? 245  GLY C O   1 
ATOM   9154  N N   . SER C 1 250 ? -5.635  20.074  10.737  1.00 82.43  ? 246  SER C N   1 
ATOM   9155  C CA  . SER C 1 250 ? -6.073  21.122  11.668  1.00 85.14  ? 246  SER C CA  1 
ATOM   9156  C C   . SER C 1 250 ? -6.646  20.574  12.979  1.00 85.38  ? 246  SER C C   1 
ATOM   9157  O O   . SER C 1 250 ? -7.134  19.440  13.032  1.00 84.77  ? 246  SER C O   1 
ATOM   9158  C CB  . SER C 1 250 ? -7.085  22.049  10.990  1.00 90.44  ? 246  SER C CB  1 
ATOM   9159  O OG  . SER C 1 250 ? -8.188  21.316  10.488  1.00 92.68  ? 246  SER C OG  1 
ATOM   9160  N N   . THR C 1 251 ? -6.596  21.403  14.022  1.00 86.87  ? 247  THR C N   1 
ATOM   9161  C CA  . THR C 1 251 ? -6.957  21.001  15.389  1.00 87.80  ? 247  THR C CA  1 
ATOM   9162  C C   . THR C 1 251 ? -8.422  20.594  15.594  1.00 92.16  ? 247  THR C C   1 
ATOM   9163  O O   . THR C 1 251 ? -8.684  19.520  16.139  1.00 91.64  ? 247  THR C O   1 
ATOM   9164  C CB  . THR C 1 251 ? -6.574  22.085  16.436  1.00 88.97  ? 247  THR C CB  1 
ATOM   9165  O OG1 . THR C 1 251 ? -7.032  23.369  15.994  1.00 92.80  ? 247  THR C OG1 1 
ATOM   9166  C CG2 . THR C 1 251 ? -5.063  22.135  16.649  1.00 84.55  ? 247  THR C CG2 1 
ATOM   9167  N N   . GLU C 1 252 ? -9.368  21.435  15.168  1.00 97.06  ? 248  GLU C N   1 
ATOM   9168  C CA  . GLU C 1 252 ? -10.797 21.145  15.385  1.00 102.37 ? 248  GLU C CA  1 
ATOM   9169  C C   . GLU C 1 252 ? -11.337 20.014  14.506  1.00 101.91 ? 248  GLU C C   1 
ATOM   9170  O O   . GLU C 1 252 ? -12.411 19.472  14.774  1.00 105.51 ? 248  GLU C O   1 
ATOM   9171  C CB  . GLU C 1 252 ? -11.683 22.400  15.281  1.00 108.62 ? 248  GLU C CB  1 
ATOM   9172  C CG  . GLU C 1 252 ? -11.657 23.128  13.943  1.00 110.23 ? 248  GLU C CG  1 
ATOM   9173  C CD  . GLU C 1 252 ? -10.840 24.407  13.985  1.00 110.49 ? 248  GLU C CD  1 
ATOM   9174  O OE1 . GLU C 1 252 ? -11.097 25.256  14.866  1.00 113.94 ? 248  GLU C OE1 1 
ATOM   9175  O OE2 . GLU C 1 252 ? -9.947  24.571  13.128  1.00 107.66 ? 248  GLU C OE2 1 
ATOM   9176  N N   . VAL C 1 253 ? -10.589 19.667  13.461  1.00 98.06  ? 249  VAL C N   1 
ATOM   9177  C CA  . VAL C 1 253 ? -10.867 18.467  12.675  1.00 96.73  ? 249  VAL C CA  1 
ATOM   9178  C C   . VAL C 1 253 ? -10.242 17.263  13.384  1.00 92.58  ? 249  VAL C C   1 
ATOM   9179  O O   . VAL C 1 253 ? -10.833 16.181  13.423  1.00 93.02  ? 249  VAL C O   1 
ATOM   9180  C CB  . VAL C 1 253 ? -10.349 18.597  11.221  1.00 95.19  ? 249  VAL C CB  1 
ATOM   9181  C CG1 . VAL C 1 253 ? -10.479 17.277  10.470  1.00 93.36  ? 249  VAL C CG1 1 
ATOM   9182  C CG2 . VAL C 1 253 ? -11.107 19.691  10.484  1.00 100.47 ? 249  VAL C CG2 1 
ATOM   9183  N N   . GLY C 1 254 ? -9.056  17.471  13.957  1.00 89.08  ? 250  GLY C N   1 
ATOM   9184  C CA  . GLY C 1 254 ? -8.369  16.449  14.745  1.00 85.96  ? 250  GLY C CA  1 
ATOM   9185  C C   . GLY C 1 254 ? -9.119  16.007  15.993  1.00 89.07  ? 250  GLY C C   1 
ATOM   9186  O O   . GLY C 1 254 ? -9.049  14.837  16.379  1.00 87.96  ? 250  GLY C O   1 
ATOM   9187  N N   . LYS C 1 255 ? -9.834  16.941  16.622  1.00 93.56  ? 251  LYS C N   1 
ATOM   9188  C CA  . LYS C 1 255 ? -10.648 16.650  17.810  1.00 97.88  ? 251  LYS C CA  1 
ATOM   9189  C C   . LYS C 1 255 ? -11.817 15.717  17.497  1.00 100.85 ? 251  LYS C C   1 
ATOM   9190  O O   . LYS C 1 255 ? -12.196 14.887  18.327  1.00 102.81 ? 251  LYS C O   1 
ATOM   9191  C CB  . LYS C 1 255 ? -11.171 17.943  18.449  1.00 102.63 ? 251  LYS C CB  1 
ATOM   9192  C CG  . LYS C 1 255 ? -10.157 18.675  19.319  1.00 101.02 ? 251  LYS C CG  1 
ATOM   9193  C CD  . LYS C 1 255 ? -10.830 19.744  20.172  1.00 106.70 ? 251  LYS C CD  1 
ATOM   9194  C CE  . LYS C 1 255 ? -9.835  20.423  21.101  1.00 105.29 ? 251  LYS C CE  1 
ATOM   9195  N NZ  . LYS C 1 255 ? -10.489 21.441  21.967  1.00 111.05 ? 251  LYS C NZ  1 
ATOM   9196  N N   . LEU C 1 256 ? -12.376 15.861  16.297  1.00 101.66 ? 252  LEU C N   1 
ATOM   9197  C CA  . LEU C 1 256 ? -13.488 15.027  15.845  1.00 104.70 ? 252  LEU C CA  1 
ATOM   9198  C C   . LEU C 1 256 ? -13.037 13.622  15.444  1.00 100.52 ? 252  LEU C C   1 
ATOM   9199  O O   . LEU C 1 256 ? -13.845 12.693  15.418  1.00 102.72 ? 252  LEU C O   1 
ATOM   9200  C CB  . LEU C 1 256 ? -14.237 15.700  14.686  1.00 107.63 ? 252  LEU C CB  1 
ATOM   9201  C CG  . LEU C 1 256 ? -15.045 16.973  14.977  1.00 113.77 ? 252  LEU C CG  1 
ATOM   9202  C CD1 . LEU C 1 256 ? -15.379 17.701  13.683  1.00 115.68 ? 252  LEU C CD1 1 
ATOM   9203  C CD2 . LEU C 1 256 ? -16.318 16.682  15.774  1.00 120.25 ? 252  LEU C CD2 1 
ATOM   9204  N N   . ILE C 1 257 ? -11.749 13.479  15.137  1.00 95.01  ? 253  ILE C N   1 
ATOM   9205  C CA  . ILE C 1 257 ? -11.166 12.193  14.742  1.00 91.12  ? 253  ILE C CA  1 
ATOM   9206  C C   . ILE C 1 257 ? -11.041 11.234  15.932  1.00 91.43  ? 253  ILE C C   1 
ATOM   9207  O O   . ILE C 1 257 ? -11.508 10.095  15.867  1.00 92.17  ? 253  ILE C O   1 
ATOM   9208  C CB  . ILE C 1 257 ? -9.790  12.380  14.034  1.00 85.94  ? 253  ILE C CB  1 
ATOM   9209  C CG1 . ILE C 1 257 ? -9.959  13.080  12.676  1.00 86.24  ? 253  ILE C CG1 1 
ATOM   9210  C CG2 . ILE C 1 257 ? -9.048  11.047  13.888  1.00 82.41  ? 253  ILE C CG2 1 
ATOM   9211  C CD1 . ILE C 1 257 ? -10.697 12.273  11.614  1.00 87.05  ? 253  ILE C CD1 1 
ATOM   9212  N N   . GLN C 1 258 ? -10.417 11.702  17.011  1.00 91.42  ? 254  GLN C N   1 
ATOM   9213  C CA  . GLN C 1 258 ? -10.242 10.898  18.221  1.00 92.65  ? 254  GLN C CA  1 
ATOM   9214  C C   . GLN C 1 258 ? -11.585 10.601  18.894  1.00 98.75  ? 254  GLN C C   1 
ATOM   9215  O O   . GLN C 1 258 ? -11.761 9.541   19.498  1.00 100.46 ? 254  GLN C O   1 
ATOM   9216  C CB  . GLN C 1 258 ? -9.293  11.599  19.196  1.00 91.95  ? 254  GLN C CB  1 
ATOM   9217  C CG  . GLN C 1 258 ? -8.706  10.686  20.264  1.00 92.46  ? 254  GLN C CG  1 
ATOM   9218  C CD  . GLN C 1 258 ? -7.947  11.449  21.332  1.00 93.38  ? 254  GLN C CD  1 
ATOM   9219  O OE1 . GLN C 1 258 ? -8.499  11.780  22.381  1.00 98.27  ? 254  GLN C OE1 1 
ATOM   9220  N NE2 . GLN C 1 258 ? -6.678  11.740  21.069  1.00 88.97  ? 254  GLN C NE2 1 
ATOM   9221  N N   . GLU C 1 259 ? -12.520 11.542  18.780  1.00 102.62 ? 255  GLU C N   1 
ATOM   9222  C CA  . GLU C 1 259 ? -13.880 11.373  19.287  1.00 109.29 ? 255  GLU C CA  1 
ATOM   9223  C C   . GLU C 1 259 ? -14.632 10.270  18.531  1.00 109.86 ? 255  GLU C C   1 
ATOM   9224  O O   . GLU C 1 259 ? -15.273 9.417   19.150  1.00 113.74 ? 255  GLU C O   1 
ATOM   9225  C CB  . GLU C 1 259 ? -14.639 12.701  19.203  1.00 113.55 ? 255  GLU C CB  1 
ATOM   9226  C CG  . GLU C 1 259 ? -16.055 12.672  19.763  1.00 121.74 ? 255  GLU C CG  1 
ATOM   9227  C CD  . GLU C 1 259 ? -16.798 13.979  19.538  1.00 126.66 ? 255  GLU C CD  1 
ATOM   9228  O OE1 . GLU C 1 259 ? -16.209 15.055  19.784  1.00 125.73 ? 255  GLU C OE1 1 
ATOM   9229  O OE2 . GLU C 1 259 ? -17.975 13.930  19.120  1.00 131.86 ? 255  GLU C OE2 1 
ATOM   9230  N N   . ALA C 1 260 ? -14.542 10.291  17.201  1.00 106.45 ? 256  ALA C N   1 
ATOM   9231  C CA  . ALA C 1 260 ? -15.187 9.283   16.350  1.00 106.62 ? 256  ALA C CA  1 
ATOM   9232  C C   . ALA C 1 260 ? -14.517 7.914   16.460  1.00 103.00 ? 256  ALA C C   1 
ATOM   9233  O O   . ALA C 1 260 ? -15.128 6.889   16.151  1.00 104.31 ? 256  ALA C O   1 
ATOM   9234  C CB  . ALA C 1 260 ? -15.215 9.746   14.899  1.00 104.62 ? 256  ALA C CB  1 
ATOM   9235  N N   . ALA C 1 261 ? -13.259 7.911   16.894  1.00 98.78  ? 257  ALA C N   1 
ATOM   9236  C CA  . ALA C 1 261 ? -12.508 6.680   17.115  1.00 95.86  ? 257  ALA C CA  1 
ATOM   9237  C C   . ALA C 1 261 ? -12.900 6.009   18.430  1.00 100.26 ? 257  ALA C C   1 
ATOM   9238  O O   . ALA C 1 261 ? -13.028 4.786   18.494  1.00 100.85 ? 257  ALA C O   1 
ATOM   9239  C CB  . ALA C 1 261 ? -11.023 6.964   17.092  1.00 90.76  ? 257  ALA C CB  1 
ATOM   9240  N N   . GLY C 1 262 ? -13.091 6.818   19.471  1.00 103.80 ? 258  GLY C N   1 
ATOM   9241  C CA  . GLY C 1 262 ? -13.438 6.320   20.802  1.00 108.98 ? 258  GLY C CA  1 
ATOM   9242  C C   . GLY C 1 262 ? -14.831 5.726   20.895  1.00 114.90 ? 258  GLY C C   1 
ATOM   9243  O O   . GLY C 1 262 ? -15.102 4.896   21.766  1.00 119.13 ? 258  GLY C O   1 
ATOM   9244  N N   . ARG C 1 263 ? -15.714 6.154   19.997  1.00 115.75 ? 259  ARG C N   1 
ATOM   9245  C CA  . ARG C 1 263 ? -17.083 5.653   19.958  1.00 121.62 ? 259  ARG C CA  1 
ATOM   9246  C C   . ARG C 1 263 ? -17.249 4.478   18.998  1.00 119.07 ? 259  ARG C C   1 
ATOM   9247  O O   . ARG C 1 263 ? -18.231 3.738   19.085  1.00 123.78 ? 259  ARG C O   1 
ATOM   9248  C CB  . ARG C 1 263 ? -18.061 6.779   19.620  1.00 125.63 ? 259  ARG C CB  1 
ATOM   9249  C CG  . ARG C 1 263 ? -18.386 7.653   20.813  1.00 131.60 ? 259  ARG C CG  1 
ATOM   9250  C CD  . ARG C 1 263 ? -19.664 8.437   20.606  1.00 138.48 ? 259  ARG C CD  1 
ATOM   9251  N NE  . ARG C 1 263 ? -19.408 9.802   20.156  1.00 136.94 ? 259  ARG C NE  1 
ATOM   9252  C CZ  . ARG C 1 263 ? -20.251 10.819  20.326  1.00 143.30 ? 259  ARG C CZ  1 
ATOM   9253  N NH1 . ARG C 1 263 ? -21.416 10.638  20.941  1.00 151.84 ? 259  ARG C NH1 1 
ATOM   9254  N NH2 . ARG C 1 263 ? -19.927 12.026  19.883  1.00 141.50 ? 259  ARG C NH2 1 
ATOM   9255  N N   . SER C 1 264 ? -16.283 4.307   18.096  1.00 111.99 ? 260  SER C N   1 
ATOM   9256  C CA  . SER C 1 264 ? -16.313 3.210   17.128  1.00 109.23 ? 260  SER C CA  1 
ATOM   9257  C C   . SER C 1 264 ? -15.681 1.929   17.685  1.00 108.10 ? 260  SER C C   1 
ATOM   9258  O O   . SER C 1 264 ? -16.373 1.112   18.298  1.00 112.95 ? 260  SER C O   1 
ATOM   9259  C CB  . SER C 1 264 ? -15.672 3.625   15.794  1.00 103.35 ? 260  SER C CB  1 
ATOM   9260  O OG  . SER C 1 264 ? -14.320 4.015   15.957  1.00 98.43  ? 260  SER C OG  1 
ATOM   9261  N N   . ASN C 1 265 ? -14.374 1.764   17.482  1.00 102.33 ? 261  ASN C N   1 
ATOM   9262  C CA  . ASN C 1 265 ? -13.669 0.544   17.877  1.00 101.09 ? 261  ASN C CA  1 
ATOM   9263  C C   . ASN C 1 265 ? -12.374 0.797   18.653  1.00 98.80  ? 261  ASN C C   1 
ATOM   9264  O O   . ASN C 1 265 ? -11.535 -0.101  18.779  1.00 97.00  ? 261  ASN C O   1 
ATOM   9265  C CB  . ASN C 1 265 ? -13.380 -0.315  16.645  1.00 96.95  ? 261  ASN C CB  1 
ATOM   9266  C CG  . ASN C 1 265 ? -12.528 0.406   15.621  1.00 91.28  ? 261  ASN C CG  1 
ATOM   9267  O OD1 . ASN C 1 265 ? -12.514 1.637   15.561  1.00 90.46  ? 261  ASN C OD1 1 
ATOM   9268  N ND2 . ASN C 1 265 ? -11.812 -0.360  14.805  1.00 87.47  ? 261  ASN C ND2 1 
ATOM   9269  N N   . LEU C 1 266 ? -12.226 2.021   19.165  1.00 99.23  ? 262  LEU C N   1 
ATOM   9270  C CA  . LEU C 1 266 ? -11.063 2.434   19.966  1.00 97.66  ? 262  LEU C CA  1 
ATOM   9271  C C   . LEU C 1 266 ? -9.729  2.205   19.241  1.00 91.50  ? 262  LEU C C   1 
ATOM   9272  O O   . LEU C 1 266 ? -8.779  1.648   19.801  1.00 90.91  ? 262  LEU C O   1 
ATOM   9273  C CB  . LEU C 1 266 ? -11.079 1.755   21.346  1.00 102.79 ? 262  LEU C CB  1 
ATOM   9274  C CG  . LEU C 1 266 ? -12.337 1.924   22.207  1.00 110.11 ? 262  LEU C CG  1 
ATOM   9275  C CD1 . LEU C 1 266 ? -12.495 0.749   23.160  1.00 115.37 ? 262  LEU C CD1 1 
ATOM   9276  C CD2 . LEU C 1 266 ? -12.328 3.249   22.965  1.00 112.26 ? 262  LEU C CD2 1 
ATOM   9277  N N   . LYS C 1 267 ? -9.673  2.641   17.987  1.00 87.58  ? 263  LYS C N   1 
ATOM   9278  C CA  . LYS C 1 267 ? -8.471  2.506   17.174  1.00 82.43  ? 263  LYS C CA  1 
ATOM   9279  C C   . LYS C 1 267 ? -7.386  3.473   17.645  1.00 80.60  ? 263  LYS C C   1 
ATOM   9280  O O   . LYS C 1 267 ? -7.687  4.566   18.123  1.00 82.08  ? 263  LYS C O   1 
ATOM   9281  C CB  . LYS C 1 267 ? -8.793  2.716   15.689  1.00 79.84  ? 263  LYS C CB  1 
ATOM   9282  C CG  . LYS C 1 267 ? -9.320  4.098   15.330  1.00 79.99  ? 263  LYS C CG  1 
ATOM   9283  C CD  . LYS C 1 267 ? -9.468  4.262   13.828  1.00 77.77  ? 263  LYS C CD  1 
ATOM   9284  C CE  . LYS C 1 267 ? -10.904 4.108   13.362  1.00 81.22  ? 263  LYS C CE  1 
ATOM   9285  N NZ  . LYS C 1 267 ? -11.420 2.725   13.493  1.00 82.88  ? 263  LYS C NZ  1 
ATOM   9286  N N   . ARG C 1 268 ? -6.129  3.053   17.519  1.00 77.88  ? 264  ARG C N   1 
ATOM   9287  C CA  . ARG C 1 268 ? -4.985  3.871   17.916  1.00 76.21  ? 264  ARG C CA  1 
ATOM   9288  C C   . ARG C 1 268 ? -4.975  5.175   17.133  1.00 73.94  ? 264  ARG C C   1 
ATOM   9289  O O   . ARG C 1 268 ? -5.016  5.169   15.902  1.00 71.78  ? 264  ARG C O   1 
ATOM   9290  C CB  . ARG C 1 268 ? -3.681  3.107   17.695  1.00 74.03  ? 264  ARG C CB  1 
ATOM   9291  C CG  . ARG C 1 268 ? -3.518  1.897   18.595  1.00 77.08  ? 264  ARG C CG  1 
ATOM   9292  C CD  . ARG C 1 268 ? -2.914  0.737   17.835  1.00 75.96  ? 264  ARG C CD  1 
ATOM   9293  N NE  . ARG C 1 268 ? -2.562  -0.368  18.722  1.00 79.61  ? 264  ARG C NE  1 
ATOM   9294  C CZ  . ARG C 1 268 ? -1.317  -0.733  19.016  1.00 79.98  ? 264  ARG C CZ  1 
ATOM   9295  N NH1 . ARG C 1 268 ? -0.281  -0.091  18.488  1.00 77.10  ? 264  ARG C NH1 1 
ATOM   9296  N NH2 . ARG C 1 268 ? -1.106  -1.751  19.838  1.00 83.80  ? 264  ARG C NH2 1 
ATOM   9297  N N   . VAL C 1 269 ? -4.941  6.290   17.855  1.00 75.02  ? 265  VAL C N   1 
ATOM   9298  C CA  . VAL C 1 269 ? -5.021  7.604   17.232  1.00 73.83  ? 265  VAL C CA  1 
ATOM   9299  C C   . VAL C 1 269 ? -3.698  8.351   17.334  1.00 71.51  ? 265  VAL C C   1 
ATOM   9300  O O   . VAL C 1 269 ? -3.114  8.460   18.413  1.00 72.50  ? 265  VAL C O   1 
ATOM   9301  C CB  . VAL C 1 269 ? -6.154  8.459   17.845  1.00 77.42  ? 265  VAL C CB  1 
ATOM   9302  C CG1 . VAL C 1 269 ? -6.269  9.797   17.130  1.00 76.71  ? 265  VAL C CG1 1 
ATOM   9303  C CG2 . VAL C 1 269 ? -7.473  7.724   17.767  1.00 80.56  ? 265  VAL C CG2 1 
ATOM   9304  N N   . THR C 1 270 ? -3.235  8.855   16.195  1.00 69.03  ? 266  THR C N   1 
ATOM   9305  C CA  . THR C 1 270 ? -2.073  9.730   16.144  1.00 67.35  ? 266  THR C CA  1 
ATOM   9306  C C   . THR C 1 270 ? -2.438  10.993  15.372  1.00 67.30  ? 266  THR C C   1 
ATOM   9307  O O   . THR C 1 270 ? -2.965  10.925  14.260  1.00 67.20  ? 266  THR C O   1 
ATOM   9308  C CB  . THR C 1 270 ? -0.859  9.043   15.486  1.00 65.04  ? 266  THR C CB  1 
ATOM   9309  O OG1 . THR C 1 270 ? -0.703  7.725   16.023  1.00 65.77  ? 266  THR C OG1 1 
ATOM   9310  C CG2 . THR C 1 270 ? 0.413   9.840   15.746  1.00 64.22  ? 266  THR C CG2 1 
ATOM   9311  N N   . LEU C 1 271 ? -2.160  12.142  15.977  1.00 67.90  ? 267  LEU C N   1 
ATOM   9312  C CA  . LEU C 1 271 ? -2.491  13.424  15.380  1.00 68.58  ? 267  LEU C CA  1 
ATOM   9313  C C   . LEU C 1 271 ? -1.243  14.268  15.197  1.00 67.11  ? 267  LEU C C   1 
ATOM   9314  O O   . LEU C 1 271 ? -0.424  14.385  16.110  1.00 66.69  ? 267  LEU C O   1 
ATOM   9315  C CB  . LEU C 1 271 ? -3.497  14.181  16.252  1.00 71.68  ? 267  LEU C CB  1 
ATOM   9316  C CG  . LEU C 1 271 ? -4.809  13.498  16.649  1.00 74.32  ? 267  LEU C CG  1 
ATOM   9317  C CD1 . LEU C 1 271 ? -5.472  14.263  17.777  1.00 77.88  ? 267  LEU C CD1 1 
ATOM   9318  C CD2 . LEU C 1 271 ? -5.751  13.371  15.463  1.00 75.21  ? 267  LEU C CD2 1 
ATOM   9319  N N   . GLU C 1 272 ? -1.101  14.840  14.006  1.00 67.03  ? 268  GLU C N   1 
ATOM   9320  C CA  . GLU C 1 272 ? -0.062  15.828  13.736  1.00 66.63  ? 268  GLU C CA  1 
ATOM   9321  C C   . GLU C 1 272 ? -0.740  17.173  13.458  1.00 68.89  ? 268  GLU C C   1 
ATOM   9322  O O   . GLU C 1 272 ? -0.863  17.604  12.308  1.00 69.83  ? 268  GLU C O   1 
ATOM   9323  C CB  . GLU C 1 272 ? 0.834   15.383  12.570  1.00 65.35  ? 268  GLU C CB  1 
ATOM   9324  C CG  . GLU C 1 272 ? 2.146   16.167  12.436  1.00 65.35  ? 268  GLU C CG  1 
ATOM   9325  C CD  . GLU C 1 272 ? 2.947   15.800  11.186  1.00 66.24  ? 268  GLU C CD  1 
ATOM   9326  O OE1 . GLU C 1 272 ? 2.766   14.684  10.648  1.00 66.24  ? 268  GLU C OE1 1 
ATOM   9327  O OE2 . GLU C 1 272 ? 3.769   16.632  10.737  1.00 67.43  ? 268  GLU C OE2 1 
ATOM   9328  N N   . LEU C 1 273 ? -1.187  17.821  14.531  1.00 70.42  ? 269  LEU C N   1 
ATOM   9329  C CA  . LEU C 1 273 ? -1.924  19.081  14.444  1.00 73.30  ? 269  LEU C CA  1 
ATOM   9330  C C   . LEU C 1 273 ? -0.993  20.274  14.223  1.00 73.25  ? 269  LEU C C   1 
ATOM   9331  O O   . LEU C 1 273 ? 0.230   20.123  14.232  1.00 71.13  ? 269  LEU C O   1 
ATOM   9332  C CB  . LEU C 1 273 ? -2.764  19.281  15.708  1.00 75.57  ? 269  LEU C CB  1 
ATOM   9333  C CG  . LEU C 1 273 ? -3.622  18.101  16.180  1.00 76.45  ? 269  LEU C CG  1 
ATOM   9334  C CD1 . LEU C 1 273 ? -4.161  18.354  17.583  1.00 79.28  ? 269  LEU C CD1 1 
ATOM   9335  C CD2 . LEU C 1 273 ? -4.758  17.804  15.204  1.00 78.27  ? 269  LEU C CD2 1 
ATOM   9336  N N   . GLY C 1 274 ? -1.577  21.455  14.025  1.00 76.16  ? 270  GLY C N   1 
ATOM   9337  C CA  . GLY C 1 274 ? -0.808  22.675  13.772  1.00 76.90  ? 270  GLY C CA  1 
ATOM   9338  C C   . GLY C 1 274 ? -0.143  23.258  15.008  1.00 76.41  ? 270  GLY C C   1 
ATOM   9339  O O   . GLY C 1 274 ? 0.436   22.528  15.817  1.00 74.35  ? 270  GLY C O   1 
ATOM   9340  N N   . GLY C 1 275 ? -0.221  24.579  15.149  1.00 78.78  ? 271  GLY C N   1 
ATOM   9341  C CA  . GLY C 1 275 ? 0.350   25.275  16.304  1.00 78.85  ? 271  GLY C CA  1 
ATOM   9342  C C   . GLY C 1 275 ? 1.464   26.235  15.935  1.00 78.61  ? 271  GLY C C   1 
ATOM   9343  O O   . GLY C 1 275 ? 2.129   26.060  14.912  1.00 77.73  ? 271  GLY C O   1 
ATOM   9344  N N   . LYS C 1 276 ? 1.668   27.247  16.777  1.00 79.88  ? 272  LYS C N   1 
ATOM   9345  C CA  . LYS C 1 276 ? 2.678   28.286  16.538  1.00 80.15  ? 272  LYS C CA  1 
ATOM   9346  C C   . LYS C 1 276 ? 4.106   27.739  16.570  1.00 77.06  ? 272  LYS C C   1 
ATOM   9347  O O   . LYS C 1 276 ? 4.367   26.683  17.154  1.00 74.98  ? 272  LYS C O   1 
ATOM   9348  C CB  . LYS C 1 276 ? 2.529   29.442  17.537  1.00 82.46  ? 272  LYS C CB  1 
ATOM   9349  C CG  . LYS C 1 276 ? 2.561   29.022  19.003  1.00 81.99  ? 272  LYS C CG  1 
ATOM   9350  C CD  . LYS C 1 276 ? 2.814   30.197  19.940  1.00 84.43  ? 272  LYS C CD  1 
ATOM   9351  C CE  . LYS C 1 276 ? 4.304   30.423  20.172  1.00 82.62  ? 272  LYS C CE  1 
ATOM   9352  N NZ  . LYS C 1 276 ? 4.564   31.302  21.347  1.00 84.30  ? 272  LYS C NZ  1 
ATOM   9353  N N   . SER C 1 277 ? 5.020   28.468  15.933  1.00 77.33  ? 273  SER C N   1 
ATOM   9354  C CA  . SER C 1 277 ? 6.424   28.077  15.867  1.00 75.20  ? 273  SER C CA  1 
ATOM   9355  C C   . SER C 1 277 ? 7.344   29.302  15.914  1.00 76.41  ? 273  SER C C   1 
ATOM   9356  O O   . SER C 1 277 ? 7.676   29.873  14.872  1.00 78.22  ? 273  SER C O   1 
ATOM   9357  C CB  . SER C 1 277 ? 6.686   27.233  14.616  1.00 74.62  ? 273  SER C CB  1 
ATOM   9358  O OG  . SER C 1 277 ? 8.065   26.946  14.473  1.00 74.08  ? 273  SER C OG  1 
ATOM   9359  N N   . PRO C 1 278 ? 7.760   29.706  17.129  1.00 75.83  ? 274  PRO C N   1 
ATOM   9360  C CA  . PRO C 1 278 ? 8.547   30.923  17.326  1.00 77.22  ? 274  PRO C CA  1 
ATOM   9361  C C   . PRO C 1 278 ? 10.018  30.809  16.912  1.00 76.69  ? 274  PRO C C   1 
ATOM   9362  O O   . PRO C 1 278 ? 10.691  29.831  17.250  1.00 74.85  ? 274  PRO C O   1 
ATOM   9363  C CB  . PRO C 1 278 ? 8.444   31.159  18.835  1.00 77.09  ? 274  PRO C CB  1 
ATOM   9364  C CG  . PRO C 1 278 ? 8.263   29.801  19.408  1.00 75.06  ? 274  PRO C CG  1 
ATOM   9365  C CD  . PRO C 1 278 ? 7.428   29.057  18.412  1.00 74.56  ? 274  PRO C CD  1 
ATOM   9366  N N   . ASN C 1 279 ? 10.493  31.812  16.177  1.00 78.85  ? 275  ASN C N   1 
ATOM   9367  C CA  . ASN C 1 279 ? 11.918  31.992  15.912  1.00 79.41  ? 275  ASN C CA  1 
ATOM   9368  C C   . ASN C 1 279 ? 12.492  33.005  16.894  1.00 80.05  ? 275  ASN C C   1 
ATOM   9369  O O   . ASN C 1 279 ? 11.980  34.120  17.010  1.00 81.84  ? 275  ASN C O   1 
ATOM   9370  C CB  . ASN C 1 279 ? 12.157  32.479  14.477  1.00 82.46  ? 275  ASN C CB  1 
ATOM   9371  C CG  . ASN C 1 279 ? 12.014  31.376  13.444  1.00 82.13  ? 275  ASN C CG  1 
ATOM   9372  O OD1 . ASN C 1 279 ? 10.980  30.712  13.359  1.00 80.93  ? 275  ASN C OD1 1 
ATOM   9373  N ND2 . ASN C 1 279 ? 13.052  31.190  12.636  1.00 84.13  ? 275  ASN C ND2 1 
ATOM   9374  N N   . ILE C 1 280 ? 13.543  32.614  17.606  1.00 78.80  ? 276  ILE C N   1 
ATOM   9375  C CA  . ILE C 1 280 ? 14.195  33.510  18.555  1.00 79.57  ? 276  ILE C CA  1 
ATOM   9376  C C   . ILE C 1 280 ? 15.568  33.903  18.025  1.00 81.60  ? 276  ILE C C   1 
ATOM   9377  O O   . ILE C 1 280 ? 16.409  33.046  17.763  1.00 81.31  ? 276  ILE C O   1 
ATOM   9378  C CB  . ILE C 1 280 ? 14.306  32.886  19.966  1.00 77.84  ? 276  ILE C CB  1 
ATOM   9379  C CG1 . ILE C 1 280 ? 12.940  32.370  20.432  1.00 76.09  ? 276  ILE C CG1 1 
ATOM   9380  C CG2 . ILE C 1 280 ? 14.852  33.910  20.954  1.00 79.43  ? 276  ILE C CG2 1 
ATOM   9381  C CD1 . ILE C 1 280 ? 12.998  31.376  21.572  1.00 74.60  ? 276  ILE C CD1 1 
ATOM   9382  N N   . ILE C 1 281 ? 15.778  35.205  17.854  1.00 84.13  ? 277  ILE C N   1 
ATOM   9383  C CA  . ILE C 1 281 ? 17.023  35.723  17.292  1.00 86.97  ? 277  ILE C CA  1 
ATOM   9384  C C   . ILE C 1 281 ? 17.701  36.695  18.254  1.00 88.34  ? 277  ILE C C   1 
ATOM   9385  O O   . ILE C 1 281 ? 17.156  37.754  18.579  1.00 89.35  ? 277  ILE C O   1 
ATOM   9386  C CB  . ILE C 1 281 ? 16.794  36.382  15.909  1.00 90.04  ? 277  ILE C CB  1 
ATOM   9387  C CG1 . ILE C 1 281 ? 16.290  35.336  14.914  1.00 89.13  ? 277  ILE C CG1 1 
ATOM   9388  C CG2 . ILE C 1 281 ? 18.080  37.028  15.389  1.00 93.88  ? 277  ILE C CG2 1 
ATOM   9389  C CD1 . ILE C 1 281 ? 15.421  35.889  13.817  1.00 91.78  ? 277  ILE C CD1 1 
ATOM   9390  N N   . PHE C 1 282 ? 18.893  36.312  18.703  1.00 88.73  ? 278  PHE C N   1 
ATOM   9391  C CA  . PHE C 1 282 ? 19.680  37.120  19.626  1.00 90.30  ? 278  PHE C CA  1 
ATOM   9392  C C   . PHE C 1 282 ? 20.592  38.091  18.880  1.00 94.37  ? 278  PHE C C   1 
ATOM   9393  O O   . PHE C 1 282 ? 20.769  37.980  17.665  1.00 96.21  ? 278  PHE C O   1 
ATOM   9394  C CB  . PHE C 1 282 ? 20.497  36.219  20.552  1.00 89.39  ? 278  PHE C CB  1 
ATOM   9395  C CG  . PHE C 1 282 ? 19.678  35.527  21.607  1.00 86.33  ? 278  PHE C CG  1 
ATOM   9396  C CD1 . PHE C 1 282 ? 19.611  36.041  22.897  1.00 86.52  ? 278  PHE C CD1 1 
ATOM   9397  C CD2 . PHE C 1 282 ? 18.981  34.359  21.315  1.00 83.70  ? 278  PHE C CD2 1 
ATOM   9398  C CE1 . PHE C 1 282 ? 18.860  35.404  23.882  1.00 84.67  ? 278  PHE C CE1 1 
ATOM   9399  C CE2 . PHE C 1 282 ? 18.227  33.715  22.293  1.00 81.59  ? 278  PHE C CE2 1 
ATOM   9400  C CZ  . PHE C 1 282 ? 18.167  34.239  23.578  1.00 82.27  ? 278  PHE C CZ  1 
ATOM   9401  N N   . ALA C 1 283 ? 21.165  39.039  19.619  1.00 96.25  ? 279  ALA C N   1 
ATOM   9402  C CA  . ALA C 1 283 ? 22.006  40.087  19.043  1.00 100.59 ? 279  ALA C CA  1 
ATOM   9403  C C   . ALA C 1 283 ? 23.335  39.565  18.493  1.00 103.35 ? 279  ALA C C   1 
ATOM   9404  O O   . ALA C 1 283 ? 23.823  40.061  17.475  1.00 107.25 ? 279  ALA C O   1 
ATOM   9405  C CB  . ALA C 1 283 ? 22.250  41.190  20.064  1.00 101.73 ? 279  ALA C CB  1 
ATOM   9406  N N   . ASP C 1 284 ? 23.906  38.565  19.162  1.00 102.09 ? 280  ASP C N   1 
ATOM   9407  C CA  . ASP C 1 284 ? 25.239  38.047  18.825  1.00 105.30 ? 280  ASP C CA  1 
ATOM   9408  C C   . ASP C 1 284 ? 25.291  37.223  17.532  1.00 106.42 ? 280  ASP C C   1 
ATOM   9409  O O   . ASP C 1 284 ? 26.371  36.998  16.979  1.00 110.36 ? 280  ASP C O   1 
ATOM   9410  C CB  . ASP C 1 284 ? 25.822  37.252  20.000  1.00 104.24 ? 280  ASP C CB  1 
ATOM   9411  C CG  . ASP C 1 284 ? 24.921  36.116  20.444  1.00 99.83  ? 280  ASP C CG  1 
ATOM   9412  O OD1 . ASP C 1 284 ? 24.798  35.121  19.698  1.00 99.06  ? 280  ASP C OD1 1 
ATOM   9413  O OD2 . ASP C 1 284 ? 24.345  36.214  21.547  1.00 97.49  ? 280  ASP C OD2 1 
ATOM   9414  N N   . ALA C 1 285 ? 24.129  36.774  17.063  1.00 103.47 ? 281  ALA C N   1 
ATOM   9415  C CA  . ALA C 1 285 ? 24.028  36.025  15.811  1.00 104.57 ? 281  ALA C CA  1 
ATOM   9416  C C   . ALA C 1 285 ? 24.359  36.911  14.613  1.00 109.74 ? 281  ALA C C   1 
ATOM   9417  O O   . ALA C 1 285 ? 24.124  38.121  14.645  1.00 111.21 ? 281  ALA C O   1 
ATOM   9418  C CB  . ALA C 1 285 ? 22.637  35.431  15.663  1.00 100.26 ? 281  ALA C CB  1 
ATOM   9419  N N   . ASP C 1 286 ? 24.914  36.303  13.567  1.00 100.82 ? 282  ASP C N   1 
ATOM   9420  C CA  . ASP C 1 286 ? 25.226  37.017  12.327  1.00 104.79 ? 282  ASP C CA  1 
ATOM   9421  C C   . ASP C 1 286 ? 23.946  37.391  11.579  1.00 105.72 ? 282  ASP C C   1 
ATOM   9422  O O   . ASP C 1 286 ? 23.081  36.544  11.349  1.00 104.55 ? 282  ASP C O   1 
ATOM   9423  C CB  . ASP C 1 286 ? 26.187  36.209  11.437  1.00 107.53 ? 282  ASP C CB  1 
ATOM   9424  C CG  . ASP C 1 286 ? 25.680  34.799  11.122  1.00 106.87 ? 282  ASP C CG  1 
ATOM   9425  O OD1 . ASP C 1 286 ? 24.802  34.274  11.843  1.00 103.94 ? 282  ASP C OD1 1 
ATOM   9426  O OD2 . ASP C 1 286 ? 26.183  34.206  10.144  1.00 110.14 ? 282  ASP C OD2 1 
ATOM   9427  N N   . LEU C 1 287 ? 23.836  38.665  11.212  1.00 108.45 ? 283  LEU C N   1 
ATOM   9428  C CA  . LEU C 1 287 ? 22.595  39.216  10.663  1.00 109.91 ? 283  LEU C CA  1 
ATOM   9429  C C   . LEU C 1 287 ? 22.257  38.700  9.261   1.00 112.20 ? 283  LEU C C   1 
ATOM   9430  O O   . LEU C 1 287 ? 21.086  38.484  8.948   1.00 111.95 ? 283  LEU C O   1 
ATOM   9431  C CB  . LEU C 1 287 ? 22.635  40.750  10.683  1.00 113.29 ? 283  LEU C CB  1 
ATOM   9432  C CG  . LEU C 1 287 ? 21.311  41.522  10.647  1.00 114.87 ? 283  LEU C CG  1 
ATOM   9433  C CD1 . LEU C 1 287 ? 20.442  41.220  11.867  1.00 111.23 ? 283  LEU C CD1 1 
ATOM   9434  C CD2 . LEU C 1 287 ? 21.580  43.015  10.544  1.00 119.66 ? 283  LEU C CD2 1 
ATOM   9435  N N   . ASP C 1 288 ? 23.282  38.501  8.433   1.00 114.90 ? 284  ASP C N   1 
ATOM   9436  C CA  . ASP C 1 288 ? 23.102  38.031  7.055   1.00 117.84 ? 284  ASP C CA  1 
ATOM   9437  C C   . ASP C 1 288 ? 22.418  36.666  6.982   1.00 115.48 ? 284  ASP C C   1 
ATOM   9438  O O   . ASP C 1 288 ? 21.530  36.453  6.154   1.00 116.79 ? 284  ASP C O   1 
ATOM   9439  C CB  . ASP C 1 288 ? 24.448  37.980  6.321   1.00 121.66 ? 284  ASP C CB  1 
ATOM   9440  C CG  . ASP C 1 288 ? 25.088  39.348  6.168   1.00 125.53 ? 284  ASP C CG  1 
ATOM   9441  O OD1 . ASP C 1 288 ? 24.380  40.310  5.798   1.00 127.70 ? 284  ASP C OD1 1 
ATOM   9442  O OD2 . ASP C 1 288 ? 26.309  39.458  6.408   1.00 127.05 ? 284  ASP C OD2 1 
ATOM   9443  N N   . TYR C 1 289 ? 22.836  35.755  7.859   1.00 112.56 ? 285  TYR C N   1 
ATOM   9444  C CA  . TYR C 1 289 ? 22.317  34.389  7.883   1.00 111.16 ? 285  TYR C CA  1 
ATOM   9445  C C   . TYR C 1 289 ? 20.999  34.273  8.651   1.00 108.24 ? 285  TYR C C   1 
ATOM   9446  O O   . TYR C 1 289 ? 20.129  33.486  8.275   1.00 108.47 ? 285  TYR C O   1 
ATOM   9447  C CB  . TYR C 1 289 ? 23.365  33.434  8.466   1.00 110.48 ? 285  TYR C CB  1 
ATOM   9448  C CG  . TYR C 1 289 ? 22.965  31.974  8.445   1.00 110.27 ? 285  TYR C CG  1 
ATOM   9449  C CD1 . TYR C 1 289 ? 23.149  31.196  7.300   1.00 113.89 ? 285  TYR C CD1 1 
ATOM   9450  C CD2 . TYR C 1 289 ? 22.410  31.369  9.572   1.00 107.05 ? 285  TYR C CD2 1 
ATOM   9451  C CE1 . TYR C 1 289 ? 22.783  29.855  7.278   1.00 114.61 ? 285  TYR C CE1 1 
ATOM   9452  C CE2 . TYR C 1 289 ? 22.042  30.033  9.558   1.00 107.80 ? 285  TYR C CE2 1 
ATOM   9453  C CZ  . TYR C 1 289 ? 22.232  29.281  8.412   1.00 111.66 ? 285  TYR C CZ  1 
ATOM   9454  O OH  . TYR C 1 289 ? 21.866  27.957  8.401   1.00 113.36 ? 285  TYR C OH  1 
ATOM   9455  N N   . ALA C 1 290 ? 20.862  35.053  9.722   1.00 106.16 ? 286  ALA C N   1 
ATOM   9456  C CA  . ALA C 1 290 ? 19.668  35.018  10.571  1.00 104.12 ? 286  ALA C CA  1 
ATOM   9457  C C   . ALA C 1 290 ? 18.416  35.561  9.876   1.00 106.22 ? 286  ALA C C   1 
ATOM   9458  O O   . ALA C 1 290 ? 17.328  35.006  10.036  1.00 105.83 ? 286  ALA C O   1 
ATOM   9459  C CB  . ALA C 1 290 ? 19.917  35.762  11.877  1.00 102.08 ? 286  ALA C CB  1 
ATOM   9460  N N   . VAL C 1 291 ? 18.577  36.641  9.113   1.00 109.09 ? 287  VAL C N   1 
ATOM   9461  C CA  . VAL C 1 291 ? 17.469  37.245  8.371   1.00 111.98 ? 287  VAL C CA  1 
ATOM   9462  C C   . VAL C 1 291 ? 16.983  36.313  7.259   1.00 113.49 ? 287  VAL C C   1 
ATOM   9463  O O   . VAL C 1 291 ? 15.781  36.065  7.138   1.00 114.11 ? 287  VAL C O   1 
ATOM   9464  C CB  . VAL C 1 291 ? 17.852  38.637  7.787   1.00 115.67 ? 287  VAL C CB  1 
ATOM   9465  C CG1 . VAL C 1 291 ? 16.775  39.156  6.832   1.00 119.41 ? 287  VAL C CG1 1 
ATOM   9466  C CG2 . VAL C 1 291 ? 18.095  39.643  8.906   1.00 115.16 ? 287  VAL C CG2 1 
ATOM   9467  N N   . GLU C 1 292 ? 17.925  35.793  6.470   1.00 114.67 ? 288  GLU C N   1 
ATOM   9468  C CA  . GLU C 1 292 ? 17.620  34.947  5.312   1.00 116.98 ? 288  GLU C CA  1 
ATOM   9469  C C   . GLU C 1 292 ? 16.966  33.611  5.686   1.00 115.40 ? 288  GLU C C   1 
ATOM   9470  O O   . GLU C 1 292 ? 16.035  33.167  5.010   1.00 117.20 ? 288  GLU C O   1 
ATOM   9471  C CB  . GLU C 1 292 ? 18.881  34.724  4.463   1.00 119.31 ? 288  GLU C CB  1 
ATOM   9472  C CG  . GLU C 1 292 ? 18.665  33.961  3.149   1.00 122.60 ? 288  GLU C CG  1 
ATOM   9473  C CD  . GLU C 1 292 ? 17.777  34.696  2.154   1.00 125.73 ? 288  GLU C CD  1 
ATOM   9474  O OE1 . GLU C 1 292 ? 17.921  35.928  2.004   1.00 127.50 ? 288  GLU C OE1 1 
ATOM   9475  O OE2 . GLU C 1 292 ? 16.938  34.032  1.509   1.00 126.96 ? 288  GLU C OE2 1 
ATOM   9476  N N   . GLN C 1 293 ? 17.451  32.981  6.757   1.00 112.68 ? 289  GLN C N   1 
ATOM   9477  C CA  . GLN C 1 293 ? 16.898  31.704  7.230   1.00 111.86 ? 289  GLN C CA  1 
ATOM   9478  C C   . GLN C 1 293 ? 15.515  31.854  7.871   1.00 111.19 ? 289  GLN C C   1 
ATOM   9479  O O   . GLN C 1 293 ? 14.703  30.927  7.824   1.00 112.21 ? 289  GLN C O   1 
ATOM   9480  C CB  . GLN C 1 293 ? 17.861  31.010  8.199   1.00 109.81 ? 289  GLN C CB  1 
ATOM   9481  C CG  . GLN C 1 293 ? 19.001  30.252  7.522   1.00 111.90 ? 289  GLN C CG  1 
ATOM   9482  C CD  . GLN C 1 293 ? 18.610  28.854  7.070   1.00 114.19 ? 289  GLN C CD  1 
ATOM   9483  O OE1 . GLN C 1 293 ? 18.010  28.085  7.823   1.00 113.34 ? 289  GLN C OE1 1 
ATOM   9484  N NE2 . GLN C 1 293 ? 18.963  28.514  5.836   1.00 117.82 ? 289  GLN C NE2 1 
ATOM   9485  N N   . ALA C 1 294 ? 15.257  33.017  8.469   1.00 110.30 ? 290  ALA C N   1 
ATOM   9486  C CA  . ALA C 1 294 ? 13.947  33.324  9.045   1.00 110.70 ? 290  ALA C CA  1 
ATOM   9487  C C   . ALA C 1 294 ? 12.938  33.733  7.970   1.00 114.21 ? 290  ALA C C   1 
ATOM   9488  O O   . ALA C 1 294 ? 11.736  33.512  8.127   1.00 115.62 ? 290  ALA C O   1 
ATOM   9489  C CB  . ALA C 1 294 ? 14.068  34.408  10.106  1.00 109.25 ? 290  ALA C CB  1 
ATOM   9490  N N   . HIS C 1 295 ? 13.439  34.332  6.888   1.00 116.19 ? 291  HIS C N   1 
ATOM   9491  C CA  . HIS C 1 295 ? 12.618  34.727  5.739   1.00 120.01 ? 291  HIS C CA  1 
ATOM   9492  C C   . HIS C 1 295 ? 12.118  33.504  4.967   1.00 121.54 ? 291  HIS C C   1 
ATOM   9493  O O   . HIS C 1 295 ? 10.958  33.457  4.551   1.00 124.04 ? 291  HIS C O   1 
ATOM   9494  C CB  . HIS C 1 295 ? 13.409  35.662  4.816   1.00 122.12 ? 291  HIS C CB  1 
ATOM   9495  C CG  . HIS C 1 295 ? 12.653  36.104  3.600   1.00 126.44 ? 291  HIS C CG  1 
ATOM   9496  N ND1 . HIS C 1 295 ? 12.799  35.497  2.372   1.00 128.59 ? 291  HIS C ND1 1 
ATOM   9497  C CD2 . HIS C 1 295 ? 11.752  37.098  3.422   1.00 129.53 ? 291  HIS C CD2 1 
ATOM   9498  C CE1 . HIS C 1 295 ? 12.018  36.096  1.490   1.00 132.47 ? 291  HIS C CE1 1 
ATOM   9499  N NE2 . HIS C 1 295 ? 11.371  37.070  2.102   1.00 133.20 ? 291  HIS C NE2 1 
ATOM   9500  N N   . GLN C 1 296 ? 13.000  32.522  4.787   1.00 120.71 ? 292  GLN C N   1 
ATOM   9501  C CA  . GLN C 1 296 ? 12.659  31.255  4.136   1.00 122.71 ? 292  GLN C CA  1 
ATOM   9502  C C   . GLN C 1 296 ? 11.966  30.278  5.090   1.00 121.83 ? 292  GLN C C   1 
ATOM   9503  O O   . GLN C 1 296 ? 11.608  29.166  4.696   1.00 123.91 ? 292  GLN C O   1 
ATOM   9504  C CB  . GLN C 1 296 ? 13.912  30.605  3.537   1.00 123.34 ? 292  GLN C CB  1 
ATOM   9505  C CG  . GLN C 1 296 ? 14.287  31.107  2.148   1.00 126.53 ? 292  GLN C CG  1 
ATOM   9506  C CD  . GLN C 1 296 ? 13.389  30.557  1.050   1.00 130.18 ? 292  GLN C CD  1 
ATOM   9507  O OE1 . GLN C 1 296 ? 12.762  29.508  1.205   1.00 130.70 ? 292  GLN C OE1 1 
ATOM   9508  N NE2 . GLN C 1 296 ? 13.329  31.266  -0.071  1.00 133.26 ? 292  GLN C NE2 1 
ATOM   9509  N N   . GLY C 1 297 ? 11.787  30.697  6.341   1.00 119.42 ? 293  GLY C N   1 
ATOM   9510  C CA  . GLY C 1 297 ? 11.138  29.874  7.359   1.00 119.03 ? 293  GLY C CA  1 
ATOM   9511  C C   . GLY C 1 297 ? 9.711   30.292  7.657   1.00 120.87 ? 293  GLY C C   1 
ATOM   9512  O O   . GLY C 1 297 ? 9.022   29.658  8.454   1.00 121.51 ? 293  GLY C O   1 
ATOM   9513  N N   . VAL C 1 298 ? 9.276   31.374  7.020   1.00 122.50 ? 294  VAL C N   1 
ATOM   9514  C CA  . VAL C 1 298 ? 7.900   31.842  7.128   1.00 125.47 ? 294  VAL C CA  1 
ATOM   9515  C C   . VAL C 1 298 ? 7.229   31.711  5.767   1.00 129.26 ? 294  VAL C C   1 
ATOM   9516  O O   . VAL C 1 298 ? 6.134   31.162  5.658   1.00 132.27 ? 294  VAL C O   1 
ATOM   9517  C CB  . VAL C 1 298 ? 7.824   33.319  7.602   1.00 125.44 ? 294  VAL C CB  1 
ATOM   9518  C CG1 . VAL C 1 298 ? 6.376   33.786  7.681   1.00 129.63 ? 294  VAL C CG1 1 
ATOM   9519  C CG2 . VAL C 1 298 ? 8.513   33.497  8.948   1.00 121.97 ? 294  VAL C CG2 1 
ATOM   9520  N N   . PHE C 1 299 ? 7.914   32.205  4.737   1.00 129.52 ? 295  PHE C N   1 
ATOM   9521  C CA  . PHE C 1 299 ? 7.374   32.295  3.381   1.00 133.37 ? 295  PHE C CA  1 
ATOM   9522  C C   . PHE C 1 299 ? 7.502   31.000  2.571   1.00 134.60 ? 295  PHE C C   1 
ATOM   9523  O O   . PHE C 1 299 ? 6.956   30.902  1.467   1.00 138.15 ? 295  PHE C O   1 
ATOM   9524  C CB  . PHE C 1 299 ? 8.046   33.453  2.632   1.00 134.07 ? 295  PHE C CB  1 
ATOM   9525  C CG  . PHE C 1 299 ? 7.632   34.815  3.117   1.00 135.23 ? 295  PHE C CG  1 
ATOM   9526  C CD1 . PHE C 1 299 ? 6.616   35.514  2.475   1.00 139.90 ? 295  PHE C CD1 1 
ATOM   9527  C CD2 . PHE C 1 299 ? 8.262   35.405  4.210   1.00 132.33 ? 295  PHE C CD2 1 
ATOM   9528  C CE1 . PHE C 1 299 ? 6.228   36.776  2.917   1.00 142.11 ? 295  PHE C CE1 1 
ATOM   9529  C CE2 . PHE C 1 299 ? 7.879   36.666  4.660   1.00 134.24 ? 295  PHE C CE2 1 
ATOM   9530  C CZ  . PHE C 1 299 ? 6.860   37.352  4.011   1.00 139.36 ? 295  PHE C CZ  1 
ATOM   9531  N N   . PHE C 1 300 ? 8.220   30.020  3.121   1.00 132.24 ? 296  PHE C N   1 
ATOM   9532  C CA  . PHE C 1 300 ? 8.421   28.717  2.476   1.00 134.06 ? 296  PHE C CA  1 
ATOM   9533  C C   . PHE C 1 300 ? 7.088   28.040  2.161   1.00 137.96 ? 296  PHE C C   1 
ATOM   9534  O O   . PHE C 1 300 ? 6.195   27.993  3.011   1.00 138.36 ? 296  PHE C O   1 
ATOM   9535  C CB  . PHE C 1 300 ? 9.284   27.812  3.363   1.00 131.66 ? 296  PHE C CB  1 
ATOM   9536  C CG  . PHE C 1 300 ? 9.648   26.498  2.728   1.00 134.32 ? 296  PHE C CG  1 
ATOM   9537  C CD1 . PHE C 1 300 ? 10.596  26.438  1.711   1.00 135.52 ? 296  PHE C CD1 1 
ATOM   9538  C CD2 . PHE C 1 300 ? 9.051   25.317  3.158   1.00 136.52 ? 296  PHE C CD2 1 
ATOM   9539  C CE1 . PHE C 1 300 ? 10.935  25.224  1.123   1.00 138.98 ? 296  PHE C CE1 1 
ATOM   9540  C CE2 . PHE C 1 300 ? 9.384   24.096  2.578   1.00 140.06 ? 296  PHE C CE2 1 
ATOM   9541  C CZ  . PHE C 1 300 ? 10.329  24.050  1.559   1.00 141.32 ? 296  PHE C CZ  1 
ATOM   9542  N N   . ASN C 1 301 ? 6.972   27.523  0.936   1.00 141.35 ? 297  ASN C N   1 
ATOM   9543  C CA  . ASN C 1 301 ? 5.727   26.938  0.419   1.00 145.80 ? 297  ASN C CA  1 
ATOM   9544  C C   . ASN C 1 301 ? 4.521   27.872  0.606   1.00 147.21 ? 297  ASN C C   1 
ATOM   9545  O O   . ASN C 1 301 ? 3.470   27.464  1.111   1.00 149.51 ? 297  ASN C O   1 
ATOM   9546  C CB  . ASN C 1 301 ? 5.473   25.544  1.024   1.00 147.28 ? 297  ASN C CB  1 
ATOM   9547  C CG  . ASN C 1 301 ? 4.393   24.760  0.284   1.00 152.73 ? 297  ASN C CG  1 
ATOM   9548  O OD1 . ASN C 1 301 ? 4.033   25.081  -0.850  1.00 155.27 ? 297  ASN C OD1 1 
ATOM   9549  N ND2 . ASN C 1 301 ? 3.872   23.725  0.931   1.00 154.85 ? 297  ASN C ND2 1 
ATOM   9550  N N   . GLN C 1 302 ? 4.704   29.132  0.203   1.00 146.56 ? 298  GLN C N   1 
ATOM   9551  C CA  . GLN C 1 302 ? 3.666   30.175  0.259   1.00 148.76 ? 298  GLN C CA  1 
ATOM   9552  C C   . GLN C 1 302 ? 3.230   30.555  1.680   1.00 147.25 ? 298  GLN C C   1 
ATOM   9553  O O   . GLN C 1 302 ? 2.295   31.338  1.859   1.00 149.97 ? 298  GLN C O   1 
ATOM   9554  C CB  . GLN C 1 302 ? 2.449   29.796  -0.601  1.00 154.16 ? 298  GLN C CB  1 
ATOM   9555  C CG  . GLN C 1 302 ? 2.716   29.793  -2.099  1.00 156.46 ? 298  GLN C CG  1 
ATOM   9556  C CD  . GLN C 1 302 ? 3.610   28.650  -2.546  1.00 155.37 ? 298  GLN C CD  1 
ATOM   9557  O OE1 . GLN C 1 302 ? 4.758   28.864  -2.930  1.00 153.35 ? 298  GLN C OE1 1 
ATOM   9558  N NE2 . GLN C 1 302 ? 3.092   27.428  -2.480  1.00 157.46 ? 298  GLN C NE2 1 
ATOM   9559  N N   . GLY C 1 303 ? 3.915   30.001  2.679   1.00 143.55 ? 299  GLY C N   1 
ATOM   9560  C CA  . GLY C 1 303 ? 3.631   30.294  4.084   1.00 142.07 ? 299  GLY C CA  1 
ATOM   9561  C C   . GLY C 1 303 ? 2.732   29.285  4.776   1.00 144.43 ? 299  GLY C C   1 
ATOM   9562  O O   . GLY C 1 303 ? 2.702   29.211  6.007   1.00 142.99 ? 299  GLY C O   1 
ATOM   9563  N N   . GLN C 1 304 ? 2.005   28.508  3.980   1.00 148.59 ? 300  GLN C N   1 
ATOM   9564  C CA  . GLN C 1 304 ? 1.022   27.556  4.491   1.00 152.34 ? 300  GLN C CA  1 
ATOM   9565  C C   . GLN C 1 304 ? 1.632   26.186  4.798   1.00 151.58 ? 300  GLN C C   1 
ATOM   9566  O O   . GLN C 1 304 ? 1.528   25.247  4.003   1.00 154.50 ? 300  GLN C O   1 
ATOM   9567  C CB  . GLN C 1 304 ? -0.172  27.446  3.527   1.00 158.24 ? 300  GLN C CB  1 
ATOM   9568  C CG  . GLN C 1 304 ? 0.201   27.438  2.039   1.00 158.71 ? 300  GLN C CG  1 
ATOM   9569  C CD  . GLN C 1 304 ? -0.976  27.720  1.121   1.00 164.11 ? 300  GLN C CD  1 
ATOM   9570  O OE1 . GLN C 1 304 ? -1.885  28.478  1.463   1.00 166.68 ? 300  GLN C OE1 1 
ATOM   9571  N NE2 . GLN C 1 304 ? -0.959  27.114  -0.059  1.00 166.45 ? 300  GLN C NE2 1 
ATOM   9572  N N   . CYS C 1 305 ? 2.282   26.090  5.957   1.00 148.18 ? 301  CYS C N   1 
ATOM   9573  C CA  . CYS C 1 305 ? 2.814   24.819  6.459   1.00 148.24 ? 301  CYS C CA  1 
ATOM   9574  C C   . CYS C 1 305 ? 2.853   24.759  7.987   1.00 146.79 ? 301  CYS C C   1 
ATOM   9575  O O   . CYS C 1 305 ? 3.262   25.716  8.650   1.00 142.93 ? 301  CYS C O   1 
ATOM   9576  C CB  . CYS C 1 305 ? 4.194   24.510  5.865   1.00 145.22 ? 301  CYS C CB  1 
ATOM   9577  S SG  . CYS C 1 305 ? 5.486   25.709  6.223   1.00 138.65 ? 301  CYS C SG  1 
ATOM   9578  N N   . CYS C 1 306 ? 2.420   23.623  8.529   1.00 150.55 ? 302  CYS C N   1 
ATOM   9579  C CA  . CYS C 1 306 ? 2.367   23.400  9.974   1.00 150.44 ? 302  CYS C CA  1 
ATOM   9580  C C   . CYS C 1 306 ? 3.759   23.290  10.595  1.00 145.45 ? 302  CYS C C   1 
ATOM   9581  O O   . CYS C 1 306 ? 3.933   23.538  11.790  1.00 143.62 ? 302  CYS C O   1 
ATOM   9582  C CB  . CYS C 1 306 ? 1.551   22.143  10.288  1.00 156.88 ? 302  CYS C CB  1 
ATOM   9583  S SG  . CYS C 1 306 ? 2.154   20.634  9.490   1.00 159.77 ? 302  CYS C SG  1 
ATOM   9584  N N   . THR C 1 307 ? 4.740   22.922  9.774   1.00 143.84 ? 303  THR C N   1 
ATOM   9585  C CA  . THR C 1 307 ? 6.122   22.744  10.221  1.00 139.92 ? 303  THR C CA  1 
ATOM   9586  C C   . THR C 1 307 ? 6.838   24.068  10.508  1.00 134.06 ? 303  THR C C   1 
ATOM   9587  O O   . THR C 1 307 ? 7.698   24.131  11.389  1.00 130.92 ? 303  THR C O   1 
ATOM   9588  C CB  . THR C 1 307 ? 6.949   21.918  9.206   1.00 141.21 ? 303  THR C CB  1 
ATOM   9589  O OG1 . THR C 1 307 ? 6.802   22.474  7.892   1.00 141.32 ? 303  THR C OG1 1 
ATOM   9590  C CG2 . THR C 1 307 ? 6.497   20.458  9.193   1.00 147.41 ? 303  THR C CG2 1 
ATOM   9591  N N   . ALA C 1 308 ? 6.479   25.116  9.768   1.00 133.20 ? 304  ALA C N   1 
ATOM   9592  C CA  . ALA C 1 308 ? 7.103   26.433  9.925   1.00 128.70 ? 304  ALA C CA  1 
ATOM   9593  C C   . ALA C 1 308 ? 6.346   27.330  10.909  1.00 128.44 ? 304  ALA C C   1 
ATOM   9594  O O   . ALA C 1 308 ? 5.378   26.897  11.538  1.00 131.64 ? 304  ALA C O   1 
ATOM   9595  C CB  . ALA C 1 308 ? 7.247   27.115  8.574   1.00 128.72 ? 304  ALA C CB  1 
ATOM   9596  N N   . GLY C 1 309 ? 6.801   28.576  11.039  1.00 125.35 ? 305  GLY C N   1 
ATOM   9597  C CA  . GLY C 1 309 ? 6.187   29.538  11.949  1.00 125.51 ? 305  GLY C CA  1 
ATOM   9598  C C   . GLY C 1 309 ? 6.468   30.985  11.595  1.00 124.06 ? 305  GLY C C   1 
ATOM   9599  O O   . GLY C 1 309 ? 7.612   31.363  11.332  1.00 120.77 ? 305  GLY C O   1 
ATOM   9600  N N   . SER C 1 310 ? 5.410   31.792  11.604  1.00 127.30 ? 306  SER C N   1 
ATOM   9601  C CA  . SER C 1 310 ? 5.486   33.208  11.249  1.00 127.55 ? 306  SER C CA  1 
ATOM   9602  C C   . SER C 1 310 ? 6.012   34.075  12.391  1.00 125.32 ? 306  SER C C   1 
ATOM   9603  O O   . SER C 1 310 ? 6.542   35.164  12.159  1.00 124.78 ? 306  SER C O   1 
ATOM   9604  C CB  . SER C 1 310 ? 4.112   33.715  10.801  1.00 133.17 ? 306  SER C CB  1 
ATOM   9605  O OG  . SER C 1 310 ? 3.159   33.620  11.846  1.00 136.21 ? 306  SER C OG  1 
ATOM   9606  N N   . ARG C 1 311 ? 5.860   33.581  13.616  1.00 124.49 ? 307  ARG C N   1 
ATOM   9607  C CA  . ARG C 1 311 ? 6.213   34.323  14.820  1.00 122.99 ? 307  ARG C CA  1 
ATOM   9608  C C   . ARG C 1 311 ? 7.731   34.439  14.985  1.00 117.66 ? 307  ARG C C   1 
ATOM   9609  O O   . ARG C 1 311 ? 8.435   33.428  15.004  1.00 114.81 ? 307  ARG C O   1 
ATOM   9610  C CB  . ARG C 1 311 ? 5.585   33.642  16.035  1.00 124.51 ? 307  ARG C CB  1 
ATOM   9611  C CG  . ARG C 1 311 ? 5.392   34.546  17.223  1.00 125.93 ? 307  ARG C CG  1 
ATOM   9612  C CD  . ARG C 1 311 ? 4.421   33.940  18.213  1.00 129.69 ? 307  ARG C CD  1 
ATOM   9613  N NE  . ARG C 1 311 ? 4.145   34.870  19.303  1.00 132.22 ? 307  ARG C NE  1 
ATOM   9614  C CZ  . ARG C 1 311 ? 3.293   34.641  20.299  1.00 136.51 ? 307  ARG C CZ  1 
ATOM   9615  N NH1 . ARG C 1 311 ? 2.615   33.504  20.358  1.00 138.95 ? 307  ARG C NH1 1 
ATOM   9616  N NH2 . ARG C 1 311 ? 3.119   35.559  21.239  1.00 139.07 ? 307  ARG C NH2 1 
ATOM   9617  N N   . ILE C 1 312 ? 8.224   35.673  15.095  1.00 117.01 ? 308  ILE C N   1 
ATOM   9618  C CA  . ILE C 1 312 ? 9.664   35.941  15.211  1.00 112.70 ? 308  ILE C CA  1 
ATOM   9619  C C   . ILE C 1 312 ? 9.972   36.963  16.314  1.00 112.46 ? 308  ILE C C   1 
ATOM   9620  O O   . ILE C 1 312 ? 9.474   38.090  16.283  1.00 115.92 ? 308  ILE C O   1 
ATOM   9621  C CB  . ILE C 1 312 ? 10.273  36.413  13.856  1.00 112.70 ? 308  ILE C CB  1 
ATOM   9622  C CG1 . ILE C 1 312 ? 10.207  35.292  12.811  1.00 112.43 ? 308  ILE C CG1 1 
ATOM   9623  C CG2 . ILE C 1 312 ? 11.716  36.889  14.034  1.00 109.71 ? 308  ILE C CG2 1 
ATOM   9624  C CD1 . ILE C 1 312 ? 10.482  35.740  11.387  1.00 113.76 ? 308  ILE C CD1 1 
ATOM   9625  N N   . PHE C 1 313 ? 10.799  36.556  17.278  1.00 108.86 ? 309  PHE C N   1 
ATOM   9626  C CA  . PHE C 1 313 ? 11.231  37.421  18.380  1.00 108.32 ? 309  PHE C CA  1 
ATOM   9627  C C   . PHE C 1 313 ? 12.659  37.926  18.160  1.00 105.51 ? 309  PHE C C   1 
ATOM   9628  O O   . PHE C 1 313 ? 13.598  37.131  18.077  1.00 102.16 ? 309  PHE C O   1 
ATOM   9629  C CB  . PHE C 1 313 ? 11.156  36.672  19.715  1.00 107.01 ? 309  PHE C CB  1 
ATOM   9630  C CG  . PHE C 1 313 ? 9.767   36.243  20.106  1.00 110.53 ? 309  PHE C CG  1 
ATOM   9631  C CD1 . PHE C 1 313 ? 9.314   34.959  19.817  1.00 110.46 ? 309  PHE C CD1 1 
ATOM   9632  C CD2 . PHE C 1 313 ? 8.918   37.115  20.781  1.00 114.60 ? 309  PHE C CD2 1 
ATOM   9633  C CE1 . PHE C 1 313 ? 8.031   34.553  20.184  1.00 114.45 ? 309  PHE C CE1 1 
ATOM   9634  C CE2 . PHE C 1 313 ? 7.634   36.718  21.152  1.00 118.71 ? 309  PHE C CE2 1 
ATOM   9635  C CZ  . PHE C 1 313 ? 7.191   35.434  20.853  1.00 118.56 ? 309  PHE C CZ  1 
ATOM   9636  N N   . VAL C 1 314 ? 12.819  39.245  18.074  1.00 107.65 ? 310  VAL C N   1 
ATOM   9637  C CA  . VAL C 1 314 ? 14.130  39.856  17.829  1.00 106.16 ? 310  VAL C CA  1 
ATOM   9638  C C   . VAL C 1 314 ? 14.567  40.709  19.018  1.00 106.58 ? 310  VAL C C   1 
ATOM   9639  O O   . VAL C 1 314 ? 13.750  41.402  19.626  1.00 109.99 ? 310  VAL C O   1 
ATOM   9640  C CB  . VAL C 1 314 ? 14.135  40.714  16.537  1.00 109.31 ? 310  VAL C CB  1 
ATOM   9641  C CG1 . VAL C 1 314 ? 15.542  41.200  16.211  1.00 108.33 ? 310  VAL C CG1 1 
ATOM   9642  C CG2 . VAL C 1 314 ? 13.580  39.923  15.364  1.00 109.52 ? 310  VAL C CG2 1 
ATOM   9643  N N   . GLU C 1 315 ? 15.857  40.639  19.347  1.00 103.66 ? 311  GLU C N   1 
ATOM   9644  C CA  . GLU C 1 315 ? 16.434  41.408  20.449  1.00 103.98 ? 311  GLU C CA  1 
ATOM   9645  C C   . GLU C 1 315 ? 16.384  42.907  20.149  1.00 108.85 ? 311  GLU C C   1 
ATOM   9646  O O   . GLU C 1 315 ? 16.482  43.316  18.989  1.00 110.94 ? 311  GLU C O   1 
ATOM   9647  C CB  . GLU C 1 315 ? 17.874  40.955  20.722  1.00 100.21 ? 311  GLU C CB  1 
ATOM   9648  C CG  . GLU C 1 315 ? 18.386  41.284  22.124  1.00 99.35  ? 311  GLU C CG  1 
ATOM   9649  C CD  . GLU C 1 315 ? 19.691  40.585  22.467  1.00 95.42  ? 311  GLU C CD  1 
ATOM   9650  O OE1 . GLU C 1 315 ? 19.865  39.410  22.085  1.00 92.93  ? 311  GLU C OE1 1 
ATOM   9651  O OE2 . GLU C 1 315 ? 20.543  41.208  23.132  1.00 95.43  ? 311  GLU C OE2 1 
ATOM   9652  N N   . GLU C 1 316 ? 16.228  43.712  21.199  1.00 111.33 ? 312  GLU C N   1 
ATOM   9653  C CA  . GLU C 1 316 ? 16.069  45.168  21.079  1.00 117.24 ? 312  GLU C CA  1 
ATOM   9654  C C   . GLU C 1 316 ? 17.217  45.861  20.347  1.00 118.29 ? 312  GLU C C   1 
ATOM   9655  O O   . GLU C 1 316 ? 17.004  46.847  19.640  1.00 123.52 ? 312  GLU C O   1 
ATOM   9656  C CB  . GLU C 1 316 ? 15.891  45.801  22.462  1.00 119.69 ? 312  GLU C CB  1 
ATOM   9657  C CG  . GLU C 1 316 ? 14.604  45.406  23.176  1.00 121.35 ? 312  GLU C CG  1 
ATOM   9658  C CD  . GLU C 1 316 ? 14.447  46.061  24.538  1.00 124.80 ? 312  GLU C CD  1 
ATOM   9659  O OE1 . GLU C 1 316 ? 15.468  46.436  25.153  1.00 123.86 ? 312  GLU C OE1 1 
ATOM   9660  O OE2 . GLU C 1 316 ? 13.293  46.193  24.998  1.00 128.92 ? 312  GLU C OE2 1 
ATOM   9661  N N   . SER C 1 317 ? 18.425  45.334  20.525  1.00 114.08 ? 313  SER C N   1 
ATOM   9662  C CA  . SER C 1 317 ? 19.642  45.929  19.974  1.00 115.45 ? 313  SER C CA  1 
ATOM   9663  C C   . SER C 1 317 ? 19.709  45.874  18.446  1.00 116.88 ? 313  SER C C   1 
ATOM   9664  O O   . SER C 1 317 ? 20.249  46.782  17.812  1.00 121.08 ? 313  SER C O   1 
ATOM   9665  C CB  . SER C 1 317 ? 20.874  45.248  20.575  1.00 110.87 ? 313  SER C CB  1 
ATOM   9666  O OG  . SER C 1 317 ? 20.788  45.193  21.989  1.00 109.39 ? 313  SER C OG  1 
ATOM   9667  N N   . ILE C 1 318 ? 19.159  44.808  17.867  1.00 114.00 ? 314  ILE C N   1 
ATOM   9668  C CA  . ILE C 1 318 ? 19.214  44.582  16.418  1.00 115.09 ? 314  ILE C CA  1 
ATOM   9669  C C   . ILE C 1 318 ? 17.833  44.630  15.755  1.00 117.71 ? 314  ILE C C   1 
ATOM   9670  O O   . ILE C 1 318 ? 17.684  44.267  14.584  1.00 118.16 ? 314  ILE C O   1 
ATOM   9671  C CB  . ILE C 1 318 ? 19.921  43.243  16.072  1.00 110.32 ? 314  ILE C CB  1 
ATOM   9672  C CG1 . ILE C 1 318 ? 19.252  42.066  16.797  1.00 106.12 ? 314  ILE C CG1 1 
ATOM   9673  C CG2 . ILE C 1 318 ? 21.415  43.327  16.399  1.00 109.39 ? 314  ILE C CG2 1 
ATOM   9674  C CD1 . ILE C 1 318 ? 19.475  40.714  16.138  1.00 103.16 ? 314  ILE C CD1 1 
ATOM   9675  N N   . TYR C 1 319 ? 16.836  45.083  16.513  1.00 119.98 ? 315  TYR C N   1 
ATOM   9676  C CA  . TYR C 1 319 ? 15.451  45.167  16.046  1.00 123.29 ? 315  TYR C CA  1 
ATOM   9677  C C   . TYR C 1 319 ? 15.286  46.160  14.899  1.00 129.33 ? 315  TYR C C   1 
ATOM   9678  O O   . TYR C 1 319 ? 14.546  45.901  13.949  1.00 130.76 ? 315  TYR C O   1 
ATOM   9679  C CB  . TYR C 1 319 ? 14.527  45.548  17.206  1.00 125.50 ? 315  TYR C CB  1 
ATOM   9680  C CG  . TYR C 1 319 ? 13.050  45.451  16.891  1.00 128.82 ? 315  TYR C CG  1 
ATOM   9681  C CD1 . TYR C 1 319 ? 12.379  44.231  16.976  1.00 125.50 ? 315  TYR C CD1 1 
ATOM   9682  C CD2 . TYR C 1 319 ? 12.320  46.580  16.520  1.00 136.11 ? 315  TYR C CD2 1 
ATOM   9683  C CE1 . TYR C 1 319 ? 11.022  44.136  16.693  1.00 129.09 ? 315  TYR C CE1 1 
ATOM   9684  C CE2 . TYR C 1 319 ? 10.960  46.495  16.233  1.00 139.84 ? 315  TYR C CE2 1 
ATOM   9685  C CZ  . TYR C 1 319 ? 10.318  45.269  16.322  1.00 136.20 ? 315  TYR C CZ  1 
ATOM   9686  O OH  . TYR C 1 319 ? 8.974   45.173  16.042  1.00 140.38 ? 315  TYR C OH  1 
ATOM   9687  N N   . GLU C 1 320 ? 15.977  47.293  15.003  1.00 133.41 ? 316  GLU C N   1 
ATOM   9688  C CA  . GLU C 1 320 ? 15.951  48.332  13.977  1.00 140.34 ? 316  GLU C CA  1 
ATOM   9689  C C   . GLU C 1 320 ? 16.513  47.814  12.654  1.00 139.15 ? 316  GLU C C   1 
ATOM   9690  O O   . GLU C 1 320 ? 15.897  47.990  11.600  1.00 142.79 ? 316  GLU C O   1 
ATOM   9691  C CB  . GLU C 1 320 ? 16.725  49.572  14.454  1.00 145.02 ? 316  GLU C CB  1 
ATOM   9692  C CG  . GLU C 1 320 ? 16.983  50.645  13.393  1.00 152.52 ? 316  GLU C CG  1 
ATOM   9693  C CD  . GLU C 1 320 ? 15.737  51.421  13.010  1.00 159.82 ? 316  GLU C CD  1 
ATOM   9694  O OE1 . GLU C 1 320 ? 14.898  50.881  12.258  1.00 159.35 ? 316  GLU C OE1 1 
ATOM   9695  O OE2 . GLU C 1 320 ? 15.605  52.580  13.452  1.00 166.68 ? 316  GLU C OE2 1 
ATOM   9696  N N   . GLU C 1 321 ? 17.674  47.166  12.726  1.00 134.61 ? 317  GLU C N   1 
ATOM   9697  C CA  . GLU C 1 321 ? 18.348  46.646  11.540  1.00 134.03 ? 317  GLU C CA  1 
ATOM   9698  C C   . GLU C 1 321 ? 17.624  45.454  10.930  1.00 130.80 ? 317  GLU C C   1 
ATOM   9699  O O   . GLU C 1 321 ? 17.643  45.272  9.713   1.00 132.61 ? 317  GLU C O   1 
ATOM   9700  C CB  . GLU C 1 321 ? 19.802  46.280  11.855  1.00 130.82 ? 317  GLU C CB  1 
ATOM   9701  C CG  . GLU C 1 321 ? 20.719  47.481  12.085  1.00 135.48 ? 317  GLU C CG  1 
ATOM   9702  C CD  . GLU C 1 321 ? 20.789  48.425  10.888  1.00 142.79 ? 317  GLU C CD  1 
ATOM   9703  O OE1 . GLU C 1 321 ? 20.937  47.943  9.743   1.00 143.13 ? 317  GLU C OE1 1 
ATOM   9704  O OE2 . GLU C 1 321 ? 20.702  49.653  11.096  1.00 148.69 ? 317  GLU C OE2 1 
ATOM   9705  N N   . PHE C 1 322 ? 16.982  44.653  11.779  1.00 87.09  ? 318  PHE C N   1 
ATOM   9706  C CA  . PHE C 1 322 ? 16.277  43.451  11.333  1.00 84.16  ? 318  PHE C CA  1 
ATOM   9707  C C   . PHE C 1 322 ? 15.097  43.767  10.411  1.00 85.33  ? 318  PHE C C   1 
ATOM   9708  O O   . PHE C 1 322 ? 14.921  43.116  9.378   1.00 84.26  ? 318  PHE C O   1 
ATOM   9709  C CB  . PHE C 1 322 ? 15.811  42.617  12.530  1.00 81.39  ? 318  PHE C CB  1 
ATOM   9710  C CG  . PHE C 1 322 ? 15.425  41.212  12.170  1.00 78.36  ? 318  PHE C CG  1 
ATOM   9711  C CD1 . PHE C 1 322 ? 14.107  40.898  11.852  1.00 77.78  ? 318  PHE C CD1 1 
ATOM   9712  C CD2 . PHE C 1 322 ? 16.382  40.202  12.142  1.00 76.58  ? 318  PHE C CD2 1 
ATOM   9713  C CE1 . PHE C 1 322 ? 13.747  39.594  11.513  1.00 75.41  ? 318  PHE C CE1 1 
ATOM   9714  C CE2 . PHE C 1 322 ? 16.032  38.896  11.806  1.00 74.08  ? 318  PHE C CE2 1 
ATOM   9715  C CZ  . PHE C 1 322 ? 14.713  38.592  11.490  1.00 73.46  ? 318  PHE C CZ  1 
ATOM   9716  N N   . VAL C 1 323 ? 14.300  44.763  10.790  1.00 87.90  ? 319  VAL C N   1 
ATOM   9717  C CA  . VAL C 1 323 ? 13.139  45.175  9.999   1.00 89.79  ? 319  VAL C CA  1 
ATOM   9718  C C   . VAL C 1 323 ? 13.576  45.641  8.606   1.00 92.43  ? 319  VAL C C   1 
ATOM   9719  O O   . VAL C 1 323 ? 13.003  45.216  7.599   1.00 92.10  ? 319  VAL C O   1 
ATOM   9720  C CB  . VAL C 1 323 ? 12.303  46.272  10.720  1.00 92.64  ? 319  VAL C CB  1 
ATOM   9721  C CG1 . VAL C 1 323 ? 11.097  46.677  9.882   1.00 94.67  ? 319  VAL C CG1 1 
ATOM   9722  C CG2 . VAL C 1 323 ? 11.841  45.783  12.086  1.00 90.72  ? 319  VAL C CG2 1 
ATOM   9723  N N   . ARG C 1 324 ? 14.603  46.492  8.563   1.00 95.49  ? 320  ARG C N   1 
ATOM   9724  C CA  . ARG C 1 324 ? 15.164  47.015  7.311   1.00 98.81  ? 320  ARG C CA  1 
ATOM   9725  C C   . ARG C 1 324 ? 15.612  45.913  6.351   1.00 96.79  ? 320  ARG C C   1 
ATOM   9726  O O   . ARG C 1 324 ? 15.417  46.022  5.139   1.00 98.66  ? 320  ARG C O   1 
ATOM   9727  C CB  . ARG C 1 324 ? 16.342  47.947  7.599   1.00 102.07 ? 320  ARG C CB  1 
ATOM   9728  C CG  . ARG C 1 324 ? 15.964  49.375  7.931   1.00 106.60 ? 320  ARG C CG  1 
ATOM   9729  C CD  . ARG C 1 324 ? 17.183  50.127  8.434   1.00 109.78 ? 320  ARG C CD  1 
ATOM   9730  N NE  . ARG C 1 324 ? 17.069  51.572  8.247   1.00 115.97 ? 320  ARG C NE  1 
ATOM   9731  C CZ  . ARG C 1 324 ? 18.064  52.438  8.433   1.00 119.99 ? 320  ARG C CZ  1 
ATOM   9732  N NH1 . ARG C 1 324 ? 19.264  52.017  8.817   1.00 118.88 ? 320  ARG C NH1 1 
ATOM   9733  N NH2 . ARG C 1 324 ? 17.863  53.734  8.235   1.00 125.36 ? 320  ARG C NH2 1 
ATOM   9734  N N   . ARG C 1 325 ? 16.220  44.863  6.901   1.00 93.47  ? 321  ARG C N   1 
ATOM   9735  C CA  . ARG C 1 325 ? 16.681  43.725  6.108   1.00 91.68  ? 321  ARG C CA  1 
ATOM   9736  C C   . ARG C 1 325 ? 15.501  42.915  5.582   1.00 89.64  ? 321  ARG C C   1 
ATOM   9737  O O   . ARG C 1 325 ? 15.514  42.460  4.435   1.00 90.02  ? 321  ARG C O   1 
ATOM   9738  C CB  . ARG C 1 325 ? 17.607  42.821  6.931   1.00 88.90  ? 321  ARG C CB  1 
ATOM   9739  C CG  . ARG C 1 325 ? 18.950  43.431  7.317   1.00 91.09  ? 321  ARG C CG  1 
ATOM   9740  C CD  . ARG C 1 325 ? 19.984  43.311  6.208   1.00 93.32  ? 321  ARG C CD  1 
ATOM   9741  N NE  . ARG C 1 325 ? 21.306  43.740  6.662   1.00 95.52  ? 321  ARG C NE  1 
ATOM   9742  C CZ  . ARG C 1 325 ? 22.271  42.920  7.076   1.00 94.13  ? 321  ARG C CZ  1 
ATOM   9743  N NH1 . ARG C 1 325 ? 22.083  41.606  7.094   1.00 90.74  ? 321  ARG C NH1 1 
ATOM   9744  N NH2 . ARG C 1 325 ? 23.434  43.418  7.472   1.00 96.56  ? 321  ARG C NH2 1 
ATOM   9745  N N   . SER C 1 326 ? 14.484  42.751  6.428   1.00 87.95  ? 322  SER C N   1 
ATOM   9746  C CA  . SER C 1 326 ? 13.301  41.954  6.100   1.00 86.18  ? 322  SER C CA  1 
ATOM   9747  C C   . SER C 1 326 ? 12.454  42.586  4.996   1.00 88.97  ? 322  SER C C   1 
ATOM   9748  O O   . SER C 1 326 ? 12.042  41.903  4.054   1.00 88.39  ? 322  SER C O   1 
ATOM   9749  C CB  . SER C 1 326 ? 12.449  41.719  7.351   1.00 84.31  ? 322  SER C CB  1 
ATOM   9750  O OG  . SER C 1 326 ? 13.167  40.977  8.320   1.00 82.00  ? 322  SER C OG  1 
ATOM   9751  N N   . VAL C 1 327 ? 12.207  43.890  5.111   1.00 92.37  ? 323  VAL C N   1 
ATOM   9752  C CA  . VAL C 1 327 ? 11.390  44.605  4.133   1.00 95.75  ? 323  VAL C CA  1 
ATOM   9753  C C   . VAL C 1 327 ? 12.040  44.615  2.746   1.00 97.91  ? 323  VAL C C   1 
ATOM   9754  O O   . VAL C 1 327 ? 11.345  44.659  1.730   1.00 99.63  ? 323  VAL C O   1 
ATOM   9755  C CB  . VAL C 1 327 ? 11.030  46.047  4.595   1.00 99.55  ? 323  VAL C CB  1 
ATOM   9756  C CG1 . VAL C 1 327 ? 10.208  46.006  5.877   1.00 97.97  ? 323  VAL C CG1 1 
ATOM   9757  C CG2 . VAL C 1 327 ? 12.277  46.909  4.777   1.00 102.14 ? 323  VAL C CG2 1 
ATOM   9758  N N   . GLU C 1 328 ? 13.369  44.559  2.717   1.00 98.21  ? 324  GLU C N   1 
ATOM   9759  C CA  . GLU C 1 328 ? 14.117  44.531  1.462   1.00 100.68 ? 324  GLU C CA  1 
ATOM   9760  C C   . GLU C 1 328 ? 14.102  43.151  0.807   1.00 97.89  ? 324  GLU C C   1 
ATOM   9761  O O   . GLU C 1 328 ? 14.377  43.024  -0.389  1.00 100.03 ? 324  GLU C O   1 
ATOM   9762  C CB  . GLU C 1 328 ? 15.554  45.013  1.673   1.00 102.61 ? 324  GLU C CB  1 
ATOM   9763  C CG  . GLU C 1 328 ? 15.696  46.527  1.710   1.00 107.54 ? 324  GLU C CG  1 
ATOM   9764  C CD  . GLU C 1 328 ? 17.110  46.973  2.027   1.00 109.72 ? 324  GLU C CD  1 
ATOM   9765  O OE1 . GLU C 1 328 ? 17.627  46.612  3.106   1.00 107.08 ? 324  GLU C OE1 1 
ATOM   9766  O OE2 . GLU C 1 328 ? 17.703  47.694  1.198   1.00 114.41 ? 324  GLU C OE2 1 
ATOM   9767  N N   . ARG C 1 329 ? 13.787  42.123  1.590   1.00 93.60  ? 325  ARG C N   1 
ATOM   9768  C CA  . ARG C 1 329 ? 13.630  40.774  1.051   1.00 91.20  ? 325  ARG C CA  1 
ATOM   9769  C C   . ARG C 1 329 ? 12.218  40.554  0.517   1.00 91.02  ? 325  ARG C C   1 
ATOM   9770  O O   . ARG C 1 329 ? 11.996  39.691  -0.337  1.00 90.47  ? 325  ARG C O   1 
ATOM   9771  C CB  . ARG C 1 329 ? 13.994  39.705  2.093   1.00 87.23  ? 325  ARG C CB  1 
ATOM   9772  C CG  . ARG C 1 329 ? 15.495  39.545  2.336   1.00 87.68  ? 325  ARG C CG  1 
ATOM   9773  C CD  . ARG C 1 329 ? 16.239  39.146  1.060   1.00 90.22  ? 325  ARG C CD  1 
ATOM   9774  N NE  . ARG C 1 329 ? 17.619  39.633  1.054   1.00 92.93  ? 325  ARG C NE  1 
ATOM   9775  C CZ  . ARG C 1 329 ? 18.345  39.847  -0.042  1.00 96.33  ? 325  ARG C CZ  1 
ATOM   9776  N NH1 . ARG C 1 329 ? 17.833  39.627  -1.247  1.00 97.90  ? 325  ARG C NH1 1 
ATOM   9777  N NH2 . ARG C 1 329 ? 19.589  40.291  0.068   1.00 98.63  ? 325  ARG C NH2 1 
ATOM   9778  N N   . ALA C 1 330 ? 11.272  41.345  1.020   1.00 91.84  ? 326  ALA C N   1 
ATOM   9779  C CA  . ALA C 1 330 ? 9.875   41.261  0.598   1.00 92.24  ? 326  ALA C CA  1 
ATOM   9780  C C   . ALA C 1 330 ? 9.598   42.099  -0.653  1.00 96.54  ? 326  ALA C C   1 
ATOM   9781  O O   . ALA C 1 330 ? 8.753   41.737  -1.478  1.00 97.10  ? 326  ALA C O   1 
ATOM   9782  C CB  . ALA C 1 330 ? 8.955   41.671  1.734   1.00 91.65  ? 326  ALA C CB  1 
ATOM   9783  N N   . LYS C 1 331 ? 10.314  43.215  -0.784  1.00 99.85  ? 327  LYS C N   1 
ATOM   9784  C CA  . LYS C 1 331 ? 10.221  44.082  -1.962  1.00 104.66 ? 327  LYS C CA  1 
ATOM   9785  C C   . LYS C 1 331 ? 11.019  43.532  -3.153  1.00 105.71 ? 327  LYS C C   1 
ATOM   9786  O O   . LYS C 1 331 ? 10.997  44.110  -4.244  1.00 109.99 ? 327  LYS C O   1 
ATOM   9787  C CB  . LYS C 1 331 ? 10.690  45.503  -1.623  1.00 108.48 ? 327  LYS C CB  1 
ATOM   9788  C CG  . LYS C 1 331 ? 9.702   46.324  -0.802  1.00 109.40 ? 327  LYS C CG  1 
ATOM   9789  C CD  . LYS C 1 331 ? 10.301  47.669  -0.411  1.00 113.20 ? 327  LYS C CD  1 
ATOM   9790  C CE  . LYS C 1 331 ? 9.304   48.540  0.340   1.00 114.86 ? 327  LYS C CE  1 
ATOM   9791  N NZ  . LYS C 1 331 ? 8.278   49.139  -0.558  1.00 118.80 ? 327  LYS C NZ  1 
ATOM   9792  N N   . ARG C 1 332 ? 11.716  42.415  -2.936  1.00 102.19 ? 328  ARG C N   1 
ATOM   9793  C CA  . ARG C 1 332 ? 12.555  41.796  -3.967  1.00 103.14 ? 328  ARG C CA  1 
ATOM   9794  C C   . ARG C 1 332 ? 12.217  40.326  -4.228  1.00 99.63  ? 328  ARG C C   1 
ATOM   9795  O O   . ARG C 1 332 ? 12.805  39.701  -5.115  1.00 100.59 ? 328  ARG C O   1 
ATOM   9796  C CB  . ARG C 1 332 ? 14.041  41.956  -3.622  1.00 103.70 ? 328  ARG C CB  1 
ATOM   9797  C CG  . ARG C 1 332 ? 14.569  43.371  -3.825  1.00 108.82 ? 328  ARG C CG  1 
ATOM   9798  C CD  . ARG C 1 332 ? 15.992  43.527  -3.311  1.00 109.54 ? 328  ARG C CD  1 
ATOM   9799  N NE  . ARG C 1 332 ? 16.420  44.926  -3.325  1.00 114.47 ? 328  ARG C NE  1 
ATOM   9800  C CZ  . ARG C 1 332 ? 17.092  45.508  -4.317  1.00 119.69 ? 328  ARG C CZ  1 
ATOM   9801  N NH1 . ARG C 1 332 ? 17.430  44.819  -5.400  1.00 120.85 ? 328  ARG C NH1 1 
ATOM   9802  N NH2 . ARG C 1 332 ? 17.429  46.787  -4.223  1.00 124.31 ? 328  ARG C NH2 1 
ATOM   9803  N N   . ARG C 1 333 ? 11.271  39.781  -3.463  1.00 96.00  ? 329  ARG C N   1 
ATOM   9804  C CA  . ARG C 1 333 ? 10.812  38.406  -3.662  1.00 93.02  ? 329  ARG C CA  1 
ATOM   9805  C C   . ARG C 1 333 ? 9.915   38.310  -4.894  1.00 95.10  ? 329  ARG C C   1 
ATOM   9806  O O   . ARG C 1 333 ? 8.907   39.012  -4.993  1.00 96.79  ? 329  ARG C O   1 
ATOM   9807  C CB  . ARG C 1 333 ? 10.074  37.887  -2.421  1.00 89.30  ? 329  ARG C CB  1 
ATOM   9808  C CG  . ARG C 1 333 ? 9.838   36.379  -2.422  1.00 86.65  ? 329  ARG C CG  1 
ATOM   9809  C CD  . ARG C 1 333 ? 9.418   35.877  -1.053  1.00 84.01  ? 329  ARG C CD  1 
ATOM   9810  N NE  . ARG C 1 333 ? 9.886   34.510  -0.807  1.00 82.27  ? 329  ARG C NE  1 
ATOM   9811  C CZ  . ARG C 1 333 ? 9.101   33.439  -0.690  1.00 80.57  ? 329  ARG C CZ  1 
ATOM   9812  N NH1 . ARG C 1 333 ? 7.781   33.553  -0.782  1.00 81.14  ? 329  ARG C NH1 1 
ATOM   9813  N NH2 . ARG C 1 333 ? 9.641   32.249  -0.466  1.00 78.40  ? 329  ARG C NH2 1 
ATOM   9814  N N   . VAL C 1 334 ? 10.291  37.440  -5.828  1.00 95.28  ? 330  VAL C N   1 
ATOM   9815  C CA  . VAL C 1 334 ? 9.527   37.243  -7.060  1.00 97.39  ? 330  VAL C CA  1 
ATOM   9816  C C   . VAL C 1 334 ? 8.298   36.373  -6.788  1.00 94.63  ? 330  VAL C C   1 
ATOM   9817  O O   . VAL C 1 334 ? 8.416   35.248  -6.290  1.00 91.36  ? 330  VAL C O   1 
ATOM   9818  C CB  . VAL C 1 334 ? 10.391  36.615  -8.189  1.00 99.33  ? 330  VAL C CB  1 
ATOM   9819  C CG1 . VAL C 1 334 ? 9.623   36.582  -9.506  1.00 102.47 ? 330  VAL C CG1 1 
ATOM   9820  C CG2 . VAL C 1 334 ? 11.696  37.381  -8.363  1.00 101.99 ? 330  VAL C CG2 1 
ATOM   9821  N N   . VAL C 1 335 ? 7.124   36.916  -7.106  1.00 96.26  ? 331  VAL C N   1 
ATOM   9822  C CA  . VAL C 1 335 ? 5.856   36.210  -6.923  1.00 94.48  ? 331  VAL C CA  1 
ATOM   9823  C C   . VAL C 1 335 ? 5.129   36.103  -8.261  1.00 97.49  ? 331  VAL C C   1 
ATOM   9824  O O   . VAL C 1 335 ? 4.824   37.117  -8.892  1.00 101.19 ? 331  VAL C O   1 
ATOM   9825  C CB  . VAL C 1 335 ? 4.935   36.918  -5.889  1.00 93.88  ? 331  VAL C CB  1 
ATOM   9826  C CG1 . VAL C 1 335 ? 3.761   36.019  -5.513  1.00 92.05  ? 331  VAL C CG1 1 
ATOM   9827  C CG2 . VAL C 1 335 ? 5.710   37.312  -4.639  1.00 91.78  ? 331  VAL C CG2 1 
ATOM   9828  N N   . GLY C 1 336 ? 4.858   34.874  -8.690  1.00 96.18  ? 332  GLY C N   1 
ATOM   9829  C CA  . GLY C 1 336 ? 4.156   34.644  -9.948  1.00 98.98  ? 332  GLY C CA  1 
ATOM   9830  C C   . GLY C 1 336 ? 3.909   33.182  -10.258 1.00 97.31  ? 332  GLY C C   1 
ATOM   9831  O O   . GLY C 1 336 ? 3.674   32.378  -9.355  1.00 93.96  ? 332  GLY C O   1 
ATOM   9832  N N   . SER C 1 337 ? 3.972   32.852  -11.546 1.00 100.07 ? 333  SER C N   1 
ATOM   9833  C CA  . SER C 1 337 ? 3.670   31.514  -12.057 1.00 99.54  ? 333  SER C CA  1 
ATOM   9834  C C   . SER C 1 337 ? 4.553   30.432  -11.431 1.00 96.28  ? 333  SER C C   1 
ATOM   9835  O O   . SER C 1 337 ? 5.758   30.628  -11.291 1.00 96.02  ? 333  SER C O   1 
ATOM   9836  C CB  . SER C 1 337 ? 3.815   31.497  -13.583 1.00 103.80 ? 333  SER C CB  1 
ATOM   9837  O OG  . SER C 1 337 ? 3.471   30.234  -14.123 1.00 103.83 ? 333  SER C OG  1 
ATOM   9838  N N   . PRO C 1 338 ? 3.952   29.285  -11.052 1.00 94.21  ? 334  PRO C N   1 
ATOM   9839  C CA  . PRO C 1 338 ? 4.708   28.178  -10.455 1.00 91.57  ? 334  PRO C CA  1 
ATOM   9840  C C   . PRO C 1 338 ? 5.640   27.489  -11.453 1.00 93.48  ? 334  PRO C C   1 
ATOM   9841  O O   . PRO C 1 338 ? 6.621   26.858  -11.047 1.00 92.10  ? 334  PRO C O   1 
ATOM   9842  C CB  . PRO C 1 338 ? 3.612   27.212  -9.995  1.00 90.17  ? 334  PRO C CB  1 
ATOM   9843  C CG  . PRO C 1 338 ? 2.450   27.512  -10.868 1.00 92.93  ? 334  PRO C CG  1 
ATOM   9844  C CD  . PRO C 1 338 ? 2.511   28.983  -11.133 1.00 94.69  ? 334  PRO C CD  1 
ATOM   9845  N N   . PHE C 1 339 ? 5.325   27.617  -12.742 1.00 96.98  ? 335  PHE C N   1 
ATOM   9846  C CA  . PHE C 1 339 ? 6.131   27.045  -13.819 1.00 99.66  ? 335  PHE C CA  1 
ATOM   9847  C C   . PHE C 1 339 ? 7.294   27.955  -14.216 1.00 101.68 ? 335  PHE C C   1 
ATOM   9848  O O   . PHE C 1 339 ? 8.232   27.513  -14.881 1.00 103.79 ? 335  PHE C O   1 
ATOM   9849  C CB  . PHE C 1 339 ? 5.260   26.753  -15.045 1.00 103.11 ? 335  PHE C CB  1 
ATOM   9850  C CG  . PHE C 1 339 ? 4.251   25.657  -14.835 1.00 102.03 ? 335  PHE C CG  1 
ATOM   9851  C CD1 . PHE C 1 339 ? 4.584   24.330  -15.087 1.00 102.40 ? 335  PHE C CD1 1 
ATOM   9852  C CD2 . PHE C 1 339 ? 2.961   25.953  -14.399 1.00 101.28 ? 335  PHE C CD2 1 
ATOM   9853  C CE1 . PHE C 1 339 ? 3.653   23.311  -14.900 1.00 101.85 ? 335  PHE C CE1 1 
ATOM   9854  C CE2 . PHE C 1 339 ? 2.022   24.941  -14.208 1.00 100.71 ? 335  PHE C CE2 1 
ATOM   9855  C CZ  . PHE C 1 339 ? 2.370   23.617  -14.459 1.00 101.00 ? 335  PHE C CZ  1 
ATOM   9856  N N   . ASP C 1 340 ? 7.222   29.223  -13.814 1.00 101.46 ? 336  ASP C N   1 
ATOM   9857  C CA  . ASP C 1 340 ? 8.273   30.197  -14.102 1.00 103.70 ? 336  ASP C CA  1 
ATOM   9858  C C   . ASP C 1 340 ? 9.476   29.965  -13.182 1.00 101.06 ? 336  ASP C C   1 
ATOM   9859  O O   . ASP C 1 340 ? 9.328   29.965  -11.957 1.00 97.20  ? 336  ASP C O   1 
ATOM   9860  C CB  . ASP C 1 340 ? 7.735   31.625  -13.949 1.00 104.85 ? 336  ASP C CB  1 
ATOM   9861  C CG  . ASP C 1 340 ? 8.535   32.651  -14.743 1.00 109.48 ? 336  ASP C CG  1 
ATOM   9862  O OD1 . ASP C 1 340 ? 9.768   32.736  -14.565 1.00 109.96 ? 336  ASP C OD1 1 
ATOM   9863  O OD2 . ASP C 1 340 ? 7.921   33.390  -15.540 1.00 113.39 ? 336  ASP C OD2 1 
ATOM   9864  N N   . PRO C 1 341 ? 10.672  29.764  -13.772 1.00 103.46 ? 337  PRO C N   1 
ATOM   9865  C CA  . PRO C 1 341 ? 11.887  29.431  -13.020 1.00 101.68 ? 337  PRO C CA  1 
ATOM   9866  C C   . PRO C 1 341 ? 12.395  30.554  -12.118 1.00 100.46 ? 337  PRO C C   1 
ATOM   9867  O O   . PRO C 1 341 ? 13.244  30.309  -11.260 1.00 98.40  ? 337  PRO C O   1 
ATOM   9868  C CB  . PRO C 1 341 ? 12.913  29.145  -14.122 1.00 105.99 ? 337  PRO C CB  1 
ATOM   9869  C CG  . PRO C 1 341 ? 12.428  29.912  -15.294 1.00 110.34 ? 337  PRO C CG  1 
ATOM   9870  C CD  . PRO C 1 341 ? 10.935  29.819  -15.223 1.00 108.59 ? 337  PRO C CD  1 
ATOM   9871  N N   . THR C 1 342 ? 11.882  31.766  -12.313 1.00 102.11 ? 338  THR C N   1 
ATOM   9872  C CA  . THR C 1 342 ? 12.324  32.924  -11.536 1.00 101.73 ? 338  THR C CA  1 
ATOM   9873  C C   . THR C 1 342 ? 11.535  33.103  -10.236 1.00 97.46  ? 338  THR C C   1 
ATOM   9874  O O   . THR C 1 342 ? 12.006  33.760  -9.304  1.00 96.15  ? 338  THR C O   1 
ATOM   9875  C CB  . THR C 1 342 ? 12.254  34.240  -12.359 1.00 106.43 ? 338  THR C CB  1 
ATOM   9876  O OG1 . THR C 1 342 ? 10.910  34.463  -12.807 1.00 107.22 ? 338  THR C OG1 1 
ATOM   9877  C CG2 . THR C 1 342 ? 13.195  34.187  -13.562 1.00 111.30 ? 338  THR C CG2 1 
ATOM   9878  N N   . THR C 1 343 ? 10.348  32.504  -10.174 1.00 95.70  ? 339  THR C N   1 
ATOM   9879  C CA  . THR C 1 343 ? 9.419   32.741  -9.067  1.00 92.62  ? 339  THR C CA  1 
ATOM   9880  C C   . THR C 1 343 ? 9.779   32.003  -7.782  1.00 88.51  ? 339  THR C C   1 
ATOM   9881  O O   . THR C 1 343 ? 9.987   30.784  -7.778  1.00 87.11  ? 339  THR C O   1 
ATOM   9882  C CB  . THR C 1 343 ? 7.964   32.411  -9.453  1.00 92.84  ? 339  THR C CB  1 
ATOM   9883  O OG1 . THR C 1 343 ? 7.870   31.033  -9.840  1.00 92.12  ? 339  THR C OG1 1 
ATOM   9884  C CG2 . THR C 1 343 ? 7.496   33.312  -10.600 1.00 97.14  ? 339  THR C CG2 1 
ATOM   9885  N N   . GLU C 1 344 ? 9.845   32.765  -6.694  1.00 86.95  ? 340  GLU C N   1 
ATOM   9886  C CA  . GLU C 1 344 ? 10.123  32.225  -5.368  1.00 83.40  ? 340  GLU C CA  1 
ATOM   9887  C C   . GLU C 1 344 ? 8.826   31.807  -4.680  1.00 81.17  ? 340  GLU C C   1 
ATOM   9888  O O   . GLU C 1 344 ? 8.791   30.813  -3.950  1.00 78.73  ? 340  GLU C O   1 
ATOM   9889  C CB  . GLU C 1 344 ? 10.857  33.260  -4.508  1.00 83.18  ? 340  GLU C CB  1 
ATOM   9890  C CG  . GLU C 1 344 ? 12.173  33.763  -5.091  1.00 85.98  ? 340  GLU C CG  1 
ATOM   9891  C CD  . GLU C 1 344 ? 12.925  34.675  -4.138  1.00 86.09  ? 340  GLU C CD  1 
ATOM   9892  O OE1 . GLU C 1 344 ? 13.346  34.198  -3.061  1.00 83.48  ? 340  GLU C OE1 1 
ATOM   9893  O OE2 . GLU C 1 344 ? 13.103  35.867  -4.472  1.00 89.04  ? 340  GLU C OE2 1 
ATOM   9894  N N   . GLN C 1 345 ? 7.766   32.576  -4.924  1.00 82.46  ? 341  GLN C N   1 
ATOM   9895  C CA  . GLN C 1 345 ? 6.469   32.360  -4.292  1.00 81.08  ? 341  GLN C CA  1 
ATOM   9896  C C   . GLN C 1 345 ? 5.425   31.949  -5.323  1.00 82.74  ? 341  GLN C C   1 
ATOM   9897  O O   . GLN C 1 345 ? 5.429   32.441  -6.453  1.00 85.74  ? 341  GLN C O   1 
ATOM   9898  C CB  . GLN C 1 345 ? 6.022   33.635  -3.569  1.00 81.59  ? 341  GLN C CB  1 
ATOM   9899  C CG  . GLN C 1 345 ? 4.809   33.473  -2.658  1.00 80.63  ? 341  GLN C CG  1 
ATOM   9900  C CD  . GLN C 1 345 ? 4.464   34.747  -1.903  1.00 81.93  ? 341  GLN C CD  1 
ATOM   9901  O OE1 . GLN C 1 345 ? 5.296   35.303  -1.185  1.00 81.47  ? 341  GLN C OE1 1 
ATOM   9902  N NE2 . GLN C 1 345 ? 3.228   35.210  -2.056  1.00 83.83  ? 341  GLN C NE2 1 
ATOM   9903  N N   . GLY C 1 346 ? 4.540   31.041  -4.924  1.00 81.16  ? 342  GLY C N   1 
ATOM   9904  C CA  . GLY C 1 346 ? 3.397   30.654  -5.746  1.00 82.65  ? 342  GLY C CA  1 
ATOM   9905  C C   . GLY C 1 346 ? 2.113   31.265  -5.212  1.00 83.00  ? 342  GLY C C   1 
ATOM   9906  O O   . GLY C 1 346 ? 2.160   32.223  -4.440  1.00 82.71  ? 342  GLY C O   1 
ATOM   9907  N N   . PRO C 1 347 ? 0.954   30.720  -5.625  1.00 84.04  ? 343  PRO C N   1 
ATOM   9908  C CA  . PRO C 1 347 ? -0.343  31.153  -5.108  1.00 84.89  ? 343  PRO C CA  1 
ATOM   9909  C C   . PRO C 1 347 ? -0.789  30.343  -3.888  1.00 82.67  ? 343  PRO C C   1 
ATOM   9910  O O   . PRO C 1 347 ? -0.179  29.322  -3.567  1.00 80.65  ? 343  PRO C O   1 
ATOM   9911  C CB  . PRO C 1 347 ? -1.277  30.871  -6.282  1.00 87.74  ? 343  PRO C CB  1 
ATOM   9912  C CG  . PRO C 1 347 ? -0.690  29.655  -6.914  1.00 86.97  ? 343  PRO C CG  1 
ATOM   9913  C CD  . PRO C 1 347 ? 0.802   29.767  -6.742  1.00 85.28  ? 343  PRO C CD  1 
ATOM   9914  N N   . GLN C 1 348 ? -1.848  30.795  -3.222  1.00 83.46  ? 344  GLN C N   1 
ATOM   9915  C CA  . GLN C 1 348 ? -2.439  30.033  -2.124  1.00 82.27  ? 344  GLN C CA  1 
ATOM   9916  C C   . GLN C 1 348 ? -3.342  28.935  -2.682  1.00 83.50  ? 344  GLN C C   1 
ATOM   9917  O O   . GLN C 1 348 ? -3.627  28.912  -3.881  1.00 85.35  ? 344  GLN C O   1 
ATOM   9918  C CB  . GLN C 1 348 ? -3.205  30.947  -1.160  1.00 83.34  ? 344  GLN C CB  1 
ATOM   9919  C CG  . GLN C 1 348 ? -2.422  32.169  -0.655  1.00 82.78  ? 344  GLN C CG  1 
ATOM   9920  C CD  . GLN C 1 348 ? -0.982  31.859  -0.255  1.00 79.91  ? 344  GLN C CD  1 
ATOM   9921  O OE1 . GLN C 1 348 ? -0.041  32.428  -0.811  1.00 79.53  ? 344  GLN C OE1 1 
ATOM   9922  N NE2 . GLN C 1 348 ? -0.806  30.956  0.709   1.00 77.91  ? 344  GLN C NE2 1 
ATOM   9923  N N   . ILE C 1 349 ? -3.788  28.028  -1.817  1.00 82.80  ? 345  ILE C N   1 
ATOM   9924  C CA  . ILE C 1 349 ? -4.522  26.838  -2.258  1.00 84.05  ? 345  ILE C CA  1 
ATOM   9925  C C   . ILE C 1 349 ? -5.994  27.096  -2.627  1.00 87.42  ? 345  ILE C C   1 
ATOM   9926  O O   . ILE C 1 349 ? -6.456  26.663  -3.686  1.00 89.30  ? 345  ILE C O   1 
ATOM   9927  C CB  . ILE C 1 349 ? -4.390  25.663  -1.235  1.00 82.66  ? 345  ILE C CB  1 
ATOM   9928  C CG1 . ILE C 1 349 ? -4.808  24.328  -1.864  1.00 83.85  ? 345  ILE C CG1 1 
ATOM   9929  C CG2 . ILE C 1 349 ? -5.172  25.943  0.048   1.00 83.36  ? 345  ILE C CG2 1 
ATOM   9930  C CD1 . ILE C 1 349 ? -3.762  23.712  -2.776  1.00 82.64  ? 345  ILE C CD1 1 
ATOM   9931  N N   . ASP C 1 350 ? -6.713  27.808  -1.762  1.00 88.45  ? 346  ASP C N   1 
ATOM   9932  C CA  . ASP C 1 350 ? -8.161  27.948  -1.885  1.00 91.89  ? 346  ASP C CA  1 
ATOM   9933  C C   . ASP C 1 350 ? -8.630  29.394  -1.911  1.00 93.93  ? 346  ASP C C   1 
ATOM   9934  O O   . ASP C 1 350 ? -7.904  30.302  -1.501  1.00 92.53  ? 346  ASP C O   1 
ATOM   9935  C CB  . ASP C 1 350 ? -8.857  27.224  -0.725  1.00 92.54  ? 346  ASP C CB  1 
ATOM   9936  C CG  . ASP C 1 350 ? -9.491  25.906  -1.138  1.00 94.10  ? 346  ASP C CG  1 
ATOM   9937  O OD1 . ASP C 1 350 ? -9.585  25.623  -2.352  1.00 95.10  ? 346  ASP C OD1 1 
ATOM   9938  O OD2 . ASP C 1 350 ? -9.915  25.154  -0.236  1.00 94.78  ? 346  ASP C OD2 1 
ATOM   9939  N N   . LYS C 1 351 ? -9.855  29.588  -2.401  1.00 97.62  ? 347  LYS C N   1 
ATOM   9940  C CA  . LYS C 1 351 ? -10.606 30.819  -2.183  1.00 100.57 ? 347  LYS C CA  1 
ATOM   9941  C C   . LYS C 1 351 ? -10.858 30.945  -0.682  1.00 100.46 ? 347  LYS C C   1 
ATOM   9942  O O   . LYS C 1 351 ? -10.757 32.033  -0.114  1.00 101.01 ? 347  LYS C O   1 
ATOM   9943  C CB  . LYS C 1 351 ? -11.933 30.776  -2.952  1.00 104.84 ? 347  LYS C CB  1 
ATOM   9944  C CG  . LYS C 1 351 ? -12.842 32.003  -2.784  1.00 108.69 ? 347  LYS C CG  1 
ATOM   9945  C CD  . LYS C 1 351 ? -12.635 33.058  -3.876  1.00 110.38 ? 347  LYS C CD  1 
ATOM   9946  C CE  . LYS C 1 351 ? -11.600 34.110  -3.484  1.00 108.53 ? 347  LYS C CE  1 
ATOM   9947  N NZ  . LYS C 1 351 ? -11.530 35.223  -4.476  1.00 111.13 ? 347  LYS C NZ  1 
ATOM   9948  N N   . LYS C 1 352 ? -11.168 29.811  -0.054  1.00 100.18 ? 348  LYS C N   1 
ATOM   9949  C CA  . LYS C 1 352 ? -11.340 29.708  1.395   1.00 100.23 ? 348  LYS C CA  1 
ATOM   9950  C C   . LYS C 1 352 ? -10.073 30.144  2.136   1.00 96.67  ? 348  LYS C C   1 
ATOM   9951  O O   . LYS C 1 352 ? -10.150 30.780  3.187   1.00 97.21  ? 348  LYS C O   1 
ATOM   9952  C CB  . LYS C 1 352 ? -11.697 28.265  1.770   1.00 100.50 ? 348  LYS C CB  1 
ATOM   9953  C CG  . LYS C 1 352 ? -12.753 28.124  2.857   1.00 103.90 ? 348  LYS C CG  1 
ATOM   9954  C CD  . LYS C 1 352 ? -13.283 26.692  2.910   1.00 105.59 ? 348  LYS C CD  1 
ATOM   9955  C CE  . LYS C 1 352 ? -14.661 26.609  3.561   1.00 110.57 ? 348  LYS C CE  1 
ATOM   9956  N NZ  . LYS C 1 352 ? -14.624 26.816  5.035   1.00 111.18 ? 348  LYS C NZ  1 
ATOM   9957  N N   . GLN C 1 353 ? -8.917  29.802  1.567   1.00 93.43  ? 349  GLN C N   1 
ATOM   9958  C CA  . GLN C 1 353 ? -7.613  30.120  2.146   1.00 90.16  ? 349  GLN C CA  1 
ATOM   9959  C C   . GLN C 1 353 ? -7.219  31.574  1.894   1.00 90.45  ? 349  GLN C C   1 
ATOM   9960  O O   . GLN C 1 353 ? -6.822  32.284  2.819   1.00 89.84  ? 349  GLN C O   1 
ATOM   9961  C CB  . GLN C 1 353 ? -6.547  29.172  1.584   1.00 87.23  ? 349  GLN C CB  1 
ATOM   9962  C CG  . GLN C 1 353 ? -5.139  29.363  2.151   1.00 84.10  ? 349  GLN C CG  1 
ATOM   9963  C CD  . GLN C 1 353 ? -4.940  28.736  3.524   1.00 83.10  ? 349  GLN C CD  1 
ATOM   9964  O OE1 . GLN C 1 353 ? -5.846  28.117  4.087   1.00 84.88  ? 349  GLN C OE1 1 
ATOM   9965  N NE2 . GLN C 1 353 ? -3.739  28.894  4.067   1.00 80.58  ? 349  GLN C NE2 1 
ATOM   9966  N N   . TYR C 1 354 ? -7.330  31.999  0.637   1.00 91.77  ? 350  TYR C N   1 
ATOM   9967  C CA  . TYR C 1 354 ? -7.030  33.370  0.219   1.00 92.94  ? 350  TYR C CA  1 
ATOM   9968  C C   . TYR C 1 354 ? -7.751  34.399  1.089   1.00 95.60  ? 350  TYR C C   1 
ATOM   9969  O O   . TYR C 1 354 ? -7.143  35.369  1.544   1.00 95.29  ? 350  TYR C O   1 
ATOM   9970  C CB  . TYR C 1 354 ? -7.402  33.548  -1.261  1.00 95.18  ? 350  TYR C CB  1 
ATOM   9971  C CG  . TYR C 1 354 ? -7.218  34.942  -1.833  1.00 97.23  ? 350  TYR C CG  1 
ATOM   9972  C CD1 . TYR C 1 354 ? -5.947  35.444  -2.119  1.00 95.40  ? 350  TYR C CD1 1 
ATOM   9973  C CD2 . TYR C 1 354 ? -8.323  35.746  -2.121  1.00 101.46 ? 350  TYR C CD2 1 
ATOM   9974  C CE1 . TYR C 1 354 ? -5.781  36.722  -2.657  1.00 98.04  ? 350  TYR C CE1 1 
ATOM   9975  C CE2 . TYR C 1 354 ? -8.170  37.024  -2.660  1.00 103.92 ? 350  TYR C CE2 1 
ATOM   9976  C CZ  . TYR C 1 354 ? -6.898  37.505  -2.924  1.00 102.28 ? 350  TYR C CZ  1 
ATOM   9977  O OH  . TYR C 1 354 ? -6.747  38.768  -3.453  1.00 105.12 ? 350  TYR C OH  1 
ATOM   9978  N N   . ASN C 1 355 ? -9.041  34.165  1.323   1.00 98.59  ? 351  ASN C N   1 
ATOM   9979  C CA  . ASN C 1 355 ? -9.876  35.053  2.133   1.00 101.92 ? 351  ASN C CA  1 
ATOM   9980  C C   . ASN C 1 355 ? -9.568  34.984  3.627   1.00 100.64 ? 351  ASN C C   1 
ATOM   9981  O O   . ASN C 1 355 ? -9.742  35.968  4.346   1.00 102.58 ? 351  ASN C O   1 
ATOM   9982  C CB  . ASN C 1 355 ? -11.362 34.758  1.896   1.00 105.87 ? 351  ASN C CB  1 
ATOM   9983  C CG  . ASN C 1 355 ? -11.811 35.090  0.480   1.00 108.27 ? 351  ASN C CG  1 
ATOM   9984  O OD1 . ASN C 1 355 ? -12.486 34.292  -0.167  1.00 109.52 ? 351  ASN C OD1 1 
ATOM   9985  N ND2 . ASN C 1 355 ? -11.444 36.271  -0.003  1.00 109.36 ? 351  ASN C ND2 1 
ATOM   9986  N N   . LYS C 1 356 ? -9.113  33.820  4.084   1.00 97.83  ? 352  LYS C N   1 
ATOM   9987  C CA  . LYS C 1 356 ? -8.821  33.598  5.499   1.00 96.87  ? 352  LYS C CA  1 
ATOM   9988  C C   . LYS C 1 356 ? -7.553  34.329  5.946   1.00 94.24  ? 352  LYS C C   1 
ATOM   9989  O O   . LYS C 1 356 ? -7.417  34.684  7.120   1.00 94.51  ? 352  LYS C O   1 
ATOM   9990  C CB  . LYS C 1 356 ? -8.702  32.098  5.787   1.00 95.10  ? 352  LYS C CB  1 
ATOM   9991  C CG  . LYS C 1 356 ? -9.145  31.683  7.184   1.00 96.87  ? 352  LYS C CG  1 
ATOM   9992  C CD  . LYS C 1 356 ? -9.412  30.182  7.246   1.00 97.27  ? 352  LYS C CD  1 
ATOM   9993  C CE  . LYS C 1 356 ? -10.048 29.776  8.568   1.00 99.99  ? 352  LYS C CE  1 
ATOM   9994  N NZ  . LYS C 1 356 ? -10.473 28.348  8.560   1.00 100.87 ? 352  LYS C NZ  1 
ATOM   9995  N N   . ILE C 1 357 ? -6.635  34.550  5.006   1.00 92.07  ? 353  ILE C N   1 
ATOM   9996  C CA  . ILE C 1 357 ? -5.381  35.254  5.282   1.00 89.91  ? 353  ILE C CA  1 
ATOM   9997  C C   . ILE C 1 357 ? -5.597  36.770  5.314   1.00 92.82  ? 353  ILE C C   1 
ATOM   9998  O O   . ILE C 1 357 ? -5.193  37.437  6.271   1.00 92.86  ? 353  ILE C O   1 
ATOM   9999  C CB  . ILE C 1 357 ? -4.269  34.870  4.269   1.00 87.04  ? 353  ILE C CB  1 
ATOM   10000 C CG1 . ILE C 1 357 ? -3.923  33.383  4.402   1.00 84.35  ? 353  ILE C CG1 1 
ATOM   10001 C CG2 . ILE C 1 357 ? -3.019  35.725  4.478   1.00 85.51  ? 353  ILE C CG2 1 
ATOM   10002 C CD1 . ILE C 1 357 ? -3.250  32.780  3.179   1.00 82.68  ? 353  ILE C CD1 1 
ATOM   10003 N N   . LEU C 1 358 ? -6.245  37.299  4.275   1.00 95.58  ? 354  LEU C N   1 
ATOM   10004 C CA  . LEU C 1 358 ? -6.553  38.730  4.175   1.00 99.13  ? 354  LEU C CA  1 
ATOM   10005 C C   . LEU C 1 358 ? -7.350  39.237  5.374   1.00 101.97 ? 354  LEU C C   1 
ATOM   10006 O O   . LEU C 1 358 ? -7.139  40.359  5.835   1.00 103.71 ? 354  LEU C O   1 
ATOM   10007 C CB  . LEU C 1 358 ? -7.315  39.035  2.879   1.00 102.19 ? 354  LEU C CB  1 
ATOM   10008 C CG  . LEU C 1 358 ? -6.580  38.948  1.537   1.00 100.99 ? 354  LEU C CG  1 
ATOM   10009 C CD1 . LEU C 1 358 ? -7.584  38.916  0.396   1.00 104.26 ? 354  LEU C CD1 1 
ATOM   10010 C CD2 . LEU C 1 358 ? -5.593  40.099  1.351   1.00 101.33 ? 354  LEU C CD2 1 
ATOM   10011 N N   . GLU C 1 359 ? -8.261  38.397  5.865   1.00 102.84 ? 355  GLU C N   1 
ATOM   10012 C CA  . GLU C 1 359 ? -9.049  38.683  7.063   1.00 105.94 ? 355  GLU C CA  1 
ATOM   10013 C C   . GLU C 1 359 ? -8.147  38.928  8.269   1.00 104.10 ? 355  GLU C C   1 
ATOM   10014 O O   . GLU C 1 359 ? -8.395  39.833  9.070   1.00 106.89 ? 355  GLU C O   1 
ATOM   10015 C CB  . GLU C 1 359 ? -10.024 37.528  7.344   1.00 106.84 ? 355  GLU C CB  1 
ATOM   10016 C CG  . GLU C 1 359 ? -10.733 37.570  8.704   1.00 110.06 ? 355  GLU C CG  1 
ATOM   10017 C CD  . GLU C 1 359 ? -11.562 38.830  8.912   1.00 115.75 ? 355  GLU C CD  1 
ATOM   10018 O OE1 . GLU C 1 359 ? -12.493 39.081  8.117   1.00 119.28 ? 355  GLU C OE1 1 
ATOM   10019 O OE2 . GLU C 1 359 ? -11.286 39.566  9.882   1.00 117.04 ? 355  GLU C OE2 1 
ATOM   10020 N N   . LEU C 1 360 ? -7.095  38.123  8.378   1.00 99.75  ? 356  LEU C N   1 
ATOM   10021 C CA  . LEU C 1 360 ? -6.175  38.203  9.503   1.00 97.88  ? 356  LEU C CA  1 
ATOM   10022 C C   . LEU C 1 360 ? -5.145  39.321  9.316   1.00 97.33  ? 356  LEU C C   1 
ATOM   10023 O O   . LEU C 1 360 ? -4.656  39.883  10.297  1.00 97.55  ? 356  LEU C O   1 
ATOM   10024 C CB  . LEU C 1 360 ? -5.500  36.845  9.728   1.00 93.90  ? 356  LEU C CB  1 
ATOM   10025 C CG  . LEU C 1 360 ? -5.546  36.242  11.136  1.00 93.80  ? 356  LEU C CG  1 
ATOM   10026 C CD1 . LEU C 1 360 ? -6.964  36.212  11.699  1.00 97.98  ? 356  LEU C CD1 1 
ATOM   10027 C CD2 . LEU C 1 360 ? -4.966  34.839  11.121  1.00 90.57  ? 356  LEU C CD2 1 
ATOM   10028 N N   . ILE C 1 361 ? -4.827  39.643  8.062   1.00 97.10  ? 357  ILE C N   1 
ATOM   10029 C CA  . ILE C 1 361 ? -3.962  40.785  7.746   1.00 97.68  ? 357  ILE C CA  1 
ATOM   10030 C C   . ILE C 1 361 ? -4.663  42.090  8.126   1.00 102.56 ? 357  ILE C C   1 
ATOM   10031 O O   . ILE C 1 361 ? -4.110  42.905  8.868   1.00 103.36 ? 357  ILE C O   1 
ATOM   10032 C CB  . ILE C 1 361 ? -3.560  40.824  6.246   1.00 97.08  ? 357  ILE C CB  1 
ATOM   10033 C CG1 . ILE C 1 361 ? -2.701  39.609  5.881   1.00 92.67  ? 357  ILE C CG1 1 
ATOM   10034 C CG2 . ILE C 1 361 ? -2.818  42.129  5.913   1.00 98.69  ? 357  ILE C CG2 1 
ATOM   10035 C CD1 . ILE C 1 361 ? -2.505  39.409  4.383   1.00 92.44  ? 357  ILE C CD1 1 
ATOM   10036 N N   . GLN C 1 362 ? -5.885  42.268  7.622   1.00 106.22 ? 358  GLN C N   1 
ATOM   10037 C CA  . GLN C 1 362 ? -6.701  43.452  7.911   1.00 111.62 ? 358  GLN C CA  1 
ATOM   10038 C C   . GLN C 1 362 ? -7.178  43.493  9.364   1.00 113.20 ? 358  GLN C C   1 
ATOM   10039 O O   . GLN C 1 362 ? -7.680  44.517  9.834   1.00 117.66 ? 358  GLN C O   1 
ATOM   10040 C CB  . GLN C 1 362 ? -7.890  43.540  6.948   1.00 115.17 ? 358  GLN C CB  1 
ATOM   10041 C CG  . GLN C 1 362 ? -7.517  44.011  5.546   1.00 116.24 ? 358  GLN C CG  1 
ATOM   10042 C CD  . GLN C 1 362 ? -8.541  43.619  4.492   1.00 119.12 ? 358  GLN C CD  1 
ATOM   10043 O OE1 . GLN C 1 362 ? -9.727  43.453  4.783   1.00 122.32 ? 358  GLN C OE1 1 
ATOM   10044 N NE2 . GLN C 1 362 ? -8.081  43.469  3.254   1.00 118.33 ? 358  GLN C NE2 1 
ATOM   10045 N N   . SER C 1 363 ? -7.024  42.371  10.064  1.00 110.08 ? 359  SER C N   1 
ATOM   10046 C CA  . SER C 1 363 ? -7.223  42.321  11.506  1.00 111.18 ? 359  SER C CA  1 
ATOM   10047 C C   . SER C 1 363 ? -6.085  43.067  12.201  1.00 110.16 ? 359  SER C C   1 
ATOM   10048 O O   . SER C 1 363 ? -6.329  43.984  12.989  1.00 113.67 ? 359  SER C O   1 
ATOM   10049 C CB  . SER C 1 363 ? -7.298  40.869  11.986  1.00 108.41 ? 359  SER C CB  1 
ATOM   10050 O OG  . SER C 1 363 ? -7.035  40.765  13.373  1.00 108.60 ? 359  SER C OG  1 
ATOM   10051 N N   . GLY C 1 364 ? -4.850  42.678  11.881  1.00 105.69 ? 360  GLY C N   1 
ATOM   10052 C CA  . GLY C 1 364 ? -3.646  43.269  12.468  1.00 104.42 ? 360  GLY C CA  1 
ATOM   10053 C C   . GLY C 1 364 ? -3.410  44.736  12.144  1.00 107.60 ? 360  GLY C C   1 
ATOM   10054 O O   . GLY C 1 364 ? -2.750  45.443  12.910  1.00 108.34 ? 360  GLY C O   1 
ATOM   10055 N N   . VAL C 1 365 ? -3.943  45.190  11.009  1.00 109.81 ? 361  VAL C N   1 
ATOM   10056 C CA  . VAL C 1 365 ? -3.832  46.594  10.587  1.00 113.64 ? 361  VAL C CA  1 
ATOM   10057 C C   . VAL C 1 365 ? -4.606  47.521  11.527  1.00 118.70 ? 361  VAL C C   1 
ATOM   10058 O O   . VAL C 1 365 ? -4.081  48.548  11.963  1.00 120.94 ? 361  VAL C O   1 
ATOM   10059 C CB  . VAL C 1 365 ? -4.292  46.800  9.111   1.00 115.29 ? 361  VAL C CB  1 
ATOM   10060 C CG1 . VAL C 1 365 ? -4.432  48.287  8.770   1.00 120.41 ? 361  VAL C CG1 1 
ATOM   10061 C CG2 . VAL C 1 365 ? -3.322  46.125  8.146   1.00 111.04 ? 361  VAL C CG2 1 
ATOM   10062 N N   . ALA C 1 366 ? -5.843  47.144  11.843  1.00 120.87 ? 362  ALA C N   1 
ATOM   10063 C CA  . ALA C 1 366 ? -6.696  47.941  12.723  1.00 126.31 ? 362  ALA C CA  1 
ATOM   10064 C C   . ALA C 1 366 ? -6.501  47.606  14.208  1.00 125.63 ? 362  ALA C C   1 
ATOM   10065 O O   . ALA C 1 366 ? -7.208  48.143  15.067  1.00 130.17 ? 362  ALA C O   1 
ATOM   10066 C CB  . ALA C 1 366 ? -8.165  47.788  12.321  1.00 129.96 ? 362  ALA C CB  1 
ATOM   10067 N N   . GLU C 1 367 ? -5.535  46.736  14.504  1.00 120.38 ? 363  GLU C N   1 
ATOM   10068 C CA  . GLU C 1 367 ? -5.313  46.254  15.870  1.00 119.50 ? 363  GLU C CA  1 
ATOM   10069 C C   . GLU C 1 367 ? -4.056  46.818  16.541  1.00 118.26 ? 363  GLU C C   1 
ATOM   10070 O O   . GLU C 1 367 ? -3.950  46.799  17.770  1.00 119.20 ? 363  GLU C O   1 
ATOM   10071 C CB  . GLU C 1 367 ? -5.294  44.722  15.899  1.00 115.23 ? 363  GLU C CB  1 
ATOM   10072 C CG  . GLU C 1 367 ? -5.743  44.112  17.224  1.00 116.60 ? 363  GLU C CG  1 
ATOM   10073 C CD  . GLU C 1 367 ? -5.903  42.600  17.162  1.00 113.61 ? 363  GLU C CD  1 
ATOM   10074 O OE1 . GLU C 1 367 ? -6.688  42.056  17.966  1.00 116.01 ? 363  GLU C OE1 1 
ATOM   10075 O OE2 . GLU C 1 367 ? -5.251  41.950  16.316  1.00 109.25 ? 363  GLU C OE2 1 
ATOM   10076 N N   . GLY C 1 368 ? -3.110  47.314  15.746  1.00 116.53 ? 364  GLY C N   1 
ATOM   10077 C CA  . GLY C 1 368 ? -1.928  47.973  16.302  1.00 116.12 ? 364  GLY C CA  1 
ATOM   10078 C C   . GLY C 1 368 ? -0.658  47.912  15.474  1.00 112.42 ? 364  GLY C C   1 
ATOM   10079 O O   . GLY C 1 368 ? 0.036   48.920  15.327  1.00 114.12 ? 364  GLY C O   1 
ATOM   10080 N N   . ALA C 1 369 ? -0.353  46.729  14.942  1.00 107.79 ? 365  ALA C N   1 
ATOM   10081 C CA  . ALA C 1 369 ? 0.896   46.486  14.209  1.00 104.16 ? 365  ALA C CA  1 
ATOM   10082 C C   . ALA C 1 369 ? 1.061   47.382  12.976  1.00 106.20 ? 365  ALA C C   1 
ATOM   10083 O O   . ALA C 1 369 ? 0.074   47.813  12.373  1.00 109.30 ? 365  ALA C O   1 
ATOM   10084 C CB  . ALA C 1 369 ? 1.005   45.016  13.822  1.00 99.53  ? 365  ALA C CB  1 
ATOM   10085 N N   . LYS C 1 370 ? 2.316   47.656  12.617  1.00 104.82 ? 366  LYS C N   1 
ATOM   10086 C CA  . LYS C 1 370 ? 2.636   48.511  11.475  1.00 107.12 ? 366  LYS C CA  1 
ATOM   10087 C C   . LYS C 1 370 ? 2.784   47.702  10.186  1.00 104.39 ? 366  LYS C C   1 
ATOM   10088 O O   . LYS C 1 370 ? 3.596   46.774  10.111  1.00 100.29 ? 366  LYS C O   1 
ATOM   10089 C CB  . LYS C 1 370 ? 3.908   49.325  11.745  1.00 108.00 ? 366  LYS C CB  1 
ATOM   10090 C CG  . LYS C 1 370 ? 4.183   50.416  10.717  1.00 111.80 ? 366  LYS C CG  1 
ATOM   10091 C CD  . LYS C 1 370 ? 5.568   51.011  10.892  1.00 112.28 ? 366  LYS C CD  1 
ATOM   10092 C CE  . LYS C 1 370 ? 5.874   52.017  9.796   1.00 116.44 ? 366  LYS C CE  1 
ATOM   10093 N NZ  . LYS C 1 370 ? 7.284   52.485  9.867   1.00 116.96 ? 366  LYS C NZ  1 
ATOM   10094 N N   . LEU C 1 371 ? 1.990   48.065  9.181   1.00 107.09 ? 367  LEU C N   1 
ATOM   10095 C CA  . LEU C 1 371 ? 2.060   47.451  7.860   1.00 105.48 ? 367  LEU C CA  1 
ATOM   10096 C C   . LEU C 1 371 ? 3.298   47.962  7.124   1.00 105.99 ? 367  LEU C C   1 
ATOM   10097 O O   . LEU C 1 371 ? 3.288   49.055  6.547   1.00 110.25 ? 367  LEU C O   1 
ATOM   10098 C CB  . LEU C 1 371 ? 0.779   47.748  7.065   1.00 108.87 ? 367  LEU C CB  1 
ATOM   10099 C CG  . LEU C 1 371 ? 0.559   47.129  5.678   1.00 107.96 ? 367  LEU C CG  1 
ATOM   10100 C CD1 . LEU C 1 371 ? 0.535   45.605  5.734   1.00 102.97 ? 367  LEU C CD1 1 
ATOM   10101 C CD2 . LEU C 1 371 ? -0.730  47.657  5.063   1.00 112.17 ? 367  LEU C CD2 1 
ATOM   10102 N N   . GLU C 1 372 ? 4.362   47.162  7.164   1.00 102.06 ? 368  GLU C N   1 
ATOM   10103 C CA  . GLU C 1 372 ? 5.650   47.535  6.577   1.00 102.47 ? 368  GLU C CA  1 
ATOM   10104 C C   . GLU C 1 372 ? 5.674   47.375  5.057   1.00 103.39 ? 368  GLU C C   1 
ATOM   10105 O O   . GLU C 1 372 ? 6.277   48.190  4.355   1.00 106.54 ? 368  GLU C O   1 
ATOM   10106 C CB  . GLU C 1 372 ? 6.788   46.730  7.213   1.00 98.32  ? 368  GLU C CB  1 
ATOM   10107 C CG  . GLU C 1 372 ? 7.096   47.094  8.665   1.00 98.16  ? 368  GLU C CG  1 
ATOM   10108 C CD  . GLU C 1 372 ? 7.974   48.330  8.809   1.00 101.40 ? 368  GLU C CD  1 
ATOM   10109 O OE1 . GLU C 1 372 ? 8.575   48.770  7.806   1.00 103.29 ? 368  GLU C OE1 1 
ATOM   10110 O OE2 . GLU C 1 372 ? 8.071   48.859  9.936   1.00 102.48 ? 368  GLU C OE2 1 
ATOM   10111 N N   . CYS C 1 373 ? 5.021   46.323  4.561   1.00 101.07 ? 369  CYS C N   1 
ATOM   10112 C CA  . CYS C 1 373 ? 4.938   46.045  3.124   1.00 101.92 ? 369  CYS C CA  1 
ATOM   10113 C C   . CYS C 1 373 ? 3.797   45.080  2.805   1.00 100.37 ? 369  CYS C C   1 
ATOM   10114 O O   . CYS C 1 373 ? 3.401   44.276  3.652   1.00 97.45  ? 369  CYS C O   1 
ATOM   10115 C CB  . CYS C 1 373 ? 6.255   45.458  2.614   1.00 99.71  ? 369  CYS C CB  1 
ATOM   10116 S SG  . CYS C 1 373 ? 6.714   43.903  3.407   1.00 93.78  ? 369  CYS C SG  1 
ATOM   10117 N N   . GLY C 1 374 ? 3.284   45.166  1.580   1.00 102.77 ? 370  GLY C N   1 
ATOM   10118 C CA  . GLY C 1 374 ? 2.223   44.276  1.106   1.00 101.91 ? 370  GLY C CA  1 
ATOM   10119 C C   . GLY C 1 374 ? 0.863   44.568  1.714   1.00 103.82 ? 370  GLY C C   1 
ATOM   10120 O O   . GLY C 1 374 ? 0.487   45.730  1.885   1.00 107.77 ? 370  GLY C O   1 
ATOM   10121 N N   . GLY C 1 375 ? 0.126   43.506  2.034   1.00 101.43 ? 371  GLY C N   1 
ATOM   10122 C CA  . GLY C 1 375 ? -1.172  43.630  2.695   1.00 103.30 ? 371  GLY C CA  1 
ATOM   10123 C C   . GLY C 1 375 ? -2.333  43.080  1.890   1.00 104.59 ? 371  GLY C C   1 
ATOM   10124 O O   . GLY C 1 375 ? -3.072  42.215  2.365   1.00 103.25 ? 371  GLY C O   1 
ATOM   10125 N N   . LYS C 1 376 ? -2.494  43.589  0.671   1.00 107.64 ? 372  LYS C N   1 
ATOM   10126 C CA  . LYS C 1 376 ? -3.591  43.186  -0.215  1.00 109.53 ? 372  LYS C CA  1 
ATOM   10127 C C   . LYS C 1 376 ? -3.234  41.964  -1.077  1.00 106.46 ? 372  LYS C C   1 
ATOM   10128 O O   . LYS C 1 376 ? -2.156  41.384  -0.927  1.00 102.84 ? 372  LYS C O   1 
ATOM   10129 C CB  . LYS C 1 376 ? -4.039  44.371  -1.092  1.00 115.03 ? 372  LYS C CB  1 
ATOM   10130 C CG  . LYS C 1 376 ? -2.909  45.081  -1.850  1.00 116.37 ? 372  LYS C CG  1 
ATOM   10131 C CD  . LYS C 1 376 ? -3.438  45.970  -2.976  1.00 122.18 ? 372  LYS C CD  1 
ATOM   10132 C CE  . LYS C 1 376 ? -3.931  47.325  -2.474  1.00 127.11 ? 372  LYS C CE  1 
ATOM   10133 N NZ  . LYS C 1 376 ? -2.812  48.219  -2.064  1.00 127.87 ? 372  LYS C NZ  1 
ATOM   10134 N N   . GLY C 1 377 ? -4.154  41.569  -1.958  1.00 108.20 ? 373  GLY C N   1 
ATOM   10135 C CA  . GLY C 1 377 ? -3.894  40.526  -2.952  1.00 106.33 ? 373  GLY C CA  1 
ATOM   10136 C C   . GLY C 1 377 ? -3.166  41.102  -4.153  1.00 108.41 ? 373  GLY C C   1 
ATOM   10137 O O   . GLY C 1 377 ? -3.185  42.316  -4.369  1.00 112.19 ? 373  GLY C O   1 
ATOM   10138 N N   . LEU C 1 378 ? -2.529  40.238  -4.940  1.00 106.47 ? 374  LEU C N   1 
ATOM   10139 C CA  . LEU C 1 378 ? -1.702  40.694  -6.058  1.00 108.55 ? 374  LEU C CA  1 
ATOM   10140 C C   . LEU C 1 378 ? -2.528  41.074  -7.290  1.00 113.28 ? 374  LEU C C   1 
ATOM   10141 O O   . LEU C 1 378 ? -2.214  42.053  -7.971  1.00 117.10 ? 374  LEU C O   1 
ATOM   10142 C CB  . LEU C 1 378 ? -0.643  39.648  -6.418  1.00 105.26 ? 374  LEU C CB  1 
ATOM   10143 C CG  . LEU C 1 378 ? 0.809   40.117  -6.585  1.00 105.18 ? 374  LEU C CG  1 
ATOM   10144 C CD1 . LEU C 1 378 ? 1.738   38.918  -6.643  1.00 101.51 ? 374  LEU C CD1 1 
ATOM   10145 C CD2 . LEU C 1 378 ? 1.012   41.007  -7.807  1.00 109.99 ? 374  LEU C CD2 1 
ATOM   10146 N N   . GLY C 1 379 ? -3.574  40.299  -7.573  1.00 113.36 ? 375  GLY C N   1 
ATOM   10147 C CA  . GLY C 1 379 ? -4.467  40.592  -8.695  1.00 117.97 ? 375  GLY C CA  1 
ATOM   10148 C C   . GLY C 1 379 ? -5.367  39.444  -9.115  1.00 117.39 ? 375  GLY C C   1 
ATOM   10149 O O   . GLY C 1 379 ? -5.519  38.461  -8.386  1.00 113.70 ? 375  GLY C O   1 
ATOM   10150 N N   . ARG C 1 380 ? -5.961  39.582  -10.303 1.00 121.45 ? 376  ARG C N   1 
ATOM   10151 C CA  . ARG C 1 380 ? -6.865  38.574  -10.872 1.00 121.85 ? 376  ARG C CA  1 
ATOM   10152 C C   . ARG C 1 380 ? -6.208  37.217  -11.109 1.00 117.98 ? 376  ARG C C   1 
ATOM   10153 O O   . ARG C 1 380 ? -4.988  37.125  -11.265 1.00 116.12 ? 376  ARG C O   1 
ATOM   10154 C CB  . ARG C 1 380 ? -7.462  39.062  -12.196 1.00 127.39 ? 376  ARG C CB  1 
ATOM   10155 C CG  . ARG C 1 380 ? -8.950  39.351  -12.135 1.00 131.18 ? 376  ARG C CG  1 
ATOM   10156 C CD  . ARG C 1 380 ? -9.209  40.838  -12.123 1.00 136.35 ? 376  ARG C CD  1 
ATOM   10157 N NE  . ARG C 1 380 ? -10.631 41.139  -12.021 1.00 140.54 ? 376  ARG C NE  1 
ATOM   10158 C CZ  . ARG C 1 380 ? -11.224 41.597  -10.924 1.00 141.06 ? 376  ARG C CZ  1 
ATOM   10159 N NH1 . ARG C 1 380 ? -10.521 41.818  -9.818  1.00 137.72 ? 376  ARG C NH1 1 
ATOM   10160 N NH2 . ARG C 1 380 ? -12.525 41.844  -10.935 1.00 145.35 ? 376  ARG C NH2 1 
ATOM   10161 N N   . LYS C 1 381 ? -7.044  36.179  -11.154 1.00 117.24 ? 377  LYS C N   1 
ATOM   10162 C CA  . LYS C 1 381 ? -6.635  34.792  -11.411 1.00 114.30 ? 377  LYS C CA  1 
ATOM   10163 C C   . LYS C 1 381 ? -5.654  34.223  -10.391 1.00 109.21 ? 377  LYS C C   1 
ATOM   10164 O O   . LYS C 1 381 ? -4.579  34.778  -10.146 1.00 107.93 ? 377  LYS C O   1 
ATOM   10165 C CB  . LYS C 1 381 ? -6.116  34.600  -12.842 1.00 116.51 ? 377  LYS C CB  1 
ATOM   10166 C CG  . LYS C 1 381 ? -7.224  34.462  -13.870 1.00 121.02 ? 377  LYS C CG  1 
ATOM   10167 C CD  . LYS C 1 381 ? -6.755  33.706  -15.098 1.00 122.51 ? 377  LYS C CD  1 
ATOM   10168 C CE  . LYS C 1 381 ? -7.900  33.501  -16.075 1.00 126.89 ? 377  LYS C CE  1 
ATOM   10169 N NZ  . LYS C 1 381 ? -7.502  32.641  -17.220 1.00 128.25 ? 377  LYS C NZ  1 
ATOM   10170 N N   . GLY C 1 382 ? -6.038  33.093  -9.809  1.00 106.63 ? 378  GLY C N   1 
ATOM   10171 C CA  . GLY C 1 382 ? -5.272  32.490  -8.734  1.00 102.09 ? 378  GLY C CA  1 
ATOM   10172 C C   . GLY C 1 382 ? -5.548  33.183  -7.416  1.00 100.94 ? 378  GLY C C   1 
ATOM   10173 O O   . GLY C 1 382 ? -6.422  34.045  -7.323  1.00 103.71 ? 378  GLY C O   1 
ATOM   10174 N N   . PHE C 1 383 ? -4.795  32.803  -6.392  1.00 97.16  ? 379  PHE C N   1 
ATOM   10175 C CA  . PHE C 1 383 ? -4.991  33.355  -5.061  1.00 96.02  ? 379  PHE C CA  1 
ATOM   10176 C C   . PHE C 1 383 ? -3.680  33.947  -4.541  1.00 93.74  ? 379  PHE C C   1 
ATOM   10177 O O   . PHE C 1 383 ? -3.178  33.556  -3.485  1.00 90.90  ? 379  PHE C O   1 
ATOM   10178 C CB  . PHE C 1 383 ? -5.542  32.278  -4.115  1.00 94.33  ? 379  PHE C CB  1 
ATOM   10179 C CG  . PHE C 1 383 ? -6.655  31.444  -4.711  1.00 96.25  ? 379  PHE C CG  1 
ATOM   10180 C CD1 . PHE C 1 383 ? -7.912  31.997  -4.951  1.00 99.76  ? 379  PHE C CD1 1 
ATOM   10181 C CD2 . PHE C 1 383 ? -6.445  30.101  -5.022  1.00 94.73  ? 379  PHE C CD2 1 
ATOM   10182 C CE1 . PHE C 1 383 ? -8.939  31.226  -5.498  1.00 101.87 ? 379  PHE C CE1 1 
ATOM   10183 C CE2 . PHE C 1 383 ? -7.466  29.323  -5.567  1.00 96.81  ? 379  PHE C CE2 1 
ATOM   10184 C CZ  . PHE C 1 383 ? -8.715  29.886  -5.805  1.00 100.35 ? 379  PHE C CZ  1 
ATOM   10185 N N   . PHE C 1 384 ? -3.133  34.896  -5.297  1.00 95.38  ? 380  PHE C N   1 
ATOM   10186 C CA  . PHE C 1 384 ? -1.839  35.496  -4.982  1.00 93.79  ? 380  PHE C CA  1 
ATOM   10187 C C   . PHE C 1 384 ? -1.953  36.597  -3.936  1.00 94.16  ? 380  PHE C C   1 
ATOM   10188 O O   . PHE C 1 384 ? -2.838  37.452  -4.013  1.00 97.36  ? 380  PHE C O   1 
ATOM   10189 C CB  . PHE C 1 384 ? -1.177  36.051  -6.247  1.00 96.20  ? 380  PHE C CB  1 
ATOM   10190 C CG  . PHE C 1 384 ? -0.797  34.998  -7.249  1.00 95.77  ? 380  PHE C CG  1 
ATOM   10191 C CD1 . PHE C 1 384 ? -1.666  34.656  -8.281  1.00 98.38  ? 380  PHE C CD1 1 
ATOM   10192 C CD2 . PHE C 1 384 ? 0.432   34.353  -7.165  1.00 93.25  ? 380  PHE C CD2 1 
ATOM   10193 C CE1 . PHE C 1 384 ? -1.319  33.683  -9.213  1.00 98.41  ? 380  PHE C CE1 1 
ATOM   10194 C CE2 . PHE C 1 384 ? 0.791   33.378  -8.091  1.00 93.40  ? 380  PHE C CE2 1 
ATOM   10195 C CZ  . PHE C 1 384 ? -0.087  33.042  -9.117  1.00 95.95  ? 380  PHE C CZ  1 
ATOM   10196 N N   . ILE C 1 385 ? -1.050  36.557  -2.960  1.00 91.17  ? 381  ILE C N   1 
ATOM   10197 C CA  . ILE C 1 385 ? -0.941  37.595  -1.939  1.00 91.43  ? 381  ILE C CA  1 
ATOM   10198 C C   . ILE C 1 385 ? 0.496   38.118  -1.913  1.00 90.52  ? 381  ILE C C   1 
ATOM   10199 O O   . ILE C 1 385 ? 1.441   37.338  -1.753  1.00 87.61  ? 381  ILE C O   1 
ATOM   10200 C CB  . ILE C 1 385 ? -1.340  37.071  -0.532  1.00 89.22  ? 381  ILE C CB  1 
ATOM   10201 C CG1 . ILE C 1 385 ? -2.774  36.527  -0.541  1.00 90.52  ? 381  ILE C CG1 1 
ATOM   10202 C CG2 . ILE C 1 385 ? -1.181  38.173  0.525   1.00 89.92  ? 381  ILE C CG2 1 
ATOM   10203 C CD1 . ILE C 1 385 ? -3.110  35.619  0.632   1.00 88.39  ? 381  ILE C CD1 1 
ATOM   10204 N N   . GLU C 1 386 ? 0.651   39.432  -2.081  1.00 93.39  ? 382  GLU C N   1 
ATOM   10205 C CA  . GLU C 1 386 ? 1.966   40.081  -2.020  1.00 93.31  ? 382  GLU C CA  1 
ATOM   10206 C C   . GLU C 1 386 ? 2.576   39.973  -0.612  1.00 90.30  ? 382  GLU C C   1 
ATOM   10207 O O   . GLU C 1 386 ? 1.862   40.142  0.381   1.00 90.09  ? 382  GLU C O   1 
ATOM   10208 C CB  . GLU C 1 386 ? 1.897   41.542  -2.506  1.00 97.84  ? 382  GLU C CB  1 
ATOM   10209 C CG  . GLU C 1 386 ? 0.845   42.425  -1.822  1.00 100.32 ? 382  GLU C CG  1 
ATOM   10210 C CD  . GLU C 1 386 ? 0.708   43.811  -2.453  1.00 105.44 ? 382  GLU C CD  1 
ATOM   10211 O OE1 . GLU C 1 386 ? 0.795   43.927  -3.694  1.00 107.88 ? 382  GLU C OE1 1 
ATOM   10212 O OE2 . GLU C 1 386 ? 0.496   44.789  -1.704  1.00 107.31 ? 382  GLU C OE2 1 
ATOM   10213 N N   . PRO C 1 387 ? 3.891   39.670  -0.527  1.00 88.26  ? 383  PRO C N   1 
ATOM   10214 C CA  . PRO C 1 387 ? 4.584   39.432  0.746   1.00 85.40  ? 383  PRO C CA  1 
ATOM   10215 C C   . PRO C 1 387 ? 4.305   40.504  1.798   1.00 86.78  ? 383  PRO C C   1 
ATOM   10216 O O   . PRO C 1 387 ? 4.419   41.698  1.511   1.00 90.01  ? 383  PRO C O   1 
ATOM   10217 C CB  . PRO C 1 387 ? 6.059   39.451  0.342   1.00 85.01  ? 383  PRO C CB  1 
ATOM   10218 C CG  . PRO C 1 387 ? 6.058   38.971  -1.056  1.00 86.03  ? 383  PRO C CG  1 
ATOM   10219 C CD  . PRO C 1 387 ? 4.809   39.532  -1.674  1.00 89.02  ? 383  PRO C CD  1 
ATOM   10220 N N   . THR C 1 388 ? 3.937   40.069  3.000   1.00 84.83  ? 384  THR C N   1 
ATOM   10221 C CA  . THR C 1 388 ? 3.553   40.981  4.077   1.00 86.38  ? 384  THR C CA  1 
ATOM   10222 C C   . THR C 1 388 ? 4.478   40.846  5.286   1.00 84.21  ? 384  THR C C   1 
ATOM   10223 O O   . THR C 1 388 ? 4.798   39.735  5.715   1.00 81.10  ? 384  THR C O   1 
ATOM   10224 C CB  . THR C 1 388 ? 2.082   40.757  4.510   1.00 87.22  ? 384  THR C CB  1 
ATOM   10225 O OG1 . THR C 1 388 ? 1.243   40.683  3.352   1.00 89.02  ? 384  THR C OG1 1 
ATOM   10226 C CG2 . THR C 1 388 ? 1.596   41.891  5.405   1.00 89.96  ? 384  THR C CG2 1 
ATOM   10227 N N   . VAL C 1 389 ? 4.910   41.989  5.818   1.00 86.22  ? 385  VAL C N   1 
ATOM   10228 C CA  . VAL C 1 389 ? 5.736   42.040  7.023   1.00 84.89  ? 385  VAL C CA  1 
ATOM   10229 C C   . VAL C 1 389 ? 5.121   43.023  8.013   1.00 87.56  ? 385  VAL C C   1 
ATOM   10230 O O   . VAL C 1 389 ? 4.862   44.178  7.669   1.00 91.16  ? 385  VAL C O   1 
ATOM   10231 C CB  . VAL C 1 389 ? 7.198   42.467  6.709   1.00 84.98  ? 385  VAL C CB  1 
ATOM   10232 C CG1 . VAL C 1 389 ? 7.993   42.695  7.991   1.00 84.16  ? 385  VAL C CG1 1 
ATOM   10233 C CG2 . VAL C 1 389 ? 7.893   41.431  5.835   1.00 82.67  ? 385  VAL C CG2 1 
ATOM   10234 N N   . PHE C 1 390 ? 4.881   42.558  9.236   1.00 86.34  ? 386  PHE C N   1 
ATOM   10235 C CA  . PHE C 1 390 ? 4.373   43.421  10.300  1.00 89.09  ? 386  PHE C CA  1 
ATOM   10236 C C   . PHE C 1 390 ? 5.440   43.728  11.343  1.00 88.64  ? 386  PHE C C   1 
ATOM   10237 O O   . PHE C 1 390 ? 6.270   42.875  11.670  1.00 85.61  ? 386  PHE C O   1 
ATOM   10238 C CB  . PHE C 1 390 ? 3.139   42.808  10.972  1.00 89.14  ? 386  PHE C CB  1 
ATOM   10239 C CG  . PHE C 1 390 ? 1.855   43.063  10.234  1.00 91.70  ? 386  PHE C CG  1 
ATOM   10240 C CD1 . PHE C 1 390 ? 1.293   44.337  10.204  1.00 95.92  ? 386  PHE C CD1 1 
ATOM   10241 C CD2 . PHE C 1 390 ? 1.199   42.027  9.577   1.00 90.29  ? 386  PHE C CD2 1 
ATOM   10242 C CE1 . PHE C 1 390 ? 0.102   44.577  9.521   1.00 98.89  ? 386  PHE C CE1 1 
ATOM   10243 C CE2 . PHE C 1 390 ? 0.005   42.255  8.892   1.00 92.98  ? 386  PHE C CE2 1 
ATOM   10244 C CZ  . PHE C 1 390 ? -0.544  43.533  8.865   1.00 97.32  ? 386  PHE C CZ  1 
ATOM   10245 N N   . SER C 1 391 ? 5.408   44.955  11.857  1.00 92.10  ? 387  SER C N   1 
ATOM   10246 C CA  . SER C 1 391 ? 6.328   45.390  12.900  1.00 92.46  ? 387  SER C CA  1 
ATOM   10247 C C   . SER C 1 391 ? 5.565   45.728  14.176  1.00 94.69  ? 387  SER C C   1 
ATOM   10248 O O   . SER C 1 391 ? 4.351   45.948  14.136  1.00 96.98  ? 387  SER C O   1 
ATOM   10249 C CB  . SER C 1 391 ? 7.133   46.601  12.424  1.00 95.16  ? 387  SER C CB  1 
ATOM   10250 O OG  . SER C 1 391 ? 8.147   46.938  13.353  1.00 95.20  ? 387  SER C OG  1 
ATOM   10251 N N   . ASN C 1 392 ? 6.285   45.761  15.299  1.00 94.46  ? 388  ASN C N   1 
ATOM   10252 C CA  . ASN C 1 392 ? 5.730   46.126  16.613  1.00 97.08  ? 388  ASN C CA  1 
ATOM   10253 C C   . ASN C 1 392 ? 4.545   45.257  17.060  1.00 96.81  ? 388  ASN C C   1 
ATOM   10254 O O   . ASN C 1 392 ? 3.513   45.774  17.503  1.00 100.28 ? 388  ASN C O   1 
ATOM   10255 C CB  . ASN C 1 392 ? 5.353   47.622  16.662  1.00 102.06 ? 388  ASN C CB  1 
ATOM   10256 C CG  . ASN C 1 392 ? 6.549   48.547  16.470  1.00 103.34 ? 388  ASN C CG  1 
ATOM   10257 O OD1 . ASN C 1 392 ? 7.485   48.239  15.733  1.00 101.14 ? 388  ASN C OD1 1 
ATOM   10258 N ND2 . ASN C 1 392 ? 6.509   49.699  17.128  1.00 107.51 ? 388  ASN C ND2 1 
ATOM   10259 N N   . VAL C 1 393 ? 4.703   43.940  16.945  1.00 93.19  ? 389  VAL C N   1 
ATOM   10260 C CA  . VAL C 1 393 ? 3.646   42.993  17.304  1.00 93.04  ? 389  VAL C CA  1 
ATOM   10261 C C   . VAL C 1 393 ? 3.747   42.583  18.778  1.00 93.49  ? 389  VAL C C   1 
ATOM   10262 O O   . VAL C 1 393 ? 4.838   42.296  19.274  1.00 91.60  ? 389  VAL C O   1 
ATOM   10263 C CB  . VAL C 1 393 ? 3.672   41.744  16.381  1.00 89.46  ? 389  VAL C CB  1 
ATOM   10264 C CG1 . VAL C 1 393 ? 2.581   40.746  16.762  1.00 89.58  ? 389  VAL C CG1 1 
ATOM   10265 C CG2 . VAL C 1 393 ? 3.520   42.155  14.923  1.00 89.65  ? 389  VAL C CG2 1 
ATOM   10266 N N   . THR C 1 394 ? 2.608   42.577  19.472  1.00 96.53  ? 390  THR C N   1 
ATOM   10267 C CA  . THR C 1 394 ? 2.537   42.135  20.871  1.00 97.72  ? 390  THR C CA  1 
ATOM   10268 C C   . THR C 1 394 ? 1.826   40.783  21.002  1.00 96.84  ? 390  THR C C   1 
ATOM   10269 O O   . THR C 1 394 ? 1.203   40.308  20.051  1.00 95.93  ? 390  THR C O   1 
ATOM   10270 C CB  . THR C 1 394 ? 1.850   43.185  21.787  1.00 102.71 ? 390  THR C CB  1 
ATOM   10271 O OG1 . THR C 1 394 ? 0.575   43.547  21.241  1.00 105.51 ? 390  THR C OG1 1 
ATOM   10272 C CG2 . THR C 1 394 ? 2.716   44.435  21.937  1.00 103.98 ? 390  THR C CG2 1 
ATOM   10273 N N   . ASP C 1 395 ? 1.922   40.179  22.186  1.00 97.64  ? 391  ASP C N   1 
ATOM   10274 C CA  . ASP C 1 395 ? 1.388   38.837  22.451  1.00 97.32  ? 391  ASP C CA  1 
ATOM   10275 C C   . ASP C 1 395 ? -0.141  38.722  22.422  1.00 100.80 ? 391  ASP C C   1 
ATOM   10276 O O   . ASP C 1 395 ? -0.679  37.707  21.974  1.00 99.90  ? 391  ASP C O   1 
ATOM   10277 C CB  . ASP C 1 395 ? 1.912   38.314  23.794  1.00 97.85  ? 391  ASP C CB  1 
ATOM   10278 C CG  . ASP C 1 395 ? 3.326   37.768  23.701  1.00 94.14  ? 391  ASP C CG  1 
ATOM   10279 O OD1 . ASP C 1 395 ? 4.146   38.324  22.939  1.00 91.94  ? 391  ASP C OD1 1 
ATOM   10280 O OD2 . ASP C 1 395 ? 3.618   36.775  24.401  1.00 93.91  ? 391  ASP C OD2 1 
ATOM   10281 N N   . ASP C 1 396 ? -0.830  39.756  22.901  1.00 105.26 ? 392  ASP C N   1 
ATOM   10282 C CA  . ASP C 1 396 ? -2.289  39.712  23.067  1.00 109.58 ? 392  ASP C CA  1 
ATOM   10283 C C   . ASP C 1 396 ? -3.089  39.956  21.779  1.00 109.91 ? 392  ASP C C   1 
ATOM   10284 O O   . ASP C 1 396 ? -4.323  39.911  21.793  1.00 113.45 ? 392  ASP C O   1 
ATOM   10285 C CB  . ASP C 1 396 ? -2.742  40.669  24.186  1.00 114.76 ? 392  ASP C CB  1 
ATOM   10286 C CG  . ASP C 1 396 ? -2.363  42.121  23.916  1.00 115.88 ? 392  ASP C CG  1 
ATOM   10287 O OD1 . ASP C 1 396 ? -1.164  42.407  23.703  1.00 112.77 ? 392  ASP C OD1 1 
ATOM   10288 O OD2 . ASP C 1 396 ? -3.269  42.982  23.935  1.00 120.25 ? 392  ASP C OD2 1 
ATOM   10289 N N   . MET C 1 397 ? -2.386  40.201  20.675  1.00 106.70 ? 393  MET C N   1 
ATOM   10290 C CA  . MET C 1 397 ? -3.022  40.448  19.378  1.00 107.01 ? 393  MET C CA  1 
ATOM   10291 C C   . MET C 1 397 ? -3.571  39.164  18.743  1.00 105.45 ? 393  MET C C   1 
ATOM   10292 O O   . MET C 1 397 ? -3.067  38.067  19.009  1.00 102.74 ? 393  MET C O   1 
ATOM   10293 C CB  . MET C 1 397 ? -2.041  41.138  18.423  1.00 104.46 ? 393  MET C CB  1 
ATOM   10294 C CG  . MET C 1 397 ? -1.644  42.551  18.842  1.00 106.97 ? 393  MET C CG  1 
ATOM   10295 S SD  . MET C 1 397 ? -0.515  43.364  17.690  1.00 104.72 ? 393  MET C SD  1 
ATOM   10296 C CE  . MET C 1 397 ? -1.605  43.733  16.318  1.00 106.93 ? 393  MET C CE  1 
ATOM   10297 N N   . ARG C 1 398 ? -4.601  39.311  17.907  1.00 107.56 ? 394  ARG C N   1 
ATOM   10298 C CA  . ARG C 1 398 ? -5.232  38.177  17.221  1.00 106.75 ? 394  ARG C CA  1 
ATOM   10299 C C   . ARG C 1 398 ? -4.253  37.454  16.295  1.00 101.84 ? 394  ARG C C   1 
ATOM   10300 O O   . ARG C 1 398 ? -4.318  36.231  16.145  1.00 100.18 ? 394  ARG C O   1 
ATOM   10301 C CB  . ARG C 1 398 ? -6.473  38.626  16.435  1.00 110.07 ? 394  ARG C CB  1 
ATOM   10302 C CG  . ARG C 1 398 ? -7.330  37.472  15.907  1.00 110.26 ? 394  ARG C CG  1 
ATOM   10303 C CD  . ARG C 1 398 ? -8.200  37.885  14.727  1.00 112.36 ? 394  ARG C CD  1 
ATOM   10304 N NE  . ARG C 1 398 ? -9.539  38.307  15.132  1.00 118.25 ? 394  ARG C NE  1 
ATOM   10305 C CZ  . ARG C 1 398 ? -9.917  39.570  15.316  1.00 122.19 ? 394  ARG C CZ  1 
ATOM   10306 N NH1 . ARG C 1 398 ? -9.061  40.568  15.133  1.00 121.08 ? 394  ARG C NH1 1 
ATOM   10307 N NH2 . ARG C 1 398 ? -11.163 39.839  15.685  1.00 127.60 ? 394  ARG C NH2 1 
ATOM   10308 N N   . ILE C 1 399 ? -3.347  38.217  15.686  1.00 100.09 ? 395  ILE C N   1 
ATOM   10309 C CA  . ILE C 1 399 ? -2.326  37.664  14.789  1.00 95.98  ? 395  ILE C CA  1 
ATOM   10310 C C   . ILE C 1 399 ? -1.247  36.856  15.526  1.00 93.10  ? 395  ILE C C   1 
ATOM   10311 O O   . ILE C 1 399 ? -0.532  36.064  14.909  1.00 89.85  ? 395  ILE C O   1 
ATOM   10312 C CB  . ILE C 1 399 ? -1.664  38.761  13.905  1.00 95.54  ? 395  ILE C CB  1 
ATOM   10313 C CG1 . ILE C 1 399 ? -1.161  39.934  14.760  1.00 97.26  ? 395  ILE C CG1 1 
ATOM   10314 C CG2 . ILE C 1 399 ? -2.640  39.236  12.829  1.00 97.85  ? 395  ILE C CG2 1 
ATOM   10315 C CD1 . ILE C 1 399 ? -0.150  40.836  14.063  1.00 96.36  ? 395  ILE C CD1 1 
ATOM   10316 N N   . ALA C 1 400 ? -1.148  37.056  16.840  1.00 94.73  ? 396  ALA C N   1 
ATOM   10317 C CA  . ALA C 1 400 ? -0.156  36.369  17.670  1.00 92.72  ? 396  ALA C CA  1 
ATOM   10318 C C   . ALA C 1 400 ? -0.655  35.041  18.249  1.00 93.22  ? 396  ALA C C   1 
ATOM   10319 O O   . ALA C 1 400 ? 0.114   34.085  18.344  1.00 90.78  ? 396  ALA C O   1 
ATOM   10320 C CB  . ALA C 1 400 ? 0.335   37.283  18.779  1.00 94.23  ? 396  ALA C CB  1 
ATOM   10321 N N   . LYS C 1 401 ? -1.930  34.986  18.638  1.00 96.94  ? 397  LYS C N   1 
ATOM   10322 C CA  . LYS C 1 401 ? -2.522  33.754  19.175  1.00 98.37  ? 397  LYS C CA  1 
ATOM   10323 C C   . LYS C 1 401 ? -2.856  32.754  18.065  1.00 96.89  ? 397  LYS C C   1 
ATOM   10324 O O   . LYS C 1 401 ? -2.307  31.652  18.034  1.00 94.87  ? 397  LYS C O   1 
ATOM   10325 C CB  . LYS C 1 401 ? -3.761  34.049  20.029  1.00 103.40 ? 397  LYS C CB  1 
ATOM   10326 C CG  . LYS C 1 401 ? -3.460  34.657  21.395  1.00 105.68 ? 397  LYS C CG  1 
ATOM   10327 C CD  . LYS C 1 401 ? -4.595  34.412  22.395  1.00 111.01 ? 397  LYS C CD  1 
ATOM   10328 C CE  . LYS C 1 401 ? -5.867  35.194  22.060  1.00 115.03 ? 397  LYS C CE  1 
ATOM   10329 N NZ  . LYS C 1 401 ? -5.715  36.665  22.245  1.00 116.51 ? 397  LYS C NZ  1 
ATOM   10330 N N   . GLU C 1 402 ? -3.765  33.137  17.168  1.00 98.37  ? 398  GLU C N   1 
ATOM   10331 C CA  . GLU C 1 402 ? -4.051  32.351  15.969  1.00 97.06  ? 398  GLU C CA  1 
ATOM   10332 C C   . GLU C 1 402 ? -2.957  32.660  14.965  1.00 93.37  ? 398  GLU C C   1 
ATOM   10333 O O   . GLU C 1 402 ? -2.756  33.821  14.602  1.00 93.52  ? 398  GLU C O   1 
ATOM   10334 C CB  . GLU C 1 402 ? -5.398  32.741  15.353  1.00 100.21 ? 398  GLU C CB  1 
ATOM   10335 C CG  . GLU C 1 402 ? -6.602  32.698  16.282  1.00 104.95 ? 398  GLU C CG  1 
ATOM   10336 C CD  . GLU C 1 402 ? -7.821  33.399  15.693  1.00 108.40 ? 398  GLU C CD  1 
ATOM   10337 O OE1 . GLU C 1 402 ? -7.752  33.873  14.536  1.00 106.85 ? 398  GLU C OE1 1 
ATOM   10338 O OE2 . GLU C 1 402 ? -8.853  33.480  16.392  1.00 112.98 ? 398  GLU C OE2 1 
ATOM   10339 N N   . GLU C 1 403 ? -2.245  31.632  14.519  1.00 90.62  ? 399  GLU C N   1 
ATOM   10340 C CA  . GLU C 1 403 ? -1.179  31.845  13.548  1.00 87.55  ? 399  GLU C CA  1 
ATOM   10341 C C   . GLU C 1 403 ? -1.740  31.947  12.133  1.00 87.68  ? 399  GLU C C   1 
ATOM   10342 O O   . GLU C 1 403 ? -2.643  31.194  11.756  1.00 88.97  ? 399  GLU C O   1 
ATOM   10343 C CB  . GLU C 1 403 ? -0.113  30.752  13.634  1.00 84.89  ? 399  GLU C CB  1 
ATOM   10344 C CG  . GLU C 1 403 ? 1.211   31.159  13.002  1.00 82.33  ? 399  GLU C CG  1 
ATOM   10345 C CD  . GLU C 1 403 ? 2.295   30.116  13.163  1.00 80.50  ? 399  GLU C CD  1 
ATOM   10346 O OE1 . GLU C 1 403 ? 2.106   28.974  12.692  1.00 80.36  ? 399  GLU C OE1 1 
ATOM   10347 O OE2 . GLU C 1 403 ? 3.347   30.448  13.752  1.00 79.48  ? 399  GLU C OE2 1 
ATOM   10348 N N   . ILE C 1 404 ? -1.206  32.897  11.367  1.00 86.72  ? 400  ILE C N   1 
ATOM   10349 C CA  . ILE C 1 404 ? -1.557  33.057  9.958   1.00 86.76  ? 400  ILE C CA  1 
ATOM   10350 C C   . ILE C 1 404 ? -0.871  31.953  9.155   1.00 84.08  ? 400  ILE C C   1 
ATOM   10351 O O   . ILE C 1 404 ? 0.270   31.577  9.441   1.00 81.77  ? 400  ILE C O   1 
ATOM   10352 C CB  . ILE C 1 404 ? -1.160  34.455  9.391   1.00 87.27  ? 400  ILE C CB  1 
ATOM   10353 C CG1 . ILE C 1 404 ? -1.607  35.592  10.316  1.00 89.90  ? 400  ILE C CG1 1 
ATOM   10354 C CG2 . ILE C 1 404 ? -1.759  34.671  8.006   1.00 88.42  ? 400  ILE C CG2 1 
ATOM   10355 C CD1 . ILE C 1 404 ? -0.557  36.041  11.310  1.00 89.03  ? 400  ILE C CD1 1 
ATOM   10356 N N   . PHE C 1 405 ? -1.585  31.440  8.159   1.00 84.62  ? 401  PHE C N   1 
ATOM   10357 C CA  . PHE C 1 405 ? -1.107  30.348  7.317   1.00 82.68  ? 401  PHE C CA  1 
ATOM   10358 C C   . PHE C 1 405 ? -0.871  30.829  5.881   1.00 82.24  ? 401  PHE C C   1 
ATOM   10359 O O   . PHE C 1 405 ? -1.478  30.327  4.930   1.00 83.17  ? 401  PHE C O   1 
ATOM   10360 C CB  . PHE C 1 405 ? -2.087  29.163  7.373   1.00 84.16  ? 401  PHE C CB  1 
ATOM   10361 C CG  . PHE C 1 405 ? -3.458  29.524  7.906   1.00 87.80  ? 401  PHE C CG  1 
ATOM   10362 C CD1 . PHE C 1 405 ? -4.465  29.963  7.050   1.00 90.40  ? 401  PHE C CD1 1 
ATOM   10363 C CD2 . PHE C 1 405 ? -3.740  29.425  9.269   1.00 89.31  ? 401  PHE C CD2 1 
ATOM   10364 C CE1 . PHE C 1 405 ? -5.732  30.297  7.541   1.00 93.91  ? 401  PHE C CE1 1 
ATOM   10365 C CE2 . PHE C 1 405 ? -5.003  29.760  9.770   1.00 92.89  ? 401  PHE C CE2 1 
ATOM   10366 C CZ  . PHE C 1 405 ? -6.000  30.195  8.903   1.00 95.20  ? 401  PHE C CZ  1 
ATOM   10367 N N   . GLY C 1 406 ? 0.020   31.812  5.745   1.00 81.08  ? 402  GLY C N   1 
ATOM   10368 C CA  . GLY C 1 406 ? 0.349   32.416  4.452   1.00 80.97  ? 402  GLY C CA  1 
ATOM   10369 C C   . GLY C 1 406 ? 1.600   33.283  4.493   1.00 79.69  ? 402  GLY C C   1 
ATOM   10370 O O   . GLY C 1 406 ? 2.354   33.237  5.467   1.00 78.16  ? 402  GLY C O   1 
ATOM   10371 N N   . PRO C 1 407 ? 1.823   34.094  3.437   1.00 80.69  ? 403  PRO C N   1 
ATOM   10372 C CA  . PRO C 1 407 ? 3.039   34.901  3.313   1.00 80.18  ? 403  PRO C CA  1 
ATOM   10373 C C   . PRO C 1 407 ? 3.013   36.176  4.164   1.00 81.26  ? 403  PRO C C   1 
ATOM   10374 O O   . PRO C 1 407 ? 3.067   37.287  3.633   1.00 83.42  ? 403  PRO C O   1 
ATOM   10375 C CB  . PRO C 1 407 ? 3.085   35.229  1.817   1.00 81.88  ? 403  PRO C CB  1 
ATOM   10376 C CG  . PRO C 1 407 ? 1.673   35.210  1.378   1.00 83.93  ? 403  PRO C CG  1 
ATOM   10377 C CD  . PRO C 1 407 ? 0.902   34.309  2.305   1.00 82.96  ? 403  PRO C CD  1 
ATOM   10378 N N   . VAL C 1 408 ? 2.936   35.996  5.481   1.00 80.07  ? 404  VAL C N   1 
ATOM   10379 C CA  . VAL C 1 408 ? 2.899   37.101  6.440   1.00 81.23  ? 404  VAL C CA  1 
ATOM   10380 C C   . VAL C 1 408 ? 3.830   36.784  7.614   1.00 79.09  ? 404  VAL C C   1 
ATOM   10381 O O   . VAL C 1 408 ? 3.674   35.750  8.269   1.00 77.53  ? 404  VAL C O   1 
ATOM   10382 C CB  . VAL C 1 408 ? 1.463   37.332  6.989   1.00 83.38  ? 404  VAL C CB  1 
ATOM   10383 C CG1 . VAL C 1 408 ? 1.416   38.562  7.889   1.00 85.31  ? 404  VAL C CG1 1 
ATOM   10384 C CG2 . VAL C 1 408 ? 0.450   37.457  5.854   1.00 85.45  ? 404  VAL C CG2 1 
ATOM   10385 N N   . GLN C 1 409 ? 4.793   37.667  7.877   1.00 79.29  ? 405  GLN C N   1 
ATOM   10386 C CA  . GLN C 1 409 ? 5.685   37.494  9.033   1.00 77.68  ? 405  GLN C CA  1 
ATOM   10387 C C   . GLN C 1 409 ? 5.573   38.609  10.075  1.00 79.55  ? 405  GLN C C   1 
ATOM   10388 O O   . GLN C 1 409 ? 5.473   39.793  9.735   1.00 81.96  ? 405  GLN C O   1 
ATOM   10389 C CB  . GLN C 1 409 ? 7.148   37.255  8.614   1.00 76.07  ? 405  GLN C CB  1 
ATOM   10390 C CG  . GLN C 1 409 ? 7.867   38.424  7.949   1.00 77.70  ? 405  GLN C CG  1 
ATOM   10391 C CD  . GLN C 1 409 ? 9.371   38.199  7.828   1.00 76.49  ? 405  GLN C CD  1 
ATOM   10392 O OE1 . GLN C 1 409 ? 10.041  37.841  8.796   1.00 74.98  ? 405  GLN C OE1 1 
ATOM   10393 N NE2 . GLN C 1 409 ? 9.907   38.420  6.636   1.00 77.53  ? 405  GLN C NE2 1 
ATOM   10394 N N   . GLU C 1 410 ? 5.585   38.209  11.344  1.00 78.75  ? 406  GLU C N   1 
ATOM   10395 C CA  . GLU C 1 410 ? 5.470   39.140  12.464  1.00 80.60  ? 406  GLU C CA  1 
ATOM   10396 C C   . GLU C 1 410 ? 6.818   39.290  13.161  1.00 79.49  ? 406  GLU C C   1 
ATOM   10397 O O   . GLU C 1 410 ? 7.474   38.295  13.487  1.00 77.22  ? 406  GLU C O   1 
ATOM   10398 C CB  . GLU C 1 410 ? 4.414   38.651  13.460  1.00 81.36  ? 406  GLU C CB  1 
ATOM   10399 C CG  . GLU C 1 410 ? 3.060   38.334  12.832  1.00 82.69  ? 406  GLU C CG  1 
ATOM   10400 C CD  . GLU C 1 410 ? 2.179   37.477  13.725  1.00 83.35  ? 406  GLU C CD  1 
ATOM   10401 O OE1 . GLU C 1 410 ? 1.677   37.993  14.747  1.00 85.59  ? 406  GLU C OE1 1 
ATOM   10402 O OE2 . GLU C 1 410 ? 1.982   36.286  13.398  1.00 81.91  ? 406  GLU C OE2 1 
ATOM   10403 N N   . ILE C 1 411 ? 7.231   40.536  13.377  1.00 81.40  ? 407  ILE C N   1 
ATOM   10404 C CA  . ILE C 1 411 ? 8.503   40.823  14.036  1.00 80.84  ? 407  ILE C CA  1 
ATOM   10405 C C   . ILE C 1 411 ? 8.259   41.463  15.404  1.00 82.74  ? 407  ILE C C   1 
ATOM   10406 O O   . ILE C 1 411 ? 7.771   42.592  15.497  1.00 85.75  ? 407  ILE C O   1 
ATOM   10407 C CB  . ILE C 1 411 ? 9.433   41.693  13.147  1.00 81.84  ? 407  ILE C CB  1 
ATOM   10408 C CG1 . ILE C 1 411 ? 9.729   40.971  11.825  1.00 80.04  ? 407  ILE C CG1 1 
ATOM   10409 C CG2 . ILE C 1 411 ? 10.734  42.018  13.881  1.00 81.88  ? 407  ILE C CG2 1 
ATOM   10410 C CD1 . ILE C 1 411 ? 10.424  41.821  10.773  1.00 81.73  ? 407  ILE C CD1 1 
ATOM   10411 N N   . LEU C 1 412 ? 8.601   40.721  16.456  1.00 81.29  ? 408  LEU C N   1 
ATOM   10412 C CA  . LEU C 1 412 ? 8.348   41.131  17.837  1.00 83.13  ? 408  LEU C CA  1 
ATOM   10413 C C   . LEU C 1 412 ? 9.633   41.547  18.561  1.00 83.23  ? 408  LEU C C   1 
ATOM   10414 O O   . LEU C 1 412 ? 10.732  41.132  18.188  1.00 81.24  ? 408  LEU C O   1 
ATOM   10415 C CB  . LEU C 1 412 ? 7.632   40.013  18.611  1.00 82.46  ? 408  LEU C CB  1 
ATOM   10416 C CG  . LEU C 1 412 ? 6.221   39.589  18.175  1.00 83.02  ? 408  LEU C CG  1 
ATOM   10417 C CD1 . LEU C 1 412 ? 6.255   38.537  17.074  1.00 80.23  ? 408  LEU C CD1 1 
ATOM   10418 C CD2 . LEU C 1 412 ? 5.422   39.071  19.361  1.00 84.47  ? 408  LEU C CD2 1 
ATOM   10419 N N   . ARG C 1 413 ? 9.477   42.368  19.597  1.00 85.90  ? 409  ARG C N   1 
ATOM   10420 C CA  . ARG C 1 413 ? 10.601  42.930  20.346  1.00 86.74  ? 409  ARG C CA  1 
ATOM   10421 C C   . ARG C 1 413 ? 10.776  42.215  21.688  1.00 86.33  ? 409  ARG C C   1 
ATOM   10422 O O   . ARG C 1 413 ? 9.796   42.013  22.410  1.00 87.77  ? 409  ARG C O   1 
ATOM   10423 C CB  . ARG C 1 413 ? 10.355  44.426  20.573  1.00 90.69  ? 409  ARG C CB  1 
ATOM   10424 C CG  . ARG C 1 413 ? 11.463  45.167  21.308  1.00 92.67  ? 409  ARG C CG  1 
ATOM   10425 C CD  . ARG C 1 413 ? 10.962  46.477  21.906  1.00 97.73  ? 409  ARG C CD  1 
ATOM   10426 N NE  . ARG C 1 413 ? 10.666  47.486  20.888  1.00 100.45 ? 409  ARG C NE  1 
ATOM   10427 C CZ  . ARG C 1 413 ? 11.501  48.453  20.512  1.00 102.56 ? 409  ARG C CZ  1 
ATOM   10428 N NH1 . ARG C 1 413 ? 12.703  48.561  21.064  1.00 102.63 ? 409  ARG C NH1 1 
ATOM   10429 N NH2 . ARG C 1 413 ? 11.132  49.318  19.578  1.00 104.94 ? 409  ARG C NH2 1 
ATOM   10430 N N   . PHE C 1 414 ? 12.013  41.836  22.022  1.00 84.79  ? 410  PHE C N   1 
ATOM   10431 C CA  . PHE C 1 414 ? 12.296  41.234  23.336  1.00 84.89  ? 410  PHE C CA  1 
ATOM   10432 C C   . PHE C 1 414 ? 13.589  41.710  24.013  1.00 85.77  ? 410  PHE C C   1 
ATOM   10433 O O   . PHE C 1 414 ? 14.565  42.062  23.346  1.00 85.09  ? 410  PHE C O   1 
ATOM   10434 C CB  . PHE C 1 414 ? 12.209  39.696  23.292  1.00 82.21  ? 410  PHE C CB  1 
ATOM   10435 C CG  . PHE C 1 414 ? 13.468  39.012  22.832  1.00 79.52  ? 410  PHE C CG  1 
ATOM   10436 C CD1 . PHE C 1 414 ? 13.634  38.659  21.498  1.00 77.15  ? 410  PHE C CD1 1 
ATOM   10437 C CD2 . PHE C 1 414 ? 14.470  38.682  23.742  1.00 79.53  ? 410  PHE C CD2 1 
ATOM   10438 C CE1 . PHE C 1 414 ? 14.788  38.009  21.071  1.00 75.23  ? 410  PHE C CE1 1 
ATOM   10439 C CE2 . PHE C 1 414 ? 15.628  38.036  23.323  1.00 77.64  ? 410  PHE C CE2 1 
ATOM   10440 C CZ  . PHE C 1 414 ? 15.787  37.699  21.985  1.00 75.56  ? 410  PHE C CZ  1 
ATOM   10441 N N   . LYS C 1 415 ? 13.569  41.704  25.346  1.00 87.59  ? 411  LYS C N   1 
ATOM   10442 C CA  . LYS C 1 415 ? 14.624  42.288  26.175  1.00 89.27  ? 411  LYS C CA  1 
ATOM   10443 C C   . LYS C 1 415 ? 15.529  41.212  26.784  1.00 87.79  ? 411  LYS C C   1 
ATOM   10444 O O   . LYS C 1 415 ? 16.694  41.090  26.399  1.00 86.52  ? 411  LYS C O   1 
ATOM   10445 C CB  . LYS C 1 415 ? 13.991  43.176  27.264  1.00 93.21  ? 411  LYS C CB  1 
ATOM   10446 C CG  . LYS C 1 415 ? 14.943  43.828  28.269  1.00 95.63  ? 411  LYS C CG  1 
ATOM   10447 C CD  . LYS C 1 415 ? 14.142  44.522  29.379  1.00 99.72  ? 411  LYS C CD  1 
ATOM   10448 C CE  . LYS C 1 415 ? 14.993  44.874  30.598  1.00 102.06 ? 411  LYS C CE  1 
ATOM   10449 N NZ  . LYS C 1 415 ? 15.842  46.078  30.387  1.00 103.68 ? 411  LYS C NZ  1 
ATOM   10450 N N   . THR C 1 416 ? 14.986  40.432  27.719  1.00 88.34  ? 412  THR C N   1 
ATOM   10451 C CA  . THR C 1 416 ? 15.768  39.444  28.471  1.00 87.82  ? 412  THR C CA  1 
ATOM   10452 C C   . THR C 1 416 ? 15.566  38.022  27.953  1.00 85.12  ? 412  THR C C   1 
ATOM   10453 O O   . THR C 1 416 ? 14.628  37.756  27.198  1.00 83.96  ? 412  THR C O   1 
ATOM   10454 C CB  . THR C 1 416 ? 15.438  39.480  29.984  1.00 91.07  ? 412  THR C CB  1 
ATOM   10455 O OG1 . THR C 1 416 ? 14.076  39.084  30.193  1.00 92.03  ? 412  THR C OG1 1 
ATOM   10456 C CG2 . THR C 1 416 ? 15.659  40.876  30.561  1.00 94.14  ? 412  THR C CG2 1 
ATOM   10457 N N   . MET C 1 417 ? 16.451  37.115  28.368  1.00 84.51  ? 413  MET C N   1 
ATOM   10458 C CA  . MET C 1 417 ? 16.366  35.707  27.982  1.00 82.50  ? 413  MET C CA  1 
ATOM   10459 C C   . MET C 1 417 ? 15.177  35.016  28.648  1.00 83.78  ? 413  MET C C   1 
ATOM   10460 O O   . MET C 1 417 ? 14.542  34.149  28.048  1.00 82.36  ? 413  MET C O   1 
ATOM   10461 C CB  . MET C 1 417 ? 17.659  34.969  28.332  1.00 82.30  ? 413  MET C CB  1 
ATOM   10462 C CG  . MET C 1 417 ? 17.936  33.759  27.442  1.00 80.19  ? 413  MET C CG  1 
ATOM   10463 S SD  . MET C 1 417 ? 19.022  32.518  28.176  1.00 81.45  ? 413  MET C SD  1 
ATOM   10464 C CE  . MET C 1 417 ? 20.428  33.514  28.680  1.00 82.92  ? 413  MET C CE  1 
ATOM   10465 N N   . ASP C 1 418 ? 14.885  35.408  29.888  1.00 86.79  ? 414  ASP C N   1 
ATOM   10466 C CA  . ASP C 1 418 ? 13.727  34.895  30.621  1.00 88.92  ? 414  ASP C CA  1 
ATOM   10467 C C   . ASP C 1 418 ? 12.402  35.329  29.994  1.00 88.81  ? 414  ASP C C   1 
ATOM   10468 O O   . ASP C 1 418 ? 11.386  34.655  30.161  1.00 89.89  ? 414  ASP C O   1 
ATOM   10469 C CB  . ASP C 1 418 ? 13.774  35.334  32.088  1.00 92.82  ? 414  ASP C CB  1 
ATOM   10470 C CG  . ASP C 1 418 ? 14.734  34.503  32.922  1.00 93.77  ? 414  ASP C CG  1 
ATOM   10471 O OD1 . ASP C 1 418 ? 14.742  33.260  32.782  1.00 92.96  ? 414  ASP C OD1 1 
ATOM   10472 O OD2 . ASP C 1 418 ? 15.473  35.096  33.734  1.00 95.80  ? 414  ASP C OD2 1 
ATOM   10473 N N   . GLU C 1 419 ? 12.424  36.451  29.276  1.00 87.89  ? 415  GLU C N   1 
ATOM   10474 C CA  . GLU C 1 419 ? 11.231  36.984  28.623  1.00 88.08  ? 415  GLU C CA  1 
ATOM   10475 C C   . GLU C 1 419 ? 10.775  36.114  27.451  1.00 85.22  ? 415  GLU C C   1 
ATOM   10476 O O   . GLU C 1 419 ? 9.612   35.713  27.397  1.00 86.18  ? 415  GLU C O   1 
ATOM   10477 C CB  . GLU C 1 419 ? 11.465  38.423  28.157  1.00 88.44  ? 415  GLU C CB  1 
ATOM   10478 C CG  . GLU C 1 419 ? 10.208  39.128  27.660  1.00 89.79  ? 415  GLU C CG  1 
ATOM   10479 C CD  . GLU C 1 419 ? 10.508  40.415  26.913  1.00 89.90  ? 415  GLU C CD  1 
ATOM   10480 O OE1 . GLU C 1 419 ? 11.465  41.124  27.289  1.00 90.82  ? 415  GLU C OE1 1 
ATOM   10481 O OE2 . GLU C 1 419 ? 9.779   40.721  25.947  1.00 89.44  ? 415  GLU C OE2 1 
ATOM   10482 N N   . VAL C 1 420 ? 11.690  35.828  26.524  1.00 82.06  ? 416  VAL C N   1 
ATOM   10483 C CA  . VAL C 1 420 ? 11.378  35.012  25.344  1.00 79.39  ? 416  VAL C CA  1 
ATOM   10484 C C   . VAL C 1 420 ? 10.936  33.597  25.681  1.00 79.54  ? 416  VAL C C   1 
ATOM   10485 O O   . VAL C 1 420 ? 10.088  33.036  24.992  1.00 78.90  ? 416  VAL C O   1 
ATOM   10486 C CB  . VAL C 1 420 ? 12.548  34.933  24.329  1.00 76.59  ? 416  VAL C CB  1 
ATOM   10487 C CG1 . VAL C 1 420 ? 12.277  35.823  23.139  1.00 75.64  ? 416  VAL C CG1 1 
ATOM   10488 C CG2 . VAL C 1 420 ? 13.888  35.250  24.985  1.00 76.91  ? 416  VAL C CG2 1 
ATOM   10489 N N   . ILE C 1 421 ? 11.511  33.026  26.736  1.00 80.78  ? 417  ILE C N   1 
ATOM   10490 C CA  . ILE C 1 421 ? 11.185  31.661  27.152  1.00 81.67  ? 417  ILE C CA  1 
ATOM   10491 C C   . ILE C 1 421 ? 9.707   31.523  27.537  1.00 84.24  ? 417  ILE C C   1 
ATOM   10492 O O   . ILE C 1 421 ? 9.021   30.620  27.059  1.00 83.97  ? 417  ILE C O   1 
ATOM   10493 C CB  . ILE C 1 421 ? 12.124  31.163  28.289  1.00 83.17  ? 417  ILE C CB  1 
ATOM   10494 C CG1 . ILE C 1 421 ? 13.550  30.984  27.756  1.00 80.77  ? 417  ILE C CG1 1 
ATOM   10495 C CG2 . ILE C 1 421 ? 11.617  29.848  28.889  1.00 85.15  ? 417  ILE C CG2 1 
ATOM   10496 C CD1 . ILE C 1 421 ? 14.617  30.849  28.833  1.00 82.54  ? 417  ILE C CD1 1 
ATOM   10497 N N   . GLU C 1 422 ? 9.221   32.432  28.379  1.00 87.07  ? 418  GLU C N   1 
ATOM   10498 C CA  . GLU C 1 422 ? 7.830   32.402  28.827  1.00 90.32  ? 418  GLU C CA  1 
ATOM   10499 C C   . GLU C 1 422 ? 6.847   32.870  27.755  1.00 89.39  ? 418  GLU C C   1 
ATOM   10500 O O   . GLU C 1 422 ? 5.696   32.433  27.736  1.00 91.26  ? 418  GLU C O   1 
ATOM   10501 C CB  . GLU C 1 422 ? 7.654   33.215  30.116  1.00 94.27  ? 418  GLU C CB  1 
ATOM   10502 C CG  . GLU C 1 422 ? 7.793   32.398  31.407  1.00 97.95  ? 418  GLU C CG  1 
ATOM   10503 C CD  . GLU C 1 422 ? 9.140   31.684  31.537  1.00 96.91  ? 418  GLU C CD  1 
ATOM   10504 O OE1 . GLU C 1 422 ? 10.181  32.371  31.642  1.00 96.10  ? 418  GLU C OE1 1 
ATOM   10505 O OE2 . GLU C 1 422 ? 9.152   30.432  31.542  1.00 97.11  ? 418  GLU C OE2 1 
ATOM   10506 N N   . ARG C 1 423 ? 7.300   33.749  26.867  1.00 86.94  ? 419  ARG C N   1 
ATOM   10507 C CA  . ARG C 1 423 ? 6.444   34.250  25.793  1.00 86.27  ? 419  ARG C CA  1 
ATOM   10508 C C   . ARG C 1 423 ? 6.323   33.253  24.643  1.00 83.62  ? 419  ARG C C   1 
ATOM   10509 O O   . ARG C 1 423 ? 5.262   33.143  24.024  1.00 84.18  ? 419  ARG C O   1 
ATOM   10510 C CB  . ARG C 1 423 ? 6.926   35.611  25.284  1.00 85.47  ? 419  ARG C CB  1 
ATOM   10511 C CG  . ARG C 1 423 ? 6.724   36.756  26.279  1.00 88.80  ? 419  ARG C CG  1 
ATOM   10512 C CD  . ARG C 1 423 ? 6.442   38.082  25.579  1.00 89.14  ? 419  ARG C CD  1 
ATOM   10513 N NE  . ARG C 1 423 ? 7.526   38.498  24.691  1.00 86.21  ? 419  ARG C NE  1 
ATOM   10514 C CZ  . ARG C 1 423 ? 7.408   39.410  23.728  1.00 85.83  ? 419  ARG C CZ  1 
ATOM   10515 N NH1 . ARG C 1 423 ? 6.248   40.015  23.510  1.00 88.05  ? 419  ARG C NH1 1 
ATOM   10516 N NH2 . ARG C 1 423 ? 8.456   39.713  22.974  1.00 83.72  ? 419  ARG C NH2 1 
ATOM   10517 N N   . ALA C 1 424 ? 7.406   32.531  24.365  1.00 81.14  ? 420  ALA C N   1 
ATOM   10518 C CA  . ALA C 1 424 ? 7.409   31.516  23.311  1.00 78.94  ? 420  ALA C CA  1 
ATOM   10519 C C   . ALA C 1 424 ? 6.697   30.237  23.744  1.00 80.67  ? 420  ALA C C   1 
ATOM   10520 O O   . ALA C 1 424 ? 6.063   29.569  22.925  1.00 80.06  ? 420  ALA C O   1 
ATOM   10521 C CB  . ALA C 1 424 ? 8.828   31.209  22.866  1.00 76.21  ? 420  ALA C CB  1 
ATOM   10522 N N   . ASN C 1 425 ? 6.808   29.904  25.030  1.00 83.29  ? 421  ASN C N   1 
ATOM   10523 C CA  . ASN C 1 425 ? 6.171   28.710  25.598  1.00 85.88  ? 421  ASN C CA  1 
ATOM   10524 C C   . ASN C 1 425 ? 4.653   28.812  25.724  1.00 88.97  ? 421  ASN C C   1 
ATOM   10525 O O   . ASN C 1 425 ? 3.963   27.788  25.770  1.00 90.72  ? 421  ASN C O   1 
ATOM   10526 C CB  . ASN C 1 425 ? 6.777   28.362  26.964  1.00 88.11  ? 421  ASN C CB  1 
ATOM   10527 C CG  . ASN C 1 425 ? 8.037   27.519  26.855  1.00 86.20  ? 421  ASN C CG  1 
ATOM   10528 O OD1 . ASN C 1 425 ? 8.440   27.108  25.765  1.00 83.26  ? 421  ASN C OD1 1 
ATOM   10529 N ND2 . ASN C 1 425 ? 8.663   27.251  27.995  1.00 88.20  ? 421  ASN C ND2 1 
ATOM   10530 N N   . ASN C 1 426 ? 4.143   30.042  25.787  1.00 90.14  ? 422  ASN C N   1 
ATOM   10531 C CA  . ASN C 1 426 ? 2.706   30.288  25.914  1.00 93.59  ? 422  ASN C CA  1 
ATOM   10532 C C   . ASN C 1 426 ? 1.944   29.843  24.663  1.00 92.51  ? 422  ASN C C   1 
ATOM   10533 O O   . ASN C 1 426 ? 1.632   30.648  23.779  1.00 91.34  ? 422  ASN C O   1 
ATOM   10534 C CB  . ASN C 1 426 ? 2.429   31.761  26.245  1.00 95.12  ? 422  ASN C CB  1 
ATOM   10535 C CG  . ASN C 1 426 ? 1.044   31.979  26.832  1.00 99.81  ? 422  ASN C CG  1 
ATOM   10536 O OD1 . ASN C 1 426 ? 0.038   31.916  26.126  1.00 100.43 ? 422  ASN C OD1 1 
ATOM   10537 N ND2 . ASN C 1 426 ? 0.989   32.244  28.131  1.00 103.41 ? 422  ASN C ND2 1 
ATOM   10538 N N   . SER C 1 427 ? 1.661   28.543  24.606  1.00 93.33  ? 423  SER C N   1 
ATOM   10539 C CA  . SER C 1 427 ? 0.999   27.917  23.470  1.00 92.56  ? 423  SER C CA  1 
ATOM   10540 C C   . SER C 1 427 ? 0.325   26.629  23.908  1.00 95.80  ? 423  SER C C   1 
ATOM   10541 O O   . SER C 1 427 ? 0.789   25.957  24.832  1.00 97.34  ? 423  SER C O   1 
ATOM   10542 C CB  . SER C 1 427 ? 2.014   27.602  22.369  1.00 88.10  ? 423  SER C CB  1 
ATOM   10543 O OG  . SER C 1 427 ? 1.440   26.806  21.344  1.00 87.51  ? 423  SER C OG  1 
ATOM   10544 N N   . ASP C 1 428 ? -0.770  26.292  23.237  1.00 97.29  ? 424  ASP C N   1 
ATOM   10545 C CA  . ASP C 1 428 ? -1.425  25.008  23.436  1.00 100.50 ? 424  ASP C CA  1 
ATOM   10546 C C   . ASP C 1 428 ? -0.730  23.935  22.598  1.00 97.80  ? 424  ASP C C   1 
ATOM   10547 O O   . ASP C 1 428 ? 0.060   24.258  21.705  1.00 93.63  ? 424  ASP C O   1 
ATOM   10548 C CB  . ASP C 1 428 ? -2.915  25.108  23.098  1.00 103.67 ? 424  ASP C CB  1 
ATOM   10549 C CG  . ASP C 1 428 ? -3.694  25.936  24.115  1.00 107.99 ? 424  ASP C CG  1 
ATOM   10550 O OD1 . ASP C 1 428 ? -3.181  26.171  25.233  1.00 109.29 ? 424  ASP C OD1 1 
ATOM   10551 O OD2 . ASP C 1 428 ? -4.830  26.347  23.797  1.00 110.49 ? 424  ASP C OD2 1 
ATOM   10552 N N   . PHE C 1 429 ? -1.024  22.669  22.902  1.00 100.69 ? 425  PHE C N   1 
ATOM   10553 C CA  . PHE C 1 429 ? -0.377  21.500  22.278  1.00 99.22  ? 425  PHE C CA  1 
ATOM   10554 C C   . PHE C 1 429 ? 0.133   21.702  20.848  1.00 94.66  ? 425  PHE C C   1 
ATOM   10555 O O   . PHE C 1 429 ? -0.643  21.964  19.926  1.00 94.32  ? 425  PHE C O   1 
ATOM   10556 C CB  . PHE C 1 429 ? -1.292  20.272  22.339  1.00 103.35 ? 425  PHE C CB  1 
ATOM   10557 C CG  . PHE C 1 429 ? -0.952  19.316  23.449  1.00 107.01 ? 425  PHE C CG  1 
ATOM   10558 C CD1 . PHE C 1 429 ? -1.657  19.338  24.651  1.00 112.19 ? 425  PHE C CD1 1 
ATOM   10559 C CD2 . PHE C 1 429 ? 0.077   18.389  23.293  1.00 105.87 ? 425  PHE C CD2 1 
ATOM   10560 C CE1 . PHE C 1 429 ? -1.343  18.450  25.682  1.00 115.89 ? 425  PHE C CE1 1 
ATOM   10561 C CE2 . PHE C 1 429 ? 0.400   17.497  24.317  1.00 109.64 ? 425  PHE C CE2 1 
ATOM   10562 C CZ  . PHE C 1 429 ? -0.312  17.528  25.514  1.00 114.59 ? 425  PHE C CZ  1 
ATOM   10563 N N   . GLY C 1 430 ? 1.447   21.571  20.683  1.00 91.61  ? 426  GLY C N   1 
ATOM   10564 C CA  . GLY C 1 430 ? 2.093   21.732  19.386  1.00 87.54  ? 426  GLY C CA  1 
ATOM   10565 C C   . GLY C 1 430 ? 3.028   22.923  19.370  1.00 84.39  ? 426  GLY C C   1 
ATOM   10566 O O   . GLY C 1 430 ? 2.579   24.073  19.401  1.00 84.29  ? 426  GLY C O   1 
ATOM   10567 N N   . LEU C 1 431 ? 4.331   22.643  19.332  1.00 82.19  ? 427  LEU C N   1 
ATOM   10568 C CA  . LEU C 1 431 ? 5.348   23.691  19.258  1.00 79.28  ? 427  LEU C CA  1 
ATOM   10569 C C   . LEU C 1 431 ? 6.623   23.230  18.543  1.00 76.70  ? 427  LEU C C   1 
ATOM   10570 O O   . LEU C 1 431 ? 7.049   22.079  18.677  1.00 77.55  ? 427  LEU C O   1 
ATOM   10571 C CB  . LEU C 1 431 ? 5.679   24.227  20.659  1.00 80.67  ? 427  LEU C CB  1 
ATOM   10572 C CG  . LEU C 1 431 ? 6.255   25.646  20.771  1.00 79.02  ? 427  LEU C CG  1 
ATOM   10573 C CD1 . LEU C 1 431 ? 5.190   26.697  20.507  1.00 79.75  ? 427  LEU C CD1 1 
ATOM   10574 C CD2 . LEU C 1 431 ? 6.881   25.876  22.138  1.00 80.49  ? 427  LEU C CD2 1 
ATOM   10575 N N   . VAL C 1 432 ? 7.200   24.146  17.766  1.00 73.88  ? 428  VAL C N   1 
ATOM   10576 C CA  . VAL C 1 432 ? 8.507   23.976  17.129  1.00 71.55  ? 428  VAL C CA  1 
ATOM   10577 C C   . VAL C 1 432 ? 9.306   25.255  17.403  1.00 70.15  ? 428  VAL C C   1 
ATOM   10578 O O   . VAL C 1 432 ? 8.774   26.357  17.279  1.00 70.01  ? 428  VAL C O   1 
ATOM   10579 C CB  . VAL C 1 432 ? 8.380   23.747  15.595  1.00 70.21  ? 428  VAL C CB  1 
ATOM   10580 C CG1 . VAL C 1 432 ? 9.753   23.616  14.940  1.00 68.55  ? 428  VAL C CG1 1 
ATOM   10581 C CG2 . VAL C 1 432 ? 7.529   22.519  15.287  1.00 71.82  ? 428  VAL C CG2 1 
ATOM   10582 N N   . ALA C 1 433 ? 10.574  25.115  17.783  1.00 69.42  ? 429  ALA C N   1 
ATOM   10583 C CA  . ALA C 1 433 ? 11.402  26.274  18.124  1.00 68.34  ? 429  ALA C CA  1 
ATOM   10584 C C   . ALA C 1 433 ? 12.596  26.472  17.183  1.00 66.54  ? 429  ALA C C   1 
ATOM   10585 O O   . ALA C 1 433 ? 13.052  25.528  16.540  1.00 66.30  ? 429  ALA C O   1 
ATOM   10586 C CB  . ALA C 1 433 ? 11.868  26.176  19.566  1.00 69.85  ? 429  ALA C CB  1 
ATOM   10587 N N   . ALA C 1 434 ? 13.093  27.706  17.112  1.00 65.71  ? 430  ALA C N   1 
ATOM   10588 C CA  . ALA C 1 434 ? 14.236  28.053  16.266  1.00 64.48  ? 430  ALA C CA  1 
ATOM   10589 C C   . ALA C 1 434 ? 15.055  29.192  16.869  1.00 64.64  ? 430  ALA C C   1 
ATOM   10590 O O   . ALA C 1 434 ? 14.606  30.341  16.896  1.00 64.91  ? 430  ALA C O   1 
ATOM   10591 C CB  . ALA C 1 434 ? 13.765  28.425  14.870  1.00 63.73  ? 430  ALA C CB  1 
ATOM   10592 N N   . VAL C 1 435 ? 16.258  28.868  17.341  1.00 64.73  ? 431  VAL C N   1 
ATOM   10593 C CA  . VAL C 1 435 ? 17.135  29.856  17.982  1.00 65.15  ? 431  VAL C CA  1 
ATOM   10594 C C   . VAL C 1 435 ? 18.333  30.220  17.101  1.00 64.84  ? 431  VAL C C   1 
ATOM   10595 O O   . VAL C 1 435 ? 18.913  29.358  16.439  1.00 64.65  ? 431  VAL C O   1 
ATOM   10596 C CB  . VAL C 1 435 ? 17.670  29.375  19.354  1.00 66.32  ? 431  VAL C CB  1 
ATOM   10597 C CG1 . VAL C 1 435 ? 17.721  30.537  20.332  1.00 67.14  ? 431  VAL C CG1 1 
ATOM   10598 C CG2 . VAL C 1 435 ? 16.818  28.249  19.917  1.00 67.10  ? 431  VAL C CG2 1 
ATOM   10599 N N   . PHE C 1 436 ? 18.696  31.502  17.110  1.00 65.15  ? 432  PHE C N   1 
ATOM   10600 C CA  . PHE C 1 436 ? 19.865  31.992  16.380  1.00 65.47  ? 432  PHE C CA  1 
ATOM   10601 C C   . PHE C 1 436 ? 20.855  32.681  17.324  1.00 66.82  ? 432  PHE C C   1 
ATOM   10602 O O   . PHE C 1 436 ? 20.634  33.812  17.772  1.00 67.49  ? 432  PHE C O   1 
ATOM   10603 C CB  . PHE C 1 436 ? 19.444  32.909  15.225  1.00 65.42  ? 432  PHE C CB  1 
ATOM   10604 C CG  . PHE C 1 436 ? 18.734  32.189  14.111  1.00 64.01  ? 432  PHE C CG  1 
ATOM   10605 C CD1 . PHE C 1 436 ? 17.352  32.029  14.134  1.00 63.04  ? 432  PHE C CD1 1 
ATOM   10606 C CD2 . PHE C 1 436 ? 19.450  31.665  13.041  1.00 64.07  ? 432  PHE C CD2 1 
ATOM   10607 C CE1 . PHE C 1 436 ? 16.692  31.360  13.108  1.00 62.32  ? 432  PHE C CE1 1 
ATOM   10608 C CE2 . PHE C 1 436 ? 18.800  30.992  12.009  1.00 63.39  ? 432  PHE C CE2 1 
ATOM   10609 C CZ  . PHE C 1 436 ? 17.417  30.840  12.044  1.00 62.47  ? 432  PHE C CZ  1 
ATOM   10610 N N   . THR C 1 437 ? 21.940  31.969  17.627  1.00 67.39  ? 433  THR C N   1 
ATOM   10611 C CA  . THR C 1 437 ? 22.929  32.403  18.612  1.00 68.90  ? 433  THR C CA  1 
ATOM   10612 C C   . THR C 1 437 ? 24.312  31.862  18.262  1.00 70.01  ? 433  THR C C   1 
ATOM   10613 O O   . THR C 1 437 ? 24.437  30.854  17.565  1.00 69.57  ? 433  THR C O   1 
ATOM   10614 C CB  . THR C 1 437 ? 22.575  31.887  20.031  1.00 69.07  ? 433  THR C CB  1 
ATOM   10615 O OG1 . THR C 1 437 ? 21.164  31.670  20.141  1.00 68.16  ? 433  THR C OG1 1 
ATOM   10616 C CG2 . THR C 1 437 ? 23.005  32.876  21.093  1.00 70.61  ? 433  THR C CG2 1 
ATOM   10617 N N   . ASN C 1 438 ? 25.347  32.545  18.741  1.00 71.82  ? 434  ASN C N   1 
ATOM   10618 C CA  . ASN C 1 438 ? 26.700  31.996  18.748  1.00 73.48  ? 434  ASN C CA  1 
ATOM   10619 C C   . ASN C 1 438 ? 27.212  31.848  20.182  1.00 74.83  ? 434  ASN C C   1 
ATOM   10620 O O   . ASN C 1 438 ? 28.410  31.689  20.412  1.00 76.79  ? 434  ASN C O   1 
ATOM   10621 C CB  . ASN C 1 438 ? 27.649  32.851  17.904  1.00 75.19  ? 434  ASN C CB  1 
ATOM   10622 C CG  . ASN C 1 438 ? 27.380  32.725  16.417  1.00 74.58  ? 434  ASN C CG  1 
ATOM   10623 O OD1 . ASN C 1 438 ? 26.854  31.715  15.951  1.00 73.18  ? 434  ASN C OD1 1 
ATOM   10624 N ND2 . ASN C 1 438 ? 27.746  33.753  15.663  1.00 76.12  ? 434  ASN C ND2 1 
ATOM   10625 N N   . ASP C 1 439 ? 26.280  31.900  21.134  1.00 74.15  ? 435  ASP C N   1 
ATOM   10626 C CA  . ASP C 1 439 ? 26.564  31.736  22.559  1.00 75.56  ? 435  ASP C CA  1 
ATOM   10627 C C   . ASP C 1 439 ? 26.061  30.367  23.017  1.00 75.02  ? 435  ASP C C   1 
ATOM   10628 O O   . ASP C 1 439 ? 24.866  30.083  22.923  1.00 73.63  ? 435  ASP C O   1 
ATOM   10629 C CB  . ASP C 1 439 ? 25.886  32.857  23.358  1.00 75.93  ? 435  ASP C CB  1 
ATOM   10630 C CG  . ASP C 1 439 ? 26.249  32.840  24.835  1.00 78.19  ? 435  ASP C CG  1 
ATOM   10631 O OD1 . ASP C 1 439 ? 25.846  31.898  25.554  1.00 78.66  ? 435  ASP C OD1 1 
ATOM   10632 O OD2 . ASP C 1 439 ? 26.921  33.793  25.282  1.00 80.23  ? 435  ASP C OD2 1 
ATOM   10633 N N   . ILE C 1 440 ? 26.969  29.528  23.513  1.00 76.59  ? 436  ILE C N   1 
ATOM   10634 C CA  . ILE C 1 440 ? 26.627  28.152  23.895  1.00 76.81  ? 436  ILE C CA  1 
ATOM   10635 C C   . ILE C 1 440 ? 25.617  28.123  25.036  1.00 76.95  ? 436  ILE C C   1 
ATOM   10636 O O   . ILE C 1 440 ? 24.573  27.475  24.931  1.00 76.06  ? 436  ILE C O   1 
ATOM   10637 C CB  . ILE C 1 440 ? 27.872  27.307  24.282  1.00 79.27  ? 436  ILE C CB  1 
ATOM   10638 C CG1 . ILE C 1 440 ? 28.973  27.443  23.232  1.00 79.93  ? 436  ILE C CG1 1 
ATOM   10639 C CG2 . ILE C 1 440 ? 27.496  25.835  24.444  1.00 79.74  ? 436  ILE C CG2 1 
ATOM   10640 C CD1 . ILE C 1 440 ? 30.342  27.023  23.719  1.00 83.38  ? 436  ILE C CD1 1 
ATOM   10641 N N   . ASN C 1 441 ? 25.931  28.836  26.114  1.00 78.15  ? 437  ASN C N   1 
ATOM   10642 C CA  . ASN C 1 441 ? 25.082  28.860  27.299  1.00 76.93  ? 437  ASN C CA  1 
ATOM   10643 C C   . ASN C 1 441 ? 23.677  29.390  27.024  1.00 75.00  ? 437  ASN C C   1 
ATOM   10644 O O   . ASN C 1 441 ? 22.705  28.894  27.593  1.00 73.97  ? 437  ASN C O   1 
ATOM   10645 C CB  . ASN C 1 441 ? 25.758  29.637  28.431  1.00 77.79  ? 437  ASN C CB  1 
ATOM   10646 C CG  . ASN C 1 441 ? 26.913  28.868  29.058  1.00 79.54  ? 437  ASN C CG  1 
ATOM   10647 O OD1 . ASN C 1 441 ? 26.907  27.637  29.105  1.00 79.54  ? 437  ASN C OD1 1 
ATOM   10648 N ND2 . ASN C 1 441 ? 27.906  29.595  29.549  1.00 80.86  ? 437  ASN C ND2 1 
ATOM   10649 N N   . LYS C 1 442 ? 23.579  30.380  26.140  1.00 74.74  ? 438  LYS C N   1 
ATOM   10650 C CA  . LYS C 1 442 ? 22.285  30.918  25.725  1.00 73.22  ? 438  LYS C CA  1 
ATOM   10651 C C   . LYS C 1 442 ? 21.483  29.882  24.937  1.00 72.56  ? 438  LYS C C   1 
ATOM   10652 O O   . LYS C 1 442 ? 20.315  29.640  25.240  1.00 71.47  ? 438  LYS C O   1 
ATOM   10653 C CB  . LYS C 1 442 ? 22.453  32.210  24.915  1.00 73.40  ? 438  LYS C CB  1 
ATOM   10654 C CG  . LYS C 1 442 ? 22.780  33.439  25.756  1.00 73.65  ? 438  LYS C CG  1 
ATOM   10655 C CD  . LYS C 1 442 ? 22.526  34.731  24.992  1.00 73.55  ? 438  LYS C CD  1 
ATOM   10656 C CE  . LYS C 1 442 ? 22.702  35.949  25.889  1.00 73.47  ? 438  LYS C CE  1 
ATOM   10657 N NZ  . LYS C 1 442 ? 22.378  37.217  25.179  1.00 73.36  ? 438  LYS C NZ  1 
ATOM   10658 N N   . ALA C 1 443 ? 22.122  29.264  23.946  1.00 73.41  ? 439  ALA C N   1 
ATOM   10659 C CA  . ALA C 1 443 ? 21.468  28.273  23.091  1.00 73.02  ? 439  ALA C CA  1 
ATOM   10660 C C   . ALA C 1 443 ? 20.934  27.083  23.881  1.00 72.48  ? 439  ALA C C   1 
ATOM   10661 O O   . ALA C 1 443 ? 19.776  26.695  23.716  1.00 71.41  ? 439  ALA C O   1 
ATOM   10662 C CB  . ALA C 1 443 ? 22.411  27.805  22.004  1.00 74.40  ? 439  ALA C CB  1 
ATOM   10663 N N   . LEU C 1 444 ? 21.780  26.517  24.740  1.00 73.40  ? 440  LEU C N   1 
ATOM   10664 C CA  . LEU C 1 444 ? 21.403  25.369  25.561  1.00 73.23  ? 440  LEU C CA  1 
ATOM   10665 C C   . LEU C 1 444 ? 20.233  25.677  26.499  1.00 72.11  ? 440  LEU C C   1 
ATOM   10666 O O   . LEU C 1 444 ? 19.289  24.890  26.587  1.00 71.34  ? 440  LEU C O   1 
ATOM   10667 C CB  . LEU C 1 444 ? 22.607  24.840  26.349  1.00 74.71  ? 440  LEU C CB  1 
ATOM   10668 C CG  . LEU C 1 444 ? 23.616  23.967  25.595  1.00 76.10  ? 440  LEU C CG  1 
ATOM   10669 C CD1 . LEU C 1 444 ? 24.926  23.908  26.356  1.00 77.98  ? 440  LEU C CD1 1 
ATOM   10670 C CD2 . LEU C 1 444 ? 23.081  22.558  25.342  1.00 75.72  ? 440  LEU C CD2 1 
ATOM   10671 N N   . THR C 1 445 ? 20.297  26.825  27.177  1.00 72.09  ? 441  THR C N   1 
ATOM   10672 C CA  . THR C 1 445 ? 19.225  27.277  28.073  1.00 71.22  ? 441  THR C CA  1 
ATOM   10673 C C   . THR C 1 445 ? 17.892  27.405  27.340  1.00 69.97  ? 441  THR C C   1 
ATOM   10674 O O   . THR C 1 445 ? 16.866  26.920  27.820  1.00 69.38  ? 441  THR C O   1 
ATOM   10675 C CB  . THR C 1 445 ? 19.565  28.634  28.736  1.00 71.42  ? 441  THR C CB  1 
ATOM   10676 O OG1 . THR C 1 445 ? 20.794  28.518  29.459  1.00 72.95  ? 441  THR C OG1 1 
ATOM   10677 C CG2 . THR C 1 445 ? 18.462  29.070  29.697  1.00 70.67  ? 441  THR C CG2 1 
ATOM   10678 N N   . VAL C 1 446 ? 17.922  28.053  26.177  1.00 69.79  ? 442  VAL C N   1 
ATOM   10679 C CA  . VAL C 1 446 ? 16.715  28.313  25.397  1.00 68.97  ? 442  VAL C CA  1 
ATOM   10680 C C   . VAL C 1 446 ? 16.133  27.031  24.798  1.00 68.77  ? 442  VAL C C   1 
ATOM   10681 O O   . VAL C 1 446 ? 14.931  26.792  24.899  1.00 68.10  ? 442  VAL C O   1 
ATOM   10682 C CB  . VAL C 1 446 ? 16.956  29.379  24.301  1.00 69.19  ? 442  VAL C CB  1 
ATOM   10683 C CG1 . VAL C 1 446 ? 15.776  29.451  23.343  1.00 68.66  ? 442  VAL C CG1 1 
ATOM   10684 C CG2 . VAL C 1 446 ? 17.206  30.745  24.937  1.00 69.22  ? 442  VAL C CG2 1 
ATOM   10685 N N   . SER C 1 447 ? 16.989  26.206  24.198  1.00 69.53  ? 443  SER C N   1 
ATOM   10686 C CA  . SER C 1 447 ? 16.546  24.953  23.584  1.00 69.45  ? 443  SER C CA  1 
ATOM   10687 C C   . SER C 1 447 ? 15.988  23.964  24.606  1.00 69.15  ? 443  SER C C   1 
ATOM   10688 O O   . SER C 1 447 ? 15.093  23.186  24.282  1.00 68.69  ? 443  SER C O   1 
ATOM   10689 C CB  . SER C 1 447 ? 17.673  24.300  22.776  1.00 70.43  ? 443  SER C CB  1 
ATOM   10690 O OG  . SER C 1 447 ? 18.673  23.760  23.618  1.00 71.24  ? 443  SER C OG  1 
ATOM   10691 N N   . SER C 1 448 ? 16.516  24.005  25.830  1.00 69.66  ? 444  SER C N   1 
ATOM   10692 C CA  . SER C 1 448 ? 16.118  23.078  26.901  1.00 69.72  ? 444  SER C CA  1 
ATOM   10693 C C   . SER C 1 448 ? 14.823  23.484  27.608  1.00 68.97  ? 444  SER C C   1 
ATOM   10694 O O   . SER C 1 448 ? 14.061  22.626  28.060  1.00 68.80  ? 444  SER C O   1 
ATOM   10695 C CB  . SER C 1 448 ? 17.242  22.930  27.928  1.00 70.73  ? 444  SER C CB  1 
ATOM   10696 O OG  . SER C 1 448 ? 17.555  24.179  28.519  1.00 71.02  ? 444  SER C OG  1 
ATOM   10697 N N   . ALA C 1 449 ? 14.589  24.792  27.705  1.00 68.64  ? 445  ALA C N   1 
ATOM   10698 C CA  . ALA C 1 449 ? 13.396  25.327  28.358  1.00 68.15  ? 445  ALA C CA  1 
ATOM   10699 C C   . ALA C 1 449 ? 12.194  25.433  27.411  1.00 67.50  ? 445  ALA C C   1 
ATOM   10700 O O   . ALA C 1 449 ? 11.065  25.653  27.864  1.00 67.31  ? 445  ALA C O   1 
ATOM   10701 C CB  . ALA C 1 449 ? 13.702  26.677  29.000  1.00 68.25  ? 445  ALA C CB  1 
ATOM   10702 N N   . MET C 1 450 ? 12.443  25.274  26.108  1.00 67.35  ? 446  MET C N   1 
ATOM   10703 C CA  . MET C 1 450 ? 11.382  25.263  25.092  1.00 66.94  ? 446  MET C CA  1 
ATOM   10704 C C   . MET C 1 450 ? 10.480  24.044  25.217  1.00 66.75  ? 446  MET C C   1 
ATOM   10705 O O   . MET C 1 450 ? 10.948  22.904  25.199  1.00 66.89  ? 446  MET C O   1 
ATOM   10706 C CB  . MET C 1 450 ? 11.966  25.299  23.677  1.00 67.21  ? 446  MET C CB  1 
ATOM   10707 C CG  . MET C 1 450 ? 12.361  26.670  23.162  1.00 67.52  ? 446  MET C CG  1 
ATOM   10708 S SD  . MET C 1 450 ? 11.080  27.921  23.306  1.00 67.12  ? 446  MET C SD  1 
ATOM   10709 C CE  . MET C 1 450 ? 11.662  28.815  24.743  1.00 67.20  ? 446  MET C CE  1 
ATOM   10710 N N   . GLN C 1 451 ? 9.182   24.293  25.330  1.00 66.53  ? 447  GLN C N   1 
ATOM   10711 C CA  . GLN C 1 451 ? 8.200   23.219  25.405  1.00 66.46  ? 447  GLN C CA  1 
ATOM   10712 C C   . GLN C 1 451 ? 7.780   22.825  23.991  1.00 66.38  ? 447  GLN C C   1 
ATOM   10713 O O   . GLN C 1 451 ? 6.594   22.823  23.644  1.00 66.48  ? 447  GLN C O   1 
ATOM   10714 C CB  . GLN C 1 451 ? 7.004   23.647  26.254  1.00 66.63  ? 447  GLN C CB  1 
ATOM   10715 C CG  . GLN C 1 451 ? 7.375   24.004  27.682  1.00 67.00  ? 447  GLN C CG  1 
ATOM   10716 C CD  . GLN C 1 451 ? 6.173   24.340  28.525  1.00 67.77  ? 447  GLN C CD  1 
ATOM   10717 O OE1 . GLN C 1 451 ? 5.439   25.286  28.234  1.00 67.88  ? 447  GLN C OE1 1 
ATOM   10718 N NE2 . GLN C 1 451 ? 5.963   23.568  29.585  1.00 68.39  ? 447  GLN C NE2 1 
ATOM   10719 N N   . ALA C 1 452 ? 8.782   22.490  23.185  1.00 66.31  ? 448  ALA C N   1 
ATOM   10720 C CA  . ALA C 1 452 ? 8.597   22.191  21.778  1.00 66.33  ? 448  ALA C CA  1 
ATOM   10721 C C   . ALA C 1 452 ? 9.042   20.773  21.478  1.00 66.32  ? 448  ALA C C   1 
ATOM   10722 O O   . ALA C 1 452 ? 9.947   20.251  22.128  1.00 66.34  ? 448  ALA C O   1 
ATOM   10723 C CB  . ALA C 1 452 ? 9.384   23.173  20.938  1.00 66.74  ? 448  ALA C CB  1 
ATOM   10724 N N   . GLY C 1 453 ? 8.396   20.157  20.492  1.00 66.42  ? 449  GLY C N   1 
ATOM   10725 C CA  . GLY C 1 453 ? 8.777   18.830  20.023  1.00 66.49  ? 449  GLY C CA  1 
ATOM   10726 C C   . GLY C 1 453 ? 10.146  18.850  19.372  1.00 66.92  ? 449  GLY C C   1 
ATOM   10727 O O   . GLY C 1 453 ? 11.011  18.038  19.700  1.00 67.11  ? 449  GLY C O   1 
ATOM   10728 N N   . THR C 1 454 ? 10.338  19.793  18.454  1.00 67.28  ? 450  THR C N   1 
ATOM   10729 C CA  . THR C 1 454 ? 11.608  19.957  17.751  1.00 67.92  ? 450  THR C CA  1 
ATOM   10730 C C   . THR C 1 454 ? 12.149  21.384  17.899  1.00 68.01  ? 450  THR C C   1 
ATOM   10731 O O   . THR C 1 454 ? 11.404  22.352  17.748  1.00 67.87  ? 450  THR C O   1 
ATOM   10732 C CB  . THR C 1 454 ? 11.503  19.526  16.256  1.00 68.75  ? 450  THR C CB  1 
ATOM   10733 O OG1 . THR C 1 454 ? 12.548  20.136  15.486  1.00 69.70  ? 450  THR C OG1 1 
ATOM   10734 C CG2 . THR C 1 454 ? 10.155  19.909  15.663  1.00 69.01  ? 450  THR C CG2 1 
ATOM   10735 N N   . VAL C 1 455 ? 13.441  21.495  18.219  1.00 68.34  ? 451  VAL C N   1 
ATOM   10736 C CA  . VAL C 1 455 ? 14.122  22.789  18.369  1.00 68.50  ? 451  VAL C CA  1 
ATOM   10737 C C   . VAL C 1 455 ? 15.318  22.905  17.423  1.00 69.77  ? 451  VAL C C   1 
ATOM   10738 O O   . VAL C 1 455 ? 16.272  22.127  17.513  1.00 70.33  ? 451  VAL C O   1 
ATOM   10739 C CB  . VAL C 1 455 ? 14.617  23.033  19.818  1.00 67.99  ? 451  VAL C CB  1 
ATOM   10740 C CG1 . VAL C 1 455 ? 15.195  24.436  19.953  1.00 68.12  ? 451  VAL C CG1 1 
ATOM   10741 C CG2 . VAL C 1 455 ? 13.495  22.824  20.825  1.00 67.17  ? 451  VAL C CG2 1 
ATOM   10742 N N   . TRP C 1 456 ? 15.259  23.885  16.525  1.00 70.43  ? 452  TRP C N   1 
ATOM   10743 C CA  . TRP C 1 456 ? 16.343  24.149  15.585  1.00 71.94  ? 452  TRP C CA  1 
ATOM   10744 C C   . TRP C 1 456 ? 17.282  25.198  16.167  1.00 72.16  ? 452  TRP C C   1 
ATOM   10745 O O   . TRP C 1 456 ? 16.833  26.166  16.780  1.00 71.45  ? 452  TRP C O   1 
ATOM   10746 C CB  . TRP C 1 456 ? 15.792  24.647  14.246  1.00 72.87  ? 452  TRP C CB  1 
ATOM   10747 C CG  . TRP C 1 456 ? 14.716  23.786  13.636  1.00 73.14  ? 452  TRP C CG  1 
ATOM   10748 C CD1 . TRP C 1 456 ? 13.368  23.915  13.810  1.00 72.63  ? 452  TRP C CD1 1 
ATOM   10749 C CD2 . TRP C 1 456 ? 14.900  22.680  12.745  1.00 74.59  ? 452  TRP C CD2 1 
ATOM   10750 N NE1 . TRP C 1 456 ? 12.701  22.955  13.089  1.00 73.17  ? 452  TRP C NE1 1 
ATOM   10751 C CE2 . TRP C 1 456 ? 13.616  22.183  12.425  1.00 74.38  ? 452  TRP C CE2 1 
ATOM   10752 C CE3 . TRP C 1 456 ? 16.024  22.060  12.184  1.00 76.20  ? 452  TRP C CE3 1 
ATOM   10753 C CZ2 . TRP C 1 456 ? 13.425  21.092  11.571  1.00 75.43  ? 452  TRP C CZ2 1 
ATOM   10754 C CZ3 . TRP C 1 456 ? 15.834  20.973  11.335  1.00 77.18  ? 452  TRP C CZ3 1 
ATOM   10755 C CH2 . TRP C 1 456 ? 14.544  20.500  11.040  1.00 76.77  ? 452  TRP C CH2 1 
ATOM   10756 N N   . ILE C 1 457 ? 18.583  24.997  15.986  1.00 73.37  ? 453  ILE C N   1 
ATOM   10757 C CA  . ILE C 1 457 ? 19.577  25.988  16.390  1.00 74.02  ? 453  ILE C CA  1 
ATOM   10758 C C   . ILE C 1 457 ? 20.367  26.431  15.165  1.00 76.12  ? 453  ILE C C   1 
ATOM   10759 O O   . ILE C 1 457 ? 21.034  25.617  14.522  1.00 77.43  ? 453  ILE C O   1 
ATOM   10760 C CB  . ILE C 1 457 ? 20.537  25.451  17.478  1.00 74.04  ? 453  ILE C CB  1 
ATOM   10761 C CG1 . ILE C 1 457 ? 19.760  25.091  18.745  1.00 72.26  ? 453  ILE C CG1 1 
ATOM   10762 C CG2 . ILE C 1 457 ? 21.613  26.482  17.803  1.00 74.74  ? 453  ILE C CG2 1 
ATOM   10763 C CD1 . ILE C 1 457 ? 20.505  24.176  19.685  1.00 72.29  ? 453  ILE C CD1 1 
ATOM   10764 N N   . ASN C 1 458 ? 20.270  27.723  14.851  1.00 76.68  ? 454  ASN C N   1 
ATOM   10765 C CA  . ASN C 1 458 ? 20.965  28.343  13.715  1.00 78.85  ? 454  ASN C CA  1 
ATOM   10766 C C   . ASN C 1 458 ? 20.575  27.774  12.345  1.00 80.28  ? 454  ASN C C   1 
ATOM   10767 O O   . ASN C 1 458 ? 21.394  27.732  11.425  1.00 82.27  ? 454  ASN C O   1 
ATOM   10768 C CB  . ASN C 1 458 ? 22.490  28.315  13.914  1.00 80.16  ? 454  ASN C CB  1 
ATOM   10769 C CG  . ASN C 1 458 ? 22.941  29.106  15.133  1.00 79.18  ? 454  ASN C CG  1 
ATOM   10770 O OD1 . ASN C 1 458 ? 22.420  30.183  15.420  1.00 78.04  ? 454  ASN C OD1 1 
ATOM   10771 N ND2 . ASN C 1 458 ? 23.923  28.576  15.848  1.00 79.42  ? 454  ASN C ND2 1 
ATOM   10772 N N   . CYS C 1 459 ? 19.320  27.343  12.226  1.00 79.63  ? 455  CYS C N   1 
ATOM   10773 C CA  . CYS C 1 459 ? 18.776  26.786  10.982  1.00 81.14  ? 455  CYS C CA  1 
ATOM   10774 C C   . CYS C 1 459 ? 17.253  26.675  11.060  1.00 80.22  ? 455  CYS C C   1 
ATOM   10775 O O   . CYS C 1 459 ? 16.672  26.892  12.127  1.00 78.55  ? 455  CYS C O   1 
ATOM   10776 C CB  . CYS C 1 459 ? 19.383  25.412  10.691  1.00 81.79  ? 455  CYS C CB  1 
ATOM   10777 S SG  . CYS C 1 459 ? 19.175  24.223  12.027  1.00 79.57  ? 455  CYS C SG  1 
ATOM   10778 N N   . TYR C 1 460 ? 16.617  26.342  9.933   1.00 81.71  ? 456  TYR C N   1 
ATOM   10779 C CA  . TYR C 1 460 ? 15.156  26.197  9.860   1.00 81.33  ? 456  TYR C CA  1 
ATOM   10780 C C   . TYR C 1 460 ? 14.682  25.584  8.537   1.00 83.01  ? 456  TYR C C   1 
ATOM   10781 O O   . TYR C 1 460 ? 14.602  26.273  7.515   1.00 84.70  ? 456  TYR C O   1 
ATOM   10782 C CB  . TYR C 1 460 ? 14.482  27.554  10.077  1.00 81.12  ? 456  TYR C CB  1 
ATOM   10783 C CG  . TYR C 1 460 ? 13.090  27.483  10.658  1.00 80.24  ? 456  TYR C CG  1 
ATOM   10784 C CD1 . TYR C 1 460 ? 12.848  26.829  11.864  1.00 78.74  ? 456  TYR C CD1 1 
ATOM   10785 C CD2 . TYR C 1 460 ? 12.019  28.095  10.016  1.00 81.45  ? 456  TYR C CD2 1 
ATOM   10786 C CE1 . TYR C 1 460 ? 11.573  26.776  12.405  1.00 78.00  ? 456  TYR C CE1 1 
ATOM   10787 C CE2 . TYR C 1 460 ? 10.741  28.049  10.549  1.00 80.69  ? 456  TYR C CE2 1 
ATOM   10788 C CZ  . TYR C 1 460 ? 10.525  27.389  11.743  1.00 79.01  ? 456  TYR C CZ  1 
ATOM   10789 O OH  . TYR C 1 460 ? 9.260   27.342  12.274  1.00 78.72  ? 456  TYR C OH  1 
ATOM   10790 N N   . ASN C 1 461 ? 14.366  24.290  8.567   1.00 82.72  ? 457  ASN C N   1 
ATOM   10791 C CA  . ASN C 1 461 ? 13.929  23.562  7.369   1.00 84.32  ? 457  ASN C CA  1 
ATOM   10792 C C   . ASN C 1 461 ? 13.136  22.291  7.670   1.00 83.20  ? 457  ASN C C   1 
ATOM   10793 O O   . ASN C 1 461 ? 13.667  21.334  8.235   1.00 82.42  ? 457  ASN C O   1 
ATOM   10794 C CB  . ASN C 1 461 ? 15.113  23.249  6.431   1.00 86.42  ? 457  ASN C CB  1 
ATOM   10795 C CG  . ASN C 1 461 ? 16.388  22.843  7.181   1.00 86.25  ? 457  ASN C CG  1 
ATOM   10796 O OD1 . ASN C 1 461 ? 17.468  23.367  6.900   1.00 87.88  ? 457  ASN C OD1 1 
ATOM   10797 N ND2 . ASN C 1 461 ? 16.269  21.908  8.126   1.00 84.50  ? 457  ASN C ND2 1 
ATOM   10798 N N   . ALA C 1 462 ? 11.861  22.296  7.285   1.00 83.37  ? 458  ALA C N   1 
ATOM   10799 C CA  . ALA C 1 462 ? 10.996  21.123  7.413   1.00 82.62  ? 458  ALA C CA  1 
ATOM   10800 C C   . ALA C 1 462 ? 9.869   21.151  6.379   1.00 83.94  ? 458  ALA C C   1 
ATOM   10801 O O   . ALA C 1 462 ? 10.106  21.374  5.188   1.00 85.91  ? 458  ALA C O   1 
ATOM   10802 C CB  . ALA C 1 462 ? 10.430  21.019  8.829   1.00 80.39  ? 458  ALA C CB  1 
ATOM   10803 N N   . GLY C 1 482 ? 12.042  9.405   11.732  1.00 78.44  ? 478  GLY C N   1 
ATOM   10804 C CA  . GLY C 1 482 ? 13.261  8.740   12.281  1.00 78.79  ? 478  GLY C CA  1 
ATOM   10805 C C   . GLY C 1 482 ? 12.969  7.404   12.940  1.00 78.25  ? 478  GLY C C   1 
ATOM   10806 O O   . GLY C 1 482 ? 11.958  6.762   12.638  1.00 77.85  ? 478  GLY C O   1 
ATOM   10807 N N   . GLU C