data_4X4P
# 
_entry.id   4X4P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X4P         
WWPDB D_1000202139 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4X4N unspecified 
PDB . 4X4O unspecified 
PDB . 4X4Q unspecified 
PDB . 4X4R unspecified 
PDB . 4X4S unspecified 
PDB . 4X4T unspecified 
PDB . 4X4U unspecified 
PDB . 4X4V unspecified 
PDB . 4X4W unspecified 
PDB . 4X4X unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X4P 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuhn, C.-D.'    1 
'Joshua-Tor, L.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            160 
_citation.language                  ? 
_citation.page_first                644 
_citation.page_last                 658 
_citation.title                     'On-Enzyme Refolding Permits Small RNA and tRNA Surveillance by the CCA-Adding Enzyme.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2015.01.005 
_citation.pdbx_database_id_PubMed   25640237 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kuhn, C.D.'     1 ? 
primary 'Wilusz, J.E.'   2 ? 
primary 'Zheng, Y.'      3 ? 
primary 'Beal, P.A.'     4 ? 
primary 'Joshua-Tor, L.' 5 ? 
# 
_cell.angle_alpha                  85.200 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   87.980 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  89.810 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4X4P 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     58.108 
_cell.length_a_esd                 ? 
_cell.length_b                     58.112 
_cell.length_b_esd                 ? 
_cell.length_c                     217.806 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4X4P 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CCA-adding enzyme'                  53672.484 4  2.7.7.72 ? ? ? 
2 polymer     syn 'G70A tRNA minihelix ending in CCAC' 11562.915 4  ?        ? ? ? 
3 non-polymer syn 'SULFATE ION'                        96.063    10 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CCA tRNA nucleotidyltransferase,tRNA CCA-pyrophosphorylase,tRNA adenylyl-/cytidylyl- transferase,tRNA nucleotidyltransferase,tRNA-NT
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSVDKLAAALEHHHHHH
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSVDKLAAALEHHHHHH
;
A,C,E,G ? 
2 polyribonucleotide no no GGCCGCGGCAGGUUCGAGUCCUGCCGCGAUCGCCAC GGCCGCGGCAGGUUCGAGUCCUGCCGCGAUCGCCAC B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 SER n 
1 439 ASN n 
1 440 SER n 
1 441 SER n 
1 442 SER n 
1 443 VAL n 
1 444 ASP n 
1 445 LYS n 
1 446 LEU n 
1 447 ALA n 
1 448 ALA n 
1 449 ALA n 
1 450 LEU n 
1 451 GLU n 
1 452 HIS n 
1 453 HIS n 
1 454 HIS n 
1 455 HIS n 
1 456 HIS n 
1 457 HIS n 
2 1   G   n 
2 2   G   n 
2 3   C   n 
2 4   C   n 
2 5   G   n 
2 6   C   n 
2 7   G   n 
2 8   G   n 
2 9   C   n 
2 10  A   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  G   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  U   n 
2 23  G   n 
2 24  C   n 
2 25  C   n 
2 26  G   n 
2 27  C   n 
2 28  G   n 
2 29  A   n 
2 30  U   n 
2 31  C   n 
2 32  G   n 
2 33  C   n 
2 34  C   n 
2 35  A   n 
2 36  C   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   457 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'cca, AF_2156' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      
'Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     224325 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       36 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CCA_ARCFU O28126 ? 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 
2 PDB 4X4P      4X4P   ? 2 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4X4P A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 4X4P B 1 ? 36  ? 4X4P   1 ? 36  ? 1 36  
3 1 4X4P C 1 ? 437 ? O28126 1 ? 437 ? 1 437 
4 2 4X4P D 1 ? 36  ? 4X4P   1 ? 36  ? 1 36  
5 1 4X4P E 1 ? 437 ? O28126 1 ? 437 ? 1 437 
6 2 4X4P F 1 ? 36  ? 4X4P   1 ? 36  ? 1 36  
7 1 4X4P G 1 ? 437 ? O28126 1 ? 437 ? 1 437 
8 2 4X4P H 1 ? 36  ? 4X4P   1 ? 36  ? 1 36  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X4P SER A 438 ? UNP O28126 ? ? 'expression tag' 438 1  
1 4X4P ASN A 439 ? UNP O28126 ? ? 'expression tag' 439 2  
1 4X4P SER A 440 ? UNP O28126 ? ? 'expression tag' 440 3  
1 4X4P SER A 441 ? UNP O28126 ? ? 'expression tag' 441 4  
1 4X4P SER A 442 ? UNP O28126 ? ? 'expression tag' 442 5  
1 4X4P VAL A 443 ? UNP O28126 ? ? 'expression tag' 443 6  
1 4X4P ASP A 444 ? UNP O28126 ? ? 'expression tag' 444 7  
1 4X4P LYS A 445 ? UNP O28126 ? ? 'expression tag' 445 8  
1 4X4P LEU A 446 ? UNP O28126 ? ? 'expression tag' 446 9  
1 4X4P ALA A 447 ? UNP O28126 ? ? 'expression tag' 447 10 
1 4X4P ALA A 448 ? UNP O28126 ? ? 'expression tag' 448 11 
1 4X4P ALA A 449 ? UNP O28126 ? ? 'expression tag' 449 12 
1 4X4P LEU A 450 ? UNP O28126 ? ? 'expression tag' 450 13 
1 4X4P GLU A 451 ? UNP O28126 ? ? 'expression tag' 451 14 
1 4X4P HIS A 452 ? UNP O28126 ? ? 'expression tag' 452 15 
1 4X4P HIS A 453 ? UNP O28126 ? ? 'expression tag' 453 16 
1 4X4P HIS A 454 ? UNP O28126 ? ? 'expression tag' 454 17 
1 4X4P HIS A 455 ? UNP O28126 ? ? 'expression tag' 455 18 
1 4X4P HIS A 456 ? UNP O28126 ? ? 'expression tag' 456 19 
1 4X4P HIS A 457 ? UNP O28126 ? ? 'expression tag' 457 20 
3 4X4P SER C 438 ? UNP O28126 ? ? 'expression tag' 438 21 
3 4X4P ASN C 439 ? UNP O28126 ? ? 'expression tag' 439 22 
3 4X4P SER C 440 ? UNP O28126 ? ? 'expression tag' 440 23 
3 4X4P SER C 441 ? UNP O28126 ? ? 'expression tag' 441 24 
3 4X4P SER C 442 ? UNP O28126 ? ? 'expression tag' 442 25 
3 4X4P VAL C 443 ? UNP O28126 ? ? 'expression tag' 443 26 
3 4X4P ASP C 444 ? UNP O28126 ? ? 'expression tag' 444 27 
3 4X4P LYS C 445 ? UNP O28126 ? ? 'expression tag' 445 28 
3 4X4P LEU C 446 ? UNP O28126 ? ? 'expression tag' 446 29 
3 4X4P ALA C 447 ? UNP O28126 ? ? 'expression tag' 447 30 
3 4X4P ALA C 448 ? UNP O28126 ? ? 'expression tag' 448 31 
3 4X4P ALA C 449 ? UNP O28126 ? ? 'expression tag' 449 32 
3 4X4P LEU C 450 ? UNP O28126 ? ? 'expression tag' 450 33 
3 4X4P GLU C 451 ? UNP O28126 ? ? 'expression tag' 451 34 
3 4X4P HIS C 452 ? UNP O28126 ? ? 'expression tag' 452 35 
3 4X4P HIS C 453 ? UNP O28126 ? ? 'expression tag' 453 36 
3 4X4P HIS C 454 ? UNP O28126 ? ? 'expression tag' 454 37 
3 4X4P HIS C 455 ? UNP O28126 ? ? 'expression tag' 455 38 
3 4X4P HIS C 456 ? UNP O28126 ? ? 'expression tag' 456 39 
3 4X4P HIS C 457 ? UNP O28126 ? ? 'expression tag' 457 40 
5 4X4P SER E 438 ? UNP O28126 ? ? 'expression tag' 438 41 
5 4X4P ASN E 439 ? UNP O28126 ? ? 'expression tag' 439 42 
5 4X4P SER E 440 ? UNP O28126 ? ? 'expression tag' 440 43 
5 4X4P SER E 441 ? UNP O28126 ? ? 'expression tag' 441 44 
5 4X4P SER E 442 ? UNP O28126 ? ? 'expression tag' 442 45 
5 4X4P VAL E 443 ? UNP O28126 ? ? 'expression tag' 443 46 
5 4X4P ASP E 444 ? UNP O28126 ? ? 'expression tag' 444 47 
5 4X4P LYS E 445 ? UNP O28126 ? ? 'expression tag' 445 48 
5 4X4P LEU E 446 ? UNP O28126 ? ? 'expression tag' 446 49 
5 4X4P ALA E 447 ? UNP O28126 ? ? 'expression tag' 447 50 
5 4X4P ALA E 448 ? UNP O28126 ? ? 'expression tag' 448 51 
5 4X4P ALA E 449 ? UNP O28126 ? ? 'expression tag' 449 52 
5 4X4P LEU E 450 ? UNP O28126 ? ? 'expression tag' 450 53 
5 4X4P GLU E 451 ? UNP O28126 ? ? 'expression tag' 451 54 
5 4X4P HIS E 452 ? UNP O28126 ? ? 'expression tag' 452 55 
5 4X4P HIS E 453 ? UNP O28126 ? ? 'expression tag' 453 56 
5 4X4P HIS E 454 ? UNP O28126 ? ? 'expression tag' 454 57 
5 4X4P HIS E 455 ? UNP O28126 ? ? 'expression tag' 455 58 
5 4X4P HIS E 456 ? UNP O28126 ? ? 'expression tag' 456 59 
5 4X4P HIS E 457 ? UNP O28126 ? ? 'expression tag' 457 60 
7 4X4P SER G 438 ? UNP O28126 ? ? 'expression tag' 438 61 
7 4X4P ASN G 439 ? UNP O28126 ? ? 'expression tag' 439 62 
7 4X4P SER G 440 ? UNP O28126 ? ? 'expression tag' 440 63 
7 4X4P SER G 441 ? UNP O28126 ? ? 'expression tag' 441 64 
7 4X4P SER G 442 ? UNP O28126 ? ? 'expression tag' 442 65 
7 4X4P VAL G 443 ? UNP O28126 ? ? 'expression tag' 443 66 
7 4X4P ASP G 444 ? UNP O28126 ? ? 'expression tag' 444 67 
7 4X4P LYS G 445 ? UNP O28126 ? ? 'expression tag' 445 68 
7 4X4P LEU G 446 ? UNP O28126 ? ? 'expression tag' 446 69 
7 4X4P ALA G 447 ? UNP O28126 ? ? 'expression tag' 447 70 
7 4X4P ALA G 448 ? UNP O28126 ? ? 'expression tag' 448 71 
7 4X4P ALA G 449 ? UNP O28126 ? ? 'expression tag' 449 72 
7 4X4P LEU G 450 ? UNP O28126 ? ? 'expression tag' 450 73 
7 4X4P GLU G 451 ? UNP O28126 ? ? 'expression tag' 451 74 
7 4X4P HIS G 452 ? UNP O28126 ? ? 'expression tag' 452 75 
7 4X4P HIS G 453 ? UNP O28126 ? ? 'expression tag' 453 76 
7 4X4P HIS G 454 ? UNP O28126 ? ? 'expression tag' 454 77 
7 4X4P HIS G 455 ? UNP O28126 ? ? 'expression tag' 455 78 
7 4X4P HIS G 456 ? UNP O28126 ? ? 'expression tag' 456 79 
7 4X4P HIS G 457 ? UNP O28126 ? ? 'expression tag' 457 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X4P 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.66 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.3 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% 2-Propanol, 0.1M Sodium Acetate pH 5.3, 0.2M Lithium Sulfate, 4.8% PEG 1.5K' 
_exptl_crystal_grow.pdbx_pH_range   5.3 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-11-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.1000 1.0 
2 1.1    1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4X4P 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.000 
_reflns.d_resolution_low                 29.576 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       53506 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.000 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.081 
_reflns.pdbx_netI_over_av_sigmaI         8.767 
_reflns.pdbx_netI_over_sigmaI            9.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.109 
_reflns.pdbx_Rpim_I_all                  0.073 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         107845 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.000 3.160  ? 2.200  16462 ? ? 8090 ? 96.400 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 2.000 0.348 ? ? 2.500  ? 0.317 0 1  1 ? ? 
3.160 3.350  ? 3.300  15046 ? ? 7452 ? 96.000 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 2.000 0.226 ? ? 3.900  ? 0.207 0 2  1 ? ? 
3.350 3.590  ? 4.900  14343 ? ? 7019 ? 94.300 ? ? ? ? 0.153 ? ? ? ? ? ? ? ? 2.000 0.153 ? ? 5.900  ? 0.138 0 3  1 ? ? 
3.590 3.870  ? 7.100  12974 ? ? 6453 ? 93.600 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 2.000 0.104 ? ? 8.300  ? 0.095 0 4  1 ? ? 
3.870 4.240  ? 9.500  11510 ? ? 5749 ? 92.300 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 2.000 0.078 ? ? 10.400 ? 0.071 0 5  1 ? ? 
4.240 4.740  ? 12.900 10500 ? ? 5232 ? 91.300 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 2.000 0.057 ? ? 13.600 ? 0.051 0 6  1 ? ? 
4.740 5.480  ? 13.500 9461  ? ? 4727 ? 93.200 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 2.000 0.053 ? ? 14.000 ? 0.048 0 7  1 ? ? 
5.480 6.710  ? 13.200 8141  ? ? 4001 ? 94.600 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 2.000 0.056 ? ? 12.800 ? 0.050 0 8  1 ? ? 
6.710 9.490  ? 18.200 6153  ? ? 3137 ? 94.600 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 2.000 0.036 ? ? 17.400 ? 0.033 0 9  1 ? ? 
9.490 29.576 ? 22.900 3255  ? ? 1646 ? 91.800 ? ? ? ? 0.026 ? ? ? ? ? ? ? ? 2.000 0.026 ? ? 23.000 ? 0.023 0 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                252.670 
_refine.B_iso_mean                               69.3324 
_refine.B_iso_min                                22.020 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4X4P 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0000 
_refine.ls_d_res_low                             29.5760 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  4210 
_refine.ls_number_reflns_R_work                  93504 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    85.5600 
_refine.ls_percent_reflns_R_free                 4.3300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2257 
_refine.ls_R_factor_R_free                       0.2738 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2235 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.960 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 33.8400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.0000 
_refine_hist.d_res_low                        29.5760 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               16991 
_refine_hist.pdbx_number_residues_total       1849 
_refine_hist.pdbx_B_iso_mean_ligand           62.05 
_refine_hist.pdbx_number_atoms_protein        14332 
_refine_hist.pdbx_number_atoms_nucleic_acid   2609 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 17601 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.093  ? 24273 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 2658  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 2681  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.548 ? 7085  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 8601 7.680 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL C 8601 7.680 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 1 3 TORSIONAL E 8601 7.680 ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 1 4 TORSIONAL G 8601 7.680 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.0000 3.0517  4941 . 200 4741 81.0000 . . . 0.3653 . 0.3036 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.0517 3.1071  4957 . 154 4803 87.0000 . . . 0.4000 . 0.2989 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.1071 3.1668  5017 . 206 4811 84.0000 . . . 0.3585 . 0.2938 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.1668 3.2313  5093 . 190 4903 85.0000 . . . 0.3146 . 0.2783 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.2313 3.3014  4545 . 174 4371 80.0000 . . . 0.3186 . 0.2749 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.3014 3.3781  5131 . 189 4942 86.0000 . . . 0.3261 . 0.2616 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.3781 3.4624  4903 . 177 4726 83.0000 . . . 0.2909 . 0.2542 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.4624 3.5558  4801 . 198 4603 82.0000 . . . 0.2756 . 0.2383 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.5558 3.6601  4769 . 188 4581 80.0000 . . . 0.2809 . 0.2374 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.6601 3.7780  4745 . 184 4561 81.0000 . . . 0.2392 . 0.2265 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.7780 3.9126  5028 . 173 4855 83.0000 . . . 0.2850 . 0.2223 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.9126 4.0687  4612 . 176 4436 80.0000 . . . 0.2502 . 0.2243 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.0687 4.2532  4703 . 165 4538 81.0000 . . . 0.3089 . 0.2118 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.2532 4.4764  4925 . 193 4732 81.0000 . . . 0.2865 . 0.2095 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.4764 4.7553  4518 . 162 4356 79.0000 . . . 0.2481 . 0.1993 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.7553 5.1201  4921 . 190 4731 83.0000 . . . 0.2510 . 0.1918 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 5.1201 5.6308  4752 . 175 4577 81.0000 . . . 0.2475 . 0.2027 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 5.6308 6.4354  5106 . 211 4895 85.0000 . . . 0.2493 . 0.2172 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 6.4354 8.0697  4832 . 175 4657 83.0000 . . . 0.2518 . 0.2029 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 8.0697 26.4785 4869 . 184 4685 83.0000 . . . 0.2345 . 0.1873 . . . . . . 20 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 'chain A and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' 
1 2 'chain C and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' 
1 3 'chain E and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' 
1 4 'chain G and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 3   A 89  'chain A and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 1 2 ? A 97  A 121 'chain A and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 1 3 ? A 123 A 437 'chain A and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 2 1 ? C 3   C 89  'chain C and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 2 2 ? C 97  C 121 'chain C and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 2 3 ? C 123 C 437 'chain C and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 3 1 ? E 3   E 89  'chain E and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 3 2 ? E 97  E 121 'chain E and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 3 3 ? E 123 E 437 'chain E and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 4 1 ? G 3   G 89  'chain G and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 4 2 ? G 97  G 121 'chain G and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
1 4 3 ? G 123 G 437 'chain G and (resseq 3:89 or resseq 97:121 or resseq 123:437 )' ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     4X4P 
_struct.title                        
'Crystal structure of the A.fulgidus CCA-adding enzyme in complex with a G70A arginyl-tRNA minihelix ending in CCAC' 
_struct.pdbx_descriptor              'A.fulgidus CCA-adding enzyme/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X4P 
_struct_keywords.text            
'protein-RNA complex, tRNA, non-coding RNA, CCA-adding enzyme, nucleotidyltransferase, ncRNA, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 2   ? ILE A 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  AA2 ASP A 17  ? GLY A 39  ? ASP A 17  GLY A 39  1 ? 23 
HELX_P HELX_P3  AA3 GLY A 46  ? ARG A 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  AA4 SER A 71  ? LEU A 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  AA5 ASP A 128 ? ILE A 141 ? ASP A 128 ILE A 141 1 ? 14 
HELX_P HELX_P6  AA6 LYS A 144 ? ASN A 158 ? LYS A 144 ASN A 158 1 ? 15 
HELX_P HELX_P7  AA7 SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  AA8 SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  AA9 SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P10 AB1 SER A 250 ? LYS A 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P11 AB2 GLU A 263 ? GLY A 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P12 AB3 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P13 AB4 ASP A 351 ? LEU A 359 ? ASP A 351 LEU A 359 1 ? 9  
HELX_P HELX_P14 AB5 THR A 384 ? TRP A 397 ? THR A 384 TRP A 397 1 ? 14 
HELX_P HELX_P15 AB6 HIS A 398 ? LEU A 400 ? HIS A 398 LEU A 400 5 ? 3  
HELX_P HELX_P16 AB7 GLY A 401 ? TYR A 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P17 AB8 GLY A 417 ? LYS A 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P18 AB9 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P19 AC1 GLU C 4   ? ILE C 15  ? GLU C 4   ILE C 15  1 ? 12 
HELX_P HELX_P20 AC2 ASP C 17  ? ASP C 36  ? ASP C 17  ASP C 36  1 ? 20 
HELX_P HELX_P21 AC3 GLY C 46  ? ARG C 50  ? GLY C 46  ARG C 50  1 ? 5  
HELX_P HELX_P22 AC4 SER C 71  ? ALA C 85  ? SER C 71  ALA C 85  1 ? 15 
HELX_P HELX_P23 AC5 ASP C 128 ? ILE C 141 ? ASP C 128 ILE C 141 1 ? 14 
HELX_P HELX_P24 AC6 LYS C 144 ? ASN C 158 ? LYS C 144 ASN C 158 1 ? 15 
HELX_P HELX_P25 AC7 SER C 171 ? GLY C 183 ? SER C 171 GLY C 183 1 ? 13 
HELX_P HELX_P26 AC8 SER C 184 ? ARG C 193 ? SER C 184 ARG C 193 1 ? 10 
HELX_P HELX_P27 AC9 SER C 231 ? ALA C 248 ? SER C 231 ALA C 248 1 ? 18 
HELX_P HELX_P28 AD1 SER C 250 ? LYS C 255 ? SER C 250 LYS C 255 5 ? 6  
HELX_P HELX_P29 AD2 GLU C 263 ? GLY C 275 ? GLU C 263 GLY C 275 1 ? 13 
HELX_P HELX_P30 AD3 VAL C 289 ? GLU C 311 ? VAL C 289 GLU C 311 1 ? 23 
HELX_P HELX_P31 AD4 ASP C 351 ? LEU C 359 ? ASP C 351 LEU C 359 1 ? 9  
HELX_P HELX_P32 AD5 THR C 384 ? HIS C 396 ? THR C 384 HIS C 396 1 ? 13 
HELX_P HELX_P33 AD6 TRP C 397 ? LEU C 400 ? TRP C 397 LEU C 400 5 ? 4  
HELX_P HELX_P34 AD7 GLY C 401 ? TYR C 411 ? GLY C 401 TYR C 411 1 ? 11 
HELX_P HELX_P35 AD8 GLU C 418 ? LEU C 420 ? GLU C 418 LEU C 420 5 ? 3  
HELX_P HELX_P36 AD9 VAL C 425 ? GLY C 434 ? VAL C 425 GLY C 434 1 ? 10 
HELX_P HELX_P37 AE1 GLU E 4   ? ILE E 15  ? GLU E 4   ILE E 15  1 ? 12 
HELX_P HELX_P38 AE2 ASP E 17  ? ASP E 36  ? ASP E 17  ASP E 36  1 ? 20 
HELX_P HELX_P39 AE3 GLY E 46  ? ARG E 50  ? GLY E 46  ARG E 50  1 ? 5  
HELX_P HELX_P40 AE4 SER E 71  ? LEU E 87  ? SER E 71  LEU E 87  1 ? 17 
HELX_P HELX_P41 AE5 ASP E 128 ? ILE E 141 ? ASP E 128 ILE E 141 1 ? 14 
HELX_P HELX_P42 AE6 LYS E 144 ? ASN E 158 ? LYS E 144 ASN E 158 1 ? 15 
HELX_P HELX_P43 AE7 SER E 171 ? GLY E 183 ? SER E 171 GLY E 183 1 ? 13 
HELX_P HELX_P44 AE8 SER E 184 ? ARG E 193 ? SER E 184 ARG E 193 1 ? 10 
HELX_P HELX_P45 AE9 SER E 231 ? ALA E 248 ? SER E 231 ALA E 248 1 ? 18 
HELX_P HELX_P46 AF1 SER E 250 ? LYS E 255 ? SER E 250 LYS E 255 5 ? 6  
HELX_P HELX_P47 AF2 GLU E 263 ? GLY E 275 ? GLU E 263 GLY E 275 1 ? 13 
HELX_P HELX_P48 AF3 VAL E 289 ? GLU E 311 ? VAL E 289 GLU E 311 1 ? 23 
HELX_P HELX_P49 AF4 ASP E 351 ? SER E 360 ? ASP E 351 SER E 360 1 ? 10 
HELX_P HELX_P50 AF5 THR E 384 ? HIS E 396 ? THR E 384 HIS E 396 1 ? 13 
HELX_P HELX_P51 AF6 TRP E 397 ? LEU E 400 ? TRP E 397 LEU E 400 5 ? 4  
HELX_P HELX_P52 AF7 GLY E 401 ? TYR E 411 ? GLY E 401 TYR E 411 1 ? 11 
HELX_P HELX_P53 AF8 GLY E 417 ? PHE E 421 ? GLY E 417 PHE E 421 1 ? 5  
HELX_P HELX_P54 AF9 VAL E 425 ? GLY E 434 ? VAL E 425 GLY E 434 1 ? 10 
HELX_P HELX_P55 AG1 VAL G 3   ? ILE G 15  ? VAL G 3   ILE G 15  1 ? 13 
HELX_P HELX_P56 AG2 ASP G 17  ? ASP G 36  ? ASP G 17  ASP G 36  1 ? 20 
HELX_P HELX_P57 AG3 GLY G 46  ? ARG G 50  ? GLY G 46  ARG G 50  1 ? 5  
HELX_P HELX_P58 AG4 SER G 71  ? ALA G 85  ? SER G 71  ALA G 85  1 ? 15 
HELX_P HELX_P59 AG5 ASP G 128 ? ILE G 141 ? ASP G 128 ILE G 141 1 ? 14 
HELX_P HELX_P60 AG6 LYS G 144 ? ASN G 158 ? LYS G 144 ASN G 158 1 ? 15 
HELX_P HELX_P61 AG7 SER G 171 ? GLY G 183 ? SER G 171 GLY G 183 1 ? 13 
HELX_P HELX_P62 AG8 SER G 184 ? ARG G 193 ? SER G 184 ARG G 193 1 ? 10 
HELX_P HELX_P63 AG9 SER G 231 ? ALA G 248 ? SER G 231 ALA G 248 1 ? 18 
HELX_P HELX_P64 AH1 SER G 250 ? LYS G 255 ? SER G 250 LYS G 255 5 ? 6  
HELX_P HELX_P65 AH2 GLU G 263 ? GLY G 275 ? GLU G 263 GLY G 275 1 ? 13 
HELX_P HELX_P66 AH3 VAL G 289 ? GLU G 311 ? VAL G 289 GLU G 311 1 ? 23 
HELX_P HELX_P67 AH4 ASP G 351 ? SER G 360 ? ASP G 351 SER G 360 1 ? 10 
HELX_P HELX_P68 AH5 THR G 384 ? HIS G 396 ? THR G 384 HIS G 396 1 ? 13 
HELX_P HELX_P69 AH6 TRP G 397 ? LEU G 400 ? TRP G 397 LEU G 400 5 ? 4  
HELX_P HELX_P70 AH7 GLY G 401 ? TYR G 411 ? GLY G 401 TYR G 411 1 ? 11 
HELX_P HELX_P71 AH8 GLU G 418 ? LEU G 420 ? GLU G 418 LEU G 420 5 ? 3  
HELX_P HELX_P72 AH9 VAL G 425 ? GLY G 434 ? VAL G 425 GLY G 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B G 1  N1 ? ? ? 1_555 B C 34 N3 ? ? B G 1  B C 34 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog2  hydrog ? ? B G 2  N1 ? ? ? 1_555 B C 33 N3 ? ? B G 2  B C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog3  hydrog ? ? B G 2  N2 ? ? ? 1_555 B C 33 O2 ? ? B G 2  B C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog4  hydrog ? ? B G 2  O6 ? ? ? 1_555 B C 33 N4 ? ? B G 2  B C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog5  hydrog ? ? B C 3  N3 ? ? ? 1_555 B G 32 N1 ? ? B C 3  B G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog6  hydrog ? ? B C 3  N4 ? ? ? 1_555 B G 32 O6 ? ? B C 3  B G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog7  hydrog ? ? B C 3  O2 ? ? ? 1_555 B G 32 N2 ? ? B C 3  B G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog8  hydrog ? ? B C 4  N4 ? ? ? 1_555 B G 28 O6 ? ? B C 4  B G 28 1_555 ? ? ? ? ? ? 'C-G PAIR'    ? ? 
hydrog9  hydrog ? ? B G 5  N1 ? ? ? 1_555 B C 27 N3 ? ? B G 5  B C 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog10 hydrog ? ? B G 5  N2 ? ? ? 1_555 B C 27 O2 ? ? B G 5  B C 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog11 hydrog ? ? B G 5  O6 ? ? ? 1_555 B C 27 N4 ? ? B G 5  B C 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog12 hydrog ? ? B C 6  N3 ? ? ? 1_555 B G 26 N1 ? ? B C 6  B G 26 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog13 hydrog ? ? B C 6  N4 ? ? ? 1_555 B G 26 O6 ? ? B C 6  B G 26 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog14 hydrog ? ? B C 6  O2 ? ? ? 1_555 B G 26 N2 ? ? B C 6  B G 26 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog15 hydrog ? ? B G 7  N1 ? ? ? 1_555 B C 25 N3 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog16 hydrog ? ? B G 7  N2 ? ? ? 1_555 B C 25 O2 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog17 hydrog ? ? B G 7  O6 ? ? ? 1_555 B C 25 N4 ? ? B G 7  B C 25 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog18 hydrog ? ? B G 8  N1 ? ? ? 1_555 B C 24 N3 ? ? B G 8  B C 24 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog19 hydrog ? ? B C 9  N3 ? ? ? 1_555 B G 23 N1 ? ? B C 9  B G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog20 hydrog ? ? B C 9  N4 ? ? ? 1_555 B G 23 O6 ? ? B C 9  B G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog21 hydrog ? ? B C 9  O2 ? ? ? 1_555 B G 23 N2 ? ? B C 9  B G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog22 hydrog ? ? B G 11 N1 ? ? ? 1_555 B C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog23 hydrog ? ? B G 11 N2 ? ? ? 1_555 B C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog24 hydrog ? ? B G 11 O6 ? ? ? 1_555 B C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog25 hydrog ? ? B G 12 N1 ? ? ? 1_555 B C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog26 hydrog ? ? B G 12 N2 ? ? ? 1_555 B C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog27 hydrog ? ? B G 12 O6 ? ? ? 1_555 B C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog28 hydrog ? ? D G 1  N2 ? ? ? 1_555 D C 34 O2 ? ? D G 1  D C 34 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog29 hydrog ? ? D G 2  N1 ? ? ? 1_555 D C 33 N3 ? ? D G 2  D C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog30 hydrog ? ? D G 2  N2 ? ? ? 1_555 D C 33 O2 ? ? D G 2  D C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog31 hydrog ? ? D G 2  O6 ? ? ? 1_555 D C 33 N4 ? ? D G 2  D C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog32 hydrog ? ? D C 3  N3 ? ? ? 1_555 D G 32 N1 ? ? D C 3  D G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog33 hydrog ? ? D C 3  N4 ? ? ? 1_555 D G 32 O6 ? ? D C 3  D G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog34 hydrog ? ? D C 3  O2 ? ? ? 1_555 D G 32 N2 ? ? D C 3  D G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog35 hydrog ? ? D G 5  N1 ? ? ? 1_555 D C 27 N3 ? ? D G 5  D C 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog36 hydrog ? ? D G 5  N2 ? ? ? 1_555 D C 27 O2 ? ? D G 5  D C 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog37 hydrog ? ? D G 5  O6 ? ? ? 1_555 D C 27 N4 ? ? D G 5  D C 27 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog38 hydrog ? ? D C 6  O2 ? ? ? 1_555 D G 26 N2 ? ? D C 6  D G 26 1_555 ? ? ? ? ? ? 'C-G PAIR'    ? ? 
hydrog39 hydrog ? ? D G 7  N1 ? ? ? 1_555 D C 25 N3 ? ? D G 7  D C 25 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog40 hydrog ? ? D G 8  N1 ? ? ? 1_555 D C 24 N3 ? ? D G 8  D C 24 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog41 hydrog ? ? D G 8  N2 ? ? ? 1_555 D C 24 O2 ? ? D G 8  D C 24 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog42 hydrog ? ? D G 8  O6 ? ? ? 1_555 D C 24 N4 ? ? D G 8  D C 24 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog43 hydrog ? ? D C 9  N3 ? ? ? 1_555 D G 23 N1 ? ? D C 9  D G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog44 hydrog ? ? D C 9  N4 ? ? ? 1_555 D G 23 O6 ? ? D C 9  D G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog45 hydrog ? ? D C 9  O2 ? ? ? 1_555 D G 23 N2 ? ? D C 9  D G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog46 hydrog ? ? D A 10 N1 ? ? ? 1_555 D U 22 N3 ? ? D A 10 D U 22 1_555 ? ? ? ? ? ? 'A-U PAIR'    ? ? 
hydrog47 hydrog ? ? D G 11 N1 ? ? ? 1_555 D C 21 N3 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog48 hydrog ? ? D G 11 N2 ? ? ? 1_555 D C 21 O2 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog49 hydrog ? ? D G 11 O6 ? ? ? 1_555 D C 21 N4 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog50 hydrog ? ? D G 12 N1 ? ? ? 1_555 D C 20 N3 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog51 hydrog ? ? D G 12 N2 ? ? ? 1_555 D C 20 O2 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog52 hydrog ? ? D G 12 O6 ? ? ? 1_555 D C 20 N4 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog53 hydrog ? ? F G 1  O6 ? ? ? 1_555 F C 33 N4 ? ? F G 1  F C 33 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog54 hydrog ? ? F G 1  N1 ? ? ? 1_555 F C 34 N3 ? ? F G 1  F C 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog55 hydrog ? ? F G 1  N2 ? ? ? 1_555 F C 34 O2 ? ? F G 1  F C 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog56 hydrog ? ? F G 1  O6 ? ? ? 1_555 F C 34 N4 ? ? F G 1  F C 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog57 hydrog ? ? F G 2  N1 ? ? ? 1_555 F C 33 N3 ? ? F G 2  F C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog58 hydrog ? ? F G 2  N2 ? ? ? 1_555 F C 33 O2 ? ? F G 2  F C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog59 hydrog ? ? F G 2  O6 ? ? ? 1_555 F C 33 N4 ? ? F G 2  F C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog60 hydrog ? ? F C 3  N3 ? ? ? 1_555 F G 32 N1 ? ? F C 3  F G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog61 hydrog ? ? F C 3  N4 ? ? ? 1_555 F G 32 O6 ? ? F C 3  F G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog62 hydrog ? ? F C 3  O2 ? ? ? 1_555 F G 32 N2 ? ? F C 3  F G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog63 hydrog ? ? F C 9  N4 ? ? ? 1_555 F G 23 O6 ? ? F C 9  F G 23 1_555 ? ? ? ? ? ? 'C-G PAIR'    ? ? 
hydrog64 hydrog ? ? F A 10 N1 ? ? ? 1_555 F U 22 N3 ? ? F A 10 F U 22 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog65 hydrog ? ? F A 10 N6 ? ? ? 1_555 F U 22 O4 ? ? F A 10 F U 22 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog66 hydrog ? ? F G 11 N1 ? ? ? 1_555 F C 21 N3 ? ? F G 11 F C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog67 hydrog ? ? F G 11 N2 ? ? ? 1_555 F C 21 O2 ? ? F G 11 F C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog68 hydrog ? ? F G 11 O6 ? ? ? 1_555 F C 21 N4 ? ? F G 11 F C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog69 hydrog ? ? H G 1  N1 ? ? ? 1_555 H C 34 N3 ? ? H G 1  H C 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog70 hydrog ? ? H G 1  N2 ? ? ? 1_555 H C 34 O2 ? ? H G 1  H C 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog71 hydrog ? ? H G 1  O6 ? ? ? 1_555 H C 34 N4 ? ? H G 1  H C 34 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog72 hydrog ? ? H G 2  N1 ? ? ? 1_555 H C 33 N3 ? ? H G 2  H C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog73 hydrog ? ? H G 2  N2 ? ? ? 1_555 H C 33 O2 ? ? H G 2  H C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog74 hydrog ? ? H G 2  O6 ? ? ? 1_555 H C 33 N4 ? ? H G 2  H C 33 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog75 hydrog ? ? H C 3  N3 ? ? ? 1_555 H G 32 N1 ? ? H C 3  H G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog76 hydrog ? ? H C 3  N4 ? ? ? 1_555 H G 32 O6 ? ? H C 3  H G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog77 hydrog ? ? H C 3  O2 ? ? ? 1_555 H G 32 N2 ? ? H C 3  H G 32 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog78 hydrog ? ? H G 7  N1 ? ? ? 1_555 H C 25 N3 ? ? H G 7  H C 25 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog79 hydrog ? ? H G 7  N2 ? ? ? 1_555 H C 25 O2 ? ? H G 7  H C 25 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog80 hydrog ? ? H G 7  O6 ? ? ? 1_555 H C 25 N4 ? ? H G 7  H C 25 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog81 hydrog ? ? H G 8  N1 ? ? ? 1_555 H C 24 N3 ? ? H G 8  H C 24 1_555 ? ? ? ? ? ? 'G-C PAIR'    ? ? 
hydrog82 hydrog ? ? H C 9  N3 ? ? ? 1_555 H G 23 N1 ? ? H C 9  H G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog83 hydrog ? ? H C 9  N4 ? ? ? 1_555 H G 23 O6 ? ? H C 9  H G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog84 hydrog ? ? H C 9  O2 ? ? ? 1_555 H G 23 N2 ? ? H C 9  H G 23 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog85 hydrog ? ? H A 10 N1 ? ? ? 1_555 H U 22 N3 ? ? H A 10 H U 22 1_555 ? ? ? ? ? ? 'A-U PAIR'    ? ? 
hydrog86 hydrog ? ? H G 11 N1 ? ? ? 1_555 H C 21 N3 ? ? H G 11 H C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog87 hydrog ? ? H G 11 N2 ? ? ? 1_555 H C 21 O2 ? ? H G 11 H C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog88 hydrog ? ? H G 11 O6 ? ? ? 1_555 H C 21 N4 ? ? H G 11 H C 21 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog89 hydrog ? ? H G 12 N1 ? ? ? 1_555 H C 20 N3 ? ? H G 12 H C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog90 hydrog ? ? H G 12 N2 ? ? ? 1_555 H C 20 O2 ? ? H G 12 H C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog91 hydrog ? ? H G 12 O6 ? ? ? 1_555 H C 20 N4 ? ? H G 12 H C 20 1_555 ? ? ? ? ? ? WATSON-CRICK  ? ? 
hydrog92 hydrog ? ? H U 13 N3 ? ? ? 1_555 H U 19 O4 ? ? H U 13 H U 19 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 3 ? 
AA9 ? 4 ? 
AB1 ? 3 ? 
AB2 ? 4 ? 
AB3 ? 3 ? 
AB4 ? 5 ? 
AB5 ? 3 ? 
AB6 ? 4 ? 
AB7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? parallel      
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
AA1 2 ILE A 60  ? PHE A 66  ? ILE A 60  PHE A 66  
AA1 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
AA1 4 TYR A 99  ? VAL A 104 ? TYR A 99  VAL A 104 
AA1 5 SER A 89  ? ARG A 93  ? SER A 89  ARG A 93  
AA2 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
AA2 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
AA2 3 PHE A 215 ? VAL A 217 ? PHE A 215 VAL A 217 
AA3 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
AA3 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
AA3 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
AA3 4 GLU A 413 ? SER A 416 ? GLU A 413 SER A 416 
AA4 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
AA4 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
AA4 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
AA5 1 TYR C 42  ? VAL C 45  ? TYR C 42  VAL C 45  
AA5 2 ILE C 60  ? PHE C 66  ? ILE C 60  PHE C 66  
AA5 3 VAL C 107 ? TYR C 115 ? VAL C 107 TYR C 115 
AA5 4 TYR C 99  ? VAL C 104 ? TYR C 99  VAL C 104 
AA5 5 SER C 89  ? ARG C 93  ? SER C 89  ARG C 93  
AA6 1 GLU C 207 ? LYS C 210 ? GLU C 207 LYS C 210 
AA6 2 THR C 199 ? ASP C 202 ? THR C 199 ASP C 202 
AA6 3 PHE C 215 ? VAL C 217 ? PHE C 215 VAL C 217 
AA7 1 PRO C 315 ? ALA C 322 ? PRO C 315 ALA C 322 
AA7 2 PHE C 326 ? CYS C 333 ? PHE C 326 CYS C 333 
AA7 3 ALA C 277 ? ARG C 284 ? ALA C 277 ARG C 284 
AA7 4 GLU C 413 ? SER C 416 ? GLU C 413 SER C 416 
AA8 1 VAL C 341 ? GLN C 348 ? VAL C 341 GLN C 348 
AA8 2 ARG C 373 ? MET C 379 ? ARG C 373 MET C 379 
AA8 3 PHE C 368 ? GLU C 370 ? PHE C 368 GLU C 370 
AA9 1 TYR E 42  ? VAL E 45  ? TYR E 42  VAL E 45  
AA9 2 GLU E 59  ? PHE E 66  ? GLU E 59  PHE E 66  
AA9 3 VAL E 107 ? TYR E 115 ? VAL E 107 TYR E 115 
AA9 4 VAL E 100 ? VAL E 104 ? VAL E 100 VAL E 104 
AB1 1 GLU E 207 ? LYS E 210 ? GLU E 207 LYS E 210 
AB1 2 THR E 199 ? ASP E 202 ? THR E 199 ASP E 202 
AB1 3 PHE E 215 ? VAL E 217 ? PHE E 215 VAL E 217 
AB2 1 PRO E 315 ? ALA E 322 ? PRO E 315 ALA E 322 
AB2 2 PHE E 326 ? CYS E 333 ? PHE E 326 CYS E 333 
AB2 3 ALA E 277 ? ARG E 284 ? ALA E 277 ARG E 284 
AB2 4 GLU E 413 ? SER E 416 ? GLU E 413 SER E 416 
AB3 1 VAL E 341 ? GLN E 348 ? VAL E 341 GLN E 348 
AB3 2 ARG E 373 ? MET E 379 ? ARG E 373 MET E 379 
AB3 3 PHE E 368 ? GLU E 370 ? PHE E 368 GLU E 370 
AB4 1 TYR G 42  ? VAL G 45  ? TYR G 42  VAL G 45  
AB4 2 ILE G 60  ? PHE G 66  ? ILE G 60  PHE G 66  
AB4 3 VAL G 107 ? TYR G 115 ? VAL G 107 TYR G 115 
AB4 4 PRO G 98  ? VAL G 104 ? PRO G 98  VAL G 104 
AB4 5 SER G 89  ? TYR G 94  ? SER G 89  TYR G 94  
AB5 1 GLU G 207 ? LYS G 210 ? GLU G 207 LYS G 210 
AB5 2 THR G 199 ? ASP G 202 ? THR G 199 ASP G 202 
AB5 3 PHE G 215 ? VAL G 217 ? PHE G 215 VAL G 217 
AB6 1 PRO G 315 ? ALA G 322 ? PRO G 315 ALA G 322 
AB6 2 PHE G 326 ? CYS G 333 ? PHE G 326 CYS G 333 
AB6 3 ALA G 277 ? ARG G 284 ? ALA G 277 ARG G 284 
AB6 4 GLU G 413 ? SER G 416 ? GLU G 413 SER G 416 
AB7 1 VAL G 341 ? GLN G 348 ? VAL G 341 GLN G 348 
AB7 2 ARG G 373 ? MET G 379 ? ARG G 373 MET G 379 
AB7 3 PHE G 368 ? GLU G 370 ? PHE G 368 GLU G 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
AA1 2 3 N PHE A 66  ? N PHE A 66  O CYS A 114 ? O CYS A 114 
AA1 3 4 O VAL A 107 ? O VAL A 107 N VAL A 104 ? N VAL A 104 
AA1 4 5 O HIS A 101 ? O HIS A 101 N GLU A 91  ? N GLU A 91  
AA2 1 2 O ARG A 209 ? O ARG A 209 N VAL A 200 ? N VAL A 200 
AA2 2 3 N ILE A 201 ? N ILE A 201 O PHE A 215 ? O PHE A 215 
AA3 1 2 N LEU A 316 ? N LEU A 316 O GLU A 332 ? O GLU A 332 
AA3 2 3 O CYS A 327 ? O CYS A 327 N PHE A 283 ? N PHE A 283 
AA3 3 4 N LYS A 282 ? N LYS A 282 O GLU A 413 ? O GLU A 413 
AA4 1 2 N GLY A 346 ? N GLY A 346 O TRP A 374 ? O TRP A 374 
AA4 2 3 O TRP A 375 ? O TRP A 375 N PHE A 368 ? N PHE A 368 
AA5 1 2 N VAL C 43  ? N VAL C 43  O PHE C 63  ? O PHE C 63  
AA5 2 3 N ILE C 60  ? N ILE C 60  O ASP C 110 ? O ASP C 110 
AA5 3 4 O VAL C 111 ? O VAL C 111 N VAL C 100 ? N VAL C 100 
AA5 4 5 O HIS C 101 ? O HIS C 101 N GLU C 91  ? N GLU C 91  
AA6 1 2 O GLU C 207 ? O GLU C 207 N ASP C 202 ? N ASP C 202 
AA6 2 3 N ILE C 201 ? N ILE C 201 O PHE C 215 ? O PHE C 215 
AA7 1 2 N LEU C 316 ? N LEU C 316 O GLU C 332 ? O GLU C 332 
AA7 2 3 O CYS C 327 ? O CYS C 327 N PHE C 283 ? N PHE C 283 
AA7 3 4 N ALA C 280 ? N ALA C 280 O ILE C 415 ? O ILE C 415 
AA8 1 2 N GLY C 346 ? N GLY C 346 O TRP C 374 ? O TRP C 374 
AA8 2 3 O TRP C 375 ? O TRP C 375 N PHE C 368 ? N PHE C 368 
AA9 1 2 N VAL E 43  ? N VAL E 43  O PHE E 63  ? O PHE E 63  
AA9 2 3 N ILE E 60  ? N ILE E 60  O ASP E 110 ? O ASP E 110 
AA9 3 4 O VAL E 109 ? O VAL E 109 N GLY E 102 ? N GLY E 102 
AB1 1 2 O GLU E 207 ? O GLU E 207 N ASP E 202 ? N ASP E 202 
AB1 2 3 N ILE E 201 ? N ILE E 201 O PHE E 215 ? O PHE E 215 
AB2 1 2 N LEU E 316 ? N LEU E 316 O GLU E 332 ? O GLU E 332 
AB2 2 3 O CYS E 333 ? O CYS E 333 N ALA E 277 ? N ALA E 277 
AB2 3 4 N ALA E 280 ? N ALA E 280 O ILE E 415 ? O ILE E 415 
AB3 1 2 N PRO E 347 ? N PRO E 347 O TRP E 374 ? O TRP E 374 
AB3 2 3 O ARG E 373 ? O ARG E 373 N GLU E 370 ? N GLU E 370 
AB4 1 2 N VAL G 43  ? N VAL G 43  O PHE G 63  ? O PHE G 63  
AB4 2 3 N PHE G 66  ? N PHE G 66  O CYS G 114 ? O CYS G 114 
AB4 3 4 O VAL G 107 ? O VAL G 107 N VAL G 104 ? N VAL G 104 
AB4 4 5 O HIS G 101 ? O HIS G 101 N GLU G 91  ? N GLU G 91  
AB5 1 2 O ARG G 209 ? O ARG G 209 N VAL G 200 ? N VAL G 200 
AB5 2 3 N ILE G 201 ? N ILE G 201 O PHE G 215 ? O PHE G 215 
AB6 1 2 N LEU G 316 ? N LEU G 316 O GLU G 332 ? O GLU G 332 
AB6 2 3 O CYS G 327 ? O CYS G 327 N PHE G 283 ? N PHE G 283 
AB6 3 4 N LYS G 282 ? N LYS G 282 O GLU G 413 ? O GLU G 413 
AB7 1 2 N GLY G 346 ? N GLY G 346 O TRP G 374 ? O TRP G 374 
AB7 2 3 O ARG G 373 ? O ARG G 373 N GLU G 370 ? N GLU G 370 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 5 'binding site for residue SO4 A 501' 
AC2 Software A SO4 502 ? 2 'binding site for residue SO4 A 502' 
AC3 Software A SO4 503 ? 2 'binding site for residue SO4 A 503' 
AC4 Software A SO4 504 ? 3 'binding site for residue SO4 A 504' 
AC5 Software A SO4 505 ? 5 'binding site for residue SO4 A 505' 
AC6 Software C SO4 501 ? 6 'binding site for residue SO4 C 501' 
AC7 Software E SO4 501 ? 6 'binding site for residue SO4 E 501' 
AC8 Software E SO4 502 ? 2 'binding site for residue SO4 E 502' 
AC9 Software G SO4 501 ? 6 'binding site for residue SO4 G 501' 
AD1 Software G SO4 502 ? 3 'binding site for residue SO4 G 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 SER A 47  ? SER A 47  . ? 1_555 ? 
2  AC1 5 LEU A 54  ? LEU A 54  . ? 1_555 ? 
3  AC1 5 SER A 57  ? SER A 57  . ? 1_555 ? 
4  AC1 5 TYR A 161 ? TYR A 161 . ? 1_555 ? 
5  AC1 5 C   B 36  ? C   B 36  . ? 1_555 ? 
6  AC2 2 SER A 231 ? SER A 231 . ? 1_555 ? 
7  AC2 2 LEU A 232 ? LEU A 232 . ? 1_555 ? 
8  AC3 2 ARG A 299 ? ARG A 299 . ? 1_555 ? 
9  AC3 2 LYS A 303 ? LYS A 303 . ? 1_555 ? 
10 AC4 3 GLN A 348 ? GLN A 348 . ? 1_555 ? 
11 AC4 3 ARG A 373 ? ARG A 373 . ? 1_555 ? 
12 AC4 3 ARG C 197 ? ARG C 197 . ? 1_555 ? 
13 AC5 5 ARG A 50  ? ARG A 50  . ? 1_555 ? 
14 AC5 5 THR A 130 ? THR A 130 . ? 1_555 ? 
15 AC5 5 HIS A 133 ? HIS A 133 . ? 1_555 ? 
16 AC5 5 TYR A 173 ? TYR A 173 . ? 1_555 ? 
17 AC5 5 C   B 36  ? C   B 36  . ? 1_555 ? 
18 AC6 6 SER C 47  ? SER C 47  . ? 1_555 ? 
19 AC6 6 TRP C 53  ? TRP C 53  . ? 1_555 ? 
20 AC6 6 LEU C 54  ? LEU C 54  . ? 1_555 ? 
21 AC6 6 SER C 57  ? SER C 57  . ? 1_555 ? 
22 AC6 6 LYS C 152 ? LYS C 152 . ? 1_555 ? 
23 AC6 6 TYR C 161 ? TYR C 161 . ? 1_555 ? 
24 AC7 6 SER E 47  ? SER E 47  . ? 1_555 ? 
25 AC7 6 TRP E 53  ? TRP E 53  . ? 1_555 ? 
26 AC7 6 LEU E 54  ? LEU E 54  . ? 1_555 ? 
27 AC7 6 SER E 57  ? SER E 57  . ? 1_555 ? 
28 AC7 6 LYS E 152 ? LYS E 152 . ? 1_555 ? 
29 AC7 6 TYR E 161 ? TYR E 161 . ? 1_555 ? 
30 AC8 2 GLN E 348 ? GLN E 348 . ? 1_555 ? 
31 AC8 2 ARG E 373 ? ARG E 373 . ? 1_555 ? 
32 AC9 6 SER G 47  ? SER G 47  . ? 1_555 ? 
33 AC9 6 TRP G 53  ? TRP G 53  . ? 1_555 ? 
34 AC9 6 LEU G 54  ? LEU G 54  . ? 1_555 ? 
35 AC9 6 SER G 57  ? SER G 57  . ? 1_555 ? 
36 AC9 6 LYS G 152 ? LYS G 152 . ? 1_555 ? 
37 AC9 6 TYR G 161 ? TYR G 161 . ? 1_555 ? 
38 AD1 3 ARG E 197 ? ARG E 197 . ? 1_555 ? 
39 AD1 3 GLN G 348 ? GLN G 348 . ? 1_555 ? 
40 AD1 3 ARG G 373 ? ARG G 373 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X4P 
_atom_sites.fract_transf_matrix[1][1]   0.017209 
_atom_sites.fract_transf_matrix[1][2]   -0.000058 
_atom_sites.fract_transf_matrix[1][3]   -0.000604 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017208 
_atom_sites.fract_transf_matrix[2][3]   -0.001444 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004610 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N      . MET A 1 1   ? 50.011  -58.248 101.434 1.00 72.77  ? 1   MET A N      1 
ATOM   2     C CA     . MET A 1 1   ? 49.940  -57.959 102.894 1.00 80.73  ? 1   MET A CA     1 
ATOM   3     C C      . MET A 1 1   ? 50.739  -56.693 103.263 1.00 80.19  ? 1   MET A C      1 
ATOM   4     O O      . MET A 1 1   ? 50.251  -55.865 104.044 1.00 80.25  ? 1   MET A O      1 
ATOM   5     C CB     . MET A 1 1   ? 50.441  -59.170 103.696 1.00 90.54  ? 1   MET A CB     1 
ATOM   6     C CG     . MET A 1 1   ? 49.641  -60.463 103.454 1.00 92.89  ? 1   MET A CG     1 
ATOM   7     S SD     . MET A 1 1   ? 48.402  -60.820 104.728 1.00 102.62 ? 1   MET A SD     1 
ATOM   8     C CE     . MET A 1 1   ? 47.598  -62.273 104.051 1.00 91.28  ? 1   MET A CE     1 
ATOM   9     H H1     . MET A 1 1   ? 49.284  -58.697 101.185 1.00 87.71  ? 1   MET A H1     1 
ATOM   10    H H2     . MET A 1 1   ? 50.056  -57.482 100.982 1.00 87.71  ? 1   MET A H2     1 
ATOM   11    H H3     . MET A 1 1   ? 50.735  -58.737 101.263 1.00 87.71  ? 1   MET A H3     1 
ATOM   12    H HA     . MET A 1 1   ? 49.011  -57.815 103.134 1.00 97.27  ? 1   MET A HA     1 
ATOM   13    H HB2    . MET A 1 1   ? 51.363  -59.344 103.452 1.00 109.04 ? 1   MET A HB2    1 
ATOM   14    H HB3    . MET A 1 1   ? 50.386  -58.962 104.641 1.00 109.04 ? 1   MET A HB3    1 
ATOM   15    H HG2    . MET A 1 1   ? 49.178  -60.389 102.605 1.00 111.86 ? 1   MET A HG2    1 
ATOM   16    H HG3    . MET A 1 1   ? 50.258  -61.211 103.426 1.00 111.86 ? 1   MET A HG3    1 
ATOM   17    H HE1    . MET A 1 1   ? 46.901  -62.561 104.661 1.00 109.93 ? 1   MET A HE1    1 
ATOM   18    H HE2    . MET A 1 1   ? 47.213  -62.048 103.190 1.00 109.93 ? 1   MET A HE2    1 
ATOM   19    H HE3    . MET A 1 1   ? 48.257  -62.977 103.945 1.00 109.93 ? 1   MET A HE3    1 
ATOM   20    N N      . LYS A 1 2   ? 51.949  -56.545 102.707 1.00 77.36  ? 2   LYS A N      1 
ATOM   21    C CA     . LYS A 1 2   ? 52.780  -55.357 102.956 1.00 71.81  ? 2   LYS A CA     1 
ATOM   22    C C      . LYS A 1 2   ? 52.530  -54.316 101.872 1.00 67.30  ? 2   LYS A C      1 
ATOM   23    O O      . LYS A 1 2   ? 51.885  -54.613 100.869 1.00 65.03  ? 2   LYS A O      1 
ATOM   24    C CB     . LYS A 1 2   ? 54.265  -55.738 102.995 1.00 74.67  ? 2   LYS A CB     1 
ATOM   25    C CG     . LYS A 1 2   ? 55.221  -54.630 103.448 1.00 75.13  ? 2   LYS A CG     1 
ATOM   26    C CD     . LYS A 1 2   ? 56.624  -55.178 103.718 1.00 80.25  ? 2   LYS A CD     1 
ATOM   27    C CE     . LYS A 1 2   ? 57.509  -54.183 104.466 1.00 80.93  ? 2   LYS A CE     1 
ATOM   28    N NZ     . LYS A 1 2   ? 57.676  -52.903 103.726 1.00 77.34  ? 2   LYS A NZ     1 
ATOM   29    H H      . LYS A 1 2   ? 52.313  -57.120 102.181 1.00 93.22  ? 2   LYS A H      1 
ATOM   30    H HA     . LYS A 1 2   ? 52.541  -54.970 103.813 1.00 84.21  ? 2   LYS A HA     1 
ATOM   31    H HB2    . LYS A 1 2   ? 54.375  -56.484 103.605 1.00 87.65  ? 2   LYS A HB2    1 
ATOM   32    H HB3    . LYS A 1 2   ? 54.536  -56.008 102.103 1.00 87.65  ? 2   LYS A HB3    1 
ATOM   33    H HG2    . LYS A 1 2   ? 55.286  -53.958 102.751 1.00 88.21  ? 2   LYS A HG2    1 
ATOM   34    H HG3    . LYS A 1 2   ? 54.887  -54.233 104.267 1.00 88.21  ? 2   LYS A HG3    1 
ATOM   35    H HD2    . LYS A 1 2   ? 56.551  -55.981 104.258 1.00 96.69  ? 2   LYS A HD2    1 
ATOM   36    H HD3    . LYS A 1 2   ? 57.052  -55.384 102.872 1.00 96.69  ? 2   LYS A HD3    1 
ATOM   37    H HE2    . LYS A 1 2   ? 57.106  -53.984 105.325 1.00 95.64  ? 2   LYS A HE2    1 
ATOM   38    H HE3    . LYS A 1 2   ? 58.388  -54.574 104.593 1.00 95.64  ? 2   LYS A HE3    1 
ATOM   39    H HZ1    . LYS A 1 2   ? 58.196  -52.349 104.190 1.00 91.30  ? 2   LYS A HZ1    1 
ATOM   40    H HZ2    . LYS A 1 2   ? 58.051  -53.057 102.934 1.00 91.30  ? 2   LYS A HZ2    1 
ATOM   41    H HZ3    . LYS A 1 2   ? 56.883  -52.519 103.601 1.00 91.30  ? 2   LYS A HZ3    1 
ATOM   42    N N      . VAL A 1 3   ? 53.096  -53.121 102.041 1.00 69.33  ? 3   VAL A N      1 
ATOM   43    C CA     . VAL A 1 3   ? 52.842  -52.004 101.126 1.00 67.80  ? 3   VAL A CA     1 
ATOM   44    C C      . VAL A 1 3   ? 53.539  -52.235 99.791  1.00 73.55  ? 3   VAL A C      1 
ATOM   45    O O      . VAL A 1 3   ? 53.056  -51.839 98.732  1.00 63.49  ? 3   VAL A O      1 
ATOM   46    C CB     . VAL A 1 3   ? 53.323  -50.657 101.711 1.00 62.55  ? 3   VAL A CB     1 
ATOM   47    C CG1    . VAL A 1 3   ? 52.670  -49.504 100.984 1.00 58.91  ? 3   VAL A CG1    1 
ATOM   48    C CG2    . VAL A 1 3   ? 53.023  -50.569 103.196 1.00 65.45  ? 3   VAL A CG2    1 
ATOM   49    H H      . VAL A 1 3   ? 53.635  -52.929 102.683 1.00 83.59  ? 3   VAL A H      1 
ATOM   50    H HA     . VAL A 1 3   ? 51.888  -51.938 100.961 1.00 81.75  ? 3   VAL A HA     1 
ATOM   51    H HB     . VAL A 1 3   ? 54.283  -50.584 101.592 1.00 75.44  ? 3   VAL A HB     1 
ATOM   52    H HG11   . VAL A 1 3   ? 52.985  -48.671 101.367 1.00 70.90  ? 3   VAL A HG11   1 
ATOM   53    H HG12   . VAL A 1 3   ? 52.908  -49.549 100.045 1.00 70.90  ? 3   VAL A HG12   1 
ATOM   54    H HG13   . VAL A 1 3   ? 51.708  -49.572 101.085 1.00 70.90  ? 3   VAL A HG13   1 
ATOM   55    H HG21   . VAL A 1 3   ? 53.337  -49.715 103.531 1.00 76.59  ? 3   VAL A HG21   1 
ATOM   56    H HG22   . VAL A 1 3   ? 52.066  -50.646 103.330 1.00 76.59  ? 3   VAL A HG22   1 
ATOM   57    H HG23   . VAL A 1 3   ? 53.481  -51.292 103.653 1.00 76.59  ? 3   VAL A HG23   1 
ATOM   58    N N      . GLU A 1 4   ? 54.704  -52.859 99.866  1.00 91.98  ? 4   GLU A N      1 
ATOM   59    C CA     . GLU A 1 4   ? 55.522  -53.126 98.696  1.00 102.54 ? 4   GLU A CA     1 
ATOM   60    C C      . GLU A 1 4   ? 54.751  -53.975 97.691  1.00 103.37 ? 4   GLU A C      1 
ATOM   61    O O      . GLU A 1 4   ? 54.566  -53.573 96.544  1.00 101.24 ? 4   GLU A O      1 
ATOM   62    C CB     . GLU A 1 4   ? 56.831  -53.804 99.108  1.00 110.51 ? 4   GLU A CB     1 
ATOM   63    C CG     . GLU A 1 4   ? 57.615  -52.996 100.134 1.00 112.45 ? 4   GLU A CG     1 
ATOM   64    C CD     . GLU A 1 4   ? 58.762  -53.764 100.732 1.00 115.12 ? 4   GLU A CD     1 
ATOM   65    O OE1    . GLU A 1 4   ? 58.646  -55.000 100.858 1.00 115.21 ? 4   GLU A OE1    1 
ATOM   66    O OE2    . GLU A 1 4   ? 59.774  -53.127 101.092 1.00 117.37 ? 4   GLU A OE2    1 
ATOM   67    H H      . GLU A 1 4   ? 55.049  -53.144 100.600 1.00 110.76 ? 4   GLU A H      1 
ATOM   68    H HA     . GLU A 1 4   ? 55.744  -52.284 98.269  1.00 123.44 ? 4   GLU A HA     1 
ATOM   69    H HB2    . GLU A 1 4   ? 56.630  -54.670 99.497  1.00 133.00 ? 4   GLU A HB2    1 
ATOM   70    H HB3    . GLU A 1 4   ? 57.390  -53.916 98.322  1.00 133.00 ? 4   GLU A HB3    1 
ATOM   71    H HG2    . GLU A 1 4   ? 57.976  -52.206 99.703  1.00 135.33 ? 4   GLU A HG2    1 
ATOM   72    H HG3    . GLU A 1 4   ? 57.019  -52.738 100.854 1.00 135.33 ? 4   GLU A HG3    1 
ATOM   73    N N      . GLU A 1 5   ? 54.294  -55.145 98.124  1.00 105.71 ? 5   GLU A N      1 
ATOM   74    C CA     . GLU A 1 5   ? 53.676  -56.088 97.205  1.00 104.83 ? 5   GLU A CA     1 
ATOM   75    C C      . GLU A 1 5   ? 52.286  -55.663 96.756  1.00 96.30  ? 5   GLU A C      1 
ATOM   76    O O      . GLU A 1 5   ? 51.834  -56.076 95.695  1.00 101.03 ? 5   GLU A O      1 
ATOM   77    C CB     . GLU A 1 5   ? 53.591  -57.473 97.850  1.00 111.67 ? 5   GLU A CB     1 
ATOM   78    C CG     . GLU A 1 5   ? 54.944  -58.111 98.131  1.00 118.42 ? 5   GLU A CG     1 
ATOM   79    C CD     . GLU A 1 5   ? 54.850  -59.600 98.443  1.00 123.37 ? 5   GLU A CD     1 
ATOM   80    O OE1    . GLU A 1 5   ? 53.727  -60.153 98.425  1.00 123.99 ? 5   GLU A OE1    1 
ATOM   81    O OE2    . GLU A 1 5   ? 55.908  -60.218 98.698  1.00 125.25 ? 5   GLU A OE2    1 
ATOM   82    H H      . GLU A 1 5   ? 54.331  -55.414 98.940  1.00 127.24 ? 5   GLU A H      1 
ATOM   83    H HA     . GLU A 1 5   ? 54.233  -56.163 96.414  1.00 126.18 ? 5   GLU A HA     1 
ATOM   84    H HB2    . GLU A 1 5   ? 53.119  -57.395 98.694  1.00 134.39 ? 5   GLU A HB2    1 
ATOM   85    H HB3    . GLU A 1 5   ? 53.103  -58.064 97.255  1.00 134.39 ? 5   GLU A HB3    1 
ATOM   86    H HG2    . GLU A 1 5   ? 55.511  -58.004 97.351  1.00 142.50 ? 5   GLU A HG2    1 
ATOM   87    H HG3    . GLU A 1 5   ? 55.347  -57.671 98.896  1.00 142.50 ? 5   GLU A HG3    1 
ATOM   88    N N      . ILE A 1 6   ? 51.607  -54.832 97.534  1.00 83.31  ? 6   ILE A N      1 
ATOM   89    C CA     . ILE A 1 6   ? 50.283  -54.371 97.128  1.00 72.13  ? 6   ILE A CA     1 
ATOM   90    C C      . ILE A 1 6   ? 50.354  -53.547 95.846  1.00 67.58  ? 6   ILE A C      1 
ATOM   91    O O      . ILE A 1 6   ? 49.614  -53.800 94.901  1.00 65.50  ? 6   ILE A O      1 
ATOM   92    C CB     . ILE A 1 6   ? 49.593  -53.539 98.230  1.00 64.72  ? 6   ILE A CB     1 
ATOM   93    C CG1    . ILE A 1 6   ? 49.245  -54.425 99.417  1.00 65.87  ? 6   ILE A CG1    1 
ATOM   94    C CG2    . ILE A 1 6   ? 48.273  -52.962 97.734  1.00 62.56  ? 6   ILE A CG2    1 
ATOM   95    C CD1    . ILE A 1 6   ? 48.887  -53.652 100.664 1.00 66.05  ? 6   ILE A CD1    1 
ATOM   96    H H      . ILE A 1 6   ? 51.882  -54.523 98.289  1.00 100.37 ? 6   ILE A H      1 
ATOM   97    H HA     . ILE A 1 6   ? 49.726  -55.145 96.951  1.00 86.94  ? 6   ILE A HA     1 
ATOM   98    H HB     . ILE A 1 6   ? 50.179  -52.821 98.517  1.00 78.05  ? 6   ILE A HB     1 
ATOM   99    H HG12   . ILE A 1 6   ? 48.485  -54.979 99.182  1.00 79.44  ? 6   ILE A HG12   1 
ATOM   100   H HG13   . ILE A 1 6   ? 50.010  -54.985 99.624  1.00 79.44  ? 6   ILE A HG13   1 
ATOM   101   H HG21   . ILE A 1 6   ? 47.867  -52.446 98.448  1.00 75.46  ? 6   ILE A HG21   1 
ATOM   102   H HG22   . ILE A 1 6   ? 48.447  -52.390 96.970  1.00 75.46  ? 6   ILE A HG22   1 
ATOM   103   H HG23   . ILE A 1 6   ? 47.687  -53.690 97.477  1.00 75.46  ? 6   ILE A HG23   1 
ATOM   104   H HD11   . ILE A 1 6   ? 48.678  -54.280 101.374 1.00 79.65  ? 6   ILE A HD11   1 
ATOM   105   H HD12   . ILE A 1 6   ? 49.642  -53.100 100.921 1.00 79.65  ? 6   ILE A HD12   1 
ATOM   106   H HD13   . ILE A 1 6   ? 48.116  -53.094 100.479 1.00 79.65  ? 6   ILE A HD13   1 
ATOM   107   N N      . LEU A 1 7   ? 51.264  -52.585 95.800  1.00 67.78  ? 7   LEU A N      1 
ATOM   108   C CA     . LEU A 1 7   ? 51.334  -51.683 94.660  1.00 66.92  ? 7   LEU A CA     1 
ATOM   109   C C      . LEU A 1 7   ? 51.582  -52.430 93.362  1.00 71.60  ? 7   LEU A C      1 
ATOM   110   O O      . LEU A 1 7   ? 51.006  -52.083 92.334  1.00 70.28  ? 7   LEU A O      1 
ATOM   111   C CB     . LEU A 1 7   ? 52.442  -50.650 94.875  1.00 64.46  ? 7   LEU A CB     1 
ATOM   112   C CG     . LEU A 1 7   ? 52.274  -49.767 96.115  1.00 63.33  ? 7   LEU A CG     1 
ATOM   113   C CD1    . LEU A 1 7   ? 53.379  -48.734 96.171  1.00 63.29  ? 7   LEU A CD1    1 
ATOM   114   C CD2    . LEU A 1 7   ? 50.903  -49.086 96.162  1.00 59.90  ? 7   LEU A CD2    1 
ATOM   115   H H      . LEU A 1 7   ? 51.850  -52.433 96.411  1.00 81.73  ? 7   LEU A H      1 
ATOM   116   H HA     . LEU A 1 7   ? 50.492  -51.209 94.578  1.00 80.69  ? 7   LEU A HA     1 
ATOM   117   H HB2    . LEU A 1 7   ? 53.287  -51.118 94.962  1.00 77.74  ? 7   LEU A HB2    1 
ATOM   118   H HB3    . LEU A 1 7   ? 52.472  -50.065 94.102  1.00 77.74  ? 7   LEU A HB3    1 
ATOM   119   H HG     . LEU A 1 7   ? 52.352  -50.324 96.905  1.00 76.38  ? 7   LEU A HG     1 
ATOM   120   H HD11   . LEU A 1 7   ? 53.258  -48.185 96.961  1.00 76.34  ? 7   LEU A HD11   1 
ATOM   121   H HD12   . LEU A 1 7   ? 54.235  -49.190 96.213  1.00 76.34  ? 7   LEU A HD12   1 
ATOM   122   H HD13   . LEU A 1 7   ? 53.336  -48.183 95.374  1.00 76.34  ? 7   LEU A HD13   1 
ATOM   123   H HD21   . LEU A 1 7   ? 50.849  -48.541 96.962  1.00 72.27  ? 7   LEU A HD21   1 
ATOM   124   H HD22   . LEU A 1 7   ? 50.801  -48.528 95.374  1.00 72.27  ? 7   LEU A HD22   1 
ATOM   125   H HD23   . LEU A 1 7   ? 50.213  -49.767 96.177  1.00 72.27  ? 7   LEU A HD23   1 
ATOM   126   N N      . GLU A 1 8   ? 52.411  -53.467 93.410  1.00 79.43  ? 8   GLU A N      1 
ATOM   127   C CA     . GLU A 1 8   ? 52.702  -54.247 92.215  1.00 82.34  ? 8   GLU A CA     1 
ATOM   128   C C      . GLU A 1 8   ? 51.507  -55.115 91.819  1.00 80.83  ? 8   GLU A C      1 
ATOM   129   O O      . GLU A 1 8   ? 51.225  -55.272 90.634  1.00 79.35  ? 8   GLU A O      1 
ATOM   130   C CB     . GLU A 1 8   ? 53.964  -55.084 92.405  1.00 87.55  ? 8   GLU A CB     1 
ATOM   131   C CG     . GLU A 1 8   ? 55.218  -54.219 92.426  1.00 89.51  ? 8   GLU A CG     1 
ATOM   132   C CD     . GLU A 1 8   ? 56.501  -55.020 92.451  1.00 92.65  ? 8   GLU A CD     1 
ATOM   133   O OE1    . GLU A 1 8   ? 57.584  -54.399 92.415  1.00 92.16  ? 8   GLU A OE1    1 
ATOM   134   O OE2    . GLU A 1 8   ? 56.429  -56.266 92.489  1.00 94.21  ? 8   GLU A OE2    1 
ATOM   135   H H      . GLU A 1 8   ? 52.816  -53.739 94.119  1.00 95.70  ? 8   GLU A H      1 
ATOM   136   H HA     . GLU A 1 8   ? 52.869  -53.633 91.482  1.00 99.20  ? 8   GLU A HA     1 
ATOM   137   H HB2    . GLU A 1 8   ? 53.908  -55.558 93.249  1.00 105.45 ? 8   GLU A HB2    1 
ATOM   138   H HB3    . GLU A 1 8   ? 54.042  -55.714 91.671  1.00 105.45 ? 8   GLU A HB3    1 
ATOM   139   H HG2    . GLU A 1 8   ? 55.230  -53.664 91.630  1.00 107.80 ? 8   GLU A HG2    1 
ATOM   140   H HG3    . GLU A 1 8   ? 55.200  -53.660 93.218  1.00 107.80 ? 8   GLU A HG3    1 
ATOM   141   N N      . LYS A 1 9   ? 50.815  -55.692 92.799  1.00 79.35  ? 9   LYS A N      1 
ATOM   142   C CA     . LYS A 1 9   ? 49.604  -56.455 92.503  1.00 76.69  ? 9   LYS A CA     1 
ATOM   143   C C      . LYS A 1 9   ? 48.602  -55.546 91.798  1.00 71.96  ? 9   LYS A C      1 
ATOM   144   O O      . LYS A 1 9   ? 47.988  -55.928 90.801  1.00 75.32  ? 9   LYS A O      1 
ATOM   145   C CB     . LYS A 1 9   ? 48.984  -57.039 93.776  1.00 78.78  ? 9   LYS A CB     1 
ATOM   146   C CG     . LYS A 1 9   ? 49.812  -58.119 94.450  1.00 84.00  ? 9   LYS A CG     1 
ATOM   147   C CD     . LYS A 1 9   ? 49.337  -58.358 95.880  1.00 86.10  ? 9   LYS A CD     1 
ATOM   148   C CE     . LYS A 1 9   ? 50.276  -59.277 96.656  1.00 87.41  ? 9   LYS A CE     1 
ATOM   149   N NZ     . LYS A 1 9   ? 49.862  -59.452 98.086  1.00 84.65  ? 9   LYS A NZ     1 
ATOM   150   H H      . LYS A 1 9   ? 51.022  -55.658 93.633  1.00 95.61  ? 9   LYS A H      1 
ATOM   151   H HA     . LYS A 1 9   ? 49.823  -57.188 91.907  1.00 92.41  ? 9   LYS A HA     1 
ATOM   152   H HB2    . LYS A 1 9   ? 48.861  -56.321 94.417  1.00 94.93  ? 9   LYS A HB2    1 
ATOM   153   H HB3    . LYS A 1 9   ? 48.124  -57.426 93.551  1.00 94.93  ? 9   LYS A HB3    1 
ATOM   154   H HG2    . LYS A 1 9   ? 49.722  -58.949 93.955  1.00 101.19 ? 9   LYS A HG2    1 
ATOM   155   H HG3    . LYS A 1 9   ? 50.741  -57.842 94.479  1.00 101.19 ? 9   LYS A HG3    1 
ATOM   156   H HD2    . LYS A 1 9   ? 49.293  -57.509 96.346  1.00 103.71 ? 9   LYS A HD2    1 
ATOM   157   H HD3    . LYS A 1 9   ? 48.460  -58.773 95.858  1.00 103.71 ? 9   LYS A HD3    1 
ATOM   158   H HE2    . LYS A 1 9   ? 50.282  -60.151 96.236  1.00 105.29 ? 9   LYS A HE2    1 
ATOM   159   H HE3    . LYS A 1 9   ? 51.169  -58.898 96.647  1.00 105.29 ? 9   LYS A HE3    1 
ATOM   160   H HZ1    . LYS A 1 9   ? 50.433  -59.993 98.503  1.00 101.97 ? 9   LYS A HZ1    1 
ATOM   161   H HZ2    . LYS A 1 9   ? 49.855  -58.664 98.499  1.00 101.97 ? 9   LYS A HZ2    1 
ATOM   162   H HZ3    . LYS A 1 9   ? 49.047  -59.807 98.125  1.00 101.97 ? 9   LYS A HZ3    1 
ATOM   163   N N      . ALA A 1 10  ? 48.453  -54.335 92.325  1.00 63.34  ? 10  ALA A N      1 
ATOM   164   C CA     . ALA A 1 10  ? 47.502  -53.372 91.791  1.00 59.24  ? 10  ALA A CA     1 
ATOM   165   C C      . ALA A 1 10  ? 47.848  -52.940 90.369  1.00 59.64  ? 10  ALA A C      1 
ATOM   166   O O      . ALA A 1 10  ? 46.958  -52.604 89.596  1.00 57.75  ? 10  ALA A O      1 
ATOM   167   C CB     . ALA A 1 10  ? 47.434  -52.164 92.692  1.00 58.91  ? 10  ALA A CB     1 
ATOM   168   H H      . ALA A 1 10  ? 48.898  -54.045 93.001  1.00 76.40  ? 10  ALA A H      1 
ATOM   169   H HA     . ALA A 1 10  ? 46.622  -53.779 91.772  1.00 71.47  ? 10  ALA A HA     1 
ATOM   170   H HB1    . ALA A 1 10  ? 46.797  -51.532 92.324  1.00 71.08  ? 10  ALA A HB1    1 
ATOM   171   H HB2    . ALA A 1 10  ? 47.149  -52.445 93.576  1.00 71.08  ? 10  ALA A HB2    1 
ATOM   172   H HB3    . ALA A 1 10  ? 48.314  -51.758 92.741  1.00 71.08  ? 10  ALA A HB3    1 
ATOM   173   N N      . LEU A 1 11  ? 49.135  -52.945 90.029  1.00 65.53  ? 11  LEU A N      1 
ATOM   174   C CA     . LEU A 1 11  ? 49.581  -52.548 88.696  1.00 70.19  ? 11  LEU A CA     1 
ATOM   175   C C      . LEU A 1 11  ? 48.758  -53.243 87.632  1.00 75.96  ? 11  LEU A C      1 
ATOM   176   O O      . LEU A 1 11  ? 48.337  -52.621 86.663  1.00 78.22  ? 11  LEU A O      1 
ATOM   177   C CB     . LEU A 1 11  ? 51.061  -52.870 88.480  1.00 72.83  ? 11  LEU A CB     1 
ATOM   178   C CG     . LEU A 1 11  ? 52.114  -52.034 89.208  1.00 73.08  ? 11  LEU A CG     1 
ATOM   179   C CD1    . LEU A 1 11  ? 53.502  -52.638 89.023  1.00 73.29  ? 11  LEU A CD1    1 
ATOM   180   C CD2    . LEU A 1 11  ? 52.085  -50.599 88.707  1.00 71.78  ? 11  LEU A CD2    1 
ATOM   181   H H      . LEU A 1 11  ? 49.774  -53.176 90.557  1.00 79.02  ? 11  LEU A H      1 
ATOM   182   H HA     . LEU A 1 11  ? 49.462  -51.591 88.593  1.00 84.62  ? 11  LEU A HA     1 
ATOM   183   H HB2    . LEU A 1 11  ? 51.204  -53.791 88.747  1.00 87.78  ? 11  LEU A HB2    1 
ATOM   184   H HB3    . LEU A 1 11  ? 51.245  -52.786 87.531  1.00 87.78  ? 11  LEU A HB3    1 
ATOM   185   H HG     . LEU A 1 11  ? 51.913  -52.026 90.157  1.00 88.09  ? 11  LEU A HG     1 
ATOM   186   H HD11   . LEU A 1 11  ? 54.150  -52.090 89.493  1.00 88.34  ? 11  LEU A HD11   1 
ATOM   187   H HD12   . LEU A 1 11  ? 53.505  -53.538 89.385  1.00 88.34  ? 11  LEU A HD12   1 
ATOM   188   H HD13   . LEU A 1 11  ? 53.713  -52.661 88.076  1.00 88.34  ? 11  LEU A HD13   1 
ATOM   189   H HD21   . LEU A 1 11  ? 52.759  -50.086 89.180  1.00 86.53  ? 11  LEU A HD21   1 
ATOM   190   H HD22   . LEU A 1 11  ? 52.272  -50.593 87.755  1.00 86.53  ? 11  LEU A HD22   1 
ATOM   191   H HD23   . LEU A 1 11  ? 51.206  -50.224 88.875  1.00 86.53  ? 11  LEU A HD23   1 
ATOM   192   N N      . GLU A 1 12  ? 48.511  -54.532 87.829  1.00 80.89  ? 12  GLU A N      1 
ATOM   193   C CA     . GLU A 1 12  ? 47.799  -55.332 86.841  1.00 84.77  ? 12  GLU A CA     1 
ATOM   194   C C      . GLU A 1 12  ? 46.446  -54.730 86.505  1.00 76.40  ? 12  GLU A C      1 
ATOM   195   O O      . GLU A 1 12  ? 45.971  -54.810 85.367  1.00 80.71  ? 12  GLU A O      1 
ATOM   196   C CB     . GLU A 1 12  ? 47.573  -56.749 87.359  1.00 93.11  ? 12  GLU A CB     1 
ATOM   197   C CG     . GLU A 1 12  ? 48.805  -57.476 87.821  1.00 97.82  ? 12  GLU A CG     1 
ATOM   198   C CD     . GLU A 1 12  ? 48.473  -58.871 88.292  1.00 103.35 ? 12  GLU A CD     1 
ATOM   199   O OE1    . GLU A 1 12  ? 49.408  -59.676 88.471  1.00 106.23 ? 12  GLU A OE1    1 
ATOM   200   O OE2    . GLU A 1 12  ? 47.271  -59.161 88.481  1.00 105.33 ? 12  GLU A OE2    1 
ATOM   201   H H      . GLU A 1 12  ? 48.746  -54.969 88.531  1.00 97.46  ? 12  GLU A H      1 
ATOM   202   H HA     . GLU A 1 12  ? 48.323  -55.382 86.026  1.00 102.12 ? 12  GLU A HA     1 
ATOM   203   H HB2    . GLU A 1 12  ? 46.962  -56.707 88.111  1.00 112.12 ? 12  GLU A HB2    1 
ATOM   204   H HB3    . GLU A 1 12  ? 47.174  -57.276 86.648  1.00 112.12 ? 12  GLU A HB3    1 
ATOM   205   H HG2    . GLU A 1 12  ? 49.433  -57.545 87.084  1.00 117.78 ? 12  GLU A HG2    1 
ATOM   206   H HG3    . GLU A 1 12  ? 49.206  -56.992 88.560  1.00 117.78 ? 12  GLU A HG3    1 
ATOM   207   N N      . LEU A 1 13  ? 45.845  -54.105 87.507  1.00 62.79  ? 13  LEU A N      1 
ATOM   208   C CA     . LEU A 1 13  ? 44.504  -53.579 87.372  1.00 56.58  ? 13  LEU A CA     1 
ATOM   209   C C      . LEU A 1 13  ? 44.507  -52.323 86.510  1.00 53.90  ? 13  LEU A C      1 
ATOM   210   O O      . LEU A 1 13  ? 43.572  -52.074 85.750  1.00 54.60  ? 13  LEU A O      1 
ATOM   211   C CB     . LEU A 1 13  ? 43.917  -53.256 88.746  1.00 55.19  ? 13  LEU A CB     1 
ATOM   212   C CG     . LEU A 1 13  ? 44.011  -54.304 89.859  1.00 55.25  ? 13  LEU A CG     1 
ATOM   213   C CD1    . LEU A 1 13  ? 43.373  -53.744 91.122  1.00 54.56  ? 13  LEU A CD1    1 
ATOM   214   C CD2    . LEU A 1 13  ? 43.389  -55.634 89.497  1.00 58.01  ? 13  LEU A CD2    1 
ATOM   215   H H      . LEU A 1 13  ? 46.198  -53.973 88.280  1.00 75.74  ? 13  LEU A H      1 
ATOM   216   H HA     . LEU A 1 13  ? 43.939  -54.242 86.946  1.00 68.29  ? 13  LEU A HA     1 
ATOM   217   H HB2    . LEU A 1 13  ? 44.360  -52.459 89.076  1.00 66.62  ? 13  LEU A HB2    1 
ATOM   218   H HB3    . LEU A 1 13  ? 42.974  -53.063 88.624  1.00 66.62  ? 13  LEU A HB3    1 
ATOM   219   H HG     . LEU A 1 13  ? 44.948  -54.464 90.051  1.00 66.70  ? 13  LEU A HG     1 
ATOM   220   H HD11   . LEU A 1 13  ? 43.434  -54.408 91.827  1.00 65.86  ? 13  LEU A HD11   1 
ATOM   221   H HD12   . LEU A 1 13  ? 43.847  -52.939 91.385  1.00 65.86  ? 13  LEU A HD12   1 
ATOM   222   H HD13   . LEU A 1 13  ? 42.443  -53.537 90.941  1.00 65.86  ? 13  LEU A HD13   1 
ATOM   223   H HD21   . LEU A 1 13  ? 43.488  -56.242 90.246  1.00 70.01  ? 13  LEU A HD21   1 
ATOM   224   H HD22   . LEU A 1 13  ? 42.449  -55.500 89.301  1.00 70.01  ? 13  LEU A HD22   1 
ATOM   225   H HD23   . LEU A 1 13  ? 43.842  -55.993 88.718  1.00 70.01  ? 13  LEU A HD23   1 
ATOM   226   N N      . VAL A 1 14  ? 45.547  -51.517 86.658  1.00 50.45  ? 14  VAL A N      1 
ATOM   227   C CA     . VAL A 1 14  ? 45.586  -50.232 85.998  1.00 47.26  ? 14  VAL A CA     1 
ATOM   228   C C      . VAL A 1 14  ? 46.305  -50.269 84.660  1.00 48.10  ? 14  VAL A C      1 
ATOM   229   O O      . VAL A 1 14  ? 46.185  -49.332 83.871  1.00 47.97  ? 14  VAL A O      1 
ATOM   230   C CB     . VAL A 1 14  ? 46.254  -49.177 86.907  1.00 44.71  ? 14  VAL A CB     1 
ATOM   231   C CG1    . VAL A 1 14  ? 45.410  -48.964 88.128  1.00 45.13  ? 14  VAL A CG1    1 
ATOM   232   C CG2    . VAL A 1 14  ? 47.665  -49.590 87.319  1.00 45.01  ? 14  VAL A CG2    1 
ATOM   233   H H      . VAL A 1 14  ? 46.240  -51.693 87.136  1.00 60.93  ? 14  VAL A H      1 
ATOM   234   H HA     . VAL A 1 14  ? 44.675  -49.942 85.833  1.00 57.10  ? 14  VAL A HA     1 
ATOM   235   H HB     . VAL A 1 14  ? 46.313  -48.336 86.428  1.00 54.04  ? 14  VAL A HB     1 
ATOM   236   H HG11   . VAL A 1 14  ? 45.835  -48.301 88.694  1.00 54.55  ? 14  VAL A HG11   1 
ATOM   237   H HG12   . VAL A 1 14  ? 44.533  -48.652 87.855  1.00 54.55  ? 14  VAL A HG12   1 
ATOM   238   H HG13   . VAL A 1 14  ? 45.328  -49.804 88.606  1.00 54.55  ? 14  VAL A HG13   1 
ATOM   239   H HG21   . VAL A 1 14  ? 48.042  -48.900 87.886  1.00 54.40  ? 14  VAL A HG21   1 
ATOM   240   H HG22   . VAL A 1 14  ? 47.619  -50.429 87.804  1.00 54.40  ? 14  VAL A HG22   1 
ATOM   241   H HG23   . VAL A 1 14  ? 48.208  -49.698 86.522  1.00 54.40  ? 14  VAL A HG23   1 
ATOM   242   N N      . ILE A 1 15  ? 47.021  -51.350 84.378  1.00 48.35  ? 15  ILE A N      1 
ATOM   243   C CA     . ILE A 1 15  ? 47.903  -51.360 83.213  1.00 51.07  ? 15  ILE A CA     1 
ATOM   244   C C      . ILE A 1 15  ? 47.278  -52.075 82.033  1.00 57.00  ? 15  ILE A C      1 
ATOM   245   O O      . ILE A 1 15  ? 46.855  -53.225 82.169  1.00 57.71  ? 15  ILE A O      1 
ATOM   246   C CB     . ILE A 1 15  ? 49.257  -52.020 83.525  1.00 52.65  ? 15  ILE A CB     1 
ATOM   247   C CG1    . ILE A 1 15  ? 50.057  -51.136 84.486  1.00 50.87  ? 15  ILE A CG1    1 
ATOM   248   C CG2    . ILE A 1 15  ? 50.070  -52.230 82.242  1.00 52.66  ? 15  ILE A CG2    1 
ATOM   249   C CD1    . ILE A 1 15  ? 51.338  -51.761 84.984  1.00 51.41  ? 15  ILE A CD1    1 
ATOM   250   H H      . ILE A 1 15  ? 47.018  -52.079 84.835  1.00 58.42  ? 15  ILE A H      1 
ATOM   251   H HA     . ILE A 1 15  ? 48.075  -50.444 82.946  1.00 61.68  ? 15  ILE A HA     1 
ATOM   252   H HB     . ILE A 1 15  ? 49.099  -52.880 83.944  1.00 63.57  ? 15  ILE A HB     1 
ATOM   253   H HG12   . ILE A 1 15  ? 50.288  -50.311 84.031  1.00 61.44  ? 15  ILE A HG12   1 
ATOM   254   H HG13   . ILE A 1 15  ? 49.505  -50.938 85.260  1.00 61.44  ? 15  ILE A HG13   1 
ATOM   255   H HG21   . ILE A 1 15  ? 50.916  -52.646 82.469  1.00 63.58  ? 15  ILE A HG21   1 
ATOM   256   H HG22   . ILE A 1 15  ? 49.569  -52.804 81.642  1.00 63.58  ? 15  ILE A HG22   1 
ATOM   257   H HG23   . ILE A 1 15  ? 50.226  -51.369 81.823  1.00 63.58  ? 15  ILE A HG23   1 
ATOM   258   H HD11   . ILE A 1 15  ? 51.780  -51.139 85.583  1.00 62.08  ? 15  ILE A HD11   1 
ATOM   259   H HD12   . ILE A 1 15  ? 51.126  -52.582 85.456  1.00 62.08  ? 15  ILE A HD12   1 
ATOM   260   H HD13   . ILE A 1 15  ? 51.910  -51.954 84.225  1.00 62.08  ? 15  ILE A HD13   1 
ATOM   261   N N      . PRO A 1 16  ? 47.239  -51.403 80.866  1.00 63.76  ? 16  PRO A N      1 
ATOM   262   C CA     . PRO A 1 16  ? 46.675  -52.025 79.664  1.00 68.24  ? 16  PRO A CA     1 
ATOM   263   C C      . PRO A 1 16  ? 47.380  -53.323 79.301  1.00 75.64  ? 16  PRO A C      1 
ATOM   264   O O      . PRO A 1 16  ? 48.609  -53.359 79.310  1.00 75.99  ? 16  PRO A O      1 
ATOM   265   C CB     . PRO A 1 16  ? 46.904  -50.969 78.577  1.00 66.06  ? 16  PRO A CB     1 
ATOM   266   C CG     . PRO A 1 16  ? 47.035  -49.700 79.301  1.00 64.32  ? 16  PRO A CG     1 
ATOM   267   C CD     . PRO A 1 16  ? 47.680  -50.021 80.602  1.00 63.40  ? 16  PRO A CD     1 
ATOM   268   H HA     . PRO A 1 16  ? 45.724  -52.185 79.772  1.00 82.28  ? 16  PRO A HA     1 
ATOM   269   H HB2    . PRO A 1 16  ? 47.718  -51.172 78.090  1.00 79.67  ? 16  PRO A HB2    1 
ATOM   270   H HB3    . PRO A 1 16  ? 46.142  -50.946 77.978  1.00 79.67  ? 16  PRO A HB3    1 
ATOM   271   H HG2    . PRO A 1 16  ? 47.590  -49.092 78.788  1.00 77.58  ? 16  PRO A HG2    1 
ATOM   272   H HG3    . PRO A 1 16  ? 46.155  -49.317 79.444  1.00 77.58  ? 16  PRO A HG3    1 
ATOM   273   H HD2    . PRO A 1 16  ? 48.645  -49.984 80.520  1.00 76.47  ? 16  PRO A HD2    1 
ATOM   274   H HD3    . PRO A 1 16  ? 47.358  -49.425 81.296  1.00 76.47  ? 16  PRO A HD3    1 
ATOM   275   N N      . ASP A 1 17  ? 46.622  -54.369 78.992  1.00 82.28  ? 17  ASP A N      1 
ATOM   276   C CA     . ASP A 1 17  ? 47.225  -55.630 78.590  1.00 88.36  ? 17  ASP A CA     1 
ATOM   277   C C      . ASP A 1 17  ? 47.744  -55.464 77.174  1.00 87.74  ? 17  ASP A C      1 
ATOM   278   O O      . ASP A 1 17  ? 47.373  -54.518 76.483  1.00 86.25  ? 17  ASP A O      1 
ATOM   279   C CB     . ASP A 1 17  ? 46.225  -56.782 78.671  1.00 94.85  ? 17  ASP A CB     1 
ATOM   280   C CG     . ASP A 1 17  ? 44.906  -56.461 77.993  1.00 99.21  ? 17  ASP A CG     1 
ATOM   281   O OD1    . ASP A 1 17  ? 44.921  -55.917 76.867  1.00 100.60 ? 17  ASP A OD1    1 
ATOM   282   O OD2    . ASP A 1 17  ? 43.848  -56.747 78.592  1.00 100.58 ? 17  ASP A OD2    1 
ATOM   283   H H      . ASP A 1 17  ? 45.762  -54.374 79.007  1.00 99.13  ? 17  ASP A H      1 
ATOM   284   H HA     . ASP A 1 17  ? 47.975  -55.832 79.172  1.00 106.42 ? 17  ASP A HA     1 
ATOM   285   H HB2    . ASP A 1 17  ? 46.604  -57.561 78.235  1.00 114.22 ? 17  ASP A HB2    1 
ATOM   286   H HB3    . ASP A 1 17  ? 46.044  -56.978 79.603  1.00 114.22 ? 17  ASP A HB3    1 
ATOM   287   N N      . GLU A 1 18  ? 48.576  -56.396 76.734  1.00 88.41  ? 18  GLU A N      1 
ATOM   288   C CA     . GLU A 1 18  ? 49.285  -56.228 75.480  1.00 85.55  ? 18  GLU A CA     1 
ATOM   289   C C      . GLU A 1 18  ? 48.332  -56.073 74.301  1.00 83.92  ? 18  GLU A C      1 
ATOM   290   O O      . GLU A 1 18  ? 48.546  -55.231 73.436  1.00 82.17  ? 18  GLU A O      1 
ATOM   291   C CB     . GLU A 1 18  ? 50.242  -57.395 75.255  1.00 88.04  ? 18  GLU A CB     1 
ATOM   292   C CG     . GLU A 1 18  ? 51.309  -57.501 76.335  1.00 88.84  ? 18  GLU A CG     1 
ATOM   293   C CD     . GLU A 1 18  ? 52.209  -58.710 76.168  1.00 92.34  ? 18  GLU A CD     1 
ATOM   294   O OE1    . GLU A 1 18  ? 51.851  -59.618 75.386  1.00 94.76  ? 18  GLU A OE1    1 
ATOM   295   O OE2    . GLU A 1 18  ? 53.287  -58.743 76.806  1.00 91.43  ? 18  GLU A OE2    1 
ATOM   296   H H      . GLU A 1 18  ? 48.746  -57.133 77.142  1.00 106.48 ? 18  GLU A H      1 
ATOM   297   H HA     . GLU A 1 18  ? 49.818  -55.419 75.533  1.00 103.05 ? 18  GLU A HA     1 
ATOM   298   H HB2    . GLU A 1 18  ? 49.736  -58.223 75.251  1.00 106.03 ? 18  GLU A HB2    1 
ATOM   299   H HB3    . GLU A 1 18  ? 50.690  -57.277 74.402  1.00 106.03 ? 18  GLU A HB3    1 
ATOM   300   H HG2    . GLU A 1 18  ? 51.866  -56.708 76.306  1.00 107.00 ? 18  GLU A HG2    1 
ATOM   301   H HG3    . GLU A 1 18  ? 50.875  -57.569 77.200  1.00 107.00 ? 18  GLU A HG3    1 
ATOM   302   N N      . GLU A 1 19  ? 47.270  -56.860 74.268  1.00 87.87  ? 19  GLU A N      1 
ATOM   303   C CA     . GLU A 1 19  ? 46.357  -56.797 73.138  1.00 95.19  ? 19  GLU A CA     1 
ATOM   304   C C      . GLU A 1 19  ? 45.602  -55.470 73.156  1.00 92.28  ? 19  GLU A C      1 
ATOM   305   O O      . GLU A 1 19  ? 45.147  -54.995 72.118  1.00 95.26  ? 19  GLU A O      1 
ATOM   306   C CB     . GLU A 1 19  ? 45.388  -57.984 73.150  1.00 102.64 ? 19  GLU A CB     1 
ATOM   307   C CG     . GLU A 1 19  ? 44.535  -58.101 74.404  1.00 103.70 ? 19  GLU A CG     1 
ATOM   308   C CD     . GLU A 1 19  ? 45.284  -58.724 75.573  1.00 104.69 ? 19  GLU A CD     1 
ATOM   309   O OE1    . GLU A 1 19  ? 44.640  -59.025 76.597  1.00 105.15 ? 19  GLU A OE1    1 
ATOM   310   O OE2    . GLU A 1 19  ? 46.519  -58.908 75.471  1.00 104.68 ? 19  GLU A OE2    1 
ATOM   311   H H      . GLU A 1 19  ? 47.057  -57.431 74.876  1.00 105.84 ? 19  GLU A H      1 
ATOM   312   H HA     . GLU A 1 19  ? 46.870  -56.838 72.316  1.00 114.62 ? 19  GLU A HA     1 
ATOM   313   H HB2    . GLU A 1 19  ? 44.788  -57.899 72.393  1.00 123.55 ? 19  GLU A HB2    1 
ATOM   314   H HB3    . GLU A 1 19  ? 45.902  -58.802 73.067  1.00 123.55 ? 19  GLU A HB3    1 
ATOM   315   H HG2    . GLU A 1 19  ? 44.244  -57.215 74.672  1.00 124.83 ? 19  GLU A HG2    1 
ATOM   316   H HG3    . GLU A 1 19  ? 43.765  -58.659 74.210  1.00 124.83 ? 19  GLU A HG3    1 
ATOM   317   N N      . GLU A 1 20  ? 45.477  -54.866 74.332  1.00 85.10  ? 20  GLU A N      1 
ATOM   318   C CA     . GLU A 1 20  ? 44.936  -53.515 74.422  1.00 81.36  ? 20  GLU A CA     1 
ATOM   319   C C      . GLU A 1 20  ? 45.996  -52.523 73.945  1.00 76.20  ? 20  GLU A C      1 
ATOM   320   O O      . GLU A 1 20  ? 45.685  -51.560 73.243  1.00 74.94  ? 20  GLU A O      1 
ATOM   321   C CB     . GLU A 1 20  ? 44.470  -53.191 75.838  1.00 81.40  ? 20  GLU A CB     1 
ATOM   322   C CG     . GLU A 1 20  ? 43.969  -51.769 75.993  1.00 81.58  ? 20  GLU A CG     1 
ATOM   323   C CD     . GLU A 1 20  ? 43.118  -51.591 77.226  1.00 82.30  ? 20  GLU A CD     1 
ATOM   324   O OE1    . GLU A 1 20  ? 43.371  -52.292 78.225  1.00 84.56  ? 20  GLU A OE1    1 
ATOM   325   O OE2    . GLU A 1 20  ? 42.204  -50.741 77.199  1.00 80.27  ? 20  GLU A OE2    1 
ATOM   326   H H      . GLU A 1 20  ? 45.696  -55.213 75.087  1.00 102.51 ? 20  GLU A H      1 
ATOM   327   H HA     . GLU A 1 20  ? 44.170  -53.442 73.832  1.00 98.02  ? 20  GLU A HA     1 
ATOM   328   H HB2    . GLU A 1 20  ? 43.746  -53.790 76.076  1.00 98.07  ? 20  GLU A HB2    1 
ATOM   329   H HB3    . GLU A 1 20  ? 45.214  -53.313 76.449  1.00 98.07  ? 20  GLU A HB3    1 
ATOM   330   H HG2    . GLU A 1 20  ? 44.729  -51.171 76.063  1.00 98.29  ? 20  GLU A HG2    1 
ATOM   331   H HG3    . GLU A 1 20  ? 43.432  -51.536 75.220  1.00 98.29  ? 20  GLU A HG3    1 
ATOM   332   N N      . VAL A 1 21  ? 47.243  -52.752 74.351  1.00 70.56  ? 21  VAL A N      1 
ATOM   333   C CA     . VAL A 1 21  ? 48.366  -51.956 73.870  1.00 63.74  ? 21  VAL A CA     1 
ATOM   334   C C      . VAL A 1 21  ? 48.471  -52.098 72.366  1.00 70.41  ? 21  VAL A C      1 
ATOM   335   O O      . VAL A 1 21  ? 48.759  -51.135 71.656  1.00 70.44  ? 21  VAL A O      1 
ATOM   336   C CB     . VAL A 1 21  ? 49.694  -52.405 74.481  1.00 60.93  ? 21  VAL A CB     1 
ATOM   337   C CG1    . VAL A 1 21  ? 50.853  -51.639 73.864  1.00 60.28  ? 21  VAL A CG1    1 
ATOM   338   C CG2    . VAL A 1 21  ? 49.677  -52.221 75.976  1.00 62.37  ? 21  VAL A CG2    1 
ATOM   339   H H      . VAL A 1 21  ? 47.465  -53.368 74.909  1.00 85.06  ? 21  VAL A H      1 
ATOM   340   H HA     . VAL A 1 21  ? 48.223  -51.021 74.086  1.00 76.88  ? 21  VAL A HA     1 
ATOM   341   H HB     . VAL A 1 21  ? 49.825  -53.348 74.296  1.00 73.51  ? 21  VAL A HB     1 
ATOM   342   H HG11   . VAL A 1 21  ? 51.681  -51.941 74.267  1.00 72.73  ? 21  VAL A HG11   1 
ATOM   343   H HG12   . VAL A 1 21  ? 50.869  -51.807 72.909  1.00 72.73  ? 21  VAL A HG12   1 
ATOM   344   H HG13   . VAL A 1 21  ? 50.729  -50.692 74.032  1.00 72.73  ? 21  VAL A HG13   1 
ATOM   345   H HG21   . VAL A 1 21  ? 50.528  -52.512 76.340  1.00 75.24  ? 21  VAL A HG21   1 
ATOM   346   H HG22   . VAL A 1 21  ? 49.535  -51.282 76.177  1.00 75.24  ? 21  VAL A HG22   1 
ATOM   347   H HG23   . VAL A 1 21  ? 48.957  -52.752 76.351  1.00 75.24  ? 21  VAL A HG23   1 
ATOM   348   N N      . ARG A 1 22  ? 48.236  -53.324 71.901  1.00 76.84  ? 22  ARG A N      1 
ATOM   349   C CA     . ARG A 1 22  ? 48.313  -53.674 70.490  1.00 79.16  ? 22  ARG A CA     1 
ATOM   350   C C      . ARG A 1 22  ? 47.229  -52.959 69.695  1.00 79.05  ? 22  ARG A C      1 
ATOM   351   O O      . ARG A 1 22  ? 47.489  -52.436 68.609  1.00 80.99  ? 22  ARG A O      1 
ATOM   352   C CB     . ARG A 1 22  ? 48.190  -55.187 70.315  1.00 81.02  ? 22  ARG A CB     1 
ATOM   353   C CG     . ARG A 1 22  ? 48.279  -55.676 68.877  1.00 84.72  ? 22  ARG A CG     1 
ATOM   354   C CD     . ARG A 1 22  ? 47.923  -57.150 68.808  1.00 90.56  ? 22  ARG A CD     1 
ATOM   355   N NE     . ARG A 1 22  ? 46.523  -57.387 69.170  1.00 93.93  ? 22  ARG A NE     1 
ATOM   356   C CZ     . ARG A 1 22  ? 45.519  -57.533 68.306  1.00 97.27  ? 22  ARG A CZ     1 
ATOM   357   N NH1    . ARG A 1 22  ? 45.732  -57.474 66.996  1.00 99.90  ? 22  ARG A NH1    1 
ATOM   358   N NH2    . ARG A 1 22  ? 44.289  -57.745 68.758  1.00 96.86  ? 22  ARG A NH2    1 
ATOM   359   H H      . ARG A 1 22  ? 48.023  -53.989 72.404  1.00 92.60  ? 22  ARG A H      1 
ATOM   360   H HA     . ARG A 1 22  ? 49.175  -53.399 70.140  1.00 95.39  ? 22  ARG A HA     1 
ATOM   361   H HB2    . ARG A 1 22  ? 48.903  -55.614 70.815  1.00 97.61  ? 22  ARG A HB2    1 
ATOM   362   H HB3    . ARG A 1 22  ? 47.331  -55.469 70.668  1.00 97.61  ? 22  ARG A HB3    1 
ATOM   363   H HG2    . ARG A 1 22  ? 47.654  -55.181 68.325  1.00 102.06 ? 22  ARG A HG2    1 
ATOM   364   H HG3    . ARG A 1 22  ? 49.186  -55.562 68.550  1.00 102.06 ? 22  ARG A HG3    1 
ATOM   365   H HD2    . ARG A 1 22  ? 48.061  -57.470 67.903  1.00 109.06 ? 22  ARG A HD2    1 
ATOM   366   H HD3    . ARG A 1 22  ? 48.484  -57.644 69.427  1.00 109.06 ? 22  ARG A HD3    1 
ATOM   367   H HE     . ARG A 1 22  ? 46.334  -57.435 70.008  1.00 113.10 ? 22  ARG A HE     1 
ATOM   368   H HH11   . ARG A 1 22  ? 46.526  -57.338 66.695  1.00 120.27 ? 22  ARG A HH11   1 
ATOM   369   H HH12   . ARG A 1 22  ? 45.075  -57.571 66.449  1.00 120.27 ? 22  ARG A HH12   1 
ATOM   370   H HH21   . ARG A 1 22  ? 44.143  -57.786 69.605  1.00 116.63 ? 22  ARG A HH21   1 
ATOM   371   H HH22   . ARG A 1 22  ? 43.638  -57.841 68.204  1.00 116.63 ? 22  ARG A HH22   1 
ATOM   372   N N      . LYS A 1 23  ? 46.012  -52.946 70.231  1.00 76.78  ? 23  LYS A N      1 
ATOM   373   C CA     . LYS A 1 23  ? 44.921  -52.238 69.583  1.00 78.08  ? 23  LYS A CA     1 
ATOM   374   C C      . LYS A 1 23  ? 45.314  -50.795 69.316  1.00 78.98  ? 23  LYS A C      1 
ATOM   375   O O      . LYS A 1 23  ? 45.017  -50.259 68.250  1.00 82.93  ? 23  LYS A O      1 
ATOM   376   C CB     . LYS A 1 23  ? 43.661  -52.279 70.449  1.00 78.56  ? 23  LYS A CB     1 
ATOM   377   C CG     . LYS A 1 23  ? 42.660  -53.338 70.055  1.00 84.96  ? 23  LYS A CG     1 
ATOM   378   C CD     . LYS A 1 23  ? 41.981  -52.956 68.746  1.00 88.68  ? 23  LYS A CD     1 
ATOM   379   C CE     . LYS A 1 23  ? 41.006  -54.021 68.285  1.00 91.33  ? 23  LYS A CE     1 
ATOM   380   N NZ     . LYS A 1 23  ? 40.393  -53.685 66.969  1.00 92.94  ? 23  LYS A NZ     1 
ATOM   381   H H      . LYS A 1 23  ? 45.796  -53.338 70.965  1.00 92.53  ? 23  LYS A H      1 
ATOM   382   H HA     . LYS A 1 23  ? 44.722  -52.663 68.734  1.00 94.08  ? 23  LYS A HA     1 
ATOM   383   H HB2    . LYS A 1 23  ? 43.922  -52.449 71.367  1.00 94.66  ? 23  LYS A HB2    1 
ATOM   384   H HB3    . LYS A 1 23  ? 43.217  -51.419 70.390  1.00 94.66  ? 23  LYS A HB3    1 
ATOM   385   H HG2    . LYS A 1 23  ? 43.116  -54.185 69.930  1.00 102.34 ? 23  LYS A HG2    1 
ATOM   386   H HG3    . LYS A 1 23  ? 41.982  -53.415 70.744  1.00 102.34 ? 23  LYS A HG3    1 
ATOM   387   H HD2    . LYS A 1 23  ? 41.489  -52.129 68.870  1.00 106.81 ? 23  LYS A HD2    1 
ATOM   388   H HD3    . LYS A 1 23  ? 42.655  -52.844 68.057  1.00 106.81 ? 23  LYS A HD3    1 
ATOM   389   H HE2    . LYS A 1 23  ? 41.475  -54.865 68.194  1.00 109.98 ? 23  LYS A HE2    1 
ATOM   390   H HE3    . LYS A 1 23  ? 40.293  -54.104 68.938  1.00 109.98 ? 23  LYS A HE3    1 
ATOM   391   H HZ1    . LYS A 1 23  ? 39.827  -54.326 66.724  1.00 111.92 ? 23  LYS A HZ1    1 
ATOM   392   H HZ2    . LYS A 1 23  ? 39.950  -52.915 67.027  1.00 111.92 ? 23  LYS A HZ2    1 
ATOM   393   H HZ3    . LYS A 1 23  ? 41.027  -53.608 66.349  1.00 111.92 ? 23  LYS A HZ3    1 
ATOM   394   N N      . GLY A 1 24  ? 46.027  -50.198 70.272  1.00 71.26  ? 24  GLY A N      1 
ATOM   395   C CA     . GLY A 1 24  ? 46.423  -48.804 70.207  1.00 65.42  ? 24  GLY A CA     1 
ATOM   396   C C      . GLY A 1 24  ? 47.523  -48.487 69.219  1.00 71.09  ? 24  GLY A C      1 
ATOM   397   O O      . GLY A 1 24  ? 47.451  -47.482 68.525  1.00 69.14  ? 24  GLY A O      1 
ATOM   398   H H      . GLY A 1 24  ? 46.297  -50.596 70.985  1.00 85.90  ? 24  GLY A H      1 
ATOM   399   H HA2    . GLY A 1 24  ? 45.649  -48.269 69.971  1.00 78.89  ? 24  GLY A HA2    1 
ATOM   400   H HA3    . GLY A 1 24  ? 46.723  -48.522 71.086  1.00 78.89  ? 24  GLY A HA3    1 
ATOM   401   N N      . ARG A 1 25  ? 48.562  -49.308 69.169  1.00 81.61  ? 25  ARG A N      1 
ATOM   402   C CA     . ARG A 1 25  ? 49.637  -49.068 68.215  1.00 90.26  ? 25  ARG A CA     1 
ATOM   403   C C      . ARG A 1 25  ? 49.174  -49.227 66.758  1.00 92.73  ? 25  ARG A C      1 
ATOM   404   O O      . ARG A 1 25  ? 49.532  -48.399 65.918  1.00 93.27  ? 25  ARG A O      1 
ATOM   405   C CB     . ARG A 1 25  ? 50.848  -49.965 68.489  1.00 95.78  ? 25  ARG A CB     1 
ATOM   406   C CG     . ARG A 1 25  ? 51.865  -49.328 69.444  1.00 97.30  ? 25  ARG A CG     1 
ATOM   407   C CD     . ARG A 1 25  ? 53.263  -49.902 69.243  1.00 100.93 ? 25  ARG A CD     1 
ATOM   408   N NE     . ARG A 1 25  ? 53.354  -51.325 69.560  1.00 103.05 ? 25  ARG A NE     1 
ATOM   409   C CZ     . ARG A 1 25  ? 53.837  -51.822 70.697  1.00 101.83 ? 25  ARG A CZ     1 
ATOM   410   N NH1    . ARG A 1 25  ? 54.295  -51.021 71.656  1.00 99.97  ? 25  ARG A NH1    1 
ATOM   411   N NH2    . ARG A 1 25  ? 53.871  -53.136 70.873  1.00 101.08 ? 25  ARG A NH2    1 
ATOM   412   H H      . ARG A 1 25  ? 48.670  -50.001 69.668  1.00 98.33  ? 25  ARG A H      1 
ATOM   413   H HA     . ARG A 1 25  ? 49.933  -48.150 68.321  1.00 108.71 ? 25  ARG A HA     1 
ATOM   414   H HB2    . ARG A 1 25  ? 50.542  -50.794 68.889  1.00 115.33 ? 25  ARG A HB2    1 
ATOM   415   H HB3    . ARG A 1 25  ? 51.300  -50.149 67.651  1.00 115.33 ? 25  ARG A HB3    1 
ATOM   416   H HG2    . ARG A 1 25  ? 51.903  -48.372 69.279  1.00 117.16 ? 25  ARG A HG2    1 
ATOM   417   H HG3    . ARG A 1 25  ? 51.595  -49.500 70.360  1.00 117.16 ? 25  ARG A HG3    1 
ATOM   418   H HD2    . ARG A 1 25  ? 53.520  -49.787 68.315  1.00 121.51 ? 25  ARG A HD2    1 
ATOM   419   H HD3    . ARG A 1 25  ? 53.883  -49.428 69.819  1.00 121.51 ? 25  ARG A HD3    1 
ATOM   420   H HE     . ARG A 1 25  ? 53.075  -51.884 68.968  1.00 124.05 ? 25  ARG A HE     1 
ATOM   421   H HH11   . ARG A 1 25  ? 54.277  -50.168 71.548  1.00 120.35 ? 25  ARG A HH11   1 
ATOM   422   H HH12   . ARG A 1 25  ? 54.605  -51.356 72.384  1.00 120.35 ? 25  ARG A HH12   1 
ATOM   423   H HH21   . ARG A 1 25  ? 53.578  -53.660 70.257  1.00 121.69 ? 25  ARG A HH21   1 
ATOM   424   H HH22   . ARG A 1 25  ? 54.183  -53.464 71.604  1.00 121.69 ? 25  ARG A HH22   1 
ATOM   425   N N      . GLU A 1 26  ? 48.406  -50.274 66.438  1.00 92.53  ? 26  GLU A N      1 
ATOM   426   C CA     . GLU A 1 26  ? 47.917  -50.424 65.062  1.00 92.96  ? 26  GLU A CA     1 
ATOM   427   C C      . GLU A 1 26  ? 47.152  -49.186 64.644  1.00 87.61  ? 26  GLU A C      1 
ATOM   428   O O      . GLU A 1 26  ? 47.378  -48.621 63.577  1.00 89.57  ? 26  GLU A O      1 
ATOM   429   C CB     . GLU A 1 26  ? 46.989  -51.631 64.874  1.00 95.88  ? 26  GLU A CB     1 
ATOM   430   C CG     . GLU A 1 26  ? 47.637  -52.999 64.825  1.00 99.43  ? 26  GLU A CG     1 
ATOM   431   C CD     . GLU A 1 26  ? 46.606  -54.106 64.603  1.00 104.94 ? 26  GLU A CD     1 
ATOM   432   O OE1    . GLU A 1 26  ? 45.396  -53.853 64.806  1.00 102.66 ? 26  GLU A OE1    1 
ATOM   433   O OE2    . GLU A 1 26  ? 46.999  -55.221 64.191  1.00 110.98 ? 26  GLU A OE2    1 
ATOM   434   H H      . GLU A 1 26  ? 48.159  -50.894 66.981  1.00 111.43 ? 26  GLU A H      1 
ATOM   435   H HA     . GLU A 1 26  ? 48.674  -50.529 64.465  1.00 111.94 ? 26  GLU A HA     1 
ATOM   436   H HB2    . GLU A 1 26  ? 46.356  -51.642 65.609  1.00 115.45 ? 26  GLU A HB2    1 
ATOM   437   H HB3    . GLU A 1 26  ? 46.507  -51.514 64.040  1.00 115.45 ? 26  GLU A HB3    1 
ATOM   438   H HG2    . GLU A 1 26  ? 48.272  -53.025 64.092  1.00 119.71 ? 26  GLU A HG2    1 
ATOM   439   H HG3    . GLU A 1 26  ? 48.089  -53.169 65.666  1.00 119.71 ? 26  GLU A HG3    1 
ATOM   440   N N      . ALA A 1 27  ? 46.238  -48.768 65.501  1.00 82.02  ? 27  ALA A N      1 
ATOM   441   C CA     . ALA A 1 27  ? 45.427  -47.605 65.216  1.00 82.87  ? 27  ALA A CA     1 
ATOM   442   C C      . ALA A 1 27  ? 46.298  -46.349 65.200  1.00 85.13  ? 27  ALA A C      1 
ATOM   443   O O      . ALA A 1 27  ? 45.928  -45.353 64.590  1.00 82.68  ? 27  ALA A O      1 
ATOM   444   C CB     . ALA A 1 27  ? 44.306  -47.477 66.232  1.00 79.38  ? 27  ALA A CB     1 
ATOM   445   H H      . ALA A 1 27  ? 46.069  -49.142 66.256  1.00 98.81  ? 27  ALA A H      1 
ATOM   446   H HA     . ALA A 1 27  ? 45.027  -47.705 64.338  1.00 99.84  ? 27  ALA A HA     1 
ATOM   447   H HB1    . ALA A 1 27  ? 43.778  -46.691 66.020  1.00 95.65  ? 27  ALA A HB1    1 
ATOM   448   H HB2    . ALA A 1 27  ? 43.751  -48.271 66.191  1.00 95.65  ? 27  ALA A HB2    1 
ATOM   449   H HB3    . ALA A 1 27  ? 44.692  -47.387 67.118  1.00 95.65  ? 27  ALA A HB3    1 
ATOM   450   N N      . GLU A 1 28  ? 47.447  -46.387 65.871  1.00 94.80  ? 28  GLU A N      1 
ATOM   451   C CA     . GLU A 1 28  ? 48.361  -45.247 65.836  1.00 101.75 ? 28  GLU A CA     1 
ATOM   452   C C      . GLU A 1 28  ? 49.148  -45.249 64.528  1.00 104.54 ? 28  GLU A C      1 
ATOM   453   O O      . GLU A 1 28  ? 49.344  -44.198 63.917  1.00 106.01 ? 28  GLU A O      1 
ATOM   454   C CB     . GLU A 1 28  ? 49.326  -45.274 67.026  1.00 103.07 ? 28  GLU A CB     1 
ATOM   455   C CG     . GLU A 1 28  ? 50.324  -44.122 67.032  1.00 103.93 ? 28  GLU A CG     1 
ATOM   456   C CD     . GLU A 1 28  ? 51.637  -44.485 67.684  1.00 105.79 ? 28  GLU A CD     1 
ATOM   457   O OE1    . GLU A 1 28  ? 51.633  -45.329 68.604  1.00 103.93 ? 28  GLU A OE1    1 
ATOM   458   O OE2    . GLU A 1 28  ? 52.674  -43.925 67.270  1.00 108.72 ? 28  GLU A OE2    1 
ATOM   459   H H      . GLU A 1 28  ? 47.718  -47.050 66.348  1.00 114.15 ? 28  GLU A H      1 
ATOM   460   H HA     . GLU A 1 28  ? 47.848  -44.425 65.880  1.00 122.49 ? 28  GLU A HA     1 
ATOM   461   H HB2    . GLU A 1 28  ? 48.811  -45.225 67.847  1.00 124.07 ? 28  GLU A HB2    1 
ATOM   462   H HB3    . GLU A 1 28  ? 49.829  -46.103 67.002  1.00 124.07 ? 28  GLU A HB3    1 
ATOM   463   H HG2    . GLU A 1 28  ? 50.508  -43.859 66.116  1.00 125.10 ? 28  GLU A HG2    1 
ATOM   464   H HG3    . GLU A 1 28  ? 49.943  -43.377 67.521  1.00 125.10 ? 28  GLU A HG3    1 
ATOM   465   N N      . GLU A 1 29  ? 49.625  -46.422 64.120  1.00 101.82 ? 29  GLU A N      1 
ATOM   466   C CA     . GLU A 1 29  ? 50.399  -46.536 62.891  1.00 100.07 ? 29  GLU A CA     1 
ATOM   467   C C      . GLU A 1 29  ? 49.558  -46.191 61.667  1.00 94.87  ? 29  GLU A C      1 
ATOM   468   O O      . GLU A 1 29  ? 50.072  -45.629 60.700  1.00 96.14  ? 29  GLU A O      1 
ATOM   469   C CB     . GLU A 1 29  ? 50.978  -47.937 62.725  1.00 107.15 ? 29  GLU A CB     1 
ATOM   470   C CG     . GLU A 1 29  ? 52.108  -47.976 61.710  1.00 114.84 ? 29  GLU A CG     1 
ATOM   471   C CD     . GLU A 1 29  ? 52.739  -49.343 61.574  1.00 119.44 ? 29  GLU A CD     1 
ATOM   472   O OE1    . GLU A 1 29  ? 52.064  -50.259 61.052  1.00 122.80 ? 29  GLU A OE1    1 
ATOM   473   O OE2    . GLU A 1 29  ? 53.916  -49.495 61.963  1.00 118.24 ? 29  GLU A OE2    1 
ATOM   474   H H      . GLU A 1 29  ? 49.515  -47.166 64.538  1.00 122.57 ? 29  GLU A H      1 
ATOM   475   H HA     . GLU A 1 29  ? 51.139  -45.911 62.928  1.00 120.48 ? 29  GLU A HA     1 
ATOM   476   H HB2    . GLU A 1 29  ? 51.328  -48.239 63.578  1.00 128.96 ? 29  GLU A HB2    1 
ATOM   477   H HB3    . GLU A 1 29  ? 50.279  -48.536 62.420  1.00 128.96 ? 29  GLU A HB3    1 
ATOM   478   H HG2    . GLU A 1 29  ? 51.760  -47.719 60.842  1.00 138.20 ? 29  GLU A HG2    1 
ATOM   479   H HG3    . GLU A 1 29  ? 52.800  -47.354 61.986  1.00 138.20 ? 29  GLU A HG3    1 
ATOM   480   N N      . GLU A 1 30  ? 48.268  -46.521 61.720  1.00 87.64  ? 30  GLU A N      1 
ATOM   481   C CA     . GLU A 1 30  ? 47.358  -46.256 60.609  1.00 85.37  ? 30  GLU A CA     1 
ATOM   482   C C      . GLU A 1 30  ? 46.996  -44.790 60.539  1.00 85.99  ? 30  GLU A C      1 
ATOM   483   O O      . GLU A 1 30  ? 46.974  -44.196 59.465  1.00 83.47  ? 30  GLU A O      1 
ATOM   484   C CB     . GLU A 1 30  ? 46.081  -47.087 60.752  1.00 84.18  ? 30  GLU A CB     1 
ATOM   485   C CG     . GLU A 1 30  ? 45.064  -46.885 59.624  1.00 88.50  ? 30  GLU A CG     1 
ATOM   486   C CD     . GLU A 1 30  ? 45.569  -47.347 58.259  1.00 90.80  ? 30  GLU A CD     1 
ATOM   487   O OE1    . GLU A 1 30  ? 45.080  -46.835 57.226  1.00 90.94  ? 30  GLU A OE1    1 
ATOM   488   O OE2    . GLU A 1 30  ? 46.456  -48.224 58.216  1.00 90.80  ? 30  GLU A OE2    1 
ATOM   489   H H      . GLU A 1 30  ? 47.893  -46.903 62.393  1.00 105.56 ? 30  GLU A H      1 
ATOM   490   H HA     . GLU A 1 30  ? 47.790  -46.503 59.776  1.00 102.83 ? 30  GLU A HA     1 
ATOM   491   H HB2    . GLU A 1 30  ? 46.321  -48.027 60.767  1.00 101.41 ? 30  GLU A HB2    1 
ATOM   492   H HB3    . GLU A 1 30  ? 45.647  -46.848 61.586  1.00 101.41 ? 30  GLU A HB3    1 
ATOM   493   H HG2    . GLU A 1 30  ? 44.261  -47.390 59.831  1.00 106.59 ? 30  GLU A HG2    1 
ATOM   494   H HG3    . GLU A 1 30  ? 44.851  -45.941 59.558  1.00 106.59 ? 30  GLU A HG3    1 
ATOM   495   N N      . LEU A 1 31  ? 46.714  -44.210 61.695  1.00 94.58  ? 31  LEU A N      1 
ATOM   496   C CA     . LEU A 1 31  ? 46.407  -42.792 61.785  1.00 98.64  ? 31  LEU A CA     1 
ATOM   497   C C      . LEU A 1 31  ? 47.585  -41.974 61.252  1.00 95.86  ? 31  LEU A C      1 
ATOM   498   O O      . LEU A 1 31  ? 47.444  -41.201 60.303  1.00 99.64  ? 31  LEU A O      1 
ATOM   499   C CB     . LEU A 1 31  ? 46.082  -42.430 63.234  1.00 99.10  ? 31  LEU A CB     1 
ATOM   500   C CG     . LEU A 1 31  ? 45.107  -41.293 63.513  1.00 99.33  ? 31  LEU A CG     1 
ATOM   501   C CD1    . LEU A 1 31  ? 43.740  -41.633 62.982  1.00 102.30 ? 31  LEU A CD1    1 
ATOM   502   C CD2    . LEU A 1 31  ? 45.015  -41.076 65.007  1.00 96.48  ? 31  LEU A CD2    1 
ATOM   503   H H      . LEU A 1 31  ? 46.693  -44.621 62.450  1.00 113.89 ? 31  LEU A H      1 
ATOM   504   H HA     . LEU A 1 31  ? 45.628  -42.597 61.240  1.00 118.75 ? 31  LEU A HA     1 
ATOM   505   H HB2    . LEU A 1 31  ? 45.716  -43.221 63.659  1.00 119.31 ? 31  LEU A HB2    1 
ATOM   506   H HB3    . LEU A 1 31  ? 46.915  -42.196 63.672  1.00 119.31 ? 31  LEU A HB3    1 
ATOM   507   H HG     . LEU A 1 31  ? 45.417  -40.476 63.092  1.00 119.59 ? 31  LEU A HG     1 
ATOM   508   H HD11   . LEU A 1 31  ? 43.136  -40.898 63.170  1.00 123.15 ? 31  LEU A HD11   1 
ATOM   509   H HD12   . LEU A 1 31  ? 43.801  -41.776 62.024  1.00 123.15 ? 31  LEU A HD12   1 
ATOM   510   H HD13   . LEU A 1 31  ? 43.425  -42.440 63.417  1.00 123.15 ? 31  LEU A HD13   1 
ATOM   511   H HD21   . LEU A 1 31  ? 44.394  -40.352 65.182  1.00 116.17 ? 31  LEU A HD21   1 
ATOM   512   H HD22   . LEU A 1 31  ? 44.699  -41.893 65.424  1.00 116.17 ? 31  LEU A HD22   1 
ATOM   513   H HD23   . LEU A 1 31  ? 45.894  -40.849 65.347  1.00 116.17 ? 31  LEU A HD23   1 
ATOM   514   N N      . ARG A 1 32  ? 48.757  -42.201 61.839  1.00 87.19  ? 32  ARG A N      1 
ATOM   515   C CA     . ARG A 1 32  ? 49.987  -41.542 61.419  1.00 83.20  ? 32  ARG A CA     1 
ATOM   516   C C      . ARG A 1 32  ? 50.258  -41.804 59.940  1.00 90.85  ? 32  ARG A C      1 
ATOM   517   O O      . ARG A 1 32  ? 50.930  -41.015 59.280  1.00 89.78  ? 32  ARG A O      1 
ATOM   518   C CB     . ARG A 1 32  ? 51.171  -42.027 62.261  1.00 79.28  ? 32  ARG A CB     1 
ATOM   519   C CG     . ARG A 1 32  ? 52.513  -41.462 61.816  1.00 81.93  ? 32  ARG A CG     1 
ATOM   520   C CD     . ARG A 1 32  ? 53.645  -41.765 62.795  1.00 80.94  ? 32  ARG A CD     1 
ATOM   521   N NE     . ARG A 1 32  ? 53.641  -40.912 63.982  1.00 75.82  ? 32  ARG A NE     1 
ATOM   522   C CZ     . ARG A 1 32  ? 53.088  -41.244 65.147  1.00 72.32  ? 32  ARG A CZ     1 
ATOM   523   N NH1    . ARG A 1 32  ? 52.483  -42.414 65.299  1.00 72.41  ? 32  ARG A NH1    1 
ATOM   524   N NH2    . ARG A 1 32  ? 53.145  -40.404 66.172  1.00 68.12  ? 32  ARG A NH2    1 
ATOM   525   H H      . ARG A 1 32  ? 48.866  -42.744 62.497  1.00 105.02 ? 32  ARG A H      1 
ATOM   526   H HA     . ARG A 1 32  ? 49.896  -40.585 61.546  1.00 100.23 ? 32  ARG A HA     1 
ATOM   527   H HB2    . ARG A 1 32  ? 51.028  -41.761 63.183  1.00 95.52  ? 32  ARG A HB2    1 
ATOM   528   H HB3    . ARG A 1 32  ? 51.222  -42.994 62.202  1.00 95.52  ? 32  ARG A HB3    1 
ATOM   529   H HG2    . ARG A 1 32  ? 52.748  -41.848 60.958  1.00 98.70  ? 32  ARG A HG2    1 
ATOM   530   H HG3    . ARG A 1 32  ? 52.437  -40.498 61.736  1.00 98.70  ? 32  ARG A HG3    1 
ATOM   531   H HD2    . ARG A 1 32  ? 53.564  -42.685 63.091  1.00 97.52  ? 32  ARG A HD2    1 
ATOM   532   H HD3    . ARG A 1 32  ? 54.493  -41.639 62.341  1.00 97.52  ? 32  ARG A HD3    1 
ATOM   533   H HE     . ARG A 1 32  ? 54.022  -40.143 63.924  1.00 91.38  ? 32  ARG A HE     1 
ATOM   534   H HH11   . ARG A 1 32  ? 52.444  -42.966 64.641  1.00 87.28  ? 32  ARG A HH11   1 
ATOM   535   H HH12   . ARG A 1 32  ? 52.128  -42.619 66.055  1.00 87.28  ? 32  ARG A HH12   1 
ATOM   536   H HH21   . ARG A 1 32  ? 53.534  -39.642 66.083  1.00 82.14  ? 32  ARG A HH21   1 
ATOM   537   H HH22   . ARG A 1 32  ? 52.785  -40.617 66.923  1.00 82.14  ? 32  ARG A HH22   1 
ATOM   538   N N      . ARG A 1 33  ? 49.737  -42.917 59.426  1.00 100.63 ? 33  ARG A N      1 
ATOM   539   C CA     . ARG A 1 33  ? 49.895  -43.246 58.014  1.00 106.30 ? 33  ARG A CA     1 
ATOM   540   C C      . ARG A 1 33  ? 48.982  -42.393 57.142  1.00 104.50 ? 33  ARG A C      1 
ATOM   541   O O      . ARG A 1 33  ? 49.370  -41.990 56.051  1.00 109.65 ? 33  ARG A O      1 
ATOM   542   C CB     . ARG A 1 33  ? 49.593  -44.731 57.758  1.00 110.64 ? 33  ARG A CB     1 
ATOM   543   C CG     . ARG A 1 33  ? 49.844  -45.166 56.322  1.00 115.69 ? 33  ARG A CG     1 
ATOM   544   C CD     . ARG A 1 33  ? 49.635  -46.660 56.110  1.00 117.70 ? 33  ARG A CD     1 
ATOM   545   N NE     . ARG A 1 33  ? 50.436  -47.491 57.009  1.00 118.31 ? 33  ARG A NE     1 
ATOM   546   C CZ     . ARG A 1 33  ? 49.960  -48.164 58.057  1.00 117.31 ? 33  ARG A CZ     1 
ATOM   547   N NH1    . ARG A 1 33  ? 48.669  -48.141 58.356  1.00 116.75 ? 33  ARG A NH1    1 
ATOM   548   N NH2    . ARG A 1 33  ? 50.777  -48.893 58.804  1.00 115.51 ? 33  ARG A NH2    1 
ATOM   549   H H      . ARG A 1 33  ? 49.288  -43.497 59.875  1.00 121.15 ? 33  ARG A H      1 
ATOM   550   H HA     . ARG A 1 33  ? 50.813  -43.075 57.749  1.00 127.95 ? 33  ARG A HA     1 
ATOM   551   H HB2    . ARG A 1 33  ? 50.158  -45.269 58.335  1.00 133.16 ? 33  ARG A HB2    1 
ATOM   552   H HB3    . ARG A 1 33  ? 48.660  -44.899 57.961  1.00 133.16 ? 33  ARG A HB3    1 
ATOM   553   H HG2    . ARG A 1 33  ? 49.232  -44.692 55.738  1.00 139.22 ? 33  ARG A HG2    1 
ATOM   554   H HG3    . ARG A 1 33  ? 50.760  -44.955 56.084  1.00 139.22 ? 33  ARG A HG3    1 
ATOM   555   H HD2    . ARG A 1 33  ? 48.700  -46.871 56.263  1.00 141.63 ? 33  ARG A HD2    1 
ATOM   556   H HD3    . ARG A 1 33  ? 49.879  -46.885 55.199  1.00 141.63 ? 33  ARG A HD3    1 
ATOM   557   H HE     . ARG A 1 33  ? 51.279  -47.550 56.850  1.00 142.37 ? 33  ARG A HE     1 
ATOM   558   H HH11   . ARG A 1 33  ? 48.126  -47.675 57.879  1.00 140.49 ? 33  ARG A HH11   1 
ATOM   559   H HH12   . ARG A 1 33  ? 48.377  -48.583 59.033  1.00 140.49 ? 33  ARG A HH12   1 
ATOM   560   H HH21   . ARG A 1 33  ? 51.617  -48.921 58.620  1.00 139.00 ? 33  ARG A HH21   1 
ATOM   561   H HH22   . ARG A 1 33  ? 50.469  -49.330 59.478  1.00 139.00 ? 33  ARG A HH22   1 
ATOM   562   N N      . ARG A 1 34  ? 47.787  -42.088 57.637  1.00 96.12  ? 34  ARG A N      1 
ATOM   563   C CA     . ARG A 1 34  ? 46.814  -41.338 56.850  1.00 95.02  ? 34  ARG A CA     1 
ATOM   564   C C      . ARG A 1 34  ? 47.131  -39.852 56.795  1.00 91.95  ? 34  ARG A C      1 
ATOM   565   O O      . ARG A 1 34  ? 46.816  -39.193 55.814  1.00 96.09  ? 34  ARG A O      1 
ATOM   566   C CB     . ARG A 1 34  ? 45.400  -41.539 57.407  1.00 96.05  ? 34  ARG A CB     1 
ATOM   567   C CG     . ARG A 1 34  ? 44.842  -42.948 57.210  1.00 98.60  ? 34  ARG A CG     1 
ATOM   568   C CD     . ARG A 1 34  ? 43.465  -43.108 57.848  1.00 97.33  ? 34  ARG A CD     1 
ATOM   569   N NE     . ARG A 1 34  ? 43.035  -44.505 57.899  1.00 98.59  ? 34  ARG A NE     1 
ATOM   570   C CZ     . ARG A 1 34  ? 41.825  -44.905 58.284  1.00 96.31  ? 34  ARG A CZ     1 
ATOM   571   N NH1    . ARG A 1 34  ? 40.912  -44.018 58.644  1.00 95.58  ? 34  ARG A NH1    1 
ATOM   572   N NH2    . ARG A 1 34  ? 41.524  -46.195 58.306  1.00 94.85  ? 34  ARG A NH2    1 
ATOM   573   H H      . ARG A 1 34  ? 47.515  -42.303 58.424  1.00 115.73 ? 34  ARG A H      1 
ATOM   574   H HA     . ARG A 1 34  ? 46.824  -41.675 55.941  1.00 114.42 ? 34  ARG A HA     1 
ATOM   575   H HB2    . ARG A 1 34  ? 45.412  -41.357 58.359  1.00 115.65 ? 34  ARG A HB2    1 
ATOM   576   H HB3    . ARG A 1 34  ? 44.800  -40.919 56.963  1.00 115.65 ? 34  ARG A HB3    1 
ATOM   577   H HG2    . ARG A 1 34  ? 44.759  -43.128 56.260  1.00 118.71 ? 34  ARG A HG2    1 
ATOM   578   H HG3    . ARG A 1 34  ? 45.443  -43.589 57.621  1.00 118.71 ? 34  ARG A HG3    1 
ATOM   579   H HD2    . ARG A 1 34  ? 43.495  -42.769 58.756  1.00 117.19 ? 34  ARG A HD2    1 
ATOM   580   H HD3    . ARG A 1 34  ? 42.815  -42.611 57.327  1.00 117.19 ? 34  ARG A HD3    1 
ATOM   581   H HE     . ARG A 1 34  ? 43.601  -45.108 57.664  1.00 118.70 ? 34  ARG A HE     1 
ATOM   582   H HH11   . ARG A 1 34  ? 41.100  -43.179 58.635  1.00 115.09 ? 34  ARG A HH11   1 
ATOM   583   H HH12   . ARG A 1 34  ? 40.131  -44.281 58.891  1.00 115.09 ? 34  ARG A HH12   1 
ATOM   584   H HH21   . ARG A 1 34  ? 42.112  -46.778 58.071  1.00 114.21 ? 34  ARG A HH21   1 
ATOM   585   H HH22   . ARG A 1 34  ? 40.741  -46.450 58.552  1.00 114.21 ? 34  ARG A HH22   1 
ATOM   586   N N      . LEU A 1 35  ? 47.747  -39.318 57.843  1.00 83.15  ? 35  LEU A N      1 
ATOM   587   C CA     . LEU A 1 35  ? 48.078  -37.891 57.871  1.00 81.53  ? 35  LEU A CA     1 
ATOM   588   C C      . LEU A 1 35  ? 49.333  -37.596 57.068  1.00 83.57  ? 35  LEU A C      1 
ATOM   589   O O      . LEU A 1 35  ? 49.468  -36.526 56.476  1.00 81.28  ? 35  LEU A O      1 
ATOM   590   C CB     . LEU A 1 35  ? 48.262  -37.407 59.311  1.00 76.67  ? 35  LEU A CB     1 
ATOM   591   C CG     . LEU A 1 35  ? 46.993  -37.041 60.088  1.00 73.87  ? 35  LEU A CG     1 
ATOM   592   C CD1    . LEU A 1 35  ? 46.117  -38.249 60.332  1.00 71.56  ? 35  LEU A CD1    1 
ATOM   593   C CD2    . LEU A 1 35  ? 47.350  -36.389 61.410  1.00 72.97  ? 35  LEU A CD2    1 
ATOM   594   H H      . LEU A 1 35  ? 47.984  -39.752 58.547  1.00 100.17 ? 35  LEU A H      1 
ATOM   595   H HA     . LEU A 1 35  ? 47.346  -37.390 57.478  1.00 98.22  ? 35  LEU A HA     1 
ATOM   596   H HB2    . LEU A 1 35  ? 48.710  -38.108 59.810  1.00 92.40  ? 35  LEU A HB2    1 
ATOM   597   H HB3    . LEU A 1 35  ? 48.825  -36.617 59.295  1.00 92.40  ? 35  LEU A HB3    1 
ATOM   598   H HG     . LEU A 1 35  ? 46.480  -36.401 59.569  1.00 89.04  ? 35  LEU A HG     1 
ATOM   599   H HD11   . LEU A 1 35  ? 45.328  -37.972 60.824  1.00 86.27  ? 35  LEU A HD11   1 
ATOM   600   H HD12   . LEU A 1 35  ? 45.858  -38.629 59.478  1.00 86.27  ? 35  LEU A HD12   1 
ATOM   601   H HD13   . LEU A 1 35  ? 46.616  -38.902 60.847  1.00 86.27  ? 35  LEU A HD13   1 
ATOM   602   H HD21   . LEU A 1 35  ? 46.533  -36.166 61.883  1.00 87.95  ? 35  LEU A HD21   1 
ATOM   603   H HD22   . LEU A 1 35  ? 47.878  -37.011 61.936  1.00 87.95  ? 35  LEU A HD22   1 
ATOM   604   H HD23   . LEU A 1 35  ? 47.863  -35.584 61.237  1.00 87.95  ? 35  LEU A HD23   1 
ATOM   605   N N      . ASP A 1 36  ? 50.259  -38.546 57.069  1.00 93.18  ? 36  ASP A N      1 
ATOM   606   C CA     . ASP A 1 36  ? 51.448  -38.439 56.247  1.00 100.15 ? 36  ASP A CA     1 
ATOM   607   C C      . ASP A 1 36  ? 51.033  -38.723 54.811  1.00 110.95 ? 36  ASP A C      1 
ATOM   608   O O      . ASP A 1 36  ? 51.774  -38.444 53.871  1.00 110.56 ? 36  ASP A O      1 
ATOM   609   C CB     . ASP A 1 36  ? 52.531  -39.399 56.731  1.00 98.48  ? 36  ASP A CB     1 
ATOM   610   C CG     . ASP A 1 36  ? 53.076  -39.011 58.097  1.00 95.73  ? 36  ASP A CG     1 
ATOM   611   O OD1    . ASP A 1 36  ? 52.527  -38.071 58.717  1.00 94.07  ? 36  ASP A OD1    1 
ATOM   612   O OD2    . ASP A 1 36  ? 54.048  -39.645 58.559  1.00 94.97  ? 36  ASP A OD2    1 
ATOM   613   H H      . ASP A 1 36  ? 50.218  -39.265 57.539  1.00 112.21 ? 36  ASP A H      1 
ATOM   614   H HA     . ASP A 1 36  ? 51.795  -37.534 56.294  1.00 120.57 ? 36  ASP A HA     1 
ATOM   615   H HB2    . ASP A 1 36  ? 52.157  -40.291 56.798  1.00 118.57 ? 36  ASP A HB2    1 
ATOM   616   H HB3    . ASP A 1 36  ? 53.267  -39.392 56.100  1.00 118.57 ? 36  ASP A HB3    1 
ATOM   617   N N      . GLU A 1 37  ? 49.840  -39.293 54.657  1.00 122.96 ? 37  GLU A N      1 
ATOM   618   C CA     . GLU A 1 37  ? 49.251  -39.503 53.347  1.00 130.27 ? 37  GLU A CA     1 
ATOM   619   C C      . GLU A 1 37  ? 48.672  -38.168 52.880  1.00 126.09 ? 37  GLU A C      1 
ATOM   620   O O      . GLU A 1 37  ? 48.761  -37.823 51.704  1.00 135.30 ? 37  GLU A O      1 
ATOM   621   C CB     . GLU A 1 37  ? 48.172  -40.588 53.415  1.00 137.04 ? 37  GLU A CB     1 
ATOM   622   C CG     . GLU A 1 37  ? 47.849  -41.293 52.118  1.00 146.24 ? 37  GLU A CG     1 
ATOM   623   C CD     . GLU A 1 37  ? 46.844  -42.419 52.320  1.00 148.49 ? 37  GLU A CD     1 
ATOM   624   O OE1    . GLU A 1 37  ? 46.590  -43.172 51.360  1.00 149.33 ? 37  GLU A OE1    1 
ATOM   625   O OE2    . GLU A 1 37  ? 46.308  -42.553 53.439  1.00 148.32 ? 37  GLU A OE2    1 
ATOM   626   H H      . GLU A 1 37  ? 49.349  -39.569 55.307  1.00 147.94 ? 37  GLU A H      1 
ATOM   627   H HA     . GLU A 1 37  ? 49.936  -39.783 52.720  1.00 156.72 ? 37  GLU A HA     1 
ATOM   628   H HB2    . GLU A 1 37  ? 48.461  -41.265 54.047  1.00 164.84 ? 37  GLU A HB2    1 
ATOM   629   H HB3    . GLU A 1 37  ? 47.351  -40.180 53.734  1.00 164.84 ? 37  GLU A HB3    1 
ATOM   630   H HG2    . GLU A 1 37  ? 47.468  -40.655 51.495  1.00 175.88 ? 37  GLU A HG2    1 
ATOM   631   H HG3    . GLU A 1 37  ? 48.662  -41.674 51.752  1.00 175.88 ? 37  GLU A HG3    1 
ATOM   632   N N      . LEU A 1 38  ? 48.074  -37.426 53.815  1.00 108.57 ? 38  LEU A N      1 
ATOM   633   C CA     . LEU A 1 38  ? 47.480  -36.115 53.524  1.00 100.57 ? 38  LEU A CA     1 
ATOM   634   C C      . LEU A 1 38  ? 48.397  -34.944 53.901  1.00 96.16  ? 38  LEU A C      1 
ATOM   635   O O      . LEU A 1 38  ? 48.018  -33.782 53.762  1.00 96.21  ? 38  LEU A O      1 
ATOM   636   C CB     . LEU A 1 38  ? 46.133  -35.978 54.231  1.00 96.17  ? 38  LEU A CB     1 
ATOM   637   C CG     . LEU A 1 38  ? 45.148  -37.103 53.896  1.00 97.08  ? 38  LEU A CG     1 
ATOM   638   C CD1    . LEU A 1 38  ? 43.858  -36.925 54.674  1.00 95.00  ? 38  LEU A CD1    1 
ATOM   639   C CD2    . LEU A 1 38  ? 44.865  -37.185 52.398  1.00 101.13 ? 38  LEU A CD2    1 
ATOM   640   H H      . LEU A 1 38  ? 47.999  -37.662 54.638  1.00 130.67 ? 38  LEU A H      1 
ATOM   641   H HA     . LEU A 1 38  ? 47.315  -36.059 52.570  1.00 121.08 ? 38  LEU A HA     1 
ATOM   642   H HB2    . LEU A 1 38  ? 46.280  -35.987 55.189  1.00 115.79 ? 38  LEU A HB2    1 
ATOM   643   H HB3    . LEU A 1 38  ? 45.726  -35.138 53.968  1.00 115.79 ? 38  LEU A HB3    1 
ATOM   644   H HG     . LEU A 1 38  ? 45.540  -37.948 54.167  1.00 116.89 ? 38  LEU A HG     1 
ATOM   645   H HD11   . LEU A 1 38  ? 43.251  -37.646 54.447  1.00 114.39 ? 38  LEU A HD11   1 
ATOM   646   H HD12   . LEU A 1 38  ? 44.057  -36.945 55.623  1.00 114.39 ? 38  LEU A HD12   1 
ATOM   647   H HD13   . LEU A 1 38  ? 43.462  -36.072 54.437  1.00 114.39 ? 38  LEU A HD13   1 
ATOM   648   H HD21   . LEU A 1 38  ? 44.239  -37.907 52.234  1.00 121.75 ? 38  LEU A HD21   1 
ATOM   649   H HD22   . LEU A 1 38  ? 44.484  -36.343 52.102  1.00 121.75 ? 38  LEU A HD22   1 
ATOM   650   H HD23   . LEU A 1 38  ? 45.697  -37.354 51.929  1.00 121.75 ? 38  LEU A HD23   1 
ATOM   651   N N      . GLY A 1 39  ? 49.587  -35.265 54.398  1.00 88.92  ? 39  GLY A N      1 
ATOM   652   C CA     . GLY A 1 39  ? 50.629  -34.283 54.664  1.00 87.87  ? 39  GLY A CA     1 
ATOM   653   C C      . GLY A 1 39  ? 50.314  -33.083 55.553  1.00 86.15  ? 39  GLY A C      1 
ATOM   654   O O      . GLY A 1 39  ? 50.671  -31.956 55.205  1.00 85.93  ? 39  GLY A O      1 
ATOM   655   H H      . GLY A 1 39  ? 49.820  -36.070 54.594  1.00 107.10 ? 39  GLY A H      1 
ATOM   656   H HA2    . GLY A 1 39  ? 51.379  -34.745 55.069  1.00 105.83 ? 39  GLY A HA2    1 
ATOM   657   H HA3    . GLY A 1 39  ? 50.933  -33.932 53.812  1.00 105.83 ? 39  GLY A HA3    1 
ATOM   658   N N      . VAL A 1 40  ? 49.691  -33.314 56.708  1.00 80.38  ? 40  VAL A N      1 
ATOM   659   C CA     . VAL A 1 40  ? 49.374  -32.233 57.646  1.00 78.46  ? 40  VAL A CA     1 
ATOM   660   C C      . VAL A 1 40  ? 50.350  -32.274 58.809  1.00 81.14  ? 40  VAL A C      1 
ATOM   661   O O      . VAL A 1 40  ? 50.825  -33.341 59.175  1.00 74.83  ? 40  VAL A O      1 
ATOM   662   C CB     . VAL A 1 40  ? 47.940  -32.322 58.199  1.00 75.65  ? 40  VAL A CB     1 
ATOM   663   C CG1    . VAL A 1 40  ? 47.575  -31.028 58.921  1.00 73.44  ? 40  VAL A CG1    1 
ATOM   664   C CG2    . VAL A 1 40  ? 46.952  -32.582 57.085  1.00 77.60  ? 40  VAL A CG2    1 
ATOM   665   H H      . VAL A 1 40  ? 49.438  -34.092 56.974  1.00 96.85  ? 40  VAL A H      1 
ATOM   666   H HA     . VAL A 1 40  ? 49.474  -31.379 57.195  1.00 94.54  ? 40  VAL A HA     1 
ATOM   667   H HB     . VAL A 1 40  ? 47.885  -33.053 58.834  1.00 91.17  ? 40  VAL A HB     1 
ATOM   668   H HG11   . VAL A 1 40  ? 46.670  -31.102 59.262  1.00 88.52  ? 40  VAL A HG11   1 
ATOM   669   H HG12   . VAL A 1 40  ? 48.195  -30.889 59.654  1.00 88.52  ? 40  VAL A HG12   1 
ATOM   670   H HG13   . VAL A 1 40  ? 47.633  -30.290 58.294  1.00 88.52  ? 40  VAL A HG13   1 
ATOM   671   H HG21   . VAL A 1 40  ? 46.059  -32.633 57.462  1.00 93.51  ? 40  VAL A HG21   1 
ATOM   672   H HG22   . VAL A 1 40  ? 47.000  -31.855 56.445  1.00 93.51  ? 40  VAL A HG22   1 
ATOM   673   H HG23   . VAL A 1 40  ? 47.178  -33.420 56.653  1.00 93.51  ? 40  VAL A HG23   1 
ATOM   674   N N      . GLU A 1 41  ? 50.674  -31.110 59.365  1.00 94.43  ? 41  GLU A N      1 
ATOM   675   C CA     . GLU A 1 41  ? 51.538  -31.037 60.539  1.00 98.81  ? 41  GLU A CA     1 
ATOM   676   C C      . GLU A 1 41  ? 50.687  -31.337 61.760  1.00 94.73  ? 41  GLU A C      1 
ATOM   677   O O      . GLU A 1 41  ? 49.580  -30.817 61.896  1.00 93.66  ? 41  GLU A O      1 
ATOM   678   C CB     . GLU A 1 41  ? 52.198  -29.661 60.655  1.00 105.36 ? 41  GLU A CB     1 
ATOM   679   C CG     . GLU A 1 41  ? 53.266  -29.566 61.728  1.00 106.64 ? 41  GLU A CG     1 
ATOM   680   C CD     . GLU A 1 41  ? 53.967  -28.223 61.722  1.00 111.05 ? 41  GLU A CD     1 
ATOM   681   O OE1    . GLU A 1 41  ? 53.499  -27.316 61.006  1.00 114.31 ? 41  GLU A OE1    1 
ATOM   682   O OE2    . GLU A 1 41  ? 54.997  -28.078 62.413  1.00 111.00 ? 41  GLU A OE2    1 
ATOM   683   H H      . GLU A 1 41  ? 50.406  -30.345 59.079  1.00 113.71 ? 41  GLU A H      1 
ATOM   684   H HA     . GLU A 1 41  ? 52.234  -31.710 60.473  1.00 118.96 ? 41  GLU A HA     1 
ATOM   685   H HB2    . GLU A 1 41  ? 52.614  -29.444 59.806  1.00 126.83 ? 41  GLU A HB2    1 
ATOM   686   H HB3    . GLU A 1 41  ? 51.514  -29.005 60.861  1.00 126.83 ? 41  GLU A HB3    1 
ATOM   687   H HG2    . GLU A 1 41  ? 52.854  -29.687 62.597  1.00 128.36 ? 41  GLU A HG2    1 
ATOM   688   H HG3    . GLU A 1 41  ? 53.932  -30.254 61.575  1.00 128.36 ? 41  GLU A HG3    1 
ATOM   689   N N      . TYR A 1 42  ? 51.203  -32.184 62.641  1.00 90.53  ? 42  TYR A N      1 
ATOM   690   C CA     . TYR A 1 42  ? 50.444  -32.627 63.802  1.00 86.57  ? 42  TYR A CA     1 
ATOM   691   C C      . TYR A 1 42  ? 51.323  -33.046 64.973  1.00 82.82  ? 42  TYR A C      1 
ATOM   692   O O      . TYR A 1 42  ? 52.549  -33.055 64.881  1.00 85.35  ? 42  TYR A O      1 
ATOM   693   C CB     . TYR A 1 42  ? 49.552  -33.807 63.399  1.00 86.62  ? 42  TYR A CB     1 
ATOM   694   C CG     . TYR A 1 42  ? 50.335  -35.003 62.869  1.00 88.55  ? 42  TYR A CG     1 
ATOM   695   C CD1    . TYR A 1 42  ? 50.893  -35.947 63.722  1.00 85.57  ? 42  TYR A CD1    1 
ATOM   696   C CD2    . TYR A 1 42  ? 50.524  -35.173 61.507  1.00 95.00  ? 42  TYR A CD2    1 
ATOM   697   C CE1    . TYR A 1 42  ? 51.613  -37.032 63.223  1.00 87.83  ? 42  TYR A CE1    1 
ATOM   698   C CE2    . TYR A 1 42  ? 51.239  -36.251 60.999  1.00 96.80  ? 42  TYR A CE2    1 
ATOM   699   C CZ     . TYR A 1 42  ? 51.779  -37.176 61.858  1.00 92.67  ? 42  TYR A CZ     1 
ATOM   700   O OH     . TYR A 1 42  ? 52.485  -38.236 61.338  1.00 91.80  ? 42  TYR A OH     1 
ATOM   701   H H      . TYR A 1 42  ? 51.994  -32.518 62.590  1.00 109.02 ? 42  TYR A H      1 
ATOM   702   H HA     . TYR A 1 42  ? 49.870  -31.904 64.100  1.00 104.28 ? 42  TYR A HA     1 
ATOM   703   H HB2    . TYR A 1 42  ? 49.050  -34.101 64.176  1.00 104.33 ? 42  TYR A HB2    1 
ATOM   704   H HB3    . TYR A 1 42  ? 48.943  -33.517 62.703  1.00 104.33 ? 42  TYR A HB3    1 
ATOM   705   H HD1    . TYR A 1 42  ? 50.783  -35.855 64.641  1.00 103.07 ? 42  TYR A HD1    1 
ATOM   706   H HD2    . TYR A 1 42  ? 50.161  -34.552 60.918  1.00 114.39 ? 42  TYR A HD2    1 
ATOM   707   H HE1    . TYR A 1 42  ? 51.979  -37.657 63.806  1.00 105.79 ? 42  TYR A HE1    1 
ATOM   708   H HE2    . TYR A 1 42  ? 51.350  -36.346 60.081  1.00 116.55 ? 42  TYR A HE2    1 
ATOM   709   H HH     . TYR A 1 42  ? 52.500  -38.188 60.499  1.00 110.56 ? 42  TYR A HH     1 
ATOM   710   N N      . VAL A 1 43  ? 50.673  -33.378 66.081  1.00 73.51  ? 43  VAL A N      1 
ATOM   711   C CA     . VAL A 1 43  ? 51.338  -33.978 67.226  1.00 66.75  ? 43  VAL A CA     1 
ATOM   712   C C      . VAL A 1 43  ? 50.340  -34.828 67.998  1.00 65.66  ? 43  VAL A C      1 
ATOM   713   O O      . VAL A 1 43  ? 49.176  -34.453 68.134  1.00 61.75  ? 43  VAL A O      1 
ATOM   714   C CB     . VAL A 1 43  ? 51.937  -32.911 68.157  1.00 62.85  ? 43  VAL A CB     1 
ATOM   715   C CG1    . VAL A 1 43  ? 50.863  -31.923 68.600  1.00 60.54  ? 43  VAL A CG1    1 
ATOM   716   C CG2    . VAL A 1 43  ? 52.609  -33.560 69.364  1.00 61.95  ? 43  VAL A CG2    1 
ATOM   717   H H      . VAL A 1 43  ? 49.828  -33.263 66.195  1.00 88.61  ? 43  VAL A H      1 
ATOM   718   H HA     . VAL A 1 43  ? 52.055  -34.552 66.917  1.00 80.50  ? 43  VAL A HA     1 
ATOM   719   H HB     . VAL A 1 43  ? 52.614  -32.416 67.671  1.00 75.82  ? 43  VAL A HB     1 
ATOM   720   H HG11   . VAL A 1 43  ? 51.265  -31.262 69.185  1.00 73.04  ? 43  VAL A HG11   1 
ATOM   721   H HG12   . VAL A 1 43  ? 50.491  -31.489 67.816  1.00 73.04  ? 43  VAL A HG12   1 
ATOM   722   H HG13   . VAL A 1 43  ? 50.167  -32.405 69.073  1.00 73.04  ? 43  VAL A HG13   1 
ATOM   723   H HG21   . VAL A 1 43  ? 52.977  -32.865 69.932  1.00 74.73  ? 43  VAL A HG21   1 
ATOM   724   H HG22   . VAL A 1 43  ? 51.949  -34.074 69.855  1.00 74.73  ? 43  VAL A HG22   1 
ATOM   725   H HG23   . VAL A 1 43  ? 53.319  -34.144 69.054  1.00 74.73  ? 43  VAL A HG23   1 
ATOM   726   N N      . PHE A 1 44  ? 50.802  -35.968 68.499  1.00 71.43  ? 44  PHE A N      1 
ATOM   727   C CA     . PHE A 1 44  ? 49.999  -36.828 69.366  1.00 71.06  ? 44  PHE A CA     1 
ATOM   728   C C      . PHE A 1 44  ? 50.185  -36.407 70.820  1.00 67.28  ? 44  PHE A C      1 
ATOM   729   O O      . PHE A 1 44  ? 51.304  -36.123 71.241  1.00 70.84  ? 44  PHE A O      1 
ATOM   730   C CB     . PHE A 1 44  ? 50.389  -38.295 69.176  1.00 72.97  ? 44  PHE A CB     1 
ATOM   731   C CG     . PHE A 1 44  ? 49.905  -38.884 67.885  1.00 76.40  ? 44  PHE A CG     1 
ATOM   732   C CD1    . PHE A 1 44  ? 50.396  -38.430 66.676  1.00 80.32  ? 44  PHE A CD1    1 
ATOM   733   C CD2    . PHE A 1 44  ? 48.959  -39.886 67.879  1.00 76.31  ? 44  PHE A CD2    1 
ATOM   734   C CE1    . PHE A 1 44  ? 49.951  -38.963 65.488  1.00 81.73  ? 44  PHE A CE1    1 
ATOM   735   C CE2    . PHE A 1 44  ? 48.513  -40.421 66.693  1.00 77.89  ? 44  PHE A CE2    1 
ATOM   736   C CZ     . PHE A 1 44  ? 49.011  -39.959 65.496  1.00 80.02  ? 44  PHE A CZ     1 
ATOM   737   H H      . PHE A 1 44  ? 51.593  -36.273 68.349  1.00 86.11  ? 44  PHE A H      1 
ATOM   738   H HA     . PHE A 1 44  ? 49.061  -36.729 69.136  1.00 85.66  ? 44  PHE A HA     1 
ATOM   739   H HB2    . PHE A 1 44  ? 51.357  -38.365 69.190  1.00 87.96  ? 44  PHE A HB2    1 
ATOM   740   H HB3    . PHE A 1 44  ? 50.011  -38.816 69.901  1.00 87.96  ? 44  PHE A HB3    1 
ATOM   741   H HD1    . PHE A 1 44  ? 51.034  -37.753 66.665  1.00 96.78  ? 44  PHE A HD1    1 
ATOM   742   H HD2    . PHE A 1 44  ? 48.617  -40.202 68.684  1.00 91.96  ? 44  PHE A HD2    1 
ATOM   743   H HE1    . PHE A 1 44  ? 50.289  -38.650 64.681  1.00 98.46  ? 44  PHE A HE1    1 
ATOM   744   H HE2    . PHE A 1 44  ? 47.875  -41.098 66.699  1.00 93.86  ? 44  PHE A HE2    1 
ATOM   745   H HZ     . PHE A 1 44  ? 48.710  -40.322 64.695  1.00 96.41  ? 44  PHE A HZ     1 
ATOM   746   N N      . VAL A 1 45  ? 49.102  -36.355 71.586  1.00 62.66  ? 45  VAL A N      1 
ATOM   747   C CA     . VAL A 1 45  ? 49.177  -35.863 72.953  1.00 58.52  ? 45  VAL A CA     1 
ATOM   748   C C      . VAL A 1 45  ? 48.347  -36.735 73.884  1.00 57.69  ? 45  VAL A C      1 
ATOM   749   O O      . VAL A 1 45  ? 47.823  -37.778 73.480  1.00 59.77  ? 45  VAL A O      1 
ATOM   750   C CB     . VAL A 1 45  ? 48.707  -34.407 73.049  1.00 57.40  ? 45  VAL A CB     1 
ATOM   751   C CG1    . VAL A 1 45  ? 49.516  -33.522 72.104  1.00 59.38  ? 45  VAL A CG1    1 
ATOM   752   C CG2    . VAL A 1 45  ? 47.233  -34.301 72.737  1.00 58.11  ? 45  VAL A CG2    1 
ATOM   753   H H      . VAL A 1 45  ? 48.315  -36.597 71.338  1.00 75.59  ? 45  VAL A H      1 
ATOM   754   H HA     . VAL A 1 45  ? 50.100  -35.900 73.251  1.00 70.62  ? 45  VAL A HA     1 
ATOM   755   H HB     . VAL A 1 45  ? 48.847  -34.088 73.954  1.00 69.27  ? 45  VAL A HB     1 
ATOM   756   H HG11   . VAL A 1 45  ? 49.202  -32.608 72.182  1.00 71.65  ? 45  VAL A HG11   1 
ATOM   757   H HG12   . VAL A 1 45  ? 50.453  -33.572 72.350  1.00 71.65  ? 45  VAL A HG12   1 
ATOM   758   H HG13   . VAL A 1 45  ? 49.395  -33.838 71.195  1.00 71.65  ? 45  VAL A HG13   1 
ATOM   759   H HG21   . VAL A 1 45  ? 46.962  -33.372 72.804  1.00 70.13  ? 45  VAL A HG21   1 
ATOM   760   H HG22   . VAL A 1 45  ? 47.077  -34.627 71.836  1.00 70.13  ? 45  VAL A HG22   1 
ATOM   761   H HG23   . VAL A 1 45  ? 46.736  -34.838 73.374  1.00 70.13  ? 45  VAL A HG23   1 
ATOM   762   N N      . GLY A 1 46  ? 48.256  -36.312 75.141  1.00 50.03  ? 46  GLY A N      1 
ATOM   763   C CA     . GLY A 1 46  ? 47.387  -36.960 76.106  1.00 48.75  ? 46  GLY A CA     1 
ATOM   764   C C      . GLY A 1 46  ? 47.970  -38.184 76.782  1.00 44.86  ? 46  GLY A C      1 
ATOM   765   O O      . GLY A 1 46  ? 49.175  -38.429 76.754  1.00 41.17  ? 46  GLY A O      1 
ATOM   766   H H      . GLY A 1 46  ? 48.694  -35.643 75.459  1.00 60.43  ? 46  GLY A H      1 
ATOM   767   H HA2    . GLY A 1 46  ? 47.155  -36.320 76.798  1.00 58.89  ? 46  GLY A HA2    1 
ATOM   768   H HA3    . GLY A 1 46  ? 46.569  -37.228 75.660  1.00 58.89  ? 46  GLY A HA3    1 
ATOM   769   N N      . SER A 1 47  ? 47.095  -38.935 77.435  1.00 50.29  ? 47  SER A N      1 
ATOM   770   C CA     . SER A 1 47  ? 47.509  -40.100 78.187  1.00 49.76  ? 47  SER A CA     1 
ATOM   771   C C      . SER A 1 47  ? 48.171  -41.157 77.292  1.00 51.99  ? 47  SER A C      1 
ATOM   772   O O      . SER A 1 47  ? 49.125  -41.814 77.710  1.00 52.71  ? 47  SER A O      1 
ATOM   773   C CB     . SER A 1 47  ? 46.302  -40.694 78.919  1.00 48.60  ? 47  SER A CB     1 
ATOM   774   O OG     . SER A 1 47  ? 45.194  -40.880 78.045  1.00 51.28  ? 47  SER A OG     1 
ATOM   775   H H      . SER A 1 47  ? 46.248  -38.787 77.456  1.00 60.74  ? 47  SER A H      1 
ATOM   776   H HA     . SER A 1 47  ? 48.158  -39.828 78.854  1.00 60.10  ? 47  SER A HA     1 
ATOM   777   H HB2    . SER A 1 47  ? 46.553  -41.553 79.292  1.00 58.71  ? 47  SER A HB2    1 
ATOM   778   H HB3    . SER A 1 47  ? 46.040  -40.090 79.631  1.00 58.71  ? 47  SER A HB3    1 
ATOM   779   H HG     . SER A 1 47  ? 44.545  -41.205 78.468  1.00 61.93  ? 47  SER A HG     1 
ATOM   780   N N      . TYR A 1 48  ? 47.711  -41.289 76.050  1.00 51.69  ? 48  TYR A N      1 
ATOM   781   C CA     . TYR A 1 48  ? 48.254  -42.317 75.162  1.00 51.18  ? 48  TYR A CA     1 
ATOM   782   C C      . TYR A 1 48  ? 49.695  -42.003 74.758  1.00 52.94  ? 48  TYR A C      1 
ATOM   783   O O      . TYR A 1 48  ? 50.572  -42.867 74.822  1.00 53.91  ? 48  TYR A O      1 
ATOM   784   C CB     . TYR A 1 48  ? 47.392  -42.468 73.907  1.00 53.52  ? 48  TYR A CB     1 
ATOM   785   C CG     . TYR A 1 48  ? 47.912  -43.518 72.939  1.00 58.49  ? 48  TYR A CG     1 
ATOM   786   C CD1    . TYR A 1 48  ? 47.593  -44.863 73.108  1.00 59.57  ? 48  TYR A CD1    1 
ATOM   787   C CD2    . TYR A 1 48  ? 48.728  -43.174 71.861  1.00 58.77  ? 48  TYR A CD2    1 
ATOM   788   C CE1    . TYR A 1 48  ? 48.066  -45.835 72.231  1.00 59.06  ? 48  TYR A CE1    1 
ATOM   789   C CE2    . TYR A 1 48  ? 49.203  -44.143 70.977  1.00 57.78  ? 48  TYR A CE2    1 
ATOM   790   C CZ     . TYR A 1 48  ? 48.870  -45.471 71.171  1.00 59.03  ? 48  TYR A CZ     1 
ATOM   791   O OH     . TYR A 1 48  ? 49.338  -46.442 70.308  1.00 62.57  ? 48  TYR A OH     1 
ATOM   792   H H      . TYR A 1 48  ? 47.094  -40.804 75.700  1.00 62.42  ? 48  TYR A H      1 
ATOM   793   H HA     . TYR A 1 48  ? 48.253  -43.168 75.629  1.00 61.81  ? 48  TYR A HA     1 
ATOM   794   H HB2    . TYR A 1 48  ? 46.495  -42.724 74.172  1.00 64.62  ? 48  TYR A HB2    1 
ATOM   795   H HB3    . TYR A 1 48  ? 47.367  -41.618 73.440  1.00 64.62  ? 48  TYR A HB3    1 
ATOM   796   H HD1    . TYR A 1 48  ? 47.052  -45.117 73.821  1.00 71.87  ? 48  TYR A HD1    1 
ATOM   797   H HD2    . TYR A 1 48  ? 48.955  -42.283 71.727  1.00 70.92  ? 48  TYR A HD2    1 
ATOM   798   H HE1    . TYR A 1 48  ? 47.842  -46.728 72.360  1.00 71.26  ? 48  TYR A HE1    1 
ATOM   799   H HE2    . TYR A 1 48  ? 49.746  -43.898 70.264  1.00 69.72  ? 48  TYR A HE2    1 
ATOM   800   H HH     . TYR A 1 48  ? 49.813  -46.091 69.710  1.00 75.48  ? 48  TYR A HH     1 
ATOM   801   N N      . ALA A 1 49  ? 49.928  -40.761 74.339  1.00 50.94  ? 49  ALA A N      1 
ATOM   802   C CA     . ALA A 1 49  ? 51.246  -40.313 73.880  1.00 51.24  ? 49  ALA A CA     1 
ATOM   803   C C      . ALA A 1 49  ? 52.330  -40.450 74.946  1.00 50.75  ? 49  ALA A C      1 
ATOM   804   O O      . ALA A 1 49  ? 53.489  -40.711 74.625  1.00 51.24  ? 49  ALA A O      1 
ATOM   805   C CB     . ALA A 1 49  ? 51.170  -38.869 73.410  1.00 53.99  ? 49  ALA A CB     1 
ATOM   806   H H      . ALA A 1 49  ? 49.327  -40.146 74.310  1.00 61.52  ? 49  ALA A H      1 
ATOM   807   H HA     . ALA A 1 49  ? 51.511  -40.856 73.122  1.00 61.88  ? 49  ALA A HA     1 
ATOM   808   H HB1    . ALA A 1 49  ? 52.049  -38.588 73.111  1.00 65.18  ? 49  ALA A HB1    1 
ATOM   809   H HB2    . ALA A 1 49  ? 50.536  -38.808 72.679  1.00 65.18  ? 49  ALA A HB2    1 
ATOM   810   H HB3    . ALA A 1 49  ? 50.878  -38.312 74.149  1.00 65.18  ? 49  ALA A HB3    1 
ATOM   811   N N      . ARG A 1 50  ? 51.951  -40.228 76.203  1.00 54.09  ? 50  ARG A N      1 
ATOM   812   C CA     . ARG A 1 50  ? 52.873  -40.339 77.335  1.00 55.75  ? 50  ARG A CA     1 
ATOM   813   C C      . ARG A 1 50  ? 52.919  -41.755 77.894  1.00 58.24  ? 50  ARG A C      1 
ATOM   814   O O      . ARG A 1 50  ? 53.681  -42.045 78.821  1.00 57.46  ? 50  ARG A O      1 
ATOM   815   C CB     . ARG A 1 50  ? 52.474  -39.345 78.433  1.00 53.93  ? 50  ARG A CB     1 
ATOM   816   C CG     . ARG A 1 50  ? 52.538  -37.896 77.978  1.00 51.89  ? 50  ARG A CG     1 
ATOM   817   C CD     . ARG A 1 50  ? 52.065  -36.892 79.020  1.00 48.16  ? 50  ARG A CD     1 
ATOM   818   N NE     . ARG A 1 50  ? 51.297  -35.850 78.347  1.00 49.12  ? 50  ARG A NE     1 
ATOM   819   C CZ     . ARG A 1 50  ? 50.045  -35.506 78.620  1.00 53.33  ? 50  ARG A CZ     1 
ATOM   820   N NH1    . ARG A 1 50  ? 49.371  -36.088 79.604  1.00 51.61  ? 50  ARG A NH1    1 
ATOM   821   N NH2    . ARG A 1 50  ? 49.472  -34.546 77.902  1.00 57.50  ? 50  ARG A NH2    1 
ATOM   822   H H      . ARG A 1 50  ? 51.151  -40.009 76.432  1.00 65.30  ? 50  ARG A H      1 
ATOM   823   H HA     . ARG A 1 50  ? 53.766  -40.109 77.034  1.00 67.29  ? 50  ARG A HA     1 
ATOM   824   H HB2    . ARG A 1 50  ? 51.564  -39.531 78.710  1.00 65.11  ? 50  ARG A HB2    1 
ATOM   825   H HB3    . ARG A 1 50  ? 53.077  -39.449 79.185  1.00 65.11  ? 50  ARG A HB3    1 
ATOM   826   H HG2    . ARG A 1 50  ? 53.458  -37.680 77.756  1.00 62.65  ? 50  ARG A HG2    1 
ATOM   827   H HG3    . ARG A 1 50  ? 51.979  -37.791 77.192  1.00 62.65  ? 50  ARG A HG3    1 
ATOM   828   H HD2    . ARG A 1 50  ? 51.493  -37.334 79.667  1.00 58.18  ? 50  ARG A HD2    1 
ATOM   829   H HD3    . ARG A 1 50  ? 52.830  -36.485 79.456  1.00 58.18  ? 50  ARG A HD3    1 
ATOM   830   H HE     . ARG A 1 50  ? 51.692  -35.419 77.716  1.00 59.34  ? 50  ARG A HE     1 
ATOM   831   H HH11   . ARG A 1 50  ? 49.740  -36.712 80.067  1.00 62.32  ? 50  ARG A HH11   1 
ATOM   832   H HH12   . ARG A 1 50  ? 48.563  -35.848 79.772  1.00 62.32  ? 50  ARG A HH12   1 
ATOM   833   H HH21   . ARG A 1 50  ? 49.911  -34.162 77.270  1.00 69.39  ? 50  ARG A HH21   1 
ATOM   834   H HH22   . ARG A 1 50  ? 48.666  -34.302 78.076  1.00 69.39  ? 50  ARG A HH22   1 
ATOM   835   N N      . ASN A 1 51  ? 52.118  -42.633 77.302  1.00 64.35  ? 51  ASN A N      1 
ATOM   836   C CA     . ASN A 1 51  ? 52.070  -44.025 77.709  1.00 70.71  ? 51  ASN A CA     1 
ATOM   837   C C      . ASN A 1 51  ? 51.624  -44.130 79.164  1.00 67.53  ? 51  ASN A C      1 
ATOM   838   O O      . ASN A 1 51  ? 51.957  -45.088 79.854  1.00 69.74  ? 51  ASN A O      1 
ATOM   839   C CB     . ASN A 1 51  ? 53.446  -44.673 77.491  1.00 78.13  ? 51  ASN A CB     1 
ATOM   840   C CG     . ASN A 1 51  ? 53.409  -46.191 77.549  1.00 84.08  ? 51  ASN A CG     1 
ATOM   841   O OD1    . ASN A 1 51  ? 52.526  -46.827 76.969  1.00 87.24  ? 51  ASN A OD1    1 
ATOM   842   N ND2    . ASN A 1 51  ? 54.406  -46.781 78.206  1.00 84.22  ? 51  ASN A ND2    1 
ATOM   843   H H      . ASN A 1 51  ? 51.587  -42.441 76.654  1.00 77.61  ? 51  ASN A H      1 
ATOM   844   H HA     . ASN A 1 51  ? 51.424  -44.495 77.159  1.00 85.25  ? 51  ASN A HA     1 
ATOM   845   H HB2    . ASN A 1 51  ? 53.780  -44.415 76.618  1.00 94.15  ? 51  ASN A HB2    1 
ATOM   846   H HB3    . ASN A 1 51  ? 54.052  -44.363 78.182  1.00 94.15  ? 51  ASN A HB3    1 
ATOM   847   H HD21   . ASN A 1 51  ? 54.432  -47.638 78.268  1.00 101.45 ? 51  ASN A HD21   1 
ATOM   848   H HD22   . ASN A 1 51  ? 55.023  -46.304 78.569  1.00 101.45 ? 51  ASN A HD22   1 
ATOM   849   N N      . THR A 1 52  ? 50.874  -43.127 79.624  1.00 60.42  ? 52  THR A N      1 
ATOM   850   C CA     . THR A 1 52  ? 50.311  -43.128 80.974  1.00 57.42  ? 52  THR A CA     1 
ATOM   851   C C      . THR A 1 52  ? 48.854  -43.567 80.999  1.00 58.20  ? 52  THR A C      1 
ATOM   852   O O      . THR A 1 52  ? 48.229  -43.524 82.056  1.00 59.66  ? 52  THR A O      1 
ATOM   853   C CB     . THR A 1 52  ? 50.391  -41.735 81.660  1.00 49.54  ? 52  THR A CB     1 
ATOM   854   O OG1    . THR A 1 52  ? 49.615  -40.775 80.937  1.00 47.56  ? 52  THR A OG1    1 
ATOM   855   C CG2    . THR A 1 52  ? 51.825  -41.267 81.760  1.00 50.33  ? 52  THR A CG2    1 
ATOM   856   H H      . THR A 1 52  ? 50.675  -42.427 79.166  1.00 72.90  ? 52  THR A H      1 
ATOM   857   H HA     . THR A 1 52  ? 50.815  -43.753 81.518  1.00 69.30  ? 52  THR A HA     1 
ATOM   858   H HB     . THR A 1 52  ? 50.039  -41.808 82.561  1.00 59.84  ? 52  THR A HB     1 
ATOM   859   H HG1    . THR A 1 52  ? 49.662  -40.025 81.312  1.00 57.47  ? 52  THR A HG1    1 
ATOM   860   H HG21   . THR A 1 52  ? 51.861  -40.398 82.189  1.00 60.79  ? 52  THR A HG21   1 
ATOM   861   H HG22   . THR A 1 52  ? 52.344  -41.898 82.282  1.00 60.79  ? 52  THR A HG22   1 
ATOM   862   H HG23   . THR A 1 52  ? 52.213  -41.197 80.874  1.00 60.79  ? 52  THR A HG23   1 
ATOM   863   N N      . TRP A 1 53  ? 48.295  -43.964 79.856  1.00 55.31  ? 53  TRP A N      1 
ATOM   864   C CA     . TRP A 1 53  ? 46.846  -44.198 79.791  1.00 57.32  ? 53  TRP A CA     1 
ATOM   865   C C      . TRP A 1 53  ? 46.392  -45.420 80.604  1.00 56.96  ? 53  TRP A C      1 
ATOM   866   O O      . TRP A 1 53  ? 47.056  -46.462 80.642  1.00 61.89  ? 53  TRP A O      1 
ATOM   867   C CB     . TRP A 1 53  ? 46.390  -44.311 78.323  1.00 60.08  ? 53  TRP A CB     1 
ATOM   868   C CG     . TRP A 1 53  ? 46.540  -45.662 77.694  1.00 63.33  ? 53  TRP A CG     1 
ATOM   869   C CD1    . TRP A 1 53  ? 45.637  -46.692 77.719  1.00 63.96  ? 53  TRP A CD1    1 
ATOM   870   C CD2    . TRP A 1 53  ? 47.647  -46.120 76.906  1.00 62.98  ? 53  TRP A CD2    1 
ATOM   871   N NE1    . TRP A 1 53  ? 46.126  -47.772 77.009  1.00 63.26  ? 53  TRP A NE1    1 
ATOM   872   C CE2    . TRP A 1 53  ? 47.356  -47.444 76.500  1.00 62.62  ? 53  TRP A CE2    1 
ATOM   873   C CE3    . TRP A 1 53  ? 48.859  -45.545 76.514  1.00 60.13  ? 53  TRP A CE3    1 
ATOM   874   C CZ2    . TRP A 1 53  ? 48.232  -48.196 75.725  1.00 62.12  ? 53  TRP A CZ2    1 
ATOM   875   C CZ3    . TRP A 1 53  ? 49.727  -46.292 75.743  1.00 63.75  ? 53  TRP A CZ3    1 
ATOM   876   C CH2    . TRP A 1 53  ? 49.411  -47.606 75.357  1.00 65.18  ? 53  TRP A CH2    1 
ATOM   877   H H      . TRP A 1 53  ? 48.717  -44.103 79.120  1.00 66.77  ? 53  TRP A H      1 
ATOM   878   H HA     . TRP A 1 53  ? 46.400  -43.424 80.168  1.00 69.18  ? 53  TRP A HA     1 
ATOM   879   H HB2    . TRP A 1 53  ? 45.451  -44.073 78.276  1.00 72.49  ? 53  TRP A HB2    1 
ATOM   880   H HB3    . TRP A 1 53  ? 46.909  -43.686 77.793  1.00 72.49  ? 53  TRP A HB3    1 
ATOM   881   H HD1    . TRP A 1 53  ? 44.817  -46.671 78.157  1.00 77.14  ? 53  TRP A HD1    1 
ATOM   882   H HE1    . TRP A 1 53  ? 45.723  -48.524 76.901  1.00 76.30  ? 53  TRP A HE1    1 
ATOM   883   H HE3    . TRP A 1 53  ? 49.076  -44.677 76.768  1.00 72.55  ? 53  TRP A HE3    1 
ATOM   884   H HZ2    . TRP A 1 53  ? 48.026  -49.065 75.467  1.00 74.93  ? 53  TRP A HZ2    1 
ATOM   885   H HZ3    . TRP A 1 53  ? 50.537  -45.920 75.477  1.00 76.89  ? 53  TRP A HZ3    1 
ATOM   886   H HH2    . TRP A 1 53  ? 50.016  -48.085 74.837  1.00 78.61  ? 53  TRP A HH2    1 
ATOM   887   N N      . LEU A 1 54  ? 45.239  -45.257 81.249  1.00 51.58  ? 54  LEU A N      1 
ATOM   888   C CA     . LEU A 1 54  ? 44.722  -46.222 82.211  1.00 50.32  ? 54  LEU A CA     1 
ATOM   889   C C      . LEU A 1 54  ? 44.052  -47.402 81.505  1.00 55.78  ? 54  LEU A C      1 
ATOM   890   O O      . LEU A 1 54  ? 43.567  -47.258 80.388  1.00 58.19  ? 54  LEU A O      1 
ATOM   891   C CB     . LEU A 1 54  ? 43.751  -45.505 83.159  1.00 49.11  ? 54  LEU A CB     1 
ATOM   892   C CG     . LEU A 1 54  ? 43.408  -46.108 84.522  1.00 45.83  ? 54  LEU A CG     1 
ATOM   893   C CD1    . LEU A 1 54  ? 44.639  -46.307 85.359  1.00 46.59  ? 54  LEU A CD1    1 
ATOM   894   C CD2    . LEU A 1 54  ? 42.456  -45.190 85.234  1.00 43.81  ? 54  LEU A CD2    1 
ATOM   895   H H      . LEU A 1 54  ? 44.725  -44.575 81.142  1.00 62.28  ? 54  LEU A H      1 
ATOM   896   H HA     . LEU A 1 54  ? 45.458  -46.568 82.740  1.00 60.77  ? 54  LEU A HA     1 
ATOM   897   H HB2    . LEU A 1 54  ? 44.116  -44.624 83.335  1.00 59.32  ? 54  LEU A HB2    1 
ATOM   898   H HB3    . LEU A 1 54  ? 42.909  -45.402 82.687  1.00 59.32  ? 54  LEU A HB3    1 
ATOM   899   H HG     . LEU A 1 54  ? 42.975  -46.967 84.399  1.00 55.39  ? 54  LEU A HG     1 
ATOM   900   H HD11   . LEU A 1 54  ? 44.382  -46.690 86.212  1.00 56.30  ? 54  LEU A HD11   1 
ATOM   901   H HD12   . LEU A 1 54  ? 45.242  -46.909 84.894  1.00 56.30  ? 54  LEU A HD12   1 
ATOM   902   H HD13   . LEU A 1 54  ? 45.069  -45.449 85.496  1.00 56.30  ? 54  LEU A HD13   1 
ATOM   903   H HD21   . LEU A 1 54  ? 42.237  -45.571 86.099  1.00 52.96  ? 54  LEU A HD21   1 
ATOM   904   H HD22   . LEU A 1 54  ? 42.879  -44.325 85.350  1.00 52.96  ? 54  LEU A HD22   1 
ATOM   905   H HD23   . LEU A 1 54  ? 41.651  -45.095 84.700  1.00 52.96  ? 54  LEU A HD23   1 
ATOM   906   N N      . LYS A 1 55  ? 44.018  -48.558 82.169  1.00 60.99  ? 55  LYS A N      1 
ATOM   907   C CA     . LYS A 1 55  ? 43.440  -49.780 81.596  1.00 65.40  ? 55  LYS A CA     1 
ATOM   908   C C      . LYS A 1 55  ? 41.963  -49.614 81.219  1.00 64.32  ? 55  LYS A C      1 
ATOM   909   O O      . LYS A 1 55  ? 41.144  -49.174 82.024  1.00 66.26  ? 55  LYS A O      1 
ATOM   910   C CB     . LYS A 1 55  ? 43.625  -50.949 82.576  1.00 69.37  ? 55  LYS A CB     1 
ATOM   911   C CG     . LYS A 1 55  ? 43.100  -52.296 82.084  1.00 73.38  ? 55  LYS A CG     1 
ATOM   912   C CD     . LYS A 1 55  ? 43.521  -53.430 83.026  1.00 71.96  ? 55  LYS A CD     1 
ATOM   913   C CE     . LYS A 1 55  ? 43.176  -54.794 82.474  1.00 72.65  ? 55  LYS A CE     1 
ATOM   914   N NZ     . LYS A 1 55  ? 43.813  -55.036 81.156  1.00 76.03  ? 55  LYS A NZ     1 
ATOM   915   H H      . LYS A 1 55  ? 44.327  -48.664 82.964  1.00 73.57  ? 55  LYS A H      1 
ATOM   916   H HA     . LYS A 1 55  ? 43.925  -50.000 80.785  1.00 78.87  ? 55  LYS A HA     1 
ATOM   917   H HB2    . LYS A 1 55  ? 44.572  -51.052 82.758  1.00 83.63  ? 55  LYS A HB2    1 
ATOM   918   H HB3    . LYS A 1 55  ? 43.158  -50.737 83.400  1.00 83.63  ? 55  LYS A HB3    1 
ATOM   919   H HG2    . LYS A 1 55  ? 42.131  -52.271 82.051  1.00 88.45  ? 55  LYS A HG2    1 
ATOM   920   H HG3    . LYS A 1 55  ? 43.464  -52.480 81.204  1.00 88.45  ? 55  LYS A HG3    1 
ATOM   921   H HD2    . LYS A 1 55  ? 44.482  -53.393 83.158  1.00 86.74  ? 55  LYS A HD2    1 
ATOM   922   H HD3    . LYS A 1 55  ? 43.064  -53.324 83.875  1.00 86.74  ? 55  LYS A HD3    1 
ATOM   923   H HE2    . LYS A 1 55  ? 43.487  -55.475 83.090  1.00 87.57  ? 55  LYS A HE2    1 
ATOM   924   H HE3    . LYS A 1 55  ? 42.214  -54.858 82.362  1.00 87.57  ? 55  LYS A HE3    1 
ATOM   925   H HZ1    . LYS A 1 55  ? 43.593  -55.844 80.856  1.00 91.63  ? 55  LYS A HZ1    1 
ATOM   926   H HZ2    . LYS A 1 55  ? 43.540  -54.425 80.569  1.00 91.63  ? 55  LYS A HZ2    1 
ATOM   927   H HZ3    . LYS A 1 55  ? 44.699  -54.987 81.233  1.00 91.63  ? 55  LYS A HZ3    1 
ATOM   928   N N      . GLY A 1 56  ? 41.639  -49.952 79.976  1.00 64.24  ? 56  GLY A N      1 
ATOM   929   C CA     . GLY A 1 56  ? 40.278  -49.843 79.480  1.00 67.89  ? 56  GLY A CA     1 
ATOM   930   C C      . GLY A 1 56  ? 39.836  -48.415 79.205  1.00 67.50  ? 56  GLY A C      1 
ATOM   931   O O      . GLY A 1 56  ? 38.699  -48.182 78.791  1.00 69.15  ? 56  GLY A O      1 
ATOM   932   H H      . GLY A 1 56  ? 42.198  -50.250 79.395  1.00 77.48  ? 56  GLY A H      1 
ATOM   933   H HA2    . GLY A 1 56  ? 40.199  -50.348 78.656  1.00 81.86  ? 56  GLY A HA2    1 
ATOM   934   H HA3    . GLY A 1 56  ? 39.670  -50.228 80.131  1.00 81.86  ? 56  GLY A HA3    1 
ATOM   935   N N      . SER A 1 57  ? 40.737  -47.464 79.441  1.00 63.87  ? 57  SER A N      1 
ATOM   936   C CA     . SER A 1 57  ? 40.475  -46.038 79.224  1.00 60.30  ? 57  SER A CA     1 
ATOM   937   C C      . SER A 1 57  ? 41.013  -45.503 77.886  1.00 57.38  ? 57  SER A C      1 
ATOM   938   O O      . SER A 1 57  ? 41.044  -44.288 77.682  1.00 57.49  ? 57  SER A O      1 
ATOM   939   C CB     . SER A 1 57  ? 41.053  -45.214 80.381  1.00 61.21  ? 57  SER A CB     1 
ATOM   940   O OG     . SER A 1 57  ? 40.410  -45.536 81.608  1.00 61.74  ? 57  SER A OG     1 
ATOM   941   H H      . SER A 1 57  ? 41.529  -47.622 79.736  1.00 77.04  ? 57  SER A H      1 
ATOM   942   H HA     . SER A 1 57  ? 39.515  -45.902 79.224  1.00 72.76  ? 57  SER A HA     1 
ATOM   943   H HB2    . SER A 1 57  ? 42.000  -45.406 80.462  1.00 73.84  ? 57  SER A HB2    1 
ATOM   944   H HB3    . SER A 1 57  ? 40.920  -44.272 80.193  1.00 73.84  ? 57  SER A HB3    1 
ATOM   945   H HG     . SER A 1 57  ? 40.736  -45.077 82.232  1.00 74.48  ? 57  SER A HG     1 
ATOM   946   N N      . LEU A 1 58  ? 41.479  -46.392 77.008  1.00 61.39  ? 58  LEU A N      1 
ATOM   947   C CA     . LEU A 1 58  ? 42.222  -45.995 75.801  1.00 63.29  ? 58  LEU A CA     1 
ATOM   948   C C      . LEU A 1 58  ? 41.512  -45.008 74.895  1.00 63.81  ? 58  LEU A C      1 
ATOM   949   O O      . LEU A 1 58  ? 40.420  -45.259 74.403  1.00 63.75  ? 58  LEU A O      1 
ATOM   950   C CB     . LEU A 1 58  ? 42.586  -47.229 74.969  1.00 65.96  ? 58  LEU A CB     1 
ATOM   951   C CG     . LEU A 1 58  ? 43.232  -46.969 73.600  1.00 66.45  ? 58  LEU A CG     1 
ATOM   952   C CD1    . LEU A 1 58  ? 44.569  -46.261 73.730  1.00 66.36  ? 58  LEU A CD1    1 
ATOM   953   C CD2    . LEU A 1 58  ? 43.416  -48.279 72.858  1.00 66.57  ? 58  LEU A CD2    1 
ATOM   954   H H      . LEU A 1 58  ? 41.379  -47.243 77.088  1.00 74.06  ? 58  LEU A H      1 
ATOM   955   H HA     . LEU A 1 58  ? 43.053  -45.581 76.081  1.00 76.34  ? 58  LEU A HA     1 
ATOM   956   H HB2    . LEU A 1 58  ? 43.208  -47.768 75.483  1.00 79.54  ? 58  LEU A HB2    1 
ATOM   957   H HB3    . LEU A 1 58  ? 41.775  -47.739 74.812  1.00 79.54  ? 58  LEU A HB3    1 
ATOM   958   H HG     . LEU A 1 58  ? 42.644  -46.405 73.073  1.00 80.13  ? 58  LEU A HG     1 
ATOM   959   H HD11   . LEU A 1 58  ? 44.937  -46.119 72.844  1.00 80.03  ? 58  LEU A HD11   1 
ATOM   960   H HD12   . LEU A 1 58  ? 44.433  -45.410 74.173  1.00 80.03  ? 58  LEU A HD12   1 
ATOM   961   H HD13   . LEU A 1 58  ? 45.169  -46.815 74.253  1.00 80.03  ? 58  LEU A HD13   1 
ATOM   962   H HD21   . LEU A 1 58  ? 43.825  -48.100 71.997  1.00 80.27  ? 58  LEU A HD21   1 
ATOM   963   H HD22   . LEU A 1 58  ? 43.990  -48.860 73.382  1.00 80.27  ? 58  LEU A HD22   1 
ATOM   964   H HD23   . LEU A 1 58  ? 42.549  -48.695 72.733  1.00 80.27  ? 58  LEU A HD23   1 
ATOM   965   N N      . GLU A 1 59  ? 42.184  -43.888 74.664  1.00 64.25  ? 59  GLU A N      1 
ATOM   966   C CA     . GLU A 1 59  ? 41.732  -42.867 73.738  1.00 66.17  ? 59  GLU A CA     1 
ATOM   967   C C      . GLU A 1 59  ? 42.953  -42.263 73.062  1.00 63.66  ? 59  GLU A C      1 
ATOM   968   O O      . GLU A 1 59  ? 43.899  -41.862 73.740  1.00 65.39  ? 59  GLU A O      1 
ATOM   969   C CB     . GLU A 1 59  ? 40.948  -41.782 74.482  1.00 69.55  ? 59  GLU A CB     1 
ATOM   970   C CG     . GLU A 1 59  ? 40.020  -40.930 73.619  1.00 76.07  ? 59  GLU A CG     1 
ATOM   971   C CD     . GLU A 1 59  ? 39.121  -40.019 74.464  1.00 79.22  ? 59  GLU A CD     1 
ATOM   972   O OE1    . GLU A 1 59  ? 39.585  -39.579 75.542  1.00 78.06  ? 59  GLU A OE1    1 
ATOM   973   O OE2    . GLU A 1 59  ? 37.957  -39.757 74.065  1.00 80.01  ? 59  GLU A OE2    1 
ATOM   974   H H      . GLU A 1 59  ? 42.930  -43.693 75.047  1.00 77.49  ? 59  GLU A H      1 
ATOM   975   H HA     . GLU A 1 59  ? 41.160  -43.263 73.062  1.00 79.79  ? 59  GLU A HA     1 
ATOM   976   H HB2    . GLU A 1 59  ? 40.403  -42.208 75.162  1.00 83.85  ? 59  GLU A HB2    1 
ATOM   977   H HB3    . GLU A 1 59  ? 41.582  -41.182 74.906  1.00 83.85  ? 59  GLU A HB3    1 
ATOM   978   H HG2    . GLU A 1 59  ? 40.554  -40.370 73.035  1.00 91.68  ? 59  GLU A HG2    1 
ATOM   979   H HG3    . GLU A 1 59  ? 39.450  -41.513 73.093  1.00 91.68  ? 59  GLU A HG3    1 
ATOM   980   N N      . ILE A 1 60  ? 42.933  -42.181 71.736  1.00 62.98  ? 60  ILE A N      1 
ATOM   981   C CA     . ILE A 1 60  ? 44.031  -41.556 71.007  1.00 61.73  ? 60  ILE A CA     1 
ATOM   982   C C      . ILE A 1 60  ? 43.593  -40.138 70.759  1.00 64.75  ? 60  ILE A C      1 
ATOM   983   O O      . ILE A 1 60  ? 42.503  -39.904 70.245  1.00 68.00  ? 60  ILE A O      1 
ATOM   984   C CB     . ILE A 1 60  ? 44.357  -42.259 69.673  1.00 59.21  ? 60  ILE A CB     1 
ATOM   985   C CG1    . ILE A 1 60  ? 44.934  -43.649 69.941  1.00 60.22  ? 60  ILE A CG1    1 
ATOM   986   C CG2    . ILE A 1 60  ? 45.350  -41.432 68.862  1.00 57.83  ? 60  ILE A CG2    1 
ATOM   987   C CD1    . ILE A 1 60  ? 45.198  -44.470 68.694  1.00 63.93  ? 60  ILE A CD1    1 
ATOM   988   H H      . ILE A 1 60  ? 42.299  -42.477 71.237  1.00 75.97  ? 60  ILE A H      1 
ATOM   989   H HA     . ILE A 1 60  ? 44.829  -41.546 71.559  1.00 74.47  ? 60  ILE A HA     1 
ATOM   990   H HB     . ILE A 1 60  ? 43.539  -42.354 69.161  1.00 71.44  ? 60  ILE A HB     1 
ATOM   991   H HG12   . ILE A 1 60  ? 45.776  -43.550 70.413  1.00 72.65  ? 60  ILE A HG12   1 
ATOM   992   H HG13   . ILE A 1 60  ? 44.307  -44.144 70.492  1.00 72.65  ? 60  ILE A HG13   1 
ATOM   993   H HG21   . ILE A 1 60  ? 45.539  -41.894 68.030  1.00 69.79  ? 60  ILE A HG21   1 
ATOM   994   H HG22   . ILE A 1 60  ? 44.960  -40.563 68.678  1.00 69.79  ? 60  ILE A HG22   1 
ATOM   995   H HG23   . ILE A 1 60  ? 46.166  -41.327 69.375  1.00 69.79  ? 60  ILE A HG23   1 
ATOM   996   H HD11   . ILE A 1 60  ? 45.560  -45.331 68.955  1.00 77.11  ? 60  ILE A HD11   1 
ATOM   997   H HD12   . ILE A 1 60  ? 44.364  -44.592 68.215  1.00 77.11  ? 60  ILE A HD12   1 
ATOM   998   H HD13   . ILE A 1 60  ? 45.835  -43.998 68.136  1.00 77.11  ? 60  ILE A HD13   1 
ATOM   999   N N      . ASP A 1 61  ? 44.425  -39.191 71.158  1.00 65.81  ? 61  ASP A N      1 
ATOM   1000  C CA     . ASP A 1 61  ? 44.146  -37.791 70.908  1.00 66.57  ? 61  ASP A CA     1 
ATOM   1001  C C      . ASP A 1 61  ? 45.160  -37.287 69.887  1.00 63.92  ? 61  ASP A C      1 
ATOM   1002  O O      . ASP A 1 61  ? 46.339  -37.637 69.954  1.00 62.99  ? 61  ASP A O      1 
ATOM   1003  C CB     . ASP A 1 61  ? 44.176  -36.984 72.217  1.00 67.06  ? 61  ASP A CB     1 
ATOM   1004  C CG     . ASP A 1 61  ? 43.094  -37.427 73.211  1.00 67.17  ? 61  ASP A CG     1 
ATOM   1005  O OD1    . ASP A 1 61  ? 42.035  -37.922 72.770  1.00 67.95  ? 61  ASP A OD1    1 
ATOM   1006  O OD2    . ASP A 1 61  ? 43.300  -37.283 74.435  1.00 66.42  ? 61  ASP A OD2    1 
ATOM   1007  H H      . ASP A 1 61  ? 45.162  -39.335 71.577  1.00 79.37  ? 61  ASP A H      1 
ATOM   1008  H HA     . ASP A 1 61  ? 43.260  -37.706 70.522  1.00 80.27  ? 61  ASP A HA     1 
ATOM   1009  H HB2    . ASP A 1 61  ? 45.040  -37.103 72.642  1.00 80.86  ? 61  ASP A HB2    1 
ATOM   1010  H HB3    . ASP A 1 61  ? 44.031  -36.047 72.014  1.00 80.86  ? 61  ASP A HB3    1 
ATOM   1011  N N      . VAL A 1 62  ? 44.680  -36.523 68.911  1.00 62.81  ? 62  VAL A N      1 
ATOM   1012  C CA     . VAL A 1 62  ? 45.533  -35.962 67.871  1.00 66.85  ? 62  VAL A CA     1 
ATOM   1013  C C      . VAL A 1 62  ? 45.240  -34.475 67.668  1.00 70.06  ? 62  VAL A C      1 
ATOM   1014  O O      . VAL A 1 62  ? 44.122  -34.102 67.340  1.00 72.30  ? 62  VAL A O      1 
ATOM   1015  C CB     . VAL A 1 62  ? 45.337  -36.710 66.527  1.00 67.54  ? 62  VAL A CB     1 
ATOM   1016  C CG1    . VAL A 1 62  ? 46.313  -36.209 65.462  1.00 67.35  ? 62  VAL A CG1    1 
ATOM   1017  C CG2    . VAL A 1 62  ? 45.502  -38.197 66.726  1.00 67.00  ? 62  VAL A CG2    1 
ATOM   1018  H H      . VAL A 1 62  ? 43.851  -36.312 68.829  1.00 75.76  ? 62  VAL A H      1 
ATOM   1019  H HA     . VAL A 1 62  ? 46.461  -36.054 68.137  1.00 80.61  ? 62  VAL A HA     1 
ATOM   1020  H HB     . VAL A 1 62  ? 44.436  -36.550 66.206  1.00 81.44  ? 62  VAL A HB     1 
ATOM   1021  H HG11   . VAL A 1 62  ? 46.160  -36.699 64.639  1.00 81.21  ? 62  VAL A HG11   1 
ATOM   1022  H HG12   . VAL A 1 62  ? 46.162  -35.262 65.317  1.00 81.21  ? 62  VAL A HG12   1 
ATOM   1023  H HG13   . VAL A 1 62  ? 47.221  -36.356 65.772  1.00 81.21  ? 62  VAL A HG13   1 
ATOM   1024  H HG21   . VAL A 1 62  ? 45.376  -38.645 65.875  1.00 80.79  ? 62  VAL A HG21   1 
ATOM   1025  H HG22   . VAL A 1 62  ? 46.394  -38.374 67.064  1.00 80.79  ? 62  VAL A HG22   1 
ATOM   1026  H HG23   . VAL A 1 62  ? 44.839  -38.506 67.363  1.00 80.79  ? 62  VAL A HG23   1 
ATOM   1027  N N      . PHE A 1 63  ? 46.248  -33.629 67.849  1.00 72.08  ? 63  PHE A N      1 
ATOM   1028  C CA     . PHE A 1 63  ? 46.069  -32.199 67.645  1.00 73.44  ? 63  PHE A CA     1 
ATOM   1029  C C      . PHE A 1 63  ? 46.627  -31.799 66.290  1.00 75.29  ? 63  PHE A C      1 
ATOM   1030  O O      . PHE A 1 63  ? 47.766  -32.112 65.957  1.00 77.20  ? 63  PHE A O      1 
ATOM   1031  C CB     . PHE A 1 63  ? 46.744  -31.381 68.752  1.00 73.09  ? 63  PHE A CB     1 
ATOM   1032  C CG     . PHE A 1 63  ? 45.862  -31.119 69.943  1.00 72.26  ? 63  PHE A CG     1 
ATOM   1033  C CD1    . PHE A 1 63  ? 45.468  -32.150 70.781  1.00 71.85  ? 63  PHE A CD1    1 
ATOM   1034  C CD2    . PHE A 1 63  ? 45.423  -29.837 70.221  1.00 72.31  ? 63  PHE A CD2    1 
ATOM   1035  C CE1    . PHE A 1 63  ? 44.655  -31.905 71.878  1.00 69.85  ? 63  PHE A CE1    1 
ATOM   1036  C CE2    . PHE A 1 63  ? 44.611  -29.587 71.309  1.00 71.44  ? 63  PHE A CE2    1 
ATOM   1037  C CZ     . PHE A 1 63  ? 44.226  -30.622 72.139  1.00 70.16  ? 63  PHE A CZ     1 
ATOM   1038  H H      . PHE A 1 63  ? 47.042  -33.857 68.088  1.00 86.88  ? 63  PHE A H      1 
ATOM   1039  H HA     . PHE A 1 63  ? 45.121  -31.994 67.654  1.00 88.52  ? 63  PHE A HA     1 
ATOM   1040  H HB2    . PHE A 1 63  ? 47.526  -31.862 69.062  1.00 88.09  ? 63  PHE A HB2    1 
ATOM   1041  H HB3    . PHE A 1 63  ? 47.010  -30.522 68.386  1.00 88.09  ? 63  PHE A HB3    1 
ATOM   1042  H HD1    . PHE A 1 63  ? 45.756  -33.017 70.608  1.00 86.61  ? 63  PHE A HD1    1 
ATOM   1043  H HD2    . PHE A 1 63  ? 45.677  -29.135 69.667  1.00 87.16  ? 63  PHE A HD2    1 
ATOM   1044  H HE1    . PHE A 1 63  ? 44.398  -32.605 72.434  1.00 84.20  ? 63  PHE A HE1    1 
ATOM   1045  H HE2    . PHE A 1 63  ? 44.324  -28.720 71.485  1.00 86.11  ? 63  PHE A HE2    1 
ATOM   1046  H HZ     . PHE A 1 63  ? 43.681  -30.453 72.873  1.00 84.59  ? 63  PHE A HZ     1 
ATOM   1047  N N      . LEU A 1 64  ? 45.789  -31.135 65.501  1.00 68.22  ? 64  LEU A N      1 
ATOM   1048  C CA     . LEU A 1 64  ? 46.186  -30.601 64.207  1.00 68.70  ? 64  LEU A CA     1 
ATOM   1049  C C      . LEU A 1 64  ? 46.751  -29.194 64.390  1.00 70.86  ? 64  LEU A C      1 
ATOM   1050  O O      . LEU A 1 64  ? 46.070  -28.317 64.927  1.00 67.07  ? 64  LEU A O      1 
ATOM   1051  C CB     . LEU A 1 64  ? 45.001  -30.587 63.243  1.00 70.16  ? 64  LEU A CB     1 
ATOM   1052  C CG     . LEU A 1 64  ? 44.213  -31.895 63.133  1.00 67.59  ? 64  LEU A CG     1 
ATOM   1053  C CD1    . LEU A 1 64  ? 42.976  -31.692 62.285  1.00 69.94  ? 64  LEU A CD1    1 
ATOM   1054  C CD2    . LEU A 1 64  ? 45.076  -32.986 62.554  1.00 69.13  ? 64  LEU A CD2    1 
ATOM   1055  H H      . LEU A 1 64  ? 44.967  -30.979 65.699  1.00 82.26  ? 64  LEU A H      1 
ATOM   1056  H HA     . LEU A 1 64  ? 46.881  -31.162 63.828  1.00 82.83  ? 64  LEU A HA     1 
ATOM   1057  H HB2    . LEU A 1 64  ? 44.381  -29.899 63.532  1.00 84.58  ? 64  LEU A HB2    1 
ATOM   1058  H HB3    . LEU A 1 64  ? 45.331  -30.372 62.356  1.00 84.58  ? 64  LEU A HB3    1 
ATOM   1059  H HG     . LEU A 1 64  ? 43.930  -32.172 64.019  1.00 81.50  ? 64  LEU A HG     1 
ATOM   1060  H HD11   . LEU A 1 64  ? 42.492  -32.530 62.228  1.00 84.32  ? 64  LEU A HD11   1 
ATOM   1061  H HD12   . LEU A 1 64  ? 42.418  -31.014 62.699  1.00 84.32  ? 64  LEU A HD12   1 
ATOM   1062  H HD13   . LEU A 1 64  ? 43.245  -31.403 61.399  1.00 84.32  ? 64  LEU A HD13   1 
ATOM   1063  H HD21   . LEU A 1 64  ? 44.555  -33.802 62.495  1.00 83.35  ? 64  LEU A HD21   1 
ATOM   1064  H HD22   . LEU A 1 64  ? 45.373  -32.718 61.670  1.00 83.35  ? 64  LEU A HD22   1 
ATOM   1065  H HD23   . LEU A 1 64  ? 45.842  -33.123 63.133  1.00 83.35  ? 64  LEU A HD23   1 
ATOM   1066  N N      . LEU A 1 65  ? 47.991  -28.991 63.937  1.00 78.34  ? 65  LEU A N      1 
ATOM   1067  C CA     . LEU A 1 65  ? 48.724  -27.747 64.182  1.00 80.56  ? 65  LEU A CA     1 
ATOM   1068  C C      . LEU A 1 65  ? 48.718  -26.791 62.985  1.00 84.42  ? 65  LEU A C      1 
ATOM   1069  O O      . LEU A 1 65  ? 49.443  -27.000 62.008  1.00 81.88  ? 65  LEU A O      1 
ATOM   1070  C CB     . LEU A 1 65  ? 50.178  -28.082 64.527  1.00 80.11  ? 65  LEU A CB     1 
ATOM   1071  C CG     . LEU A 1 65  ? 50.449  -28.966 65.745  1.00 74.11  ? 65  LEU A CG     1 
ATOM   1072  C CD1    . LEU A 1 65  ? 51.946  -29.164 65.929  1.00 71.50  ? 65  LEU A CD1    1 
ATOM   1073  C CD2    . LEU A 1 65  ? 49.819  -28.390 67.002  1.00 71.37  ? 65  LEU A CD2    1 
ATOM   1074  H H      . LEU A 1 65  ? 48.435  -29.567 63.479  1.00 94.40  ? 65  LEU A H      1 
ATOM   1075  H HA     . LEU A 1 65  ? 48.329  -27.288 64.940  1.00 97.07  ? 65  LEU A HA     1 
ATOM   1076  H HB2    . LEU A 1 65  ? 50.569  -28.530 63.761  1.00 96.52  ? 65  LEU A HB2    1 
ATOM   1077  H HB3    . LEU A 1 65  ? 50.647  -27.246 64.677  1.00 96.52  ? 65  LEU A HB3    1 
ATOM   1078  H HG     . LEU A 1 65  ? 50.053  -29.838 65.590  1.00 89.33  ? 65  LEU A HG     1 
ATOM   1079  H HD11   . LEU A 1 65  ? 52.097  -29.727 66.705  1.00 86.20  ? 65  LEU A HD11   1 
ATOM   1080  H HD12   . LEU A 1 65  ? 52.308  -29.590 65.136  1.00 86.20  ? 65  LEU A HD12   1 
ATOM   1081  H HD13   . LEU A 1 65  ? 52.365  -28.299 66.061  1.00 86.20  ? 65  LEU A HD13   1 
ATOM   1082  H HD21   . LEU A 1 65  ? 50.012  -28.977 67.749  1.00 86.03  ? 65  LEU A HD21   1 
ATOM   1083  H HD22   . LEU A 1 65  ? 50.192  -27.510 67.167  1.00 86.03  ? 65  LEU A HD22   1 
ATOM   1084  H HD23   . LEU A 1 65  ? 48.860  -28.324 66.872  1.00 86.03  ? 65  LEU A HD23   1 
ATOM   1085  N N      . PHE A 1 66  ? 47.933  -25.720 63.098  1.00 94.48  ? 66  PHE A N      1 
ATOM   1086  C CA     . PHE A 1 66  ? 47.824  -24.691 62.060  1.00 99.82  ? 66  PHE A CA     1 
ATOM   1087  C C      . PHE A 1 66  ? 48.691  -23.463 62.338  1.00 99.89  ? 66  PHE A C      1 
ATOM   1088  O O      . PHE A 1 66  ? 48.820  -23.043 63.484  1.00 99.15  ? 66  PHE A O      1 
ATOM   1089  C CB     . PHE A 1 66  ? 46.365  -24.266 61.880  1.00 100.43 ? 66  PHE A CB     1 
ATOM   1090  C CG     . PHE A 1 66  ? 45.515  -25.306 61.209  1.00 100.22 ? 66  PHE A CG     1 
ATOM   1091  C CD1    . PHE A 1 66  ? 45.586  -25.487 59.839  1.00 101.82 ? 66  PHE A CD1    1 
ATOM   1092  C CD2    . PHE A 1 66  ? 44.661  -26.110 61.941  1.00 98.91  ? 66  PHE A CD2    1 
ATOM   1093  C CE1    . PHE A 1 66  ? 44.814  -26.437 59.211  1.00 102.62 ? 66  PHE A CE1    1 
ATOM   1094  C CE2    . PHE A 1 66  ? 43.885  -27.066 61.314  1.00 98.86  ? 66  PHE A CE2    1 
ATOM   1095  C CZ     . PHE A 1 66  ? 43.961  -27.228 59.948  1.00 100.77 ? 66  PHE A CZ     1 
ATOM   1096  H H      . PHE A 1 66  ? 47.440  -25.563 63.785  1.00 113.76 ? 66  PHE A H      1 
ATOM   1097  H HA     . PHE A 1 66  ? 48.121  -25.072 61.219  1.00 120.17 ? 66  PHE A HA     1 
ATOM   1098  H HB2    . PHE A 1 66  ? 45.982  -24.086 62.753  1.00 120.91 ? 66  PHE A HB2    1 
ATOM   1099  H HB3    . PHE A 1 66  ? 46.337  -23.463 61.337  1.00 120.91 ? 66  PHE A HB3    1 
ATOM   1100  H HD1    . PHE A 1 66  ? 46.157  -24.954 59.335  1.00 122.57 ? 66  PHE A HD1    1 
ATOM   1101  H HD2    . PHE A 1 66  ? 44.603  -26.002 62.863  1.00 119.08 ? 66  PHE A HD2    1 
ATOM   1102  H HE1    . PHE A 1 66  ? 44.869  -26.546 58.289  1.00 123.53 ? 66  PHE A HE1    1 
ATOM   1103  H HE2    . PHE A 1 66  ? 43.310  -27.600 61.814  1.00 119.02 ? 66  PHE A HE2    1 
ATOM   1104  H HZ     . PHE A 1 66  ? 43.441  -27.872 59.525  1.00 121.32 ? 66  PHE A HZ     1 
ATOM   1105  N N      . PRO A 1 67  ? 49.286  -22.879 61.285  1.00 97.68  ? 67  PRO A N      1 
ATOM   1106  C CA     . PRO A 1 67  ? 49.970  -21.594 61.463  1.00 98.87  ? 67  PRO A CA     1 
ATOM   1107  C C      . PRO A 1 67  ? 49.025  -20.506 61.977  1.00 101.69 ? 67  PRO A C      1 
ATOM   1108  O O      . PRO A 1 67  ? 47.806  -20.660 61.894  1.00 99.44  ? 67  PRO A O      1 
ATOM   1109  C CB     . PRO A 1 67  ? 50.474  -21.270 60.055  1.00 101.69 ? 67  PRO A CB     1 
ATOM   1110  C CG     . PRO A 1 67  ? 50.619  -22.590 59.395  1.00 100.21 ? 67  PRO A CG     1 
ATOM   1111  C CD     . PRO A 1 67  ? 49.512  -23.434 59.938  1.00 97.84  ? 67  PRO A CD     1 
ATOM   1112  H HA     . PRO A 1 67  ? 50.723  -21.688 62.067  1.00 119.04 ? 67  PRO A HA     1 
ATOM   1113  H HB2    . PRO A 1 67  ? 49.822  -20.722 59.590  1.00 122.41 ? 67  PRO A HB2    1 
ATOM   1114  H HB3    . PRO A 1 67  ? 51.330  -20.816 60.109  1.00 122.41 ? 67  PRO A HB3    1 
ATOM   1115  H HG2    . PRO A 1 67  ? 50.529  -22.486 58.435  1.00 120.64 ? 67  PRO A HG2    1 
ATOM   1116  H HG3    . PRO A 1 67  ? 51.482  -22.973 59.619  1.00 120.64 ? 67  PRO A HG3    1 
ATOM   1117  H HD2    . PRO A 1 67  ? 48.715  -23.338 59.394  1.00 117.80 ? 67  PRO A HD2    1 
ATOM   1118  H HD3    . PRO A 1 67  ? 49.792  -24.361 59.998  1.00 117.80 ? 67  PRO A HD3    1 
ATOM   1119  N N      . GLU A 1 68  ? 49.590  -19.426 62.508  1.00 106.46 ? 68  GLU A N      1 
ATOM   1120  C CA     . GLU A 1 68  ? 48.799  -18.381 63.149  1.00 109.53 ? 68  GLU A CA     1 
ATOM   1121  C C      . GLU A 1 68  ? 48.201  -17.397 62.144  1.00 108.89 ? 68  GLU A C      1 
ATOM   1122  O O      . GLU A 1 68  ? 47.520  -16.447 62.531  1.00 112.58 ? 68  GLU A O      1 
ATOM   1123  C CB     . GLU A 1 68  ? 49.655  -17.634 64.174  1.00 112.49 ? 68  GLU A CB     1 
ATOM   1124  C CG     . GLU A 1 68  ? 50.020  -18.477 65.390  1.00 112.48 ? 68  GLU A CG     1 
ATOM   1125  C CD     . GLU A 1 68  ? 50.767  -17.692 66.450  1.00 114.71 ? 68  GLU A CD     1 
ATOM   1126  O OE1    . GLU A 1 68  ? 50.252  -16.642 66.890  1.00 117.42 ? 68  GLU A OE1    1 
ATOM   1127  O OE2    . GLU A 1 68  ? 51.869  -18.124 66.849  1.00 113.28 ? 68  GLU A OE2    1 
ATOM   1128  H H      . GLU A 1 68  ? 50.436  -19.274 62.511  1.00 128.14 ? 68  GLU A H      1 
ATOM   1129  H HA     . GLU A 1 68  ? 48.064  -18.797 63.626  1.00 131.83 ? 68  GLU A HA     1 
ATOM   1130  H HB2    . GLU A 1 68  ? 50.480  -17.354 63.748  1.00 135.37 ? 68  GLU A HB2    1 
ATOM   1131  H HB3    . GLU A 1 68  ? 49.165  -16.858 64.486  1.00 135.37 ? 68  GLU A HB3    1 
ATOM   1132  H HG2    . GLU A 1 68  ? 49.206  -18.822 65.791  1.00 135.37 ? 68  GLU A HG2    1 
ATOM   1133  H HG3    . GLU A 1 68  ? 50.587  -19.212 65.107  1.00 135.37 ? 68  GLU A HG3    1 
ATOM   1134  N N      . GLU A 1 69  ? 48.461  -17.617 60.858  1.00 101.20 ? 69  GLU A N      1 
ATOM   1135  C CA     . GLU A 1 69  ? 47.892  -16.769 59.817  1.00 98.45  ? 69  GLU A CA     1 
ATOM   1136  C C      . GLU A 1 69  ? 46.399  -17.045 59.657  1.00 99.24  ? 69  GLU A C      1 
ATOM   1137  O O      . GLU A 1 69  ? 45.690  -16.272 59.016  1.00 99.41  ? 69  GLU A O      1 
ATOM   1138  C CB     . GLU A 1 69  ? 48.604  -16.992 58.480  1.00 98.57  ? 69  GLU A CB     1 
ATOM   1139  C CG     . GLU A 1 69  ? 50.015  -16.423 58.402  1.00 100.73 ? 69  GLU A CG     1 
ATOM   1140  C CD     . GLU A 1 69  ? 51.002  -17.145 59.298  1.00 97.79  ? 69  GLU A CD     1 
ATOM   1141  O OE1    . GLU A 1 69  ? 50.593  -18.106 59.980  1.00 95.18  ? 69  GLU A OE1    1 
ATOM   1142  O OE2    . GLU A 1 69  ? 52.190  -16.753 59.320  1.00 97.93  ? 69  GLU A OE2    1 
ATOM   1143  H H      . GLU A 1 69  ? 48.964  -18.249 60.564  1.00 121.83 ? 69  GLU A H      1 
ATOM   1144  H HA     . GLU A 1 69  ? 48.003  -15.839 60.068  1.00 118.53 ? 69  GLU A HA     1 
ATOM   1145  H HB2    . GLU A 1 69  ? 48.663  -17.946 58.318  1.00 118.68 ? 69  GLU A HB2    1 
ATOM   1146  H HB3    . GLU A 1 69  ? 48.080  -16.574 57.779  1.00 118.68 ? 69  GLU A HB3    1 
ATOM   1147  H HG2    . GLU A 1 69  ? 50.333  -16.496 57.489  1.00 121.27 ? 69  GLU A HG2    1 
ATOM   1148  H HG3    . GLU A 1 69  ? 49.993  -15.492 58.671  1.00 121.27 ? 69  GLU A HG3    1 
ATOM   1149  N N      . PHE A 1 70  ? 45.922  -18.133 60.265  1.00 103.17 ? 70  PHE A N      1 
ATOM   1150  C CA     . PHE A 1 70  ? 44.518  -18.524 60.154  1.00 109.20 ? 70  PHE A CA     1 
ATOM   1151  C C      . PHE A 1 70  ? 43.666  -18.057 61.328  1.00 112.85 ? 70  PHE A C      1 
ATOM   1152  O O      . PHE A 1 70  ? 44.172  -17.508 62.306  1.00 111.88 ? 70  PHE A O      1 
ATOM   1153  C CB     . PHE A 1 70  ? 44.398  -20.048 60.060  1.00 106.73 ? 70  PHE A CB     1 
ATOM   1154  C CG     . PHE A 1 70  ? 45.062  -20.651 58.852  1.00 107.79 ? 70  PHE A CG     1 
ATOM   1155  C CD1    . PHE A 1 70  ? 44.481  -20.544 57.605  1.00 109.48 ? 70  PHE A CD1    1 
ATOM   1156  C CD2    . PHE A 1 70  ? 46.251  -21.354 58.970  1.00 106.43 ? 70  PHE A CD2    1 
ATOM   1157  C CE1    . PHE A 1 70  ? 45.078  -21.109 56.497  1.00 109.59 ? 70  PHE A CE1    1 
ATOM   1158  C CE2    . PHE A 1 70  ? 46.853  -21.923 57.857  1.00 106.06 ? 70  PHE A CE2    1 
ATOM   1159  C CZ     . PHE A 1 70  ? 46.265  -21.800 56.625  1.00 107.29 ? 70  PHE A CZ     1 
ATOM   1160  H H      . PHE A 1 70  ? 46.395  -18.664 60.749  1.00 124.19 ? 70  PHE A H      1 
ATOM   1161  H HA     . PHE A 1 70  ? 44.147  -18.142 59.344  1.00 131.43 ? 70  PHE A HA     1 
ATOM   1162  H HB2    . PHE A 1 70  ? 44.806  -20.441 60.847  1.00 128.46 ? 70  PHE A HB2    1 
ATOM   1163  H HB3    . PHE A 1 70  ? 43.457  -20.284 60.027  1.00 128.46 ? 70  PHE A HB3    1 
ATOM   1164  H HD1    . PHE A 1 70  ? 43.681  -20.081 57.509  1.00 131.76 ? 70  PHE A HD1    1 
ATOM   1165  H HD2    . PHE A 1 70  ? 46.653  -21.441 59.804  1.00 128.11 ? 70  PHE A HD2    1 
ATOM   1166  H HE1    . PHE A 1 70  ? 44.679  -21.024 55.661  1.00 131.90 ? 70  PHE A HE1    1 
ATOM   1167  H HE2    . PHE A 1 70  ? 47.653  -22.388 57.946  1.00 127.66 ? 70  PHE A HE2    1 
ATOM   1168  H HZ     . PHE A 1 70  ? 46.667  -22.178 55.877  1.00 129.14 ? 70  PHE A HZ     1 
ATOM   1169  N N      . SER A 1 71  ? 42.366  -18.312 61.217  1.00 117.31 ? 71  SER A N      1 
ATOM   1170  C CA     . SER A 1 71  ? 41.392  -17.960 62.242  1.00 116.80 ? 71  SER A CA     1 
ATOM   1171  C C      . SER A 1 71  ? 40.472  -19.148 62.483  1.00 115.71 ? 71  SER A C      1 
ATOM   1172  O O      . SER A 1 71  ? 40.658  -20.210 61.888  1.00 111.64 ? 71  SER A O      1 
ATOM   1173  C CB     . SER A 1 71  ? 40.586  -16.725 61.833  1.00 119.03 ? 71  SER A CB     1 
ATOM   1174  O OG     . SER A 1 71  ? 40.015  -16.889 60.551  1.00 119.89 ? 71  SER A OG     1 
ATOM   1175  H H      . SER A 1 71  ? 42.015  -18.700 60.535  1.00 141.16 ? 71  SER A H      1 
ATOM   1176  H HA     . SER A 1 71  ? 41.855  -17.760 63.070  1.00 140.56 ? 71  SER A HA     1 
ATOM   1177  H HB2    . SER A 1 71  ? 39.875  -16.585 62.479  1.00 143.22 ? 71  SER A HB2    1 
ATOM   1178  H HB3    . SER A 1 71  ? 41.176  -15.955 61.819  1.00 143.22 ? 71  SER A HB3    1 
ATOM   1179  H HG     . SER A 1 71  ? 39.576  -16.204 60.342  1.00 144.26 ? 71  SER A HG     1 
ATOM   1180  N N      . LYS A 1 72  ? 39.481  -18.961 63.352  1.00 116.91 ? 72  LYS A N      1 
ATOM   1181  C CA     . LYS A 1 72  ? 38.497  -19.997 63.649  1.00 116.98 ? 72  LYS A CA     1 
ATOM   1182  C C      . LYS A 1 72  ? 37.853  -20.487 62.366  1.00 118.93 ? 72  LYS A C      1 
ATOM   1183  O O      . LYS A 1 72  ? 37.381  -21.616 62.280  1.00 117.03 ? 72  LYS A O      1 
ATOM   1184  C CB     . LYS A 1 72  ? 37.399  -19.476 64.578  1.00 119.21 ? 72  LYS A CB     1 
ATOM   1185  C CG     . LYS A 1 72  ? 36.233  -20.462 64.740  1.00 119.91 ? 72  LYS A CG     1 
ATOM   1186  C CD     . LYS A 1 72  ? 35.139  -19.948 65.661  1.00 120.31 ? 72  LYS A CD     1 
ATOM   1187  C CE     . LYS A 1 72  ? 33.885  -20.822 65.576  1.00 119.65 ? 72  LYS A CE     1 
ATOM   1188  N NZ     . LYS A 1 72  ? 34.144  -22.260 65.889  1.00 115.98 ? 72  LYS A NZ     1 
ATOM   1189  H H      . LYS A 1 72  ? 39.357  -18.230 63.789  1.00 140.68 ? 72  LYS A H      1 
ATOM   1190  H HA     . LYS A 1 72  ? 38.936  -20.747 64.080  1.00 140.77 ? 72  LYS A HA     1 
ATOM   1191  H HB2    . LYS A 1 72  ? 37.778  -19.314 65.456  1.00 143.44 ? 72  LYS A HB2    1 
ATOM   1192  H HB3    . LYS A 1 72  ? 37.043  -18.650 64.214  1.00 143.44 ? 72  LYS A HB3    1 
ATOM   1193  H HG2    . LYS A 1 72  ? 35.838  -20.628 63.870  1.00 144.28 ? 72  LYS A HG2    1 
ATOM   1194  H HG3    . LYS A 1 72  ? 36.572  -21.291 65.113  1.00 144.28 ? 72  LYS A HG3    1 
ATOM   1195  H HD2    . LYS A 1 72  ? 35.458  -19.961 66.577  1.00 144.77 ? 72  LYS A HD2    1 
ATOM   1196  H HD3    . LYS A 1 72  ? 34.899  -19.044 65.402  1.00 144.77 ? 72  LYS A HD3    1 
ATOM   1197  H HE2    . LYS A 1 72  ? 33.229  -20.493 66.210  1.00 143.98 ? 72  LYS A HE2    1 
ATOM   1198  H HE3    . LYS A 1 72  ? 33.528  -20.773 64.676  1.00 143.98 ? 72  LYS A HE3    1 
ATOM   1199  H HZ1    . LYS A 1 72  ? 33.389  -22.726 65.827  1.00 139.56 ? 72  LYS A HZ1    1 
ATOM   1200  H HZ2    . LYS A 1 72  ? 34.738  -22.594 65.316  1.00 139.56 ? 72  LYS A HZ2    1 
ATOM   1201  H HZ3    . LYS A 1 72  ? 34.465  -22.338 66.716  1.00 139.56 ? 72  LYS A HZ3    1 
ATOM   1202  N N      . GLU A 1 73  ? 37.843  -19.628 61.362  1.00 121.96 ? 73  GLU A N      1 
ATOM   1203  C CA     . GLU A 1 73  ? 37.149  -19.926 60.131  1.00 124.76 ? 73  GLU A CA     1 
ATOM   1204  C C      . GLU A 1 73  ? 37.831  -21.088 59.421  1.00 120.46 ? 73  GLU A C      1 
ATOM   1205  O O      . GLU A 1 73  ? 37.162  -22.031 59.002  1.00 121.41 ? 73  GLU A O      1 
ATOM   1206  C CB     . GLU A 1 73  ? 37.146  -18.673 59.257  1.00 130.81 ? 73  GLU A CB     1 
ATOM   1207  C CG     . GLU A 1 73  ? 36.563  -17.452 59.975  1.00 133.65 ? 73  GLU A CG     1 
ATOM   1208  C CD     . GLU A 1 73  ? 37.003  -16.136 59.372  1.00 136.68 ? 73  GLU A CD     1 
ATOM   1209  O OE1    . GLU A 1 73  ? 37.750  -16.152 58.370  1.00 136.91 ? 73  GLU A OE1    1 
ATOM   1210  O OE2    . GLU A 1 73  ? 36.615  -15.079 59.915  1.00 138.80 ? 73  GLU A OE2    1 
ATOM   1211  H H      . GLU A 1 73  ? 38.233  -18.862 61.372  1.00 146.74 ? 73  GLU A H      1 
ATOM   1212  H HA     . GLU A 1 73  ? 36.231  -20.174 60.323  1.00 150.10 ? 73  GLU A HA     1 
ATOM   1213  H HB2    . GLU A 1 73  ? 38.058  -18.463 59.002  1.00 157.36 ? 73  GLU A HB2    1 
ATOM   1214  H HB3    . GLU A 1 73  ? 36.610  -18.840 58.466  1.00 157.36 ? 73  GLU A HB3    1 
ATOM   1215  H HG2    . GLU A 1 73  ? 35.595  -17.493 59.929  1.00 160.77 ? 73  GLU A HG2    1 
ATOM   1216  H HG3    . GLU A 1 73  ? 36.850  -17.466 60.902  1.00 160.77 ? 73  GLU A HG3    1 
ATOM   1217  N N      . GLU A 1 74  ? 39.157  -21.048 59.322  1.00 116.75 ? 74  GLU A N      1 
ATOM   1218  C CA     . GLU A 1 74  ? 39.898  -22.151 58.715  1.00 111.20 ? 74  GLU A CA     1 
ATOM   1219  C C      . GLU A 1 74  ? 40.115  -23.256 59.726  1.00 103.43 ? 74  GLU A C      1 
ATOM   1220  O O      . GLU A 1 74  ? 40.341  -24.407 59.363  1.00 101.30 ? 74  GLU A O      1 
ATOM   1221  C CB     . GLU A 1 74  ? 41.244  -21.680 58.155  1.00 111.64 ? 74  GLU A CB     1 
ATOM   1222  C CG     . GLU A 1 74  ? 41.148  -20.925 56.844  1.00 115.63 ? 74  GLU A CG     1 
ATOM   1223  C CD     . GLU A 1 74  ? 40.836  -21.850 55.673  1.00 117.13 ? 74  GLU A CD     1 
ATOM   1224  O OE1    . GLU A 1 74  ? 41.492  -22.913 55.564  1.00 115.76 ? 74  GLU A OE1    1 
ATOM   1225  O OE2    . GLU A 1 74  ? 39.952  -21.512 54.855  1.00 118.30 ? 74  GLU A OE2    1 
ATOM   1226  H H      . GLU A 1 74  ? 39.648  -20.398 59.596  1.00 140.49 ? 74  GLU A H      1 
ATOM   1227  H HA     . GLU A 1 74  ? 39.379  -22.514 57.981  1.00 133.83 ? 74  GLU A HA     1 
ATOM   1228  H HB2    . GLU A 1 74  ? 41.661  -21.092 58.804  1.00 134.36 ? 74  GLU A HB2    1 
ATOM   1229  H HB3    . GLU A 1 74  ? 41.807  -22.456 58.008  1.00 134.36 ? 74  GLU A HB3    1 
ATOM   1230  H HG2    . GLU A 1 74  ? 40.438  -20.266 56.907  1.00 139.15 ? 74  GLU A HG2    1 
ATOM   1231  H HG3    . GLU A 1 74  ? 41.995  -20.487 56.666  1.00 139.15 ? 74  GLU A HG3    1 
ATOM   1232  N N      . LEU A 1 75  ? 40.042  -22.904 61.003  1.00 99.42  ? 75  LEU A N      1 
ATOM   1233  C CA     . LEU A 1 75  ? 40.189  -23.899 62.051  1.00 96.80  ? 75  LEU A CA     1 
ATOM   1234  C C      . LEU A 1 75  ? 38.952  -24.785 62.156  1.00 100.01 ? 75  LEU A C      1 
ATOM   1235  O O      . LEU A 1 75  ? 39.064  -26.006 62.178  1.00 98.96  ? 75  LEU A O      1 
ATOM   1236  C CB     . LEU A 1 75  ? 40.470  -23.223 63.392  1.00 92.28  ? 75  LEU A CB     1 
ATOM   1237  C CG     . LEU A 1 75  ? 41.911  -23.404 63.865  1.00 88.54  ? 75  LEU A CG     1 
ATOM   1238  C CD1    . LEU A 1 75  ? 42.860  -22.705 62.892  1.00 92.39  ? 75  LEU A CD1    1 
ATOM   1239  C CD2    . LEU A 1 75  ? 42.099  -22.880 65.276  1.00 85.54  ? 75  LEU A CD2    1 
ATOM   1240  H H      . LEU A 1 75  ? 39.908  -22.103 61.285  1.00 119.69 ? 75  LEU A H      1 
ATOM   1241  H HA     . LEU A 1 75  ? 40.946  -24.468 61.839  1.00 116.55 ? 75  LEU A HA     1 
ATOM   1242  H HB2    . LEU A 1 75  ? 40.301  -22.272 63.306  1.00 111.12 ? 75  LEU A HB2    1 
ATOM   1243  H HB3    . LEU A 1 75  ? 39.884  -23.604 64.065  1.00 111.12 ? 75  LEU A HB3    1 
ATOM   1244  H HG     . LEU A 1 75  ? 42.127  -24.350 63.866  1.00 106.64 ? 75  LEU A HG     1 
ATOM   1245  H HD11   . LEU A 1 75  ? 43.772  -22.824 63.200  1.00 111.26 ? 75  LEU A HD11   1 
ATOM   1246  H HD12   . LEU A 1 75  ? 42.753  -23.096 62.011  1.00 111.26 ? 75  LEU A HD12   1 
ATOM   1247  H HD13   . LEU A 1 75  ? 42.642  -21.760 62.863  1.00 111.26 ? 75  LEU A HD13   1 
ATOM   1248  H HD21   . LEU A 1 75  ? 43.023  -23.012 65.541  1.00 103.04 ? 75  LEU A HD21   1 
ATOM   1249  H HD22   . LEU A 1 75  ? 41.881  -21.935 65.293  1.00 103.04 ? 75  LEU A HD22   1 
ATOM   1250  H HD23   . LEU A 1 75  ? 41.510  -23.367 65.874  1.00 103.04 ? 75  LEU A HD23   1 
ATOM   1251  N N      . ARG A 1 76  ? 37.776  -24.171 62.235  1.00 107.01 ? 76  ARG A N      1 
ATOM   1252  C CA     . ARG A 1 76  ? 36.533  -24.926 62.350  1.00 108.43 ? 76  ARG A CA     1 
ATOM   1253  C C      . ARG A 1 76  ? 36.279  -25.782 61.114  1.00 110.83 ? 76  ARG A C      1 
ATOM   1254  O O      . ARG A 1 76  ? 35.979  -26.968 61.227  1.00 108.42 ? 76  ARG A O      1 
ATOM   1255  C CB     . ARG A 1 76  ? 35.357  -23.970 62.585  1.00 112.68 ? 76  ARG A CB     1 
ATOM   1256  C CG     . ARG A 1 76  ? 33.993  -24.642 62.720  1.00 111.86 ? 76  ARG A CG     1 
ATOM   1257  C CD     . ARG A 1 76  ? 32.878  -23.612 62.909  1.00 115.58 ? 76  ARG A CD     1 
ATOM   1258  N NE     . ARG A 1 76  ? 32.769  -22.691 61.779  1.00 118.91 ? 76  ARG A NE     1 
ATOM   1259  C CZ     . ARG A 1 76  ? 32.113  -22.953 60.651  1.00 121.44 ? 76  ARG A CZ     1 
ATOM   1260  N NH1    . ARG A 1 76  ? 31.500  -24.118 60.485  1.00 121.94 ? 76  ARG A NH1    1 
ATOM   1261  N NH2    . ARG A 1 76  ? 32.072  -22.050 59.681  1.00 123.22 ? 76  ARG A NH2    1 
ATOM   1262  H H      . ARG A 1 76  ? 37.671  -23.317 62.223  1.00 128.80 ? 76  ARG A H      1 
ATOM   1263  H HA     . ARG A 1 76  ? 36.594  -25.518 63.116  1.00 130.51 ? 76  ARG A HA     1 
ATOM   1264  H HB2    . ARG A 1 76  ? 35.521  -23.474 63.403  1.00 135.60 ? 76  ARG A HB2    1 
ATOM   1265  H HB3    . ARG A 1 76  ? 35.306  -23.354 61.837  1.00 135.60 ? 76  ARG A HB3    1 
ATOM   1266  H HG2    . ARG A 1 76  ? 33.806  -25.149 61.915  1.00 134.63 ? 76  ARG A HG2    1 
ATOM   1267  H HG3    . ARG A 1 76  ? 34.001  -25.228 63.493  1.00 134.63 ? 76  ARG A HG3    1 
ATOM   1268  H HD2    . ARG A 1 76  ? 32.031  -24.076 63.002  1.00 139.09 ? 76  ARG A HD2    1 
ATOM   1269  H HD3    . ARG A 1 76  ? 33.061  -23.090 63.706  1.00 139.09 ? 76  ARG A HD3    1 
ATOM   1270  H HE     . ARG A 1 76  ? 33.155  -21.926 61.847  1.00 143.08 ? 76  ARG A HE     1 
ATOM   1271  H HH11   . ARG A 1 76  ? 31.523  -24.709 61.110  1.00 146.72 ? 76  ARG A HH11   1 
ATOM   1272  H HH12   . ARG A 1 76  ? 31.078  -24.282 59.754  1.00 146.72 ? 76  ARG A HH12   1 
ATOM   1273  H HH21   . ARG A 1 76  ? 32.467  -21.293 59.781  1.00 148.25 ? 76  ARG A HH21   1 
ATOM   1274  H HH22   . ARG A 1 76  ? 31.648  -22.220 58.952  1.00 148.25 ? 76  ARG A HH22   1 
ATOM   1275  N N      . GLU A 1 77  ? 36.423  -25.172 59.940  1.00 114.61 ? 77  GLU A N      1 
ATOM   1276  C CA     . GLU A 1 77  ? 36.113  -25.830 58.669  1.00 117.21 ? 77  GLU A CA     1 
ATOM   1277  C C      . GLU A 1 77  ? 37.125  -26.888 58.251  1.00 110.53 ? 77  GLU A C      1 
ATOM   1278  O O      . GLU A 1 77  ? 36.784  -28.058 58.087  1.00 111.31 ? 77  GLU A O      1 
ATOM   1279  C CB     . GLU A 1 77  ? 36.011  -24.787 57.554  1.00 122.79 ? 77  GLU A CB     1 
ATOM   1280  C CG     . GLU A 1 77  ? 35.583  -25.354 56.209  1.00 126.63 ? 77  GLU A CG     1 
ATOM   1281  C CD     . GLU A 1 77  ? 35.645  -24.324 55.105  1.00 130.62 ? 77  GLU A CD     1 
ATOM   1282  O OE1    . GLU A 1 77  ? 35.469  -24.699 53.923  1.00 131.61 ? 77  GLU A OE1    1 
ATOM   1283  O OE2    . GLU A 1 77  ? 35.880  -23.138 55.423  1.00 132.86 ? 77  GLU A OE2    1 
ATOM   1284  H H      . GLU A 1 77  ? 36.703  -24.363 59.850  1.00 137.92 ? 77  GLU A H      1 
ATOM   1285  H HA     . GLU A 1 77  ? 35.249  -26.264 58.747  1.00 141.04 ? 77  GLU A HA     1 
ATOM   1286  H HB2    . GLU A 1 77  ? 35.360  -24.117 57.812  1.00 147.74 ? 77  GLU A HB2    1 
ATOM   1287  H HB3    . GLU A 1 77  ? 36.880  -24.371 57.436  1.00 147.74 ? 77  GLU A HB3    1 
ATOM   1288  H HG2    . GLU A 1 77  ? 36.174  -26.086 55.972  1.00 152.35 ? 77  GLU A HG2    1 
ATOM   1289  H HG3    . GLU A 1 77  ? 34.669  -25.671 56.275  1.00 152.35 ? 77  GLU A HG3    1 
ATOM   1290  N N      . ARG A 1 78  ? 38.364  -26.457 58.055  1.00 104.91 ? 78  ARG A N      1 
ATOM   1291  C CA     . ARG A 1 78  ? 39.417  -27.336 57.567  1.00 100.33 ? 78  ARG A CA     1 
ATOM   1292  C C      . ARG A 1 78  ? 39.988  -28.191 58.703  1.00 95.38  ? 78  ARG A C      1 
ATOM   1293  O O      . ARG A 1 78  ? 40.908  -28.980 58.498  1.00 93.28  ? 78  ARG A O      1 
ATOM   1294  C CB     . ARG A 1 78  ? 40.489  -26.529 56.832  1.00 101.26 ? 78  ARG A CB     1 
ATOM   1295  C CG     . ARG A 1 78  ? 39.899  -25.788 55.613  1.00 106.01 ? 78  ARG A CG     1 
ATOM   1296  C CD     . ARG A 1 78  ? 39.326  -26.771 54.562  1.00 109.29 ? 78  ARG A CD     1 
ATOM   1297  N NE     . ARG A 1 78  ? 38.793  -26.123 53.358  1.00 114.18 ? 78  ARG A NE     1 
ATOM   1298  C CZ     . ARG A 1 78  ? 39.513  -25.754 52.301  1.00 115.99 ? 78  ARG A CZ     1 
ATOM   1299  N NH1    . ARG A 1 78  ? 40.822  -25.965 52.262  1.00 112.36 ? 78  ARG A NH1    1 
ATOM   1300  N NH2    . ARG A 1 78  ? 38.911  -25.179 51.270  1.00 120.80 ? 78  ARG A NH2    1 
ATOM   1301  H H      . ARG A 1 78  ? 38.624  -25.650 58.199  1.00 126.28 ? 78  ARG A H      1 
ATOM   1302  H HA     . ARG A 1 78  ? 39.027  -27.945 56.921  1.00 120.78 ? 78  ARG A HA     1 
ATOM   1303  H HB2    . ARG A 1 78  ? 40.863  -25.869 57.437  1.00 121.91 ? 78  ARG A HB2    1 
ATOM   1304  H HB3    . ARG A 1 78  ? 41.183  -27.129 56.518  1.00 121.91 ? 78  ARG A HB3    1 
ATOM   1305  H HG2    . ARG A 1 78  ? 39.179  -25.208 55.909  1.00 127.61 ? 78  ARG A HG2    1 
ATOM   1306  H HG3    . ARG A 1 78  ? 40.597  -25.265 55.189  1.00 127.61 ? 78  ARG A HG3    1 
ATOM   1307  H HD2    . ARG A 1 78  ? 40.032  -27.375 54.284  1.00 131.54 ? 78  ARG A HD2    1 
ATOM   1308  H HD3    . ARG A 1 78  ? 38.605  -27.276 54.969  1.00 131.54 ? 78  ARG A HD3    1 
ATOM   1309  H HE     . ARG A 1 78  ? 37.947  -25.970 53.333  1.00 137.41 ? 78  ARG A HE     1 
ATOM   1310  H HH11   . ARG A 1 78  ? 41.217  -26.340 52.928  1.00 135.23 ? 78  ARG A HH11   1 
ATOM   1311  H HH12   . ARG A 1 78  ? 41.277  -25.724 51.573  1.00 135.23 ? 78  ARG A HH12   1 
ATOM   1312  H HH21   . ARG A 1 78  ? 38.063  -25.041 51.290  1.00 145.35 ? 78  ARG A HH21   1 
ATOM   1313  H HH22   . ARG A 1 78  ? 39.370  -24.939 50.584  1.00 145.35 ? 78  ARG A HH22   1 
ATOM   1314  N N      . GLY A 1 79  ? 39.475  -27.978 59.913  1.00 94.24  ? 79  GLY A N      1 
ATOM   1315  C CA     . GLY A 1 79  ? 39.768  -28.848 61.042  1.00 89.62  ? 79  GLY A CA     1 
ATOM   1316  C C      . GLY A 1 79  ? 38.759  -29.993 61.072  1.00 89.49  ? 79  GLY A C      1 
ATOM   1317  O O      . GLY A 1 79  ? 39.044  -31.076 61.576  1.00 85.77  ? 79  GLY A O      1 
ATOM   1318  H H      . GLY A 1 79  ? 38.948  -27.326 60.105  1.00 113.48 ? 79  GLY A H      1 
ATOM   1319  H HA2    . GLY A 1 79  ? 40.662  -29.215 60.957  1.00 107.93 ? 79  GLY A HA2    1 
ATOM   1320  H HA3    . GLY A 1 79  ? 39.707  -28.350 61.872  1.00 107.93 ? 79  GLY A HA3    1 
ATOM   1321  N N      . LEU A 1 80  ? 37.575  -29.744 60.515  1.00 94.13  ? 80  LEU A N      1 
ATOM   1322  C CA     . LEU A 1 80  ? 36.535  -30.760 60.354  1.00 94.85  ? 80  LEU A CA     1 
ATOM   1323  C C      . LEU A 1 80  ? 36.806  -31.661 59.150  1.00 94.71  ? 80  LEU A C      1 
ATOM   1324  O O      . LEU A 1 80  ? 36.619  -32.875 59.207  1.00 94.23  ? 80  LEU A O      1 
ATOM   1325  C CB     . LEU A 1 80  ? 35.165  -30.090 60.182  1.00 100.19 ? 80  LEU A CB     1 
ATOM   1326  C CG     . LEU A 1 80  ? 34.059  -30.896 59.482  1.00 101.83 ? 80  LEU A CG     1 
ATOM   1327  C CD1    . LEU A 1 80  ? 33.671  -32.093 60.331  1.00 101.36 ? 80  LEU A CD1    1 
ATOM   1328  C CD2    . LEU A 1 80  ? 32.838  -30.031 59.158  1.00 102.43 ? 80  LEU A CD2    1 
ATOM   1329  H H      . LEU A 1 80  ? 37.345  -28.971 60.215  1.00 113.35 ? 80  LEU A H      1 
ATOM   1330  H HA     . LEU A 1 80  ? 36.504  -31.316 61.149  1.00 114.21 ? 80  LEU A HA     1 
ATOM   1331  H HB2    . LEU A 1 80  ? 34.833  -29.858 61.063  1.00 120.62 ? 80  LEU A HB2    1 
ATOM   1332  H HB3    . LEU A 1 80  ? 35.293  -29.278 59.667  1.00 120.62 ? 80  LEU A HB3    1 
ATOM   1333  H HG     . LEU A 1 80  ? 34.408  -31.234 58.643  1.00 122.58 ? 80  LEU A HG     1 
ATOM   1334  H HD11   . LEU A 1 80  ? 32.973  -32.590 59.875  1.00 122.03 ? 80  LEU A HD11   1 
ATOM   1335  H HD12   . LEU A 1 80  ? 34.450  -32.657 60.456  1.00 122.03 ? 80  LEU A HD12   1 
ATOM   1336  H HD13   . LEU A 1 80  ? 33.347  -31.780 61.190  1.00 122.03 ? 80  LEU A HD13   1 
ATOM   1337  H HD21   . LEU A 1 80  ? 32.170  -30.581 58.720  1.00 123.30 ? 80  LEU A HD21   1 
ATOM   1338  H HD22   . LEU A 1 80  ? 32.480  -29.670 59.984  1.00 123.30 ? 80  LEU A HD22   1 
ATOM   1339  H HD23   . LEU A 1 80  ? 33.110  -29.309 58.571  1.00 123.30 ? 80  LEU A HD23   1 
ATOM   1340  N N      . GLU A 1 81  ? 37.244  -31.054 58.055  1.00 93.09  ? 81  GLU A N      1 
ATOM   1341  C CA     . GLU A 1 81  ? 37.454  -31.788 56.816  1.00 95.19  ? 81  GLU A CA     1 
ATOM   1342  C C      . GLU A 1 81  ? 38.626  -32.752 56.924  1.00 92.08  ? 81  GLU A C      1 
ATOM   1343  O O      . GLU A 1 81  ? 38.658  -33.760 56.227  1.00 94.80  ? 81  GLU A O      1 
ATOM   1344  C CB     . GLU A 1 81  ? 37.668  -30.824 55.643  1.00 99.18  ? 81  GLU A CB     1 
ATOM   1345  C CG     . GLU A 1 81  ? 36.441  -29.983 55.289  1.00 104.06 ? 81  GLU A CG     1 
ATOM   1346  C CD     . GLU A 1 81  ? 35.206  -30.829 54.983  1.00 106.08 ? 81  GLU A CD     1 
ATOM   1347  O OE1    . GLU A 1 81  ? 35.292  -31.738 54.127  1.00 105.78 ? 81  GLU A OE1    1 
ATOM   1348  O OE2    . GLU A 1 81  ? 34.149  -30.589 55.607  1.00 107.47 ? 81  GLU A OE2    1 
ATOM   1349  H H      . GLU A 1 81  ? 37.428  -30.216 58.003  1.00 112.09 ? 81  GLU A H      1 
ATOM   1350  H HA     . GLU A 1 81  ? 36.659  -32.311 56.627  1.00 114.62 ? 81  GLU A HA     1 
ATOM   1351  H HB2    . GLU A 1 81  ? 38.388  -30.214 55.869  1.00 119.40 ? 81  GLU A HB2    1 
ATOM   1352  H HB3    . GLU A 1 81  ? 37.910  -31.338 54.857  1.00 119.40 ? 81  GLU A HB3    1 
ATOM   1353  H HG2    . GLU A 1 81  ? 36.229  -29.404 56.038  1.00 125.27 ? 81  GLU A HG2    1 
ATOM   1354  H HG3    . GLU A 1 81  ? 36.640  -29.449 54.504  1.00 125.27 ? 81  GLU A HG3    1 
ATOM   1355  N N      . ILE A 1 82  ? 39.584  -32.458 57.795  1.00 90.72  ? 82  ILE A N      1 
ATOM   1356  C CA     . ILE A 1 82  ? 40.709  -33.368 57.995  1.00 91.29  ? 82  ILE A CA     1 
ATOM   1357  C C      . ILE A 1 82  ? 40.248  -34.591 58.796  1.00 93.11  ? 82  ILE A C      1 
ATOM   1358  O O      . ILE A 1 82  ? 40.690  -35.714 58.545  1.00 92.32  ? 82  ILE A O      1 
ATOM   1359  C CB     . ILE A 1 82  ? 41.886  -32.665 58.710  1.00 86.29  ? 82  ILE A CB     1 
ATOM   1360  C CG1    . ILE A 1 82  ? 42.492  -31.604 57.790  1.00 87.03  ? 82  ILE A CG1    1 
ATOM   1361  C CG2    . ILE A 1 82  ? 42.957  -33.678 59.126  1.00 83.05  ? 82  ILE A CG2    1 
ATOM   1362  C CD1    . ILE A 1 82  ? 43.546  -30.742 58.435  1.00 84.97  ? 82  ILE A CD1    1 
ATOM   1363  H H      . ILE A 1 82  ? 39.608  -31.747 58.278  1.00 109.25 ? 82  ILE A H      1 
ATOM   1364  H HA     . ILE A 1 82  ? 41.024  -33.676 57.131  1.00 109.93 ? 82  ILE A HA     1 
ATOM   1365  H HB     . ILE A 1 82  ? 41.548  -32.227 59.507  1.00 103.93 ? 82  ILE A HB     1 
ATOM   1366  H HG12   . ILE A 1 82  ? 42.901  -32.050 57.031  1.00 104.83 ? 82  ILE A HG12   1 
ATOM   1367  H HG13   . ILE A 1 82  ? 41.783  -31.019 57.482  1.00 104.83 ? 82  ILE A HG13   1 
ATOM   1368  H HG21   . ILE A 1 82  ? 43.680  -33.208 59.571  1.00 100.05 ? 82  ILE A HG21   1 
ATOM   1369  H HG22   . ILE A 1 82  ? 42.561  -34.325 59.731  1.00 100.05 ? 82  ILE A HG22   1 
ATOM   1370  H HG23   . ILE A 1 82  ? 43.292  -34.126 58.334  1.00 100.05 ? 82  ILE A HG23   1 
ATOM   1371  H HD11   . ILE A 1 82  ? 43.873  -30.103 57.783  1.00 102.35 ? 82  ILE A HD11   1 
ATOM   1372  H HD12   . ILE A 1 82  ? 43.154  -30.275 59.189  1.00 102.35 ? 82  ILE A HD12   1 
ATOM   1373  H HD13   . ILE A 1 82  ? 44.274  -31.307 58.738  1.00 102.35 ? 82  ILE A HD13   1 
ATOM   1374  N N      . GLY A 1 83  ? 39.359  -34.370 59.759  1.00 95.14  ? 83  GLY A N      1 
ATOM   1375  C CA     . GLY A 1 83  ? 38.802  -35.452 60.549  1.00 95.97  ? 83  GLY A CA     1 
ATOM   1376  C C      . GLY A 1 83  ? 38.007  -36.465 59.740  1.00 102.16 ? 83  GLY A C      1 
ATOM   1377  O O      . GLY A 1 83  ? 38.173  -37.672 59.919  1.00 101.62 ? 83  GLY A O      1 
ATOM   1378  H H      . GLY A 1 83  ? 39.062  -33.592 59.974  1.00 114.56 ? 83  GLY A H      1 
ATOM   1379  H HA2    . GLY A 1 83  ? 39.523  -35.922 60.996  1.00 115.55 ? 83  GLY A HA2    1 
ATOM   1380  H HA3    . GLY A 1 83  ? 38.216  -35.081 61.227  1.00 115.55 ? 83  GLY A HA3    1 
ATOM   1381  N N      . LYS A 1 84  ? 37.162  -35.972 58.834  1.00 109.17 ? 84  LYS A N      1 
ATOM   1382  C CA     . LYS A 1 84  ? 36.294  -36.825 58.016  1.00 112.95 ? 84  LYS A CA     1 
ATOM   1383  C C      . LYS A 1 84  ? 37.057  -37.856 57.185  1.00 112.10 ? 84  LYS A C      1 
ATOM   1384  O O      . LYS A 1 84  ? 36.655  -39.016 57.101  1.00 113.97 ? 84  LYS A O      1 
ATOM   1385  C CB     . LYS A 1 84  ? 35.470  -35.947 57.069  1.00 118.30 ? 84  LYS A CB     1 
ATOM   1386  C CG     . LYS A 1 84  ? 34.268  -35.261 57.697  1.00 121.70 ? 84  LYS A CG     1 
ATOM   1387  C CD     . LYS A 1 84  ? 33.443  -34.539 56.635  1.00 127.43 ? 84  LYS A CD     1 
ATOM   1388  C CE     . LYS A 1 84  ? 32.184  -33.909 57.214  1.00 128.32 ? 84  LYS A CE     1 
ATOM   1389  N NZ     . LYS A 1 84  ? 31.328  -33.278 56.168  1.00 131.20 ? 84  LYS A NZ     1 
ATOM   1390  H H      . LYS A 1 84  ? 37.071  -35.133 58.671  1.00 131.39 ? 84  LYS A H      1 
ATOM   1391  H HA     . LYS A 1 84  ? 35.680  -37.301 58.596  1.00 135.93 ? 84  LYS A HA     1 
ATOM   1392  H HB2    . LYS A 1 84  ? 36.048  -35.254 56.712  1.00 142.35 ? 84  LYS A HB2    1 
ATOM   1393  H HB3    . LYS A 1 84  ? 35.143  -36.501 56.343  1.00 142.35 ? 84  LYS A HB3    1 
ATOM   1394  H HG2    . LYS A 1 84  ? 33.704  -35.925 58.125  1.00 146.43 ? 84  LYS A HG2    1 
ATOM   1395  H HG3    . LYS A 1 84  ? 34.572  -34.607 58.346  1.00 146.43 ? 84  LYS A HG3    1 
ATOM   1396  H HD2    . LYS A 1 84  ? 33.979  -33.833 56.241  1.00 153.30 ? 84  LYS A HD2    1 
ATOM   1397  H HD3    . LYS A 1 84  ? 33.176  -35.175 55.953  1.00 153.30 ? 84  LYS A HD3    1 
ATOM   1398  H HE2    . LYS A 1 84  ? 31.661  -34.596 57.657  1.00 154.38 ? 84  LYS A HE2    1 
ATOM   1399  H HE3    . LYS A 1 84  ? 32.437  -33.222 57.850  1.00 154.38 ? 84  LYS A HE3    1 
ATOM   1400  H HZ1    . LYS A 1 84  ? 30.603  -32.922 56.542  1.00 157.83 ? 84  LYS A HZ1    1 
ATOM   1401  H HZ2    . LYS A 1 84  ? 31.782  -32.638 55.749  1.00 157.83 ? 84  LYS A HZ2    1 
ATOM   1402  H HZ3    . LYS A 1 84  ? 31.075  -33.890 55.573  1.00 157.83 ? 84  LYS A HZ3    1 
ATOM   1403  N N      . ALA A 1 85  ? 38.159  -37.423 56.580  1.00 107.51 ? 85  ALA A N      1 
ATOM   1404  C CA     . ALA A 1 85  ? 38.922  -38.256 55.650  1.00 108.53 ? 85  ALA A CA     1 
ATOM   1405  C C      . ALA A 1 85  ? 39.810  -39.286 56.343  1.00 105.51 ? 85  ALA A C      1 
ATOM   1406  O O      . ALA A 1 85  ? 40.334  -40.198 55.703  1.00 106.17 ? 85  ALA A O      1 
ATOM   1407  C CB     . ALA A 1 85  ? 39.770  -37.374 54.752  1.00 109.92 ? 85  ALA A CB     1 
ATOM   1408  H H      . ALA A 1 85  ? 38.491  -36.638 56.692  1.00 129.40 ? 85  ALA A H      1 
ATOM   1409  H HA     . ALA A 1 85  ? 38.299  -38.739 55.085  1.00 130.63 ? 85  ALA A HA     1 
ATOM   1410  H HB1    . ALA A 1 85  ? 40.271  -37.936 54.140  1.00 132.30 ? 85  ALA A HB1    1 
ATOM   1411  H HB2    . ALA A 1 85  ? 39.187  -36.779 54.253  1.00 132.30 ? 85  ALA A HB2    1 
ATOM   1412  H HB3    . ALA A 1 85  ? 40.379  -36.857 55.302  1.00 132.30 ? 85  ALA A HB3    1 
ATOM   1413  N N      . VAL A 1 86  ? 39.976  -39.136 57.650  1.00 100.78 ? 86  VAL A N      1 
ATOM   1414  C CA     . VAL A 1 86  ? 40.842  -40.018 58.419  1.00 97.38  ? 86  VAL A CA     1 
ATOM   1415  C C      . VAL A 1 86  ? 39.974  -40.881 59.313  1.00 96.64  ? 86  VAL A C      1 
ATOM   1416  O O      . VAL A 1 86  ? 40.039  -42.103 59.245  1.00 101.25 ? 86  VAL A O      1 
ATOM   1417  C CB     . VAL A 1 86  ? 41.863  -39.242 59.246  1.00 92.47  ? 86  VAL A CB     1 
ATOM   1418  C CG1    . VAL A 1 86  ? 42.729  -40.198 60.032  1.00 91.37  ? 86  VAL A CG1    1 
ATOM   1419  C CG2    . VAL A 1 86  ? 42.733  -38.398 58.332  1.00 92.66  ? 86  VAL A CG2    1 
ATOM   1420  H H      . VAL A 1 86  ? 39.595  -38.524 58.120  1.00 121.33 ? 86  VAL A H      1 
ATOM   1421  H HA     . VAL A 1 86  ? 41.324  -40.600 57.811  1.00 117.24 ? 86  VAL A HA     1 
ATOM   1422  H HB     . VAL A 1 86  ? 41.404  -38.655 59.867  1.00 111.35 ? 86  VAL A HB     1 
ATOM   1423  H HG11   . VAL A 1 86  ? 43.370  -39.688 60.551  1.00 110.03 ? 86  VAL A HG11   1 
ATOM   1424  H HG12   . VAL A 1 86  ? 42.164  -40.720 60.624  1.00 110.03 ? 86  VAL A HG12   1 
ATOM   1425  H HG13   . VAL A 1 86  ? 43.193  -40.784 59.415  1.00 110.03 ? 86  VAL A HG13   1 
ATOM   1426  H HG21   . VAL A 1 86  ? 43.376  -37.912 58.870  1.00 111.58 ? 86  VAL A HG21   1 
ATOM   1427  H HG22   . VAL A 1 86  ? 43.195  -38.982 57.710  1.00 111.58 ? 86  VAL A HG22   1 
ATOM   1428  H HG23   . VAL A 1 86  ? 42.169  -37.776 57.847  1.00 111.58 ? 86  VAL A HG23   1 
ATOM   1429  N N      . LEU A 1 87  ? 39.203  -40.252 60.190  1.00 89.95  ? 87  LEU A N      1 
ATOM   1430  C CA     . LEU A 1 87  ? 38.303  -41.006 61.051  1.00 88.64  ? 87  LEU A CA     1 
ATOM   1431  C C      . LEU A 1 87  ? 37.341  -41.841 60.198  1.00 94.03  ? 87  LEU A C      1 
ATOM   1432  O O      . LEU A 1 87  ? 36.907  -41.410 59.122  1.00 94.53  ? 87  LEU A O      1 
ATOM   1433  C CB     . LEU A 1 87  ? 37.520  -40.066 61.969  1.00 85.27  ? 87  LEU A CB     1 
ATOM   1434  C CG     . LEU A 1 87  ? 38.287  -39.354 63.089  1.00 82.85  ? 87  LEU A CG     1 
ATOM   1435  C CD1    . LEU A 1 87  ? 38.590  -40.345 64.184  1.00 81.54  ? 87  LEU A CD1    1 
ATOM   1436  C CD2    . LEU A 1 87  ? 39.581  -38.698 62.637  1.00 81.36  ? 87  LEU A CD2    1 
ATOM   1437  H H      . LEU A 1 87  ? 39.181  -39.400 60.306  1.00 108.33 ? 87  LEU A H      1 
ATOM   1438  H HA     . LEU A 1 87  ? 38.821  -41.610 61.605  1.00 106.76 ? 87  LEU A HA     1 
ATOM   1439  H HB2    . LEU A 1 87  ? 37.120  -39.376 61.417  1.00 102.71 ? 87  LEU A HB2    1 
ATOM   1440  H HB3    . LEU A 1 87  ? 36.816  -40.581 62.392  1.00 102.71 ? 87  LEU A HB3    1 
ATOM   1441  H HG     . LEU A 1 87  ? 37.720  -38.662 63.464  1.00 99.81  ? 87  LEU A HG     1 
ATOM   1442  H HD11   . LEU A 1 87  ? 39.075  -39.894 64.893  1.00 98.24  ? 87  LEU A HD11   1 
ATOM   1443  H HD12   . LEU A 1 87  ? 37.755  -40.700 64.528  1.00 98.24  ? 87  LEU A HD12   1 
ATOM   1444  H HD13   . LEU A 1 87  ? 39.129  -41.064 63.819  1.00 98.24  ? 87  LEU A HD13   1 
ATOM   1445  H HD21   . LEU A 1 87  ? 40.002  -38.272 63.400  1.00 98.03  ? 87  LEU A HD21   1 
ATOM   1446  H HD22   . LEU A 1 87  ? 40.168  -39.377 62.271  1.00 98.03  ? 87  LEU A HD22   1 
ATOM   1447  H HD23   . LEU A 1 87  ? 39.378  -38.035 61.958  1.00 98.03  ? 87  LEU A HD23   1 
ATOM   1448  N N      . ASP A 1 88  ? 37.011  -43.035 60.682  1.00 95.56  ? 88  ASP A N      1 
ATOM   1449  C CA     . ASP A 1 88  ? 36.086  -43.913 59.979  1.00 98.76  ? 88  ASP A CA     1 
ATOM   1450  C C      . ASP A 1 88  ? 34.654  -43.481 60.249  1.00 99.87  ? 88  ASP A C      1 
ATOM   1451  O O      . ASP A 1 88  ? 33.937  -43.054 59.342  1.00 106.32 ? 88  ASP A O      1 
ATOM   1452  C CB     . ASP A 1 88  ? 36.300  -45.368 60.397  1.00 98.33  ? 88  ASP A CB     1 
ATOM   1453  C CG     . ASP A 1 88  ? 37.726  -45.834 60.174  1.00 97.14  ? 88  ASP A CG     1 
ATOM   1454  O OD1    . ASP A 1 88  ? 38.454  -45.186 59.394  1.00 96.90  ? 88  ASP A OD1    1 
ATOM   1455  O OD2    . ASP A 1 88  ? 38.116  -46.861 60.766  1.00 96.10  ? 88  ASP A OD2    1 
ATOM   1456  H H      . ASP A 1 88  ? 37.311  -43.360 61.420  1.00 115.07 ? 88  ASP A H      1 
ATOM   1457  H HA     . ASP A 1 88  ? 36.248  -43.846 59.025  1.00 118.91 ? 88  ASP A HA     1 
ATOM   1458  H HB2    . ASP A 1 88  ? 36.098  -45.459 61.341  1.00 118.39 ? 88  ASP A HB2    1 
ATOM   1459  H HB3    . ASP A 1 88  ? 35.713  -45.936 59.875  1.00 118.39 ? 88  ASP A HB3    1 
ATOM   1460  N N      . SER A 1 89  ? 34.242  -43.615 61.503  1.00 93.39  ? 89  SER A N      1 
ATOM   1461  C CA     . SER A 1 89  ? 32.972  -43.083 61.957  1.00 92.61  ? 89  SER A CA     1 
ATOM   1462  C C      . SER A 1 89  ? 33.217  -41.801 62.732  1.00 93.67  ? 89  SER A C      1 
ATOM   1463  O O      . SER A 1 89  ? 33.745  -41.836 63.840  1.00 90.56  ? 89  SER A O      1 
ATOM   1464  C CB     . SER A 1 89  ? 32.245  -44.115 62.817  1.00 89.96  ? 89  SER A CB     1 
ATOM   1465  O OG     . SER A 1 89  ? 32.989  -44.406 63.985  1.00 83.72  ? 89  SER A OG     1 
ATOM   1466  H H      . SER A 1 89  ? 34.690  -44.017 62.117  1.00 112.46 ? 89  SER A H      1 
ATOM   1467  H HA     . SER A 1 89  ? 32.415  -42.877 61.190  1.00 111.52 ? 89  SER A HA     1 
ATOM   1468  H HB2    . SER A 1 89  ? 31.380  -43.760 63.074  1.00 108.35 ? 89  SER A HB2    1 
ATOM   1469  H HB3    . SER A 1 89  ? 32.131  -44.930 62.304  1.00 108.35 ? 89  SER A HB3    1 
ATOM   1470  H HG     . SER A 1 89  ? 33.096  -43.707 64.439  1.00 100.85 ? 89  SER A HG     1 
ATOM   1471  N N      . TYR A 1 90  ? 32.828  -40.673 62.149  1.00 88.69  ? 90  TYR A N      1 
ATOM   1472  C CA     . TYR A 1 90  ? 33.050  -39.372 62.773  1.00 88.18  ? 90  TYR A CA     1 
ATOM   1473  C C      . TYR A 1 90  ? 31.801  -38.880 63.506  1.00 90.98  ? 90  TYR A C      1 
ATOM   1474  O O      . TYR A 1 90  ? 30.728  -38.771 62.916  1.00 98.22  ? 90  TYR A O      1 
ATOM   1475  C CB     . TYR A 1 90  ? 33.482  -38.341 61.722  1.00 92.00  ? 90  TYR A CB     1 
ATOM   1476  C CG     . TYR A 1 90  ? 32.637  -38.340 60.465  1.00 98.02  ? 90  TYR A CG     1 
ATOM   1477  C CD1    . TYR A 1 90  ? 31.435  -37.645 60.411  1.00 100.75 ? 90  TYR A CD1    1 
ATOM   1478  C CD2    . TYR A 1 90  ? 33.045  -39.030 59.330  1.00 102.16 ? 90  TYR A CD2    1 
ATOM   1479  C CE1    . TYR A 1 90  ? 30.657  -37.644 59.270  1.00 107.25 ? 90  TYR A CE1    1 
ATOM   1480  C CE2    . TYR A 1 90  ? 32.274  -39.034 58.178  1.00 107.76 ? 90  TYR A CE2    1 
ATOM   1481  C CZ     . TYR A 1 90  ? 31.079  -38.337 58.155  1.00 111.06 ? 90  TYR A CZ     1 
ATOM   1482  O OH     . TYR A 1 90  ? 30.301  -38.333 57.018  1.00 118.03 ? 90  TYR A OH     1 
ATOM   1483  H H      . TYR A 1 90  ? 32.431  -40.633 61.387  1.00 106.81 ? 90  TYR A H      1 
ATOM   1484  H HA     . TYR A 1 90  ? 33.765  -39.453 63.423  1.00 106.21 ? 90  TYR A HA     1 
ATOM   1485  H HB2    . TYR A 1 90  ? 33.428  -37.456 62.115  1.00 110.79 ? 90  TYR A HB2    1 
ATOM   1486  H HB3    . TYR A 1 90  ? 34.398  -38.528 61.462  1.00 110.79 ? 90  TYR A HB3    1 
ATOM   1487  H HD1    . TYR A 1 90  ? 31.145  -37.178 61.161  1.00 121.29 ? 90  TYR A HD1    1 
ATOM   1488  H HD2    . TYR A 1 90  ? 33.847  -39.501 59.345  1.00 122.99 ? 90  TYR A HD2    1 
ATOM   1489  H HE1    . TYR A 1 90  ? 29.854  -37.175 59.253  1.00 129.09 ? 90  TYR A HE1    1 
ATOM   1490  H HE2    . TYR A 1 90  ? 32.557  -39.502 57.426  1.00 129.70 ? 90  TYR A HE2    1 
ATOM   1491  H HH     . TYR A 1 90  ? 30.669  -38.789 56.416  1.00 142.03 ? 90  TYR A HH     1 
ATOM   1492  N N      . GLU A 1 91  ? 31.949  -38.612 64.801  1.00 85.14  ? 91  GLU A N      1 
ATOM   1493  C CA     . GLU A 1 91  ? 30.898  -37.989 65.602  1.00 86.78  ? 91  GLU A CA     1 
ATOM   1494  C C      . GLU A 1 91  ? 31.379  -36.613 66.029  1.00 83.86  ? 91  GLU A C      1 
ATOM   1495  O O      . GLU A 1 91  ? 32.320  -36.509 66.812  1.00 88.44  ? 91  GLU A O      1 
ATOM   1496  C CB     . GLU A 1 91  ? 30.560  -38.837 66.836  1.00 88.76  ? 91  GLU A CB     1 
ATOM   1497  C CG     . GLU A 1 91  ? 29.571  -38.174 67.820  1.00 93.54  ? 91  GLU A CG     1 
ATOM   1498  C CD     . GLU A 1 91  ? 29.620  -38.768 69.229  1.00 94.02  ? 91  GLU A CD     1 
ATOM   1499  O OE1    . GLU A 1 91  ? 30.678  -39.307 69.638  1.00 88.66  ? 91  GLU A OE1    1 
ATOM   1500  O OE2    . GLU A 1 91  ? 28.591  -38.688 69.936  1.00 95.48  ? 91  GLU A OE2    1 
ATOM   1501  H H      . GLU A 1 91  ? 32.664  -38.784 65.247  1.00 102.55 ? 91  GLU A H      1 
ATOM   1502  H HA     . GLU A 1 91  ? 30.096  -37.886 65.066  1.00 104.53 ? 91  GLU A HA     1 
ATOM   1503  H HB2    . GLU A 1 91  ? 30.164  -39.671 66.540  1.00 106.90 ? 91  GLU A HB2    1 
ATOM   1504  H HB3    . GLU A 1 91  ? 31.380  -39.019 67.321  1.00 106.90 ? 91  GLU A HB3    1 
ATOM   1505  H HG2    . GLU A 1 91  ? 29.783  -37.230 67.888  1.00 112.64 ? 91  GLU A HG2    1 
ATOM   1506  H HG3    . GLU A 1 91  ? 28.669  -38.286 67.481  1.00 112.64 ? 91  GLU A HG3    1 
ATOM   1507  N N      . ILE A 1 92  ? 30.723  -35.560 65.555  1.00 75.56  ? 92  ILE A N      1 
ATOM   1508  C CA     . ILE A 1 92  ? 31.201  -34.207 65.821  1.00 72.30  ? 92  ILE A CA     1 
ATOM   1509  C C      . ILE A 1 92  ? 30.564  -33.654 67.093  1.00 77.05  ? 92  ILE A C      1 
ATOM   1510  O O      . ILE A 1 92  ? 29.366  -33.360 67.133  1.00 85.18  ? 92  ILE A O      1 
ATOM   1511  C CB     . ILE A 1 92  ? 30.915  -33.266 64.619  1.00 74.46  ? 92  ILE A CB     1 
ATOM   1512  C CG1    . ILE A 1 92  ? 31.924  -33.528 63.502  1.00 73.71  ? 92  ILE A CG1    1 
ATOM   1513  C CG2    . ILE A 1 92  ? 31.002  -31.784 65.011  1.00 74.88  ? 92  ILE A CG2    1 
ATOM   1514  C CD1    . ILE A 1 92  ? 31.782  -34.881 62.821  1.00 74.73  ? 92  ILE A CD1    1 
ATOM   1515  H H      . ILE A 1 92  ? 30.006  -35.600 65.081  1.00 91.06  ? 92  ILE A H      1 
ATOM   1516  H HA     . ILE A 1 92  ? 32.161  -34.234 65.956  1.00 87.15  ? 92  ILE A HA     1 
ATOM   1517  H HB     . ILE A 1 92  ? 30.023  -33.448 64.285  1.00 87.70  ? 92  ILE A HB     1 
ATOM   1518  H HG12   . ILE A 1 92  ? 31.817  -32.845 62.822  1.00 86.78  ? 92  ILE A HG12   1 
ATOM   1519  H HG13   . ILE A 1 92  ? 32.818  -33.479 63.875  1.00 86.78  ? 92  ILE A HG13   1 
ATOM   1520  H HG21   . ILE A 1 92  ? 30.816  -31.240 64.229  1.00 87.90  ? 92  ILE A HG21   1 
ATOM   1521  H HG22   . ILE A 1 92  ? 30.349  -31.602 65.704  1.00 87.90  ? 92  ILE A HG22   1 
ATOM   1522  H HG23   . ILE A 1 92  ? 31.896  -31.597 65.339  1.00 87.90  ? 92  ILE A HG23   1 
ATOM   1523  H HD11   . ILE A 1 92  ? 32.459  -34.959 62.130  1.00 90.07  ? 92  ILE A HD11   1 
ATOM   1524  H HD12   . ILE A 1 92  ? 31.901  -35.581 63.482  1.00 90.07  ? 92  ILE A HD12   1 
ATOM   1525  H HD13   . ILE A 1 92  ? 30.898  -34.945 62.427  1.00 90.07  ? 92  ILE A HD13   1 
ATOM   1526  N N      . ARG A 1 93  ? 31.389  -33.510 68.125  1.00 75.99  ? 93  ARG A N      1 
ATOM   1527  C CA     . ARG A 1 93  ? 30.968  -32.923 69.390  1.00 86.40  ? 93  ARG A CA     1 
ATOM   1528  C C      . ARG A 1 93  ? 31.500  -31.496 69.452  1.00 93.47  ? 93  ARG A C      1 
ATOM   1529  O O      . ARG A 1 93  ? 32.054  -30.995 68.467  1.00 91.66  ? 93  ARG A O      1 
ATOM   1530  C CB     . ARG A 1 93  ? 31.457  -33.763 70.582  1.00 83.32  ? 93  ARG A CB     1 
ATOM   1531  C CG     . ARG A 1 93  ? 30.376  -34.655 71.190  1.00 84.55  ? 93  ARG A CG     1 
ATOM   1532  C CD     . ARG A 1 93  ? 30.747  -36.128 71.167  1.00 82.84  ? 93  ARG A CD     1 
ATOM   1533  N NE     . ARG A 1 93  ? 31.663  -36.480 72.246  1.00 82.39  ? 93  ARG A NE     1 
ATOM   1534  C CZ     . ARG A 1 93  ? 31.951  -37.728 72.611  1.00 83.73  ? 93  ARG A CZ     1 
ATOM   1535  N NH1    . ARG A 1 93  ? 31.387  -38.756 71.986  1.00 87.20  ? 93  ARG A NH1    1 
ATOM   1536  N NH2    . ARG A 1 93  ? 32.802  -37.951 73.608  1.00 78.16  ? 93  ARG A NH2    1 
ATOM   1537  H H      . ARG A 1 93  ? 32.215  -33.750 68.115  1.00 91.58  ? 93  ARG A H      1 
ATOM   1538  H HA     . ARG A 1 93  ? 29.999  -32.888 69.420  1.00 104.07 ? 93  ARG A HA     1 
ATOM   1539  H HB2    . ARG A 1 93  ? 32.182  -34.335 70.286  1.00 100.37 ? 93  ARG A HB2    1 
ATOM   1540  H HB3    . ARG A 1 93  ? 31.774  -33.165 71.277  1.00 100.37 ? 93  ARG A HB3    1 
ATOM   1541  H HG2    . ARG A 1 93  ? 30.235  -34.396 72.115  1.00 101.85 ? 93  ARG A HG2    1 
ATOM   1542  H HG3    . ARG A 1 93  ? 29.555  -34.545 70.686  1.00 101.85 ? 93  ARG A HG3    1 
ATOM   1543  H HD2    . ARG A 1 93  ? 29.942  -36.660 71.269  1.00 99.80  ? 93  ARG A HD2    1 
ATOM   1544  H HD3    . ARG A 1 93  ? 31.180  -36.334 70.324  1.00 99.80  ? 93  ARG A HD3    1 
ATOM   1545  H HE     . ARG A 1 93  ? 32.044  -35.839 72.675  1.00 99.25  ? 93  ARG A HE     1 
ATOM   1546  H HH11   . ARG A 1 93  ? 30.836  -38.616 71.340  1.00 105.03 ? 93  ARG A HH11   1 
ATOM   1547  H HH12   . ARG A 1 93  ? 31.574  -39.560 72.225  1.00 105.03 ? 93  ARG A HH12   1 
ATOM   1548  H HH21   . ARG A 1 93  ? 33.169  -37.290 74.017  1.00 94.19  ? 93  ARG A HH21   1 
ATOM   1549  H HH22   . ARG A 1 93  ? 32.986  -38.758 73.844  1.00 94.19  ? 93  ARG A HH22   1 
ATOM   1550  N N      . TYR A 1 94  ? 31.314  -30.839 70.596  1.00 99.02  ? 94  TYR A N      1 
ATOM   1551  C CA     . TYR A 1 94  ? 31.665  -29.431 70.730  1.00 96.14  ? 94  TYR A CA     1 
ATOM   1552  C C      . TYR A 1 94  ? 32.479  -29.085 71.962  1.00 90.81  ? 94  TYR A C      1 
ATOM   1553  O O      . TYR A 1 94  ? 32.638  -29.869 72.896  1.00 81.51  ? 94  TYR A O      1 
ATOM   1554  C CB     . TYR A 1 94  ? 30.401  -28.579 70.736  1.00 94.90  ? 94  TYR A CB     1 
ATOM   1555  C CG     . TYR A 1 94  ? 29.709  -28.559 69.408  1.00 96.76  ? 94  TYR A CG     1 
ATOM   1556  C CD1    . TYR A 1 94  ? 28.750  -29.510 69.091  1.00 96.94  ? 94  TYR A CD1    1 
ATOM   1557  C CD2    . TYR A 1 94  ? 30.023  -27.596 68.460  1.00 100.31 ? 94  TYR A CD2    1 
ATOM   1558  C CE1    . TYR A 1 94  ? 28.113  -29.495 67.873  1.00 102.01 ? 94  TYR A CE1    1 
ATOM   1559  C CE2    . TYR A 1 94  ? 29.391  -27.572 67.238  1.00 103.74 ? 94  TYR A CE2    1 
ATOM   1560  C CZ     . TYR A 1 94  ? 28.438  -28.524 66.950  1.00 104.22 ? 94  TYR A CZ     1 
ATOM   1561  O OH     . TYR A 1 94  ? 27.805  -28.509 65.735  1.00 108.30 ? 94  TYR A OH     1 
ATOM   1562  H H      . TYR A 1 94  ? 30.986  -31.189 71.309  1.00 119.22 ? 94  TYR A H      1 
ATOM   1563  H HA     . TYR A 1 94  ? 32.188  -29.171 69.955  1.00 115.76 ? 94  TYR A HA     1 
ATOM   1564  H HB2    . TYR A 1 94  ? 29.781  -28.937 71.392  1.00 114.27 ? 94  TYR A HB2    1 
ATOM   1565  H HB3    . TYR A 1 94  ? 30.636  -27.666 70.966  1.00 114.27 ? 94  TYR A HB3    1 
ATOM   1566  H HD1    . TYR A 1 94  ? 28.529  -30.164 69.715  1.00 116.72 ? 94  TYR A HD1    1 
ATOM   1567  H HD2    . TYR A 1 94  ? 30.664  -26.953 68.657  1.00 120.77 ? 94  TYR A HD2    1 
ATOM   1568  H HE1    . TYR A 1 94  ? 27.469  -30.135 67.673  1.00 122.80 ? 94  TYR A HE1    1 
ATOM   1569  H HE2    . TYR A 1 94  ? 29.607  -26.920 66.611  1.00 124.88 ? 94  TYR A HE2    1 
ATOM   1570  H HH     . TYR A 1 94  ? 28.093  -27.871 65.269  1.00 130.35 ? 94  TYR A HH     1 
ATOM   1571  N N      . ALA A 1 95  ? 33.002  -27.872 71.905  1.00 97.63  ? 95  ALA A N      1 
ATOM   1572  C CA     . ALA A 1 95  ? 33.714  -27.237 72.990  1.00 103.48 ? 95  ALA A CA     1 
ATOM   1573  C C      . ALA A 1 95  ? 33.565  -25.760 72.703  1.00 112.15 ? 95  ALA A C      1 
ATOM   1574  O O      . ALA A 1 95  ? 32.652  -25.367 71.968  1.00 116.86 ? 95  ALA A O      1 
ATOM   1575  C CB     . ALA A 1 95  ? 35.166  -27.661 73.052  1.00 101.68 ? 95  ALA A CB     1 
ATOM   1576  H H      . ALA A 1 95  ? 32.952  -27.374 71.206  1.00 117.54 ? 95  ALA A H      1 
ATOM   1577  H HA     . ALA A 1 95  ? 33.286  -27.441 73.836  1.00 124.57 ? 95  ALA A HA     1 
ATOM   1578  H HB1    . ALA A 1 95  ? 35.596  -27.207 73.794  1.00 122.40 ? 95  ALA A HB1    1 
ATOM   1579  H HB2    . ALA A 1 95  ? 35.209  -28.621 73.181  1.00 122.40 ? 95  ALA A HB2    1 
ATOM   1580  H HB3    . ALA A 1 95  ? 35.601  -27.419 72.219  1.00 122.40 ? 95  ALA A HB3    1 
ATOM   1581  N N      . GLU A 1 96  ? 34.402  -24.942 73.326  1.00 116.40 ? 96  GLU A N      1 
ATOM   1582  C CA     . GLU A 1 96  ? 34.560  -23.566 72.878  1.00 123.49 ? 96  GLU A CA     1 
ATOM   1583  C C      . GLU A 1 96  ? 34.647  -23.616 71.355  1.00 119.63 ? 96  GLU A C      1 
ATOM   1584  O O      . GLU A 1 96  ? 33.834  -22.999 70.665  1.00 120.48 ? 96  GLU A O      1 
ATOM   1585  C CB     . GLU A 1 96  ? 35.794  -22.904 73.495  1.00 127.50 ? 96  GLU A CB     1 
ATOM   1586  C CG     . GLU A 1 96  ? 35.851  -21.391 73.297  1.00 135.66 ? 96  GLU A CG     1 
ATOM   1587  C CD     . GLU A 1 96  ? 34.663  -20.662 73.914  1.00 141.78 ? 96  GLU A CD     1 
ATOM   1588  O OE1    . GLU A 1 96  ? 33.973  -21.252 74.775  1.00 141.45 ? 96  GLU A OE1    1 
ATOM   1589  O OE2    . GLU A 1 96  ? 34.420  -19.496 73.533  1.00 146.02 ? 96  GLU A OE2    1 
ATOM   1590  H H      . GLU A 1 96  ? 34.887  -25.155 74.004  1.00 140.07 ? 96  GLU A H      1 
ATOM   1591  H HA     . GLU A 1 96  ? 33.776  -23.051 73.127  1.00 148.58 ? 96  GLU A HA     1 
ATOM   1592  H HB2    . GLU A 1 96  ? 35.797  -23.078 74.450  1.00 153.39 ? 96  GLU A HB2    1 
ATOM   1593  H HB3    . GLU A 1 96  ? 36.588  -23.286 73.090  1.00 153.39 ? 96  GLU A HB3    1 
ATOM   1594  H HG2    . GLU A 1 96  ? 36.659  -21.049 73.711  1.00 163.18 ? 96  GLU A HG2    1 
ATOM   1595  H HG3    . GLU A 1 96  ? 35.859  -21.198 72.347  1.00 163.18 ? 96  GLU A HG3    1 
ATOM   1596  N N      . HIS A 1 97  ? 35.626  -24.355 70.837  1.00 117.04 ? 97  HIS A N      1 
ATOM   1597  C CA     . HIS A 1 97  ? 35.656  -24.660 69.410  1.00 116.71 ? 97  HIS A CA     1 
ATOM   1598  C C      . HIS A 1 97  ? 35.429  -26.145 69.157  1.00 114.15 ? 97  HIS A C      1 
ATOM   1599  O O      . HIS A 1 97  ? 35.842  -26.985 69.947  1.00 107.51 ? 97  HIS A O      1 
ATOM   1600  C CB     . HIS A 1 97  ? 36.985  -24.236 68.789  1.00 115.66 ? 97  HIS A CB     1 
ATOM   1601  C CG     . HIS A 1 97  ? 37.181  -22.756 68.749  1.00 117.07 ? 97  HIS A CG     1 
ATOM   1602  N ND1    . HIS A 1 97  ? 37.787  -22.056 69.770  1.00 117.52 ? 97  HIS A ND1    1 
ATOM   1603  C CD2    . HIS A 1 97  ? 36.825  -21.839 67.821  1.00 117.69 ? 97  HIS A CD2    1 
ATOM   1604  C CE1    . HIS A 1 97  ? 37.812  -20.771 69.463  1.00 119.05 ? 97  HIS A CE1    1 
ATOM   1605  N NE2    . HIS A 1 97  ? 37.233  -20.613 68.286  1.00 119.41 ? 97  HIS A NE2    1 
ATOM   1606  H H      . HIS A 1 97  ? 36.278  -24.689 71.287  1.00 140.84 ? 97  HIS A H      1 
ATOM   1607  H HA     . HIS A 1 97  ? 34.947  -24.168 68.967  1.00 140.44 ? 97  HIS A HA     1 
ATOM   1608  H HB2    . HIS A 1 97  ? 37.709  -24.618 69.309  1.00 139.18 ? 97  HIS A HB2    1 
ATOM   1609  H HB3    . HIS A 1 97  ? 37.024  -24.566 67.878  1.00 139.18 ? 97  HIS A HB3    1 
ATOM   1610  H HD1    . HIS A 1 97  ? 38.108  -22.402 70.489  1.00 141.41 ? 97  HIS A HD1    1 
ATOM   1611  H HD2    . HIS A 1 97  ? 36.393  -22.007 67.015  1.00 141.62 ? 97  HIS A HD2    1 
ATOM   1612  H HE1    . HIS A 1 97  ? 38.172  -20.093 69.988  1.00 143.25 ? 97  HIS A HE1    1 
ATOM   1613  H HE2    . HIS A 1 97  ? 37.128  -19.863 67.877  1.00 143.68 ? 97  HIS A HE2    1 
ATOM   1614  N N      . PRO A 1 98  ? 34.767  -26.468 68.036  1.00 119.11 ? 98  PRO A N      1 
ATOM   1615  C CA     . PRO A 1 98  ? 34.337  -27.838 67.749  1.00 118.10 ? 98  PRO A CA     1 
ATOM   1616  C C      . PRO A 1 98  ? 35.501  -28.743 67.371  1.00 112.21 ? 98  PRO A C      1 
ATOM   1617  O O      . PRO A 1 98  ? 36.438  -28.281 66.718  1.00 113.32 ? 98  PRO A O      1 
ATOM   1618  C CB     . PRO A 1 98  ? 33.373  -27.658 66.577  1.00 123.26 ? 98  PRO A CB     1 
ATOM   1619  C CG     . PRO A 1 98  ? 33.872  -26.455 65.877  1.00 125.72 ? 98  PRO A CG     1 
ATOM   1620  C CD     . PRO A 1 98  ? 34.415  -25.548 66.938  1.00 124.26 ? 98  PRO A CD     1 
ATOM   1621  H HA     . PRO A 1 98  ? 33.862  -28.213 68.507  1.00 142.11 ? 98  PRO A HA     1 
ATOM   1622  H HB2    . PRO A 1 98  ? 33.411  -28.435 65.998  1.00 148.31 ? 98  PRO A HB2    1 
ATOM   1623  H HB3    . PRO A 1 98  ? 32.473  -27.516 66.909  1.00 148.31 ? 98  PRO A HB3    1 
ATOM   1624  H HG2    . PRO A 1 98  ? 34.572  -26.708 65.256  1.00 151.26 ? 98  PRO A HG2    1 
ATOM   1625  H HG3    . PRO A 1 98  ? 33.139  -26.027 65.407  1.00 151.26 ? 98  PRO A HG3    1 
ATOM   1626  H HD2    . PRO A 1 98  ? 35.206  -25.088 66.617  1.00 149.51 ? 98  PRO A HD2    1 
ATOM   1627  H HD3    . PRO A 1 98  ? 33.733  -24.922 67.228  1.00 149.51 ? 98  PRO A HD3    1 
ATOM   1628  N N      . TYR A 1 99  ? 35.435  -30.009 67.776  1.00 102.17 ? 99  TYR A N      1 
ATOM   1629  C CA     . TYR A 1 99  ? 36.436  -30.992 67.382  1.00 92.68  ? 99  TYR A CA     1 
ATOM   1630  C C      . TYR A 1 99  ? 35.733  -32.238 66.866  1.00 88.73  ? 99  TYR A C      1 
ATOM   1631  O O      . TYR A 1 99  ? 34.507  -32.319 66.913  1.00 89.86  ? 99  TYR A O      1 
ATOM   1632  C CB     . TYR A 1 99  ? 37.342  -31.353 68.559  1.00 88.19  ? 99  TYR A CB     1 
ATOM   1633  C CG     . TYR A 1 99  ? 36.670  -32.177 69.644  1.00 86.12  ? 99  TYR A CG     1 
ATOM   1634  C CD1    . TYR A 1 99  ? 35.853  -31.583 70.601  1.00 84.16  ? 99  TYR A CD1    1 
ATOM   1635  C CD2    . TYR A 1 99  ? 36.866  -33.553 69.712  1.00 86.18  ? 99  TYR A CD2    1 
ATOM   1636  C CE1    . TYR A 1 99  ? 35.246  -32.340 71.589  1.00 82.76  ? 99  TYR A CE1    1 
ATOM   1637  C CE2    . TYR A 1 99  ? 36.264  -34.315 70.695  1.00 85.25  ? 99  TYR A CE2    1 
ATOM   1638  C CZ     . TYR A 1 99  ? 35.456  -33.705 71.631  1.00 83.65  ? 99  TYR A CZ     1 
ATOM   1639  O OH     . TYR A 1 99  ? 34.862  -34.474 72.607  1.00 82.59  ? 99  TYR A OH     1 
ATOM   1640  H H      . TYR A 1 99  ? 34.816  -30.324 68.282  1.00 122.99 ? 99  TYR A H      1 
ATOM   1641  H HA     . TYR A 1 99  ? 36.985  -30.630 66.669  1.00 111.60 ? 99  TYR A HA     1 
ATOM   1642  H HB2    . TYR A 1 99  ? 38.095  -31.865 68.225  1.00 106.22 ? 99  TYR A HB2    1 
ATOM   1643  H HB3    . TYR A 1 99  ? 37.661  -30.533 68.968  1.00 106.22 ? 99  TYR A HB3    1 
ATOM   1644  H HD1    . TYR A 1 99  ? 35.709  -30.665 70.575  1.00 101.38 ? 99  TYR A HD1    1 
ATOM   1645  H HD2    . TYR A 1 99  ? 37.410  -33.968 69.082  1.00 103.80 ? 99  TYR A HD2    1 
ATOM   1646  H HE1    . TYR A 1 99  ? 34.700  -31.931 72.222  1.00 99.70  ? 99  TYR A HE1    1 
ATOM   1647  H HE2    . TYR A 1 99  ? 36.404  -35.234 70.725  1.00 102.70 ? 99  TYR A HE2    1 
ATOM   1648  H HH     . TYR A 1 99  ? 34.399  -33.988 73.112  1.00 99.49  ? 99  TYR A HH     1 
ATOM   1649  N N      . VAL A 1 100 ? 36.512  -33.209 66.394  1.00 85.25  ? 100 VAL A N      1 
ATOM   1650  C CA     . VAL A 1 100 ? 35.965  -34.422 65.782  1.00 85.15  ? 100 VAL A CA     1 
ATOM   1651  C C      . VAL A 1 100 ? 36.295  -35.700 66.572  1.00 84.81  ? 100 VAL A C      1 
ATOM   1652  O O      . VAL A 1 100 ? 37.438  -36.153 66.599  1.00 83.07  ? 100 VAL A O      1 
ATOM   1653  C CB     . VAL A 1 100 ? 36.468  -34.571 64.327  1.00 82.69  ? 100 VAL A CB     1 
ATOM   1654  C CG1    . VAL A 1 100 ? 35.803  -35.761 63.642  1.00 84.42  ? 100 VAL A CG1    1 
ATOM   1655  C CG2    . VAL A 1 100 ? 36.195  -33.294 63.541  1.00 83.70  ? 100 VAL A CG2    1 
ATOM   1656  H H      . VAL A 1 100 ? 37.372  -33.190 66.416  1.00 102.69 ? 100 VAL A H      1 
ATOM   1657  H HA     . VAL A 1 100 ? 34.999  -34.341 65.750  1.00 102.57 ? 100 VAL A HA     1 
ATOM   1658  H HB     . VAL A 1 100 ? 37.426  -34.723 64.335  1.00 99.62  ? 100 VAL A HB     1 
ATOM   1659  H HG11   . VAL A 1 100 ? 36.137  -35.829 62.734  1.00 101.70 ? 100 VAL A HG11   1 
ATOM   1660  H HG12   . VAL A 1 100 ? 36.017  -36.569 64.135  1.00 101.70 ? 100 VAL A HG12   1 
ATOM   1661  H HG13   . VAL A 1 100 ? 34.843  -35.623 63.632  1.00 101.70 ? 100 VAL A HG13   1 
ATOM   1662  H HG21   . VAL A 1 100 ? 36.518  -33.408 62.633  1.00 100.83 ? 100 VAL A HG21   1 
ATOM   1663  H HG22   . VAL A 1 100 ? 35.240  -33.126 63.534  1.00 100.83 ? 100 VAL A HG22   1 
ATOM   1664  H HG23   . VAL A 1 100 ? 36.658  -32.556 63.967  1.00 100.83 ? 100 VAL A HG23   1 
ATOM   1665  N N      . HIS A 1 101 ? 35.277  -36.271 67.208  1.00 86.95  ? 101 HIS A N      1 
ATOM   1666  C CA     . HIS A 1 101 ? 35.385  -37.564 67.876  1.00 86.99  ? 101 HIS A CA     1 
ATOM   1667  C C      . HIS A 1 101 ? 35.234  -38.662 66.830  1.00 86.83  ? 101 HIS A C      1 
ATOM   1668  O O      . HIS A 1 101 ? 34.669  -38.421 65.764  1.00 95.52  ? 101 HIS A O      1 
ATOM   1669  C CB     . HIS A 1 101 ? 34.302  -37.690 68.949  1.00 93.22  ? 101 HIS A CB     1 
ATOM   1670  C CG     . HIS A 1 101 ? 34.511  -38.819 69.909  1.00 95.92  ? 101 HIS A CG     1 
ATOM   1671  N ND1    . HIS A 1 101 ? 35.536  -38.835 70.830  1.00 93.30  ? 101 HIS A ND1    1 
ATOM   1672  C CD2    . HIS A 1 101 ? 33.819  -39.968 70.096  1.00 99.34  ? 101 HIS A CD2    1 
ATOM   1673  C CE1    . HIS A 1 101 ? 35.465  -39.943 71.546  1.00 93.57  ? 101 HIS A CE1    1 
ATOM   1674  N NE2    . HIS A 1 101 ? 34.434  -40.649 71.117  1.00 97.28  ? 101 HIS A NE2    1 
ATOM   1675  H H      . HIS A 1 101 ? 34.494  -35.920 67.267  1.00 104.73 ? 101 HIS A H      1 
ATOM   1676  H HA     . HIS A 1 101 ? 36.255  -37.647 68.296  1.00 104.78 ? 101 HIS A HA     1 
ATOM   1677  H HB2    . HIS A 1 101 ? 34.277  -36.867 69.463  1.00 112.25 ? 101 HIS A HB2    1 
ATOM   1678  H HB3    . HIS A 1 101 ? 33.447  -37.829 68.513  1.00 112.25 ? 101 HIS A HB3    1 
ATOM   1679  H HD1    . HIS A 1 101 ? 36.126  -38.217 70.928  1.00 112.35 ? 101 HIS A HD1    1 
ATOM   1680  H HD2    . HIS A 1 101 ? 33.067  -40.243 69.622  1.00 119.60 ? 101 HIS A HD2    1 
ATOM   1681  H HE1    . HIS A 1 101 ? 36.047  -40.188 72.228  1.00 112.68 ? 101 HIS A HE1    1 
ATOM   1682  H HE2    . HIS A 1 101 ? 34.187  -41.412 71.428  1.00 117.13 ? 101 HIS A HE2    1 
ATOM   1683  N N      . GLY A 1 102 ? 35.714  -39.868 67.121  1.00 79.14  ? 102 GLY A N      1 
ATOM   1684  C CA     . GLY A 1 102 ? 35.536  -40.967 66.185  1.00 77.74  ? 102 GLY A CA     1 
ATOM   1685  C C      . GLY A 1 102 ? 36.288  -42.257 66.478  1.00 73.33  ? 102 GLY A C      1 
ATOM   1686  O O      . GLY A 1 102 ? 36.644  -42.544 67.624  1.00 71.83  ? 102 GLY A O      1 
ATOM   1687  H H      . GLY A 1 102 ? 36.138  -40.072 67.840  1.00 95.35  ? 102 GLY A H      1 
ATOM   1688  H HA2    . GLY A 1 102 ? 34.592  -41.184 66.142  1.00 93.68  ? 102 GLY A HA2    1 
ATOM   1689  H HA3    . GLY A 1 102 ? 35.808  -40.667 65.303  1.00 93.68  ? 102 GLY A HA3    1 
ATOM   1690  N N      . VAL A 1 103 ? 36.497  -43.049 65.427  1.00 71.61  ? 103 VAL A N      1 
ATOM   1691  C CA     . VAL A 1 103 ? 37.152  -44.352 65.535  1.00 69.71  ? 103 VAL A CA     1 
ATOM   1692  C C      . VAL A 1 103 ? 38.092  -44.631 64.366  1.00 72.97  ? 103 VAL A C      1 
ATOM   1693  O O      . VAL A 1 103 ? 37.822  -44.238 63.233  1.00 74.57  ? 103 VAL A O      1 
ATOM   1694  C CB     . VAL A 1 103 ? 36.108  -45.494 65.596  1.00 69.65  ? 103 VAL A CB     1 
ATOM   1695  C CG1    . VAL A 1 103 ? 36.786  -46.855 65.699  1.00 68.75  ? 103 VAL A CG1    1 
ATOM   1696  C CG2    . VAL A 1 103 ? 35.152  -45.285 66.758  1.00 69.20  ? 103 VAL A CG2    1 
ATOM   1697  H H      . VAL A 1 103 ? 36.264  -42.849 64.623  1.00 86.32  ? 103 VAL A H      1 
ATOM   1698  H HA     . VAL A 1 103 ? 37.673  -44.377 66.353  1.00 84.05  ? 103 VAL A HA     1 
ATOM   1699  H HB     . VAL A 1 103 ? 35.586  -45.483 64.778  1.00 83.97  ? 103 VAL A HB     1 
ATOM   1700  H HG11   . VAL A 1 103 ? 36.105  -47.545 65.734  1.00 82.89  ? 103 VAL A HG11   1 
ATOM   1701  H HG12   . VAL A 1 103 ? 37.350  -46.987 64.920  1.00 82.89  ? 103 VAL A HG12   1 
ATOM   1702  H HG13   . VAL A 1 103 ? 37.324  -46.879 66.505  1.00 82.89  ? 103 VAL A HG13   1 
ATOM   1703  H HG21   . VAL A 1 103 ? 34.510  -46.012 66.773  1.00 83.44  ? 103 VAL A HG21   1 
ATOM   1704  H HG22   . VAL A 1 103 ? 35.659  -45.273 67.585  1.00 83.44  ? 103 VAL A HG22   1 
ATOM   1705  H HG23   . VAL A 1 103 ? 34.692  -44.439 66.640  1.00 83.44  ? 103 VAL A HG23   1 
ATOM   1706  N N      . VAL A 1 104 ? 39.219  -45.268 64.659  1.00 78.34  ? 104 VAL A N      1 
ATOM   1707  C CA     . VAL A 1 104 ? 40.101  -45.758 63.615  1.00 83.81  ? 104 VAL A CA     1 
ATOM   1708  C C      . VAL A 1 104 ? 40.569  -47.157 63.989  1.00 85.96  ? 104 VAL A C      1 
ATOM   1709  O O      . VAL A 1 104 ? 41.293  -47.332 64.962  1.00 86.01  ? 104 VAL A O      1 
ATOM   1710  C CB     . VAL A 1 104 ? 41.281  -44.804 63.409  1.00 84.10  ? 104 VAL A CB     1 
ATOM   1711  C CG1    . VAL A 1 104 ? 42.297  -45.388 62.444  1.00 86.36  ? 104 VAL A CG1    1 
ATOM   1712  C CG2    . VAL A 1 104 ? 40.757  -43.471 62.901  1.00 85.93  ? 104 VAL A CG2    1 
ATOM   1713  H H      . VAL A 1 104 ? 39.495  -45.429 65.458  1.00 94.40  ? 104 VAL A H      1 
ATOM   1714  H HA     . VAL A 1 104 ? 39.608  -45.815 62.782  1.00 100.97 ? 104 VAL A HA     1 
ATOM   1715  H HB     . VAL A 1 104 ? 41.722  -44.653 64.260  1.00 101.32 ? 104 VAL A HB     1 
ATOM   1716  H HG11   . VAL A 1 104 ? 43.028  -44.759 62.338  1.00 104.03 ? 104 VAL A HG11   1 
ATOM   1717  H HG12   . VAL A 1 104 ? 42.629  -46.225 62.805  1.00 104.03 ? 104 VAL A HG12   1 
ATOM   1718  H HG13   . VAL A 1 104 ? 41.866  -45.543 61.589  1.00 104.03 ? 104 VAL A HG13   1 
ATOM   1719  H HG21   . VAL A 1 104 ? 41.505  -42.867 62.771  1.00 103.51 ? 104 VAL A HG21   1 
ATOM   1720  H HG22   . VAL A 1 104 ? 40.296  -43.614 62.060  1.00 103.51 ? 104 VAL A HG22   1 
ATOM   1721  H HG23   . VAL A 1 104 ? 40.144  -43.103 63.556  1.00 103.51 ? 104 VAL A HG23   1 
ATOM   1722  N N      . LYS A 1 105 ? 40.177  -48.137 63.177  1.00 79.22  ? 105 LYS A N      1 
ATOM   1723  C CA     . LYS A 1 105 ? 40.495  -49.539 63.423  1.00 75.93  ? 105 LYS A CA     1 
ATOM   1724  C C      . LYS A 1 105 ? 40.216  -49.923 64.869  1.00 75.25  ? 105 LYS A C      1 
ATOM   1725  O O      . LYS A 1 105 ? 41.088  -50.442 65.566  1.00 73.35  ? 105 LYS A O      1 
ATOM   1726  C CB     . LYS A 1 105 ? 41.942  -49.857 63.050  1.00 74.21  ? 105 LYS A CB     1 
ATOM   1727  C CG     . LYS A 1 105 ? 42.244  -49.622 61.581  1.00 78.43  ? 105 LYS A CG     1 
ATOM   1728  C CD     . LYS A 1 105 ? 43.662  -50.045 61.195  1.00 79.38  ? 105 LYS A CD     1 
ATOM   1729  C CE     . LYS A 1 105 ? 43.832  -51.562 61.207  1.00 80.23  ? 105 LYS A CE     1 
ATOM   1730  N NZ     . LYS A 1 105 ? 45.156  -51.993 60.674  1.00 81.04  ? 105 LYS A NZ     1 
ATOM   1731  H H      . LYS A 1 105 ? 39.716  -48.010 62.463  1.00 95.45  ? 105 LYS A H      1 
ATOM   1732  H HA     . LYS A 1 105 ? 39.923  -50.085 62.861  1.00 91.51  ? 105 LYS A HA     1 
ATOM   1733  H HB2    . LYS A 1 105 ? 42.533  -49.291 63.571  1.00 89.44  ? 105 LYS A HB2    1 
ATOM   1734  H HB3    . LYS A 1 105 ? 42.119  -50.790 63.246  1.00 89.44  ? 105 LYS A HB3    1 
ATOM   1735  H HG2    . LYS A 1 105 ? 41.621  -50.136 61.043  1.00 94.51  ? 105 LYS A HG2    1 
ATOM   1736  H HG3    . LYS A 1 105 ? 42.150  -48.676 61.386  1.00 94.51  ? 105 LYS A HG3    1 
ATOM   1737  H HD2    . LYS A 1 105 ? 43.857  -49.726 60.300  1.00 95.65  ? 105 LYS A HD2    1 
ATOM   1738  H HD3    . LYS A 1 105 ? 44.291  -49.666 61.829  1.00 95.65  ? 105 LYS A HD3    1 
ATOM   1739  H HE2    . LYS A 1 105 ? 43.756  -51.882 62.120  1.00 96.66  ? 105 LYS A HE2    1 
ATOM   1740  H HE3    . LYS A 1 105 ? 43.141  -51.962 60.656  1.00 96.66  ? 105 LYS A HE3    1 
ATOM   1741  H HZ1    . LYS A 1 105 ? 45.219  -52.880 60.697  1.00 97.64  ? 105 LYS A HZ1    1 
ATOM   1742  H HZ2    . LYS A 1 105 ? 45.250  -51.717 59.833  1.00 97.64  ? 105 LYS A HZ2    1 
ATOM   1743  H HZ3    . LYS A 1 105 ? 45.810  -51.644 61.167  1.00 97.64  ? 105 LYS A HZ3    1 
ATOM   1744  N N      . GLY A 1 106 ? 39.013  -49.617 65.335  1.00 80.53  ? 106 GLY A N      1 
ATOM   1745  C CA     . GLY A 1 106 ? 38.579  -50.098 66.632  1.00 84.37  ? 106 GLY A CA     1 
ATOM   1746  C C      . GLY A 1 106 ? 38.907  -49.175 67.787  1.00 85.89  ? 106 GLY A C      1 
ATOM   1747  O O      . GLY A 1 106 ? 38.280  -49.261 68.844  1.00 86.75  ? 106 GLY A O      1 
ATOM   1748  H H      . GLY A 1 106 ? 38.433  -49.135 64.921  1.00 97.03  ? 106 GLY A H      1 
ATOM   1749  H HA2    . GLY A 1 106 ? 37.618  -50.229 66.615  1.00 101.64 ? 106 GLY A HA2    1 
ATOM   1750  H HA3    . GLY A 1 106 ? 38.997  -50.956 66.806  1.00 101.64 ? 106 GLY A HA3    1 
ATOM   1751  N N      . VAL A 1 107 ? 39.886  -48.297 67.595  1.00 84.55  ? 107 VAL A N      1 
ATOM   1752  C CA     . VAL A 1 107 ? 40.338  -47.421 68.671  1.00 82.06  ? 107 VAL A CA     1 
ATOM   1753  C C      . VAL A 1 107 ? 39.735  -46.035 68.551  1.00 87.23  ? 107 VAL A C      1 
ATOM   1754  O O      . VAL A 1 107 ? 39.625  -45.487 67.457  1.00 88.51  ? 107 VAL A O      1 
ATOM   1755  C CB     . VAL A 1 107 ? 41.855  -47.283 68.684  1.00 75.54  ? 107 VAL A CB     1 
ATOM   1756  C CG1    . VAL A 1 107 ? 42.305  -46.511 69.921  1.00 72.60  ? 107 VAL A CG1    1 
ATOM   1757  C CG2    . VAL A 1 107 ? 42.498  -48.649 68.642  1.00 75.79  ? 107 VAL A CG2    1 
ATOM   1758  H H      . VAL A 1 107 ? 40.305  -48.188 66.852  1.00 101.85 ? 107 VAL A H      1 
ATOM   1759  H HA     . VAL A 1 107 ? 40.063  -47.796 69.522  1.00 98.87  ? 107 VAL A HA     1 
ATOM   1760  H HB     . VAL A 1 107 ? 42.138  -46.789 67.898  1.00 91.03  ? 107 VAL A HB     1 
ATOM   1761  H HG11   . VAL A 1 107 ? 43.271  -46.434 69.910  1.00 87.51  ? 107 VAL A HG11   1 
ATOM   1762  H HG12   . VAL A 1 107 ? 41.902  -45.629 69.905  1.00 87.51  ? 107 VAL A HG12   1 
ATOM   1763  H HG13   . VAL A 1 107 ? 42.019  -46.992 70.713  1.00 87.51  ? 107 VAL A HG13   1 
ATOM   1764  H HG21   . VAL A 1 107 ? 43.463  -48.545 68.650  1.00 91.34  ? 107 VAL A HG21   1 
ATOM   1765  H HG22   . VAL A 1 107 ? 42.213  -49.156 69.418  1.00 91.34  ? 107 VAL A HG22   1 
ATOM   1766  H HG23   . VAL A 1 107 ? 42.222  -49.103 67.830  1.00 91.34  ? 107 VAL A HG23   1 
ATOM   1767  N N      . GLU A 1 108 ? 39.372  -45.466 69.694  1.00 90.99  ? 108 GLU A N      1 
ATOM   1768  C CA     . GLU A 1 108 ? 38.768  -44.149 69.728  1.00 95.72  ? 108 GLU A CA     1 
ATOM   1769  C C      . GLU A 1 108 ? 39.802  -43.096 69.378  1.00 88.06  ? 108 GLU A C      1 
ATOM   1770  O O      . GLU A 1 108 ? 40.980  -43.238 69.700  1.00 89.10  ? 108 GLU A O      1 
ATOM   1771  C CB     . GLU A 1 108 ? 38.185  -43.872 71.113  1.00 103.70 ? 108 GLU A CB     1 
ATOM   1772  C CG     . GLU A 1 108 ? 36.985  -44.735 71.461  1.00 110.34 ? 108 GLU A CG     1 
ATOM   1773  C CD     . GLU A 1 108 ? 36.267  -44.268 72.716  1.00 111.69 ? 108 GLU A CD     1 
ATOM   1774  O OE1    . GLU A 1 108 ? 36.942  -43.745 73.630  1.00 109.62 ? 108 GLU A OE1    1 
ATOM   1775  O OE2    . GLU A 1 108 ? 35.031  -44.441 72.793  1.00 113.90 ? 108 GLU A OE2    1 
ATOM   1776  H H      . GLU A 1 108 ? 39.467  -45.829 70.468  1.00 109.58 ? 108 GLU A H      1 
ATOM   1777  H HA     . GLU A 1 108 ? 38.050  -44.105 69.078  1.00 115.26 ? 108 GLU A HA     1 
ATOM   1778  H HB2    . GLU A 1 108 ? 38.871  -44.036 71.779  1.00 124.83 ? 108 GLU A HB2    1 
ATOM   1779  H HB3    . GLU A 1 108 ? 37.904  -42.944 71.153  1.00 124.83 ? 108 GLU A HB3    1 
ATOM   1780  H HG2    . GLU A 1 108 ? 36.352  -44.707 70.726  1.00 132.79 ? 108 GLU A HG2    1 
ATOM   1781  H HG3    . GLU A 1 108 ? 37.283  -45.647 71.607  1.00 132.79 ? 108 GLU A HG3    1 
ATOM   1782  N N      . VAL A 1 109 ? 39.347  -42.031 68.728  1.00 79.27  ? 109 VAL A N      1 
ATOM   1783  C CA     . VAL A 1 109 ? 40.242  -40.992 68.248  1.00 70.38  ? 109 VAL A CA     1 
ATOM   1784  C C      . VAL A 1 109 ? 39.588  -39.616 68.396  1.00 71.09  ? 109 VAL A C      1 
ATOM   1785  O O      . VAL A 1 109 ? 38.441  -39.423 67.986  1.00 73.85  ? 109 VAL A O      1 
ATOM   1786  C CB     . VAL A 1 109 ? 40.618  -41.234 66.764  1.00 67.78  ? 109 VAL A CB     1 
ATOM   1787  C CG1    . VAL A 1 109 ? 41.406  -40.057 66.194  1.00 67.01  ? 109 VAL A CG1    1 
ATOM   1788  C CG2    . VAL A 1 109 ? 41.406  -42.535 66.608  1.00 67.01  ? 109 VAL A CG2    1 
ATOM   1789  H H      . VAL A 1 109 ? 38.518  -41.887 68.553  1.00 95.51  ? 109 VAL A H      1 
ATOM   1790  H HA     . VAL A 1 109 ? 41.057  -41.001 68.774  1.00 84.85  ? 109 VAL A HA     1 
ATOM   1791  H HB     . VAL A 1 109 ? 39.802  -41.320 66.247  1.00 81.73  ? 109 VAL A HB     1 
ATOM   1792  H HG11   . VAL A 1 109 ? 41.623  -40.243 65.267  1.00 80.80  ? 109 VAL A HG11   1 
ATOM   1793  H HG12   . VAL A 1 109 ? 40.863  -39.256 66.252  1.00 80.80  ? 109 VAL A HG12   1 
ATOM   1794  H HG13   . VAL A 1 109 ? 42.220  -39.944 66.708  1.00 80.80  ? 109 VAL A HG13   1 
ATOM   1795  H HG21   . VAL A 1 109 ? 41.627  -42.660 65.671  1.00 80.80  ? 109 VAL A HG21   1 
ATOM   1796  H HG22   . VAL A 1 109 ? 42.219  -42.477 67.135  1.00 80.80  ? 109 VAL A HG22   1 
ATOM   1797  H HG23   . VAL A 1 109 ? 40.861  -43.274 66.921  1.00 80.80  ? 109 VAL A HG23   1 
ATOM   1798  N N      . ASP A 1 110 ? 40.342  -38.663 68.945  1.00 69.57  ? 110 ASP A N      1 
ATOM   1799  C CA     . ASP A 1 110 ? 39.923  -37.265 69.035  1.00 68.77  ? 110 ASP A CA     1 
ATOM   1800  C C      . ASP A 1 110 ? 40.881  -36.438 68.196  1.00 69.21  ? 110 ASP A C      1 
ATOM   1801  O O      . ASP A 1 110 ? 42.096  -36.527 68.372  1.00 71.31  ? 110 ASP A O      1 
ATOM   1802  C CB     . ASP A 1 110 ? 39.928  -36.751 70.480  1.00 71.17  ? 110 ASP A CB     1 
ATOM   1803  C CG     . ASP A 1 110 ? 38.939  -37.474 71.380  1.00 75.16  ? 110 ASP A CG     1 
ATOM   1804  O OD1    . ASP A 1 110 ? 37.868  -37.872 70.885  1.00 78.93  ? 110 ASP A OD1    1 
ATOM   1805  O OD2    . ASP A 1 110 ? 39.220  -37.618 72.593  1.00 73.45  ? 110 ASP A OD2    1 
ATOM   1806  H H      . ASP A 1 110 ? 41.121  -38.807 69.280  1.00 83.87  ? 110 ASP A H      1 
ATOM   1807  H HA     . ASP A 1 110 ? 39.029  -37.168 68.674  1.00 82.91  ? 110 ASP A HA     1 
ATOM   1808  H HB2    . ASP A 1 110 ? 40.815  -36.873 70.853  1.00 85.79  ? 110 ASP A HB2    1 
ATOM   1809  H HB3    . ASP A 1 110 ? 39.697  -35.809 70.478  1.00 85.79  ? 110 ASP A HB3    1 
ATOM   1810  N N      . VAL A 1 111 ? 40.336  -35.635 67.289  1.00 64.58  ? 111 VAL A N      1 
ATOM   1811  C CA     . VAL A 1 111 ? 41.150  -34.751 66.461  1.00 64.75  ? 111 VAL A CA     1 
ATOM   1812  C C      . VAL A 1 111 ? 40.747  -33.299 66.706  1.00 64.31  ? 111 VAL A C      1 
ATOM   1813  O O      . VAL A 1 111 ? 39.648  -32.875 66.347  1.00 63.97  ? 111 VAL A O      1 
ATOM   1814  C CB     . VAL A 1 111 ? 41.024  -35.107 64.963  1.00 66.26  ? 111 VAL A CB     1 
ATOM   1815  C CG1    . VAL A 1 111 ? 41.848  -34.164 64.107  1.00 67.34  ? 111 VAL A CG1    1 
ATOM   1816  C CG2    . VAL A 1 111 ? 41.461  -36.542 64.727  1.00 63.12  ? 111 VAL A CG2    1 
ATOM   1817  H H      . VAL A 1 111 ? 39.492  -35.582 67.132  1.00 77.89  ? 111 VAL A H      1 
ATOM   1818  H HA     . VAL A 1 111 ? 42.081  -34.851 66.715  1.00 78.10  ? 111 VAL A HA     1 
ATOM   1819  H HB     . VAL A 1 111 ? 40.095  -35.026 64.694  1.00 79.90  ? 111 VAL A HB     1 
ATOM   1820  H HG11   . VAL A 1 111 ? 41.748  -34.414 63.176  1.00 81.19  ? 111 VAL A HG11   1 
ATOM   1821  H HG12   . VAL A 1 111 ? 41.532  -33.257 64.243  1.00 81.19  ? 111 VAL A HG12   1 
ATOM   1822  H HG13   . VAL A 1 111 ? 42.780  -34.233 64.370  1.00 81.19  ? 111 VAL A HG13   1 
ATOM   1823  H HG21   . VAL A 1 111 ? 41.374  -36.747 63.783  1.00 76.14  ? 111 VAL A HG21   1 
ATOM   1824  H HG22   . VAL A 1 111 ? 42.385  -36.640 65.004  1.00 76.14  ? 111 VAL A HG22   1 
ATOM   1825  H HG23   . VAL A 1 111 ? 40.894  -37.134 65.247  1.00 76.14  ? 111 VAL A HG23   1 
ATOM   1826  N N      . VAL A 1 112 ? 41.661  -32.550 67.319  1.00 66.21  ? 112 VAL A N      1 
ATOM   1827  C CA     . VAL A 1 112 ? 41.416  -31.175 67.748  1.00 68.08  ? 112 VAL A CA     1 
ATOM   1828  C C      . VAL A 1 112 ? 42.321  -30.170 67.022  1.00 74.01  ? 112 VAL A C      1 
ATOM   1829  O O      . VAL A 1 112 ? 43.535  -30.201 67.205  1.00 77.32  ? 112 VAL A O      1 
ATOM   1830  C CB     . VAL A 1 112 ? 41.641  -31.038 69.260  1.00 62.10  ? 112 VAL A CB     1 
ATOM   1831  C CG1    . VAL A 1 112 ? 41.153  -29.690 69.743  1.00 63.51  ? 112 VAL A CG1    1 
ATOM   1832  C CG2    . VAL A 1 112 ? 40.943  -32.170 70.013  1.00 60.66  ? 112 VAL A CG2    1 
ATOM   1833  H H      . VAL A 1 112 ? 42.455  -32.826 67.503  1.00 79.84  ? 112 VAL A H      1 
ATOM   1834  H HA     . VAL A 1 112 ? 40.494  -30.943 67.557  1.00 82.08  ? 112 VAL A HA     1 
ATOM   1835  H HB     . VAL A 1 112 ? 42.591  -31.097 69.445  1.00 74.91  ? 112 VAL A HB     1 
ATOM   1836  H HG11   . VAL A 1 112 ? 41.304  -29.624 70.699  1.00 76.61  ? 112 VAL A HG11   1 
ATOM   1837  H HG12   . VAL A 1 112 ? 41.645  -28.993 69.281  1.00 76.61  ? 112 VAL A HG12   1 
ATOM   1838  H HG13   . VAL A 1 112 ? 40.206  -29.610 69.551  1.00 76.61  ? 112 VAL A HG13   1 
ATOM   1839  H HG21   . VAL A 1 112 ? 41.100  -32.060 70.964  1.00 73.18  ? 112 VAL A HG21   1 
ATOM   1840  H HG22   . VAL A 1 112 ? 39.991  -32.132 69.828  1.00 73.18  ? 112 VAL A HG22   1 
ATOM   1841  H HG23   . VAL A 1 112 ? 41.305  -33.019 69.713  1.00 73.18  ? 112 VAL A HG23   1 
ATOM   1842  N N      . PRO A 1 113 ? 41.742  -29.257 66.218  1.00 76.84  ? 113 PRO A N      1 
ATOM   1843  C CA     . PRO A 1 113 ? 42.583  -28.242 65.565  1.00 78.79  ? 113 PRO A CA     1 
ATOM   1844  C C      . PRO A 1 113 ? 43.120  -27.184 66.533  1.00 85.41  ? 113 PRO A C      1 
ATOM   1845  O O      . PRO A 1 113 ? 42.457  -26.886 67.527  1.00 81.52  ? 113 PRO A O      1 
ATOM   1846  C CB     . PRO A 1 113 ? 41.632  -27.611 64.538  1.00 78.06  ? 113 PRO A CB     1 
ATOM   1847  C CG     . PRO A 1 113 ? 40.287  -27.816 65.094  1.00 78.03  ? 113 PRO A CG     1 
ATOM   1848  C CD     . PRO A 1 113 ? 40.330  -29.135 65.810  1.00 77.39  ? 113 PRO A CD     1 
ATOM   1849  H HA     . PRO A 1 113 ? 43.324  -28.663 65.102  1.00 94.94  ? 113 PRO A HA     1 
ATOM   1850  H HB2    . PRO A 1 113 ? 41.827  -26.665 64.450  1.00 94.07  ? 113 PRO A HB2    1 
ATOM   1851  H HB3    . PRO A 1 113 ? 41.724  -28.063 63.685  1.00 94.07  ? 113 PRO A HB3    1 
ATOM   1852  H HG2    . PRO A 1 113 ? 40.080  -27.099 65.715  1.00 94.02  ? 113 PRO A HG2    1 
ATOM   1853  H HG3    . PRO A 1 113 ? 39.638  -27.841 64.374  1.00 94.02  ? 113 PRO A HG3    1 
ATOM   1854  H HD2    . PRO A 1 113 ? 39.753  -29.116 66.589  1.00 93.25  ? 113 PRO A HD2    1 
ATOM   1855  H HD3    . PRO A 1 113 ? 40.089  -29.855 65.206  1.00 93.25  ? 113 PRO A HD3    1 
ATOM   1856  N N      . CYS A 1 114 ? 44.312  -26.651 66.261  1.00 95.21  ? 114 CYS A N      1 
ATOM   1857  C CA     . CYS A 1 114 ? 44.863  -25.560 67.068  1.00 103.57 ? 114 CYS A CA     1 
ATOM   1858  C C      . CYS A 1 114 ? 46.012  -24.829 66.370  1.00 106.67 ? 114 CYS A C      1 
ATOM   1859  O O      . CYS A 1 114 ? 46.424  -25.209 65.274  1.00 108.36 ? 114 CYS A O      1 
ATOM   1860  C CB     . CYS A 1 114 ? 45.356  -26.099 68.409  1.00 102.82 ? 114 CYS A CB     1 
ATOM   1861  S SG     . CYS A 1 114 ? 46.871  -27.069 68.268  1.00 98.70  ? 114 CYS A SG     1 
ATOM   1862  H H      . CYS A 1 114 ? 44.822  -26.903 65.616  1.00 114.64 ? 114 CYS A H      1 
ATOM   1863  H HA     . CYS A 1 114 ? 44.161  -24.914 67.244  1.00 124.67 ? 114 CYS A HA     1 
ATOM   1864  H HB2    . CYS A 1 114 ? 45.533  -25.352 69.002  1.00 123.77 ? 114 CYS A HB2    1 
ATOM   1865  H HB3    . CYS A 1 114 ? 44.670  -26.669 68.790  1.00 123.77 ? 114 CYS A HB3    1 
ATOM   1866  H HG     . CYS A 1 114 ? 46.669  -28.006 67.546  1.00 118.83 ? 114 CYS A HG     1 
ATOM   1867  N N      . TYR A 1 115 ? 46.520  -23.778 67.020  1.00 105.65 ? 115 TYR A N      1 
ATOM   1868  C CA     . TYR A 1 115 ? 47.612  -22.956 66.478  1.00 103.29 ? 115 TYR A CA     1 
ATOM   1869  C C      . TYR A 1 115 ? 49.018  -23.520 66.692  1.00 93.08  ? 115 TYR A C      1 
ATOM   1870  O O      . TYR A 1 115 ? 49.270  -24.236 67.662  1.00 90.32  ? 115 TYR A O      1 
ATOM   1871  C CB     . TYR A 1 115 ? 47.549  -21.546 67.076  1.00 108.34 ? 115 TYR A CB     1 
ATOM   1872  C CG     . TYR A 1 115 ? 46.393  -20.730 66.556  1.00 112.35 ? 115 TYR A CG     1 
ATOM   1873  C CD1    . TYR A 1 115 ? 46.454  -20.147 65.299  1.00 114.32 ? 115 TYR A CD1    1 
ATOM   1874  C CD2    . TYR A 1 115 ? 45.244  -20.549 67.309  1.00 113.18 ? 115 TYR A CD2    1 
ATOM   1875  C CE1    . TYR A 1 115 ? 45.410  -19.406 64.806  1.00 116.66 ? 115 TYR A CE1    1 
ATOM   1876  C CE2    . TYR A 1 115 ? 44.189  -19.806 66.822  1.00 115.97 ? 115 TYR A CE2    1 
ATOM   1877  C CZ     . TYR A 1 115 ? 44.280  -19.238 65.567  1.00 117.21 ? 115 TYR A CZ     1 
ATOM   1878  O OH     . TYR A 1 115 ? 43.237  -18.496 65.068  1.00 119.46 ? 115 TYR A OH     1 
ATOM   1879  H H      . TYR A 1 115 ? 46.244  -23.516 67.791  1.00 127.17 ? 115 TYR A H      1 
ATOM   1880  H HA     . TYR A 1 115 ? 47.479  -22.870 65.521  1.00 124.34 ? 115 TYR A HA     1 
ATOM   1881  H HB2    . TYR A 1 115 ? 47.455  -21.617 68.039  1.00 130.40 ? 115 TYR A HB2    1 
ATOM   1882  H HB3    . TYR A 1 115 ? 48.369  -21.076 66.858  1.00 130.40 ? 115 TYR A HB3    1 
ATOM   1883  H HD1    . TYR A 1 115 ? 47.217  -20.261 64.781  1.00 137.58 ? 115 TYR A HD1    1 
ATOM   1884  H HD2    . TYR A 1 115 ? 45.183  -20.934 68.153  1.00 136.20 ? 115 TYR A HD2    1 
ATOM   1885  H HE1    . TYR A 1 115 ? 45.467  -19.021 63.961  1.00 140.39 ? 115 TYR A HE1    1 
ATOM   1886  H HE2    . TYR A 1 115 ? 43.422  -19.690 67.334  1.00 139.55 ? 115 TYR A HE2    1 
ATOM   1887  H HH     . TYR A 1 115 ? 43.427  -18.212 64.301  1.00 143.74 ? 115 TYR A HH     1 
ATOM   1888  N N      . LYS A 1 116 ? 49.934  -23.170 65.786  1.00 84.36  ? 116 LYS A N      1 
ATOM   1889  C CA     . LYS A 1 116 ? 51.351  -23.473 65.975  1.00 78.02  ? 116 LYS A CA     1 
ATOM   1890  C C      . LYS A 1 116 ? 51.973  -22.272 66.666  1.00 77.39  ? 116 LYS A C      1 
ATOM   1891  O O      . LYS A 1 116 ? 52.147  -21.211 66.057  1.00 79.00  ? 116 LYS A O      1 
ATOM   1892  C CB     . LYS A 1 116 ? 52.050  -23.753 64.633  1.00 77.75  ? 116 LYS A CB     1 
ATOM   1893  C CG     . LYS A 1 116 ? 53.498  -24.248 64.754  1.00 77.32  ? 116 LYS A CG     1 
ATOM   1894  C CD     . LYS A 1 116 ? 54.145  -24.583 63.390  1.00 81.20  ? 116 LYS A CD     1 
ATOM   1895  C CE     . LYS A 1 116 ? 54.365  -23.349 62.515  1.00 82.16  ? 116 LYS A CE     1 
ATOM   1896  N NZ     . LYS A 1 116 ? 54.962  -23.685 61.187  1.00 82.45  ? 116 LYS A NZ     1 
ATOM   1897  H H      . LYS A 1 116 ? 49.759  -22.755 65.053  1.00 101.63 ? 116 LYS A H      1 
ATOM   1898  H HA     . LYS A 1 116 ? 51.448  -24.250 66.547  1.00 94.02  ? 116 LYS A HA     1 
ATOM   1899  H HB2    . LYS A 1 116 ? 51.547  -24.433 64.158  1.00 93.69  ? 116 LYS A HB2    1 
ATOM   1900  H HB3    . LYS A 1 116 ? 52.062  -22.934 64.113  1.00 93.69  ? 116 LYS A HB3    1 
ATOM   1901  H HG2    . LYS A 1 116 ? 54.033  -23.557 65.176  1.00 93.18  ? 116 LYS A HG2    1 
ATOM   1902  H HG3    . LYS A 1 116 ? 53.512  -25.053 65.296  1.00 93.18  ? 116 LYS A HG3    1 
ATOM   1903  H HD2    . LYS A 1 116 ? 55.007  -24.999 63.543  1.00 97.83  ? 116 LYS A HD2    1 
ATOM   1904  H HD3    . LYS A 1 116 ? 53.564  -25.192 62.907  1.00 97.83  ? 116 LYS A HD3    1 
ATOM   1905  H HE2    . LYS A 1 116 ? 53.512  -22.915 62.359  1.00 98.98  ? 116 LYS A HE2    1 
ATOM   1906  H HE3    . LYS A 1 116 ? 54.969  -22.742 62.971  1.00 98.98  ? 116 LYS A HE3    1 
ATOM   1907  H HZ1    . LYS A 1 116 ? 55.075  -22.943 60.708  1.00 99.34  ? 116 LYS A HZ1    1 
ATOM   1908  H HZ2    . LYS A 1 116 ? 55.752  -24.080 61.301  1.00 99.34  ? 116 LYS A HZ2    1 
ATOM   1909  H HZ3    . LYS A 1 116 ? 54.424  -24.237 60.743  1.00 99.34  ? 116 LYS A HZ3    1 
ATOM   1910  N N      . LEU A 1 117 ? 52.300  -22.456 67.943  1.00 72.12  ? 117 LEU A N      1 
ATOM   1911  C CA     . LEU A 1 117 ? 52.705  -21.362 68.819  1.00 65.12  ? 117 LEU A CA     1 
ATOM   1912  C C      . LEU A 1 117 ? 54.104  -21.574 69.387  1.00 66.20  ? 117 LEU A C      1 
ATOM   1913  O O      . LEU A 1 117 ? 54.523  -22.713 69.606  1.00 60.86  ? 117 LEU A O      1 
ATOM   1914  C CB     . LEU A 1 117 ? 51.706  -21.213 69.973  1.00 54.04  ? 117 LEU A CB     1 
ATOM   1915  C CG     . LEU A 1 117 ? 50.238  -20.983 69.597  1.00 49.45  ? 117 LEU A CG     1 
ATOM   1916  C CD1    . LEU A 1 117 ? 49.385  -20.771 70.841  1.00 47.28  ? 117 LEU A CD1    1 
ATOM   1917  C CD2    . LEU A 1 117 ? 50.084  -19.823 68.634  1.00 53.34  ? 117 LEU A CD2    1 
ATOM   1918  H H      . LEU A 1 117 ? 52.295  -23.223 68.332  1.00 86.94  ? 117 LEU A H      1 
ATOM   1919  H HA     . LEU A 1 117 ? 52.707  -20.535 68.313  1.00 78.53  ? 117 LEU A HA     1 
ATOM   1920  H HB2    . LEU A 1 117 ? 51.740  -22.022 70.508  1.00 65.24  ? 117 LEU A HB2    1 
ATOM   1921  H HB3    . LEU A 1 117 ? 51.983  -20.459 70.517  1.00 65.24  ? 117 LEU A HB3    1 
ATOM   1922  H HG     . LEU A 1 117 ? 49.907  -21.778 69.150  1.00 59.73  ? 117 LEU A HG     1 
ATOM   1923  H HD11   . LEU A 1 117 ? 48.464  -20.629 70.572  1.00 54.78  ? 117 LEU A HD11   1 
ATOM   1924  H HD12   . LEU A 1 117 ? 49.447  -21.559 71.404  1.00 54.78  ? 117 LEU A HD12   1 
ATOM   1925  H HD13   . LEU A 1 117 ? 49.714  -19.995 71.321  1.00 54.78  ? 117 LEU A HD13   1 
ATOM   1926  H HD21   . LEU A 1 117 ? 49.144  -19.711 68.423  1.00 64.39  ? 117 LEU A HD21   1 
ATOM   1927  H HD22   . LEU A 1 117 ? 50.427  -19.018 69.053  1.00 64.39  ? 117 LEU A HD22   1 
ATOM   1928  H HD23   . LEU A 1 117 ? 50.585  -20.015 67.826  1.00 64.39  ? 117 LEU A HD23   1 
ATOM   1929  N N      . LYS A 1 118 ? 54.814  -20.480 69.642  1.00 72.77  ? 118 LYS A N      1 
ATOM   1930  C CA     . LYS A 1 118 ? 56.046  -20.567 70.408  1.00 77.90  ? 118 LYS A CA     1 
ATOM   1931  C C      . LYS A 1 118 ? 55.766  -19.994 71.792  1.00 83.12  ? 118 LYS A C      1 
ATOM   1932  O O      . LYS A 1 118 ? 55.043  -19.003 71.920  1.00 86.60  ? 118 LYS A O      1 
ATOM   1933  C CB     . LYS A 1 118 ? 57.191  -19.801 69.742  1.00 80.69  ? 118 LYS A CB     1 
ATOM   1934  C CG     . LYS A 1 118 ? 57.687  -20.376 68.420  1.00 82.05  ? 118 LYS A CG     1 
ATOM   1935  C CD     . LYS A 1 118 ? 58.781  -19.477 67.835  1.00 79.91  ? 118 LYS A CD     1 
ATOM   1936  C CE     . LYS A 1 118 ? 59.411  -20.045 66.573  1.00 73.63  ? 118 LYS A CE     1 
ATOM   1937  N NZ     . LYS A 1 118 ? 60.509  -19.161 66.089  1.00 71.10  ? 118 LYS A NZ     1 
ATOM   1938  H H      . LYS A 1 118 ? 54.606  -19.686 69.385  1.00 87.72  ? 118 LYS A H      1 
ATOM   1939  H HA     . LYS A 1 118 ? 56.307  -21.496 70.503  1.00 93.87  ? 118 LYS A HA     1 
ATOM   1940  H HB2    . LYS A 1 118 ? 56.894  -18.894 69.570  1.00 97.21  ? 118 LYS A HB2    1 
ATOM   1941  H HB3    . LYS A 1 118 ? 57.945  -19.784 70.352  1.00 97.21  ? 118 LYS A HB3    1 
ATOM   1942  H HG2    . LYS A 1 118 ? 58.061  -21.259 68.570  1.00 98.85  ? 118 LYS A HG2    1 
ATOM   1943  H HG3    . LYS A 1 118 ? 56.953  -20.420 67.789  1.00 98.85  ? 118 LYS A HG3    1 
ATOM   1944  H HD2    . LYS A 1 118 ? 58.394  -18.615 67.615  1.00 96.28  ? 118 LYS A HD2    1 
ATOM   1945  H HD3    . LYS A 1 118 ? 59.483  -19.365 68.495  1.00 96.28  ? 118 LYS A HD3    1 
ATOM   1946  H HE2    . LYS A 1 118 ? 59.783  -20.920 66.763  1.00 88.75  ? 118 LYS A HE2    1 
ATOM   1947  H HE3    . LYS A 1 118 ? 58.739  -20.107 65.876  1.00 88.75  ? 118 LYS A HE3    1 
ATOM   1948  H HZ1    . LYS A 1 118 ? 60.871  -19.501 65.351  1.00 85.71  ? 118 LYS A HZ1    1 
ATOM   1949  H HZ2    . LYS A 1 118 ? 60.189  -18.350 65.908  1.00 85.71  ? 118 LYS A HZ2    1 
ATOM   1950  H HZ3    . LYS A 1 118 ? 61.139  -19.089 66.714  1.00 85.71  ? 118 LYS A HZ3    1 
ATOM   1951  N N      . GLU A 1 119 ? 56.333  -20.631 72.818  1.00 84.37  ? 119 GLU A N      1 
ATOM   1952  C CA     . GLU A 1 119 ? 56.200  -20.182 74.207  1.00 91.71  ? 119 GLU A CA     1 
ATOM   1953  C C      . GLU A 1 119 ? 54.765  -20.288 74.730  1.00 99.22  ? 119 GLU A C      1 
ATOM   1954  O O      . GLU A 1 119 ? 53.812  -20.338 73.948  1.00 94.42  ? 119 GLU A O      1 
ATOM   1955  C CB     . GLU A 1 119 ? 56.717  -18.747 74.380  1.00 96.42  ? 119 GLU A CB     1 
ATOM   1956  C CG     . GLU A 1 119 ? 58.244  -18.649 74.434  1.00 95.29  ? 119 GLU A CG     1 
ATOM   1957  C CD     . GLU A 1 119 ? 58.811  -18.700 75.855  1.00 87.15  ? 119 GLU A CD     1 
ATOM   1958  O OE1    . GLU A 1 119 ? 58.098  -18.363 76.825  1.00 83.55  ? 119 GLU A OE1    1 
ATOM   1959  O OE2    . GLU A 1 119 ? 59.982  -19.098 76.000  1.00 83.59  ? 119 GLU A OE2    1 
ATOM   1960  H H      . GLU A 1 119 ? 56.809  -21.342 72.733  1.00 101.64 ? 119 GLU A H      1 
ATOM   1961  H HA     . GLU A 1 119 ? 56.751  -20.754 74.764  1.00 110.44 ? 119 GLU A HA     1 
ATOM   1962  H HB2    . GLU A 1 119 ? 56.411  -18.212 73.631  1.00 116.09 ? 119 GLU A HB2    1 
ATOM   1963  H HB3    . GLU A 1 119 ? 56.366  -18.385 75.208  1.00 116.09 ? 119 GLU A HB3    1 
ATOM   1964  H HG2    . GLU A 1 119 ? 58.623  -19.390 73.936  1.00 114.73 ? 119 GLU A HG2    1 
ATOM   1965  H HG3    . GLU A 1 119 ? 58.519  -17.809 74.034  1.00 114.73 ? 119 GLU A HG3    1 
ATOM   1966  N N      . PRO A 1 120 ? 54.610  -20.330 76.066  1.00 114.47 ? 120 PRO A N      1 
ATOM   1967  C CA     . PRO A 1 120 ? 53.286  -20.410 76.689  1.00 117.39 ? 120 PRO A CA     1 
ATOM   1968  C C      . PRO A 1 120 ? 52.606  -19.043 76.902  1.00 108.79 ? 120 PRO A C      1 
ATOM   1969  O O      . PRO A 1 120 ? 52.160  -18.725 78.007  1.00 111.82 ? 120 PRO A O      1 
ATOM   1970  C CB     . PRO A 1 120 ? 53.583  -21.111 78.022  1.00 121.06 ? 120 PRO A CB     1 
ATOM   1971  C CG     . PRO A 1 120 ? 55.038  -20.839 78.315  1.00 122.71 ? 120 PRO A CG     1 
ATOM   1972  C CD     . PRO A 1 120 ? 55.667  -20.227 77.087  1.00 122.22 ? 120 PRO A CD     1 
ATOM   1973  H HA     . PRO A 1 120 ? 52.703  -20.975 76.158  1.00 141.26 ? 120 PRO A HA     1 
ATOM   1974  H HB2    . PRO A 1 120 ? 53.019  -20.738 78.717  1.00 145.67 ? 120 PRO A HB2    1 
ATOM   1975  H HB3    . PRO A 1 120 ? 53.426  -22.064 77.930  1.00 145.67 ? 120 PRO A HB3    1 
ATOM   1976  H HG2    . PRO A 1 120 ? 55.100  -20.224 79.063  1.00 147.64 ? 120 PRO A HG2    1 
ATOM   1977  H HG3    . PRO A 1 120 ? 55.479  -21.674 78.534  1.00 147.64 ? 120 PRO A HG3    1 
ATOM   1978  H HD2    . PRO A 1 120 ? 55.889  -19.297 77.250  1.00 147.05 ? 120 PRO A HD2    1 
ATOM   1979  H HD3    . PRO A 1 120 ? 56.447  -20.736 76.818  1.00 147.05 ? 120 PRO A HD3    1 
ATOM   1980  N N      . LYS A 1 121 ? 52.523  -18.251 75.834  1.00 93.36  ? 121 LYS A N      1 
ATOM   1981  C CA     . LYS A 1 121 ? 51.781  -16.992 75.861  1.00 82.50  ? 121 LYS A CA     1 
ATOM   1982  C C      . LYS A 1 121 ? 50.974  -16.858 74.567  1.00 81.69  ? 121 LYS A C      1 
ATOM   1983  O O      . LYS A 1 121 ? 51.069  -17.709 73.677  1.00 75.74  ? 121 LYS A O      1 
ATOM   1984  C CB     . LYS A 1 121 ? 52.721  -15.794 76.043  1.00 77.58  ? 121 LYS A CB     1 
ATOM   1985  C CG     . LYS A 1 121 ? 52.701  -15.170 77.452  1.00 76.74  ? 121 LYS A CG     1 
ATOM   1986  C CD     . LYS A 1 121 ? 51.399  -14.403 77.744  1.00 76.28  ? 121 LYS A CD     1 
ATOM   1987  C CE     . LYS A 1 121 ? 51.253  -14.019 79.230  1.00 69.89  ? 121 LYS A CE     1 
ATOM   1988  N NZ     . LYS A 1 121 ? 52.122  -12.869 79.639  1.00 66.41  ? 121 LYS A NZ     1 
ATOM   1989  H H      . LYS A 1 121 ? 52.891  -18.423 75.076  1.00 112.42 ? 121 LYS A H      1 
ATOM   1990  H HA     . LYS A 1 121 ? 51.160  -17.005 76.606  1.00 99.40  ? 121 LYS A HA     1 
ATOM   1991  H HB2    . LYS A 1 121 ? 53.629  -16.082 75.863  1.00 93.49  ? 121 LYS A HB2    1 
ATOM   1992  H HB3    . LYS A 1 121 ? 52.467  -15.102 75.412  1.00 93.49  ? 121 LYS A HB3    1 
ATOM   1993  H HG2    . LYS A 1 121 ? 52.788  -15.876 78.112  1.00 92.48  ? 121 LYS A HG2    1 
ATOM   1994  H HG3    . LYS A 1 121 ? 53.441  -14.548 77.533  1.00 92.48  ? 121 LYS A HG3    1 
ATOM   1995  H HD2    . LYS A 1 121 ? 51.390  -13.586 77.221  1.00 91.93  ? 121 LYS A HD2    1 
ATOM   1996  H HD3    . LYS A 1 121 ? 50.643  -14.960 77.502  1.00 91.93  ? 121 LYS A HD3    1 
ATOM   1997  H HE2    . LYS A 1 121 ? 50.331  -13.770 79.400  1.00 84.25  ? 121 LYS A HE2    1 
ATOM   1998  H HE3    . LYS A 1 121 ? 51.494  -14.783 79.776  1.00 84.25  ? 121 LYS A HE3    1 
ATOM   1999  H HZ1    . LYS A 1 121 ? 52.000  -12.689 80.502  1.00 80.08  ? 121 LYS A HZ1    1 
ATOM   2000  H HZ2    . LYS A 1 121 ? 52.978  -13.072 79.504  1.00 80.08  ? 121 LYS A HZ2    1 
ATOM   2001  H HZ3    . LYS A 1 121 ? 51.916  -12.148 79.161  1.00 80.08  ? 121 LYS A HZ3    1 
ATOM   2002  N N      . ASN A 1 122 ? 50.184  -15.788 74.481  1.00 86.63  ? 122 ASN A N      1 
ATOM   2003  C CA     . ASN A 1 122 ? 49.122  -15.656 73.481  1.00 86.99  ? 122 ASN A CA     1 
ATOM   2004  C C      . ASN A 1 122 ? 48.104  -16.794 73.598  1.00 78.80  ? 122 ASN A C      1 
ATOM   2005  O O      . ASN A 1 122 ? 47.381  -17.080 72.642  1.00 80.34  ? 122 ASN A O      1 
ATOM   2006  C CB     . ASN A 1 122 ? 49.691  -15.619 72.052  1.00 90.64  ? 122 ASN A CB     1 
ATOM   2007  C CG     . ASN A 1 122 ? 50.394  -14.316 71.733  1.00 92.92  ? 122 ASN A CG     1 
ATOM   2008  O OD1    . ASN A 1 122 ? 49.916  -13.523 70.923  1.00 91.95  ? 122 ASN A OD1    1 
ATOM   2009  N ND2    . ASN A 1 122 ? 51.534  -14.087 72.370  1.00 95.07  ? 122 ASN A ND2    1 
ATOM   2010  H H      . ASN A 1 122 ? 50.245  -15.109 75.005  1.00 104.34 ? 122 ASN A H      1 
ATOM   2011  H HA     . ASN A 1 122 ? 48.652  -14.822 73.634  1.00 104.78 ? 122 ASN A HA     1 
ATOM   2012  H HB2    . ASN A 1 122 ? 50.333  -16.339 71.949  1.00 109.15 ? 122 ASN A HB2    1 
ATOM   2013  H HB3    . ASN A 1 122 ? 48.964  -15.730 71.419  1.00 109.15 ? 122 ASN A HB3    1 
ATOM   2014  H HD21   . ASN A 1 122 ? 51.970  -13.361 72.223  1.00 114.48 ? 122 ASN A HD21   1 
ATOM   2015  H HD22   . ASN A 1 122 ? 51.836  -14.664 72.931  1.00 114.48 ? 122 ASN A HD22   1 
ATOM   2016  N N      . ILE A 1 123 ? 48.014  -17.413 74.776  1.00 67.94  ? 123 ILE A N      1 
ATOM   2017  C CA     . ILE A 1 123 ? 47.131  -18.567 74.952  1.00 70.04  ? 123 ILE A CA     1 
ATOM   2018  C C      . ILE A 1 123 ? 45.728  -18.122 75.359  1.00 83.80  ? 123 ILE A C      1 
ATOM   2019  O O      . ILE A 1 123 ? 45.527  -17.626 76.473  1.00 85.24  ? 123 ILE A O      1 
ATOM   2020  C CB     . ILE A 1 123 ? 47.673  -19.542 76.048  1.00 50.18  ? 123 ILE A CB     1 
ATOM   2021  C CG1    . ILE A 1 123 ? 49.014  -20.162 75.629  1.00 46.46  ? 123 ILE A CG1    1 
ATOM   2022  C CG2    . ILE A 1 123 ? 46.661  -20.650 76.350  1.00 48.51  ? 123 ILE A CG2    1 
ATOM   2023  C CD1    . ILE A 1 123 ? 49.669  -21.051 76.706  1.00 37.04  ? 123 ILE A CD1    1 
ATOM   2024  H H      . ILE A 1 123 ? 48.449  -17.188 75.482  1.00 81.92  ? 123 ILE A H      1 
ATOM   2025  H HA     . ILE A 1 123 ? 47.066  -19.053 74.115  1.00 84.44  ? 123 ILE A HA     1 
ATOM   2026  H HB     . ILE A 1 123 ? 47.816  -19.033 76.861  1.00 60.60  ? 123 ILE A HB     1 
ATOM   2027  H HG12   . ILE A 1 123 ? 48.871  -20.710 74.842  1.00 56.15  ? 123 ILE A HG12   1 
ATOM   2028  H HG13   . ILE A 1 123 ? 49.635  -19.447 75.420  1.00 56.15  ? 123 ILE A HG13   1 
ATOM   2029  H HG21   . ILE A 1 123 ? 47.027  -21.235 77.031  1.00 58.60  ? 123 ILE A HG21   1 
ATOM   2030  H HG22   . ILE A 1 123 ? 45.837  -20.247 76.667  1.00 58.60  ? 123 ILE A HG22   1 
ATOM   2031  H HG23   . ILE A 1 123 ? 46.492  -21.153 75.538  1.00 58.60  ? 123 ILE A HG23   1 
ATOM   2032  H HD11   . ILE A 1 123 ? 50.506  -21.400 76.361  1.00 42.49  ? 123 ILE A HD11   1 
ATOM   2033  H HD12   . ILE A 1 123 ? 49.835  -20.517 77.499  1.00 42.49  ? 123 ILE A HD12   1 
ATOM   2034  H HD13   . ILE A 1 123 ? 49.069  -21.782 76.919  1.00 42.49  ? 123 ILE A HD13   1 
ATOM   2035  N N      . LYS A 1 124 ? 44.761  -18.325 74.462  1.00 95.69  ? 124 LYS A N      1 
ATOM   2036  C CA     . LYS A 1 124 ? 43.371  -17.935 74.710  1.00 102.30 ? 124 LYS A CA     1 
ATOM   2037  C C      . LYS A 1 124 ? 42.489  -19.136 75.041  1.00 105.18 ? 124 LYS A C      1 
ATOM   2038  O O      . LYS A 1 124 ? 41.975  -19.247 76.157  1.00 106.20 ? 124 LYS A O      1 
ATOM   2039  C CB     . LYS A 1 124 ? 42.796  -17.155 73.523  1.00 105.07 ? 124 LYS A CB     1 
ATOM   2040  C CG     . LYS A 1 124 ? 43.402  -15.761 73.390  1.00 108.41 ? 124 LYS A CG     1 
ATOM   2041  C CD     . LYS A 1 124 ? 42.562  -14.837 72.517  1.00 112.95 ? 124 LYS A CD     1 
ATOM   2042  C CE     . LYS A 1 124 ? 43.043  -13.394 72.639  1.00 112.29 ? 124 LYS A CE     1 
ATOM   2043  N NZ     . LYS A 1 124 ? 42.247  -12.452 71.811  1.00 113.48 ? 124 LYS A NZ     1 
ATOM   2044  H H      . LYS A 1 124 ? 44.886  -18.691 73.694  1.00 115.22 ? 124 LYS A H      1 
ATOM   2045  H HA     . LYS A 1 124 ? 43.354  -17.344 75.479  1.00 123.15 ? 124 LYS A HA     1 
ATOM   2046  H HB2    . LYS A 1 124 ? 42.979  -17.642 72.705  1.00 126.47 ? 124 LYS A HB2    1 
ATOM   2047  H HB3    . LYS A 1 124 ? 41.838  -17.056 73.644  1.00 126.47 ? 124 LYS A HB3    1 
ATOM   2048  H HG2    . LYS A 1 124 ? 43.472  -15.361 74.271  1.00 130.48 ? 124 LYS A HG2    1 
ATOM   2049  H HG3    . LYS A 1 124 ? 44.282  -15.836 72.988  1.00 130.48 ? 124 LYS A HG3    1 
ATOM   2050  H HD2    . LYS A 1 124 ? 42.642  -15.109 71.589  1.00 135.93 ? 124 LYS A HD2    1 
ATOM   2051  H HD3    . LYS A 1 124 ? 41.636  -14.876 72.803  1.00 135.93 ? 124 LYS A HD3    1 
ATOM   2052  H HE2    . LYS A 1 124 ? 42.971  -13.113 73.565  1.00 135.14 ? 124 LYS A HE2    1 
ATOM   2053  H HE3    . LYS A 1 124 ? 43.967  -13.342 72.347  1.00 135.14 ? 124 LYS A HE3    1 
ATOM   2054  H HZ1    . LYS A 1 124 ? 42.558  -11.624 71.910  1.00 136.57 ? 124 LYS A HZ1    1 
ATOM   2055  H HZ2    . LYS A 1 124 ? 42.301  -12.682 70.953  1.00 136.57 ? 124 LYS A HZ2    1 
ATOM   2056  H HZ3    . LYS A 1 124 ? 41.394  -12.473 72.064  1.00 136.57 ? 124 LYS A HZ3    1 
ATOM   2057  N N      . SER A 1 125 ? 42.315  -20.037 74.081  1.00 112.19 ? 125 SER A N      1 
ATOM   2058  C CA     . SER A 1 125 ? 41.526  -21.232 74.326  1.00 106.35 ? 125 SER A CA     1 
ATOM   2059  C C      . SER A 1 125 ? 42.256  -22.150 75.299  1.00 96.75  ? 125 SER A C      1 
ATOM   2060  O O      . SER A 1 125 ? 43.468  -22.056 75.469  1.00 100.44 ? 125 SER A O      1 
ATOM   2061  C CB     . SER A 1 125 ? 41.240  -21.963 73.016  1.00 108.61 ? 125 SER A CB     1 
ATOM   2062  O OG     . SER A 1 125 ? 40.679  -21.083 72.060  1.00 111.82 ? 125 SER A OG     1 
ATOM   2063  H H      . SER A 1 125 ? 42.641  -19.979 73.287  1.00 135.02 ? 125 SER A H      1 
ATOM   2064  H HA     . SER A 1 125 ? 40.678  -20.980 74.725  1.00 128.01 ? 125 SER A HA     1 
ATOM   2065  H HB2    . SER A 1 125 ? 42.070  -22.322 72.667  1.00 130.72 ? 125 SER A HB2    1 
ATOM   2066  H HB3    . SER A 1 125 ? 40.613  -22.684 73.187  1.00 130.72 ? 125 SER A HB3    1 
ATOM   2067  H HG     . SER A 1 125 ? 40.526  -21.495 71.344  1.00 134.58 ? 125 SER A HG     1 
ATOM   2068  N N      . ALA A 1 126 ? 41.500  -23.026 75.950  1.00 73.41  ? 126 ALA A N      1 
ATOM   2069  C CA     . ALA A 1 126 ? 42.062  -24.000 76.878  1.00 59.85  ? 126 ALA A CA     1 
ATOM   2070  C C      . ALA A 1 126 ? 42.510  -25.257 76.157  1.00 65.45  ? 126 ALA A C      1 
ATOM   2071  O O      . ALA A 1 126 ? 43.192  -26.096 76.741  1.00 57.32  ? 126 ALA A O      1 
ATOM   2072  C CB     . ALA A 1 126 ? 41.050  -24.351 77.950  1.00 52.52  ? 126 ALA A CB     1 
ATOM   2073  H H      . ALA A 1 126 ? 40.645  -23.076 75.871  1.00 88.48  ? 126 ALA A H      1 
ATOM   2074  H HA     . ALA A 1 126 ? 42.837  -23.611 77.313  1.00 72.21  ? 126 ALA A HA     1 
ATOM   2075  H HB1    . ALA A 1 126 ? 41.444  -25.000 78.555  1.00 63.42  ? 126 ALA A HB1    1 
ATOM   2076  H HB2    . ALA A 1 126 ? 40.814  -23.546 78.436  1.00 63.42  ? 126 ALA A HB2    1 
ATOM   2077  H HB3    . ALA A 1 126 ? 40.262  -24.728 77.529  1.00 63.42  ? 126 ALA A HB3    1 
ATOM   2078  N N      . VAL A 1 127 ? 42.094  -25.404 74.903  1.00 90.75  ? 127 VAL A N      1 
ATOM   2079  C CA     . VAL A 1 127 ? 42.547  -26.518 74.080  1.00 105.71 ? 127 VAL A CA     1 
ATOM   2080  C C      . VAL A 1 127 ? 43.967  -26.238 73.626  1.00 110.32 ? 127 VAL A C      1 
ATOM   2081  O O      . VAL A 1 127 ? 44.659  -27.124 73.133  1.00 111.49 ? 127 VAL A O      1 
ATOM   2082  C CB     . VAL A 1 127 ? 41.649  -26.741 72.837  1.00 116.96 ? 127 VAL A CB     1 
ATOM   2083  C CG1    . VAL A 1 127 ? 40.220  -27.063 73.249  1.00 118.55 ? 127 VAL A CG1    1 
ATOM   2084  C CG2    . VAL A 1 127 ? 41.682  -25.527 71.916  1.00 120.84 ? 127 VAL A CG2    1 
ATOM   2085  H H      . VAL A 1 127 ? 41.547  -24.872 74.505  1.00 109.29 ? 127 VAL A H      1 
ATOM   2086  H HA     . VAL A 1 127 ? 42.548  -27.331 74.608  1.00 127.24 ? 127 VAL A HA     1 
ATOM   2087  H HB     . VAL A 1 127 ? 41.991  -27.500 72.338  1.00 140.75 ? 127 VAL A HB     1 
ATOM   2088  H HG11   . VAL A 1 127 ? 39.684  -27.197 72.452  1.00 142.66 ? 127 VAL A HG11   1 
ATOM   2089  H HG12   . VAL A 1 127 ? 40.221  -27.870 73.787  1.00 142.66 ? 127 VAL A HG12   1 
ATOM   2090  H HG13   . VAL A 1 127 ? 39.866  -26.321 73.765  1.00 142.66 ? 127 VAL A HG13   1 
ATOM   2091  H HG21   . VAL A 1 127 ? 41.112  -25.697 71.149  1.00 145.40 ? 127 VAL A HG21   1 
ATOM   2092  H HG22   . VAL A 1 127 ? 41.360  -24.752 72.403  1.00 145.40 ? 127 VAL A HG22   1 
ATOM   2093  H HG23   . VAL A 1 127 ? 42.595  -25.377 71.623  1.00 145.40 ? 127 VAL A HG23   1 
ATOM   2094  N N      . ASP A 1 128 ? 44.393  -24.992 73.797  1.00 110.08 ? 128 ASP A N      1 
ATOM   2095  C CA     . ASP A 1 128 ? 45.733  -24.587 73.412  1.00 108.89 ? 128 ASP A CA     1 
ATOM   2096  C C      . ASP A 1 128 ? 46.763  -24.992 74.469  1.00 98.77  ? 128 ASP A C      1 
ATOM   2097  O O      . ASP A 1 128 ? 47.941  -25.154 74.161  1.00 104.23 ? 128 ASP A O      1 
ATOM   2098  C CB     . ASP A 1 128 ? 45.779  -23.071 73.184  1.00 114.52 ? 128 ASP A CB     1 
ATOM   2099  C CG     . ASP A 1 128 ? 44.860  -22.615 72.056  1.00 119.60 ? 128 ASP A CG     1 
ATOM   2100  O OD1    . ASP A 1 128 ? 44.602  -23.415 71.133  1.00 121.30 ? 128 ASP A OD1    1 
ATOM   2101  O OD2    . ASP A 1 128 ? 44.399  -21.453 72.090  1.00 121.22 ? 128 ASP A OD2    1 
ATOM   2102  H H      . ASP A 1 128 ? 43.920  -24.359 74.137  1.00 132.48 ? 128 ASP A H      1 
ATOM   2103  H HA     . ASP A 1 128 ? 45.968  -25.024 72.578  1.00 131.06 ? 128 ASP A HA     1 
ATOM   2104  H HB2    . ASP A 1 128 ? 45.502  -22.621 73.998  1.00 137.81 ? 128 ASP A HB2    1 
ATOM   2105  H HB3    . ASP A 1 128 ? 46.686  -22.814 72.955  1.00 137.81 ? 128 ASP A HB3    1 
ATOM   2106  N N      . ARG A 1 129 ? 46.321  -25.176 75.710  1.00 81.69  ? 129 ARG A N      1 
ATOM   2107  C CA     . ARG A 1 129 ? 47.228  -25.580 76.779  1.00 66.07  ? 129 ARG A CA     1 
ATOM   2108  C C      . ARG A 1 129 ? 47.712  -27.013 76.564  1.00 63.13  ? 129 ARG A C      1 
ATOM   2109  O O      . ARG A 1 129 ? 48.824  -27.365 76.947  1.00 58.83  ? 129 ARG A O      1 
ATOM   2110  C CB     . ARG A 1 129 ? 46.551  -25.485 78.151  1.00 58.35  ? 129 ARG A CB     1 
ATOM   2111  C CG     . ARG A 1 129 ? 45.810  -24.191 78.458  1.00 57.33  ? 129 ARG A CG     1 
ATOM   2112  C CD     . ARG A 1 129 ? 45.583  -24.064 79.972  1.00 57.43  ? 129 ARG A CD     1 
ATOM   2113  N NE     . ARG A 1 129 ? 44.526  -23.114 80.344  1.00 58.89  ? 129 ARG A NE     1 
ATOM   2114  C CZ     . ARG A 1 129 ? 43.293  -23.456 80.743  1.00 58.41  ? 129 ARG A CZ     1 
ATOM   2115  N NH1    . ARG A 1 129 ? 42.928  -24.733 80.839  1.00 52.01  ? 129 ARG A NH1    1 
ATOM   2116  N NH2    . ARG A 1 129 ? 42.411  -22.513 81.057  1.00 62.01  ? 129 ARG A NH2    1 
ATOM   2117  H H      . ARG A 1 129 ? 45.504  -25.073 75.958  1.00 98.41  ? 129 ARG A H      1 
ATOM   2118  H HA     . ARG A 1 129 ? 48.001  -24.995 76.780  1.00 79.67  ? 129 ARG A HA     1 
ATOM   2119  H HB2    . ARG A 1 129 ? 45.907  -26.207 78.222  1.00 70.41  ? 129 ARG A HB2    1 
ATOM   2120  H HB3    . ARG A 1 129 ? 47.232  -25.594 78.833  1.00 70.41  ? 129 ARG A HB3    1 
ATOM   2121  H HG2    . ARG A 1 129 ? 46.340  -23.435 78.161  1.00 69.18  ? 129 ARG A HG2    1 
ATOM   2122  H HG3    . ARG A 1 129 ? 44.947  -24.198 78.016  1.00 69.18  ? 129 ARG A HG3    1 
ATOM   2123  H HD2    . ARG A 1 129 ? 45.336  -24.934 80.323  1.00 69.31  ? 129 ARG A HD2    1 
ATOM   2124  H HD3    . ARG A 1 129 ? 46.408  -23.766 80.386  1.00 69.31  ? 129 ARG A HD3    1 
ATOM   2125  H HE     . ARG A 1 129 ? 44.712  -22.275 80.303  1.00 71.06  ? 129 ARG A HE     1 
ATOM   2126  H HH11   . ARG A 1 129 ? 43.486  -25.356 80.640  1.00 62.80  ? 129 ARG A HH11   1 
ATOM   2127  H HH12   . ARG A 1 129 ? 42.133  -24.934 81.098  1.00 62.80  ? 129 ARG A HH12   1 
ATOM   2128  H HH21   . ARG A 1 129 ? 42.631  -21.683 81.001  1.00 74.80  ? 129 ARG A HH21   1 
ATOM   2129  H HH22   . ARG A 1 129 ? 41.621  -22.732 81.314  1.00 74.80  ? 129 ARG A HH22   1 
ATOM   2130  N N      . THR A 1 130 ? 46.859  -27.826 75.943  1.00 68.45  ? 130 THR A N      1 
ATOM   2131  C CA     . THR A 1 130 ? 47.020  -29.281 75.899  1.00 70.13  ? 130 THR A CA     1 
ATOM   2132  C C      . THR A 1 130 ? 48.345  -29.785 75.317  1.00 69.20  ? 130 THR A C      1 
ATOM   2133  O O      . THR A 1 130 ? 48.965  -30.682 75.891  1.00 69.88  ? 130 THR A O      1 
ATOM   2134  C CB     . THR A 1 130 ? 45.882  -29.913 75.104  1.00 69.91  ? 130 THR A CB     1 
ATOM   2135  O OG1    . THR A 1 130 ? 44.634  -29.495 75.661  1.00 67.78  ? 130 THR A OG1    1 
ATOM   2136  C CG2    . THR A 1 130 ? 45.979  -31.436 75.137  1.00 70.56  ? 130 THR A CG2    1 
ATOM   2137  H H      . THR A 1 130 ? 46.158  -27.550 75.527  1.00 82.53  ? 130 THR A H      1 
ATOM   2138  H HA     . THR A 1 130 ? 46.959  -29.618 76.807  1.00 84.55  ? 130 THR A HA     1 
ATOM   2139  H HB     . THR A 1 130 ? 45.935  -29.623 74.180  1.00 84.28  ? 130 THR A HB     1 
ATOM   2140  H HG1    . THR A 1 130 ? 43.999  -29.838 75.231  1.00 81.73  ? 130 THR A HG1    1 
ATOM   2141  H HG21   . THR A 1 130 ? 45.250  -31.825 74.628  1.00 85.07  ? 130 THR A HG21   1 
ATOM   2142  H HG22   . THR A 1 130 ? 46.821  -31.723 74.751  1.00 85.07  ? 130 THR A HG22   1 
ATOM   2143  H HG23   . THR A 1 130 ? 45.927  -31.751 76.053  1.00 85.07  ? 130 THR A HG23   1 
ATOM   2144  N N      . PRO A 1 131 ? 48.747  -29.277 74.143  1.00 65.32  ? 131 PRO A N      1 
ATOM   2145  C CA     . PRO A 1 131 ? 50.026  -29.745 73.609  1.00 62.27  ? 131 PRO A CA     1 
ATOM   2146  C C      . PRO A 1 131 ? 51.226  -29.318 74.462  1.00 57.97  ? 131 PRO A C      1 
ATOM   2147  O O      . PRO A 1 131 ? 52.194  -30.061 74.558  1.00 58.27  ? 131 PRO A O      1 
ATOM   2148  C CB     . PRO A 1 131 ? 50.083  -29.098 72.226  1.00 63.11  ? 131 PRO A CB     1 
ATOM   2149  C CG     . PRO A 1 131 ? 49.175  -27.940 72.305  1.00 62.51  ? 131 PRO A CG     1 
ATOM   2150  C CD     . PRO A 1 131 ? 48.087  -28.330 73.231  1.00 63.91  ? 131 PRO A CD     1 
ATOM   2151  H HA     . PRO A 1 131 ? 50.023  -30.711 73.514  1.00 75.12  ? 131 PRO A HA     1 
ATOM   2152  H HB2    . PRO A 1 131 ? 50.990  -28.810 72.037  1.00 76.12  ? 131 PRO A HB2    1 
ATOM   2153  H HB3    . PRO A 1 131 ? 49.777  -29.729 71.556  1.00 76.12  ? 131 PRO A HB3    1 
ATOM   2154  H HG2    . PRO A 1 131 ? 49.657  -27.173 72.651  1.00 75.40  ? 131 PRO A HG2    1 
ATOM   2155  H HG3    . PRO A 1 131 ? 48.818  -27.748 71.423  1.00 75.40  ? 131 PRO A HG3    1 
ATOM   2156  H HD2    . PRO A 1 131 ? 47.765  -27.557 73.721  1.00 77.08  ? 131 PRO A HD2    1 
ATOM   2157  H HD3    . PRO A 1 131 ? 47.371  -28.770 72.747  1.00 77.08  ? 131 PRO A HD3    1 
ATOM   2158  N N      . PHE A 1 132 ? 51.157  -28.145 75.083  1.00 51.27  ? 132 PHE A N      1 
ATOM   2159  C CA     . PHE A 1 132 ? 52.253  -27.667 75.920  1.00 48.83  ? 132 PHE A CA     1 
ATOM   2160  C C      . PHE A 1 132 ? 52.372  -28.515 77.185  1.00 48.10  ? 132 PHE A C      1 
ATOM   2161  O O      . PHE A 1 132 ? 53.485  -28.796 77.640  1.00 46.57  ? 132 PHE A O      1 
ATOM   2162  C CB     . PHE A 1 132 ? 52.064  -26.192 76.301  1.00 47.96  ? 132 PHE A CB     1 
ATOM   2163  C CG     . PHE A 1 132 ? 52.379  -25.219 75.188  1.00 51.97  ? 132 PHE A CG     1 
ATOM   2164  C CD1    . PHE A 1 132 ? 53.492  -25.389 74.382  1.00 52.39  ? 132 PHE A CD1    1 
ATOM   2165  C CD2    . PHE A 1 132 ? 51.558  -24.126 74.953  1.00 53.58  ? 132 PHE A CD2    1 
ATOM   2166  C CE1    . PHE A 1 132 ? 53.778  -24.497 73.357  1.00 54.05  ? 132 PHE A CE1    1 
ATOM   2167  C CE2    . PHE A 1 132 ? 51.839  -23.229 73.931  1.00 55.16  ? 132 PHE A CE2    1 
ATOM   2168  C CZ     . PHE A 1 132 ? 52.950  -23.416 73.133  1.00 56.78  ? 132 PHE A CZ     1 
ATOM   2169  H H      . PHE A 1 132 ? 50.487  -27.607 75.037  1.00 61.91  ? 132 PHE A H      1 
ATOM   2170  H HA     . PHE A 1 132 ? 53.085  -27.745 75.426  1.00 58.99  ? 132 PHE A HA     1 
ATOM   2171  H HB2    . PHE A 1 132 ? 51.139  -26.054 76.561  1.00 57.94  ? 132 PHE A HB2    1 
ATOM   2172  H HB3    . PHE A 1 132 ? 52.648  -25.985 77.047  1.00 57.94  ? 132 PHE A HB3    1 
ATOM   2173  H HD1    . PHE A 1 132 ? 54.053  -26.117 74.525  1.00 63.26  ? 132 PHE A HD1    1 
ATOM   2174  H HD2    . PHE A 1 132 ? 50.806  -23.995 75.484  1.00 64.68  ? 132 PHE A HD2    1 
ATOM   2175  H HE1    . PHE A 1 132 ? 54.528  -24.626 72.823  1.00 65.25  ? 132 PHE A HE1    1 
ATOM   2176  H HE2    . PHE A 1 132 ? 51.278  -22.502 73.785  1.00 66.58  ? 132 PHE A HE2    1 
ATOM   2177  H HZ     . PHE A 1 132 ? 53.140  -22.815 72.450  1.00 68.53  ? 132 PHE A HZ     1 
ATOM   2178  N N      . HIS A 1 133 ? 51.236  -28.936 77.744  1.00 47.61  ? 133 HIS A N      1 
ATOM   2179  C CA     . HIS A 1 133 ? 51.256  -29.864 78.870  1.00 47.14  ? 133 HIS A CA     1 
ATOM   2180  C C      . HIS A 1 133 ? 52.109  -31.081 78.523  1.00 49.38  ? 133 HIS A C      1 
ATOM   2181  O O      . HIS A 1 133 ? 52.901  -31.550 79.339  1.00 51.26  ? 133 HIS A O      1 
ATOM   2182  C CB     . HIS A 1 133 ? 49.840  -30.312 79.246  1.00 46.23  ? 133 HIS A CB     1 
ATOM   2183  C CG     . HIS A 1 133 ? 48.982  -29.231 79.825  1.00 47.39  ? 133 HIS A CG     1 
ATOM   2184  N ND1    . HIS A 1 133 ? 47.608  -29.324 79.883  1.00 47.74  ? 133 HIS A ND1    1 
ATOM   2185  C CD2    . HIS A 1 133 ? 49.298  -28.040 80.388  1.00 52.23  ? 133 HIS A CD2    1 
ATOM   2186  C CE1    . HIS A 1 133 ? 47.114  -28.236 80.445  1.00 50.15  ? 133 HIS A CE1    1 
ATOM   2187  N NE2    . HIS A 1 133 ? 48.117  -27.439 80.761  1.00 51.47  ? 133 HIS A NE2    1 
ATOM   2188  H H      . HIS A 1 133 ? 50.449  -28.700 77.491  1.00 57.52  ? 133 HIS A H      1 
ATOM   2189  H HA     . HIS A 1 133 ? 51.650  -29.425 79.640  1.00 56.95  ? 133 HIS A HA     1 
ATOM   2190  H HB2    . HIS A 1 133 ? 49.397  -30.644 78.449  1.00 55.87  ? 133 HIS A HB2    1 
ATOM   2191  H HB3    . HIS A 1 133 ? 49.903  -31.022 79.904  1.00 55.87  ? 133 HIS A HB3    1 
ATOM   2192  H HD1    . HIS A 1 133 ? 47.143  -29.987 79.592  1.00 57.68  ? 133 HIS A HD1    1 
ATOM   2193  H HD2    . HIS A 1 133 ? 50.153  -27.690 80.496  1.00 63.06  ? 133 HIS A HD2    1 
ATOM   2194  H HE1    . HIS A 1 133 ? 46.213  -28.061 80.594  1.00 60.57  ? 133 HIS A HE1    1 
ATOM   2195  H HE2    . HIS A 1 133 ? 48.045  -26.671 81.140  1.00 62.15  ? 133 HIS A HE2    1 
ATOM   2196  N N      . HIS A 1 134 ? 51.971  -31.561 77.292  1.00 48.99  ? 134 HIS A N      1 
ATOM   2197  C CA     . HIS A 1 134 ? 52.690  -32.744 76.837  1.00 49.45  ? 134 HIS A CA     1 
ATOM   2198  C C      . HIS A 1 134 ? 54.185  -32.526 76.685  1.00 53.45  ? 134 HIS A C      1 
ATOM   2199  O O      . HIS A 1 134 ? 54.980  -33.330 77.159  1.00 52.53  ? 134 HIS A O      1 
ATOM   2200  C CB     . HIS A 1 134 ? 52.124  -33.208 75.506  1.00 52.69  ? 134 HIS A CB     1 
ATOM   2201  C CG     . HIS A 1 134 ? 52.853  -34.369 74.914  1.00 54.77  ? 134 HIS A CG     1 
ATOM   2202  N ND1    . HIS A 1 134 ? 52.891  -35.612 75.505  1.00 54.48  ? 134 HIS A ND1    1 
ATOM   2203  C CD2    . HIS A 1 134 ? 53.578  -34.471 73.776  1.00 56.33  ? 134 HIS A CD2    1 
ATOM   2204  C CE1    . HIS A 1 134 ? 53.600  -36.433 74.752  1.00 54.91  ? 134 HIS A CE1    1 
ATOM   2205  N NE2    . HIS A 1 134 ? 54.029  -35.766 73.698  1.00 57.51  ? 134 HIS A NE2    1 
ATOM   2206  H H      . HIS A 1 134 ? 51.459  -31.214 76.694  1.00 59.18  ? 134 HIS A H      1 
ATOM   2207  H HA     . HIS A 1 134 ? 52.559  -33.457 77.481  1.00 59.74  ? 134 HIS A HA     1 
ATOM   2208  H HB2    . HIS A 1 134 ? 51.199  -33.472 75.635  1.00 63.62  ? 134 HIS A HB2    1 
ATOM   2209  H HB3    . HIS A 1 134 ? 52.171  -32.474 74.874  1.00 63.62  ? 134 HIS A HB3    1 
ATOM   2210  H HD1    . HIS A 1 134 ? 52.506  -35.823 76.244  1.00 65.76  ? 134 HIS A HD1    1 
ATOM   2211  H HD2    . HIS A 1 134 ? 53.735  -33.794 73.158  1.00 67.99  ? 134 HIS A HD2    1 
ATOM   2212  H HE1    . HIS A 1 134 ? 53.773  -37.328 74.937  1.00 66.28  ? 134 HIS A HE1    1 
ATOM   2213  H HE2    . HIS A 1 134 ? 54.516  -36.088 73.066  1.00 69.40  ? 134 HIS A HE2    1 
ATOM   2214  N N      . LYS A 1 135 ? 54.568  -31.430 76.043  1.00 59.78  ? 135 LYS A N      1 
ATOM   2215  C CA     . LYS A 1 135 ? 55.977  -31.124 75.880  1.00 65.99  ? 135 LYS A CA     1 
ATOM   2216  C C      . LYS A 1 135 ? 56.643  -31.077 77.245  1.00 63.11  ? 135 LYS A C      1 
ATOM   2217  O O      . LYS A 1 135 ? 57.770  -31.547 77.422  1.00 69.27  ? 135 LYS A O      1 
ATOM   2218  C CB     . LYS A 1 135 ? 56.174  -29.787 75.166  1.00 74.93  ? 135 LYS A CB     1 
ATOM   2219  C CG     . LYS A 1 135 ? 55.431  -29.647 73.856  1.00 85.51  ? 135 LYS A CG     1 
ATOM   2220  C CD     . LYS A 1 135 ? 55.923  -30.623 72.804  1.00 92.09  ? 135 LYS A CD     1 
ATOM   2221  C CE     . LYS A 1 135 ? 54.943  -30.708 71.639  1.00 94.36  ? 135 LYS A CE     1 
ATOM   2222  N NZ     . LYS A 1 135 ? 54.577  -29.367 71.095  1.00 94.76  ? 135 LYS A NZ     1 
ATOM   2223  H H      . LYS A 1 135 ? 54.034  -30.852 75.695  1.00 72.13  ? 135 LYS A H      1 
ATOM   2224  H HA     . LYS A 1 135 ? 56.401  -31.820 75.354  1.00 79.58  ? 135 LYS A HA     1 
ATOM   2225  H HB2    . LYS A 1 135 ? 55.870  -29.077 75.752  1.00 90.31  ? 135 LYS A HB2    1 
ATOM   2226  H HB3    . LYS A 1 135 ? 57.119  -29.673 74.980  1.00 90.31  ? 135 LYS A HB3    1 
ATOM   2227  H HG2    . LYS A 1 135 ? 54.488  -29.817 74.007  1.00 103.00 ? 135 LYS A HG2    1 
ATOM   2228  H HG3    . LYS A 1 135 ? 55.557  -28.748 73.515  1.00 103.00 ? 135 LYS A HG3    1 
ATOM   2229  H HD2    . LYS A 1 135 ? 56.780  -30.323 72.461  1.00 110.90 ? 135 LYS A HD2    1 
ATOM   2230  H HD3    . LYS A 1 135 ? 56.007  -31.506 73.197  1.00 110.90 ? 135 LYS A HD3    1 
ATOM   2231  H HE2    . LYS A 1 135 ? 55.348  -31.222 70.922  1.00 113.63 ? 135 LYS A HE2    1 
ATOM   2232  H HE3    . LYS A 1 135 ? 54.130  -31.142 71.941  1.00 113.63 ? 135 LYS A HE3    1 
ATOM   2233  H HZ1    . LYS A 1 135 ? 54.005  -29.459 70.419  1.00 114.11 ? 135 LYS A HZ1    1 
ATOM   2234  H HZ2    . LYS A 1 135 ? 54.195  -28.875 71.731  1.00 114.11 ? 135 LYS A HZ2    1 
ATOM   2235  H HZ3    . LYS A 1 135 ? 55.305  -28.948 70.803  1.00 114.11 ? 135 LYS A HZ3    1 
ATOM   2236  N N      . TRP A 1 136 ? 55.925  -30.536 78.220  1.00 52.66  ? 136 TRP A N      1 
ATOM   2237  C CA     . TRP A 1 136 ? 56.460  -30.422 79.565  1.00 47.01  ? 136 TRP A CA     1 
ATOM   2238  C C      . TRP A 1 136 ? 56.630  -31.789 80.222  1.00 45.66  ? 136 TRP A C      1 
ATOM   2239  O O      . TRP A 1 136 ? 57.689  -32.098 80.766  1.00 48.09  ? 136 TRP A O      1 
ATOM   2240  C CB     . TRP A 1 136 ? 55.547  -29.522 80.417  1.00 44.53  ? 136 TRP A CB     1 
ATOM   2241  C CG     . TRP A 1 136 ? 56.188  -29.051 81.687  1.00 42.00  ? 136 TRP A CG     1 
ATOM   2242  C CD1    . TRP A 1 136 ? 57.041  -27.994 81.834  1.00 44.36  ? 136 TRP A CD1    1 
ATOM   2243  C CD2    . TRP A 1 136 ? 56.016  -29.611 82.992  1.00 39.83  ? 136 TRP A CD2    1 
ATOM   2244  N NE1    . TRP A 1 136 ? 57.423  -27.873 83.147  1.00 42.81  ? 136 TRP A NE1    1 
ATOM   2245  C CE2    . TRP A 1 136 ? 56.805  -28.852 83.880  1.00 41.44  ? 136 TRP A CE2    1 
ATOM   2246  C CE3    . TRP A 1 136 ? 55.281  -30.686 83.493  1.00 39.89  ? 136 TRP A CE3    1 
ATOM   2247  C CZ2    . TRP A 1 136 ? 56.874  -29.131 85.243  1.00 40.81  ? 136 TRP A CZ2    1 
ATOM   2248  C CZ3    . TRP A 1 136 ? 55.350  -30.963 84.844  1.00 41.23  ? 136 TRP A CZ3    1 
ATOM   2249  C CH2    . TRP A 1 136 ? 56.142  -30.187 85.706  1.00 41.35  ? 136 TRP A CH2    1 
ATOM   2250  H H      . TRP A 1 136 ? 55.127  -30.229 78.127  1.00 63.58  ? 136 TRP A H      1 
ATOM   2251  H HA     . TRP A 1 136 ? 57.333  -30.003 79.520  1.00 56.80  ? 136 TRP A HA     1 
ATOM   2252  H HB2    . TRP A 1 136 ? 55.306  -28.739 79.897  1.00 53.83  ? 136 TRP A HB2    1 
ATOM   2253  H HB3    . TRP A 1 136 ? 54.749  -30.019 80.653  1.00 53.83  ? 136 TRP A HB3    1 
ATOM   2254  H HD1    . TRP A 1 136 ? 57.330  -27.444 81.142  1.00 53.62  ? 136 TRP A HD1    1 
ATOM   2255  H HE1    . TRP A 1 136 ? 57.955  -27.274 83.460  1.00 51.76  ? 136 TRP A HE1    1 
ATOM   2256  H HE3    . TRP A 1 136 ? 54.755  -31.206 82.928  1.00 48.25  ? 136 TRP A HE3    1 
ATOM   2257  H HZ2    . TRP A 1 136 ? 57.398  -28.618 85.815  1.00 49.36  ? 136 TRP A HZ2    1 
ATOM   2258  H HZ3    . TRP A 1 136 ? 54.863  -31.677 85.189  1.00 49.87  ? 136 TRP A HZ3    1 
ATOM   2259  H HH2    . TRP A 1 136 ? 56.169  -30.397 86.612  1.00 50.02  ? 136 TRP A HH2    1 
ATOM   2260  N N      . LEU A 1 137 ? 55.603  -32.622 80.143  1.00 44.11  ? 137 LEU A N      1 
ATOM   2261  C CA     . LEU A 1 137 ? 55.614  -33.879 80.870  1.00 44.37  ? 137 LEU A CA     1 
ATOM   2262  C C      . LEU A 1 137 ? 56.423  -34.921 80.154  1.00 49.27  ? 137 LEU A C      1 
ATOM   2263  O O      . LEU A 1 137 ? 57.035  -35.788 80.786  1.00 52.55  ? 137 LEU A O      1 
ATOM   2264  C CB     . LEU A 1 137 ? 54.204  -34.380 81.077  1.00 41.08  ? 137 LEU A CB     1 
ATOM   2265  C CG     . LEU A 1 137 ? 53.555  -33.630 82.213  1.00 39.66  ? 137 LEU A CG     1 
ATOM   2266  C CD1    . LEU A 1 137 ? 52.071  -33.890 82.201  1.00 40.42  ? 137 LEU A CD1    1 
ATOM   2267  C CD2    . LEU A 1 137 ? 54.183  -34.061 83.534  1.00 38.97  ? 137 LEU A CD2    1 
ATOM   2268  H H      . LEU A 1 137 ? 54.892  -32.484 79.678  1.00 53.32  ? 137 LEU A H      1 
ATOM   2269  H HA     . LEU A 1 137 ? 56.013  -33.736 81.743  1.00 53.64  ? 137 LEU A HA     1 
ATOM   2270  H HB2    . LEU A 1 137 ? 53.685  -34.231 80.271  1.00 49.69  ? 137 LEU A HB2    1 
ATOM   2271  H HB3    . LEU A 1 137 ? 54.224  -35.323 81.300  1.00 49.69  ? 137 LEU A HB3    1 
ATOM   2272  H HG     . LEU A 1 137 ? 53.702  -32.678 82.099  1.00 47.98  ? 137 LEU A HG     1 
ATOM   2273  H HD11   . LEU A 1 137 ? 51.660  -33.405 82.934  1.00 48.90  ? 137 LEU A HD11   1 
ATOM   2274  H HD12   . LEU A 1 137 ? 51.704  -33.586 81.356  1.00 48.90  ? 137 LEU A HD12   1 
ATOM   2275  H HD13   . LEU A 1 137 ? 51.916  -34.842 82.306  1.00 48.90  ? 137 LEU A HD13   1 
ATOM   2276  H HD21   . LEU A 1 137 ? 53.759  -33.574 84.258  1.00 47.15  ? 137 LEU A HD21   1 
ATOM   2277  H HD22   . LEU A 1 137 ? 54.047  -35.014 83.651  1.00 47.15  ? 137 LEU A HD22   1 
ATOM   2278  H HD23   . LEU A 1 137 ? 55.132  -33.862 83.511  1.00 47.15  ? 137 LEU A HD23   1 
ATOM   2279  N N      . GLU A 1 138 ? 56.407  -34.832 78.830  1.00 48.93  ? 138 GLU A N      1 
ATOM   2280  C CA     . GLU A 1 138 ? 56.990  -35.854 77.986  1.00 51.31  ? 138 GLU A CA     1 
ATOM   2281  C C      . GLU A 1 138 ? 58.375  -36.211 78.485  1.00 52.98  ? 138 GLU A C      1 
ATOM   2282  O O      . GLU A 1 138 ? 58.727  -37.386 78.574  1.00 54.03  ? 138 GLU A O      1 
ATOM   2283  C CB     . GLU A 1 138 ? 57.042  -35.353 76.544  1.00 54.89  ? 138 GLU A CB     1 
ATOM   2284  C CG     . GLU A 1 138 ? 57.921  -36.151 75.602  1.00 61.75  ? 138 GLU A CG     1 
ATOM   2285  C CD     . GLU A 1 138 ? 58.074  -35.463 74.264  1.00 63.50  ? 138 GLU A CD     1 
ATOM   2286  O OE1    . GLU A 1 138 ? 57.532  -35.982 73.261  1.00 62.17  ? 138 GLU A OE1    1 
ATOM   2287  O OE2    . GLU A 1 138 ? 58.730  -34.397 74.222  1.00 62.33  ? 138 GLU A OE2    1 
ATOM   2288  H H      . GLU A 1 138 ? 56.057  -34.179 78.394  1.00 59.11  ? 138 GLU A H      1 
ATOM   2289  H HA     . GLU A 1 138 ? 56.438  -36.651 78.015  1.00 61.97  ? 138 GLU A HA     1 
ATOM   2290  H HB2    . GLU A 1 138 ? 56.142  -35.367 76.183  1.00 66.26  ? 138 GLU A HB2    1 
ATOM   2291  H HB3    . GLU A 1 138 ? 57.374  -34.442 76.549  1.00 66.26  ? 138 GLU A HB3    1 
ATOM   2292  H HG2    . GLU A 1 138 ? 58.802  -36.251 75.995  1.00 74.49  ? 138 GLU A HG2    1 
ATOM   2293  H HG3    . GLU A 1 138 ? 57.520  -37.021 75.452  1.00 74.49  ? 138 GLU A HG3    1 
ATOM   2294  N N      . GLY A 1 139 ? 59.128  -35.192 78.882  1.00 53.58  ? 139 GLY A N      1 
ATOM   2295  C CA     . GLY A 1 139 ? 60.491  -35.397 79.318  1.00 56.10  ? 139 GLY A CA     1 
ATOM   2296  C C      . GLY A 1 139 ? 60.594  -35.809 80.765  1.00 54.68  ? 139 GLY A C      1 
ATOM   2297  O O      . GLY A 1 139 ? 61.495  -36.559 81.136  1.00 58.31  ? 139 GLY A O      1 
ATOM   2298  H H      . GLY A 1 139 ? 58.868  -34.373 78.907  1.00 64.69  ? 139 GLY A H      1 
ATOM   2299  H HA2    . GLY A 1 139 ? 60.900  -36.088 78.774  1.00 67.71  ? 139 GLY A HA2    1 
ATOM   2300  H HA3    . GLY A 1 139 ? 60.993  -34.576 79.198  1.00 67.71  ? 139 GLY A HA3    1 
ATOM   2301  N N      . ARG A 1 140 ? 59.677  -35.314 81.585  1.00 50.92  ? 140 ARG A N      1 
ATOM   2302  C CA     . ARG A 1 140 ? 59.773  -35.525 83.023  1.00 48.98  ? 140 ARG A CA     1 
ATOM   2303  C C      . ARG A 1 140 ? 59.013  -36.755 83.476  1.00 49.61  ? 140 ARG A C      1 
ATOM   2304  O O      . ARG A 1 140 ? 59.239  -37.266 84.579  1.00 47.87  ? 140 ARG A O      1 
ATOM   2305  C CB     . ARG A 1 140 ? 59.210  -34.304 83.754  1.00 46.91  ? 140 ARG A CB     1 
ATOM   2306  C CG     . ARG A 1 140 ? 59.704  -32.994 83.174  1.00 46.72  ? 140 ARG A CG     1 
ATOM   2307  C CD     . ARG A 1 140 ? 58.975  -31.799 83.730  1.00 45.26  ? 140 ARG A CD     1 
ATOM   2308  N NE     . ARG A 1 140 ? 59.167  -30.648 82.853  1.00 47.93  ? 140 ARG A NE     1 
ATOM   2309  C CZ     . ARG A 1 140 ? 60.169  -29.781 82.934  1.00 49.61  ? 140 ARG A CZ     1 
ATOM   2310  N NH1    . ARG A 1 140 ? 61.125  -29.924 83.852  1.00 49.01  ? 140 ARG A NH1    1 
ATOM   2311  N NH2    . ARG A 1 140 ? 60.224  -28.776 82.065  1.00 49.79  ? 140 ARG A NH2    1 
ATOM   2312  H H      . ARG A 1 140 ? 58.993  -34.856 81.337  1.00 61.49  ? 140 ARG A H      1 
ATOM   2313  H HA     . ARG A 1 140 ? 60.704  -35.630 83.272  1.00 59.17  ? 140 ARG A HA     1 
ATOM   2314  H HB2    . ARG A 1 140 ? 58.243  -34.315 83.689  1.00 56.68  ? 140 ARG A HB2    1 
ATOM   2315  H HB3    . ARG A 1 140 ? 59.481  -34.341 84.685  1.00 56.68  ? 140 ARG A HB3    1 
ATOM   2316  H HG2    . ARG A 1 140 ? 60.646  -32.892 83.380  1.00 56.45  ? 140 ARG A HG2    1 
ATOM   2317  H HG3    . ARG A 1 140 ? 59.573  -33.004 82.213  1.00 56.45  ? 140 ARG A HG3    1 
ATOM   2318  H HD2    . ARG A 1 140 ? 58.026  -31.992 83.783  1.00 54.70  ? 140 ARG A HD2    1 
ATOM   2319  H HD3    . ARG A 1 140 ? 59.329  -31.582 84.607  1.00 54.70  ? 140 ARG A HD3    1 
ATOM   2320  H HE     . ARG A 1 140 ? 58.584  -30.521 82.234  1.00 57.91  ? 140 ARG A HE     1 
ATOM   2321  H HH11   . ARG A 1 140 ? 61.090  -30.576 84.411  1.00 59.20  ? 140 ARG A HH11   1 
ATOM   2322  H HH12   . ARG A 1 140 ? 61.771  -29.358 83.892  1.00 59.20  ? 140 ARG A HH12   1 
ATOM   2323  H HH21   . ARG A 1 140 ? 59.609  -28.688 81.471  1.00 60.14  ? 140 ARG A HH21   1 
ATOM   2324  H HH22   . ARG A 1 140 ? 60.870  -28.210 82.104  1.00 60.14  ? 140 ARG A HH22   1 
ATOM   2325  N N      . ILE A 1 141 ? 58.128  -37.245 82.614  1.00 56.29  ? 141 ILE A N      1 
ATOM   2326  C CA     . ILE A 1 141 ? 57.294  -38.377 82.980  1.00 57.71  ? 141 ILE A CA     1 
ATOM   2327  C C      . ILE A 1 141 ? 57.881  -39.694 82.483  1.00 59.33  ? 141 ILE A C      1 
ATOM   2328  O O      . ILE A 1 141 ? 57.432  -40.769 82.878  1.00 60.16  ? 141 ILE A O      1 
ATOM   2329  C CB     . ILE A 1 141 ? 55.851  -38.193 82.451  1.00 52.15  ? 141 ILE A CB     1 
ATOM   2330  C CG1    . ILE A 1 141 ? 54.870  -38.924 83.357  1.00 52.02  ? 141 ILE A CG1    1 
ATOM   2331  C CG2    . ILE A 1 141 ? 55.715  -38.625 81.002  1.00 54.80  ? 141 ILE A CG2    1 
ATOM   2332  C CD1    . ILE A 1 141 ? 54.713  -38.276 84.723  1.00 53.91  ? 141 ILE A CD1    1 
ATOM   2333  H H      . ILE A 1 141 ? 57.994  -36.942 81.820  1.00 67.94  ? 141 ILE A H      1 
ATOM   2334  H HA     . ILE A 1 141 ? 57.247  -38.425 83.948  1.00 69.64  ? 141 ILE A HA     1 
ATOM   2335  H HB     . ILE A 1 141 ? 55.641  -37.247 82.495  1.00 62.98  ? 141 ILE A HB     1 
ATOM   2336  H HG12   . ILE A 1 141 ? 53.998  -38.936 82.931  1.00 62.81  ? 141 ILE A HG12   1 
ATOM   2337  H HG13   . ILE A 1 141 ? 55.184  -39.832 83.492  1.00 62.81  ? 141 ILE A HG13   1 
ATOM   2338  H HG21   . ILE A 1 141 ? 54.797  -38.492 80.717  1.00 66.15  ? 141 ILE A HG21   1 
ATOM   2339  H HG22   . ILE A 1 141 ? 56.312  -38.091 80.456  1.00 66.15  ? 141 ILE A HG22   1 
ATOM   2340  H HG23   . ILE A 1 141 ? 55.951  -39.564 80.929  1.00 66.15  ? 141 ILE A HG23   1 
ATOM   2341  H HD11   . ILE A 1 141 ? 54.078  -38.790 85.245  1.00 65.08  ? 141 ILE A HD11   1 
ATOM   2342  H HD12   . ILE A 1 141 ? 55.576  -38.265 85.167  1.00 65.08  ? 141 ILE A HD12   1 
ATOM   2343  H HD13   . ILE A 1 141 ? 54.389  -37.369 84.607  1.00 65.08  ? 141 ILE A HD13   1 
ATOM   2344  N N      . LYS A 1 142 ? 58.892  -39.608 81.627  1.00 56.08  ? 142 LYS A N      1 
ATOM   2345  C CA     . LYS A 1 142 ? 59.431  -40.799 80.991  1.00 53.17  ? 142 LYS A CA     1 
ATOM   2346  C C      . LYS A 1 142 ? 60.056  -41.643 82.099  1.00 54.59  ? 142 LYS A C      1 
ATOM   2347  O O      . LYS A 1 142 ? 60.909  -41.167 82.849  1.00 55.95  ? 142 LYS A O      1 
ATOM   2348  C CB     . LYS A 1 142 ? 60.433  -40.406 79.889  1.00 52.14  ? 142 LYS A CB     1 
ATOM   2349  C CG     . LYS A 1 142 ? 61.189  -41.536 79.211  1.00 54.20  ? 142 LYS A CG     1 
ATOM   2350  C CD     . LYS A 1 142 ? 62.023  -41.007 78.032  1.00 57.80  ? 142 LYS A CD     1 
ATOM   2351  C CE     . LYS A 1 142 ? 62.869  -42.121 77.377  1.00 60.49  ? 142 LYS A CE     1 
ATOM   2352  N NZ     . LYS A 1 142 ? 63.634  -41.690 76.157  1.00 57.48  ? 142 LYS A NZ     1 
ATOM   2353  H H      . LYS A 1 142 ? 59.282  -38.876 81.400  1.00 67.68  ? 142 LYS A H      1 
ATOM   2354  H HA     . LYS A 1 142 ? 58.709  -41.306 80.586  1.00 64.19  ? 142 LYS A HA     1 
ATOM   2355  H HB2    . LYS A 1 142 ? 59.949  -39.930 79.196  1.00 62.95  ? 142 LYS A HB2    1 
ATOM   2356  H HB3    . LYS A 1 142 ? 61.095  -39.815 80.280  1.00 62.95  ? 142 LYS A HB3    1 
ATOM   2357  H HG2    . LYS A 1 142 ? 61.790  -41.951 79.849  1.00 65.43  ? 142 LYS A HG2    1 
ATOM   2358  H HG3    . LYS A 1 142 ? 60.556  -42.188 78.870  1.00 65.43  ? 142 LYS A HG3    1 
ATOM   2359  H HD2    . LYS A 1 142 ? 61.427  -40.644 77.358  1.00 69.75  ? 142 LYS A HD2    1 
ATOM   2360  H HD3    . LYS A 1 142 ? 62.625  -40.318 78.352  1.00 69.75  ? 142 LYS A HD3    1 
ATOM   2361  H HE2    . LYS A 1 142 ? 63.512  -42.444 78.028  1.00 72.98  ? 142 LYS A HE2    1 
ATOM   2362  H HE3    . LYS A 1 142 ? 62.279  -42.844 77.114  1.00 72.98  ? 142 LYS A HE3    1 
ATOM   2363  H HZ1    . LYS A 1 142 ? 64.098  -42.376 75.831  1.00 69.37  ? 142 LYS A HZ1    1 
ATOM   2364  H HZ2    . LYS A 1 142 ? 63.071  -41.399 75.532  1.00 69.37  ? 142 LYS A HZ2    1 
ATOM   2365  H HZ3    . LYS A 1 142 ? 64.197  -41.034 76.367  1.00 69.37  ? 142 LYS A HZ3    1 
ATOM   2366  N N      . GLY A 1 143 ? 59.595  -42.884 82.217  1.00 58.36  ? 143 GLY A N      1 
ATOM   2367  C CA     . GLY A 1 143 ? 60.024  -43.783 83.280  1.00 62.57  ? 143 GLY A CA     1 
ATOM   2368  C C      . GLY A 1 143 ? 59.117  -43.857 84.508  1.00 62.63  ? 143 GLY A C      1 
ATOM   2369  O O      . GLY A 1 143 ? 59.142  -44.842 85.239  1.00 66.57  ? 143 GLY A O      1 
ATOM   2370  H H      . GLY A 1 143 ? 59.021  -43.234 81.681  1.00 70.42  ? 143 GLY A H      1 
ATOM   2371  H HA2    . GLY A 1 143 ? 60.100  -44.679 82.916  1.00 75.48  ? 143 GLY A HA2    1 
ATOM   2372  H HA3    . GLY A 1 143 ? 60.905  -43.510 83.580  1.00 75.48  ? 143 GLY A HA3    1 
ATOM   2373  N N      . LYS A 1 144 ? 58.340  -42.808 84.756  1.00 54.85  ? 144 LYS A N      1 
ATOM   2374  C CA     . LYS A 1 144 ? 57.379  -42.783 85.863  1.00 52.02  ? 144 LYS A CA     1 
ATOM   2375  C C      . LYS A 1 144 ? 55.955  -43.134 85.446  1.00 54.43  ? 144 LYS A C      1 
ATOM   2376  O O      . LYS A 1 144 ? 55.022  -42.918 86.217  1.00 53.33  ? 144 LYS A O      1 
ATOM   2377  C CB     . LYS A 1 144 ? 57.419  -41.434 86.593  1.00 52.19  ? 144 LYS A CB     1 
ATOM   2378  C CG     . LYS A 1 144 ? 58.659  -41.284 87.475  1.00 51.86  ? 144 LYS A CG     1 
ATOM   2379  C CD     . LYS A 1 144 ? 58.592  -42.299 88.633  1.00 50.92  ? 144 LYS A CD     1 
ATOM   2380  C CE     . LYS A 1 144 ? 59.836  -42.337 89.501  1.00 51.29  ? 144 LYS A CE     1 
ATOM   2381  N NZ     . LYS A 1 144 ? 60.136  -41.076 90.202  1.00 53.03  ? 144 LYS A NZ     1 
ATOM   2382  H H      . LYS A 1 144 ? 58.349  -42.085 84.291  1.00 66.21  ? 144 LYS A H      1 
ATOM   2383  H HA     . LYS A 1 144 ? 57.654  -43.456 86.506  1.00 62.82  ? 144 LYS A HA     1 
ATOM   2384  H HB2    . LYS A 1 144 ? 57.427  -40.719 85.938  1.00 63.02  ? 144 LYS A HB2    1 
ATOM   2385  H HB3    . LYS A 1 144 ? 56.635  -41.358 87.160  1.00 63.02  ? 144 LYS A HB3    1 
ATOM   2386  H HG2    . LYS A 1 144 ? 59.455  -41.463 86.951  1.00 62.62  ? 144 LYS A HG2    1 
ATOM   2387  H HG3    . LYS A 1 144 ? 58.688  -40.389 87.847  1.00 62.62  ? 144 LYS A HG3    1 
ATOM   2388  H HD2    . LYS A 1 144 ? 57.841  -42.071 89.203  1.00 61.49  ? 144 LYS A HD2    1 
ATOM   2389  H HD3    . LYS A 1 144 ? 58.464  -43.186 88.262  1.00 61.49  ? 144 LYS A HD3    1 
ATOM   2390  H HE2    . LYS A 1 144 ? 59.723  -43.027 90.174  1.00 61.94  ? 144 LYS A HE2    1 
ATOM   2391  H HE3    . LYS A 1 144 ? 60.599  -42.550 88.941  1.00 61.94  ? 144 LYS A HE3    1 
ATOM   2392  H HZ1    . LYS A 1 144 ? 60.874  -41.167 90.691  1.00 64.03  ? 144 LYS A HZ1    1 
ATOM   2393  H HZ2    . LYS A 1 144 ? 60.259  -40.422 89.611  1.00 64.03  ? 144 LYS A HZ2    1 
ATOM   2394  H HZ3    . LYS A 1 144 ? 59.459  -40.858 90.738  1.00 64.03  ? 144 LYS A HZ3    1 
ATOM   2395  N N      . GLU A 1 145 ? 55.774  -43.596 84.210  1.00 58.59  ? 145 GLU A N      1 
ATOM   2396  C CA     . GLU A 1 145 ? 54.431  -43.876 83.695  1.00 56.31  ? 145 GLU A CA     1 
ATOM   2397  C C      . GLU A 1 145 ? 53.597  -44.738 84.649  1.00 54.29  ? 145 GLU A C      1 
ATOM   2398  O O      . GLU A 1 145 ? 52.452  -44.417 84.927  1.00 55.59  ? 145 GLU A O      1 
ATOM   2399  C CB     . GLU A 1 145 ? 54.503  -44.565 82.330  1.00 54.73  ? 145 GLU A CB     1 
ATOM   2400  C CG     . GLU A 1 145 ? 54.944  -43.660 81.202  1.00 56.97  ? 145 GLU A CG     1 
ATOM   2401  C CD     . GLU A 1 145 ? 56.440  -43.525 81.099  1.00 61.02  ? 145 GLU A CD     1 
ATOM   2402  O OE1    . GLU A 1 145 ? 57.152  -44.101 81.947  1.00 60.59  ? 145 GLU A OE1    1 
ATOM   2403  O OE2    . GLU A 1 145 ? 56.903  -42.842 80.162  1.00 64.00  ? 145 GLU A OE2    1 
ATOM   2404  H H      . GLU A 1 145 ? 56.407  -43.756 83.651  1.00 70.69  ? 145 GLU A H      1 
ATOM   2405  H HA     . GLU A 1 145 ? 53.964  -43.035 83.575  1.00 67.97  ? 145 GLU A HA     1 
ATOM   2406  H HB2    . GLU A 1 145 ? 55.136  -45.298 82.384  1.00 66.07  ? 145 GLU A HB2    1 
ATOM   2407  H HB3    . GLU A 1 145 ? 53.623  -44.907 82.107  1.00 66.07  ? 145 GLU A HB3    1 
ATOM   2408  H HG2    . GLU A 1 145 ? 54.619  -44.022 80.362  1.00 68.75  ? 145 GLU A HG2    1 
ATOM   2409  H HG3    . GLU A 1 145 ? 54.574  -42.775 81.345  1.00 68.75  ? 145 GLU A HG3    1 
ATOM   2410  N N      . ASN A 1 146 ? 54.175  -45.809 85.175  1.00 53.11  ? 146 ASN A N      1 
ATOM   2411  C CA     . ASN A 1 146 ? 53.436  -46.724 86.040  1.00 49.10  ? 146 ASN A CA     1 
ATOM   2412  C C      . ASN A 1 146 ? 53.052  -46.114 87.382  1.00 44.59  ? 146 ASN A C      1 
ATOM   2413  O O      . ASN A 1 146 ? 52.063  -46.513 87.984  1.00 46.01  ? 146 ASN A O      1 
ATOM   2414  C CB     . ASN A 1 146 ? 54.253  -47.993 86.270  1.00 53.23  ? 146 ASN A CB     1 
ATOM   2415  C CG     . ASN A 1 146 ? 54.346  -48.861 85.025  1.00 56.92  ? 146 ASN A CG     1 
ATOM   2416  O OD1    . ASN A 1 146 ? 53.836  -48.504 83.956  1.00 53.89  ? 146 ASN A OD1    1 
ATOM   2417  N ND2    . ASN A 1 146 ? 55.022  -49.999 85.152  1.00 59.99  ? 146 ASN A ND2    1 
ATOM   2418  H H      . ASN A 1 146 ? 54.996  -46.031 85.048  1.00 64.12  ? 146 ASN A H      1 
ATOM   2419  H HA     . ASN A 1 146 ? 52.616  -46.980 85.590  1.00 59.30  ? 146 ASN A HA     1 
ATOM   2420  H HB2    . ASN A 1 146 ? 55.153  -47.747 86.533  1.00 64.27  ? 146 ASN A HB2    1 
ATOM   2421  H HB3    . ASN A 1 146 ? 53.834  -48.517 86.970  1.00 64.27  ? 146 ASN A HB3    1 
ATOM   2422  H HD21   . ASN A 1 146 ? 55.106  -50.527 84.479  1.00 72.38  ? 146 ASN A HD21   1 
ATOM   2423  H HD22   . ASN A 1 146 ? 55.376  -50.207 85.908  1.00 72.38  ? 146 ASN A HD22   1 
ATOM   2424  N N      . GLU A 1 147 ? 53.845  -45.174 87.873  1.00 41.82  ? 147 GLU A N      1 
ATOM   2425  C CA     . GLU A 1 147 ? 53.498  -44.514 89.114  1.00 37.63  ? 147 GLU A CA     1 
ATOM   2426  C C      . GLU A 1 147 ? 52.218  -43.724 88.847  1.00 38.22  ? 147 GLU A C      1 
ATOM   2427  O O      . GLU A 1 147 ? 51.288  -43.750 89.643  1.00 37.66  ? 147 GLU A O      1 
ATOM   2428  C CB     . GLU A 1 147 ? 54.620  -43.594 89.604  1.00 38.99  ? 147 GLU A CB     1 
ATOM   2429  C CG     . GLU A 1 147 ? 55.962  -44.284 89.938  1.00 44.19  ? 147 GLU A CG     1 
ATOM   2430  C CD     . GLU A 1 147 ? 55.916  -45.239 91.122  1.00 45.75  ? 147 GLU A CD     1 
ATOM   2431  O OE1    . GLU A 1 147 ? 54.921  -45.208 91.883  1.00 44.12  ? 147 GLU A OE1    1 
ATOM   2432  O OE2    . GLU A 1 147 ? 56.890  -46.020 91.278  1.00 44.82  ? 147 GLU A OE2    1 
ATOM   2433  H H      . GLU A 1 147 ? 54.577  -44.904 87.512  1.00 50.57  ? 147 GLU A H      1 
ATOM   2434  H HA     . GLU A 1 147 ? 53.318  -45.177 89.799  1.00 45.55  ? 147 GLU A HA     1 
ATOM   2435  H HB2    . GLU A 1 147 ? 54.797  -42.935 88.915  1.00 47.18  ? 147 GLU A HB2    1 
ATOM   2436  H HB3    . GLU A 1 147 ? 54.317  -43.145 90.409  1.00 47.18  ? 147 GLU A HB3    1 
ATOM   2437  H HG2    . GLU A 1 147 ? 56.249  -44.792 89.163  1.00 53.41  ? 147 GLU A HG2    1 
ATOM   2438  H HG3    . GLU A 1 147 ? 56.619  -43.599 90.140  1.00 53.41  ? 147 GLU A HG3    1 
ATOM   2439  N N      . VAL A 1 148 ? 52.154  -43.072 87.689  1.00 40.22  ? 148 VAL A N      1 
ATOM   2440  C CA     . VAL A 1 148 ? 50.975  -42.286 87.309  1.00 40.73  ? 148 VAL A CA     1 
ATOM   2441  C C      . VAL A 1 148 ? 49.714  -43.142 87.317  1.00 42.72  ? 148 VAL A C      1 
ATOM   2442  O O      . VAL A 1 148 ? 48.711  -42.764 87.926  1.00 43.58  ? 148 VAL A O      1 
ATOM   2443  C CB     . VAL A 1 148 ? 51.124  -41.652 85.898  1.00 35.57  ? 148 VAL A CB     1 
ATOM   2444  C CG1    . VAL A 1 148 ? 49.912  -40.817 85.552  1.00 31.94  ? 148 VAL A CG1    1 
ATOM   2445  C CG2    . VAL A 1 148 ? 52.345  -40.783 85.832  1.00 38.92  ? 148 VAL A CG2    1 
ATOM   2446  H H      . VAL A 1 148 ? 52.781  -43.068 87.101  1.00 48.66  ? 148 VAL A H      1 
ATOM   2447  H HA     . VAL A 1 148 ? 50.855  -41.568 87.950  1.00 49.26  ? 148 VAL A HA     1 
ATOM   2448  H HB     . VAL A 1 148 ? 51.211  -42.355 85.236  1.00 43.07  ? 148 VAL A HB     1 
ATOM   2449  H HG11   . VAL A 1 148 ? 50.034  -40.436 84.669  1.00 38.72  ? 148 VAL A HG11   1 
ATOM   2450  H HG12   . VAL A 1 148 ? 49.125  -41.384 85.562  1.00 38.72  ? 148 VAL A HG12   1 
ATOM   2451  H HG13   . VAL A 1 148 ? 49.819  -40.109 86.208  1.00 38.72  ? 148 VAL A HG13   1 
ATOM   2452  H HG21   . VAL A 1 148 ? 52.413  -40.401 84.943  1.00 47.10  ? 148 VAL A HG21   1 
ATOM   2453  H HG22   . VAL A 1 148 ? 52.265  -40.076 86.491  1.00 47.10  ? 148 VAL A HG22   1 
ATOM   2454  H HG23   . VAL A 1 148 ? 53.128  -41.324 86.021  1.00 47.10  ? 148 VAL A HG23   1 
ATOM   2455  N N      . ARG A 1 149 ? 49.753  -44.276 86.621  1.00 40.95  ? 149 ARG A N      1 
ATOM   2456  C CA     . ARG A 1 149 ? 48.581  -45.135 86.514  1.00 38.46  ? 149 ARG A CA     1 
ATOM   2457  C C      . ARG A 1 149 ? 48.098  -45.593 87.880  1.00 40.06  ? 149 ARG A C      1 
ATOM   2458  O O      . ARG A 1 149 ? 46.904  -45.698 88.102  1.00 36.31  ? 149 ARG A O      1 
ATOM   2459  C CB     . ARG A 1 149 ? 48.867  -46.354 85.655  1.00 39.15  ? 149 ARG A CB     1 
ATOM   2460  C CG     . ARG A 1 149 ? 49.047  -46.070 84.188  1.00 37.49  ? 149 ARG A CG     1 
ATOM   2461  C CD     . ARG A 1 149 ? 49.392  -47.357 83.485  1.00 39.94  ? 149 ARG A CD     1 
ATOM   2462  N NE     . ARG A 1 149 ? 49.281  -47.244 82.035  1.00 43.00  ? 149 ARG A NE     1 
ATOM   2463  C CZ     . ARG A 1 149 ? 50.310  -47.157 81.202  1.00 46.37  ? 149 ARG A CZ     1 
ATOM   2464  N NH1    . ARG A 1 149 ? 51.557  -47.168 81.664  1.00 45.15  ? 149 ARG A NH1    1 
ATOM   2465  N NH2    . ARG A 1 149 ? 50.091  -47.061 79.897  1.00 47.71  ? 149 ARG A NH2    1 
ATOM   2466  H H      . ARG A 1 149 ? 50.445  -44.568 86.203  1.00 49.54  ? 149 ARG A H      1 
ATOM   2467  H HA     . ARG A 1 149 ? 47.862  -44.636 86.094  1.00 46.54  ? 149 ARG A HA     1 
ATOM   2468  H HB2    . ARG A 1 149 ? 49.683  -46.772 85.974  1.00 47.37  ? 149 ARG A HB2    1 
ATOM   2469  H HB3    . ARG A 1 149 ? 48.128  -46.976 85.744  1.00 47.37  ? 149 ARG A HB3    1 
ATOM   2470  H HG2    . ARG A 1 149 ? 48.220  -45.723 83.816  1.00 45.38  ? 149 ARG A HG2    1 
ATOM   2471  H HG3    . ARG A 1 149 ? 49.773  -45.440 84.061  1.00 45.38  ? 149 ARG A HG3    1 
ATOM   2472  H HD2    . ARG A 1 149 ? 50.306  -47.600 83.699  1.00 48.32  ? 149 ARG A HD2    1 
ATOM   2473  H HD3    . ARG A 1 149 ? 48.784  -48.053 83.780  1.00 48.32  ? 149 ARG A HD3    1 
ATOM   2474  H HE     . ARG A 1 149 ? 48.491  -47.234 81.695  1.00 51.99  ? 149 ARG A HE     1 
ATOM   2475  H HH11   . ARG A 1 149 ? 51.701  -47.231 82.510  1.00 54.57  ? 149 ARG A HH11   1 
ATOM   2476  H HH12   . ARG A 1 149 ? 52.218  -47.111 81.118  1.00 54.57  ? 149 ARG A HH12   1 
ATOM   2477  H HH21   . ARG A 1 149 ? 49.285  -47.054 79.596  1.00 57.65  ? 149 ARG A HH21   1 
ATOM   2478  H HH22   . ARG A 1 149 ? 50.754  -47.003 79.353  1.00 57.65  ? 149 ARG A HH22   1 
ATOM   2479  N N      . LEU A 1 150 ? 49.033  -45.853 88.794  1.00 46.54  ? 150 LEU A N      1 
ATOM   2480  C CA     . LEU A 1 150 ? 48.700  -46.281 90.157  1.00 43.29  ? 150 LEU A CA     1 
ATOM   2481  C C      . LEU A 1 150 ? 47.855  -45.222 90.862  1.00 38.61  ? 150 LEU A C      1 
ATOM   2482  O O      . LEU A 1 150 ? 46.812  -45.536 91.426  1.00 31.85  ? 150 LEU A O      1 
ATOM   2483  C CB     . LEU A 1 150 ? 49.980  -46.550 90.958  1.00 39.95  ? 150 LEU A CB     1 
ATOM   2484  C CG     . LEU A 1 150 ? 50.745  -47.842 90.673  1.00 41.07  ? 150 LEU A CG     1 
ATOM   2485  C CD1    . LEU A 1 150 ? 52.063  -47.847 91.412  1.00 43.44  ? 150 LEU A CD1    1 
ATOM   2486  C CD2    . LEU A 1 150 ? 49.940  -49.036 91.093  1.00 44.13  ? 150 LEU A CD2    1 
ATOM   2487  H H      . LEU A 1 150 ? 49.878  -45.789 88.648  1.00 56.24  ? 150 LEU A H      1 
ATOM   2488  H HA     . LEU A 1 150 ? 48.187  -47.103 90.118  1.00 52.33  ? 150 LEU A HA     1 
ATOM   2489  H HB2    . LEU A 1 150 ? 50.594  -45.817 90.794  1.00 48.33  ? 150 LEU A HB2    1 
ATOM   2490  H HB3    . LEU A 1 150 ? 49.745  -46.563 91.899  1.00 48.33  ? 150 LEU A HB3    1 
ATOM   2491  H HG     . LEU A 1 150 ? 50.925  -47.910 89.722  1.00 49.68  ? 150 LEU A HG     1 
ATOM   2492  H HD11   . LEU A 1 150 ? 52.531  -48.674 91.218  1.00 52.51  ? 150 LEU A HD11   1 
ATOM   2493  H HD12   . LEU A 1 150 ? 52.593  -47.089 91.118  1.00 52.51  ? 150 LEU A HD12   1 
ATOM   2494  H HD13   . LEU A 1 150 ? 51.891  -47.780 92.364  1.00 52.51  ? 150 LEU A HD13   1 
ATOM   2495  H HD21   . LEU A 1 150 ? 50.446  -49.841 90.902  1.00 53.35  ? 150 LEU A HD21   1 
ATOM   2496  H HD22   . LEU A 1 150 ? 49.760  -48.975 92.044  1.00 53.35  ? 150 LEU A HD22   1 
ATOM   2497  H HD23   . LEU A 1 150 ? 49.106  -49.043 90.598  1.00 53.35  ? 150 LEU A HD23   1 
ATOM   2498  N N      . LEU A 1 151 ? 48.304  -43.970 90.789  1.00 39.28  ? 151 LEU A N      1 
ATOM   2499  C CA     . LEU A 1 151 ? 47.588  -42.826 91.362  1.00 35.12  ? 151 LEU A CA     1 
ATOM   2500  C C      . LEU A 1 151 ? 46.195  -42.669 90.761  1.00 38.66  ? 151 LEU A C      1 
ATOM   2501  O O      . LEU A 1 151 ? 45.205  -42.468 91.487  1.00 38.41  ? 151 LEU A O      1 
ATOM   2502  C CB     . LEU A 1 151 ? 48.382  -41.532 91.148  1.00 31.71  ? 151 LEU A CB     1 
ATOM   2503  C CG     . LEU A 1 151 ? 47.623  -40.232 91.452  1.00 28.80  ? 151 LEU A CG     1 
ATOM   2504  C CD1    . LEU A 1 151 ? 47.144  -40.193 92.896  1.00 25.72  ? 151 LEU A CD1    1 
ATOM   2505  C CD2    . LEU A 1 151 ? 48.488  -39.020 91.144  1.00 27.62  ? 151 LEU A CD2    1 
ATOM   2506  H H      . LEU A 1 151 ? 49.040  -43.751 90.403  1.00 47.53  ? 151 LEU A H      1 
ATOM   2507  H HA     . LEU A 1 151 ? 47.489  -42.962 92.317  1.00 42.54  ? 151 LEU A HA     1 
ATOM   2508  H HB2    . LEU A 1 151 ? 49.164  -41.553 91.722  1.00 38.45  ? 151 LEU A HB2    1 
ATOM   2509  H HB3    . LEU A 1 151 ? 48.663  -41.494 90.221  1.00 38.45  ? 151 LEU A HB3    1 
ATOM   2510  H HG     . LEU A 1 151 ? 46.841  -40.188 90.881  1.00 34.95  ? 151 LEU A HG     1 
ATOM   2511  H HD11   . LEU A 1 151 ? 46.671  -39.360 93.049  1.00 31.26  ? 151 LEU A HD11   1 
ATOM   2512  H HD12   . LEU A 1 151 ? 46.550  -40.944 93.052  1.00 31.26  ? 151 LEU A HD12   1 
ATOM   2513  H HD13   . LEU A 1 151 ? 47.912  -40.251 93.485  1.00 31.26  ? 151 LEU A HD13   1 
ATOM   2514  H HD21   . LEU A 1 151 ? 47.986  -38.215 91.345  1.00 33.54  ? 151 LEU A HD21   1 
ATOM   2515  H HD22   . LEU A 1 151 ? 49.288  -39.056 91.692  1.00 33.54  ? 151 LEU A HD22   1 
ATOM   2516  H HD23   . LEU A 1 151 ? 48.729  -39.035 90.205  1.00 33.54  ? 151 LEU A HD23   1 
ATOM   2517  N N      . LYS A 1 152 ? 46.140  -42.693 89.429  1.00 39.58  ? 152 LYS A N      1 
ATOM   2518  C CA     . LYS A 1 152 ? 44.885  -42.624 88.692  1.00 30.34  ? 152 LYS A CA     1 
ATOM   2519  C C      . LYS A 1 152 ? 43.914  -43.729 89.139  1.00 32.29  ? 152 LYS A C      1 
ATOM   2520  O O      . LYS A 1 152 ? 42.779  -43.443 89.497  1.00 35.59  ? 152 LYS A O      1 
ATOM   2521  C CB     . LYS A 1 152 ? 45.171  -42.704 87.197  1.00 28.62  ? 152 LYS A CB     1 
ATOM   2522  C CG     . LYS A 1 152 ? 45.901  -41.472 86.658  1.00 30.69  ? 152 LYS A CG     1 
ATOM   2523  C CD     . LYS A 1 152 ? 46.072  -41.538 85.129  1.00 35.58  ? 152 LYS A CD     1 
ATOM   2524  C CE     . LYS A 1 152 ? 46.538  -40.201 84.530  1.00 34.58  ? 152 LYS A CE     1 
ATOM   2525  N NZ     . LYS A 1 152 ? 46.748  -40.259 83.051  1.00 32.80  ? 152 LYS A NZ     1 
ATOM   2526  H H      . LYS A 1 152 ? 46.833  -42.749 88.923  1.00 47.89  ? 152 LYS A H      1 
ATOM   2527  H HA     . LYS A 1 152 ? 44.463  -41.769 88.869  1.00 36.80  ? 152 LYS A HA     1 
ATOM   2528  H HB2    . LYS A 1 152 ? 45.726  -43.480 87.024  1.00 34.73  ? 152 LYS A HB2    1 
ATOM   2529  H HB3    . LYS A 1 152 ? 44.331  -42.785 86.720  1.00 34.73  ? 152 LYS A HB3    1 
ATOM   2530  H HG2    . LYS A 1 152 ? 45.389  -40.677 86.873  1.00 37.22  ? 152 LYS A HG2    1 
ATOM   2531  H HG3    . LYS A 1 152 ? 46.783  -41.422 87.061  1.00 37.22  ? 152 LYS A HG3    1 
ATOM   2532  H HD2    . LYS A 1 152 ? 46.736  -42.211 84.913  1.00 43.08  ? 152 LYS A HD2    1 
ATOM   2533  H HD3    . LYS A 1 152 ? 45.221  -41.768 84.725  1.00 43.08  ? 152 LYS A HD3    1 
ATOM   2534  H HE2    . LYS A 1 152 ? 45.866  -39.525 84.709  1.00 41.89  ? 152 LYS A HE2    1 
ATOM   2535  H HE3    . LYS A 1 152 ? 47.379  -39.948 84.941  1.00 41.89  ? 152 LYS A HE3    1 
ATOM   2536  H HZ1    . LYS A 1 152 ? 47.016  -39.465 82.751  1.00 39.75  ? 152 LYS A HZ1    1 
ATOM   2537  H HZ2    . LYS A 1 152 ? 47.369  -40.867 82.856  1.00 39.75  ? 152 LYS A HZ2    1 
ATOM   2538  H HZ3    . LYS A 1 152 ? 45.988  -40.481 82.645  1.00 39.75  ? 152 LYS A HZ3    1 
ATOM   2539  N N      . GLY A 1 153 ? 44.366  -44.980 89.134  1.00 40.24  ? 153 GLY A N      1 
ATOM   2540  C CA     . GLY A 1 153 ? 43.530  -46.110 89.518  1.00 44.60  ? 153 GLY A CA     1 
ATOM   2541  C C      . GLY A 1 153 ? 43.007  -46.063 90.948  1.00 46.27  ? 153 GLY A C      1 
ATOM   2542  O O      . GLY A 1 153 ? 41.851  -46.417 91.207  1.00 49.31  ? 153 GLY A O      1 
ATOM   2543  H H      . GLY A 1 153 ? 45.166  -45.202 88.909  1.00 48.68  ? 153 GLY A H      1 
ATOM   2544  H HA2    . GLY A 1 153 ? 42.766  -46.152 88.922  1.00 53.91  ? 153 GLY A HA2    1 
ATOM   2545  H HA3    . GLY A 1 153 ? 44.039  -46.928 89.413  1.00 53.91  ? 153 GLY A HA3    1 
ATOM   2546  N N      . PHE A 1 154 ? 43.882  -45.665 91.876  1.00 39.21  ? 154 PHE A N      1 
ATOM   2547  C CA     . PHE A 1 154 ? 43.528  -45.443 93.275  1.00 32.74  ? 154 PHE A CA     1 
ATOM   2548  C C      . PHE A 1 154 ? 42.387  -44.459 93.382  1.00 32.44  ? 154 PHE A C      1 
ATOM   2549  O O      . PHE A 1 154 ? 41.437  -44.679 94.117  1.00 34.73  ? 154 PHE A O      1 
ATOM   2550  C CB     . PHE A 1 154 ? 44.745  -44.925 94.036  1.00 36.39  ? 154 PHE A CB     1 
ATOM   2551  C CG     . PHE A 1 154 ? 44.472  -44.540 95.473  1.00 38.00  ? 154 PHE A CG     1 
ATOM   2552  C CD1    . PHE A 1 154 ? 44.285  -45.508 96.458  1.00 41.01  ? 154 PHE A CD1    1 
ATOM   2553  C CD2    . PHE A 1 154 ? 44.440  -43.199 95.848  1.00 36.95  ? 154 PHE A CD2    1 
ATOM   2554  C CE1    . PHE A 1 154 ? 44.053  -45.144 97.794  1.00 42.68  ? 154 PHE A CE1    1 
ATOM   2555  C CE2    . PHE A 1 154 ? 44.206  -42.827 97.176  1.00 40.05  ? 154 PHE A CE2    1 
ATOM   2556  C CZ     . PHE A 1 154 ? 44.012  -43.803 98.149  1.00 43.87  ? 154 PHE A CZ     1 
ATOM   2557  H H      . PHE A 1 154 ? 44.712  -45.514 91.710  1.00 47.44  ? 154 PHE A H      1 
ATOM   2558  H HA     . PHE A 1 154 ? 43.249  -46.282 93.675  1.00 39.68  ? 154 PHE A HA     1 
ATOM   2559  H HB2    . PHE A 1 154 ? 45.425  -45.618 94.042  1.00 44.05  ? 154 PHE A HB2    1 
ATOM   2560  H HB3    . PHE A 1 154 ? 45.085  -44.139 93.580  1.00 44.05  ? 154 PHE A HB3    1 
ATOM   2561  H HD1    . PHE A 1 154 ? 44.311  -46.409 96.226  1.00 49.61  ? 154 PHE A HD1    1 
ATOM   2562  H HD2    . PHE A 1 154 ? 44.569  -42.540 95.204  1.00 44.73  ? 154 PHE A HD2    1 
ATOM   2563  H HE1    . PHE A 1 154 ? 43.922  -45.800 98.439  1.00 51.60  ? 154 PHE A HE1    1 
ATOM   2564  H HE2    . PHE A 1 154 ? 44.181  -41.927 97.409  1.00 48.45  ? 154 PHE A HE2    1 
ATOM   2565  H HZ     . PHE A 1 154 ? 43.855  -43.558 99.032  1.00 53.04  ? 154 PHE A HZ     1 
ATOM   2566  N N      . LEU A 1 155 ? 42.465  -43.389 92.605  1.00 31.55  ? 155 LEU A N      1 
ATOM   2567  C CA     . LEU A 1 155 ? 41.442  -42.354 92.601  1.00 30.72  ? 155 LEU A CA     1 
ATOM   2568  C C      . LEU A 1 155 ? 40.144  -42.855 91.949  1.00 32.46  ? 155 LEU A C      1 
ATOM   2569  O O      . LEU A 1 155 ? 39.041  -42.622 92.454  1.00 33.91  ? 155 LEU A O      1 
ATOM   2570  C CB     . LEU A 1 155 ? 41.953  -41.115 91.860  1.00 31.40  ? 155 LEU A CB     1 
ATOM   2571  C CG     . LEU A 1 155 ? 43.133  -40.370 92.481  1.00 28.24  ? 155 LEU A CG     1 
ATOM   2572  C CD1    . LEU A 1 155 ? 43.834  -39.511 91.453  1.00 22.96  ? 155 LEU A CD1    1 
ATOM   2573  C CD2    . LEU A 1 155 ? 42.646  -39.517 93.634  1.00 28.99  ? 155 LEU A CD2    1 
ATOM   2574  H H      . LEU A 1 155 ? 43.113  -43.236 92.060  1.00 38.25  ? 155 LEU A H      1 
ATOM   2575  H HA     . LEU A 1 155 ? 41.242  -42.099 93.516  1.00 37.26  ? 155 LEU A HA     1 
ATOM   2576  H HB2    . LEU A 1 155 ? 42.225  -41.387 90.970  1.00 38.07  ? 155 LEU A HB2    1 
ATOM   2577  H HB3    . LEU A 1 155 ? 41.221  -40.482 91.791  1.00 38.07  ? 155 LEU A HB3    1 
ATOM   2578  H HG     . LEU A 1 155 ? 43.771  -41.013 92.827  1.00 34.28  ? 155 LEU A HG     1 
ATOM   2579  H HD11   . LEU A 1 155 ? 44.576  -39.053 91.879  1.00 27.94  ? 155 LEU A HD11   1 
ATOM   2580  H HD12   . LEU A 1 155 ? 44.162  -40.079 90.738  1.00 27.94  ? 155 LEU A HD12   1 
ATOM   2581  H HD13   . LEU A 1 155 ? 43.204  -38.864 91.100  1.00 27.94  ? 155 LEU A HD13   1 
ATOM   2582  H HD21   . LEU A 1 155 ? 43.402  -39.049 94.021  1.00 35.17  ? 155 LEU A HD21   1 
ATOM   2583  H HD22   . LEU A 1 155 ? 41.996  -38.878 93.301  1.00 35.17  ? 155 LEU A HD22   1 
ATOM   2584  H HD23   . LEU A 1 155 ? 42.236  -40.090 94.300  1.00 35.17  ? 155 LEU A HD23   1 
ATOM   2585  N N      . LYS A 1 156 ? 40.284  -43.467 90.776  1.00 31.35  ? 156 LYS A N      1 
ATOM   2586  C CA     . LYS A 1 156 ? 39.143  -43.921 89.998  1.00 32.38  ? 156 LYS A CA     1 
ATOM   2587  C C      . LYS A 1 156 ? 38.357  -45.016 90.719  1.00 35.17  ? 156 LYS A C      1 
ATOM   2588  O O      . LYS A 1 156 ? 37.186  -45.219 90.441  1.00 43.58  ? 156 LYS A O      1 
ATOM   2589  C CB     . LYS A 1 156 ? 39.627  -44.401 88.622  1.00 32.06  ? 156 LYS A CB     1 
ATOM   2590  C CG     . LYS A 1 156 ? 38.532  -44.901 87.697  1.00 33.76  ? 156 LYS A CG     1 
ATOM   2591  C CD     . LYS A 1 156 ? 38.993  -44.890 86.241  1.00 38.35  ? 156 LYS A CD     1 
ATOM   2592  C CE     . LYS A 1 156 ? 37.972  -45.531 85.324  1.00 39.41  ? 156 LYS A CE     1 
ATOM   2593  N NZ     . LYS A 1 156 ? 38.086  -47.017 85.327  1.00 37.99  ? 156 LYS A NZ     1 
ATOM   2594  H H      . LYS A 1 156 ? 41.043  -43.633 90.407  1.00 38.01  ? 156 LYS A H      1 
ATOM   2595  H HA     . LYS A 1 156 ? 38.543  -43.172 89.857  1.00 39.25  ? 156 LYS A HA     1 
ATOM   2596  H HB2    . LYS A 1 156 ? 40.071  -43.663 88.177  1.00 38.86  ? 156 LYS A HB2    1 
ATOM   2597  H HB3    . LYS A 1 156 ? 40.255  -45.129 88.752  1.00 38.86  ? 156 LYS A HB3    1 
ATOM   2598  H HG2    . LYS A 1 156 ? 38.301  -45.812 87.937  1.00 40.90  ? 156 LYS A HG2    1 
ATOM   2599  H HG3    . LYS A 1 156 ? 37.756  -44.324 87.776  1.00 40.90  ? 156 LYS A HG3    1 
ATOM   2600  H HD2    . LYS A 1 156 ? 39.124  -43.972 85.955  1.00 46.41  ? 156 LYS A HD2    1 
ATOM   2601  H HD3    . LYS A 1 156 ? 39.823  -45.386 86.165  1.00 46.41  ? 156 LYS A HD3    1 
ATOM   2602  H HE2    . LYS A 1 156 ? 37.080  -45.295 85.624  1.00 47.69  ? 156 LYS A HE2    1 
ATOM   2603  H HE3    . LYS A 1 156 ? 38.115  -45.218 84.417  1.00 47.69  ? 156 LYS A HE3    1 
ATOM   2604  H HZ1    . LYS A 1 156 ? 37.477  -47.370 84.782  1.00 45.98  ? 156 LYS A HZ1    1 
ATOM   2605  H HZ2    . LYS A 1 156 ? 38.896  -47.260 85.051  1.00 45.98  ? 156 LYS A HZ2    1 
ATOM   2606  H HZ3    . LYS A 1 156 ? 37.954  -47.330 86.149  1.00 45.98  ? 156 LYS A HZ3    1 
ATOM   2607  N N      . ALA A 1 157 ? 39.001  -45.720 91.643  1.00 26.93  ? 157 ALA A N      1 
ATOM   2608  C CA     . ALA A 1 157 ? 38.338  -46.776 92.404  1.00 28.21  ? 157 ALA A CA     1 
ATOM   2609  C C      . ALA A 1 157 ? 37.466  -46.149 93.475  1.00 29.49  ? 157 ALA A C      1 
ATOM   2610  O O      . ALA A 1 157 ? 36.425  -46.684 93.854  1.00 30.96  ? 157 ALA A O      1 
ATOM   2611  C CB     . ALA A 1 157 ? 39.353  -47.722 93.019  1.00 29.81  ? 157 ALA A CB     1 
ATOM   2612  H H      . ALA A 1 157 ? 39.828  -45.607 91.850  1.00 31.58  ? 157 ALA A H      1 
ATOM   2613  H HA     . ALA A 1 157 ? 37.767  -47.288 91.810  1.00 33.04  ? 157 ALA A HA     1 
ATOM   2614  H HB1    . ALA A 1 157 ? 38.882  -48.409 93.517  1.00 36.16  ? 157 ALA A HB1    1 
ATOM   2615  H HB2    . ALA A 1 157 ? 39.877  -48.126 92.310  1.00 36.16  ? 157 ALA A HB2    1 
ATOM   2616  H HB3    . ALA A 1 157 ? 39.931  -47.220 93.614  1.00 36.16  ? 157 ALA A HB3    1 
ATOM   2617  N N      . ASN A 1 158 ? 37.917  -45.003 93.966  1.00 38.87  ? 158 ASN A N      1 
ATOM   2618  C CA     . ASN A 1 158 ? 37.207  -44.228 94.982  1.00 41.90  ? 158 ASN A CA     1 
ATOM   2619  C C      . ASN A 1 158 ? 36.336  -43.133 94.379  1.00 43.81  ? 158 ASN A C      1 
ATOM   2620  O O      . ASN A 1 158 ? 35.898  -42.226 95.084  1.00 43.34  ? 158 ASN A O      1 
ATOM   2621  C CB     . ASN A 1 158 ? 38.201  -43.663 95.974  1.00 41.29  ? 158 ASN A CB     1 
ATOM   2622  C CG     . ASN A 1 158 ? 39.015  -44.751 96.613  1.00 46.59  ? 158 ASN A CG     1 
ATOM   2623  O OD1    . ASN A 1 158 ? 38.728  -45.183 97.728  1.00 50.91  ? 158 ASN A OD1    1 
ATOM   2624  N ND2    . ASN A 1 158 ? 39.993  -45.258 95.881  1.00 48.77  ? 158 ASN A ND2    1 
ATOM   2625  H H      . ASN A 1 158 ? 38.657  -44.640 93.719  1.00 47.03  ? 158 ASN A H      1 
ATOM   2626  H HA     . ASN A 1 158 ? 36.620  -44.827 95.470  1.00 50.68  ? 158 ASN A HA     1 
ATOM   2627  H HB2    . ASN A 1 158 ? 38.806  -43.060 95.514  1.00 49.94  ? 158 ASN A HB2    1 
ATOM   2628  H HB3    . ASN A 1 158 ? 37.723  -43.190 96.673  1.00 49.94  ? 158 ASN A HB3    1 
ATOM   2629  H HD21   . ASN A 1 158 ? 40.489  -45.884 96.201  1.00 58.92  ? 158 ASN A HD21   1 
ATOM   2630  H HD22   . ASN A 1 158 ? 40.133  -44.963 95.086  1.00 58.92  ? 158 ASN A HD22   1 
ATOM   2631  N N      . GLY A 1 159 ? 36.193  -43.173 93.055  1.00 46.54  ? 159 GLY A N      1 
ATOM   2632  C CA     . GLY A 1 159 ? 35.206  -42.383 92.337  1.00 43.28  ? 159 GLY A CA     1 
ATOM   2633  C C      . GLY A 1 159 ? 35.550  -40.911 92.223  1.00 42.78  ? 159 GLY A C      1 
ATOM   2634  O O      . GLY A 1 159 ? 34.731  -40.116 91.767  1.00 44.41  ? 159 GLY A O      1 
ATOM   2635  H H      . GLY A 1 159 ? 36.673  -43.667 92.539  1.00 56.24  ? 159 GLY A H      1 
ATOM   2636  H HA2    . GLY A 1 159 ? 35.106  -42.739 91.441  1.00 52.33  ? 159 GLY A HA2    1 
ATOM   2637  H HA3    . GLY A 1 159 ? 34.351  -42.458 92.789  1.00 52.33  ? 159 GLY A HA3    1 
ATOM   2638  N N      . ILE A 1 160 ? 36.747  -40.540 92.659  1.00 38.75  ? 160 ILE A N      1 
ATOM   2639  C CA     . ILE A 1 160 ? 37.187  -39.163 92.540  1.00 33.67  ? 160 ILE A CA     1 
ATOM   2640  C C      . ILE A 1 160 ? 38.092  -38.924 91.326  1.00 33.79  ? 160 ILE A C      1 
ATOM   2641  O O      . ILE A 1 160 ? 38.633  -37.843 91.179  1.00 35.23  ? 160 ILE A O      1 
ATOM   2642  C CB     . ILE A 1 160 ? 37.898  -38.714 93.840  1.00 32.10  ? 160 ILE A CB     1 
ATOM   2643  C CG1    . ILE A 1 160 ? 38.962  -39.729 94.265  1.00 34.05  ? 160 ILE A CG1    1 
ATOM   2644  C CG2    . ILE A 1 160 ? 36.885  -38.587 94.954  1.00 32.33  ? 160 ILE A CG2    1 
ATOM   2645  C CD1    . ILE A 1 160 ? 39.793  -39.290 95.453  1.00 33.15  ? 160 ILE A CD1    1 
ATOM   2646  H H      . ILE A 1 160 ? 37.320  -41.066 93.025  1.00 46.89  ? 160 ILE A H      1 
ATOM   2647  H HA     . ILE A 1 160 ? 36.403  -38.602 92.431  1.00 40.79  ? 160 ILE A HA     1 
ATOM   2648  H HB     . ILE A 1 160 ? 38.319  -37.853 93.692  1.00 38.91  ? 160 ILE A HB     1 
ATOM   2649  H HG12   . ILE A 1 160 ? 38.523  -40.561 94.502  1.00 41.25  ? 160 ILE A HG12   1 
ATOM   2650  H HG13   . ILE A 1 160 ? 39.566  -39.878 93.520  1.00 41.25  ? 160 ILE A HG13   1 
ATOM   2651  H HG21   . ILE A 1 160 ? 37.341  -38.305 95.763  1.00 39.19  ? 160 ILE A HG21   1 
ATOM   2652  H HG22   . ILE A 1 160 ? 36.220  -37.928 94.702  1.00 39.19  ? 160 ILE A HG22   1 
ATOM   2653  H HG23   . ILE A 1 160 ? 36.462  -39.448 95.095  1.00 39.19  ? 160 ILE A HG23   1 
ATOM   2654  H HD11   . ILE A 1 160 ? 40.440  -39.983 95.658  1.00 40.17  ? 160 ILE A HD11   1 
ATOM   2655  H HD12   . ILE A 1 160 ? 40.251  -38.465 95.230  1.00 40.17  ? 160 ILE A HD12   1 
ATOM   2656  H HD13   . ILE A 1 160 ? 39.207  -39.149 96.213  1.00 40.17  ? 160 ILE A HD13   1 
ATOM   2657  N N      . TYR A 1 161 ? 38.294  -39.911 90.461  1.00 36.79  ? 161 TYR A N      1 
ATOM   2658  C CA     . TYR A 1 161 ? 39.162  -39.672 89.304  1.00 37.33  ? 161 TYR A CA     1 
ATOM   2659  C C      . TYR A 1 161 ? 38.424  -38.949 88.196  1.00 45.35  ? 161 TYR A C      1 
ATOM   2660  O O      . TYR A 1 161 ? 37.279  -39.275 87.893  1.00 55.92  ? 161 TYR A O      1 
ATOM   2661  C CB     . TYR A 1 161 ? 39.736  -40.960 88.731  1.00 36.12  ? 161 TYR A CB     1 
ATOM   2662  C CG     . TYR A 1 161 ? 40.484  -40.730 87.441  1.00 39.43  ? 161 TYR A CG     1 
ATOM   2663  C CD1    . TYR A 1 161 ? 41.572  -39.866 87.403  1.00 39.11  ? 161 TYR A CD1    1 
ATOM   2664  C CD2    . TYR A 1 161 ? 40.139  -41.390 86.279  1.00 46.54  ? 161 TYR A CD2    1 
ATOM   2665  C CE1    . TYR A 1 161 ? 42.283  -39.646 86.234  1.00 38.83  ? 161 TYR A CE1    1 
ATOM   2666  C CE2    . TYR A 1 161 ? 40.847  -41.180 85.105  1.00 47.52  ? 161 TYR A CE2    1 
ATOM   2667  C CZ     . TYR A 1 161 ? 41.921  -40.306 85.093  1.00 41.01  ? 161 TYR A CZ     1 
ATOM   2668  O OH     . TYR A 1 161 ? 42.634  -40.084 83.939  1.00 39.43  ? 161 TYR A OH     1 
ATOM   2669  H H      . TYR A 1 161 ? 37.958  -40.701 90.513  1.00 44.53  ? 161 TYR A H      1 
ATOM   2670  H HA     . TYR A 1 161 ? 39.905  -39.114 89.580  1.00 45.18  ? 161 TYR A HA     1 
ATOM   2671  H HB2    . TYR A 1 161 ? 40.353  -41.346 89.373  1.00 43.74  ? 161 TYR A HB2    1 
ATOM   2672  H HB3    . TYR A 1 161 ? 39.010  -41.579 88.552  1.00 43.74  ? 161 TYR A HB3    1 
ATOM   2673  H HD1    . TYR A 1 161 ? 41.822  -39.416 88.177  1.00 47.32  ? 161 TYR A HD1    1 
ATOM   2674  H HD2    . TYR A 1 161 ? 39.419  -41.978 86.282  1.00 56.23  ? 161 TYR A HD2    1 
ATOM   2675  H HE1    . TYR A 1 161 ? 43.005  -39.060 86.228  1.00 46.98  ? 161 TYR A HE1    1 
ATOM   2676  H HE2    . TYR A 1 161 ? 40.601  -41.626 84.327  1.00 57.42  ? 161 TYR A HE2    1 
ATOM   2677  H HH     . TYR A 1 161 ? 42.317  -40.544 83.312  1.00 47.70  ? 161 TYR A HH     1 
ATOM   2678  N N      . GLY A 1 162 ? 39.106  -37.994 87.576  1.00 41.61  ? 162 GLY A N      1 
ATOM   2679  C CA     . GLY A 1 162 ? 38.573  -37.212 86.468  1.00 43.41  ? 162 GLY A CA     1 
ATOM   2680  C C      . GLY A 1 162 ? 37.977  -35.899 86.927  1.00 40.65  ? 162 GLY A C      1 
ATOM   2681  O O      . GLY A 1 162 ? 37.341  -35.840 87.971  1.00 41.46  ? 162 GLY A O      1 
ATOM   2682  H H      . GLY A 1 162 ? 39.910  -37.774 87.788  1.00 50.33  ? 162 GLY A H      1 
ATOM   2683  H HA2    . GLY A 1 162 ? 39.283  -37.022 85.835  1.00 52.49  ? 162 GLY A HA2    1 
ATOM   2684  H HA3    . GLY A 1 162 ? 37.883  -37.721 86.014  1.00 52.49  ? 162 GLY A HA3    1 
ATOM   2685  N N      . ALA A 1 163 ? 38.143  -34.856 86.120  1.00 39.45  ? 163 ALA A N      1 
ATOM   2686  C CA     . ALA A 1 163 ? 37.717  -33.514 86.510  1.00 36.68  ? 163 ALA A CA     1 
ATOM   2687  C C      . ALA A 1 163 ? 36.363  -33.089 85.968  1.00 44.42  ? 163 ALA A C      1 
ATOM   2688  O O      . ALA A 1 163 ? 35.944  -31.966 86.230  1.00 47.37  ? 163 ALA A O      1 
ATOM   2689  C CB     . ALA A 1 163 ? 38.755  -32.507 86.089  1.00 31.78  ? 163 ALA A CB     1 
ATOM   2690  H H      . ALA A 1 163 ? 38.501  -34.898 85.339  1.00 47.73  ? 163 ALA A H      1 
ATOM   2691  H HA     . ALA A 1 163 ? 37.661  -33.484 87.478  1.00 44.41  ? 163 ALA A HA     1 
ATOM   2692  H HB1    . ALA A 1 163 ? 38.461  -31.621 86.353  1.00 38.53  ? 163 ALA A HB1    1 
ATOM   2693  H HB2    . ALA A 1 163 ? 39.596  -32.720 86.524  1.00 38.53  ? 163 ALA A HB2    1 
ATOM   2694  H HB3    . ALA A 1 163 ? 38.861  -32.547 85.126  1.00 38.53  ? 163 ALA A HB3    1 
ATOM   2695  N N      . GLU A 1 164 ? 35.673  -33.949 85.223  1.00 48.33  ? 164 GLU A N      1 
ATOM   2696  C CA     . GLU A 1 164 ? 34.403  -33.528 84.639  1.00 49.72  ? 164 GLU A CA     1 
ATOM   2697  C C      . GLU A 1 164 ? 33.404  -33.275 85.763  1.00 49.36  ? 164 GLU A C      1 
ATOM   2698  O O      . GLU A 1 164 ? 33.570  -33.761 86.894  1.00 48.14  ? 164 GLU A O      1 
ATOM   2699  C CB     . GLU A 1 164 ? 33.835  -34.559 83.649  1.00 54.40  ? 164 GLU A CB     1 
ATOM   2700  C CG     . GLU A 1 164 ? 33.262  -35.858 84.249  1.00 58.03  ? 164 GLU A CG     1 
ATOM   2701  C CD     . GLU A 1 164 ? 34.267  -36.983 84.376  1.00 60.42  ? 164 GLU A CD     1 
ATOM   2702  O OE1    . GLU A 1 164 ? 33.815  -38.135 84.563  1.00 58.93  ? 164 GLU A OE1    1 
ATOM   2703  O OE2    . GLU A 1 164 ? 35.490  -36.729 84.293  1.00 64.19  ? 164 GLU A OE2    1 
ATOM   2704  H H      . GLU A 1 164 ? 35.908  -34.756 85.044  1.00 58.39  ? 164 GLU A H      1 
ATOM   2705  H HA     . GLU A 1 164 ? 34.536  -32.695 84.162  1.00 60.05  ? 164 GLU A HA     1 
ATOM   2706  H HB2    . GLU A 1 164 ? 33.120  -34.135 83.149  1.00 65.67  ? 164 GLU A HB2    1 
ATOM   2707  H HB3    . GLU A 1 164 ? 34.544  -34.814 83.038  1.00 65.67  ? 164 GLU A HB3    1 
ATOM   2708  H HG2    . GLU A 1 164 ? 32.921  -35.666 85.137  1.00 70.03  ? 164 GLU A HG2    1 
ATOM   2709  H HG3    . GLU A 1 164 ? 32.540  -36.170 83.682  1.00 70.03  ? 164 GLU A HG3    1 
ATOM   2710  N N      . TYR A 1 165 ? 32.369  -32.503 85.451  1.00 47.88  ? 165 TYR A N      1 
ATOM   2711  C CA     . TYR A 1 165 ? 31.461  -32.038 86.482  1.00 43.18  ? 165 TYR A CA     1 
ATOM   2712  C C      . TYR A 1 165 ? 30.696  -33.210 87.082  1.00 38.34  ? 165 TYR A C      1 
ATOM   2713  O O      . TYR A 1 165 ? 30.097  -33.089 88.141  1.00 38.38  ? 165 TYR A O      1 
ATOM   2714  C CB     . TYR A 1 165 ? 30.510  -30.969 85.938  1.00 44.55  ? 165 TYR A CB     1 
ATOM   2715  C CG     . TYR A 1 165 ? 31.088  -29.558 86.023  1.00 42.23  ? 165 TYR A CG     1 
ATOM   2716  C CD1    . TYR A 1 165 ? 31.368  -28.963 87.251  1.00 39.35  ? 165 TYR A CD1    1 
ATOM   2717  C CD2    . TYR A 1 165 ? 31.333  -28.821 84.876  1.00 43.86  ? 165 TYR A CD2    1 
ATOM   2718  C CE1    . TYR A 1 165 ? 31.897  -27.686 87.325  1.00 41.34  ? 165 TYR A CE1    1 
ATOM   2719  C CE2    . TYR A 1 165 ? 31.854  -27.543 84.942  1.00 45.24  ? 165 TYR A CE2    1 
ATOM   2720  C CZ     . TYR A 1 165 ? 32.135  -26.981 86.165  1.00 43.58  ? 165 TYR A CZ     1 
ATOM   2721  O OH     . TYR A 1 165 ? 32.655  -25.706 86.210  1.00 43.13  ? 165 TYR A OH     1 
ATOM   2722  H H      . TYR A 1 165 ? 32.174  -32.239 84.657  1.00 57.84  ? 165 TYR A H      1 
ATOM   2723  H HA     . TYR A 1 165 ? 31.982  -31.633 87.194  1.00 52.21  ? 165 TYR A HA     1 
ATOM   2724  H HB2    . TYR A 1 165 ? 30.322  -31.160 85.006  1.00 53.85  ? 165 TYR A HB2    1 
ATOM   2725  H HB3    . TYR A 1 165 ? 29.688  -30.987 86.452  1.00 53.85  ? 165 TYR A HB3    1 
ATOM   2726  H HD1    . TYR A 1 165 ? 31.213  -29.439 88.035  1.00 47.61  ? 165 TYR A HD1    1 
ATOM   2727  H HD2    . TYR A 1 165 ? 31.150  -29.196 84.045  1.00 53.02  ? 165 TYR A HD2    1 
ATOM   2728  H HE1    . TYR A 1 165 ? 32.083  -27.304 88.152  1.00 50.00  ? 165 TYR A HE1    1 
ATOM   2729  H HE2    . TYR A 1 165 ? 32.018  -27.066 84.161  1.00 54.68  ? 165 TYR A HE2    1 
ATOM   2730  H HH     . TYR A 1 165 ? 32.745  -25.404 85.431  1.00 52.14  ? 165 TYR A HH     1 
ATOM   2731  N N      . LYS A 1 166 ? 30.710  -34.347 86.407  1.00 39.92  ? 166 LYS A N      1 
ATOM   2732  C CA     . LYS A 1 166 ? 30.110  -35.544 86.980  1.00 42.45  ? 166 LYS A CA     1 
ATOM   2733  C C      . LYS A 1 166 ? 30.911  -36.044 88.198  1.00 36.93  ? 166 LYS A C      1 
ATOM   2734  O O      . LYS A 1 166 ? 30.428  -36.876 88.977  1.00 34.19  ? 166 LYS A O      1 
ATOM   2735  C CB     . LYS A 1 166 ? 30.004  -36.652 85.923  1.00 42.94  ? 166 LYS A CB     1 
ATOM   2736  C CG     . LYS A 1 166 ? 29.356  -37.904 86.479  1.00 46.15  ? 166 LYS A CG     1 
ATOM   2737  C CD     . LYS A 1 166 ? 29.056  -38.951 85.442  1.00 50.62  ? 166 LYS A CD     1 
ATOM   2738  C CE     . LYS A 1 166 ? 28.381  -40.134 86.121  1.00 52.04  ? 166 LYS A CE     1 
ATOM   2739  N NZ     . LYS A 1 166 ? 27.852  -41.125 85.155  1.00 57.53  ? 166 LYS A NZ     1 
ATOM   2740  H H      . LYS A 1 166 ? 31.055  -34.455 85.627  1.00 48.29  ? 166 LYS A H      1 
ATOM   2741  H HA     . LYS A 1 166 ? 29.212  -35.332 87.281  1.00 51.33  ? 166 LYS A HA     1 
ATOM   2742  H HB2    . LYS A 1 166 ? 29.465  -36.336 85.182  1.00 51.91  ? 166 LYS A HB2    1 
ATOM   2743  H HB3    . LYS A 1 166 ? 30.894  -36.884 85.615  1.00 51.91  ? 166 LYS A HB3    1 
ATOM   2744  H HG2    . LYS A 1 166 ? 29.953  -38.299 87.134  1.00 55.77  ? 166 LYS A HG2    1 
ATOM   2745  H HG3    . LYS A 1 166 ? 28.519  -37.659 86.903  1.00 55.77  ? 166 LYS A HG3    1 
ATOM   2746  H HD2    . LYS A 1 166 ? 28.452  -38.588 84.774  1.00 61.14  ? 166 LYS A HD2    1 
ATOM   2747  H HD3    . LYS A 1 166 ? 29.881  -39.254 85.032  1.00 61.14  ? 166 LYS A HD3    1 
ATOM   2748  H HE2    . LYS A 1 166 ? 29.028  -40.584 86.687  1.00 62.84  ? 166 LYS A HE2    1 
ATOM   2749  H HE3    . LYS A 1 166 ? 27.639  -39.811 86.655  1.00 62.84  ? 166 LYS A HE3    1 
ATOM   2750  H HZ1    . LYS A 1 166 ? 27.467  -41.799 85.591  1.00 69.43  ? 166 LYS A HZ1    1 
ATOM   2751  H HZ2    . LYS A 1 166 ? 27.249  -40.741 84.625  1.00 69.43  ? 166 LYS A HZ2    1 
ATOM   2752  H HZ3    . LYS A 1 166 ? 28.515  -41.445 84.655  1.00 69.43  ? 166 LYS A HZ3    1 
ATOM   2753  N N      . VAL A 1 167 ? 32.134  -35.539 88.341  1.00 31.46  ? 167 VAL A N      1 
ATOM   2754  C CA     . VAL A 1 167 ? 33.081  -36.068 89.316  1.00 32.64  ? 167 VAL A CA     1 
ATOM   2755  C C      . VAL A 1 167 ? 33.581  -34.959 90.233  1.00 35.36  ? 167 VAL A C      1 
ATOM   2756  O O      . VAL A 1 167 ? 33.511  -35.076 91.465  1.00 36.05  ? 167 VAL A O      1 
ATOM   2757  C CB     . VAL A 1 167 ? 34.285  -36.762 88.632  1.00 31.73  ? 167 VAL A CB     1 
ATOM   2758  C CG1    . VAL A 1 167 ? 35.094  -37.524 89.657  1.00 29.48  ? 167 VAL A CG1    1 
ATOM   2759  C CG2    . VAL A 1 167 ? 33.815  -37.721 87.568  1.00 34.02  ? 167 VAL A CG2    1 
ATOM   2760  H H      . VAL A 1 167 ? 32.442  -34.882 87.879  1.00 38.15  ? 167 VAL A H      1 
ATOM   2761  H HA     . VAL A 1 167 ? 32.630  -36.729 89.865  1.00 39.55  ? 167 VAL A HA     1 
ATOM   2762  H HB     . VAL A 1 167 ? 34.856  -36.094 88.219  1.00 38.47  ? 167 VAL A HB     1 
ATOM   2763  H HG11   . VAL A 1 167 ? 35.844  -37.951 89.214  1.00 35.77  ? 167 VAL A HG11   1 
ATOM   2764  H HG12   . VAL A 1 167 ? 35.418  -36.903 90.329  1.00 35.77  ? 167 VAL A HG12   1 
ATOM   2765  H HG13   . VAL A 1 167 ? 34.528  -38.194 90.071  1.00 35.77  ? 167 VAL A HG13   1 
ATOM   2766  H HG21   . VAL A 1 167 ? 34.588  -38.140 87.157  1.00 41.21  ? 167 VAL A HG21   1 
ATOM   2767  H HG22   . VAL A 1 167 ? 33.252  -38.396 87.978  1.00 41.21  ? 167 VAL A HG22   1 
ATOM   2768  H HG23   . VAL A 1 167 ? 33.311  -37.230 86.900  1.00 41.21  ? 167 VAL A HG23   1 
ATOM   2769  N N      . ARG A 1 168 ? 34.169  -33.931 89.619  1.00 32.60  ? 168 ARG A N      1 
ATOM   2770  C CA     . ARG A 1 168 ? 34.787  -32.828 90.348  1.00 31.75  ? 168 ARG A CA     1 
ATOM   2771  C C      . ARG A 1 168 ? 35.928  -33.375 91.181  1.00 33.62  ? 168 ARG A C      1 
ATOM   2772  O O      . ARG A 1 168 ? 36.092  -33.030 92.352  1.00 38.18  ? 168 ARG A O      1 
ATOM   2773  C CB     . ARG A 1 168 ? 33.774  -32.122 91.245  1.00 29.09  ? 168 ARG A CB     1 
ATOM   2774  C CG     . ARG A 1 168 ? 32.714  -31.369 90.508  1.00 33.95  ? 168 ARG A CG     1 
ATOM   2775  C CD     . ARG A 1 168 ? 31.764  -30.715 91.482  1.00 42.76  ? 168 ARG A CD     1 
ATOM   2776  N NE     . ARG A 1 168 ? 31.189  -29.488 90.949  1.00 48.62  ? 168 ARG A NE     1 
ATOM   2777  C CZ     . ARG A 1 168 ? 31.800  -28.307 90.961  1.00 50.10  ? 168 ARG A CZ     1 
ATOM   2778  N NH1    . ARG A 1 168 ? 33.026  -28.177 91.481  1.00 40.43  ? 168 ARG A NH1    1 
ATOM   2779  N NH2    . ARG A 1 168 ? 31.174  -27.249 90.449  1.00 56.07  ? 168 ARG A NH2    1 
ATOM   2780  H H      . ARG A 1 168 ? 34.222  -33.851 88.764  1.00 39.51  ? 168 ARG A H      1 
ATOM   2781  H HA     . ARG A 1 168 ? 35.145  -32.183 89.719  1.00 38.49  ? 168 ARG A HA     1 
ATOM   2782  H HB2    . ARG A 1 168 ? 33.334  -32.786 91.798  1.00 35.29  ? 168 ARG A HB2    1 
ATOM   2783  H HB3    . ARG A 1 168 ? 34.247  -31.489 91.808  1.00 35.29  ? 168 ARG A HB3    1 
ATOM   2784  H HG2    . ARG A 1 168 ? 33.124  -30.677 89.966  1.00 41.13  ? 168 ARG A HG2    1 
ATOM   2785  H HG3    . ARG A 1 168 ? 32.209  -31.982 89.950  1.00 41.13  ? 168 ARG A HG3    1 
ATOM   2786  H HD2    . ARG A 1 168 ? 31.039  -31.328 91.679  1.00 51.70  ? 168 ARG A HD2    1 
ATOM   2787  H HD3    . ARG A 1 168 ? 32.245  -30.495 92.295  1.00 51.70  ? 168 ARG A HD3    1 
ATOM   2788  H HE     . ARG A 1 168 ? 30.403  -29.530 90.603  1.00 58.74  ? 168 ARG A HE     1 
ATOM   2789  H HH11   . ARG A 1 168 ? 33.427  -28.862 91.812  1.00 48.91  ? 168 ARG A HH11   1 
ATOM   2790  H HH12   . ARG A 1 168 ? 33.413  -27.409 91.484  1.00 48.91  ? 168 ARG A HH12   1 
ATOM   2791  H HH21   . ARG A 1 168 ? 30.386  -27.336 90.115  1.00 67.67  ? 168 ARG A HH21   1 
ATOM   2792  H HH22   . ARG A 1 168 ? 31.559  -26.480 90.449  1.00 67.67  ? 168 ARG A HH22   1 
ATOM   2793  N N      . GLY A 1 169 ? 36.705  -34.239 90.547  1.00 30.65  ? 169 GLY A N      1 
ATOM   2794  C CA     . GLY A 1 169 ? 37.851  -34.891 91.146  1.00 28.05  ? 169 GLY A CA     1 
ATOM   2795  C C      . GLY A 1 169 ? 39.169  -34.393 90.585  1.00 35.97  ? 169 GLY A C      1 
ATOM   2796  O O      . GLY A 1 169 ? 39.292  -33.229 90.187  1.00 36.42  ? 169 GLY A O      1 
ATOM   2797  H H      . GLY A 1 169 ? 36.579  -34.473 89.729  1.00 37.17  ? 169 GLY A H      1 
ATOM   2798  H HA2    . GLY A 1 169 ? 37.847  -34.733 92.103  1.00 34.06  ? 169 GLY A HA2    1 
ATOM   2799  H HA3    . GLY A 1 169 ? 37.794  -35.847 90.993  1.00 34.06  ? 169 GLY A HA3    1 
ATOM   2800  N N      . PHE A 1 170 ? 40.167  -35.280 90.597  1.00 37.32  ? 170 PHE A N      1 
ATOM   2801  C CA     . PHE A 1 170 ? 41.516  -34.978 90.119  1.00 33.08  ? 170 PHE A CA     1 
ATOM   2802  C C      . PHE A 1 170 ? 41.643  -35.340 88.617  1.00 34.75  ? 170 PHE A C      1 
ATOM   2803  O O      . PHE A 1 170 ? 41.492  -36.501 88.254  1.00 36.17  ? 170 PHE A O      1 
ATOM   2804  C CB     . PHE A 1 170 ? 42.567  -35.777 90.898  1.00 32.86  ? 170 PHE A CB     1 
ATOM   2805  C CG     . PHE A 1 170 ? 42.551  -35.568 92.404  1.00 35.18  ? 170 PHE A CG     1 
ATOM   2806  C CD1    . PHE A 1 170 ? 41.409  -35.836 93.156  1.00 32.96  ? 170 PHE A CD1    1 
ATOM   2807  C CD2    . PHE A 1 170 ? 43.694  -35.144 93.072  1.00 33.53  ? 170 PHE A CD2    1 
ATOM   2808  C CE1    . PHE A 1 170 ? 41.407  -35.673 94.532  1.00 30.35  ? 170 PHE A CE1    1 
ATOM   2809  C CE2    . PHE A 1 170 ? 43.689  -34.975 94.461  1.00 31.67  ? 170 PHE A CE2    1 
ATOM   2810  C CZ     . PHE A 1 170 ? 42.549  -35.239 95.183  1.00 30.25  ? 170 PHE A CZ     1 
ATOM   2811  H H      . PHE A 1 170 ? 40.083  -36.086 90.886  1.00 45.17  ? 170 PHE A H      1 
ATOM   2812  H HA     . PHE A 1 170 ? 41.699  -34.032 90.229  1.00 40.08  ? 170 PHE A HA     1 
ATOM   2813  H HB2    . PHE A 1 170 ? 42.420  -36.722 90.734  1.00 39.82  ? 170 PHE A HB2    1 
ATOM   2814  H HB3    . PHE A 1 170 ? 43.446  -35.524 90.578  1.00 39.82  ? 170 PHE A HB3    1 
ATOM   2815  H HD1    . PHE A 1 170 ? 40.637  -36.131 92.729  1.00 39.95  ? 170 PHE A HD1    1 
ATOM   2816  H HD2    . PHE A 1 170 ? 44.469  -34.966 92.591  1.00 40.62  ? 170 PHE A HD2    1 
ATOM   2817  H HE1    . PHE A 1 170 ? 40.634  -35.848 95.019  1.00 36.82  ? 170 PHE A HE1    1 
ATOM   2818  H HE2    . PHE A 1 170 ? 44.457  -34.684 94.896  1.00 38.40  ? 170 PHE A HE2    1 
ATOM   2819  H HZ     . PHE A 1 170 ? 42.544  -35.123 96.106  1.00 36.70  ? 170 PHE A HZ     1 
ATOM   2820  N N      . SER A 1 171 ? 41.893  -34.378 87.733  1.00 34.75  ? 171 SER A N      1 
ATOM   2821  C CA     . SER A 1 171 ? 42.083  -34.710 86.316  1.00 31.99  ? 171 SER A CA     1 
ATOM   2822  C C      . SER A 1 171 ? 43.362  -35.506 86.106  1.00 39.31  ? 171 SER A C      1 
ATOM   2823  O O      . SER A 1 171 ? 44.323  -35.366 86.866  1.00 39.34  ? 171 SER A O      1 
ATOM   2824  C CB     . SER A 1 171 ? 42.147  -33.452 85.448  1.00 30.92  ? 171 SER A CB     1 
ATOM   2825  O OG     . SER A 1 171 ? 43.293  -32.676 85.766  1.00 31.89  ? 171 SER A OG     1 
ATOM   2826  H H      . SER A 1 171 ? 41.957  -33.540 87.919  1.00 42.09  ? 171 SER A H      1 
ATOM   2827  H HA     . SER A 1 171 ? 41.337  -35.249 86.013  1.00 38.78  ? 171 SER A HA     1 
ATOM   2828  H HB2    . SER A 1 171 ? 42.191  -33.714 84.516  1.00 37.50  ? 171 SER A HB2    1 
ATOM   2829  H HB3    . SER A 1 171 ? 41.351  -32.919 85.606  1.00 37.50  ? 171 SER A HB3    1 
ATOM   2830  H HG     . SER A 1 171 ? 43.317  -31.988 85.283  1.00 38.66  ? 171 SER A HG     1 
ATOM   2831  N N      . GLY A 1 172 ? 43.394  -36.285 85.030  1.00 48.34  ? 172 GLY A N      1 
ATOM   2832  C CA     . GLY A 1 172 ? 44.559  -37.078 84.697  1.00 48.59  ? 172 GLY A CA     1 
ATOM   2833  C C      . GLY A 1 172 ? 45.826  -36.252 84.654  1.00 46.31  ? 172 GLY A C      1 
ATOM   2834  O O      . GLY A 1 172 ? 46.808  -36.594 85.289  1.00 47.26  ? 172 GLY A O      1 
ATOM   2835  H H      . GLY A 1 172 ? 42.743  -36.369 84.473  1.00 58.39  ? 172 GLY A H      1 
ATOM   2836  H HA2    . GLY A 1 172 ? 44.672  -37.780 85.357  1.00 58.69  ? 172 GLY A HA2    1 
ATOM   2837  H HA3    . GLY A 1 172 ? 44.432  -37.491 83.828  1.00 58.69  ? 172 GLY A HA3    1 
ATOM   2838  N N      . TYR A 1 173 ? 45.799  -35.150 83.917  1.00 42.63  ? 173 TYR A N      1 
ATOM   2839  C CA     . TYR A 1 173 ? 46.949  -34.258 83.828  1.00 38.60  ? 173 TYR A CA     1 
ATOM   2840  C C      . TYR A 1 173 ? 47.451  -33.836 85.187  1.00 35.18  ? 173 TYR A C      1 
ATOM   2841  O O      . TYR A 1 173 ? 48.652  -33.657 85.374  1.00 39.53  ? 173 TYR A O      1 
ATOM   2842  C CB     . TYR A 1 173 ? 46.596  -33.014 83.024  1.00 41.83  ? 173 TYR A CB     1 
ATOM   2843  C CG     . TYR A 1 173 ? 47.689  -31.965 83.005  1.00 44.05  ? 173 TYR A CG     1 
ATOM   2844  C CD1    . TYR A 1 173 ? 48.965  -32.270 82.547  1.00 44.11  ? 173 TYR A CD1    1 
ATOM   2845  C CD2    . TYR A 1 173 ? 47.439  -30.662 83.432  1.00 46.25  ? 173 TYR A CD2    1 
ATOM   2846  C CE1    . TYR A 1 173 ? 49.961  -31.311 82.513  1.00 43.76  ? 173 TYR A CE1    1 
ATOM   2847  C CE2    . TYR A 1 173 ? 48.430  -29.696 83.401  1.00 46.02  ? 173 TYR A CE2    1 
ATOM   2848  C CZ     . TYR A 1 173 ? 49.689  -30.028 82.938  1.00 43.70  ? 173 TYR A CZ     1 
ATOM   2849  O OH     . TYR A 1 173 ? 50.685  -29.077 82.904  1.00 41.51  ? 173 TYR A OH     1 
ATOM   2850  H H      . TYR A 1 173 ? 45.121  -34.894 83.454  1.00 51.55  ? 173 TYR A H      1 
ATOM   2851  H HA     . TYR A 1 173 ? 47.671  -34.717 83.370  1.00 46.71  ? 173 TYR A HA     1 
ATOM   2852  H HB2    . TYR A 1 173 ? 46.419  -33.274 82.107  1.00 50.58  ? 173 TYR A HB2    1 
ATOM   2853  H HB3    . TYR A 1 173 ? 45.803  -32.608 83.409  1.00 50.58  ? 173 TYR A HB3    1 
ATOM   2854  H HD1    . TYR A 1 173 ? 49.151  -33.133 82.254  1.00 53.33  ? 173 TYR A HD1    1 
ATOM   2855  H HD2    . TYR A 1 173 ? 46.590  -30.436 83.738  1.00 55.89  ? 173 TYR A HD2    1 
ATOM   2856  H HE1    . TYR A 1 173 ? 50.811  -31.531 82.204  1.00 52.90  ? 173 TYR A HE1    1 
ATOM   2857  H HE2    . TYR A 1 173 ? 48.250  -28.830 83.688  1.00 55.61  ? 173 TYR A HE2    1 
ATOM   2858  H HH     . TYR A 1 173 ? 50.391  -28.343 83.187  1.00 50.20  ? 173 TYR A HH     1 
ATOM   2859  N N      . LEU A 1 174 ? 46.527  -33.642 86.124  1.00 31.95  ? 174 LEU A N      1 
ATOM   2860  C CA     . LEU A 1 174 ? 46.909  -33.271 87.473  1.00 28.96  ? 174 LEU A CA     1 
ATOM   2861  C C      . LEU A 1 174 ? 47.660  -34.400 88.140  1.00 28.73  ? 174 LEU A C      1 
ATOM   2862  O O      . LEU A 1 174 ? 48.640  -34.171 88.850  1.00 29.50  ? 174 LEU A O      1 
ATOM   2863  C CB     . LEU A 1 174 ? 45.700  -32.889 88.311  1.00 25.16  ? 174 LEU A CB     1 
ATOM   2864  C CG     . LEU A 1 174 ? 46.087  -32.537 89.751  1.00 27.08  ? 174 LEU A CG     1 
ATOM   2865  C CD1    . LEU A 1 174 ? 47.118  -31.427 89.831  1.00 27.96  ? 174 LEU A CD1    1 
ATOM   2866  C CD2    . LEU A 1 174 ? 44.854  -32.170 90.559  1.00 29.68  ? 174 LEU A CD2    1 
ATOM   2867  H H      . LEU A 1 174 ? 45.680  -33.719 86.001  1.00 38.73  ? 174 LEU A H      1 
ATOM   2868  H HA     . LEU A 1 174 ? 47.499  -32.502 87.433  1.00 35.15  ? 174 LEU A HA     1 
ATOM   2869  H HB2    . LEU A 1 174 ? 45.270  -32.114 87.916  1.00 30.59  ? 174 LEU A HB2    1 
ATOM   2870  H HB3    . LEU A 1 174 ? 45.082  -33.636 88.339  1.00 30.59  ? 174 LEU A HB3    1 
ATOM   2871  H HG     . LEU A 1 174 ? 46.478  -33.323 90.162  1.00 32.89  ? 174 LEU A HG     1 
ATOM   2872  H HD11   . LEU A 1 174 ? 47.321  -31.251 90.763  1.00 33.94  ? 174 LEU A HD11   1 
ATOM   2873  H HD12   . LEU A 1 174 ? 47.921  -31.709 89.365  1.00 33.94  ? 174 LEU A HD12   1 
ATOM   2874  H HD13   . LEU A 1 174 ? 46.756  -30.629 89.414  1.00 33.94  ? 174 LEU A HD13   1 
ATOM   2875  H HD21   . LEU A 1 174 ? 45.124  -31.952 91.465  1.00 36.01  ? 174 LEU A HD21   1 
ATOM   2876  H HD22   . LEU A 1 174 ? 44.424  -31.404 90.148  1.00 36.01  ? 174 LEU A HD22   1 
ATOM   2877  H HD23   . LEU A 1 174 ? 44.247  -32.926 90.568  1.00 36.01  ? 174 LEU A HD23   1 
ATOM   2878  N N      . CYS A 1 175 ? 47.205  -35.621 87.903  1.00 27.65  ? 175 CYS A N      1 
ATOM   2879  C CA     . CYS A 1 175 ? 47.884  -36.795 88.440  1.00 31.43  ? 175 CYS A CA     1 
ATOM   2880  C C      . CYS A 1 175 ? 49.326  -36.839 87.943  1.00 36.09  ? 175 CYS A C      1 
ATOM   2881  O O      . CYS A 1 175 ? 50.256  -37.049 88.715  1.00 34.93  ? 175 CYS A O      1 
ATOM   2882  C CB     . CYS A 1 175 ? 47.136  -38.066 88.041  1.00 30.83  ? 175 CYS A CB     1 
ATOM   2883  S SG     . CYS A 1 175 ? 45.418  -38.112 88.616  1.00 41.79  ? 175 CYS A SG     1 
ATOM   2884  H H      . CYS A 1 175 ? 46.507  -35.800 87.434  1.00 33.57  ? 175 CYS A H      1 
ATOM   2885  H HA     . CYS A 1 175 ? 47.898  -36.742 89.409  1.00 38.11  ? 175 CYS A HA     1 
ATOM   2886  H HB2    . CYS A 1 175 ? 47.128  -38.132 87.073  1.00 37.39  ? 175 CYS A HB2    1 
ATOM   2887  H HB3    . CYS A 1 175 ? 47.597  -38.831 88.419  1.00 37.39  ? 175 CYS A HB3    1 
ATOM   2888  H HG     . CYS A 1 175 ? 44.824  -37.180 88.148  1.00 50.54  ? 175 CYS A HG     1 
ATOM   2889  N N      . GLU A 1 176 ? 49.505  -36.609 86.648  1.00 37.78  ? 176 GLU A N      1 
ATOM   2890  C CA     . GLU A 1 176 ? 50.821  -36.642 86.050  1.00 35.00  ? 176 GLU A CA     1 
ATOM   2891  C C      . GLU A 1 176 ? 51.725  -35.592 86.717  1.00 35.80  ? 176 GLU A C      1 
ATOM   2892  O O      . GLU A 1 176 ? 52.872  -35.873 87.053  1.00 37.31  ? 176 GLU A O      1 
ATOM   2893  C CB     . GLU A 1 176 ? 50.711  -36.418 84.536  1.00 33.81  ? 176 GLU A CB     1 
ATOM   2894  C CG     . GLU A 1 176 ? 49.821  -37.457 83.858  1.00 43.78  ? 176 GLU A CG     1 
ATOM   2895  C CD     . GLU A 1 176 ? 49.730  -37.337 82.325  1.00 51.52  ? 176 GLU A CD     1 
ATOM   2896  O OE1    . GLU A 1 176 ? 49.174  -38.259 81.686  1.00 51.06  ? 176 GLU A OE1    1 
ATOM   2897  O OE2    . GLU A 1 176 ? 50.212  -36.342 81.744  1.00 54.53  ? 176 GLU A OE2    1 
ATOM   2898  H H      . GLU A 1 176 ? 48.872  -36.429 86.095  1.00 45.73  ? 176 GLU A H      1 
ATOM   2899  H HA     . GLU A 1 176 ? 51.215  -37.516 86.198  1.00 42.40  ? 176 GLU A HA     1 
ATOM   2900  H HB2    . GLU A 1 176 ? 50.329  -35.541 84.372  1.00 40.97  ? 176 GLU A HB2    1 
ATOM   2901  H HB3    . GLU A 1 176 ? 51.595  -36.475 84.142  1.00 40.97  ? 176 GLU A HB3    1 
ATOM   2902  H HG2    . GLU A 1 176 ? 50.167  -38.340 84.062  1.00 52.93  ? 176 GLU A HG2    1 
ATOM   2903  H HG3    . GLU A 1 176 ? 48.921  -37.371 84.211  1.00 52.93  ? 176 GLU A HG3    1 
ATOM   2904  N N      . LEU A 1 177 ? 51.189  -34.405 86.972  1.00 29.67  ? 177 LEU A N      1 
ATOM   2905  C CA     . LEU A 1 177 ? 51.955  -33.363 87.648  1.00 33.39  ? 177 LEU A CA     1 
ATOM   2906  C C      . LEU A 1 177 ? 52.428  -33.796 89.034  1.00 36.86  ? 177 LEU A C      1 
ATOM   2907  O O      . LEU A 1 177 ? 53.583  -33.592 89.401  1.00 39.70  ? 177 LEU A O      1 
ATOM   2908  C CB     . LEU A 1 177 ? 51.117  -32.087 87.776  1.00 33.23  ? 177 LEU A CB     1 
ATOM   2909  C CG     . LEU A 1 177 ? 50.871  -31.229 86.530  1.00 32.11  ? 177 LEU A CG     1 
ATOM   2910  C CD1    . LEU A 1 177 ? 50.170  -29.951 86.952  1.00 27.36  ? 177 LEU A CD1    1 
ATOM   2911  C CD2    . LEU A 1 177 ? 52.176  -30.912 85.777  1.00 30.24  ? 177 LEU A CD2    1 
ATOM   2912  H H      . LEU A 1 177 ? 50.386  -34.177 86.765  1.00 35.99  ? 177 LEU A H      1 
ATOM   2913  H HA     . LEU A 1 177 ? 52.739  -33.154 87.117  1.00 40.46  ? 177 LEU A HA     1 
ATOM   2914  H HB2    . LEU A 1 177 ? 50.244  -32.341 88.115  1.00 40.27  ? 177 LEU A HB2    1 
ATOM   2915  H HB3    . LEU A 1 177 ? 51.551  -31.514 88.427  1.00 40.27  ? 177 LEU A HB3    1 
ATOM   2916  H HG     . LEU A 1 177 ? 50.284  -31.709 85.926  1.00 38.93  ? 177 LEU A HG     1 
ATOM   2917  H HD11   . LEU A 1 177 ? 50.012  -29.404 86.166  1.00 33.22  ? 177 LEU A HD11   1 
ATOM   2918  H HD12   . LEU A 1 177 ? 49.326  -30.178 87.372  1.00 33.22  ? 177 LEU A HD12   1 
ATOM   2919  H HD13   . LEU A 1 177 ? 50.735  -29.474 87.580  1.00 33.22  ? 177 LEU A HD13   1 
ATOM   2920  H HD21   . LEU A 1 177 ? 51.968  -30.369 85.000  1.00 36.67  ? 177 LEU A HD21   1 
ATOM   2921  H HD22   . LEU A 1 177 ? 52.773  -30.428 86.369  1.00 36.67  ? 177 LEU A HD22   1 
ATOM   2922  H HD23   . LEU A 1 177 ? 52.590  -31.744 85.498  1.00 36.67  ? 177 LEU A HD23   1 
ATOM   2923  N N      . LEU A 1 178 ? 51.535  -34.400 89.801  1.00 34.08  ? 178 LEU A N      1 
ATOM   2924  C CA     . LEU A 1 178 ? 51.860  -34.823 91.156  1.00 30.53  ? 178 LEU A CA     1 
ATOM   2925  C C      . LEU A 1 178 ? 53.059  -35.766 91.201  1.00 33.65  ? 178 LEU A C      1 
ATOM   2926  O O      . LEU A 1 178 ? 54.012  -35.543 91.933  1.00 37.62  ? 178 LEU A O      1 
ATOM   2927  C CB     . LEU A 1 178 ? 50.655  -35.527 91.762  1.00 32.95  ? 178 LEU A CB     1 
ATOM   2928  C CG     . LEU A 1 178 ? 49.466  -34.634 92.105  1.00 36.37  ? 178 LEU A CG     1 
ATOM   2929  C CD1    . LEU A 1 178 ? 48.215  -35.490 92.351  1.00 32.28  ? 178 LEU A CD1    1 
ATOM   2930  C CD2    . LEU A 1 178 ? 49.791  -33.754 93.325  1.00 37.69  ? 178 LEU A CD2    1 
ATOM   2931  H H      . LEU A 1 178 ? 50.729  -34.579 89.561  1.00 41.29  ? 178 LEU A H      1 
ATOM   2932  H HA     . LEU A 1 178 ? 52.063  -34.044 91.696  1.00 37.03  ? 178 LEU A HA     1 
ATOM   2933  H HB2    . LEU A 1 178 ? 50.343  -36.196 91.132  1.00 39.94  ? 178 LEU A HB2    1 
ATOM   2934  H HB3    . LEU A 1 178 ? 50.936  -35.963 92.582  1.00 39.94  ? 178 LEU A HB3    1 
ATOM   2935  H HG     . LEU A 1 178 ? 49.285  -34.048 91.354  1.00 44.04  ? 178 LEU A HG     1 
ATOM   2936  H HD11   . LEU A 1 178 ? 47.471  -34.906 92.567  1.00 39.13  ? 178 LEU A HD11   1 
ATOM   2937  H HD12   . LEU A 1 178 ? 48.016  -35.996 91.548  1.00 39.13  ? 178 LEU A HD12   1 
ATOM   2938  H HD13   . LEU A 1 178 ? 48.387  -36.095 93.089  1.00 39.13  ? 178 LEU A HD13   1 
ATOM   2939  H HD21   . LEU A 1 178 ? 49.024  -33.196 93.524  1.00 45.61  ? 178 LEU A HD21   1 
ATOM   2940  H HD22   . LEU A 1 178 ? 49.991  -34.327 94.082  1.00 45.61  ? 178 LEU A HD22   1 
ATOM   2941  H HD23   . LEU A 1 178 ? 50.560  -33.200 93.118  1.00 45.61  ? 178 LEU A HD23   1 
ATOM   2942  N N      . ILE A 1 179 ? 53.020  -36.802 90.378  1.00 35.35  ? 179 ILE A N      1 
ATOM   2943  C CA     . ILE A 1 179 ? 54.080  -37.791 90.355  1.00 35.95  ? 179 ILE A CA     1 
ATOM   2944  C C      . ILE A 1 179 ? 55.402  -37.119 89.992  1.00 36.31  ? 179 ILE A C      1 
ATOM   2945  O O      . ILE A 1 179 ? 56.457  -37.495 90.498  1.00 34.97  ? 179 ILE A O      1 
ATOM   2946  C CB     . ILE A 1 179 ? 53.764  -38.908 89.357  1.00 36.00  ? 179 ILE A CB     1 
ATOM   2947  C CG1    . ILE A 1 179 ? 52.388  -39.500 89.652  1.00 35.14  ? 179 ILE A CG1    1 
ATOM   2948  C CG2    . ILE A 1 179 ? 54.861  -39.950 89.347  1.00 38.71  ? 179 ILE A CG2    1 
ATOM   2949  C CD1    . ILE A 1 179 ? 52.181  -39.932 91.076  1.00 35.82  ? 179 ILE A CD1    1 
ATOM   2950  H H      . ILE A 1 179 ? 52.385  -36.955 89.818  1.00 42.81  ? 179 ILE A H      1 
ATOM   2951  H HA     . ILE A 1 179 ? 54.170  -38.186 91.237  1.00 43.53  ? 179 ILE A HA     1 
ATOM   2952  H HB     . ILE A 1 179 ? 53.728  -38.511 88.472  1.00 43.59  ? 179 ILE A HB     1 
ATOM   2953  H HG12   . ILE A 1 179 ? 51.714  -38.834 89.446  1.00 42.56  ? 179 ILE A HG12   1 
ATOM   2954  H HG13   . ILE A 1 179 ? 52.259  -40.279 89.088  1.00 42.56  ? 179 ILE A HG13   1 
ATOM   2955  H HG21   . ILE A 1 179 ? 54.633  -40.642 88.707  1.00 46.84  ? 179 ILE A HG21   1 
ATOM   2956  H HG22   . ILE A 1 179 ? 55.695  -39.526 89.093  1.00 46.84  ? 179 ILE A HG22   1 
ATOM   2957  H HG23   . ILE A 1 179 ? 54.940  -40.333 90.235  1.00 46.84  ? 179 ILE A HG23   1 
ATOM   2958  H HD11   . ILE A 1 179 ? 51.285  -40.292 91.170  1.00 43.38  ? 179 ILE A HD11   1 
ATOM   2959  H HD12   . ILE A 1 179 ? 52.836  -40.611 91.299  1.00 43.38  ? 179 ILE A HD12   1 
ATOM   2960  H HD13   . ILE A 1 179 ? 52.290  -39.163 91.658  1.00 43.38  ? 179 ILE A HD13   1 
ATOM   2961  N N      . VAL A 1 180 ? 55.338  -36.149 89.083  1.00 36.41  ? 180 VAL A N      1 
ATOM   2962  C CA     . VAL A 1 180 ? 56.499  -35.335 88.730  1.00 35.44  ? 180 VAL A CA     1 
ATOM   2963  C C      . VAL A 1 180 ? 56.920  -34.469 89.912  1.00 37.01  ? 180 VAL A C      1 
ATOM   2964  O O      . VAL A 1 180 ? 58.097  -34.176 90.088  1.00 40.74  ? 180 VAL A O      1 
ATOM   2965  C CB     . VAL A 1 180 ? 56.207  -34.423 87.519  1.00 33.43  ? 180 VAL A CB     1 
ATOM   2966  C CG1    . VAL A 1 180 ? 57.362  -33.449 87.268  1.00 29.49  ? 180 VAL A CG1    1 
ATOM   2967  C CG2    . VAL A 1 180 ? 55.929  -35.261 86.276  1.00 35.38  ? 180 VAL A CG2    1 
ATOM   2968  H H      . VAL A 1 180 ? 54.624  -35.940 88.651  1.00 44.08  ? 180 VAL A H      1 
ATOM   2969  H HA     . VAL A 1 180 ? 57.240  -35.917 88.501  1.00 42.92  ? 180 VAL A HA     1 
ATOM   2970  H HB     . VAL A 1 180 ? 55.413  -33.898 87.706  1.00 40.51  ? 180 VAL A HB     1 
ATOM   2971  H HG11   . VAL A 1 180 ? 57.145  -32.894 86.503  1.00 35.78  ? 180 VAL A HG11   1 
ATOM   2972  H HG12   . VAL A 1 180 ? 57.484  -32.895 88.055  1.00 35.78  ? 180 VAL A HG12   1 
ATOM   2973  H HG13   . VAL A 1 180 ? 58.169  -33.956 87.091  1.00 35.78  ? 180 VAL A HG13   1 
ATOM   2974  H HG21   . VAL A 1 180 ? 55.749  -34.669 85.530  1.00 42.85  ? 180 VAL A HG21   1 
ATOM   2975  H HG22   . VAL A 1 180 ? 56.706  -35.809 86.084  1.00 42.85  ? 180 VAL A HG22   1 
ATOM   2976  H HG23   . VAL A 1 180 ? 55.159  -35.827 86.443  1.00 42.85  ? 180 VAL A HG23   1 
ATOM   2977  N N      . PHE A 1 181 ? 55.960  -34.082 90.741  1.00 35.23  ? 181 PHE A N      1 
ATOM   2978  C CA     . PHE A 1 181 ? 56.255  -33.248 91.901  1.00 35.26  ? 181 PHE A CA     1 
ATOM   2979  C C      . PHE A 1 181 ? 56.755  -34.072 93.077  1.00 38.50  ? 181 PHE A C      1 
ATOM   2980  O O      . PHE A 1 181 ? 57.842  -33.830 93.581  1.00 43.18  ? 181 PHE A O      1 
ATOM   2981  C CB     . PHE A 1 181 ? 55.024  -32.460 92.324  1.00 35.57  ? 181 PHE A CB     1 
ATOM   2982  C CG     . PHE A 1 181 ? 55.305  -31.405 93.351  1.00 35.82  ? 181 PHE A CG     1 
ATOM   2983  C CD1    . PHE A 1 181 ? 55.695  -30.130 92.960  1.00 34.37  ? 181 PHE A CD1    1 
ATOM   2984  C CD2    . PHE A 1 181 ? 55.180  -31.683 94.704  1.00 39.67  ? 181 PHE A CD2    1 
ATOM   2985  C CE1    . PHE A 1 181 ? 55.951  -29.147 93.898  1.00 37.28  ? 181 PHE A CE1    1 
ATOM   2986  C CE2    . PHE A 1 181 ? 55.436  -30.700 95.656  1.00 41.15  ? 181 PHE A CE2    1 
ATOM   2987  C CZ     . PHE A 1 181 ? 55.820  -29.426 95.247  1.00 39.59  ? 181 PHE A CZ     1 
ATOM   2988  H H      . PHE A 1 181 ? 55.130  -34.287 90.656  1.00 42.66  ? 181 PHE A H      1 
ATOM   2989  H HA     . PHE A 1 181 ? 56.950  -32.614 91.664  1.00 42.71  ? 181 PHE A HA     1 
ATOM   2990  H HB2    . PHE A 1 181 ? 54.650  -32.022 91.543  1.00 43.07  ? 181 PHE A HB2    1 
ATOM   2991  H HB3    . PHE A 1 181 ? 54.374  -33.073 92.699  1.00 43.07  ? 181 PHE A HB3    1 
ATOM   2992  H HD1    . PHE A 1 181 ? 55.780  -29.934 92.055  1.00 41.64  ? 181 PHE A HD1    1 
ATOM   2993  H HD2    . PHE A 1 181 ? 54.918  -32.533 94.978  1.00 48.00  ? 181 PHE A HD2    1 
ATOM   2994  H HE1    . PHE A 1 181 ? 56.210  -28.297 93.622  1.00 45.13  ? 181 PHE A HE1    1 
ATOM   2995  H HE2    . PHE A 1 181 ? 55.349  -30.892 96.562  1.00 49.77  ? 181 PHE A HE2    1 
ATOM   2996  H HZ     . PHE A 1 181 ? 55.997  -28.767 95.879  1.00 47.90  ? 181 PHE A HZ     1 
ATOM   2997  N N      . TYR A 1 182 ? 55.956  -35.035 93.521  1.00 39.49  ? 182 TYR A N      1 
ATOM   2998  C CA     . TYR A 1 182 ? 56.295  -35.830 94.697  1.00 40.84  ? 182 TYR A CA     1 
ATOM   2999  C C      . TYR A 1 182 ? 57.151  -37.048 94.368  1.00 46.96  ? 182 TYR A C      1 
ATOM   3000  O O      . TYR A 1 182 ? 57.623  -37.738 95.275  1.00 52.05  ? 182 TYR A O      1 
ATOM   3001  C CB     . TYR A 1 182 ? 55.026  -36.274 95.428  1.00 39.04  ? 182 TYR A CB     1 
ATOM   3002  C CG     . TYR A 1 182 ? 54.368  -35.176 96.235  1.00 41.21  ? 182 TYR A CG     1 
ATOM   3003  C CD1    . TYR A 1 182 ? 55.029  -34.590 97.308  1.00 42.99  ? 182 TYR A CD1    1 
ATOM   3004  C CD2    . TYR A 1 182 ? 53.074  -34.765 95.972  1.00 43.00  ? 182 TYR A CD2    1 
ATOM   3005  C CE1    . TYR A 1 182 ? 54.437  -33.595 98.067  1.00 41.84  ? 182 TYR A CE1    1 
ATOM   3006  C CE2    . TYR A 1 182 ? 52.466  -33.765 96.738  1.00 42.58  ? 182 TYR A CE2    1 
ATOM   3007  C CZ     . TYR A 1 182 ? 53.155  -33.191 97.785  1.00 41.39  ? 182 TYR A CZ     1 
ATOM   3008  O OH     . TYR A 1 182 ? 52.570  -32.207 98.552  1.00 42.54  ? 182 TYR A OH     1 
ATOM   3009  H H      . TYR A 1 182 ? 55.206  -35.249 93.158  1.00 47.77  ? 182 TYR A H      1 
ATOM   3010  H HA     . TYR A 1 182 ? 56.803  -35.273 95.307  1.00 49.40  ? 182 TYR A HA     1 
ATOM   3011  H HB2    . TYR A 1 182 ? 54.382  -36.587 94.774  1.00 47.23  ? 182 TYR A HB2    1 
ATOM   3012  H HB3    . TYR A 1 182 ? 55.253  -36.994 96.037  1.00 47.23  ? 182 TYR A HB3    1 
ATOM   3013  H HD1    . TYR A 1 182 ? 55.897  -34.857 97.506  1.00 51.98  ? 182 TYR A HD1    1 
ATOM   3014  H HD2    . TYR A 1 182 ? 52.606  -35.149 95.266  1.00 51.99  ? 182 TYR A HD2    1 
ATOM   3015  H HE1    . TYR A 1 182 ? 54.902  -33.211 98.776  1.00 50.60  ? 182 TYR A HE1    1 
ATOM   3016  H HE2    . TYR A 1 182 ? 51.599  -33.491 96.544  1.00 51.48  ? 182 TYR A HE2    1 
ATOM   3017  H HH     . TYR A 1 182 ? 53.105  -31.950 99.147  1.00 51.44  ? 182 TYR A HH     1 
ATOM   3018  N N      . GLY A 1 183 ? 57.342  -37.310 93.078  1.00 47.08  ? 183 GLY A N      1 
ATOM   3019  C CA     . GLY A 1 183 ? 58.251  -38.351 92.629  1.00 48.30  ? 183 GLY A CA     1 
ATOM   3020  C C      . GLY A 1 183 ? 57.657  -39.728 92.397  1.00 47.80  ? 183 GLY A C      1 
ATOM   3021  O O      . GLY A 1 183 ? 58.201  -40.514 91.630  1.00 47.90  ? 183 GLY A O      1 
ATOM   3022  H H      . GLY A 1 183 ? 56.950  -36.892 92.437  1.00 56.89  ? 183 GLY A H      1 
ATOM   3023  H HA2    . GLY A 1 183 ? 58.658  -38.066 91.796  1.00 58.35  ? 183 GLY A HA2    1 
ATOM   3024  H HA3    . GLY A 1 183 ? 58.958  -38.446 93.285  1.00 58.35  ? 183 GLY A HA3    1 
ATOM   3025  N N      . SER A 1 184 ? 56.547  -40.043 93.045  1.00 47.89  ? 184 SER A N      1 
ATOM   3026  C CA     . SER A 1 184 ? 55.933  -41.340 92.825  1.00 48.43  ? 184 SER A CA     1 
ATOM   3027  C C      . SER A 1 184 ? 54.516  -41.343 93.336  1.00 48.84  ? 184 SER A C      1 
ATOM   3028  O O      . SER A 1 184 ? 54.044  -40.353 93.901  1.00 49.90  ? 184 SER A O      1 
ATOM   3029  C CB     . SER A 1 184 ? 56.722  -42.439 93.516  1.00 48.93  ? 184 SER A CB     1 
ATOM   3030  O OG     . SER A 1 184 ? 56.813  -42.168 94.899  1.00 51.78  ? 184 SER A OG     1 
ATOM   3031  H H      . SER A 1 184 ? 56.137  -39.536 93.606  1.00 57.85  ? 184 SER A H      1 
ATOM   3032  H HA     . SER A 1 184 ? 55.915  -41.530 91.874  1.00 58.51  ? 184 SER A HA     1 
ATOM   3033  H HB2    . SER A 1 184 ? 56.269  -43.287 93.386  1.00 59.11  ? 184 SER A HB2    1 
ATOM   3034  H HB3    . SER A 1 184 ? 57.615  -42.475 93.139  1.00 59.11  ? 184 SER A HB3    1 
ATOM   3035  H HG     . SER A 1 184 ? 57.249  -42.775 95.283  1.00 62.53  ? 184 SER A HG     1 
ATOM   3036  N N      . PHE A 1 185 ? 53.832  -42.457 93.112  1.00 45.87  ? 185 PHE A N      1 
ATOM   3037  C CA     . PHE A 1 185 ? 52.513  -42.637 93.678  1.00 43.48  ? 185 PHE A CA     1 
ATOM   3038  C C      . PHE A 1 185 ? 52.547  -42.529 95.182  1.00 48.30  ? 185 PHE A C      1 
ATOM   3039  O O      . PHE A 1 185 ? 51.902  -41.665 95.775  1.00 54.50  ? 185 PHE A O      1 
ATOM   3040  C CB     . PHE A 1 185 ? 51.947  -44.009 93.330  1.00 45.69  ? 185 PHE A CB     1 
ATOM   3041  C CG     . PHE A 1 185 ? 50.790  -44.407 94.208  1.00 46.44  ? 185 PHE A CG     1 
ATOM   3042  C CD1    . PHE A 1 185 ? 49.534  -43.852 94.023  1.00 44.38  ? 185 PHE A CD1    1 
ATOM   3043  C CD2    . PHE A 1 185 ? 50.972  -45.309 95.245  1.00 44.86  ? 185 PHE A CD2    1 
ATOM   3044  C CE1    . PHE A 1 185 ? 48.474  -44.208 94.839  1.00 40.44  ? 185 PHE A CE1    1 
ATOM   3045  C CE2    . PHE A 1 185 ? 49.916  -45.664 96.069  1.00 39.89  ? 185 PHE A CE2    1 
ATOM   3046  C CZ     . PHE A 1 185 ? 48.665  -45.115 95.862  1.00 38.49  ? 185 PHE A CZ     1 
ATOM   3047  H H      . PHE A 1 185 ? 54.111  -43.118 92.638  1.00 55.44  ? 185 PHE A H      1 
ATOM   3048  H HA     . PHE A 1 185 ? 51.914  -41.958 93.332  1.00 52.57  ? 185 PHE A HA     1 
ATOM   3049  H HB2    . PHE A 1 185 ? 51.635  -43.998 92.412  1.00 55.22  ? 185 PHE A HB2    1 
ATOM   3050  H HB3    . PHE A 1 185 ? 52.645  -44.675 93.435  1.00 55.22  ? 185 PHE A HB3    1 
ATOM   3051  H HD1    . PHE A 1 185 ? 49.398  -43.242 93.334  1.00 53.65  ? 185 PHE A HD1    1 
ATOM   3052  H HD2    . PHE A 1 185 ? 51.811  -45.684 95.387  1.00 54.22  ? 185 PHE A HD2    1 
ATOM   3053  H HE1    . PHE A 1 185 ? 47.634  -43.834 94.700  1.00 48.91  ? 185 PHE A HE1    1 
ATOM   3054  H HE2    . PHE A 1 185 ? 50.047  -46.277 96.756  1.00 48.26  ? 185 PHE A HE2    1 
ATOM   3055  H HZ     . PHE A 1 185 ? 47.955  -45.353 96.412  1.00 46.58  ? 185 PHE A HZ     1 
ATOM   3056  N N      . LEU A 1 186 ? 53.354  -43.395 95.782  1.00 49.31  ? 186 LEU A N      1 
ATOM   3057  C CA     . LEU A 1 186 ? 53.356  -43.589 97.223  1.00 50.63  ? 186 LEU A CA     1 
ATOM   3058  C C      . LEU A 1 186 ? 53.660  -42.297 97.969  1.00 47.74  ? 186 LEU A C      1 
ATOM   3059  O O      . LEU A 1 186 ? 52.955  -41.938 98.904  1.00 51.64  ? 186 LEU A O      1 
ATOM   3060  C CB     . LEU A 1 186 ? 54.377  -44.671 97.584  1.00 53.32  ? 186 LEU A CB     1 
ATOM   3061  C CG     . LEU A 1 186 ? 54.184  -45.423 98.901  1.00 53.96  ? 186 LEU A CG     1 
ATOM   3062  C CD1    . LEU A 1 186 ? 55.035  -46.681 98.874  1.00 53.05  ? 186 LEU A CD1    1 
ATOM   3063  C CD2    . LEU A 1 186 ? 54.527  -44.573 100.114 1.00 56.28  ? 186 LEU A CD2    1 
ATOM   3064  H H      . LEU A 1 186 ? 53.920  -43.891 95.366  1.00 59.56  ? 186 LEU A H      1 
ATOM   3065  H HA     . LEU A 1 186 ? 52.480  -43.897 97.502  1.00 61.15  ? 186 LEU A HA     1 
ATOM   3066  H HB2    . LEU A 1 186 ? 54.372  -45.335 96.876  1.00 64.38  ? 186 LEU A HB2    1 
ATOM   3067  H HB3    . LEU A 1 186 ? 55.253  -44.255 97.622  1.00 64.38  ? 186 LEU A HB3    1 
ATOM   3068  H HG     . LEU A 1 186 ? 53.255  -45.692 98.977  1.00 65.14  ? 186 LEU A HG     1 
ATOM   3069  H HD11   . LEU A 1 186 ? 54.914  -47.161 99.708  1.00 64.05  ? 186 LEU A HD11   1 
ATOM   3070  H HD12   . LEU A 1 186 ? 54.754  -47.236 98.129  1.00 64.05  ? 186 LEU A HD12   1 
ATOM   3071  H HD13   . LEU A 1 186 ? 55.965  -46.430 98.767  1.00 64.05  ? 186 LEU A HD13   1 
ATOM   3072  H HD21   . LEU A 1 186 ? 54.386  -45.099 100.917 1.00 67.93  ? 186 LEU A HD21   1 
ATOM   3073  H HD22   . LEU A 1 186 ? 55.456  -44.300 100.056 1.00 67.93  ? 186 LEU A HD22   1 
ATOM   3074  H HD23   . LEU A 1 186 ? 53.952  -43.792 100.125 1.00 67.93  ? 186 LEU A HD23   1 
ATOM   3075  N N      . GLU A 1 187 ? 54.681  -41.583 97.518  1.00 43.05  ? 187 GLU A N      1 
ATOM   3076  C CA     . GLU A 1 187 ? 55.089  -40.351 98.168  1.00 43.37  ? 187 GLU A CA     1 
ATOM   3077  C C      . GLU A 1 187 ? 53.996  -39.319 98.059  1.00 40.19  ? 187 GLU A C      1 
ATOM   3078  O O      . GLU A 1 187 ? 53.864  -38.457 98.923  1.00 43.46  ? 187 GLU A O      1 
ATOM   3079  C CB     . GLU A 1 187 ? 56.380  -39.811 97.546  1.00 50.31  ? 187 GLU A CB     1 
ATOM   3080  C CG     . GLU A 1 187 ? 57.648  -40.385 98.142  1.00 59.01  ? 187 GLU A CG     1 
ATOM   3081  C CD     . GLU A 1 187 ? 57.751  -40.132 99.632  1.00 67.39  ? 187 GLU A CD     1 
ATOM   3082  O OE1    . GLU A 1 187 ? 57.186  -39.111 100.086 1.00 72.64  ? 187 GLU A OE1    1 
ATOM   3083  O OE2    . GLU A 1 187 ? 58.383  -40.952 100.344 1.00 66.65  ? 187 GLU A OE2    1 
ATOM   3084  H H      . GLU A 1 187 ? 55.156  -41.793 96.833  1.00 52.06  ? 187 GLU A H      1 
ATOM   3085  H HA     . GLU A 1 187 ? 55.253  -40.523 99.109  1.00 52.43  ? 187 GLU A HA     1 
ATOM   3086  H HB2    . GLU A 1 187 ? 56.379  -40.020 96.598  1.00 60.76  ? 187 GLU A HB2    1 
ATOM   3087  H HB3    . GLU A 1 187 ? 56.405  -38.849 97.669  1.00 60.76  ? 187 GLU A HB3    1 
ATOM   3088  H HG2    . GLU A 1 187 ? 57.660  -41.344 97.997  1.00 71.20  ? 187 GLU A HG2    1 
ATOM   3089  H HG3    . GLU A 1 187 ? 58.414  -39.973 97.713  1.00 71.20  ? 187 GLU A HG3    1 
ATOM   3090  N N      . THR A 1 188 ? 53.211  -39.396 96.996  1.00 33.43  ? 188 THR A N      1 
ATOM   3091  C CA     . THR A 1 188 ? 52.127  -38.447 96.834  1.00 32.23  ? 188 THR A CA     1 
ATOM   3092  C C      . THR A 1 188 ? 51.107  -38.732 97.941  1.00 33.89  ? 188 THR A C      1 
ATOM   3093  O O      . THR A 1 188 ? 50.752  -37.849 98.719  1.00 31.91  ? 188 THR A O      1 
ATOM   3094  C CB     . THR A 1 188 ? 51.487  -38.535 95.425  1.00 28.87  ? 188 THR A CB     1 
ATOM   3095  O OG1    . THR A 1 188 ? 52.489  -38.320 94.425  1.00 28.55  ? 188 THR A OG1    1 
ATOM   3096  C CG2    . THR A 1 188 ? 50.392  -37.499 95.265  1.00 27.20  ? 188 THR A CG2    1 
ATOM   3097  H H      . THR A 1 188 ? 53.283  -39.976 96.365  1.00 40.51  ? 188 THR A H      1 
ATOM   3098  H HA     . THR A 1 188 ? 52.467  -37.547 96.958  1.00 39.07  ? 188 THR A HA     1 
ATOM   3099  H HB     . THR A 1 188 ? 51.095  -39.414 95.304  1.00 35.04  ? 188 THR A HB     1 
ATOM   3100  H HG1    . THR A 1 188 ? 53.090  -38.903 94.491  1.00 34.65  ? 188 THR A HG1    1 
ATOM   3101  H HG21   . THR A 1 188 ? 50.000  -37.564 94.380  1.00 33.03  ? 188 THR A HG21   1 
ATOM   3102  H HG22   . THR A 1 188 ? 49.699  -37.644 95.928  1.00 33.03  ? 188 THR A HG22   1 
ATOM   3103  H HG23   . THR A 1 188 ? 50.758  -36.608 95.382  1.00 33.03  ? 188 THR A HG23   1 
ATOM   3104  N N      . VAL A 1 189 ? 50.668  -39.980 98.022  1.00 37.21  ? 189 VAL A N      1 
ATOM   3105  C CA     . VAL A 1 189 ? 49.771  -40.405 99.077  1.00 38.00  ? 189 VAL A CA     1 
ATOM   3106  C C      . VAL A 1 189 ? 50.370  -40.062 100.425 1.00 44.72  ? 189 VAL A C      1 
ATOM   3107  O O      . VAL A 1 189 ? 49.683  -39.542 101.291 1.00 46.77  ? 189 VAL A O      1 
ATOM   3108  C CB     . VAL A 1 189 ? 49.484  -41.891 98.967  1.00 34.81  ? 189 VAL A CB     1 
ATOM   3109  C CG1    . VAL A 1 189 ? 48.800  -42.425 100.202 1.00 39.99  ? 189 VAL A CG1    1 
ATOM   3110  C CG2    . VAL A 1 189 ? 48.634  -42.123 97.752  1.00 33.40  ? 189 VAL A CG2    1 
ATOM   3111  H H      . VAL A 1 189 ? 50.880  -40.605 97.471  1.00 45.04  ? 189 VAL A H      1 
ATOM   3112  H HA     . VAL A 1 189 ? 48.931  -39.929 98.991  1.00 45.99  ? 189 VAL A HA     1 
ATOM   3113  H HB     . VAL A 1 189 ? 50.319  -42.370 98.850  1.00 42.17  ? 189 VAL A HB     1 
ATOM   3114  H HG11   . VAL A 1 189 ? 48.637  -43.374 100.086 1.00 48.37  ? 189 VAL A HG11   1 
ATOM   3115  H HG12   . VAL A 1 189 ? 49.376  -42.279 100.969 1.00 48.37  ? 189 VAL A HG12   1 
ATOM   3116  H HG13   . VAL A 1 189 ? 47.960  -41.957 100.324 1.00 48.37  ? 189 VAL A HG13   1 
ATOM   3117  H HG21   . VAL A 1 189 ? 48.446  -43.071 97.675  1.00 40.47  ? 189 VAL A HG21   1 
ATOM   3118  H HG22   . VAL A 1 189 ? 47.805  -41.628 97.848  1.00 40.47  ? 189 VAL A HG22   1 
ATOM   3119  H HG23   . VAL A 1 189 ? 49.115  -41.816 96.968  1.00 40.47  ? 189 VAL A HG23   1 
ATOM   3120  N N      . LYS A 1 190 ? 51.656  -40.338 100.596 1.00 48.71  ? 190 LYS A N      1 
ATOM   3121  C CA     . LYS A 1 190 ? 52.341  -40.021 101.845 1.00 49.84  ? 190 LYS A CA     1 
ATOM   3122  C C      . LYS A 1 190 ? 52.216  -38.535 102.156 1.00 51.02  ? 190 LYS A C      1 
ATOM   3123  O O      . LYS A 1 190 ? 51.930  -38.160 103.292 1.00 57.42  ? 190 LYS A O      1 
ATOM   3124  C CB     . LYS A 1 190 ? 53.824  -40.413 101.775 1.00 51.88  ? 190 LYS A CB     1 
ATOM   3125  C CG     . LYS A 1 190 ? 54.529  -40.400 103.130 1.00 60.83  ? 190 LYS A CG     1 
ATOM   3126  C CD     . LYS A 1 190 ? 56.046  -40.613 103.023 1.00 67.83  ? 190 LYS A CD     1 
ATOM   3127  C CE     . LYS A 1 190 ? 56.404  -41.991 102.467 1.00 68.40  ? 190 LYS A CE     1 
ATOM   3128  N NZ     . LYS A 1 190 ? 57.877  -42.178 102.355 1.00 66.41  ? 190 LYS A NZ     1 
ATOM   3129  H H      . LYS A 1 190 ? 52.157  -40.709 100.004 1.00 58.84  ? 190 LYS A H      1 
ATOM   3130  H HA     . LYS A 1 190 ? 51.930  -40.518 102.570 1.00 60.20  ? 190 LYS A HA     1 
ATOM   3131  H HB2    . LYS A 1 190 ? 53.894  -41.310 101.414 1.00 62.65  ? 190 LYS A HB2    1 
ATOM   3132  H HB3    . LYS A 1 190 ? 54.286  -39.788 101.195 1.00 62.65  ? 190 LYS A HB3    1 
ATOM   3133  H HG2    . LYS A 1 190 ? 54.377  -39.541 103.555 1.00 73.38  ? 190 LYS A HG2    1 
ATOM   3134  H HG3    . LYS A 1 190 ? 54.165  -41.111 103.681 1.00 73.38  ? 190 LYS A HG3    1 
ATOM   3135  H HD2    . LYS A 1 190 ? 56.420  -39.943 102.430 1.00 81.79  ? 190 LYS A HD2    1 
ATOM   3136  H HD3    . LYS A 1 190 ? 56.440  -40.533 103.906 1.00 81.79  ? 190 LYS A HD3    1 
ATOM   3137  H HE2    . LYS A 1 190 ? 56.056  -42.675 103.061 1.00 82.47  ? 190 LYS A HE2    1 
ATOM   3138  H HE3    . LYS A 1 190 ? 56.018  -42.088 101.583 1.00 82.47  ? 190 LYS A HE3    1 
ATOM   3139  H HZ1    . LYS A 1 190 ? 58.057  -42.987 102.030 1.00 80.09  ? 190 LYS A HZ1    1 
ATOM   3140  H HZ2    . LYS A 1 190 ? 58.221  -41.564 101.810 1.00 80.09  ? 190 LYS A HZ2    1 
ATOM   3141  H HZ3    . LYS A 1 190 ? 58.256  -42.098 103.157 1.00 80.09  ? 190 LYS A HZ3    1 
ATOM   3142  N N      . ASN A 1 191 ? 52.415  -37.698 101.136 1.00 42.61  ? 191 ASN A N      1 
ATOM   3143  C CA     . ASN A 1 191 ? 52.390  -36.241 101.292 1.00 36.51  ? 191 ASN A CA     1 
ATOM   3144  C C      . ASN A 1 191 ? 50.996  -35.612 101.301 1.00 37.52  ? 191 ASN A C      1 
ATOM   3145  O O      . ASN A 1 191 ? 50.784  -34.610 101.982 1.00 41.02  ? 191 ASN A O      1 
ATOM   3146  C CB     . ASN A 1 191 ? 53.221  -35.592 100.191 1.00 34.84  ? 191 ASN A CB     1 
ATOM   3147  C CG     . ASN A 1 191 ? 54.711  -35.666 100.473 1.00 39.83  ? 191 ASN A CG     1 
ATOM   3148  O OD1    . ASN A 1 191 ? 55.284  -34.773 101.092 1.00 38.19  ? 191 ASN A OD1    1 
ATOM   3149  N ND2    . ASN A 1 191 ? 55.345  -36.744 100.029 1.00 42.91  ? 191 ASN A ND2    1 
ATOM   3150  H H      . ASN A 1 191 ? 52.570  -37.955 100.330 1.00 51.52  ? 191 ASN A H      1 
ATOM   3151  H HA     . ASN A 1 191 ? 52.810  -36.020 102.138 1.00 44.20  ? 191 ASN A HA     1 
ATOM   3152  H HB2    . ASN A 1 191 ? 53.050  -36.050 99.353  1.00 42.20  ? 191 ASN A HB2    1 
ATOM   3153  H HB3    . ASN A 1 191 ? 52.974  -34.657 100.116 1.00 42.20  ? 191 ASN A HB3    1 
ATOM   3154  H HD21   . ASN A 1 191 ? 56.189  -36.833 100.163 1.00 51.88  ? 191 ASN A HD21   1 
ATOM   3155  H HD22   . ASN A 1 191 ? 54.910  -37.355 99.606  1.00 51.88  ? 191 ASN A HD22   1 
ATOM   3156  N N      . ALA A 1 192 ? 50.063  -36.171 100.531 1.00 37.51  ? 192 ALA A N      1 
ATOM   3157  C CA     . ALA A 1 192 ? 48.705  -35.631 100.440 1.00 33.97  ? 192 ALA A CA     1 
ATOM   3158  C C      . ALA A 1 192 ? 48.026  -35.489 101.793 1.00 38.37  ? 192 ALA A C      1 
ATOM   3159  O O      . ALA A 1 192 ? 47.174  -34.624 101.961 1.00 43.34  ? 192 ALA A O      1 
ATOM   3160  C CB     . ALA A 1 192 ? 47.852  -36.501 99.541  1.00 30.54  ? 192 ALA A CB     1 
ATOM   3161  H H      . ALA A 1 192 ? 50.192  -36.870 100.047 1.00 45.41  ? 192 ALA A H      1 
ATOM   3162  H HA     . ALA A 1 192 ? 48.749  -34.749 100.039 1.00 41.16  ? 192 ALA A HA     1 
ATOM   3163  H HB1    . ALA A 1 192 ? 46.959  -36.126 99.495  1.00 37.04  ? 192 ALA A HB1    1 
ATOM   3164  H HB2    . ALA A 1 192 ? 48.248  -36.523 98.656  1.00 37.04  ? 192 ALA A HB2    1 
ATOM   3165  H HB3    . ALA A 1 192 ? 47.817  -37.397 99.910  1.00 37.04  ? 192 ALA A HB3    1 
ATOM   3166  N N      . ARG A 1 193 ? 48.399  -36.336 102.749 1.00 34.69  ? 193 ARG A N      1 
ATOM   3167  C CA     . ARG A 1 193 ? 47.766  -36.346 104.074 1.00 31.20  ? 193 ARG A CA     1 
ATOM   3168  C C      . ARG A 1 193 ? 47.876  -35.014 104.787 1.00 33.54  ? 193 ARG A C      1 
ATOM   3169  O O      . ARG A 1 193 ? 47.060  -34.684 105.650 1.00 35.15  ? 193 ARG A O      1 
ATOM   3170  C CB     . ARG A 1 193 ? 48.394  -37.426 104.959 1.00 31.31  ? 193 ARG A CB     1 
ATOM   3171  C CG     . ARG A 1 193 ? 48.276  -38.830 104.404 1.00 34.59  ? 193 ARG A CG     1 
ATOM   3172  C CD     . ARG A 1 193 ? 48.936  -39.871 105.301 1.00 39.88  ? 193 ARG A CD     1 
ATOM   3173  N NE     . ARG A 1 193 ? 50.373  -39.663 105.453 1.00 39.80  ? 193 ARG A NE     1 
ATOM   3174  C CZ     . ARG A 1 193 ? 51.150  -40.367 106.271 1.00 41.15  ? 193 ARG A CZ     1 
ATOM   3175  N NH1    . ARG A 1 193 ? 50.648  -41.362 106.999 1.00 42.65  ? 193 ARG A NH1    1 
ATOM   3176  N NH2    . ARG A 1 193 ? 52.442  -40.090 106.340 1.00 42.06  ? 193 ARG A NH2    1 
ATOM   3177  H H      . ARG A 1 193 ? 49.022  -36.922 102.658 1.00 42.02  ? 193 ARG A H      1 
ATOM   3178  H HA     . ARG A 1 193 ? 46.824  -36.554 103.971 1.00 37.83  ? 193 ARG A HA     1 
ATOM   3179  H HB2    . ARG A 1 193 ? 49.338  -37.229 105.067 1.00 37.96  ? 193 ARG A HB2    1 
ATOM   3180  H HB3    . ARG A 1 193 ? 47.956  -37.412 105.824 1.00 37.96  ? 193 ARG A HB3    1 
ATOM   3181  H HG2    . ARG A 1 193 ? 47.337  -39.058 104.319 1.00 41.90  ? 193 ARG A HG2    1 
ATOM   3182  H HG3    . ARG A 1 193 ? 48.707  -38.864 103.536 1.00 41.90  ? 193 ARG A HG3    1 
ATOM   3183  H HD2    . ARG A 1 193 ? 48.533  -39.829 106.182 1.00 48.25  ? 193 ARG A HD2    1 
ATOM   3184  H HD3    . ARG A 1 193 ? 48.800  -40.751 104.915 1.00 48.25  ? 193 ARG A HD3    1 
ATOM   3185  H HE     . ARG A 1 193 ? 50.741  -39.045 104.982 1.00 48.15  ? 193 ARG A HE     1 
ATOM   3186  H HH11   . ARG A 1 193 ? 49.809  -41.545 106.957 1.00 51.57  ? 193 ARG A HH11   1 
ATOM   3187  H HH12   . ARG A 1 193 ? 51.161  -41.814 107.520 1.00 51.57  ? 193 ARG A HH12   1 
ATOM   3188  H HH21   . ARG A 1 193 ? 52.771  -39.452 105.866 1.00 50.87  ? 193 ARG A HH21   1 
ATOM   3189  H HH22   . ARG A 1 193 ? 52.953  -40.547 106.859 1.00 50.87  ? 193 ARG A HH22   1 
ATOM   3190  N N      . ARG A 1 194 ? 48.920  -34.273 104.447 1.00 42.16  ? 194 ARG A N      1 
ATOM   3191  C CA     . ARG A 1 194 ? 49.229  -33.030 105.125 1.00 50.97  ? 194 ARG A CA     1 
ATOM   3192  C C      . ARG A 1 194 ? 48.719  -31.812 104.361 1.00 48.61  ? 194 ARG A C      1 
ATOM   3193  O O      . ARG A 1 194 ? 48.942  -30.680 104.765 1.00 53.09  ? 194 ARG A O      1 
ATOM   3194  C CB     . ARG A 1 194 ? 50.736  -32.974 105.351 1.00 58.49  ? 194 ARG A CB     1 
ATOM   3195  C CG     . ARG A 1 194 ? 51.168  -34.140 106.239 1.00 63.07  ? 194 ARG A CG     1 
ATOM   3196  C CD     . ARG A 1 194 ? 50.652  -34.052 107.674 1.00 69.66  ? 194 ARG A CD     1 
ATOM   3197  N NE     . ARG A 1 194 ? 50.528  -35.398 108.221 1.00 74.21  ? 194 ARG A NE     1 
ATOM   3198  C CZ     . ARG A 1 194 ? 51.540  -36.133 108.660 1.00 76.29  ? 194 ARG A CZ     1 
ATOM   3199  N NH1    . ARG A 1 194 ? 52.777  -35.666 108.610 1.00 78.46  ? 194 ARG A NH1    1 
ATOM   3200  N NH2    . ARG A 1 194 ? 51.311  -37.352 109.123 1.00 76.25  ? 194 ARG A NH2    1 
ATOM   3201  H H      . ARG A 1 194 ? 49.471  -34.474 103.818 1.00 50.98  ? 194 ARG A H      1 
ATOM   3202  H HA     . ARG A 1 194 ? 48.799  -33.034 105.995 1.00 61.55  ? 194 ARG A HA     1 
ATOM   3203  H HB2    . ARG A 1 194 ? 51.196  -33.046 104.500 1.00 70.58  ? 194 ARG A HB2    1 
ATOM   3204  H HB3    . ARG A 1 194 ? 50.968  -32.144 105.796 1.00 70.58  ? 194 ARG A HB3    1 
ATOM   3205  H HG2    . ARG A 1 194 ? 50.834  -34.965 105.854 1.00 76.08  ? 194 ARG A HG2    1 
ATOM   3206  H HG3    . ARG A 1 194 ? 52.137  -34.162 106.274 1.00 76.08  ? 194 ARG A HG3    1 
ATOM   3207  H HD2    . ARG A 1 194 ? 51.281  -33.552 108.218 1.00 83.99  ? 194 ARG A HD2    1 
ATOM   3208  H HD3    . ARG A 1 194 ? 49.779  -33.630 107.683 1.00 83.99  ? 194 ARG A HD3    1 
ATOM   3209  H HE     . ARG A 1 194 ? 49.740  -35.740 108.261 1.00 89.44  ? 194 ARG A HE     1 
ATOM   3210  H HH11   . ARG A 1 194 ? 52.926  -34.877 108.303 1.00 94.54  ? 194 ARG A HH11   1 
ATOM   3211  H HH12   . ARG A 1 194 ? 53.430  -36.148 108.894 1.00 94.54  ? 194 ARG A HH12   1 
ATOM   3212  H HH21   . ARG A 1 194 ? 50.508  -37.657 109.154 1.00 91.89  ? 194 ARG A HH21   1 
ATOM   3213  H HH22   . ARG A 1 194 ? 51.965  -37.832 109.409 1.00 91.89  ? 194 ARG A HH22   1 
ATOM   3214  N N      . TRP A 1 195 ? 48.052  -32.045 103.241 1.00 43.46  ? 195 TRP A N      1 
ATOM   3215  C CA     . TRP A 1 195 ? 47.470  -30.956 102.468 1.00 37.90  ? 195 TRP A CA     1 
ATOM   3216  C C      . TRP A 1 195 ? 46.371  -30.259 103.266 1.00 35.80  ? 195 TRP A C      1 
ATOM   3217  O O      . TRP A 1 195 ? 45.719  -30.880 104.108 1.00 34.38  ? 195 TRP A O      1 
ATOM   3218  C CB     . TRP A 1 195 ? 46.898  -31.485 101.159 1.00 31.14  ? 195 TRP A CB     1 
ATOM   3219  C CG     . TRP A 1 195 ? 47.908  -31.888 100.148 1.00 27.88  ? 195 TRP A CG     1 
ATOM   3220  C CD1    . TRP A 1 195 ? 49.259  -31.790 100.248 1.00 29.97  ? 195 TRP A CD1    1 
ATOM   3221  C CD2    . TRP A 1 195 ? 47.647  -32.540 98.900  1.00 30.31  ? 195 TRP A CD2    1 
ATOM   3222  N NE1    . TRP A 1 195 ? 49.862  -32.304 99.118  1.00 28.63  ? 195 TRP A NE1    1 
ATOM   3223  C CE2    . TRP A 1 195 ? 48.887  -32.773 98.276  1.00 29.88  ? 195 TRP A CE2    1 
ATOM   3224  C CE3    . TRP A 1 195 ? 46.479  -32.937 98.243  1.00 31.39  ? 195 TRP A CE3    1 
ATOM   3225  C CZ2    . TRP A 1 195 ? 48.994  -33.378 97.032  1.00 29.79  ? 195 TRP A CZ2    1 
ATOM   3226  C CZ3    . TRP A 1 195 ? 46.588  -33.532 97.003  1.00 29.19  ? 195 TRP A CZ3    1 
ATOM   3227  C CH2    . TRP A 1 195 ? 47.836  -33.750 96.411  1.00 25.92  ? 195 TRP A CH2    1 
ATOM   3228  H H      . TRP A 1 195 ? 47.922  -32.826 102.905 1.00 52.54  ? 195 TRP A H      1 
ATOM   3229  H HA     . TRP A 1 195 ? 48.158  -30.304 102.260 1.00 45.87  ? 195 TRP A HA     1 
ATOM   3230  H HB2    . TRP A 1 195 ? 46.352  -32.263 101.353 1.00 37.76  ? 195 TRP A HB2    1 
ATOM   3231  H HB3    . TRP A 1 195 ? 46.347  -30.793 100.761 1.00 37.76  ? 195 TRP A HB3    1 
ATOM   3232  H HD1    . TRP A 1 195 ? 49.712  -31.410 100.966 1.00 36.35  ? 195 TRP A HD1    1 
ATOM   3233  H HE1    . TRP A 1 195 ? 50.708  -32.330 98.968  1.00 34.74  ? 195 TRP A HE1    1 
ATOM   3234  H HE3    . TRP A 1 195 ? 45.644  -32.790 98.627  1.00 38.06  ? 195 TRP A HE3    1 
ATOM   3235  H HZ2    . TRP A 1 195 ? 49.823  -33.524 96.635  1.00 36.14  ? 195 TRP A HZ2    1 
ATOM   3236  H HZ3    . TRP A 1 195 ? 45.818  -33.798 96.555  1.00 35.42  ? 195 TRP A HZ3    1 
ATOM   3237  H HH2    . TRP A 1 195 ? 47.878  -34.157 95.576  1.00 31.50  ? 195 TRP A HH2    1 
ATOM   3238  N N      . THR A 1 196 ? 46.175  -28.972 102.983 1.00 34.96  ? 196 THR A N      1 
ATOM   3239  C CA     . THR A 1 196 ? 45.068  -28.200 103.539 1.00 37.04  ? 196 THR A CA     1 
ATOM   3240  C C      . THR A 1 196 ? 44.308  -27.476 102.432 1.00 36.26  ? 196 THR A C      1 
ATOM   3241  O O      . THR A 1 196 ? 44.788  -27.349 101.307 1.00 35.63  ? 196 THR A O      1 
ATOM   3242  C CB     . THR A 1 196 ? 45.541  -27.140 104.565 1.00 37.07  ? 196 THR A CB     1 
ATOM   3243  O OG1    . THR A 1 196 ? 46.254  -26.098 103.879 1.00 37.22  ? 196 THR A OG1    1 
ATOM   3244  C CG2    . THR A 1 196 ? 46.440  -27.754 105.633 1.00 37.13  ? 196 THR A CG2    1 
ATOM   3245  H H      . THR A 1 196 ? 46.682  -28.515 102.460 1.00 42.34  ? 196 THR A H      1 
ATOM   3246  H HA     . THR A 1 196 ? 44.452  -28.801 103.986 1.00 44.84  ? 196 THR A HA     1 
ATOM   3247  H HB     . THR A 1 196 ? 44.767  -26.758 105.006 1.00 44.88  ? 196 THR A HB     1 
ATOM   3248  H HG1    . THR A 1 196 ? 46.515  -25.518 104.428 1.00 45.05  ? 196 THR A HG1    1 
ATOM   3249  H HG21   . THR A 1 196 ? 46.721  -27.071 106.261 1.00 44.95  ? 196 THR A HG21   1 
ATOM   3250  H HG22   . THR A 1 196 ? 45.958  -28.445 106.114 1.00 44.95  ? 196 THR A HG22   1 
ATOM   3251  H HG23   . THR A 1 196 ? 47.225  -28.146 105.220 1.00 44.95  ? 196 THR A HG23   1 
ATOM   3252  N N      . ARG A 1 197 ? 43.117  -26.990 102.770 1.00 34.76  ? 197 ARG A N      1 
ATOM   3253  C CA     . ARG A 1 197 ? 42.274  -26.301 101.806 1.00 33.50  ? 197 ARG A CA     1 
ATOM   3254  C C      . ARG A 1 197 ? 42.980  -25.065 101.244 1.00 39.20  ? 197 ARG A C      1 
ATOM   3255  O O      . ARG A 1 197 ? 42.630  -24.587 100.161 1.00 42.06  ? 197 ARG A O      1 
ATOM   3256  C CB     . ARG A 1 197 ? 40.933  -25.932 102.444 1.00 31.64  ? 197 ARG A CB     1 
ATOM   3257  C CG     . ARG A 1 197 ? 41.013  -24.949 103.587 1.00 36.86  ? 197 ARG A CG     1 
ATOM   3258  C CD     . ARG A 1 197 ? 39.718  -24.916 104.371 1.00 38.12  ? 197 ARG A CD     1 
ATOM   3259  N NE     . ARG A 1 197 ? 39.414  -26.223 104.931 1.00 39.23  ? 197 ARG A NE     1 
ATOM   3260  C CZ     . ARG A 1 197 ? 38.215  -26.596 105.364 1.00 40.64  ? 197 ARG A CZ     1 
ATOM   3261  N NH1    . ARG A 1 197 ? 37.175  -25.768 105.292 1.00 45.24  ? 197 ARG A NH1    1 
ATOM   3262  N NH2    . ARG A 1 197 ? 38.056  -27.809 105.863 1.00 36.41  ? 197 ARG A NH2    1 
ATOM   3263  H H      . ARG A 1 197 ? 42.775  -27.048 103.557 1.00 42.10  ? 197 ARG A H      1 
ATOM   3264  H HA     . ARG A 1 197 ? 42.093  -26.901 101.065 1.00 40.59  ? 197 ARG A HA     1 
ATOM   3265  H HB2    . ARG A 1 197 ? 40.366  -25.541 101.761 1.00 38.35  ? 197 ARG A HB2    1 
ATOM   3266  H HB3    . ARG A 1 197 ? 40.521  -26.742 102.784 1.00 38.35  ? 197 ARG A HB3    1 
ATOM   3267  H HG2    . ARG A 1 197 ? 41.727  -25.212 104.188 1.00 44.62  ? 197 ARG A HG2    1 
ATOM   3268  H HG3    . ARG A 1 197 ? 41.180  -24.060 103.235 1.00 44.62  ? 197 ARG A HG3    1 
ATOM   3269  H HD2    . ARG A 1 197 ? 39.800  -24.282 105.100 1.00 46.13  ? 197 ARG A HD2    1 
ATOM   3270  H HD3    . ARG A 1 197 ? 38.992  -24.659 103.781 1.00 46.13  ? 197 ARG A HD3    1 
ATOM   3271  H HE     . ARG A 1 197 ? 40.054  -26.795 104.986 1.00 47.47  ? 197 ARG A HE     1 
ATOM   3272  H HH11   . ARG A 1 197 ? 37.275  -24.978 104.969 1.00 54.68  ? 197 ARG A HH11   1 
ATOM   3273  H HH12   . ARG A 1 197 ? 36.403  -26.023 105.573 1.00 54.68  ? 197 ARG A HH12   1 
ATOM   3274  H HH21   . ARG A 1 197 ? 38.725  -28.347 105.907 1.00 44.08  ? 197 ARG A HH21   1 
ATOM   3275  H HH22   . ARG A 1 197 ? 37.282  -28.061 106.140 1.00 44.08  ? 197 ARG A HH22   1 
ATOM   3276  N N      . ARG A 1 198 ? 43.970  -24.565 101.988 1.00 40.27  ? 198 ARG A N      1 
ATOM   3277  C CA     . ARG A 1 198 ? 44.753  -23.385 101.605 1.00 42.95  ? 198 ARG A CA     1 
ATOM   3278  C C      . ARG A 1 198 ? 46.092  -23.749 100.925 1.00 39.92  ? 198 ARG A C      1 
ATOM   3279  O O      . ARG A 1 198 ? 46.928  -22.867 100.678 1.00 35.50  ? 198 ARG A O      1 
ATOM   3280  C CB     . ARG A 1 198 ? 45.021  -22.523 102.835 1.00 48.49  ? 198 ARG A CB     1 
ATOM   3281  C CG     . ARG A 1 198 ? 43.746  -22.073 103.523 1.00 54.84  ? 198 ARG A CG     1 
ATOM   3282  C CD     . ARG A 1 198 ? 43.881  -20.749 104.252 1.00 63.76  ? 198 ARG A CD     1 
ATOM   3283  N NE     . ARG A 1 198 ? 42.581  -20.304 104.754 1.00 69.83  ? 198 ARG A NE     1 
ATOM   3284  C CZ     . ARG A 1 198 ? 42.379  -19.167 105.412 1.00 72.56  ? 198 ARG A CZ     1 
ATOM   3285  N NH1    . ARG A 1 198 ? 43.396  -18.344 105.641 1.00 74.51  ? 198 ARG A NH1    1 
ATOM   3286  N NH2    . ARG A 1 198 ? 41.159  -18.846 105.834 1.00 70.97  ? 198 ARG A NH2    1 
ATOM   3287  H H      . ARG A 1 198 ? 44.213  -24.901 102.741 1.00 48.72  ? 198 ARG A H      1 
ATOM   3288  H HA     . ARG A 1 198 ? 44.235  -22.856 100.978 1.00 51.94  ? 198 ARG A HA     1 
ATOM   3289  H HB2    . ARG A 1 198 ? 45.542  -23.036 103.473 1.00 58.58  ? 198 ARG A HB2    1 
ATOM   3290  H HB3    . ARG A 1 198 ? 45.513  -21.731 102.565 1.00 58.58  ? 198 ARG A HB3    1 
ATOM   3291  H HG2    . ARG A 1 198 ? 43.048  -21.975 102.856 1.00 66.19  ? 198 ARG A HG2    1 
ATOM   3292  H HG3    . ARG A 1 198 ? 43.487  -22.745 104.173 1.00 66.19  ? 198 ARG A HG3    1 
ATOM   3293  H HD2    . ARG A 1 198 ? 44.481  -20.856 105.007 1.00 76.90  ? 198 ARG A HD2    1 
ATOM   3294  H HD3    . ARG A 1 198 ? 44.220  -20.077 103.641 1.00 76.90  ? 198 ARG A HD3    1 
ATOM   3295  H HE     . ARG A 1 198 ? 41.902  -20.812 104.614 1.00 84.19  ? 198 ARG A HE     1 
ATOM   3296  H HH11   . ARG A 1 198 ? 44.185  -18.550 105.369 1.00 89.80  ? 198 ARG A HH11   1 
ATOM   3297  H HH12   . ARG A 1 198 ? 43.266  -17.607 106.065 1.00 89.80  ? 198 ARG A HH12   1 
ATOM   3298  H HH21   . ARG A 1 198 ? 40.499  -19.376 105.684 1.00 85.55  ? 198 ARG A HH21   1 
ATOM   3299  H HH22   . ARG A 1 198 ? 41.030  -18.108 106.256 1.00 85.55  ? 198 ARG A HH22   1 
ATOM   3300  N N      . THR A 1 199 ? 46.307  -25.040 100.653 1.00 38.81  ? 199 THR A N      1 
ATOM   3301  C CA     . THR A 1 199 ? 47.551  -25.494 100.019 1.00 38.22  ? 199 THR A CA     1 
ATOM   3302  C C      . THR A 1 199 ? 47.729  -24.910 98.630  1.00 39.39  ? 199 THR A C      1 
ATOM   3303  O O      . THR A 1 199 ? 46.830  -24.988 97.800  1.00 41.19  ? 199 THR A O      1 
ATOM   3304  C CB     . THR A 1 199 ? 47.622  -27.051 99.874  1.00 33.94  ? 199 THR A CB     1 
ATOM   3305  O OG1    . THR A 1 199 ? 47.544  -27.680 101.160 1.00 38.77  ? 199 THR A OG1    1 
ATOM   3306  C CG2    . THR A 1 199 ? 48.924  -27.491 99.213  1.00 28.27  ? 199 THR A CG2    1 
ATOM   3307  H H      . THR A 1 199 ? 45.751  -25.672 100.826 1.00 46.96  ? 199 THR A H      1 
ATOM   3308  H HA     . THR A 1 199 ? 48.302  -25.209 100.562 1.00 46.26  ? 199 THR A HA     1 
ATOM   3309  H HB     . THR A 1 199 ? 46.884  -27.355 99.324  1.00 41.11  ? 199 THR A HB     1 
ATOM   3310  H HG1    . THR A 1 199 ? 47.583  -28.514 101.074 1.00 46.92  ? 199 THR A HG1    1 
ATOM   3311  H HG21   . THR A 1 199 ? 48.946  -28.457 99.135  1.00 34.32  ? 199 THR A HG21   1 
ATOM   3312  H HG22   . THR A 1 199 ? 48.995  -27.101 98.328  1.00 34.32  ? 199 THR A HG22   1 
ATOM   3313  H HG23   . THR A 1 199 ? 49.681  -27.201 99.747  1.00 34.32  ? 199 THR A HG23   1 
ATOM   3314  N N      . VAL A 1 200 ? 48.893  -24.317 98.384  1.00 37.40  ? 200 VAL A N      1 
ATOM   3315  C CA     . VAL A 1 200 ? 49.282  -23.947 97.032  1.00 32.30  ? 200 VAL A CA     1 
ATOM   3316  C C      . VAL A 1 200 ? 50.431  -24.814 96.636  1.00 30.80  ? 200 VAL A C      1 
ATOM   3317  O O      . VAL A 1 200 ? 51.429  -24.848 97.327  1.00 36.42  ? 200 VAL A O      1 
ATOM   3318  C CB     . VAL A 1 200 ? 49.676  -22.468 96.912  1.00 32.19  ? 200 VAL A CB     1 
ATOM   3319  C CG1    . VAL A 1 200 ? 50.159  -22.148 95.524  1.00 32.35  ? 200 VAL A CG1    1 
ATOM   3320  C CG2    . VAL A 1 200 ? 48.503  -21.604 97.260  1.00 35.86  ? 200 VAL A CG2    1 
ATOM   3321  H H      . VAL A 1 200 ? 49.475  -24.119 98.985  1.00 45.27  ? 200 VAL A H      1 
ATOM   3322  H HA     . VAL A 1 200 ? 48.545  -24.118 96.425  1.00 39.15  ? 200 VAL A HA     1 
ATOM   3323  H HB     . VAL A 1 200 ? 50.393  -22.275 97.536  1.00 39.01  ? 200 VAL A HB     1 
ATOM   3324  H HG11   . VAL A 1 200 ? 50.399  -21.209 95.482  1.00 39.21  ? 200 VAL A HG11   1 
ATOM   3325  H HG12   . VAL A 1 200 ? 50.933  -22.697 95.325  1.00 39.21  ? 200 VAL A HG12   1 
ATOM   3326  H HG13   . VAL A 1 200 ? 49.448  -22.336 94.892  1.00 39.21  ? 200 VAL A HG13   1 
ATOM   3327  H HG21   . VAL A 1 200 ? 48.763  -20.673 97.181  1.00 43.42  ? 200 VAL A HG21   1 
ATOM   3328  H HG22   . VAL A 1 200 ? 47.776  -21.798 96.648  1.00 43.42  ? 200 VAL A HG22   1 
ATOM   3329  H HG23   . VAL A 1 200 ? 48.229  -21.796 98.170  1.00 43.42  ? 200 VAL A HG23   1 
ATOM   3330  N N      . ILE A 1 201 ? 50.288  -25.510 95.520  1.00 26.74  ? 201 ILE A N      1 
ATOM   3331  C CA     . ILE A 1 201 ? 51.392  -26.278 94.953  1.00 29.92  ? 201 ILE A CA     1 
ATOM   3332  C C      . ILE A 1 201 ? 51.880  -25.633 93.655  1.00 32.81  ? 201 ILE A C      1 
ATOM   3333  O O      . ILE A 1 201 ? 51.200  -25.707 92.626  1.00 29.68  ? 201 ILE A O      1 
ATOM   3334  C CB     . ILE A 1 201 ? 50.989  -27.759 94.651  1.00 27.47  ? 201 ILE A CB     1 
ATOM   3335  C CG1    . ILE A 1 201 ? 50.427  -28.440 95.906  1.00 23.10  ? 201 ILE A CG1    1 
ATOM   3336  C CG2    . ILE A 1 201 ? 52.201  -28.546 94.084  1.00 25.92  ? 201 ILE A CG2    1 
ATOM   3337  C CD1    . ILE A 1 201 ? 49.999  -29.880 95.695  1.00 22.03  ? 201 ILE A CD1    1 
ATOM   3338  H H      . ILE A 1 201 ? 49.559  -25.557 95.067  1.00 32.48  ? 201 ILE A H      1 
ATOM   3339  H HA     . ILE A 1 201 ? 52.129  -26.287 95.582  1.00 36.30  ? 201 ILE A HA     1 
ATOM   3340  H HB     . ILE A 1 201 ? 50.293  -27.750 93.975  1.00 33.36  ? 201 ILE A HB     1 
ATOM   3341  H HG12   . ILE A 1 201 ? 51.109  -28.433 96.595  1.00 28.11  ? 201 ILE A HG12   1 
ATOM   3342  H HG13   . ILE A 1 201 ? 49.651  -27.943 96.208  1.00 28.11  ? 201 ILE A HG13   1 
ATOM   3343  H HG21   . ILE A 1 201 ? 51.928  -29.459 93.905  1.00 31.49  ? 201 ILE A HG21   1 
ATOM   3344  H HG22   . ILE A 1 201 ? 52.497  -28.121 93.264  1.00 31.49  ? 201 ILE A HG22   1 
ATOM   3345  H HG23   . ILE A 1 201 ? 52.916  -28.536 94.739  1.00 31.49  ? 201 ILE A HG23   1 
ATOM   3346  H HD11   . ILE A 1 201 ? 49.658  -30.233 96.532  1.00 24.48  ? 201 ILE A HD11   1 
ATOM   3347  H HD12   . ILE A 1 201 ? 49.306  -29.907 95.018  1.00 24.48  ? 201 ILE A HD12   1 
ATOM   3348  H HD13   . ILE A 1 201 ? 50.766  -30.397 95.406  1.00 24.48  ? 201 ILE A HD13   1 
ATOM   3349  N N      . ASP A 1 202 ? 53.059  -25.009 93.702  1.00 46.85  ? 202 ASP A N      1 
ATOM   3350  C CA     . ASP A 1 202 ? 53.661  -24.470 92.487  1.00 52.91  ? 202 ASP A CA     1 
ATOM   3351  C C      . ASP A 1 202 ? 54.607  -25.522 91.972  1.00 52.32  ? 202 ASP A C      1 
ATOM   3352  O O      . ASP A 1 202 ? 55.690  -25.720 92.518  1.00 57.93  ? 202 ASP A O      1 
ATOM   3353  C CB     . ASP A 1 202 ? 54.400  -23.154 92.737  1.00 56.23  ? 202 ASP A CB     1 
ATOM   3354  C CG     . ASP A 1 202 ? 54.686  -22.385 91.445  1.00 58.51  ? 202 ASP A CG     1 
ATOM   3355  O OD1    . ASP A 1 202 ? 54.900  -23.033 90.395  1.00 54.46  ? 202 ASP A OD1    1 
ATOM   3356  O OD2    . ASP A 1 202 ? 54.711  -21.133 91.479  1.00 62.70  ? 202 ASP A OD2    1 
ATOM   3357  H H      . ASP A 1 202 ? 53.522  -24.888 94.416  1.00 56.61  ? 202 ASP A H      1 
ATOM   3358  H HA     . ASP A 1 202 ? 52.972  -24.318 91.821  1.00 63.88  ? 202 ASP A HA     1 
ATOM   3359  H HB2    . ASP A 1 202 ? 53.856  -22.589 93.308  1.00 67.87  ? 202 ASP A HB2    1 
ATOM   3360  H HB3    . ASP A 1 202 ? 55.248  -23.343 93.168  1.00 67.87  ? 202 ASP A HB3    1 
ATOM   3361  N N      . VAL A 1 203 ? 54.211  -26.150 90.877  1.00 46.10  ? 203 VAL A N      1 
ATOM   3362  C CA     . VAL A 1 203 ? 54.915  -27.306 90.384  1.00 38.98  ? 203 VAL A CA     1 
ATOM   3363  C C      . VAL A 1 203 ? 56.267  -26.865 89.891  1.00 42.09  ? 203 VAL A C      1 
ATOM   3364  O O      . VAL A 1 203 ? 57.298  -27.386 90.307  1.00 46.59  ? 203 VAL A O      1 
ATOM   3365  C CB     . VAL A 1 203 ? 54.149  -27.977 89.250  1.00 38.81  ? 203 VAL A CB     1 
ATOM   3366  C CG1    . VAL A 1 203 ? 54.874  -29.241 88.789  1.00 40.24  ? 203 VAL A CG1    1 
ATOM   3367  C CG2    . VAL A 1 203 ? 52.734  -28.301 89.686  1.00 36.89  ? 203 VAL A CG2    1 
ATOM   3368  H H      . VAL A 1 203 ? 53.532  -25.921 90.402  1.00 55.71  ? 203 VAL A H      1 
ATOM   3369  H HA     . VAL A 1 203 ? 55.037  -27.947 91.102  1.00 47.17  ? 203 VAL A HA     1 
ATOM   3370  H HB     . VAL A 1 203 ? 54.099  -27.367 88.497  1.00 46.96  ? 203 VAL A HB     1 
ATOM   3371  H HG11   . VAL A 1 203 ? 54.369  -29.649 88.068  1.00 48.68  ? 203 VAL A HG11   1 
ATOM   3372  H HG12   . VAL A 1 203 ? 55.760  -29.000 88.476  1.00 48.68  ? 203 VAL A HG12   1 
ATOM   3373  H HG13   . VAL A 1 203 ? 54.942  -29.856 89.535  1.00 48.68  ? 203 VAL A HG13   1 
ATOM   3374  H HG21   . VAL A 1 203 ? 52.267  -28.726 88.950  1.00 44.66  ? 203 VAL A HG21   1 
ATOM   3375  H HG22   . VAL A 1 203 ? 52.768  -28.901 90.448  1.00 44.66  ? 203 VAL A HG22   1 
ATOM   3376  H HG23   . VAL A 1 203 ? 52.284  -27.478 89.933  1.00 44.66  ? 203 VAL A HG23   1 
ATOM   3377  N N      . ALA A 1 204 ? 56.235  -25.875 89.008  1.00 42.10  ? 204 ALA A N      1 
ATOM   3378  C CA     . ALA A 1 204 ? 57.419  -25.387 88.323  1.00 39.45  ? 204 ALA A CA     1 
ATOM   3379  C C      . ALA A 1 204 ? 58.488  -24.831 89.262  1.00 40.99  ? 204 ALA A C      1 
ATOM   3380  O O      . ALA A 1 204 ? 59.657  -24.785 88.905  1.00 44.79  ? 204 ALA A O      1 
ATOM   3381  C CB     . ALA A 1 204 ? 57.009  -24.328 87.315  1.00 39.72  ? 204 ALA A CB     1 
ATOM   3382  H H      . ALA A 1 204 ? 55.516  -25.460 88.784  1.00 50.91  ? 204 ALA A H      1 
ATOM   3383  H HA     . ALA A 1 204 ? 57.816  -26.122 87.831  1.00 47.73  ? 204 ALA A HA     1 
ATOM   3384  H HB1    . ALA A 1 204 ? 57.801  -24.003 86.859  1.00 48.05  ? 204 ALA A HB1    1 
ATOM   3385  H HB2    . ALA A 1 204 ? 56.397  -24.722 86.675  1.00 48.05  ? 204 ALA A HB2    1 
ATOM   3386  H HB3    . ALA A 1 204 ? 56.574  -23.598 87.784  1.00 48.05  ? 204 ALA A HB3    1 
ATOM   3387  N N      . LYS A 1 205 ? 58.077  -24.380 90.440  1.00 39.54  ? 205 LYS A N      1 
ATOM   3388  C CA     . LYS A 1 205 ? 58.988  -23.740 91.389  1.00 41.50  ? 205 LYS A CA     1 
ATOM   3389  C C      . LYS A 1 205 ? 59.497  -24.667 92.497  1.00 45.71  ? 205 LYS A C      1 
ATOM   3390  O O      . LYS A 1 205 ? 60.291  -24.247 93.359  1.00 54.09  ? 205 LYS A O      1 
ATOM   3391  C CB     . LYS A 1 205 ? 58.294  -22.527 92.026  1.00 41.50  ? 205 LYS A CB     1 
ATOM   3392  C CG     . LYS A 1 205 ? 57.984  -21.402 91.049  1.00 41.66  ? 205 LYS A CG     1 
ATOM   3393  C CD     . LYS A 1 205 ? 57.618  -20.121 91.770  1.00 45.93  ? 205 LYS A CD     1 
ATOM   3394  C CE     . LYS A 1 205 ? 57.307  -19.010 90.777  1.00 52.75  ? 205 LYS A CE     1 
ATOM   3395  N NZ     . LYS A 1 205 ? 57.229  -17.660 91.425  1.00 56.67  ? 205 LYS A NZ     1 
ATOM   3396  H H      . LYS A 1 205 ? 57.265  -24.432 90.720  1.00 47.83  ? 205 LYS A H      1 
ATOM   3397  H HA     . LYS A 1 205 ? 59.761  -23.413 90.902  1.00 50.19  ? 205 LYS A HA     1 
ATOM   3398  H HB2    . LYS A 1 205 ? 57.455  -22.819 92.417  1.00 50.19  ? 205 LYS A HB2    1 
ATOM   3399  H HB3    . LYS A 1 205 ? 58.870  -22.167 92.719  1.00 50.19  ? 205 LYS A HB3    1 
ATOM   3400  H HG2    . LYS A 1 205 ? 58.766  -21.230 90.502  1.00 50.39  ? 205 LYS A HG2    1 
ATOM   3401  H HG3    . LYS A 1 205 ? 57.235  -21.661 90.490  1.00 50.39  ? 205 LYS A HG3    1 
ATOM   3402  H HD2    . LYS A 1 205 ? 56.831  -20.272 92.317  1.00 55.51  ? 205 LYS A HD2    1 
ATOM   3403  H HD3    . LYS A 1 205 ? 58.364  -19.838 92.322  1.00 55.51  ? 205 LYS A HD3    1 
ATOM   3404  H HE2    . LYS A 1 205 ? 58.007  -18.980 90.105  1.00 63.69  ? 205 LYS A HE2    1 
ATOM   3405  H HE3    . LYS A 1 205 ? 56.451  -19.191 90.357  1.00 63.69  ? 205 LYS A HE3    1 
ATOM   3406  H HZ1    . LYS A 1 205 ? 57.046  -17.039 90.814  1.00 68.39  ? 205 LYS A HZ1    1 
ATOM   3407  H HZ2    . LYS A 1 205 ? 56.588  -17.657 92.043  1.00 68.39  ? 205 LYS A HZ2    1 
ATOM   3408  H HZ3    . LYS A 1 205 ? 58.006  -17.464 91.813  1.00 68.39  ? 205 LYS A HZ3    1 
ATOM   3409  N N      . GLY A 1 206 ? 59.067  -25.925 92.463  1.00 39.38  ? 206 GLY A N      1 
ATOM   3410  C CA     . GLY A 1 206 ? 59.399  -26.868 93.519  1.00 37.90  ? 206 GLY A CA     1 
ATOM   3411  C C      . GLY A 1 206 ? 58.920  -26.365 94.877  1.00 38.99  ? 206 GLY A C      1 
ATOM   3412  O O      . GLY A 1 206 ? 59.589  -26.544 95.908  1.00 40.27  ? 206 GLY A O      1 
ATOM   3413  H H      . GLY A 1 206 ? 58.580  -26.256 91.836  1.00 47.65  ? 206 GLY A H      1 
ATOM   3414  H HA2    . GLY A 1 206 ? 58.980  -27.723 93.338  1.00 45.87  ? 206 GLY A HA2    1 
ATOM   3415  H HA3    . GLY A 1 206 ? 60.361  -26.993 93.555  1.00 45.87  ? 206 GLY A HA3    1 
ATOM   3416  N N      . GLU A 1 207 ? 57.762  -25.707 94.869  1.00 37.23  ? 207 GLU A N      1 
ATOM   3417  C CA     . GLU A 1 207 ? 57.294  -25.007 96.054  1.00 41.84  ? 207 GLU A CA     1 
ATOM   3418  C C      . GLU A 1 207 ? 55.854  -25.352 96.459  1.00 37.60  ? 207 GLU A C      1 
ATOM   3419  O O      . GLU A 1 207 ? 54.976  -25.560 95.616  1.00 33.10  ? 207 GLU A O      1 
ATOM   3420  C CB     . GLU A 1 207 ? 57.431  -23.503 95.840  1.00 46.26  ? 207 GLU A CB     1 
ATOM   3421  C CG     . GLU A 1 207 ? 57.431  -22.716 97.131  1.00 48.43  ? 207 GLU A CG     1 
ATOM   3422  C CD     . GLU A 1 207 ? 57.466  -21.229 96.892  1.00 47.52  ? 207 GLU A CD     1 
ATOM   3423  O OE1    . GLU A 1 207 ? 56.873  -20.789 95.884  1.00 48.77  ? 207 GLU A OE1    1 
ATOM   3424  O OE2    . GLU A 1 207 ? 58.082  -20.504 97.705  1.00 44.87  ? 207 GLU A OE2    1 
ATOM   3425  H H      . GLU A 1 207 ? 57.234  -25.652 94.192  1.00 45.07  ? 207 GLU A H      1 
ATOM   3426  H HA     . GLU A 1 207 ? 57.869  -25.248 96.797  1.00 50.59  ? 207 GLU A HA     1 
ATOM   3427  H HB2    . GLU A 1 207 ? 58.267  -23.324 95.381  1.00 55.90  ? 207 GLU A HB2    1 
ATOM   3428  H HB3    . GLU A 1 207 ? 56.686  -23.193 95.301  1.00 55.90  ? 207 GLU A HB3    1 
ATOM   3429  H HG2    . GLU A 1 207 ? 56.625  -22.923 97.629  1.00 58.51  ? 207 GLU A HG2    1 
ATOM   3430  H HG3    . GLU A 1 207 ? 58.215  -22.956 97.650  1.00 58.51  ? 207 GLU A HG3    1 
ATOM   3431  N N      . VAL A 1 208 ? 55.666  -25.456 97.777  1.00 36.83  ? 208 VAL A N      1 
ATOM   3432  C CA     . VAL A 1 208 ? 54.358  -25.569 98.423  1.00 35.25  ? 208 VAL A CA     1 
ATOM   3433  C C      . VAL A 1 208 ? 54.218  -24.430 99.427  1.00 37.99  ? 208 VAL A C      1 
ATOM   3434  O O      . VAL A 1 208 ? 55.007  -24.322 100.362 1.00 43.99  ? 208 VAL A O      1 
ATOM   3435  C CB     . VAL A 1 208 ? 54.182  -26.931 99.154  1.00 37.29  ? 208 VAL A CB     1 
ATOM   3436  C CG1    . VAL A 1 208 ? 52.862  -26.982 99.933  1.00 38.96  ? 208 VAL A CG1    1 
ATOM   3437  C CG2    . VAL A 1 208 ? 54.295  -28.101 98.160  1.00 34.70  ? 208 VAL A CG2    1 
ATOM   3438  H H      . VAL A 1 208 ? 56.315  -25.465 98.342  1.00 44.59  ? 208 VAL A H      1 
ATOM   3439  H HA     . VAL A 1 208 ? 53.658  -25.483 97.757  1.00 42.69  ? 208 VAL A HA     1 
ATOM   3440  H HB     . VAL A 1 208 ? 54.901  -27.028 99.798  1.00 45.14  ? 208 VAL A HB     1 
ATOM   3441  H HG11   . VAL A 1 208 ? 52.788  -27.843 100.373 1.00 47.14  ? 208 VAL A HG11   1 
ATOM   3442  H HG12   . VAL A 1 208 ? 52.857  -26.271 100.593 1.00 47.14  ? 208 VAL A HG12   1 
ATOM   3443  H HG13   . VAL A 1 208 ? 52.125  -26.863 99.313  1.00 47.14  ? 208 VAL A HG13   1 
ATOM   3444  H HG21   . VAL A 1 208 ? 54.182  -28.936 98.642  1.00 42.03  ? 208 VAL A HG21   1 
ATOM   3445  H HG22   . VAL A 1 208 ? 53.603  -28.010 97.487  1.00 42.03  ? 208 VAL A HG22   1 
ATOM   3446  H HG23   . VAL A 1 208 ? 55.170  -28.076 97.742  1.00 42.03  ? 208 VAL A HG23   1 
ATOM   3447  N N      . ARG A 1 209 ? 53.205  -23.597 99.245  1.00 37.69  ? 209 ARG A N      1 
ATOM   3448  C CA     . ARG A 1 209 ? 52.977  -22.481 100.137 1.00 41.26  ? 209 ARG A CA     1 
ATOM   3449  C C      . ARG A 1 209 ? 51.494  -22.365 100.427 1.00 49.42  ? 209 ARG A C      1 
ATOM   3450  O O      . ARG A 1 209 ? 50.674  -23.075 99.843  1.00 46.50  ? 209 ARG A O      1 
ATOM   3451  C CB     . ARG A 1 209 ? 53.529  -21.199 99.526  1.00 37.22  ? 209 ARG A CB     1 
ATOM   3452  C CG     . ARG A 1 209 ? 52.856  -20.822 98.228  1.00 38.11  ? 209 ARG A CG     1 
ATOM   3453  C CD     . ARG A 1 209 ? 53.486  -19.605 97.586  1.00 41.56  ? 209 ARG A CD     1 
ATOM   3454  N NE     . ARG A 1 209 ? 52.885  -19.306 96.285  1.00 46.41  ? 209 ARG A NE     1 
ATOM   3455  C CZ     . ARG A 1 209 ? 53.261  -19.843 95.125  1.00 48.34  ? 209 ARG A CZ     1 
ATOM   3456  N NH1    . ARG A 1 209 ? 54.251  -20.727 95.081  1.00 47.62  ? 209 ARG A NH1    1 
ATOM   3457  N NH2    . ARG A 1 209 ? 52.639  -19.493 94.002  1.00 48.61  ? 209 ARG A NH2    1 
ATOM   3458  H H      . ARG A 1 209 ? 52.632  -23.660 98.606  1.00 45.61  ? 209 ARG A H      1 
ATOM   3459  H HA     . ARG A 1 209 ? 53.439  -22.641 100.974 1.00 49.91  ? 209 ARG A HA     1 
ATOM   3460  H HB2    . ARG A 1 209 ? 53.398  -20.470 100.153 1.00 45.05  ? 209 ARG A HB2    1 
ATOM   3461  H HB3    . ARG A 1 209 ? 54.475  -21.316 99.349  1.00 45.05  ? 209 ARG A HB3    1 
ATOM   3462  H HG2    . ARG A 1 209 ? 52.929  -21.563 97.606  1.00 46.12  ? 209 ARG A HG2    1 
ATOM   3463  H HG3    . ARG A 1 209 ? 51.923  -20.622 98.401  1.00 46.12  ? 209 ARG A HG3    1 
ATOM   3464  H HD2    . ARG A 1 209 ? 53.358  -18.836 98.164  1.00 50.26  ? 209 ARG A HD2    1 
ATOM   3465  H HD3    . ARG A 1 209 ? 54.433  -19.769 97.452  1.00 50.26  ? 209 ARG A HD3    1 
ATOM   3466  H HE     . ARG A 1 209 ? 52.238  -18.739 96.269  1.00 56.08  ? 209 ARG A HE     1 
ATOM   3467  H HH11   . ARG A 1 209 ? 54.656  -20.956 95.805  1.00 57.54  ? 209 ARG A HH11   1 
ATOM   3468  H HH12   . ARG A 1 209 ? 54.488  -21.070 94.329  1.00 57.54  ? 209 ARG A HH12   1 
ATOM   3469  H HH21   . ARG A 1 209 ? 51.997  -18.922 94.026  1.00 58.72  ? 209 ARG A HH21   1 
ATOM   3470  H HH22   . ARG A 1 209 ? 52.879  -19.839 93.252  1.00 58.72  ? 209 ARG A HH22   1 
ATOM   3471  N N      . LYS A 1 210 ? 51.163  -21.454 101.333 1.00 58.10  ? 210 LYS A N      1 
ATOM   3472  C CA     . LYS A 1 210 ? 49.789  -21.217 101.760 1.00 59.56  ? 210 LYS A CA     1 
ATOM   3473  C C      . LYS A 1 210 ? 49.089  -20.168 100.888 1.00 54.93  ? 210 LYS A C      1 
ATOM   3474  O O      . LYS A 1 210 ? 49.580  -19.049 100.745 1.00 60.69  ? 210 LYS A O      1 
ATOM   3475  C CB     . LYS A 1 210 ? 49.812  -20.791 103.232 1.00 63.17  ? 210 LYS A CB     1 
ATOM   3476  C CG     . LYS A 1 210 ? 48.478  -20.427 103.823 1.00 68.80  ? 210 LYS A CG     1 
ATOM   3477  C CD     . LYS A 1 210 ? 48.642  -19.968 105.262 1.00 74.09  ? 210 LYS A CD     1 
ATOM   3478  C CE     . LYS A 1 210 ? 47.377  -19.301 105.786 1.00 76.54  ? 210 LYS A CE     1 
ATOM   3479  N NZ     . LYS A 1 210 ? 47.030  -18.047 105.041 1.00 78.64  ? 210 LYS A NZ     1 
ATOM   3480  H H      . LYS A 1 210 ? 51.733  -20.945 101.726 1.00 70.12  ? 210 LYS A H      1 
ATOM   3481  H HA     . LYS A 1 210 ? 49.289  -22.046 101.693 1.00 71.87  ? 210 LYS A HA     1 
ATOM   3482  H HB2    . LYS A 1 210 ? 50.173  -21.522 103.758 1.00 76.19  ? 210 LYS A HB2    1 
ATOM   3483  H HB3    . LYS A 1 210 ? 50.389  -20.015 103.318 1.00 76.19  ? 210 LYS A HB3    1 
ATOM   3484  H HG2    . LYS A 1 210 ? 48.084  -19.702 103.312 1.00 82.95  ? 210 LYS A HG2    1 
ATOM   3485  H HG3    . LYS A 1 210 ? 47.897  -21.204 103.813 1.00 82.95  ? 210 LYS A HG3    1 
ATOM   3486  H HD2    . LYS A 1 210 ? 48.835  -20.735 105.822 1.00 89.30  ? 210 LYS A HD2    1 
ATOM   3487  H HD3    . LYS A 1 210 ? 49.367  -19.325 105.311 1.00 89.30  ? 210 LYS A HD3    1 
ATOM   3488  H HE2    . LYS A 1 210 ? 46.635  -19.918 105.696 1.00 92.24  ? 210 LYS A HE2    1 
ATOM   3489  H HE3    . LYS A 1 210 ? 47.505  -19.070 106.719 1.00 92.24  ? 210 LYS A HE3    1 
ATOM   3490  H HZ1    . LYS A 1 210 ? 46.288  -17.690 105.377 1.00 94.76  ? 210 LYS A HZ1    1 
ATOM   3491  H HZ2    . LYS A 1 210 ? 47.693  -17.458 105.113 1.00 94.76  ? 210 LYS A HZ2    1 
ATOM   3492  H HZ3    . LYS A 1 210 ? 46.899  -18.232 104.180 1.00 94.76  ? 210 LYS A HZ3    1 
ATOM   3493  N N      . GLY A 1 211 ? 47.967  -20.541 100.281 1.00 46.49  ? 211 GLY A N      1 
ATOM   3494  C CA     . GLY A 1 211 ? 47.197  -19.610 99.474  1.00 45.49  ? 211 GLY A CA     1 
ATOM   3495  C C      . GLY A 1 211 ? 45.871  -19.191 100.080 1.00 46.74  ? 211 GLY A C      1 
ATOM   3496  O O      . GLY A 1 211 ? 45.640  -19.356 101.282 1.00 42.82  ? 211 GLY A O      1 
ATOM   3497  H H      . GLY A 1 211 ? 47.631  -21.332 100.323 1.00 56.18  ? 211 GLY A H      1 
ATOM   3498  H HA2    . GLY A 1 211 ? 47.725  -18.810 99.326  1.00 54.98  ? 211 GLY A HA2    1 
ATOM   3499  H HA3    . GLY A 1 211 ? 47.017  -20.015 98.611  1.00 54.98  ? 211 GLY A HA3    1 
ATOM   3500  N N      . GLU A 1 212 ? 44.998  -18.662 99.219  1.00 50.54  ? 212 GLU A N      1 
ATOM   3501  C CA     . GLU A 1 212 ? 43.602  -18.369 99.556  1.00 52.00  ? 212 GLU A CA     1 
ATOM   3502  C C      . GLU A 1 212 ? 42.727  -19.528 99.117  1.00 53.60  ? 212 GLU A C      1 
ATOM   3503  O O      . GLU A 1 212 ? 41.542  -19.568 99.437  1.00 54.56  ? 212 GLU A O      1 
ATOM   3504  C CB     . GLU A 1 212 ? 43.112  -17.072 98.891  1.00 55.61  ? 212 GLU A CB     1 
ATOM   3505  C CG     . GLU A 1 212 ? 43.467  -16.923 97.396  1.00 64.34  ? 212 GLU A CG     1 
ATOM   3506  C CD     . GLU A 1 212 ? 43.259  -15.501 96.848  1.00 71.15  ? 212 GLU A CD     1 
ATOM   3507  O OE1    . GLU A 1 212 ? 43.680  -15.242 95.699  1.00 70.07  ? 212 GLU A OE1    1 
ATOM   3508  O OE2    . GLU A 1 212 ? 42.671  -14.645 97.549  1.00 74.18  ? 212 GLU A OE2    1 
ATOM   3509  H H      . GLU A 1 212 ? 45.198  -18.459 98.408  1.00 61.03  ? 212 GLU A H      1 
ATOM   3510  H HA     . GLU A 1 212 ? 43.518  -18.270 100.517 1.00 62.79  ? 212 GLU A HA     1 
ATOM   3511  H HB2    . GLU A 1 212 ? 42.146  -17.033 98.967  1.00 67.12  ? 212 GLU A HB2    1 
ATOM   3512  H HB3    . GLU A 1 212 ? 43.504  -16.319 99.360  1.00 67.12  ? 212 GLU A HB3    1 
ATOM   3513  H HG2    . GLU A 1 212 ? 44.400  -17.155 97.271  1.00 77.60  ? 212 GLU A HG2    1 
ATOM   3514  H HG3    . GLU A 1 212 ? 42.907  -17.524 96.880  1.00 77.60  ? 212 GLU A HG3    1 
ATOM   3515  N N      . GLU A 1 213 ? 43.317  -20.455 98.362  1.00 52.73  ? 213 GLU A N      1 
ATOM   3516  C CA     . GLU A 1 213 ? 42.601  -21.610 97.826  1.00 46.94  ? 213 GLU A CA     1 
ATOM   3517  C C      . GLU A 1 213 ? 43.574  -22.727 97.493  1.00 44.41  ? 213 GLU A C      1 
ATOM   3518  O O      . GLU A 1 213 ? 44.779  -22.487 97.329  1.00 45.62  ? 213 GLU A O      1 
ATOM   3519  C CB     . GLU A 1 213 ? 41.814  -21.246 96.565  1.00 47.79  ? 213 GLU A CB     1 
ATOM   3520  C CG     . GLU A 1 213 ? 40.398  -20.755 96.821  1.00 54.78  ? 213 GLU A CG     1 
ATOM   3521  C CD     . GLU A 1 213 ? 39.395  -21.200 95.748  1.00 63.30  ? 213 GLU A CD     1 
ATOM   3522  O OE1    . GLU A 1 213 ? 39.820  -21.687 94.675  1.00 66.94  ? 213 GLU A OE1    1 
ATOM   3523  O OE2    . GLU A 1 213 ? 38.168  -21.066 95.983  1.00 66.22  ? 213 GLU A OE2    1 
ATOM   3524  H H      . GLU A 1 213 ? 44.148  -20.435 98.143  1.00 63.67  ? 213 GLU A H      1 
ATOM   3525  H HA     . GLU A 1 213 ? 41.977  -21.938 98.492  1.00 56.71  ? 213 GLU A HA     1 
ATOM   3526  H HB2    . GLU A 1 213 ? 42.289  -20.542 96.096  1.00 57.73  ? 213 GLU A HB2    1 
ATOM   3527  H HB3    . GLU A 1 213 ? 41.755  -22.032 95.999  1.00 57.73  ? 213 GLU A HB3    1 
ATOM   3528  H HG2    . GLU A 1 213 ? 40.094  -21.102 97.675  1.00 66.13  ? 213 GLU A HG2    1 
ATOM   3529  H HG3    . GLU A 1 213 ? 40.400  -19.785 96.842  1.00 66.13  ? 213 GLU A HG3    1 
ATOM   3530  N N      . PHE A 1 214 ? 43.054  -23.949 97.403  1.00 39.70  ? 214 PHE A N      1 
ATOM   3531  C CA     . PHE A 1 214 ? 43.890  -25.079 97.032  1.00 37.92  ? 214 PHE A CA     1 
ATOM   3532  C C      . PHE A 1 214 ? 44.255  -24.935 95.581  1.00 35.33  ? 214 PHE A C      1 
ATOM   3533  O O      . PHE A 1 214 ? 43.378  -24.987 94.727  1.00 35.94  ? 214 PHE A O      1 
ATOM   3534  C CB     . PHE A 1 214 ? 43.179  -26.399 97.262  1.00 37.65  ? 214 PHE A CB     1 
ATOM   3535  C CG     . PHE A 1 214 ? 43.936  -27.585 96.749  1.00 37.15  ? 214 PHE A CG     1 
ATOM   3536  C CD1    . PHE A 1 214 ? 44.940  -28.170 97.497  1.00 37.65  ? 214 PHE A CD1    1 
ATOM   3537  C CD2    . PHE A 1 214 ? 43.624  -28.132 95.518  1.00 36.47  ? 214 PHE A CD2    1 
ATOM   3538  C CE1    . PHE A 1 214 ? 45.625  -29.278 97.020  1.00 36.84  ? 214 PHE A CE1    1 
ATOM   3539  C CE2    . PHE A 1 214 ? 44.304  -29.234 95.039  1.00 33.13  ? 214 PHE A CE2    1 
ATOM   3540  C CZ     . PHE A 1 214 ? 45.307  -29.807 95.791  1.00 32.20  ? 214 PHE A CZ     1 
ATOM   3541  H H      . PHE A 1 214 ? 42.230  -24.146 97.552  1.00 48.03  ? 214 PHE A H      1 
ATOM   3542  H HA     . PHE A 1 214 ? 44.704  -25.069 97.559  1.00 45.90  ? 214 PHE A HA     1 
ATOM   3543  H HB2    . PHE A 1 214 ? 43.045  -26.521 98.215  1.00 45.58  ? 214 PHE A HB2    1 
ATOM   3544  H HB3    . PHE A 1 214 ? 42.321  -26.375 96.810  1.00 45.58  ? 214 PHE A HB3    1 
ATOM   3545  H HD1    . PHE A 1 214 ? 45.158  -27.818 98.329  1.00 45.57  ? 214 PHE A HD1    1 
ATOM   3546  H HD2    . PHE A 1 214 ? 42.948  -27.752 95.005  1.00 44.16  ? 214 PHE A HD2    1 
ATOM   3547  H HE1    . PHE A 1 214 ? 46.302  -29.661 97.530  1.00 44.60  ? 214 PHE A HE1    1 
ATOM   3548  H HE2    . PHE A 1 214 ? 44.087  -29.589 94.208  1.00 40.15  ? 214 PHE A HE2    1 
ATOM   3549  H HZ     . PHE A 1 214 ? 45.767  -30.548 95.468  1.00 39.03  ? 214 PHE A HZ     1 
ATOM   3550  N N      . PHE A 1 215 ? 45.546  -24.820 95.301  1.00 32.98  ? 215 PHE A N      1 
ATOM   3551  C CA     . PHE A 1 215 ? 45.992  -24.358 93.991  1.00 32.33  ? 215 PHE A CA     1 
ATOM   3552  C C      . PHE A 1 215 ? 47.193  -25.113 93.476  1.00 34.52  ? 215 PHE A C      1 
ATOM   3553  O O      . PHE A 1 215 ? 48.211  -25.230 94.156  1.00 40.07  ? 215 PHE A O      1 
ATOM   3554  C CB     . PHE A 1 215 ? 46.298  -22.857 94.039  1.00 34.40  ? 215 PHE A CB     1 
ATOM   3555  C CG     . PHE A 1 215 ? 46.199  -22.152 92.692  1.00 40.19  ? 215 PHE A CG     1 
ATOM   3556  C CD1    . PHE A 1 215 ? 47.225  -22.252 91.753  1.00 41.15  ? 215 PHE A CD1    1 
ATOM   3557  C CD2    . PHE A 1 215 ? 45.085  -21.389 92.366  1.00 40.03  ? 215 PHE A CD2    1 
ATOM   3558  C CE1    . PHE A 1 215 ? 47.137  -21.596 90.532  1.00 37.89  ? 215 PHE A CE1    1 
ATOM   3559  C CE2    . PHE A 1 215 ? 45.000  -20.736 91.142  1.00 35.55  ? 215 PHE A CE2    1 
ATOM   3560  C CZ     . PHE A 1 215 ? 46.021  -20.845 90.227  1.00 33.53  ? 215 PHE A CZ     1 
ATOM   3561  H H      . PHE A 1 215 ? 46.184  -25.002 95.848  1.00 39.97  ? 215 PHE A H      1 
ATOM   3562  H HA     . PHE A 1 215 ? 45.270  -24.490 93.356  1.00 39.19  ? 215 PHE A HA     1 
ATOM   3563  H HB2    . PHE A 1 215 ? 45.668  -22.431 94.641  1.00 41.67  ? 215 PHE A HB2    1 
ATOM   3564  H HB3    . PHE A 1 215 ? 47.201  -22.734 94.370  1.00 41.67  ? 215 PHE A HB3    1 
ATOM   3565  H HD1    . PHE A 1 215 ? 47.982  -22.755 91.951  1.00 49.77  ? 215 PHE A HD1    1 
ATOM   3566  H HD2    . PHE A 1 215 ? 44.390  -21.308 92.979  1.00 48.43  ? 215 PHE A HD2    1 
ATOM   3567  H HE1    . PHE A 1 215 ? 47.828  -21.673 89.914  1.00 45.85  ? 215 PHE A HE1    1 
ATOM   3568  H HE2    . PHE A 1 215 ? 44.247  -20.230 90.938  1.00 43.05  ? 215 PHE A HE2    1 
ATOM   3569  H HZ     . PHE A 1 215 ? 45.961  -20.410 89.407  1.00 40.62  ? 215 PHE A HZ     1 
ATOM   3570  N N      . VAL A 1 216 ? 47.052  -25.630 92.263  1.00 28.56  ? 216 VAL A N      1 
ATOM   3571  C CA     . VAL A 1 216 ? 48.138  -26.287 91.563  1.00 27.47  ? 216 VAL A CA     1 
ATOM   3572  C C      . VAL A 1 216 ? 48.517  -25.398 90.394  1.00 31.12  ? 216 VAL A C      1 
ATOM   3573  O O      . VAL A 1 216 ? 47.715  -25.185 89.492  1.00 38.71  ? 216 VAL A O      1 
ATOM   3574  C CB     . VAL A 1 216 ? 47.749  -27.694 91.075  1.00 25.93  ? 216 VAL A CB     1 
ATOM   3575  C CG1    . VAL A 1 216 ? 48.969  -28.423 90.534  1.00 25.52  ? 216 VAL A CG1    1 
ATOM   3576  C CG2    . VAL A 1 216 ? 47.127  -28.492 92.212  1.00 27.90  ? 216 VAL A CG2    1 
ATOM   3577  H H      . VAL A 1 216 ? 46.318  -25.610 91.816  1.00 34.66  ? 216 VAL A H      1 
ATOM   3578  H HA     . VAL A 1 216 ? 48.904  -26.366 92.153  1.00 33.35  ? 216 VAL A HA     1 
ATOM   3579  H HB     . VAL A 1 216 ? 47.096  -27.619 90.362  1.00 31.50  ? 216 VAL A HB     1 
ATOM   3580  H HG11   . VAL A 1 216 ? 48.702  -29.305 90.233  1.00 31.02  ? 216 VAL A HG11   1 
ATOM   3581  H HG12   . VAL A 1 216 ? 49.335  -27.917 89.792  1.00 31.02  ? 216 VAL A HG12   1 
ATOM   3582  H HG13   . VAL A 1 216 ? 49.630  -28.500 91.240  1.00 31.02  ? 216 VAL A HG13   1 
ATOM   3583  H HG21   . VAL A 1 216 ? 46.889  -29.374 91.886  1.00 33.88  ? 216 VAL A HG21   1 
ATOM   3584  H HG22   . VAL A 1 216 ? 47.772  -28.568 92.933  1.00 33.88  ? 216 VAL A HG22   1 
ATOM   3585  H HG23   . VAL A 1 216 ? 46.334  -28.029 92.525  1.00 33.88  ? 216 VAL A HG23   1 
ATOM   3586  N N      . VAL A 1 217 ? 49.718  -24.834 90.426  1.00 29.97  ? 217 VAL A N      1 
ATOM   3587  C CA     . VAL A 1 217 ? 50.093  -23.857 89.414  1.00 33.72  ? 217 VAL A CA     1 
ATOM   3588  C C      . VAL A 1 217 ? 50.596  -24.568 88.151  1.00 36.29  ? 217 VAL A C      1 
ATOM   3589  O O      . VAL A 1 217 ? 51.608  -25.269 88.159  1.00 36.46  ? 217 VAL A O      1 
ATOM   3590  C CB     . VAL A 1 217 ? 51.181  -22.885 89.947  1.00 33.09  ? 217 VAL A CB     1 
ATOM   3591  C CG1    . VAL A 1 217 ? 51.628  -21.924 88.859  1.00 36.26  ? 217 VAL A CG1    1 
ATOM   3592  C CG2    . VAL A 1 217 ? 50.663  -22.108 91.146  1.00 31.94  ? 217 VAL A CG2    1 
ATOM   3593  H H      . VAL A 1 217 ? 50.325  -24.997 91.013  1.00 36.36  ? 217 VAL A H      1 
ATOM   3594  H HA     . VAL A 1 217 ? 49.313  -23.333 89.175  1.00 40.86  ? 217 VAL A HA     1 
ATOM   3595  H HB     . VAL A 1 217 ? 51.953  -23.399 90.231  1.00 40.10  ? 217 VAL A HB     1 
ATOM   3596  H HG11   . VAL A 1 217 ? 52.306  -21.332 89.221  1.00 43.91  ? 217 VAL A HG11   1 
ATOM   3597  H HG12   . VAL A 1 217 ? 51.995  -22.434 88.119  1.00 43.91  ? 217 VAL A HG12   1 
ATOM   3598  H HG13   . VAL A 1 217 ? 50.863  -21.409 88.560  1.00 43.91  ? 217 VAL A HG13   1 
ATOM   3599  H HG21   . VAL A 1 217 ? 51.360  -21.510 91.459  1.00 38.72  ? 217 VAL A HG21   1 
ATOM   3600  H HG22   . VAL A 1 217 ? 49.883  -21.598 90.878  1.00 38.72  ? 217 VAL A HG22   1 
ATOM   3601  H HG23   . VAL A 1 217 ? 50.424  -22.734 91.848  1.00 38.72  ? 217 VAL A HG23   1 
ATOM   3602  N N      . ASP A 1 218 ? 49.857  -24.353 87.065  1.00 38.11  ? 218 ASP A N      1 
ATOM   3603  C CA     . ASP A 1 218 ? 50.165  -24.919 85.764  1.00 37.21  ? 218 ASP A CA     1 
ATOM   3604  C C      . ASP A 1 218 ? 51.573  -24.447 85.412  1.00 38.25  ? 218 ASP A C      1 
ATOM   3605  O O      . ASP A 1 218 ? 51.809  -23.242 85.355  1.00 42.05  ? 218 ASP A O      1 
ATOM   3606  C CB     . ASP A 1 218 ? 49.135  -24.455 84.717  1.00 39.26  ? 218 ASP A CB     1 
ATOM   3607  C CG     . ASP A 1 218 ? 49.055  -25.369 83.514  1.00 44.78  ? 218 ASP A CG     1 
ATOM   3608  O OD1    . ASP A 1 218 ? 50.051  -26.053 83.215  1.00 50.50  ? 218 ASP A OD1    1 
ATOM   3609  O OD2    . ASP A 1 218 ? 47.998  -25.395 82.853  1.00 43.53  ? 218 ASP A OD2    1 
ATOM   3610  H H      . ASP A 1 218 ? 49.148  -23.866 87.062  1.00 46.13  ? 218 ASP A H      1 
ATOM   3611  H HA     . ASP A 1 218 ? 50.157  -25.888 85.810  1.00 45.05  ? 218 ASP A HA     1 
ATOM   3612  H HB2    . ASP A 1 218 ? 48.257  -24.428 85.129  1.00 47.51  ? 218 ASP A HB2    1 
ATOM   3613  H HB3    . ASP A 1 218 ? 49.380  -23.571 84.404  1.00 47.51  ? 218 ASP A HB3    1 
ATOM   3614  N N      . PRO A 1 219 ? 52.522  -25.382 85.214  1.00 33.47  ? 219 PRO A N      1 
ATOM   3615  C CA     . PRO A 1 219 ? 53.887  -25.021 84.803  1.00 34.80  ? 219 PRO A CA     1 
ATOM   3616  C C      . PRO A 1 219 ? 53.910  -24.163 83.539  1.00 40.18  ? 219 PRO A C      1 
ATOM   3617  O O      . PRO A 1 219 ? 54.802  -23.324 83.350  1.00 36.60  ? 219 PRO A O      1 
ATOM   3618  C CB     . PRO A 1 219 ? 54.543  -26.372 84.549  1.00 32.41  ? 219 PRO A CB     1 
ATOM   3619  C CG     . PRO A 1 219 ? 53.787  -27.317 85.358  1.00 30.45  ? 219 PRO A CG     1 
ATOM   3620  C CD     . PRO A 1 219 ? 52.387  -26.830 85.411  1.00 30.74  ? 219 PRO A CD     1 
ATOM   3621  H HA     . PRO A 1 219 ? 54.351  -24.562 85.520  1.00 42.15  ? 219 PRO A HA     1 
ATOM   3622  H HB2    . PRO A 1 219 ? 54.477  -26.596 83.607  1.00 39.28  ? 219 PRO A HB2    1 
ATOM   3623  H HB3    . PRO A 1 219 ? 55.471  -26.343 84.831  1.00 39.28  ? 219 PRO A HB3    1 
ATOM   3624  H HG2    . PRO A 1 219 ? 53.823  -28.194 84.945  1.00 36.93  ? 219 PRO A HG2    1 
ATOM   3625  H HG3    . PRO A 1 219 ? 54.166  -27.350 86.251  1.00 36.93  ? 219 PRO A HG3    1 
ATOM   3626  H HD2    . PRO A 1 219 ? 51.865  -27.222 84.694  1.00 37.28  ? 219 PRO A HD2    1 
ATOM   3627  H HD3    . PRO A 1 219 ? 51.996  -27.018 86.279  1.00 37.28  ? 219 PRO A HD3    1 
ATOM   3628  N N      . VAL A 1 220 ? 52.930  -24.441 82.677  1.00 46.09  ? 220 VAL A N      1 
ATOM   3629  C CA     . VAL A 1 220 ? 52.691  -23.755 81.408  1.00 45.45  ? 220 VAL A CA     1 
ATOM   3630  C C      . VAL A 1 220 ? 52.054  -22.391 81.618  1.00 50.63  ? 220 VAL A C      1 
ATOM   3631  O O      . VAL A 1 220 ? 52.476  -21.398 81.027  1.00 50.09  ? 220 VAL A O      1 
ATOM   3632  C CB     . VAL A 1 220 ? 51.752  -24.596 80.508  1.00 42.42  ? 220 VAL A CB     1 
ATOM   3633  C CG1    . VAL A 1 220 ? 51.236  -23.790 79.305  1.00 46.59  ? 220 VAL A CG1    1 
ATOM   3634  C CG2    . VAL A 1 220 ? 52.446  -25.875 80.069  1.00 40.99  ? 220 VAL A CG2    1 
ATOM   3635  H H      . VAL A 1 220 ? 52.356  -25.065 82.820  1.00 55.70  ? 220 VAL A H      1 
ATOM   3636  H HA     . VAL A 1 220 ? 53.534  -23.633 80.944  1.00 54.93  ? 220 VAL A HA     1 
ATOM   3637  H HB     . VAL A 1 220 ? 50.979  -24.854 81.033  1.00 51.29  ? 220 VAL A HB     1 
ATOM   3638  H HG11   . VAL A 1 220 ? 50.654  -24.355 78.772  1.00 56.30  ? 220 VAL A HG11   1 
ATOM   3639  H HG12   . VAL A 1 220 ? 50.743  -23.020 79.629  1.00 56.30  ? 220 VAL A HG12   1 
ATOM   3640  H HG13   . VAL A 1 220 ? 51.992  -23.498 78.772  1.00 56.30  ? 220 VAL A HG13   1 
ATOM   3641  H HG21   . VAL A 1 220 ? 51.841  -26.385 79.508  1.00 49.58  ? 220 VAL A HG21   1 
ATOM   3642  H HG22   . VAL A 1 220 ? 53.246  -25.645 79.571  1.00 49.58  ? 220 VAL A HG22   1 
ATOM   3643  H HG23   . VAL A 1 220 ? 52.682  -26.391 80.856  1.00 49.58  ? 220 VAL A HG23   1 
ATOM   3644  N N      . ASP A 1 221 ? 51.034  -22.362 82.473  1.00 59.12  ? 221 ASP A N      1 
ATOM   3645  C CA     . ASP A 1 221 ? 50.301  -21.137 82.769  1.00 65.18  ? 221 ASP A CA     1 
ATOM   3646  C C      . ASP A 1 221 ? 50.338  -20.837 84.266  1.00 66.45  ? 221 ASP A C      1 
ATOM   3647  O O      . ASP A 1 221 ? 49.648  -21.468 85.062  1.00 66.35  ? 221 ASP A O      1 
ATOM   3648  C CB     . ASP A 1 221 ? 48.858  -21.284 82.288  1.00 66.16  ? 221 ASP A CB     1 
ATOM   3649  C CG     . ASP A 1 221 ? 48.135  -19.968 82.202  1.00 71.55  ? 221 ASP A CG     1 
ATOM   3650  O OD1    . ASP A 1 221 ? 48.604  -18.984 82.818  1.00 74.05  ? 221 ASP A OD1    1 
ATOM   3651  O OD2    . ASP A 1 221 ? 47.091  -19.923 81.516  1.00 72.70  ? 221 ASP A OD2    1 
ATOM   3652  H H      . ASP A 1 221 ? 50.745  -23.050 82.900  1.00 71.34  ? 221 ASP A H      1 
ATOM   3653  H HA     . ASP A 1 221 ? 50.708  -20.395 82.297  1.00 78.61  ? 221 ASP A HA     1 
ATOM   3654  H HB2    . ASP A 1 221 ? 48.859  -21.684 81.404  1.00 79.79  ? 221 ASP A HB2    1 
ATOM   3655  H HB3    . ASP A 1 221 ? 48.374  -21.852 82.908  1.00 79.79  ? 221 ASP A HB3    1 
ATOM   3656  N N      . GLU A 1 222 ? 51.088  -19.808 84.632  1.00 66.58  ? 222 GLU A N      1 
ATOM   3657  C CA     . GLU A 1 222 ? 51.369  -19.553 86.035  1.00 64.25  ? 222 GLU A CA     1 
ATOM   3658  C C      . GLU A 1 222 ? 50.113  -19.056 86.758  1.00 64.26  ? 222 GLU A C      1 
ATOM   3659  O O      . GLU A 1 222 ? 50.025  -19.160 87.978  1.00 59.99  ? 222 GLU A O      1 
ATOM   3660  C CB     . GLU A 1 222 ? 52.551  -18.561 86.127  1.00 67.94  ? 222 GLU A CB     1 
ATOM   3661  C CG     . GLU A 1 222 ? 52.575  -17.581 87.297  1.00 73.44  ? 222 GLU A CG     1 
ATOM   3662  C CD     . GLU A 1 222 ? 52.655  -16.135 86.830  1.00 75.53  ? 222 GLU A CD     1 
ATOM   3663  O OE1    . GLU A 1 222 ? 53.652  -15.787 86.159  1.00 72.99  ? 222 GLU A OE1    1 
ATOM   3664  O OE2    . GLU A 1 222 ? 51.692  -15.365 87.066  1.00 76.21  ? 222 GLU A OE2    1 
ATOM   3665  H H      . GLU A 1 222 ? 51.446  -19.244 84.090  1.00 80.29  ? 222 GLU A H      1 
ATOM   3666  H HA     . GLU A 1 222 ? 51.644  -20.383 86.455  1.00 77.49  ? 222 GLU A HA     1 
ATOM   3667  H HB2    . GLU A 1 222 ? 53.371  -19.078 86.176  1.00 81.92  ? 222 GLU A HB2    1 
ATOM   3668  H HB3    . GLU A 1 222 ? 52.560  -18.031 85.315  1.00 81.92  ? 222 GLU A HB3    1 
ATOM   3669  H HG2    . GLU A 1 222 ? 51.762  -17.686 87.816  1.00 88.52  ? 222 GLU A HG2    1 
ATOM   3670  H HG3    . GLU A 1 222 ? 53.350  -17.764 87.850  1.00 88.52  ? 222 GLU A HG3    1 
ATOM   3671  N N      . LYS A 1 223 ? 49.129  -18.569 86.007  1.00 71.12  ? 223 LYS A N      1 
ATOM   3672  C CA     . LYS A 1 223 ? 47.881  -18.078 86.601  1.00 75.64  ? 223 LYS A CA     1 
ATOM   3673  C C      . LYS A 1 223 ? 46.801  -19.167 86.723  1.00 70.26  ? 223 LYS A C      1 
ATOM   3674  O O      . LYS A 1 223 ? 45.809  -18.971 87.433  1.00 69.37  ? 223 LYS A O      1 
ATOM   3675  C CB     . LYS A 1 223 ? 47.336  -16.885 85.797  1.00 81.60  ? 223 LYS A CB     1 
ATOM   3676  C CG     . LYS A 1 223 ? 46.252  -16.052 86.516  1.00 87.25  ? 223 LYS A CG     1 
ATOM   3677  C CD     . LYS A 1 223 ? 46.759  -15.370 87.802  1.00 88.98  ? 223 LYS A CD     1 
ATOM   3678  C CE     . LYS A 1 223 ? 46.182  -16.006 89.078  1.00 89.24  ? 223 LYS A CE     1 
ATOM   3679  N NZ     . LYS A 1 223 ? 46.852  -15.507 90.321  1.00 88.09  ? 223 LYS A NZ     1 
ATOM   3680  H H      . LYS A 1 223 ? 49.155  -18.510 85.149  1.00 85.73  ? 223 LYS A H      1 
ATOM   3681  H HA     . LYS A 1 223 ? 48.074  -17.761 87.497  1.00 91.16  ? 223 LYS A HA     1 
ATOM   3682  H HB2    . LYS A 1 223 ? 48.074  -16.289 85.591  1.00 98.31  ? 223 LYS A HB2    1 
ATOM   3683  H HB3    . LYS A 1 223 ? 46.950  -17.219 84.972  1.00 98.31  ? 223 LYS A HB3    1 
ATOM   3684  H HG2    . LYS A 1 223 ? 45.939  -15.359 85.914  1.00 105.09 ? 223 LYS A HG2    1 
ATOM   3685  H HG3    . LYS A 1 223 ? 45.517  -16.636 86.758  1.00 105.09 ? 223 LYS A HG3    1 
ATOM   3686  H HD2    . LYS A 1 223 ? 47.725  -15.444 87.840  1.00 107.17 ? 223 LYS A HD2    1 
ATOM   3687  H HD3    . LYS A 1 223 ? 46.498  -14.436 87.788  1.00 107.17 ? 223 LYS A HD3    1 
ATOM   3688  H HE2    . LYS A 1 223 ? 45.238  -15.793 89.139  1.00 107.48 ? 223 LYS A HE2    1 
ATOM   3689  H HE3    . LYS A 1 223 ? 46.304  -16.967 89.036  1.00 107.48 ? 223 LYS A HE3    1 
ATOM   3690  H HZ1    . LYS A 1 223 ? 46.493  -15.897 91.037  1.00 106.10 ? 223 LYS A HZ1    1 
ATOM   3691  H HZ2    . LYS A 1 223 ? 47.721  -15.696 90.295  1.00 106.10 ? 223 LYS A HZ2    1 
ATOM   3692  H HZ3    . LYS A 1 223 ? 46.749  -14.626 90.389  1.00 106.10 ? 223 LYS A HZ3    1 
ATOM   3693  N N      . ARG A 1 224 ? 46.992  -20.315 86.067  1.00 62.79  ? 224 ARG A N      1 
ATOM   3694  C CA     . ARG A 1 224 ? 45.908  -21.305 85.971  1.00 54.44  ? 224 ARG A CA     1 
ATOM   3695  C C      . ARG A 1 224 ? 45.976  -22.363 87.071  1.00 48.66  ? 224 ARG A C      1 
ATOM   3696  O O      . ARG A 1 224 ? 47.052  -22.800 87.474  1.00 52.55  ? 224 ARG A O      1 
ATOM   3697  C CB     . ARG A 1 224 ? 45.907  -22.023 84.613  1.00 50.42  ? 224 ARG A CB     1 
ATOM   3698  C CG     . ARG A 1 224 ? 44.524  -22.558 84.281  1.00 50.59  ? 224 ARG A CG     1 
ATOM   3699  C CD     . ARG A 1 224 ? 44.482  -24.012 83.881  1.00 50.08  ? 224 ARG A CD     1 
ATOM   3700  N NE     . ARG A 1 224 ? 43.102  -24.496 83.967  1.00 53.29  ? 224 ARG A NE     1 
ATOM   3701  C CZ     . ARG A 1 224 ? 42.733  -25.772 83.880  1.00 54.15  ? 224 ARG A CZ     1 
ATOM   3702  N NH1    . ARG A 1 224 ? 43.649  -26.714 83.695  1.00 56.01  ? 224 ARG A NH1    1 
ATOM   3703  N NH2    . ARG A 1 224 ? 41.449  -26.109 83.981  1.00 51.38  ? 224 ARG A NH2    1 
ATOM   3704  H H      . ARG A 1 224 ? 47.722  -20.544 85.675  1.00 75.74  ? 224 ARG A H      1 
ATOM   3705  H HA     . ARG A 1 224 ? 45.059  -20.843 86.059  1.00 65.72  ? 224 ARG A HA     1 
ATOM   3706  H HB2    . ARG A 1 224 ? 46.168  -21.398 83.918  1.00 60.89  ? 224 ARG A HB2    1 
ATOM   3707  H HB3    . ARG A 1 224 ? 46.524  -22.771 84.644  1.00 60.89  ? 224 ARG A HB3    1 
ATOM   3708  H HG2    . ARG A 1 224 ? 43.957  -22.453 85.062  1.00 61.10  ? 224 ARG A HG2    1 
ATOM   3709  H HG3    . ARG A 1 224 ? 44.161  -22.041 83.545  1.00 61.10  ? 224 ARG A HG3    1 
ATOM   3710  H HD2    . ARG A 1 224 ? 44.789  -24.108 82.966  1.00 60.49  ? 224 ARG A HD2    1 
ATOM   3711  H HD3    . ARG A 1 224 ? 45.033  -24.534 84.484  1.00 60.49  ? 224 ARG A HD3    1 
ATOM   3712  H HE     . ARG A 1 224 ? 42.482  -23.911 84.084  1.00 64.34  ? 224 ARG A HE     1 
ATOM   3713  H HH11   . ARG A 1 224 ? 44.479  -26.501 83.632  1.00 67.61  ? 224 ARG A HH11   1 
ATOM   3714  H HH12   . ARG A 1 224 ? 43.411  -27.539 83.638  1.00 67.61  ? 224 ARG A HH12   1 
ATOM   3715  H HH21   . ARG A 1 224 ? 40.853  -25.501 84.099  1.00 62.04  ? 224 ARG A HH21   1 
ATOM   3716  H HH22   . ARG A 1 224 ? 41.215  -26.935 83.921  1.00 62.04  ? 224 ARG A HH22   1 
ATOM   3717  N N      . ASN A 1 225 ? 44.811  -22.789 87.537  1.00 39.05  ? 225 ASN A N      1 
ATOM   3718  C CA     . ASN A 1 225 ? 44.732  -23.856 88.520  1.00 32.47  ? 225 ASN A CA     1 
ATOM   3719  C C      . ASN A 1 225 ? 44.377  -25.191 87.877  1.00 34.42  ? 225 ASN A C      1 
ATOM   3720  O O      . ASN A 1 225 ? 43.251  -25.396 87.429  1.00 37.19  ? 225 ASN A O      1 
ATOM   3721  C CB     . ASN A 1 225 ? 43.692  -23.504 89.567  1.00 33.37  ? 225 ASN A CB     1 
ATOM   3722  C CG     . ASN A 1 225 ? 43.722  -24.427 90.747  1.00 32.90  ? 225 ASN A CG     1 
ATOM   3723  O OD1    . ASN A 1 225 ? 44.164  -25.573 90.661  1.00 34.88  ? 225 ASN A OD1    1 
ATOM   3724  N ND2    . ASN A 1 225 ? 43.243  -23.932 91.872  1.00 30.98  ? 225 ASN A ND2    1 
ATOM   3725  H H      . ASN A 1 225 ? 44.048  -22.473 87.299  1.00 47.25  ? 225 ASN A H      1 
ATOM   3726  H HA     . ASN A 1 225 ? 45.591  -23.949 88.962  1.00 39.36  ? 225 ASN A HA     1 
ATOM   3727  H HB2    . ASN A 1 225 ? 43.857  -22.603 89.886  1.00 40.44  ? 225 ASN A HB2    1 
ATOM   3728  H HB3    . ASN A 1 225 ? 42.810  -23.558 89.166  1.00 40.44  ? 225 ASN A HB3    1 
ATOM   3729  H HD21   . ASN A 1 225 ? 43.234  -24.414 92.584  1.00 37.56  ? 225 ASN A HD21   1 
ATOM   3730  H HD22   . ASN A 1 225 ? 42.941  -23.127 91.894  1.00 37.56  ? 225 ASN A HD22   1 
ATOM   3731  N N      . VAL A 1 226 ? 45.326  -26.117 87.867  1.00 36.95  ? 226 VAL A N      1 
ATOM   3732  C CA     . VAL A 1 226 ? 45.091  -27.419 87.260  1.00 40.12  ? 226 VAL A CA     1 
ATOM   3733  C C      . VAL A 1 226 ? 44.022  -28.162 88.064  1.00 42.42  ? 226 VAL A C      1 
ATOM   3734  O O      . VAL A 1 226 ? 43.223  -28.919 87.499  1.00 49.02  ? 226 VAL A O      1 
ATOM   3735  C CB     . VAL A 1 226 ? 46.413  -28.248 87.180  1.00 38.64  ? 226 VAL A CB     1 
ATOM   3736  C CG1    . VAL A 1 226 ? 46.203  -29.599 86.514  1.00 41.82  ? 226 VAL A CG1    1 
ATOM   3737  C CG2    . VAL A 1 226 ? 47.481  -27.466 86.435  1.00 36.04  ? 226 VAL A CG2    1 
ATOM   3738  H H      . VAL A 1 226 ? 46.111  -26.017 88.204  1.00 44.73  ? 226 VAL A H      1 
ATOM   3739  H HA     . VAL A 1 226 ? 44.758  -27.294 86.357  1.00 48.53  ? 226 VAL A HA     1 
ATOM   3740  H HB     . VAL A 1 226 ? 46.736  -28.408 88.080  1.00 46.76  ? 226 VAL A HB     1 
ATOM   3741  H HG11   . VAL A 1 226 ? 47.049  -30.073 86.488  1.00 50.57  ? 226 VAL A HG11   1 
ATOM   3742  H HG12   . VAL A 1 226 ? 45.554  -30.106 87.027  1.00 50.57  ? 226 VAL A HG12   1 
ATOM   3743  H HG13   . VAL A 1 226 ? 45.875  -29.459 85.612  1.00 50.57  ? 226 VAL A HG13   1 
ATOM   3744  H HG21   . VAL A 1 226 ? 48.291  -27.997 86.397  1.00 43.64  ? 226 VAL A HG21   1 
ATOM   3745  H HG22   . VAL A 1 226 ? 47.165  -27.278 85.537  1.00 43.64  ? 226 VAL A HG22   1 
ATOM   3746  H HG23   . VAL A 1 226 ? 47.650  -26.636 86.907  1.00 43.64  ? 226 VAL A HG23   1 
ATOM   3747  N N      . ALA A 1 227 ? 43.959  -27.858 89.360  1.00 33.65  ? 227 ALA A N      1 
ATOM   3748  C CA     . ALA A 1 227 ? 43.027  -28.482 90.296  1.00 25.82  ? 227 ALA A CA     1 
ATOM   3749  C C      . ALA A 1 227 ? 41.703  -27.700 90.411  1.00 34.15  ? 227 ALA A C      1 
ATOM   3750  O O      . ALA A 1 227 ? 40.912  -27.933 91.331  1.00 34.59  ? 227 ALA A O      1 
ATOM   3751  C CB     . ALA A 1 227 ? 43.672  -28.630 91.653  1.00 22.02  ? 227 ALA A CB     1 
ATOM   3752  H H      . ALA A 1 227 ? 44.466  -27.271 89.732  1.00 40.78  ? 227 ALA A H      1 
ATOM   3753  H HA     . ALA A 1 227 ? 42.814  -29.372 89.974  1.00 31.37  ? 227 ALA A HA     1 
ATOM   3754  H HB1    . ALA A 1 227 ? 43.040  -29.046 92.259  1.00 26.81  ? 227 ALA A HB1    1 
ATOM   3755  H HB2    . ALA A 1 227 ? 44.463  -29.186 91.567  1.00 26.81  ? 227 ALA A HB2    1 
ATOM   3756  H HB3    . ALA A 1 227 ? 43.919  -27.752 91.982  1.00 26.81  ? 227 ALA A HB3    1 
ATOM   3757  N N      . ALA A 1 228 ? 41.494  -26.736 89.520  1.00 41.39  ? 228 ALA A N      1 
ATOM   3758  C CA     . ALA A 1 228 ? 40.369  -25.806 89.626  1.00 42.35  ? 228 ALA A CA     1 
ATOM   3759  C C      . ALA A 1 228 ? 39.038  -26.476 89.936  1.00 40.28  ? 228 ALA A C      1 
ATOM   3760  O O      . ALA A 1 228 ? 38.320  -26.051 90.851  1.00 37.20  ? 228 ALA A O      1 
ATOM   3761  C CB     . ALA A 1 228 ? 40.233  -25.012 88.326  1.00 40.75  ? 228 ALA A CB     1 
ATOM   3762  H H      . ALA A 1 228 ? 41.995  -26.596 88.835  1.00 50.06  ? 228 ALA A H      1 
ATOM   3763  H HA     . ALA A 1 228 ? 40.554  -25.175 90.339  1.00 51.21  ? 228 ALA A HA     1 
ATOM   3764  H HB1    . ALA A 1 228 ? 39.485  -24.400 88.407  1.00 49.29  ? 228 ALA A HB1    1 
ATOM   3765  H HB2    . ALA A 1 228 ? 41.052  -24.516 88.172  1.00 49.29  ? 228 ALA A HB2    1 
ATOM   3766  H HB3    . ALA A 1 228 ? 40.078  -25.630 87.594  1.00 49.29  ? 228 ALA A HB3    1 
ATOM   3767  N N      . ASN A 1 229 ? 38.738  -27.553 89.214  1.00 38.33  ? 229 ASN A N      1 
ATOM   3768  C CA     . ASN A 1 229 ? 37.417  -28.164 89.299  1.00 32.67  ? 229 ASN A CA     1 
ATOM   3769  C C      . ASN A 1 229 ? 37.305  -29.278 90.342  1.00 31.39  ? 229 ASN A C      1 
ATOM   3770  O O      . ASN A 1 229 ? 36.272  -29.932 90.450  1.00 31.91  ? 229 ASN A O      1 
ATOM   3771  C CB     . ASN A 1 229 ? 37.004  -28.707 87.942  1.00 28.77  ? 229 ASN A CB     1 
ATOM   3772  C CG     . ASN A 1 229 ? 35.512  -28.867 87.833  1.00 34.25  ? 229 ASN A CG     1 
ATOM   3773  O OD1    . ASN A 1 229 ? 34.752  -28.025 88.322  1.00 36.41  ? 229 ASN A OD1    1 
ATOM   3774  N ND2    . ASN A 1 229 ? 35.074  -29.956 87.215  1.00 35.25  ? 229 ASN A ND2    1 
ATOM   3775  H H      . ASN A 1 229 ? 39.278  -27.945 88.671  1.00 46.38  ? 229 ASN A H      1 
ATOM   3776  H HA     . ASN A 1 229 ? 36.779  -27.475 89.543  1.00 39.59  ? 229 ASN A HA     1 
ATOM   3777  H HB2    . ASN A 1 229 ? 37.294  -28.092 87.250  1.00 34.91  ? 229 ASN A HB2    1 
ATOM   3778  H HB3    . ASN A 1 229 ? 37.412  -29.577 87.808  1.00 34.91  ? 229 ASN A HB3    1 
ATOM   3779  H HD21   . ASN A 1 229 ? 34.229  -30.090 87.129  1.00 42.70  ? 229 ASN A HD21   1 
ATOM   3780  H HD22   . ASN A 1 229 ? 35.635  -30.527 86.900  1.00 42.70  ? 229 ASN A HD22   1 
ATOM   3781  N N      . LEU A 1 230 ? 38.365  -29.493 91.110  1.00 28.28  ? 230 LEU A N      1 
ATOM   3782  C CA     . LEU A 1 230 ? 38.314  -30.426 92.222  1.00 26.73  ? 230 LEU A CA     1 
ATOM   3783  C C      . LEU A 1 230 ? 37.472  -29.815 93.325  1.00 31.43  ? 230 LEU A C      1 
ATOM   3784  O O      . LEU A 1 230 ? 37.748  -28.704 93.769  1.00 38.09  ? 230 LEU A O      1 
ATOM   3785  C CB     . LEU A 1 230 ? 39.725  -30.743 92.732  1.00 26.38  ? 230 LEU A CB     1 
ATOM   3786  C CG     . LEU A 1 230 ? 39.850  -31.570 94.017  1.00 28.97  ? 230 LEU A CG     1 
ATOM   3787  C CD1    . LEU A 1 230 ? 39.189  -32.954 93.908  1.00 30.85  ? 230 LEU A CD1    1 
ATOM   3788  C CD2    . LEU A 1 230 ? 41.313  -31.701 94.374  1.00 26.15  ? 230 LEU A CD2    1 
ATOM   3789  H H      . LEU A 1 230 ? 39.127  -29.109 91.007  1.00 34.33  ? 230 LEU A H      1 
ATOM   3790  H HA     . LEU A 1 230 ? 37.896  -31.253 91.935  1.00 32.46  ? 230 LEU A HA     1 
ATOM   3791  H HB2    . LEU A 1 230 ? 40.193  -31.230 92.035  1.00 32.05  ? 230 LEU A HB2    1 
ATOM   3792  H HB3    . LEU A 1 230 ? 40.181  -29.902 92.891  1.00 32.05  ? 230 LEU A HB3    1 
ATOM   3793  H HG     . LEU A 1 230 ? 39.412  -31.091 94.738  1.00 35.15  ? 230 LEU A HG     1 
ATOM   3794  H HD11   . LEU A 1 230 ? 39.302  -33.424 94.749  1.00 37.41  ? 230 LEU A HD11   1 
ATOM   3795  H HD12   . LEU A 1 230 ? 38.245  -32.838 93.717  1.00 37.41  ? 230 LEU A HD12   1 
ATOM   3796  H HD13   . LEU A 1 230 ? 39.614  -33.450 93.191  1.00 37.41  ? 230 LEU A HD13   1 
ATOM   3797  H HD21   . LEU A 1 230 ? 41.394  -32.224 95.187  1.00 31.77  ? 230 LEU A HD21   1 
ATOM   3798  H HD22   . LEU A 1 230 ? 41.777  -32.145 93.647  1.00 31.77  ? 230 LEU A HD22   1 
ATOM   3799  H HD23   . LEU A 1 230 ? 41.685  -30.815 94.512  1.00 31.77  ? 230 LEU A HD23   1 
ATOM   3800  N N      . SER A 1 231 ? 36.429  -30.519 93.748  1.00 26.85  ? 231 SER A N      1 
ATOM   3801  C CA     . SER A 1 231 ? 35.556  -30.007 94.800  1.00 25.76  ? 231 SER A CA     1 
ATOM   3802  C C      . SER A 1 231 ? 36.298  -30.099 96.115  1.00 28.83  ? 231 SER A C      1 
ATOM   3803  O O      . SER A 1 231 ? 37.253  -30.857 96.237  1.00 29.23  ? 231 SER A O      1 
ATOM   3804  C CB     . SER A 1 231 ? 34.257  -30.800 94.877  1.00 24.94  ? 231 SER A CB     1 
ATOM   3805  O OG     . SER A 1 231 ? 34.501  -32.107 95.391  1.00 26.75  ? 231 SER A OG     1 
ATOM   3806  H H      . SER A 1 231 ? 36.204  -31.292 93.445  1.00 32.61  ? 231 SER A H      1 
ATOM   3807  H HA     . SER A 1 231 ? 35.344  -29.076 94.626  1.00 31.31  ? 231 SER A HA     1 
ATOM   3808  H HB2    . SER A 1 231 ? 33.638  -30.338 95.464  1.00 30.32  ? 231 SER A HB2    1 
ATOM   3809  H HB3    . SER A 1 231 ? 33.879  -30.875 93.987  1.00 30.32  ? 231 SER A HB3    1 
ATOM   3810  H HG     . SER A 1 231 ? 33.782  -32.539 95.430  1.00 32.49  ? 231 SER A HG     1 
ATOM   3811  N N      . LEU A 1 232 ? 35.897  -29.308 97.095  1.00 31.54  ? 232 LEU A N      1 
ATOM   3812  C CA     . LEU A 1 232 ? 36.561  -29.372 98.391  1.00 35.20  ? 232 LEU A CA     1 
ATOM   3813  C C      . LEU A 1 232 ? 36.351  -30.742 99.018  1.00 37.91  ? 232 LEU A C      1 
ATOM   3814  O O      . LEU A 1 232 ? 37.286  -31.354 99.525  1.00 39.64  ? 232 LEU A O      1 
ATOM   3815  C CB     . LEU A 1 232 ? 36.026  -28.294 99.332  1.00 36.94  ? 232 LEU A CB     1 
ATOM   3816  C CG     . LEU A 1 232 ? 36.586  -28.276 100.753 1.00 33.88  ? 232 LEU A CG     1 
ATOM   3817  C CD1    . LEU A 1 232 ? 38.078  -28.026 100.663 1.00 32.16  ? 232 LEU A CD1    1 
ATOM   3818  C CD2    . LEU A 1 232 ? 35.895  -27.222 101.621 1.00 34.06  ? 232 LEU A CD2    1 
ATOM   3819  H H      . LEU A 1 232 ? 35.256  -28.737 97.042  1.00 38.24  ? 232 LEU A H      1 
ATOM   3820  H HA     . LEU A 1 232 ? 37.514  -29.231 98.273  1.00 42.63  ? 232 LEU A HA     1 
ATOM   3821  H HB2    . LEU A 1 232 ? 36.217  -27.429 98.938  1.00 44.72  ? 232 LEU A HB2    1 
ATOM   3822  H HB3    . LEU A 1 232 ? 35.066  -28.407 99.404  1.00 44.72  ? 232 LEU A HB3    1 
ATOM   3823  H HG     . LEU A 1 232 ? 36.448  -29.144 101.162 1.00 41.04  ? 232 LEU A HG     1 
ATOM   3824  H HD11   . LEU A 1 232 ? 38.449  -28.011 101.559 1.00 38.99  ? 232 LEU A HD11   1 
ATOM   3825  H HD12   . LEU A 1 232 ? 38.486  -28.739 100.147 1.00 38.99  ? 232 LEU A HD12   1 
ATOM   3826  H HD13   . LEU A 1 232 ? 38.229  -27.173 100.228 1.00 38.99  ? 232 LEU A HD13   1 
ATOM   3827  H HD21   . LEU A 1 232 ? 36.280  -27.245 102.511 1.00 41.26  ? 232 LEU A HD21   1 
ATOM   3828  H HD22   . LEU A 1 232 ? 36.030  -26.348 101.224 1.00 41.26  ? 232 LEU A HD22   1 
ATOM   3829  H HD23   . LEU A 1 232 ? 34.947  -27.423 101.665 1.00 41.26  ? 232 LEU A HD23   1 
ATOM   3830  N N      . ASP A 1 233 ? 35.120  -31.235 98.932  1.00 41.21  ? 233 ASP A N      1 
ATOM   3831  C CA     . ASP A 1 233 ? 34.770  -32.495 99.560  1.00 44.47  ? 233 ASP A CA     1 
ATOM   3832  C C      . ASP A 1 233 ? 35.530  -33.656 98.936  1.00 40.15  ? 233 ASP A C      1 
ATOM   3833  O O      . ASP A 1 233 ? 35.797  -34.638 99.615  1.00 45.52  ? 233 ASP A O      1 
ATOM   3834  C CB     . ASP A 1 233 ? 33.265  -32.771 99.467  1.00 50.88  ? 233 ASP A CB     1 
ATOM   3835  C CG     . ASP A 1 233 ? 32.424  -31.869 100.372 1.00 55.42  ? 233 ASP A CG     1 
ATOM   3836  O OD1    . ASP A 1 233 ? 32.954  -31.323 101.363 1.00 57.26  ? 233 ASP A OD1    1 
ATOM   3837  O OD2    . ASP A 1 233 ? 31.203  -31.747 100.115 1.00 56.79  ? 233 ASP A OD2    1 
ATOM   3838  H H      . ASP A 1 233 ? 34.471  -30.857 98.513  1.00 49.84  ? 233 ASP A H      1 
ATOM   3839  H HA     . ASP A 1 233 ? 35.008  -32.454 100.500 1.00 53.76  ? 233 ASP A HA     1 
ATOM   3840  H HB2    . ASP A 1 233 ? 32.977  -32.627 98.552  1.00 61.44  ? 233 ASP A HB2    1 
ATOM   3841  H HB3    . ASP A 1 233 ? 33.098  -33.691 99.724  1.00 61.44  ? 233 ASP A HB3    1 
ATOM   3842  N N      . ASN A 1 234 ? 35.898  -33.550 97.664  1.00 30.72  ? 234 ASN A N      1 
ATOM   3843  C CA     . ASN A 1 234 ? 36.655  -34.628 97.018  1.00 29.38  ? 234 ASN A CA     1 
ATOM   3844  C C      . ASN A 1 234 ? 38.149  -34.596 97.404  1.00 28.89  ? 234 ASN A C      1 
ATOM   3845  O O      . ASN A 1 234 ? 38.786  -35.644 97.546  1.00 29.98  ? 234 ASN A O      1 
ATOM   3846  C CB     . ASN A 1 234 ? 36.477  -34.558 95.500  1.00 27.57  ? 234 ASN A CB     1 
ATOM   3847  C CG     . ASN A 1 234 ? 35.087  -34.991 95.063  1.00 27.09  ? 234 ASN A CG     1 
ATOM   3848  O OD1    . ASN A 1 234 ? 34.394  -35.670 95.802  1.00 27.88  ? 234 ASN A OD1    1 
ATOM   3849  N ND2    . ASN A 1 234 ? 34.680  -34.602 93.861  1.00 28.04  ? 234 ASN A ND2    1 
ATOM   3850  H H      . ASN A 1 234 ? 35.727  -32.878 97.156  1.00 37.25  ? 234 ASN A H      1 
ATOM   3851  H HA     . ASN A 1 234 ? 36.295  -35.478 97.315  1.00 35.65  ? 234 ASN A HA     1 
ATOM   3852  H HB2    . ASN A 1 234 ? 36.615  -33.644 95.206  1.00 33.47  ? 234 ASN A HB2    1 
ATOM   3853  H HB3    . ASN A 1 234 ? 37.123  -35.145 95.077  1.00 33.47  ? 234 ASN A HB3    1 
ATOM   3854  H HD21   . ASN A 1 234 ? 33.900  -34.827 93.577  1.00 34.04  ? 234 ASN A HD21   1 
ATOM   3855  H HD22   . ASN A 1 234 ? 35.197  -34.125 93.365  1.00 34.04  ? 234 ASN A HD22   1 
ATOM   3856  N N      . LEU A 1 235 ? 38.705  -33.401 97.566  1.00 26.25  ? 235 LEU A N      1 
ATOM   3857  C CA     . LEU A 1 235 ? 40.019  -33.254 98.168  1.00 25.41  ? 235 LEU A CA     1 
ATOM   3858  C C      . LEU A 1 235 ? 40.022  -33.789 99.598  1.00 33.37  ? 235 LEU A C      1 
ATOM   3859  O O      . LEU A 1 235 ? 40.978  -34.441 100.020 1.00 38.69  ? 235 LEU A O      1 
ATOM   3860  C CB     . LEU A 1 235 ? 40.445  -31.785 98.148  1.00 27.08  ? 235 LEU A CB     1 
ATOM   3861  C CG     . LEU A 1 235 ? 41.451  -31.310 99.209  1.00 28.90  ? 235 LEU A CG     1 
ATOM   3862  C CD1    . LEU A 1 235 ? 42.812  -31.982 99.103  1.00 27.75  ? 235 LEU A CD1    1 
ATOM   3863  C CD2    . LEU A 1 235 ? 41.589  -29.802 99.114  1.00 27.48  ? 235 LEU A CD2    1 
ATOM   3864  H H      . LEU A 1 235 ? 38.339  -32.658 97.335  1.00 31.89  ? 235 LEU A H      1 
ATOM   3865  H HA     . LEU A 1 235 ? 40.665  -33.764 97.653  1.00 30.88  ? 235 LEU A HA     1 
ATOM   3866  H HB2    . LEU A 1 235 ? 40.841  -31.601 97.282  1.00 32.88  ? 235 LEU A HB2    1 
ATOM   3867  H HB3    . LEU A 1 235 ? 39.647  -31.243 98.253  1.00 32.88  ? 235 LEU A HB3    1 
ATOM   3868  H HG     . LEU A 1 235 ? 41.092  -31.515 100.086 1.00 35.07  ? 235 LEU A HG     1 
ATOM   3869  H HD11   . LEU A 1 235 ? 43.391  -31.635 99.800  1.00 33.70  ? 235 LEU A HD11   1 
ATOM   3870  H HD12   . LEU A 1 235 ? 42.700  -32.939 99.212  1.00 33.70  ? 235 LEU A HD12   1 
ATOM   3871  H HD13   . LEU A 1 235 ? 43.192  -31.790 98.231  1.00 33.70  ? 235 LEU A HD13   1 
ATOM   3872  H HD21   . LEU A 1 235 ? 42.224  -29.501 99.783  1.00 33.37  ? 235 LEU A HD21   1 
ATOM   3873  H HD22   . LEU A 1 235 ? 41.907  -29.569 98.228  1.00 33.37  ? 235 LEU A HD22   1 
ATOM   3874  H HD23   . LEU A 1 235 ? 40.723  -29.395 99.272  1.00 33.37  ? 235 LEU A HD23   1 
ATOM   3875  N N      . ALA A 1 236 ? 38.927  -33.552 100.321 1.00 33.15  ? 236 ALA A N      1 
ATOM   3876  C CA     . ALA A 1 236 ? 38.827  -33.932 101.732 1.00 30.20  ? 236 ALA A CA     1 
ATOM   3877  C C      . ALA A 1 236 ? 38.746  -35.429 101.822 1.00 33.63  ? 236 ALA A C      1 
ATOM   3878  O O      . ALA A 1 236 ? 39.215  -36.035 102.783 1.00 36.44  ? 236 ALA A O      1 
ATOM   3879  C CB     . ALA A 1 236 ? 37.618  -33.306 102.376 1.00 30.05  ? 236 ALA A CB     1 
ATOM   3880  H H      . ALA A 1 236 ? 38.222  -33.167 100.015 1.00 40.17  ? 236 ALA A H      1 
ATOM   3881  H HA     . ALA A 1 236 ? 39.619  -33.635 102.207 1.00 36.63  ? 236 ALA A HA     1 
ATOM   3882  H HB1    . ALA A 1 236 ? 37.581  -33.577 103.306 1.00 36.45  ? 236 ALA A HB1    1 
ATOM   3883  H HB2    . ALA A 1 236 ? 37.692  -32.341 102.314 1.00 36.45  ? 236 ALA A HB2    1 
ATOM   3884  H HB3    . ALA A 1 236 ? 36.822  -33.608 101.911 1.00 36.45  ? 236 ALA A HB3    1 
ATOM   3885  N N      . ARG A 1 237 ? 38.132  -36.016 100.806 1.00 35.12  ? 237 ARG A N      1 
ATOM   3886  C CA     . ARG A 1 237 ? 38.040  -37.453 100.710 1.00 37.35  ? 237 ARG A CA     1 
ATOM   3887  C C      . ARG A 1 237 ? 39.395  -38.015 100.341 1.00 37.47  ? 237 ARG A C      1 
ATOM   3888  O O      . ARG A 1 237 ? 39.789  -39.057 100.863 1.00 46.77  ? 237 ARG A O      1 
ATOM   3889  C CB     . ARG A 1 237 ? 37.007  -37.869 99.668  1.00 45.18  ? 237 ARG A CB     1 
ATOM   3890  C CG     . ARG A 1 237 ? 35.578  -37.732 100.127 1.00 52.70  ? 237 ARG A CG     1 
ATOM   3891  C CD     . ARG A 1 237 ? 34.610  -38.062 99.013  1.00 54.27  ? 237 ARG A CD     1 
ATOM   3892  N NE     . ARG A 1 237 ? 33.281  -37.555 99.336  1.00 55.32  ? 237 ARG A NE     1 
ATOM   3893  C CZ     . ARG A 1 237 ? 32.782  -36.396 98.919  1.00 53.45  ? 237 ARG A CZ     1 
ATOM   3894  N NH1    . ARG A 1 237 ? 33.489  -35.601 98.124  1.00 55.57  ? 237 ARG A NH1    1 
ATOM   3895  N NH2    . ARG A 1 237 ? 31.556  -36.039 99.288  1.00 53.03  ? 237 ARG A NH2    1 
ATOM   3896  H H      . ARG A 1 237 ? 37.758  -35.596 100.156 1.00 42.54  ? 237 ARG A H      1 
ATOM   3897  H HA     . ARG A 1 237 ? 37.777  -37.820 101.569 1.00 45.21  ? 237 ARG A HA     1 
ATOM   3898  H HB2    . ARG A 1 237 ? 37.118  -37.314 98.880  1.00 54.60  ? 237 ARG A HB2    1 
ATOM   3899  H HB3    . ARG A 1 237 ? 37.155  -38.799 99.437  1.00 54.60  ? 237 ARG A HB3    1 
ATOM   3900  H HG2    . ARG A 1 237 ? 35.417  -38.345 100.862 1.00 63.63  ? 237 ARG A HG2    1 
ATOM   3901  H HG3    . ARG A 1 237 ? 35.418  -36.818 100.410 1.00 63.63  ? 237 ARG A HG3    1 
ATOM   3902  H HD2    . ARG A 1 237 ? 34.908  -37.643 98.190  1.00 65.52  ? 237 ARG A HD2    1 
ATOM   3903  H HD3    . ARG A 1 237 ? 34.556  -39.024 98.905  1.00 65.52  ? 237 ARG A HD3    1 
ATOM   3904  H HE     . ARG A 1 237 ? 32.781  -38.045 99.836  1.00 66.78  ? 237 ARG A HE     1 
ATOM   3905  H HH11   . ARG A 1 237 ? 34.282  -35.828 97.883  1.00 67.08  ? 237 ARG A HH11   1 
ATOM   3906  H HH12   . ARG A 1 237 ? 33.155  -34.855 97.856  1.00 67.08  ? 237 ARG A HH12   1 
ATOM   3907  H HH21   . ARG A 1 237 ? 31.094  -36.554 99.799  1.00 64.03  ? 237 ARG A HH21   1 
ATOM   3908  H HH22   . ARG A 1 237 ? 31.225  -35.294 99.016  1.00 64.03  ? 237 ARG A HH22   1 
ATOM   3909  N N      . PHE A 1 238 ? 40.117  -37.340 99.448  1.00 29.65  ? 238 PHE A N      1 
ATOM   3910  C CA     . PHE A 1 238 ? 41.422  -37.856 99.045  1.00 29.22  ? 238 PHE A CA     1 
ATOM   3911  C C      . PHE A 1 238 ? 42.377  -37.846 100.210 1.00 32.84  ? 238 PHE A C      1 
ATOM   3912  O O      . PHE A 1 238 ? 43.081  -38.830 100.437 1.00 39.29  ? 238 PHE A O      1 
ATOM   3913  C CB     . PHE A 1 238 ? 42.037  -37.066 97.902  1.00 27.48  ? 238 PHE A CB     1 
ATOM   3914  C CG     . PHE A 1 238 ? 43.351  -37.627 97.430  1.00 29.62  ? 238 PHE A CG     1 
ATOM   3915  C CD1    . PHE A 1 238 ? 43.418  -38.911 96.903  1.00 32.21  ? 238 PHE A CD1    1 
ATOM   3916  C CD2    . PHE A 1 238 ? 44.509  -36.877 97.491  1.00 31.37  ? 238 PHE A CD2    1 
ATOM   3917  C CE1    . PHE A 1 238 ? 44.617  -39.437 96.458  1.00 29.52  ? 238 PHE A CE1    1 
ATOM   3918  C CE2    . PHE A 1 238 ? 45.719  -37.397 97.047  1.00 29.68  ? 238 PHE A CE2    1 
ATOM   3919  C CZ     . PHE A 1 238 ? 45.772  -38.674 96.529  1.00 27.91  ? 238 PHE A CZ     1 
ATOM   3920  H H      . PHE A 1 238 ? 39.883  -36.603 99.071  1.00 35.97  ? 238 PHE A H      1 
ATOM   3921  H HA     . PHE A 1 238 ? 41.319  -38.775 98.751  1.00 35.46  ? 238 PHE A HA     1 
ATOM   3922  H HB2    . PHE A 1 238 ? 41.423  -37.071 97.150  1.00 33.36  ? 238 PHE A HB2    1 
ATOM   3923  H HB3    . PHE A 1 238 ? 42.190  -36.154 98.196  1.00 33.36  ? 238 PHE A HB3    1 
ATOM   3924  H HD1    . PHE A 1 238 ? 42.645  -39.426 96.852  1.00 39.04  ? 238 PHE A HD1    1 
ATOM   3925  H HD2    . PHE A 1 238 ? 44.480  -36.015 97.838  1.00 38.04  ? 238 PHE A HD2    1 
ATOM   3926  H HE1    . PHE A 1 238 ? 44.648  -40.299 96.110  1.00 35.81  ? 238 PHE A HE1    1 
ATOM   3927  H HE2    . PHE A 1 238 ? 46.492  -36.883 97.096  1.00 36.01  ? 238 PHE A HE2    1 
ATOM   3928  H HZ     . PHE A 1 238 ? 46.581  -39.023 96.232  1.00 33.88  ? 238 PHE A HZ     1 
ATOM   3929  N N      . VAL A 1 239 ? 42.415  -36.723 100.925 1.00 28.83  ? 239 VAL A N      1 
ATOM   3930  C CA     . VAL A 1 239 ? 43.261  -36.605 102.104 1.00 28.57  ? 239 VAL A CA     1 
ATOM   3931  C C      . VAL A 1 239 ? 42.838  -37.658 103.107 1.00 29.24  ? 239 VAL A C      1 
ATOM   3932  O O      . VAL A 1 239 ? 43.671  -38.355 103.680 1.00 32.09  ? 239 VAL A O      1 
ATOM   3933  C CB     . VAL A 1 239 ? 43.181  -35.212 102.743 1.00 29.42  ? 239 VAL A CB     1 
ATOM   3934  C CG1    . VAL A 1 239 ? 43.966  -35.169 104.046 1.00 29.81  ? 239 VAL A CG1    1 
ATOM   3935  C CG2    . VAL A 1 239 ? 43.729  -34.169 101.789 1.00 30.08  ? 239 VAL A CG2    1 
ATOM   3936  H H      . VAL A 1 239 ? 41.959  -36.016 100.746 1.00 34.98  ? 239 VAL A H      1 
ATOM   3937  H HA     . VAL A 1 239 ? 44.183  -36.773 101.855 1.00 34.68  ? 239 VAL A HA     1 
ATOM   3938  H HB     . VAL A 1 239 ? 42.255  -34.996 102.934 1.00 35.69  ? 239 VAL A HB     1 
ATOM   3939  H HG11   . VAL A 1 239 ? 43.897  -34.279 104.426 1.00 36.16  ? 239 VAL A HG11   1 
ATOM   3940  H HG12   . VAL A 1 239 ? 43.593  -35.820 104.660 1.00 36.16  ? 239 VAL A HG12   1 
ATOM   3941  H HG13   . VAL A 1 239 ? 44.894  -35.380 103.862 1.00 36.16  ? 239 VAL A HG13   1 
ATOM   3942  H HG21   . VAL A 1 239 ? 43.671  -33.297 102.208 1.00 36.48  ? 239 VAL A HG21   1 
ATOM   3943  H HG22   . VAL A 1 239 ? 44.655  -34.380 101.589 1.00 36.48  ? 239 VAL A HG22   1 
ATOM   3944  H HG23   . VAL A 1 239 ? 43.204  -34.181 100.973 1.00 36.48  ? 239 VAL A HG23   1 
ATOM   3945  N N      . HIS A 1 240 ? 41.538  -37.795 103.302 1.00 25.27  ? 240 HIS A N      1 
ATOM   3946  C CA     . HIS A 1 240 ? 41.046  -38.838 104.174 1.00 28.19  ? 240 HIS A CA     1 
ATOM   3947  C C      . HIS A 1 240 ? 41.464  -40.239 103.702 1.00 34.86  ? 240 HIS A C      1 
ATOM   3948  O O      . HIS A 1 240 ? 41.822  -41.075 104.521 1.00 33.97  ? 240 HIS A O      1 
ATOM   3949  C CB     . HIS A 1 240 ? 39.532  -38.772 104.274 1.00 29.06  ? 240 HIS A CB     1 
ATOM   3950  C CG     . HIS A 1 240 ? 38.950  -39.902 105.054 1.00 32.89  ? 240 HIS A CG     1 
ATOM   3951  N ND1    . HIS A 1 240 ? 39.271  -40.142 106.372 1.00 33.74  ? 240 HIS A ND1    1 
ATOM   3952  C CD2    . HIS A 1 240 ? 38.110  -40.898 104.680 1.00 33.05  ? 240 HIS A CD2    1 
ATOM   3953  C CE1    . HIS A 1 240 ? 38.620  -41.215 106.789 1.00 36.14  ? 240 HIS A CE1    1 
ATOM   3954  N NE2    . HIS A 1 240 ? 37.912  -41.695 105.780 1.00 33.09  ? 240 HIS A NE2    1 
ATOM   3955  H H      . HIS A 1 240 ? 40.929  -37.304 102.946 1.00 30.48  ? 240 HIS A H      1 
ATOM   3956  H HA     . HIS A 1 240 ? 41.410  -38.702 105.063 1.00 34.22  ? 240 HIS A HA     1 
ATOM   3957  H HB2    . HIS A 1 240 ? 39.281  -37.945 104.714 1.00 35.26  ? 240 HIS A HB2    1 
ATOM   3958  H HB3    . HIS A 1 240 ? 39.156  -38.800 103.380 1.00 35.26  ? 240 HIS A HB3    1 
ATOM   3959  H HD1    . HIS A 1 240 ? 39.793  -39.657 106.854 1.00 40.88  ? 240 HIS A HD1    1 
ATOM   3960  H HD2    . HIS A 1 240 ? 37.724  -41.009 103.842 1.00 40.06  ? 240 HIS A HD2    1 
ATOM   3961  H HE1    . HIS A 1 240 ? 38.663  -41.578 107.644 1.00 43.76  ? 240 HIS A HE1    1 
ATOM   3962  H HE2    . HIS A 1 240 ? 37.410  -42.392 105.809 1.00 40.09  ? 240 HIS A HE2    1 
ATOM   3963  N N      . LEU A 1 241 ? 41.376  -40.501 102.395 1.00 38.84  ? 241 LEU A N      1 
ATOM   3964  C CA     . LEU A 1 241 ? 41.781  -41.795 101.819 1.00 42.01  ? 241 LEU A CA     1 
ATOM   3965  C C      . LEU A 1 241 ? 43.279  -42.077 101.915 1.00 45.48  ? 241 LEU A C      1 
ATOM   3966  O O      . LEU A 1 241 ? 43.678  -43.226 102.106 1.00 50.39  ? 241 LEU A O      1 
ATOM   3967  C CB     . LEU A 1 241 ? 41.363  -41.893 100.347 1.00 45.31  ? 241 LEU A CB     1 
ATOM   3968  C CG     . LEU A 1 241 ? 39.878  -42.124 100.039 1.00 45.05  ? 241 LEU A CG     1 
ATOM   3969  C CD1    . LEU A 1 241 ? 39.632  -42.023 98.545  1.00 40.55  ? 241 LEU A CD1    1 
ATOM   3970  C CD2    . LEU A 1 241 ? 39.416  -43.480 100.552 1.00 43.23  ? 241 LEU A CD2    1 
ATOM   3971  H H      . LEU A 1 241 ? 41.081  -39.942 101.812 1.00 47.00  ? 241 LEU A H      1 
ATOM   3972  H HA     . LEU A 1 241 ? 41.321  -42.501 102.299 1.00 50.80  ? 241 LEU A HA     1 
ATOM   3973  H HB2    . LEU A 1 241 ? 41.618  -41.066 99.908  1.00 54.77  ? 241 LEU A HB2    1 
ATOM   3974  H HB3    . LEU A 1 241 ? 41.853  -42.628 99.945  1.00 54.77  ? 241 LEU A HB3    1 
ATOM   3975  H HG     . LEU A 1 241 ? 39.351  -41.439 100.480 1.00 54.45  ? 241 LEU A HG     1 
ATOM   3976  H HD11   . LEU A 1 241 ? 38.690  -42.172 98.370  1.00 49.05  ? 241 LEU A HD11   1 
ATOM   3977  H HD12   . LEU A 1 241 ? 39.890  -41.138 98.243  1.00 49.05  ? 241 LEU A HD12   1 
ATOM   3978  H HD13   . LEU A 1 241 ? 40.164  -42.696 98.092  1.00 49.05  ? 241 LEU A HD13   1 
ATOM   3979  H HD21   . LEU A 1 241 ? 38.475  -43.593 100.341 1.00 52.27  ? 241 LEU A HD21   1 
ATOM   3980  H HD22   . LEU A 1 241 ? 39.937  -44.175 100.120 1.00 52.27  ? 241 LEU A HD22   1 
ATOM   3981  H HD23   . LEU A 1 241 ? 39.547  -43.515 101.512 1.00 52.27  ? 241 LEU A HD23   1 
ATOM   3982  N N      . CYS A 1 242 ? 44.107  -41.044 101.761 1.00 45.89  ? 242 CYS A N      1 
ATOM   3983  C CA     . CYS A 1 242 ? 45.564  -41.203 101.831 1.00 42.62  ? 242 CYS A CA     1 
ATOM   3984  C C      . CYS A 1 242 ? 46.017  -41.598 103.221 1.00 45.16  ? 242 CYS A C      1 
ATOM   3985  O O      . CYS A 1 242 ? 46.908  -42.423 103.388 1.00 47.91  ? 242 CYS A O      1 
ATOM   3986  C CB     . CYS A 1 242 ? 46.263  -39.919 101.413 1.00 39.86  ? 242 CYS A CB     1 
ATOM   3987  S SG     . CYS A 1 242 ? 46.210  -39.649 99.644  1.00 58.48  ? 242 CYS A SG     1 
ATOM   3988  H H      . CYS A 1 242 ? 43.851  -40.237 101.615 1.00 55.46  ? 242 CYS A H      1 
ATOM   3989  H HA     . CYS A 1 242 ? 45.835  -41.905 101.218 1.00 51.53  ? 242 CYS A HA     1 
ATOM   3990  H HB2    . CYS A 1 242 ? 45.828  -39.167 101.844 1.00 48.23  ? 242 CYS A HB2    1 
ATOM   3991  H HB3    . CYS A 1 242 ? 47.194  -39.963 101.682 1.00 48.23  ? 242 CYS A HB3    1 
ATOM   3992  H HG     . CYS A 1 242 ? 45.064  -39.581 99.293  1.00 70.57  ? 242 CYS A HG     1 
ATOM   3993  N N      . ARG A 1 243 ? 45.401  -40.979 104.217 1.00 45.53  ? 243 ARG A N      1 
ATOM   3994  C CA     . ARG A 1 243 ? 45.678  -41.278 105.609 1.00 44.65  ? 243 ARG A CA     1 
ATOM   3995  C C      . ARG A 1 243 ? 45.307  -42.705 105.976 1.00 49.48  ? 243 ARG A C      1 
ATOM   3996  O O      . ARG A 1 243 ? 46.059  -43.402 106.652 1.00 52.29  ? 243 ARG A O      1 
ATOM   3997  C CB     . ARG A 1 243 ? 44.900  -40.312 106.485 1.00 41.34  ? 243 ARG A CB     1 
ATOM   3998  C CG     . ARG A 1 243 ? 45.385  -38.894 106.445 1.00 37.85  ? 243 ARG A CG     1 
ATOM   3999  C CD     . ARG A 1 243 ? 44.410  -38.042 107.203 1.00 40.69  ? 243 ARG A CD     1 
ATOM   4000  N NE     . ARG A 1 243 ? 44.813  -36.646 107.271 1.00 47.39  ? 243 ARG A NE     1 
ATOM   4001  C CZ     . ARG A 1 243 ? 44.077  -35.692 107.832 1.00 52.50  ? 243 ARG A CZ     1 
ATOM   4002  N NH1    . ARG A 1 243 ? 42.876  -35.983 108.329 1.00 57.18  ? 243 ARG A NH1    1 
ATOM   4003  N NH2    . ARG A 1 243 ? 44.530  -34.445 107.873 1.00 51.56  ? 243 ARG A NH2    1 
ATOM   4004  H H      . ARG A 1 243 ? 44.806  -40.368 104.107 1.00 55.02  ? 243 ARG A H      1 
ATOM   4005  H HA     . ARG A 1 243 ? 46.624  -41.154 105.782 1.00 53.97  ? 243 ARG A HA     1 
ATOM   4006  H HB2    . ARG A 1 243 ? 43.974  -40.313 106.198 1.00 50.00  ? 243 ARG A HB2    1 
ATOM   4007  H HB3    . ARG A 1 243 ? 44.957  -40.615 107.404 1.00 50.00  ? 243 ARG A HB3    1 
ATOM   4008  H HG2    . ARG A 1 243 ? 46.255  -38.830 106.870 1.00 45.81  ? 243 ARG A HG2    1 
ATOM   4009  H HG3    . ARG A 1 243 ? 45.425  -38.584 105.527 1.00 45.81  ? 243 ARG A HG3    1 
ATOM   4010  H HD2    . ARG A 1 243 ? 43.547  -38.084 106.764 1.00 49.22  ? 243 ARG A HD2    1 
ATOM   4011  H HD3    . ARG A 1 243 ? 44.338  -38.378 108.111 1.00 49.22  ? 243 ARG A HD3    1 
ATOM   4012  H HE     . ARG A 1 243 ? 45.611  -36.445 107.023 1.00 57.26  ? 243 ARG A HE     1 
ATOM   4013  H HH11   . ARG A 1 243 ? 42.585  -36.792 108.306 1.00 69.01  ? 243 ARG A HH11   1 
ATOM   4014  H HH12   . ARG A 1 243 ? 42.397  -35.364 108.685 1.00 69.01  ? 243 ARG A HH12   1 
ATOM   4015  H HH21   . ARG A 1 243 ? 45.301  -34.256 107.543 1.00 62.26  ? 243 ARG A HH21   1 
ATOM   4016  H HH22   . ARG A 1 243 ? 44.047  -33.824 108.221 1.00 62.26  ? 243 ARG A HH22   1 
ATOM   4017  N N      . GLU A 1 244 ? 44.152  -43.139 105.490 1.00 54.08  ? 244 GLU A N      1 
ATOM   4018  C CA     . GLU A 1 244 ? 43.647  -44.475 105.760 1.00 57.38  ? 244 GLU A CA     1 
ATOM   4019  C C      . GLU A 1 244 ? 44.623  -45.473 105.172 1.00 54.67  ? 244 GLU A C      1 
ATOM   4020  O O      . GLU A 1 244 ? 44.996  -46.463 105.796 1.00 60.38  ? 244 GLU A O      1 
ATOM   4021  C CB     . GLU A 1 244 ? 42.258  -44.655 105.136 1.00 61.03  ? 244 GLU A CB     1 
ATOM   4022  C CG     . GLU A 1 244 ? 41.118  -43.935 105.852 1.00 66.53  ? 244 GLU A CG     1 
ATOM   4023  C CD     . GLU A 1 244 ? 39.775  -44.129 105.152 1.00 75.40  ? 244 GLU A CD     1 
ATOM   4024  O OE1    . GLU A 1 244 ? 39.764  -44.348 103.924 1.00 81.11  ? 244 GLU A OE1    1 
ATOM   4025  O OE2    . GLU A 1 244 ? 38.725  -44.066 105.816 1.00 75.89  ? 244 GLU A OE2    1 
ATOM   4026  H H      . GLU A 1 244 ? 43.633  -42.667 104.992 1.00 65.29  ? 244 GLU A H      1 
ATOM   4027  H HA     . GLU A 1 244 ? 43.585  -44.620 106.717 1.00 69.24  ? 244 GLU A HA     1 
ATOM   4028  H HB2    . GLU A 1 244 ? 42.286  -44.322 104.225 1.00 73.63  ? 244 GLU A HB2    1 
ATOM   4029  H HB3    . GLU A 1 244 ? 42.046  -45.601 105.128 1.00 73.63  ? 244 GLU A HB3    1 
ATOM   4030  H HG2    . GLU A 1 244 ? 41.040  -44.283 106.754 1.00 80.23  ? 244 GLU A HG2    1 
ATOM   4031  H HG3    . GLU A 1 244 ? 41.309  -42.984 105.878 1.00 80.23  ? 244 GLU A HG3    1 
ATOM   4032  N N      . PHE A 1 245 ? 45.069  -45.167 103.967 1.00 43.01  ? 245 PHE A N      1 
ATOM   4033  C CA     . PHE A 1 245 ? 45.932  -46.058 103.235 1.00 38.83  ? 245 PHE A CA     1 
ATOM   4034  C C      . PHE A 1 245 ? 47.261  -46.244 103.952 1.00 43.03  ? 245 PHE A C      1 
ATOM   4035  O O      . PHE A 1 245 ? 47.772  -47.350 104.052 1.00 41.35  ? 245 PHE A O      1 
ATOM   4036  C CB     . PHE A 1 245 ? 46.151  -45.495 101.828 1.00 37.05  ? 245 PHE A CB     1 
ATOM   4037  C CG     . PHE A 1 245 ? 46.898  -46.417 100.917 1.00 39.35  ? 245 PHE A CG     1 
ATOM   4038  C CD1    . PHE A 1 245 ? 46.289  -47.559 100.415 1.00 38.69  ? 245 PHE A CD1    1 
ATOM   4039  C CD2    . PHE A 1 245 ? 48.206  -46.146 100.562 1.00 35.43  ? 245 PHE A CD2    1 
ATOM   4040  C CE1    . PHE A 1 245 ? 46.973  -48.411 99.582  1.00 37.11  ? 245 PHE A CE1    1 
ATOM   4041  C CE2    . PHE A 1 245 ? 48.898  -46.996 99.725  1.00 33.75  ? 245 PHE A CE2    1 
ATOM   4042  C CZ     . PHE A 1 245 ? 48.280  -48.129 99.234  1.00 36.62  ? 245 PHE A CZ     1 
ATOM   4043  H H      . PHE A 1 245 ? 44.880  -44.439 103.550 1.00 52.00  ? 245 PHE A H      1 
ATOM   4044  H HA     . PHE A 1 245 ? 45.504  -46.925 103.154 1.00 46.99  ? 245 PHE A HA     1 
ATOM   4045  H HB2    . PHE A 1 245 ? 45.287  -45.316 101.425 1.00 44.85  ? 245 PHE A HB2    1 
ATOM   4046  H HB3    . PHE A 1 245 ? 46.658  -44.671 101.896 1.00 44.85  ? 245 PHE A HB3    1 
ATOM   4047  H HD1    . PHE A 1 245 ? 45.409  -47.751 100.649 1.00 46.81  ? 245 PHE A HD1    1 
ATOM   4048  H HD2    . PHE A 1 245 ? 48.625  -45.384 100.892 1.00 42.90  ? 245 PHE A HD2    1 
ATOM   4049  H HE1    . PHE A 1 245 ? 46.556  -49.174 99.251  1.00 44.92  ? 245 PHE A HE1    1 
ATOM   4050  H HE2    . PHE A 1 245 ? 49.778  -46.807 99.490  1.00 40.89  ? 245 PHE A HE2    1 
ATOM   4051  H HZ     . PHE A 1 245 ? 48.744  -48.703 98.669  1.00 44.33  ? 245 PHE A HZ     1 
ATOM   4052  N N      . MET A 1 246 ? 47.804  -45.162 104.487 1.00 52.28  ? 246 MET A N      1 
ATOM   4053  C CA     . MET A 1 246 ? 49.110  -45.221 105.130 1.00 62.16  ? 246 MET A CA     1 
ATOM   4054  C C      . MET A 1 246 ? 49.034  -45.902 106.487 1.00 67.28  ? 246 MET A C      1 
ATOM   4055  O O      . MET A 1 246 ? 50.002  -46.503 106.943 1.00 71.25  ? 246 MET A O      1 
ATOM   4056  C CB     . MET A 1 246 ? 49.689  -43.813 105.280 1.00 66.33  ? 246 MET A CB     1 
ATOM   4057  C CG     . MET A 1 246 ? 50.191  -43.193 103.969 1.00 67.40  ? 246 MET A CG     1 
ATOM   4058  S SD     . MET A 1 246 ? 51.611  -44.033 103.221 1.00 79.02  ? 246 MET A SD     1 
ATOM   4059  C CE     . MET A 1 246 ? 50.812  -44.984 101.946 1.00 66.90  ? 246 MET A CE     1 
ATOM   4060  H H      . MET A 1 246 ? 47.440  -44.383 104.492 1.00 63.12  ? 246 MET A H      1 
ATOM   4061  H HA     . MET A 1 246 ? 49.712  -45.727 104.563 1.00 74.98  ? 246 MET A HA     1 
ATOM   4062  H HB2    . MET A 1 246 ? 49.001  -43.231 105.638 1.00 79.99  ? 246 MET A HB2    1 
ATOM   4063  H HB3    . MET A 1 246 ? 50.438  -43.850 105.895 1.00 79.99  ? 246 MET A HB3    1 
ATOM   4064  H HG2    . MET A 1 246 ? 49.467  -43.209 103.323 1.00 81.27  ? 246 MET A HG2    1 
ATOM   4065  H HG3    . MET A 1 246 ? 50.451  -42.275 104.142 1.00 81.27  ? 246 MET A HG3    1 
ATOM   4066  H HE1    . MET A 1 246 ? 51.484  -45.490 101.463 1.00 80.67  ? 246 MET A HE1    1 
ATOM   4067  H HE2    . MET A 1 246 ? 50.174  -45.588 102.356 1.00 80.67  ? 246 MET A HE2    1 
ATOM   4068  H HE3    . MET A 1 246 ? 50.355  -44.379 101.342 1.00 80.67  ? 246 MET A HE3    1 
ATOM   4069  N N      . GLU A 1 247 ? 47.871  -45.825 107.120 1.00 66.50  ? 247 GLU A N      1 
ATOM   4070  C CA     . GLU A 1 247 ? 47.679  -46.438 108.422 1.00 66.07  ? 247 GLU A CA     1 
ATOM   4071  C C      . GLU A 1 247 ? 47.519  -47.937 108.242 1.00 61.22  ? 247 GLU A C      1 
ATOM   4072  O O      . GLU A 1 247 ? 48.088  -48.725 108.987 1.00 62.23  ? 247 GLU A O      1 
ATOM   4073  C CB     . GLU A 1 247 ? 46.444  -45.852 109.116 1.00 72.59  ? 247 GLU A CB     1 
ATOM   4074  C CG     . GLU A 1 247 ? 46.535  -44.365 109.521 1.00 80.02  ? 247 GLU A CG     1 
ATOM   4075  C CD     . GLU A 1 247 ? 47.273  -44.119 110.839 1.00 86.38  ? 247 GLU A CD     1 
ATOM   4076  O OE1    . GLU A 1 247 ? 46.815  -44.626 111.889 1.00 88.69  ? 247 GLU A OE1    1 
ATOM   4077  O OE2    . GLU A 1 247 ? 48.288  -43.389 110.832 1.00 86.10  ? 247 GLU A OE2    1 
ATOM   4078  H H      . GLU A 1 247 ? 47.176  -45.422 106.814 1.00 80.19  ? 247 GLU A H      1 
ATOM   4079  H HA     . GLU A 1 247 ? 48.456  -46.274 108.979 1.00 79.67  ? 247 GLU A HA     1 
ATOM   4080  H HB2    . GLU A 1 247 ? 45.686  -45.943 108.518 1.00 87.50  ? 247 GLU A HB2    1 
ATOM   4081  H HB3    . GLU A 1 247 ? 46.278  -46.362 109.925 1.00 87.50  ? 247 GLU A HB3    1 
ATOM   4082  H HG2    . GLU A 1 247 ? 47.006  -43.881 108.825 1.00 96.42  ? 247 GLU A HG2    1 
ATOM   4083  H HG3    . GLU A 1 247 ? 45.636  -44.013 109.615 1.00 96.42  ? 247 GLU A HG3    1 
ATOM   4084  N N      . ALA A 1 248 ? 46.707  -48.319 107.263 1.00 52.89  ? 248 ALA A N      1 
ATOM   4085  C CA     . ALA A 1 248 ? 46.435  -49.721 106.982 1.00 50.44  ? 248 ALA A CA     1 
ATOM   4086  C C      . ALA A 1 248 ? 46.256  -49.962 105.493 1.00 47.12  ? 248 ALA A C      1 
ATOM   4087  O O      . ALA A 1 248 ? 45.133  -50.139 105.025 1.00 45.46  ? 248 ALA A O      1 
ATOM   4088  C CB     . ALA A 1 248 ? 45.207  -50.169 107.738 1.00 51.47  ? 248 ALA A CB     1 
ATOM   4089  H H      . ALA A 1 248 ? 46.295  -47.775 106.739 1.00 63.86  ? 248 ALA A H      1 
ATOM   4090  H HA     . ALA A 1 248 ? 47.186  -50.255 107.285 1.00 60.91  ? 248 ALA A HA     1 
ATOM   4091  H HB1    . ALA A 1 248 ? 45.039  -51.104 107.541 1.00 62.16  ? 248 ALA A HB1    1 
ATOM   4092  H HB2    . ALA A 1 248 ? 45.362  -50.054 108.689 1.00 62.16  ? 248 ALA A HB2    1 
ATOM   4093  H HB3    . ALA A 1 248 ? 44.450  -49.631 107.458 1.00 62.16  ? 248 ALA A HB3    1 
ATOM   4094  N N      . PRO A 1 249 ? 47.354  -49.961 104.735 1.00 44.70  ? 249 PRO A N      1 
ATOM   4095  C CA     . PRO A 1 249 ? 47.219  -50.143 103.281 1.00 47.69  ? 249 PRO A CA     1 
ATOM   4096  C C      . PRO A 1 249 ? 46.689  -51.518 102.847 1.00 50.14  ? 249 PRO A C      1 
ATOM   4097  O O      . PRO A 1 249 ? 47.169  -52.540 103.339 1.00 52.03  ? 249 PRO A O      1 
ATOM   4098  C CB     . PRO A 1 249 ? 48.646  -49.920 102.763 1.00 44.96  ? 249 PRO A CB     1 
ATOM   4099  C CG     . PRO A 1 249 ? 49.536  -50.108 103.938 1.00 43.45  ? 249 PRO A CG     1 
ATOM   4100  C CD     . PRO A 1 249 ? 48.753  -49.829 105.173 1.00 41.76  ? 249 PRO A CD     1 
ATOM   4101  H HA     . PRO A 1 249 ? 46.641  -49.455 102.915 1.00 57.61  ? 249 PRO A HA     1 
ATOM   4102  H HB2    . PRO A 1 249 ? 48.848  -50.573 102.074 1.00 54.34  ? 249 PRO A HB2    1 
ATOM   4103  H HB3    . PRO A 1 249 ? 48.728  -49.019 102.413 1.00 54.34  ? 249 PRO A HB3    1 
ATOM   4104  H HG2    . PRO A 1 249 ? 49.859  -51.022 103.948 1.00 52.54  ? 249 PRO A HG2    1 
ATOM   4105  H HG3    . PRO A 1 249 ? 50.283  -49.492 103.872 1.00 52.54  ? 249 PRO A HG3    1 
ATOM   4106  H HD2    . PRO A 1 249 ? 48.956  -50.487 105.856 1.00 50.50  ? 249 PRO A HD2    1 
ATOM   4107  H HD3    . PRO A 1 249 ? 48.925  -48.927 105.485 1.00 50.50  ? 249 PRO A HD3    1 
ATOM   4108  N N      . SER A 1 250 ? 45.689  -51.532 101.961 1.00 50.80  ? 250 SER A N      1 
ATOM   4109  C CA     . SER A 1 250 ? 45.223  -52.780 101.336 1.00 50.04  ? 250 SER A CA     1 
ATOM   4110  C C      . SER A 1 250 ? 44.838  -52.573 99.866  1.00 47.84  ? 250 SER A C      1 
ATOM   4111  O O      . SER A 1 250 ? 44.620  -51.459 99.399  1.00 45.79  ? 250 SER A O      1 
ATOM   4112  C CB     . SER A 1 250 ? 44.018  -53.377 102.069 1.00 50.13  ? 250 SER A CB     1 
ATOM   4113  O OG     . SER A 1 250 ? 42.818  -52.730 101.680 1.00 51.06  ? 250 SER A OG     1 
ATOM   4114  H H      . SER A 1 250 ? 45.262  -50.832 101.702 1.00 61.35  ? 250 SER A H      1 
ATOM   4115  H HA     . SER A 1 250 ? 45.941  -53.432 101.366 1.00 60.44  ? 250 SER A HA     1 
ATOM   4116  H HB2    . SER A 1 250 ? 43.953  -54.320 101.854 1.00 60.54  ? 250 SER A HB2    1 
ATOM   4117  H HB3    . SER A 1 250 ? 44.142  -53.263 103.025 1.00 60.54  ? 250 SER A HB3    1 
ATOM   4118  H HG     . SER A 1 250 ? 42.861  -51.911 101.861 1.00 61.66  ? 250 SER A HG     1 
ATOM   4119  N N      . LEU A 1 251 ? 44.728  -53.686 99.159  1.00 50.15  ? 251 LEU A N      1 
ATOM   4120  C CA     . LEU A 1 251 ? 44.429  -53.687 97.746  1.00 47.51  ? 251 LEU A CA     1 
ATOM   4121  C C      . LEU A 1 251 ? 42.997  -53.237 97.532  1.00 46.44  ? 251 LEU A C      1 
ATOM   4122  O O      . LEU A 1 251 ? 42.604  -52.901 96.419  1.00 49.34  ? 251 LEU A O      1 
ATOM   4123  C CB     . LEU A 1 251 ? 44.674  -55.080 97.180  1.00 49.82  ? 251 LEU A CB     1 
ATOM   4124  C CG     . LEU A 1 251 ? 44.640  -55.303 95.678  1.00 48.71  ? 251 LEU A CG     1 
ATOM   4125  C CD1    . LEU A 1 251 ? 45.615  -54.404 94.957  1.00 48.65  ? 251 LEU A CD1    1 
ATOM   4126  C CD2    . LEU A 1 251 ? 45.011  -56.745 95.438  1.00 49.47  ? 251 LEU A CD2    1 
ATOM   4127  H H      . LEU A 1 251 ? 44.826  -54.474 99.489  1.00 60.58  ? 251 LEU A H      1 
ATOM   4128  H HA     . LEU A 1 251 ? 45.017  -53.064 97.291  1.00 57.40  ? 251 LEU A HA     1 
ATOM   4129  H HB2    . LEU A 1 251 ? 45.551  -55.366 97.481  1.00 60.17  ? 251 LEU A HB2    1 
ATOM   4130  H HB3    . LEU A 1 251 ? 44.006  -55.671 97.561  1.00 60.17  ? 251 LEU A HB3    1 
ATOM   4131  H HG     . LEU A 1 251 ? 43.746  -55.144 95.336  1.00 58.84  ? 251 LEU A HG     1 
ATOM   4132  H HD11   . LEU A 1 251 ? 45.560  -54.579 94.004  1.00 58.77  ? 251 LEU A HD11   1 
ATOM   4133  H HD12   . LEU A 1 251 ? 45.383  -53.479 95.137  1.00 58.77  ? 251 LEU A HD12   1 
ATOM   4134  H HD13   . LEU A 1 251 ? 46.511  -54.589 95.277  1.00 58.77  ? 251 LEU A HD13   1 
ATOM   4135  H HD21   . LEU A 1 251 ? 44.998  -56.919 94.483  1.00 59.76  ? 251 LEU A HD21   1 
ATOM   4136  H HD22   . LEU A 1 251 ? 45.900  -56.905 95.791  1.00 59.76  ? 251 LEU A HD22   1 
ATOM   4137  H HD23   . LEU A 1 251 ? 44.369  -57.315 95.887  1.00 59.76  ? 251 LEU A HD23   1 
ATOM   4138  N N      . GLY A 1 252 ? 42.205  -53.278 98.596  1.00 43.40  ? 252 GLY A N      1 
ATOM   4139  C CA     . GLY A 1 252 ? 40.826  -52.835 98.528  1.00 43.53  ? 252 GLY A CA     1 
ATOM   4140  C C      . GLY A 1 252 ? 40.741  -51.405 98.019  1.00 44.75  ? 252 GLY A C      1 
ATOM   4141  O O      . GLY A 1 252 ? 39.773  -51.019 97.357  1.00 45.81  ? 252 GLY A O      1 
ATOM   4142  H H      . GLY A 1 252 ? 42.446  -53.560 99.372  1.00 52.47  ? 252 GLY A H      1 
ATOM   4143  H HA2    . GLY A 1 252 ? 40.326  -53.410 97.928  1.00 52.63  ? 252 GLY A HA2    1 
ATOM   4144  H HA3    . GLY A 1 252 ? 40.424  -52.878 99.409  1.00 52.63  ? 252 GLY A HA3    1 
ATOM   4145  N N      . PHE A 1 253 ? 41.771  -50.618 98.320  1.00 46.38  ? 253 PHE A N      1 
ATOM   4146  C CA     . PHE A 1 253 ? 41.811  -49.207 97.935  1.00 44.80  ? 253 PHE A CA     1 
ATOM   4147  C C      . PHE A 1 253 ? 41.863  -48.999 96.426  1.00 43.11  ? 253 PHE A C      1 
ATOM   4148  O O      . PHE A 1 253 ? 41.576  -47.911 95.938  1.00 42.45  ? 253 PHE A O      1 
ATOM   4149  C CB     . PHE A 1 253 ? 43.005  -48.509 98.590  1.00 45.16  ? 253 PHE A CB     1 
ATOM   4150  C CG     . PHE A 1 253 ? 42.835  -48.277 100.062 1.00 43.62  ? 253 PHE A CG     1 
ATOM   4151  C CD1    . PHE A 1 253 ? 42.999  -49.310 100.969 1.00 44.77  ? 253 PHE A CD1    1 
ATOM   4152  C CD2    . PHE A 1 253 ? 42.496  -47.019 100.536 1.00 46.22  ? 253 PHE A CD2    1 
ATOM   4153  C CE1    . PHE A 1 253 ? 42.830  -49.097 102.336 1.00 47.93  ? 253 PHE A CE1    1 
ATOM   4154  C CE2    . PHE A 1 253 ? 42.324  -46.793 101.894 1.00 48.00  ? 253 PHE A CE2    1 
ATOM   4155  C CZ     . PHE A 1 253 ? 42.490  -47.835 102.800 1.00 47.82  ? 253 PHE A CZ     1 
ATOM   4156  H H      . PHE A 1 253 ? 42.468  -50.879 98.751  1.00 56.05  ? 253 PHE A H      1 
ATOM   4157  H HA     . PHE A 1 253 ? 41.005  -48.777 98.261  1.00 54.15  ? 253 PHE A HA     1 
ATOM   4158  H HB2    . PHE A 1 253 ? 43.795  -49.057 98.465  1.00 54.59  ? 253 PHE A HB2    1 
ATOM   4159  H HB3    . PHE A 1 253 ? 43.133  -47.646 98.166  1.00 54.59  ? 253 PHE A HB3    1 
ATOM   4160  H HD1    . PHE A 1 253 ? 43.224  -50.159 100.661 1.00 54.12  ? 253 PHE A HD1    1 
ATOM   4161  H HD2    . PHE A 1 253 ? 42.379  -46.318 99.936  1.00 55.86  ? 253 PHE A HD2    1 
ATOM   4162  H HE1    . PHE A 1 253 ? 42.945  -49.798 102.935 1.00 57.91  ? 253 PHE A HE1    1 
ATOM   4163  H HE2    . PHE A 1 253 ? 42.098  -45.943 102.199 1.00 57.99  ? 253 PHE A HE2    1 
ATOM   4164  H HZ     . PHE A 1 253 ? 42.380  -47.685 103.711 1.00 57.77  ? 253 PHE A HZ     1 
ATOM   4165  N N      . PHE A 1 254 ? 42.287  -50.025 95.699  1.00 44.41  ? 254 PHE A N      1 
ATOM   4166  C CA     . PHE A 1 254 ? 42.342  -49.974 94.243  1.00 46.35  ? 254 PHE A CA     1 
ATOM   4167  C C      . PHE A 1 254 ? 41.162  -50.651 93.534  1.00 49.50  ? 254 PHE A C      1 
ATOM   4168  O O      . PHE A 1 254 ? 41.047  -50.585 92.310  1.00 49.59  ? 254 PHE A O      1 
ATOM   4169  C CB     . PHE A 1 254 ? 43.644  -50.610 93.783  1.00 46.14  ? 254 PHE A CB     1 
ATOM   4170  C CG     . PHE A 1 254 ? 44.864  -49.927 94.318  1.00 45.17  ? 254 PHE A CG     1 
ATOM   4171  C CD1    . PHE A 1 254 ? 45.256  -50.112 95.628  1.00 46.51  ? 254 PHE A CD1    1 
ATOM   4172  C CD2    . PHE A 1 254 ? 45.618  -49.099 93.506  1.00 44.81  ? 254 PHE A CD2    1 
ATOM   4173  C CE1    . PHE A 1 254 ? 46.375  -49.492 96.114  1.00 46.93  ? 254 PHE A CE1    1 
ATOM   4174  C CE2    . PHE A 1 254 ? 46.734  -48.474 93.986  1.00 44.54  ? 254 PHE A CE2    1 
ATOM   4175  C CZ     . PHE A 1 254 ? 47.118  -48.672 95.291  1.00 46.84  ? 254 PHE A CZ     1 
ATOM   4176  H H      . PHE A 1 254 ? 42.551  -50.773 96.031  1.00 53.68  ? 254 PHE A H      1 
ATOM   4177  H HA     . PHE A 1 254 ? 42.355  -49.044 93.967  1.00 56.02  ? 254 PHE A HA     1 
ATOM   4178  H HB2    . PHE A 1 254 ? 43.664  -51.533 94.082  1.00 55.75  ? 254 PHE A HB2    1 
ATOM   4179  H HB3    . PHE A 1 254 ? 43.684  -50.576 92.815  1.00 55.75  ? 254 PHE A HB3    1 
ATOM   4180  H HD1    . PHE A 1 254 ? 44.759  -50.668 96.183  1.00 56.20  ? 254 PHE A HD1    1 
ATOM   4181  H HD2    . PHE A 1 254 ? 45.363  -48.967 92.621  1.00 54.17  ? 254 PHE A HD2    1 
ATOM   4182  H HE1    . PHE A 1 254 ? 46.633  -49.623 96.998  1.00 56.71  ? 254 PHE A HE1    1 
ATOM   4183  H HE2    . PHE A 1 254 ? 47.235  -47.921 93.430  1.00 53.84  ? 254 PHE A HE2    1 
ATOM   4184  H HZ     . PHE A 1 254 ? 47.876  -48.246 95.622  1.00 56.59  ? 254 PHE A HZ     1 
ATOM   4185  N N      . LYS A 1 255 ? 40.260  -51.249 94.304  1.00 50.61  ? 255 LYS A N      1 
ATOM   4186  C CA     . LYS A 1 255 ? 39.150  -52.006 93.731  1.00 51.31  ? 255 LYS A CA     1 
ATOM   4187  C C      . LYS A 1 255 ? 37.877  -51.182 93.783  1.00 51.10  ? 255 LYS A C      1 
ATOM   4188  O O      . LYS A 1 255 ? 37.489  -50.730 94.862  1.00 50.29  ? 255 LYS A O      1 
ATOM   4189  C CB     . LYS A 1 255 ? 38.942  -53.322 94.484  1.00 49.79  ? 255 LYS A CB     1 
ATOM   4190  C CG     . LYS A 1 255 ? 40.044  -54.341 94.294  1.00 46.09  ? 255 LYS A CG     1 
ATOM   4191  C CD     . LYS A 1 255 ? 39.786  -55.588 95.125  1.00 49.08  ? 255 LYS A CD     1 
ATOM   4192  C CE     . LYS A 1 255 ? 40.798  -56.691 94.821  1.00 55.39  ? 255 LYS A CE     1 
ATOM   4193  N NZ     . LYS A 1 255 ? 40.767  -57.826 95.804  1.00 55.00  ? 255 LYS A NZ     1 
ATOM   4194  H H      . LYS A 1 255 ? 40.266  -51.232 95.164  1.00 61.12  ? 255 LYS A H      1 
ATOM   4195  H HA     . LYS A 1 255 ? 39.344  -52.211 92.803  1.00 61.97  ? 255 LYS A HA     1 
ATOM   4196  H HB2    . LYS A 1 255 ? 38.880  -53.129 95.432  1.00 60.14  ? 255 LYS A HB2    1 
ATOM   4197  H HB3    . LYS A 1 255 ? 38.114  -53.725 94.179  1.00 60.14  ? 255 LYS A HB3    1 
ATOM   4198  H HG2    . LYS A 1 255 ? 40.086  -54.600 93.361  1.00 55.69  ? 255 LYS A HG2    1 
ATOM   4199  H HG3    . LYS A 1 255 ? 40.889  -53.957 94.576  1.00 55.69  ? 255 LYS A HG3    1 
ATOM   4200  H HD2    . LYS A 1 255 ? 39.854  -55.364 96.066  1.00 59.29  ? 255 LYS A HD2    1 
ATOM   4201  H HD3    . LYS A 1 255 ? 38.899  -55.926 94.924  1.00 59.29  ? 255 LYS A HD3    1 
ATOM   4202  H HE2    . LYS A 1 255 ? 40.610  -57.054 93.942  1.00 66.86  ? 255 LYS A HE2    1 
ATOM   4203  H HE3    . LYS A 1 255 ? 41.690  -56.309 94.836  1.00 66.86  ? 255 LYS A HE3    1 
ATOM   4204  H HZ1    . LYS A 1 255 ? 41.374  -58.438 95.581  1.00 66.39  ? 255 LYS A HZ1    1 
ATOM   4205  H HZ2    . LYS A 1 255 ? 40.947  -57.525 96.622  1.00 66.39  ? 255 LYS A HZ2    1 
ATOM   4206  H HZ3    . LYS A 1 255 ? 39.962  -58.204 95.806  1.00 66.39  ? 255 LYS A HZ3    1 
ATOM   4207  N N      . PRO A 1 256 ? 37.207  -51.008 92.625  1.00 50.69  ? 256 PRO A N      1 
ATOM   4208  C CA     . PRO A 1 256 ? 35.924  -50.286 92.586  1.00 47.78  ? 256 PRO A CA     1 
ATOM   4209  C C      . PRO A 1 256 ? 34.908  -50.842 93.568  1.00 49.86  ? 256 PRO A C      1 
ATOM   4210  O O      . PRO A 1 256 ? 34.841  -52.047 93.783  1.00 48.13  ? 256 PRO A O      1 
ATOM   4211  C CB     . PRO A 1 256 ? 35.457  -50.467 91.137  1.00 45.35  ? 256 PRO A CB     1 
ATOM   4212  C CG     . PRO A 1 256 ? 36.723  -50.656 90.365  1.00 46.67  ? 256 PRO A CG     1 
ATOM   4213  C CD     . PRO A 1 256 ? 37.647  -51.416 91.276  1.00 47.92  ? 256 PRO A CD     1 
ATOM   4214  H HA     . PRO A 1 256 ? 36.062  -49.343 92.764  1.00 57.73  ? 256 PRO A HA     1 
ATOM   4215  H HB2    . PRO A 1 256 ? 34.890  -51.251 91.068  1.00 54.81  ? 256 PRO A HB2    1 
ATOM   4216  H HB3    . PRO A 1 256 ? 34.987  -49.672 90.840  1.00 54.81  ? 256 PRO A HB3    1 
ATOM   4217  H HG2    . PRO A 1 256 ? 36.541  -51.166 89.561  1.00 56.40  ? 256 PRO A HG2    1 
ATOM   4218  H HG3    . PRO A 1 256 ? 37.100  -49.790 90.143  1.00 56.40  ? 256 PRO A HG3    1 
ATOM   4219  H HD2    . PRO A 1 256 ? 37.529  -52.371 91.156  1.00 57.90  ? 256 PRO A HD2    1 
ATOM   4220  H HD3    . PRO A 1 256 ? 38.567  -51.149 91.124  1.00 57.90  ? 256 PRO A HD3    1 
ATOM   4221  N N      . LYS A 1 257 ? 34.157  -49.938 94.189  1.00 64.06  ? 257 LYS A N      1 
ATOM   4222  C CA     . LYS A 1 257 ? 33.265  -50.289 95.286  1.00 78.41  ? 257 LYS A CA     1 
ATOM   4223  C C      . LYS A 1 257 ? 31.899  -50.798 94.837  1.00 91.73  ? 257 LYS A C      1 
ATOM   4224  O O      . LYS A 1 257 ? 31.458  -50.543 93.714  1.00 86.59  ? 257 LYS A O      1 
ATOM   4225  C CB     . LYS A 1 257 ? 33.056  -49.061 96.181  1.00 77.87  ? 257 LYS A CB     1 
ATOM   4226  C CG     . LYS A 1 257 ? 34.337  -48.403 96.678  1.00 78.51  ? 257 LYS A CG     1 
ATOM   4227  C CD     . LYS A 1 257 ? 35.206  -49.357 97.472  1.00 78.52  ? 257 LYS A CD     1 
ATOM   4228  C CE     . LYS A 1 257 ? 36.512  -48.702 97.891  1.00 76.11  ? 257 LYS A CE     1 
ATOM   4229  N NZ     . LYS A 1 257 ? 37.338  -48.275 96.731  1.00 73.06  ? 257 LYS A NZ     1 
ATOM   4230  H H      . LYS A 1 257 ? 34.147  -49.101 93.989  1.00 77.26  ? 257 LYS A H      1 
ATOM   4231  H HA     . LYS A 1 257 ? 33.682  -50.983 95.821  1.00 94.48  ? 257 LYS A HA     1 
ATOM   4232  H HB2    . LYS A 1 257 ? 32.560  -48.395 95.679  1.00 93.84  ? 257 LYS A HB2    1 
ATOM   4233  H HB3    . LYS A 1 257 ? 32.543  -49.331 96.959  1.00 93.84  ? 257 LYS A HB3    1 
ATOM   4234  H HG2    . LYS A 1 257 ? 34.850  -48.091 95.916  1.00 94.60  ? 257 LYS A HG2    1 
ATOM   4235  H HG3    . LYS A 1 257 ? 34.108  -47.656 97.253  1.00 94.60  ? 257 LYS A HG3    1 
ATOM   4236  H HD2    . LYS A 1 257 ? 34.733  -49.631 98.273  1.00 94.62  ? 257 LYS A HD2    1 
ATOM   4237  H HD3    . LYS A 1 257 ? 35.416  -50.130 96.924  1.00 94.62  ? 257 LYS A HD3    1 
ATOM   4238  H HE2    . LYS A 1 257 ? 36.315  -47.917 98.424  1.00 91.72  ? 257 LYS A HE2    1 
ATOM   4239  H HE3    . LYS A 1 257 ? 37.031  -49.336 98.411  1.00 91.72  ? 257 LYS A HE3    1 
ATOM   4240  H HZ1    . LYS A 1 257 ? 38.092  -47.897 97.017  1.00 88.07  ? 257 LYS A HZ1    1 
ATOM   4241  H HZ2    . LYS A 1 257 ? 37.541  -48.979 96.226  1.00 88.07  ? 257 LYS A HZ2    1 
ATOM   4242  H HZ3    . LYS A 1 257 ? 36.888  -47.685 96.238  1.00 88.07  ? 257 LYS A HZ3    1 
ATOM   4243  N N      . HIS A 1 258 ? 31.243  -51.527 95.736  1.00 111.33 ? 258 HIS A N      1 
ATOM   4244  C CA     . HIS A 1 258 ? 29.880  -51.996 95.522  1.00 121.91 ? 258 HIS A CA     1 
ATOM   4245  C C      . HIS A 1 258 ? 28.929  -50.804 95.616  1.00 120.32 ? 258 HIS A C      1 
ATOM   4246  O O      . HIS A 1 258 ? 29.173  -49.882 96.395  1.00 122.69 ? 258 HIS A O      1 
ATOM   4247  C CB     . HIS A 1 258 ? 29.484  -53.067 96.545  1.00 127.64 ? 258 HIS A CB     1 
ATOM   4248  C CG     . HIS A 1 258 ? 30.076  -54.418 96.281  1.00 130.33 ? 258 HIS A CG     1 
ATOM   4249  N ND1    . HIS A 1 258 ? 30.248  -54.925 95.010  1.00 130.88 ? 258 HIS A ND1    1 
ATOM   4250  C CD2    . HIS A 1 258 ? 30.517  -55.379 97.129  1.00 130.64 ? 258 HIS A CD2    1 
ATOM   4251  C CE1    . HIS A 1 258 ? 30.776  -56.133 95.085  1.00 130.86 ? 258 HIS A CE1    1 
ATOM   4252  N NE2    . HIS A 1 258 ? 30.951  -56.433 96.360  1.00 131.00 ? 258 HIS A NE2    1 
ATOM   4253  H H      . HIS A 1 258 ? 31.574  -51.766 96.493  1.00 133.99 ? 258 HIS A H      1 
ATOM   4254  H HA     . HIS A 1 258 ? 29.806  -52.378 94.634  1.00 146.68 ? 258 HIS A HA     1 
ATOM   4255  H HB2    . HIS A 1 258 ? 29.780  -52.782 97.424  1.00 153.56 ? 258 HIS A HB2    1 
ATOM   4256  H HB3    . HIS A 1 258 ? 28.519  -53.161 96.539  1.00 153.56 ? 258 HIS A HB3    1 
ATOM   4257  H HD1    . HIS A 1 258 ? 30.045  -54.516 94.281  1.00 157.45 ? 258 HIS A HD1    1 
ATOM   4258  H HD2    . HIS A 1 258 ? 30.529  -55.332 98.057  1.00 157.16 ? 258 HIS A HD2    1 
ATOM   4259  H HE1    . HIS A 1 258 ? 30.991  -56.679 94.364  1.00 157.42 ? 258 HIS A HE1    1 
ATOM   4260  H HE2    . HIS A 1 258 ? 31.282  -57.168 96.660  1.00 157.59 ? 258 HIS A HE2    1 
ATOM   4261  N N      . PRO A 1 259 ? 27.845  -50.810 94.829  1.00 112.80 ? 259 PRO A N      1 
ATOM   4262  C CA     . PRO A 1 259 ? 26.837  -49.749 94.971  1.00 107.87 ? 259 PRO A CA     1 
ATOM   4263  C C      . PRO A 1 259 ? 26.122  -49.752 96.336  1.00 104.28 ? 259 PRO A C      1 
ATOM   4264  O O      . PRO A 1 259 ? 25.531  -48.741 96.718  1.00 102.63 ? 259 PRO A O      1 
ATOM   4265  C CB     . PRO A 1 259 ? 25.850  -50.048 93.836  1.00 107.28 ? 259 PRO A CB     1 
ATOM   4266  C CG     . PRO A 1 259 ? 26.622  -50.861 92.859  1.00 107.15 ? 259 PRO A CG     1 
ATOM   4267  C CD     . PRO A 1 259 ? 27.574  -51.673 93.666  1.00 108.01 ? 259 PRO A CD     1 
ATOM   4268  H HA     . PRO A 1 259 ? 27.241  -48.879 94.823  1.00 129.83 ? 259 PRO A HA     1 
ATOM   4269  H HB2    . PRO A 1 259 ? 25.096  -50.551 94.182  1.00 129.12 ? 259 PRO A HB2    1 
ATOM   4270  H HB3    . PRO A 1 259 ? 25.553  -49.217 93.433  1.00 129.12 ? 259 PRO A HB3    1 
ATOM   4271  H HG2    . PRO A 1 259 ? 26.016  -51.436 92.366  1.00 128.98 ? 259 PRO A HG2    1 
ATOM   4272  H HG3    . PRO A 1 259 ? 27.102  -50.273 92.255  1.00 128.98 ? 259 PRO A HG3    1 
ATOM   4273  H HD2    . PRO A 1 259 ? 27.158  -52.502 93.948  1.00 130.01 ? 259 PRO A HD2    1 
ATOM   4274  H HD3    . PRO A 1 259 ? 28.390  -51.835 93.166  1.00 130.01 ? 259 PRO A HD3    1 
ATOM   4275  N N      . LEU A 1 260 ? 26.201  -50.865 97.060  1.00 102.17 ? 260 LEU A N      1 
ATOM   4276  C CA     . LEU A 1 260 ? 25.408  -51.086 98.274  1.00 101.77 ? 260 LEU A CA     1 
ATOM   4277  C C      . LEU A 1 260 ? 23.920  -50.927 97.994  1.00 102.79 ? 260 LEU A C      1 
ATOM   4278  O O      . LEU A 1 260 ? 23.275  -49.978 98.444  1.00 97.76  ? 260 LEU A O      1 
ATOM   4279  C CB     . LEU A 1 260 ? 25.826  -50.119 99.392  1.00 98.62  ? 260 LEU A CB     1 
ATOM   4280  C CG     . LEU A 1 260 ? 25.132  -50.293 100.754 1.00 94.04  ? 260 LEU A CG     1 
ATOM   4281  C CD1    . LEU A 1 260 ? 25.445  -51.636 101.384 1.00 92.74  ? 260 LEU A CD1    1 
ATOM   4282  C CD2    . LEU A 1 260 ? 25.523  -49.171 101.690 1.00 91.35  ? 260 LEU A CD2    1 
ATOM   4283  H H      . LEU A 1 260 ? 26.719  -51.524 96.866  1.00 123.00 ? 260 LEU A H      1 
ATOM   4284  H HA     . LEU A 1 260 ? 25.559  -51.991 98.589  1.00 122.52 ? 260 LEU A HA     1 
ATOM   4285  H HB2    . LEU A 1 260 ? 26.779  -50.222 99.541  1.00 118.73 ? 260 LEU A HB2    1 
ATOM   4286  H HB3    . LEU A 1 260 ? 25.646  -49.214 99.092  1.00 118.73 ? 260 LEU A HB3    1 
ATOM   4287  H HG     . LEU A 1 260 ? 24.173  -50.246 100.621 1.00 113.24 ? 260 LEU A HG     1 
ATOM   4288  H HD11   . LEU A 1 260 ? 24.987  -51.699 102.237 1.00 111.68 ? 260 LEU A HD11   1 
ATOM   4289  H HD12   . LEU A 1 260 ? 25.140  -52.341 100.792 1.00 111.68 ? 260 LEU A HD12   1 
ATOM   4290  H HD13   . LEU A 1 260 ? 26.403  -51.707 101.517 1.00 111.68 ? 260 LEU A HD13   1 
ATOM   4291  H HD21   . LEU A 1 260 ? 25.075  -49.300 102.541 1.00 110.01 ? 260 LEU A HD21   1 
ATOM   4292  H HD22   . LEU A 1 260 ? 26.484  -49.185 101.816 1.00 110.01 ? 260 LEU A HD22   1 
ATOM   4293  H HD23   . LEU A 1 260 ? 25.253  -48.325 101.298 1.00 110.01 ? 260 LEU A HD23   1 
ATOM   4294  N N      . GLU A 1 261 ? 23.394  -51.867 97.216  1.00 110.58 ? 261 GLU A N      1 
ATOM   4295  C CA     . GLU A 1 261 ? 21.966  -51.964 96.980  1.00 113.14 ? 261 GLU A CA     1 
ATOM   4296  C C      . GLU A 1 261 ? 21.327  -52.674 98.174  1.00 108.12 ? 261 GLU A C      1 
ATOM   4297  O O      . GLU A 1 261 ? 21.767  -53.763 98.557  1.00 112.67 ? 261 GLU A O      1 
ATOM   4298  C CB     . GLU A 1 261 ? 21.690  -52.711 95.675  1.00 117.90 ? 261 GLU A CB     1 
ATOM   4299  C CG     . GLU A 1 261 ? 22.363  -52.083 94.449  1.00 118.07 ? 261 GLU A CG     1 
ATOM   4300  C CD     . GLU A 1 261 ? 21.794  -50.726 94.066  1.00 117.03 ? 261 GLU A CD     1 
ATOM   4301  O OE1    . GLU A 1 261 ? 20.744  -50.331 94.612  1.00 116.88 ? 261 GLU A OE1    1 
ATOM   4302  O OE2    . GLU A 1 261 ? 22.412  -50.045 93.219  1.00 115.56 ? 261 GLU A OE2    1 
ATOM   4303  H H      . GLU A 1 261 ? 23.854  -52.468 96.808  1.00 133.09 ? 261 GLU A H      1 
ATOM   4304  H HA     . GLU A 1 261 ? 21.587  -51.074 96.912  1.00 136.16 ? 261 GLU A HA     1 
ATOM   4305  H HB2    . GLU A 1 261 ? 22.017  -53.620 95.760  1.00 141.87 ? 261 GLU A HB2    1 
ATOM   4306  H HB3    . GLU A 1 261 ? 20.733  -52.719 95.516  1.00 141.87 ? 261 GLU A HB3    1 
ATOM   4307  H HG2    . GLU A 1 261 ? 23.307  -51.967 94.636  1.00 142.08 ? 261 GLU A HG2    1 
ATOM   4308  H HG3    . GLU A 1 261 ? 22.248  -52.677 93.690  1.00 142.08 ? 261 GLU A HG3    1 
ATOM   4309  N N      . ILE A 1 262 ? 20.301  -52.057 98.756  1.00 92.55  ? 262 ILE A N      1 
ATOM   4310  C CA     . ILE A 1 262 ? 19.606  -52.609 99.922  1.00 79.80  ? 262 ILE A CA     1 
ATOM   4311  C C      . ILE A 1 262 ? 18.153  -52.972 99.599  1.00 79.87  ? 262 ILE A C      1 
ATOM   4312  O O      . ILE A 1 262 ? 17.537  -52.356 98.729  1.00 79.48  ? 262 ILE A O      1 
ATOM   4313  C CB     . ILE A 1 262 ? 19.641  -51.629 101.093 1.00 71.11  ? 262 ILE A CB     1 
ATOM   4314  C CG1    . ILE A 1 262 ? 19.268  -52.341 102.388 1.00 71.41  ? 262 ILE A CG1    1 
ATOM   4315  C CG2    . ILE A 1 262 ? 18.734  -50.435 100.824 1.00 70.19  ? 262 ILE A CG2    1 
ATOM   4316  C CD1    . ILE A 1 262 ? 19.502  -51.487 103.618 1.00 70.81  ? 262 ILE A CD1    1 
ATOM   4317  H H      . ILE A 1 262 ? 19.983  -51.304 98.491  1.00 111.46 ? 262 ILE A H      1 
ATOM   4318  H HA     . ILE A 1 262 ? 20.059  -53.421 100.200 1.00 96.15  ? 262 ILE A HA     1 
ATOM   4319  H HB     . ILE A 1 262 ? 20.549  -51.300 101.183 1.00 85.72  ? 262 ILE A HB     1 
ATOM   4320  H HG12   . ILE A 1 262 ? 18.327  -52.575 102.360 1.00 86.08  ? 262 ILE A HG12   1 
ATOM   4321  H HG13   . ILE A 1 262 ? 19.806  -53.143 102.474 1.00 86.08  ? 262 ILE A HG13   1 
ATOM   4322  H HG21   . ILE A 1 262 ? 18.775  -49.831 101.582 1.00 84.62  ? 262 ILE A HG21   1 
ATOM   4323  H HG22   . ILE A 1 262 ? 19.037  -49.983 100.022 1.00 84.62  ? 262 ILE A HG22   1 
ATOM   4324  H HG23   . ILE A 1 262 ? 17.825  -50.751 100.702 1.00 84.62  ? 262 ILE A HG23   1 
ATOM   4325  H HD11   . ILE A 1 262 ? 19.248  -51.992 104.406 1.00 85.36  ? 262 ILE A HD11   1 
ATOM   4326  H HD12   . ILE A 1 262 ? 20.442  -51.252 103.665 1.00 85.36  ? 262 ILE A HD12   1 
ATOM   4327  H HD13   . ILE A 1 262 ? 18.963  -50.683 103.551 1.00 85.36  ? 262 ILE A HD13   1 
ATOM   4328  N N      . GLU A 1 263 ? 17.614  -53.975 100.283 1.00 83.99  ? 263 GLU A N      1 
ATOM   4329  C CA     . GLU A 1 263 ? 16.228  -54.388 100.059 1.00 87.27  ? 263 GLU A CA     1 
ATOM   4330  C C      . GLU A 1 263 ? 15.285  -53.318 100.622 1.00 76.10  ? 263 GLU A C      1 
ATOM   4331  O O      . GLU A 1 263 ? 15.617  -52.669 101.611 1.00 81.37  ? 263 GLU A O      1 
ATOM   4332  C CB     . GLU A 1 263 ? 15.962  -55.750 100.707 1.00 98.21  ? 263 GLU A CB     1 
ATOM   4333  C CG     . GLU A 1 263 ? 16.212  -55.797 102.210 1.00 104.66 ? 263 GLU A CG     1 
ATOM   4334  C CD     . GLU A 1 263 ? 17.665  -56.080 102.564 1.00 108.56 ? 263 GLU A CD     1 
ATOM   4335  O OE1    . GLU A 1 263 ? 17.916  -56.685 103.629 1.00 110.69 ? 263 GLU A OE1    1 
ATOM   4336  O OE2    . GLU A 1 263 ? 18.560  -55.682 101.786 1.00 108.06 ? 263 GLU A OE2    1 
ATOM   4337  H H      . GLU A 1 263 ? 18.026  -54.433 100.883 1.00 101.18 ? 263 GLU A H      1 
ATOM   4338  H HA     . GLU A 1 263 ? 16.066  -54.467 99.106  1.00 105.11 ? 263 GLU A HA     1 
ATOM   4339  H HB2    . GLU A 1 263 ? 15.035  -55.990 100.556 1.00 118.25 ? 263 GLU A HB2    1 
ATOM   4340  H HB3    . GLU A 1 263 ? 16.541  -56.409 100.292 1.00 118.25 ? 263 GLU A HB3    1 
ATOM   4341  H HG2    . GLU A 1 263 ? 15.972  -54.940 102.597 1.00 125.99 ? 263 GLU A HG2    1 
ATOM   4342  H HG3    . GLU A 1 263 ? 15.667  -56.500 102.598 1.00 125.99 ? 263 GLU A HG3    1 
ATOM   4343  N N      . PRO A 1 264 ? 14.118  -53.112 99.983  1.00 54.16  ? 264 PRO A N      1 
ATOM   4344  C CA     . PRO A 1 264 ? 13.183  -52.047 100.376 1.00 47.02  ? 264 PRO A CA     1 
ATOM   4345  C C      . PRO A 1 264 ? 12.513  -52.248 101.739 1.00 51.71  ? 264 PRO A C      1 
ATOM   4346  O O      . PRO A 1 264 ? 11.995  -51.280 102.298 1.00 52.81  ? 264 PRO A O      1 
ATOM   4347  C CB     . PRO A 1 264 ? 12.131  -52.072 99.265  1.00 41.78  ? 264 PRO A CB     1 
ATOM   4348  C CG     . PRO A 1 264 ? 12.160  -53.454 98.755  1.00 44.74  ? 264 PRO A CG     1 
ATOM   4349  C CD     . PRO A 1 264 ? 13.588  -53.911 98.869  1.00 49.09  ? 264 PRO A CD     1 
ATOM   4350  H HA     . PRO A 1 264 ? 13.633  -51.188 100.368 1.00 56.81  ? 264 PRO A HA     1 
ATOM   4351  H HB2    . PRO A 1 264 ? 11.259  -51.859 99.634  1.00 50.52  ? 264 PRO A HB2    1 
ATOM   4352  H HB3    . PRO A 1 264 ? 12.374  -51.442 98.569  1.00 50.52  ? 264 PRO A HB3    1 
ATOM   4353  H HG2    . PRO A 1 264 ? 11.581  -54.012 99.298  1.00 54.08  ? 264 PRO A HG2    1 
ATOM   4354  H HG3    . PRO A 1 264 ? 11.872  -53.464 97.829  1.00 54.08  ? 264 PRO A HG3    1 
ATOM   4355  H HD2    . PRO A 1 264 ? 13.625  -54.856 99.084  1.00 59.30  ? 264 PRO A HD2    1 
ATOM   4356  H HD3    . PRO A 1 264 ? 14.072  -53.713 98.051  1.00 59.30  ? 264 PRO A HD3    1 
ATOM   4357  N N      . GLU A 1 265 ? 12.504  -53.474 102.259 1.00 59.73  ? 265 GLU A N      1 
ATOM   4358  C CA     . GLU A 1 265 ? 11.920  -53.735 103.577 1.00 65.60  ? 265 GLU A CA     1 
ATOM   4359  C C      . GLU A 1 265 ? 12.861  -53.240 104.662 1.00 65.62  ? 265 GLU A C      1 
ATOM   4360  O O      . GLU A 1 265 ? 12.498  -52.376 105.450 1.00 62.39  ? 265 GLU A O      1 
ATOM   4361  C CB     . GLU A 1 265 ? 11.611  -55.216 103.771 1.00 72.73  ? 265 GLU A CB     1 
ATOM   4362  C CG     . GLU A 1 265 ? 11.080  -55.552 105.167 1.00 83.22  ? 265 GLU A CG     1 
ATOM   4363  C CD     . GLU A 1 265 ? 9.765   -54.857 105.499 1.00 89.59  ? 265 GLU A CD     1 
ATOM   4364  O OE1    . GLU A 1 265 ? 9.459   -54.719 106.703 1.00 88.29  ? 265 GLU A OE1    1 
ATOM   4365  O OE2    . GLU A 1 265 ? 9.031   -54.466 104.563 1.00 92.60  ? 265 GLU A OE2    1 
ATOM   4366  H H      . GLU A 1 265 ? 12.828  -54.170 101.872 1.00 72.07  ? 265 GLU A H      1 
ATOM   4367  H HA     . GLU A 1 265 ? 11.088  -53.243 103.656 1.00 79.11  ? 265 GLU A HA     1 
ATOM   4368  H HB2    . GLU A 1 265 ? 10.938  -55.483 103.125 1.00 87.66  ? 265 GLU A HB2    1 
ATOM   4369  H HB3    . GLU A 1 265 ? 12.423  -55.727 103.630 1.00 87.66  ? 265 GLU A HB3    1 
ATOM   4370  H HG2    . GLU A 1 265 ? 10.934  -56.509 105.225 1.00 100.25 ? 265 GLU A HG2    1 
ATOM   4371  H HG3    . GLU A 1 265 ? 11.737  -55.279 105.826 1.00 100.25 ? 265 GLU A HG3    1 
ATOM   4372  N N      . ARG A 1 266 ? 14.054  -53.825 104.724 1.00 69.42  ? 266 ARG A N      1 
ATOM   4373  C CA     . ARG A 1 266 ? 15.064  -53.401 105.686 1.00 67.03  ? 266 ARG A CA     1 
ATOM   4374  C C      . ARG A 1 266 ? 15.217  -51.909 105.556 1.00 63.92  ? 266 ARG A C      1 
ATOM   4375  O O      . ARG A 1 266 ? 15.402  -51.201 106.543 1.00 69.32  ? 266 ARG A O      1 
ATOM   4376  C CB     . ARG A 1 266 ? 16.406  -54.086 105.425 1.00 65.37  ? 266 ARG A CB     1 
ATOM   4377  C CG     . ARG A 1 266 ? 17.566  -53.578 106.275 1.00 66.95  ? 266 ARG A CG     1 
ATOM   4378  C CD     . ARG A 1 266 ? 18.885  -54.178 105.794 1.00 73.64  ? 266 ARG A CD     1 
ATOM   4379  N NE     . ARG A 1 266 ? 20.052  -53.446 106.288 1.00 77.15  ? 266 ARG A NE     1 
ATOM   4380  C CZ     . ARG A 1 266 ? 21.246  -53.440 105.694 1.00 78.91  ? 266 ARG A CZ     1 
ATOM   4381  N NH1    . ARG A 1 266 ? 21.446  -54.112 104.566 1.00 76.54  ? 266 ARG A NH1    1 
ATOM   4382  N NH2    . ARG A 1 266 ? 22.245  -52.749 106.222 1.00 79.71  ? 266 ARG A NH2    1 
ATOM   4383  H H      . ARG A 1 266 ? 14.303  -54.474 104.217 1.00 83.69  ? 266 ARG A H      1 
ATOM   4384  H HA     . ARG A 1 266 ? 14.772  -53.610 106.587 1.00 80.83  ? 266 ARG A HA     1 
ATOM   4385  H HB2    . ARG A 1 266 ? 16.308  -55.035 105.602 1.00 78.84  ? 266 ARG A HB2    1 
ATOM   4386  H HB3    . ARG A 1 266 ? 16.645  -53.952 104.495 1.00 78.84  ? 266 ARG A HB3    1 
ATOM   4387  H HG2    . ARG A 1 266 ? 17.623  -52.612 106.200 1.00 80.73  ? 266 ARG A HG2    1 
ATOM   4388  H HG3    . ARG A 1 266 ? 17.429  -53.839 107.199 1.00 80.73  ? 266 ARG A HG3    1 
ATOM   4389  H HD2    . ARG A 1 266 ? 18.949  -55.093 106.109 1.00 88.76  ? 266 ARG A HD2    1 
ATOM   4390  H HD3    . ARG A 1 266 ? 18.906  -54.158 104.825 1.00 88.76  ? 266 ARG A HD3    1 
ATOM   4391  H HE     . ARG A 1 266 ? 19.962  -52.988 107.011 1.00 92.97  ? 266 ARG A HE     1 
ATOM   4392  H HH11   . ARG A 1 266 ? 20.804  -54.564 104.215 1.00 92.24  ? 266 ARG A HH11   1 
ATOM   4393  H HH12   . ARG A 1 266 ? 22.219  -54.099 104.190 1.00 92.24  ? 266 ARG A HH12   1 
ATOM   4394  H HH21   . ARG A 1 266 ? 22.126  -52.308 106.950 1.00 96.05  ? 266 ARG A HH21   1 
ATOM   4395  H HH22   . ARG A 1 266 ? 23.014  -52.741 105.835 1.00 96.05  ? 266 ARG A HH22   1 
ATOM   4396  N N      . LEU A 1 267 ? 15.127  -51.432 104.322 1.00 53.14  ? 267 LEU A N      1 
ATOM   4397  C CA     . LEU A 1 267 ? 15.212  -50.013 104.073 1.00 43.49  ? 267 LEU A CA     1 
ATOM   4398  C C      . LEU A 1 267 ? 13.993  -49.331 104.688 1.00 39.87  ? 267 LEU A C      1 
ATOM   4399  O O      . LEU A 1 267 ? 14.089  -48.208 105.175 1.00 39.12  ? 267 LEU A O      1 
ATOM   4400  C CB     . LEU A 1 267 ? 15.323  -49.736 102.579 1.00 43.82  ? 267 LEU A CB     1 
ATOM   4401  C CG     . LEU A 1 267 ? 15.575  -48.294 102.153 1.00 41.90  ? 267 LEU A CG     1 
ATOM   4402  C CD1    . LEU A 1 267 ? 16.773  -47.713 102.897 1.00 41.02  ? 267 LEU A CD1    1 
ATOM   4403  C CD2    . LEU A 1 267 ? 15.801  -48.237 100.649 1.00 40.89  ? 267 LEU A CD2    1 
ATOM   4404  H H      . LEU A 1 267 ? 15.016  -51.912 103.617 1.00 64.15  ? 267 LEU A H      1 
ATOM   4405  H HA     . LEU A 1 267 ? 16.006  -49.661 104.506 1.00 52.57  ? 267 LEU A HA     1 
ATOM   4406  H HB2    . LEU A 1 267 ? 16.054  -50.269 102.228 1.00 52.97  ? 267 LEU A HB2    1 
ATOM   4407  H HB3    . LEU A 1 267 ? 14.495  -50.017 102.159 1.00 52.97  ? 267 LEU A HB3    1 
ATOM   4408  H HG     . LEU A 1 267 ? 14.796  -47.757 102.364 1.00 50.67  ? 267 LEU A HG     1 
ATOM   4409  H HD11   . LEU A 1 267 ? 16.911  -46.798 102.607 1.00 49.62  ? 267 LEU A HD11   1 
ATOM   4410  H HD12   . LEU A 1 267 ? 16.594  -47.736 103.850 1.00 49.62  ? 267 LEU A HD12   1 
ATOM   4411  H HD13   . LEU A 1 267 ? 17.558  -48.246 102.695 1.00 49.62  ? 267 LEU A HD13   1 
ATOM   4412  H HD21   . LEU A 1 267 ? 15.960  -47.317 100.389 1.00 49.46  ? 267 LEU A HD21   1 
ATOM   4413  H HD22   . LEU A 1 267 ? 16.571  -48.783 100.425 1.00 49.46  ? 267 LEU A HD22   1 
ATOM   4414  H HD23   . LEU A 1 267 ? 15.012  -48.577 100.199 1.00 49.46  ? 267 LEU A HD23   1 
ATOM   4415  N N      . ARG A 1 268 ? 12.852  -50.016 104.701 1.00 41.87  ? 268 ARG A N      1 
ATOM   4416  C CA     . ARG A 1 268 ? 11.663  -49.446 105.316 1.00 45.48  ? 268 ARG A CA     1 
ATOM   4417  C C      . ARG A 1 268 ? 11.880  -49.317 106.816 1.00 45.92  ? 268 ARG A C      1 
ATOM   4418  O O      . ARG A 1 268 ? 11.438  -48.346 107.412 1.00 49.87  ? 268 ARG A O      1 
ATOM   4419  C CB     . ARG A 1 268 ? 10.419  -50.297 105.043 1.00 52.63  ? 268 ARG A CB     1 
ATOM   4420  C CG     . ARG A 1 268 ? 9.154   -49.729 105.672 1.00 60.69  ? 268 ARG A CG     1 
ATOM   4421  C CD     . ARG A 1 268 ? 8.042   -50.750 105.780 1.00 66.64  ? 268 ARG A CD     1 
ATOM   4422  N NE     . ARG A 1 268 ? 8.416   -51.923 106.573 1.00 70.79  ? 268 ARG A NE     1 
ATOM   4423  C CZ     . ARG A 1 268 ? 8.321   -52.000 107.902 1.00 68.16  ? 268 ARG A CZ     1 
ATOM   4424  N NH1    . ARG A 1 268 ? 7.872   -50.969 108.607 1.00 65.37  ? 268 ARG A NH1    1 
ATOM   4425  N NH2    . ARG A 1 268 ? 8.674   -53.113 108.538 1.00 65.56  ? 268 ARG A NH2    1 
ATOM   4426  H H      . ARG A 1 268 ? 12.743  -50.800 104.364 1.00 50.64  ? 268 ARG A H      1 
ATOM   4427  H HA     . ARG A 1 268 ? 11.509  -48.560 104.954 1.00 54.97  ? 268 ARG A HA     1 
ATOM   4428  H HB2    . ARG A 1 268 ? 10.278  -50.350 104.085 1.00 63.55  ? 268 ARG A HB2    1 
ATOM   4429  H HB3    . ARG A 1 268 ? 10.560  -51.186 105.406 1.00 63.55  ? 268 ARG A HB3    1 
ATOM   4430  H HG2    . ARG A 1 268 ? 9.360   -49.414 106.566 1.00 73.22  ? 268 ARG A HG2    1 
ATOM   4431  H HG3    . ARG A 1 268 ? 8.833   -48.994 105.127 1.00 73.22  ? 268 ARG A HG3    1 
ATOM   4432  H HD2    . ARG A 1 268 ? 7.274   -50.335 106.204 1.00 80.36  ? 268 ARG A HD2    1 
ATOM   4433  H HD3    . ARG A 1 268 ? 7.806   -51.053 104.890 1.00 80.36  ? 268 ARG A HD3    1 
ATOM   4434  H HE     . ARG A 1 268 ? 8.717   -52.610 106.153 1.00 85.34  ? 268 ARG A HE     1 
ATOM   4435  H HH11   . ARG A 1 268 ? 7.638   -50.244 108.207 1.00 78.84  ? 268 ARG A HH11   1 
ATOM   4436  H HH12   . ARG A 1 268 ? 7.815   -51.025 109.463 1.00 78.84  ? 268 ARG A HH12   1 
ATOM   4437  H HH21   . ARG A 1 268 ? 8.968   -53.788 108.093 1.00 79.06  ? 268 ARG A HH21   1 
ATOM   4438  H HH22   . ARG A 1 268 ? 8.615   -53.156 109.395 1.00 79.06  ? 268 ARG A HH22   1 
ATOM   4439  N N      . LYS A 1 269 ? 12.539  -50.299 107.427 1.00 44.94  ? 269 LYS A N      1 
ATOM   4440  C CA     . LYS A 1 269 ? 12.812  -50.262 108.866 1.00 45.87  ? 269 LYS A CA     1 
ATOM   4441  C C      . LYS A 1 269 ? 13.776  -49.136 109.276 1.00 47.10  ? 269 LYS A C      1 
ATOM   4442  O O      . LYS A 1 269 ? 13.601  -48.515 110.326 1.00 50.85  ? 269 LYS A O      1 
ATOM   4443  C CB     . LYS A 1 269 ? 13.395  -51.595 109.350 1.00 50.77  ? 269 LYS A CB     1 
ATOM   4444  C CG     . LYS A 1 269 ? 12.413  -52.751 109.463 1.00 54.55  ? 269 LYS A CG     1 
ATOM   4445  C CD     . LYS A 1 269 ? 13.100  -53.956 110.104 1.00 58.56  ? 269 LYS A CD     1 
ATOM   4446  C CE     . LYS A 1 269 ? 12.125  -55.057 110.504 1.00 60.21  ? 269 LYS A CE     1 
ATOM   4447  N NZ     . LYS A 1 269 ? 11.583  -55.793 109.316 1.00 62.73  ? 269 LYS A NZ     1 
ATOM   4448  H H      . LYS A 1 269 ? 12.840  -51.000 107.031 1.00 54.32  ? 269 LYS A H      1 
ATOM   4449  H HA     . LYS A 1 269 ? 11.976  -50.119 109.336 1.00 55.44  ? 269 LYS A HA     1 
ATOM   4450  H HB2    . LYS A 1 269 ? 14.091  -51.867 108.731 1.00 61.31  ? 269 LYS A HB2    1 
ATOM   4451  H HB3    . LYS A 1 269 ? 13.782  -51.458 110.229 1.00 61.31  ? 269 LYS A HB3    1 
ATOM   4452  H HG2    . LYS A 1 269 ? 11.664  -52.489 110.022 1.00 65.85  ? 269 LYS A HG2    1 
ATOM   4453  H HG3    . LYS A 1 269 ? 12.106  -53.005 108.579 1.00 65.85  ? 269 LYS A HG3    1 
ATOM   4454  H HD2    . LYS A 1 269 ? 13.732  -54.332 109.471 1.00 70.67  ? 269 LYS A HD2    1 
ATOM   4455  H HD3    . LYS A 1 269 ? 13.566  -53.664 110.903 1.00 70.67  ? 269 LYS A HD3    1 
ATOM   4456  H HE2    . LYS A 1 269 ? 12.582  -55.696 111.073 1.00 72.64  ? 269 LYS A HE2    1 
ATOM   4457  H HE3    . LYS A 1 269 ? 11.378  -54.662 110.981 1.00 72.64  ? 269 LYS A HE3    1 
ATOM   4458  H HZ1    . LYS A 1 269 ? 11.019  -56.427 109.583 1.00 75.67  ? 269 LYS A HZ1    1 
ATOM   4459  H HZ2    . LYS A 1 269 ? 11.152  -55.229 108.780 1.00 75.67  ? 269 LYS A HZ2    1 
ATOM   4460  H HZ3    . LYS A 1 269 ? 12.250  -56.171 108.864 1.00 75.67  ? 269 LYS A HZ3    1 
ATOM   4461  N N      . ILE A 1 270 ? 14.799  -48.882 108.460 1.00 46.44  ? 270 ILE A N      1 
ATOM   4462  C CA     . ILE A 1 270 ? 15.774  -47.825 108.755 1.00 40.78  ? 270 ILE A CA     1 
ATOM   4463  C C      . ILE A 1 270 ? 15.134  -46.445 108.782 1.00 38.56  ? 270 ILE A C      1 
ATOM   4464  O O      . ILE A 1 270 ? 15.255  -45.716 109.764 1.00 41.64  ? 270 ILE A O      1 
ATOM   4465  C CB     . ILE A 1 270 ? 16.935  -47.800 107.710 1.00 37.97  ? 270 ILE A CB     1 
ATOM   4466  C CG1    . ILE A 1 270 ? 17.852  -49.010 107.890 1.00 36.99  ? 270 ILE A CG1    1 
ATOM   4467  C CG2    . ILE A 1 270 ? 17.769  -46.518 107.832 1.00 38.18  ? 270 ILE A CG2    1 
ATOM   4468  C CD1    . ILE A 1 270 ? 18.889  -49.177 106.799 1.00 37.28  ? 270 ILE A CD1    1 
ATOM   4469  H H      . ILE A 1 270 ? 14.953  -49.307 107.728 1.00 56.11  ? 270 ILE A H      1 
ATOM   4470  H HA     . ILE A 1 270 ? 16.161  -47.991 109.628 1.00 49.32  ? 270 ILE A HA     1 
ATOM   4471  H HB     . ILE A 1 270 ? 16.550  -47.835 106.821 1.00 45.96  ? 270 ILE A HB     1 
ATOM   4472  H HG12   . ILE A 1 270 ? 18.324  -48.919 108.733 1.00 44.78  ? 270 ILE A HG12   1 
ATOM   4473  H HG13   . ILE A 1 270 ? 17.308  -49.812 107.904 1.00 44.78  ? 270 ILE A HG13   1 
ATOM   4474  H HG21   . ILE A 1 270 ? 18.478  -46.539 107.170 1.00 46.21  ? 270 ILE A HG21   1 
ATOM   4475  H HG22   . ILE A 1 270 ? 17.194  -45.752 107.678 1.00 46.21  ? 270 ILE A HG22   1 
ATOM   4476  H HG23   . ILE A 1 270 ? 18.150  -46.473 108.723 1.00 46.21  ? 270 ILE A HG23   1 
ATOM   4477  H HD11   . ILE A 1 270 ? 19.425  -49.963 106.991 1.00 45.13  ? 270 ILE A HD11   1 
ATOM   4478  H HD12   . ILE A 1 270 ? 18.437  -49.283 105.948 1.00 45.13  ? 270 ILE A HD12   1 
ATOM   4479  H HD13   . ILE A 1 270 ? 19.454  -48.388 106.778 1.00 45.13  ? 270 ILE A HD13   1 
ATOM   4480  N N      . VAL A 1 271 ? 14.414  -46.110 107.718 1.00 34.70  ? 271 VAL A N      1 
ATOM   4481  C CA     . VAL A 1 271 ? 13.796  -44.797 107.609 1.00 35.46  ? 271 VAL A CA     1 
ATOM   4482  C C      . VAL A 1 271 ? 12.798  -44.576 108.730 1.00 38.57  ? 271 VAL A C      1 
ATOM   4483  O O      . VAL A 1 271 ? 12.604  -43.444 109.181 1.00 41.81  ? 271 VAL A O      1 
ATOM   4484  C CB     . VAL A 1 271 ? 13.086  -44.619 106.249 1.00 35.65  ? 271 VAL A CB     1 
ATOM   4485  C CG1    . VAL A 1 271 ? 12.234  -43.354 106.238 1.00 35.72  ? 271 VAL A CG1    1 
ATOM   4486  C CG2    . VAL A 1 271 ? 14.107  -44.566 105.136 1.00 33.82  ? 271 VAL A CG2    1 
ATOM   4487  H H      . VAL A 1 271 ? 14.267  -46.626 107.046 1.00 42.03  ? 271 VAL A H      1 
ATOM   4488  H HA     . VAL A 1 271 ? 14.484  -44.117 107.681 1.00 42.95  ? 271 VAL A HA     1 
ATOM   4489  H HB     . VAL A 1 271 ? 12.504  -45.378 106.091 1.00 43.17  ? 271 VAL A HB     1 
ATOM   4490  H HG11   . VAL A 1 271 ? 11.803  -43.272 105.373 1.00 43.26  ? 271 VAL A HG11   1 
ATOM   4491  H HG12   . VAL A 1 271 ? 11.564  -43.419 106.937 1.00 43.26  ? 271 VAL A HG12   1 
ATOM   4492  H HG13   . VAL A 1 271 ? 12.805  -42.587 106.398 1.00 43.26  ? 271 VAL A HG13   1 
ATOM   4493  H HG21   . VAL A 1 271 ? 13.646  -44.454 104.290 1.00 40.97  ? 271 VAL A HG21   1 
ATOM   4494  H HG22   . VAL A 1 271 ? 14.704  -43.817 105.290 1.00 40.97  ? 271 VAL A HG22   1 
ATOM   4495  H HG23   . VAL A 1 271 ? 14.611  -45.395 105.131 1.00 40.97  ? 271 VAL A HG23   1 
ATOM   4496  N N      . GLU A 1 272 ? 12.181  -45.654 109.197 1.00 42.29  ? 272 GLU A N      1 
ATOM   4497  C CA     . GLU A 1 272 ? 11.223  -45.537 110.281 1.00 46.97  ? 272 GLU A CA     1 
ATOM   4498  C C      . GLU A 1 272 ? 11.940  -45.416 111.632 1.00 45.22  ? 272 GLU A C      1 
ATOM   4499  O O      . GLU A 1 272 ? 11.482  -44.662 112.493 1.00 47.61  ? 272 GLU A O      1 
ATOM   4500  C CB     . GLU A 1 272 ? 10.240  -46.717 110.235 1.00 51.70  ? 272 GLU A CB     1 
ATOM   4501  C CG     . GLU A 1 272 ? 9.221   -46.529 109.079 1.00 65.06  ? 272 GLU A CG     1 
ATOM   4502  C CD     . GLU A 1 272 ? 8.241   -47.681 108.883 1.00 72.44  ? 272 GLU A CD     1 
ATOM   4503  O OE1    . GLU A 1 272 ? 7.418   -47.605 107.934 1.00 70.39  ? 272 GLU A OE1    1 
ATOM   4504  O OE2    . GLU A 1 272 ? 8.307   -48.663 109.653 1.00 76.23  ? 272 GLU A OE2    1 
ATOM   4505  H H      . GLU A 1 272 ? 12.299  -46.455 108.907 1.00 51.14  ? 272 GLU A H      1 
ATOM   4506  H HA     . GLU A 1 272 ? 10.709  -44.724 110.151 1.00 56.76  ? 272 GLU A HA     1 
ATOM   4507  H HB2    . GLU A 1 272 ? 10.730  -47.540 110.082 1.00 62.43  ? 272 GLU A HB2    1 
ATOM   4508  H HB3    . GLU A 1 272 ? 9.752   -46.763 111.071 1.00 62.43  ? 272 GLU A HB3    1 
ATOM   4509  H HG2    . GLU A 1 272 ? 8.700   -45.730 109.255 1.00 78.46  ? 272 GLU A HG2    1 
ATOM   4510  H HG3    . GLU A 1 272 ? 9.712   -46.420 108.250 1.00 78.46  ? 272 GLU A HG3    1 
ATOM   4511  N N      . GLU A 1 273 ? 13.074  -46.100 111.807 1.00 41.69  ? 273 GLU A N      1 
ATOM   4512  C CA     . GLU A 1 273 ? 13.884  -45.910 113.018 1.00 43.82  ? 273 GLU A CA     1 
ATOM   4513  C C      . GLU A 1 273 ? 14.468  -44.501 113.126 1.00 46.49  ? 273 GLU A C      1 
ATOM   4514  O O      . GLU A 1 273 ? 14.523  -43.937 114.221 1.00 49.09  ? 273 GLU A O      1 
ATOM   4515  C CB     . GLU A 1 273 ? 15.022  -46.920 113.127 1.00 52.14  ? 273 GLU A CB     1 
ATOM   4516  C CG     . GLU A 1 273 ? 14.592  -48.274 113.678 1.00 66.01  ? 273 GLU A CG     1 
ATOM   4517  C CD     . GLU A 1 273 ? 15.773  -49.211 113.939 1.00 71.72  ? 273 GLU A CD     1 
ATOM   4518  O OE1    . GLU A 1 273 ? 16.936  -48.745 113.859 1.00 70.69  ? 273 GLU A OE1    1 
ATOM   4519  O OE2    . GLU A 1 273 ? 15.536  -50.398 114.265 1.00 70.59  ? 273 GLU A OE2    1 
ATOM   4520  H H      . GLU A 1 273 ? 13.394  -46.672 111.250 1.00 50.42  ? 273 GLU A H      1 
ATOM   4521  H HA     . GLU A 1 273 ? 13.310  -46.042 113.788 1.00 52.98  ? 273 GLU A HA     1 
ATOM   4522  H HB2    . GLU A 1 273 ? 15.397  -47.065 112.244 1.00 62.96  ? 273 GLU A HB2    1 
ATOM   4523  H HB3    . GLU A 1 273 ? 15.702  -46.562 113.718 1.00 62.96  ? 273 GLU A HB3    1 
ATOM   4524  H HG2    . GLU A 1 273 ? 14.124  -48.139 114.517 1.00 79.60  ? 273 GLU A HG2    1 
ATOM   4525  H HG3    . GLU A 1 273 ? 14.004  -48.704 113.037 1.00 79.60  ? 273 GLU A HG3    1 
ATOM   4526  N N      . ARG A 1 274 ? 14.955  -43.964 112.009 1.00 44.29  ? 274 ARG A N      1 
ATOM   4527  C CA     . ARG A 1 274 ? 15.421  -42.577 111.957 1.00 42.62  ? 274 ARG A CA     1 
ATOM   4528  C C      . ARG A 1 274 ? 14.273  -41.609 112.233 1.00 47.55  ? 274 ARG A C      1 
ATOM   4529  O O      . ARG A 1 274 ? 14.477  -40.522 112.778 1.00 46.44  ? 274 ARG A O      1 
ATOM   4530  C CB     . ARG A 1 274 ? 16.000  -42.242 110.584 1.00 41.24  ? 274 ARG A CB     1 
ATOM   4531  C CG     . ARG A 1 274 ? 17.228  -42.991 110.168 1.00 37.10  ? 274 ARG A CG     1 
ATOM   4532  C CD     . ARG A 1 274 ? 17.497  -42.723 108.703 1.00 33.30  ? 274 ARG A CD     1 
ATOM   4533  N NE     . ARG A 1 274 ? 18.917  -42.534 108.431 1.00 37.13  ? 274 ARG A NE     1 
ATOM   4534  C CZ     . ARG A 1 274 ? 19.552  -41.369 108.478 1.00 36.91  ? 274 ARG A CZ     1 
ATOM   4535  N NH1    . ARG A 1 274 ? 18.896  -40.257 108.756 1.00 39.53  ? 274 ARG A NH1    1 
ATOM   4536  N NH2    . ARG A 1 274 ? 20.846  -41.307 108.210 1.00 35.35  ? 274 ARG A NH2    1 
ATOM   4537  H H      . ARG A 1 274 ? 15.028  -44.384 111.262 1.00 53.54  ? 274 ARG A H      1 
ATOM   4538  H HA     . ARG A 1 274 ? 16.110  -42.440 112.625 1.00 51.54  ? 274 ARG A HA     1 
ATOM   4539  H HB2    . ARG A 1 274 ? 15.318  -42.418 109.917 1.00 49.87  ? 274 ARG A HB2    1 
ATOM   4540  H HB3    . ARG A 1 274 ? 16.223  -41.298 110.573 1.00 49.87  ? 274 ARG A HB3    1 
ATOM   4541  H HG2    . ARG A 1 274 ? 17.989  -42.686 110.686 1.00 44.91  ? 274 ARG A HG2    1 
ATOM   4542  H HG3    . ARG A 1 274 ? 17.089  -43.943 110.290 1.00 44.91  ? 274 ARG A HG3    1 
ATOM   4543  H HD2    . ARG A 1 274 ? 17.187  -43.479 108.180 1.00 40.35  ? 274 ARG A HD2    1 
ATOM   4544  H HD3    . ARG A 1 274 ? 17.028  -41.917 108.436 1.00 40.35  ? 274 ARG A HD3    1 
ATOM   4545  H HE     . ARG A 1 274 ? 19.378  -43.230 108.223 1.00 44.94  ? 274 ARG A HE     1 
ATOM   4546  H HH11   . ARG A 1 274 ? 18.054  -40.286 108.929 1.00 47.83  ? 274 ARG A HH11   1 
ATOM   4547  H HH12   . ARG A 1 274 ? 19.314  -39.506 108.780 1.00 47.83  ? 274 ARG A HH12   1 
ATOM   4548  H HH21   . ARG A 1 274 ? 21.281  -42.024 108.022 1.00 42.81  ? 274 ARG A HH21   1 
ATOM   4549  H HH22   . ARG A 1 274 ? 21.254  -40.550 108.234 1.00 42.81  ? 274 ARG A HH22   1 
ATOM   4550  N N      . GLY A 1 275 ? 13.064  -42.012 111.846 1.00 52.68  ? 275 GLY A N      1 
ATOM   4551  C CA     . GLY A 1 275 ? 11.885  -41.189 112.035 1.00 51.36  ? 275 GLY A CA     1 
ATOM   4552  C C      . GLY A 1 275 ? 11.940  -39.889 111.254 1.00 46.57  ? 275 GLY A C      1 
ATOM   4553  O O      . GLY A 1 275 ? 11.324  -38.900 111.649 1.00 45.72  ? 275 GLY A O      1 
ATOM   4554  H H      . GLY A 1 275 ? 12.905  -42.767 111.467 1.00 63.61  ? 275 GLY A H      1 
ATOM   4555  H HA2    . GLY A 1 275 ? 11.100  -41.683 111.751 1.00 62.02  ? 275 GLY A HA2    1 
ATOM   4556  H HA3    . GLY A 1 275 ? 11.789  -40.977 112.976 1.00 62.02  ? 275 GLY A HA3    1 
ATOM   4557  N N      . THR A 1 276 ? 12.675  -39.891 110.144 1.00 40.95  ? 276 THR A N      1 
ATOM   4558  C CA     . THR A 1 276 ? 12.828  -38.698 109.320 1.00 36.39  ? 276 THR A CA     1 
ATOM   4559  C C      . THR A 1 276 ? 11.771  -38.711 108.242 1.00 39.49  ? 276 THR A C      1 
ATOM   4560  O O      . THR A 1 276 ? 11.028  -39.680 108.114 1.00 42.93  ? 276 THR A O      1 
ATOM   4561  C CB     . THR A 1 276 ? 14.186  -38.643 108.635 1.00 34.34  ? 276 THR A CB     1 
ATOM   4562  O OG1    . THR A 1 276 ? 14.335  -39.806 107.812 1.00 31.91  ? 276 THR A OG1    1 
ATOM   4563  C CG2    . THR A 1 276 ? 15.299  -38.572 109.657 1.00 33.84  ? 276 THR A CG2    1 
ATOM   4564  H H      . THR A 1 276 ? 13.099  -40.577 109.846 1.00 49.53  ? 276 THR A H      1 
ATOM   4565  H HA     . THR A 1 276 ? 12.715  -37.902 109.863 1.00 44.05  ? 276 THR A HA     1 
ATOM   4566  H HB     . THR A 1 276 ? 14.233  -37.849 108.080 1.00 41.59  ? 276 THR A HB     1 
ATOM   4567  H HG1    . THR A 1 276 ? 15.081  -39.791 107.426 1.00 38.68  ? 276 THR A HG1    1 
ATOM   4568  H HG21   . THR A 1 276 ? 16.158  -38.537 109.209 1.00 41.00  ? 276 THR A HG21   1 
ATOM   4569  H HG22   . THR A 1 276 ? 15.196  -37.778 110.204 1.00 41.00  ? 276 THR A HG22   1 
ATOM   4570  H HG23   . THR A 1 276 ? 15.273  -39.355 110.229 1.00 41.00  ? 276 THR A HG23   1 
ATOM   4571  N N      . ALA A 1 277 ? 11.743  -37.668 107.427 1.00 35.16  ? 277 ALA A N      1 
ATOM   4572  C CA     . ALA A 1 277 ? 10.858  -37.641 106.275 1.00 34.62  ? 277 ALA A CA     1 
ATOM   4573  C C      . ALA A 1 277 ? 11.683  -37.908 105.046 1.00 33.07  ? 277 ALA A C      1 
ATOM   4574  O O      . ALA A 1 277 ? 12.512  -37.087 104.706 1.00 36.28  ? 277 ALA A O      1 
ATOM   4575  C CB     . ALA A 1 277 ? 10.163  -36.299 106.164 1.00 36.36  ? 277 ALA A CB     1 
ATOM   4576  H H      . ALA A 1 277 ? 12.227  -36.963 107.520 1.00 42.59  ? 277 ALA A H      1 
ATOM   4577  H HA     . ALA A 1 277 ? 10.187  -38.335 106.358 1.00 41.94  ? 277 ALA A HA     1 
ATOM   4578  H HB1    . ALA A 1 277 ? 9.580   -36.308 105.388 1.00 44.03  ? 277 ALA A HB1    1 
ATOM   4579  H HB2    . ALA A 1 277 ? 9.642   -36.146 106.968 1.00 44.03  ? 277 ALA A HB2    1 
ATOM   4580  H HB3    . ALA A 1 277 ? 10.832  -35.604 106.066 1.00 44.03  ? 277 ALA A HB3    1 
ATOM   4581  N N      . VAL A 1 278 ? 11.514  -39.061 104.411 1.00 35.31  ? 278 VAL A N      1 
ATOM   4582  C CA     . VAL A 1 278 ? 12.293  -39.368 103.201 1.00 36.99  ? 278 VAL A CA     1 
ATOM   4583  C C      . VAL A 1 278 ? 11.428  -39.334 101.944 1.00 35.77  ? 278 VAL A C      1 
ATOM   4584  O O      . VAL A 1 278 ? 10.562  -40.208 101.764 1.00 35.97  ? 278 VAL A O      1 
ATOM   4585  C CB     . VAL A 1 278 ? 12.954  -40.752 103.298 1.00 36.82  ? 278 VAL A CB     1 
ATOM   4586  C CG1    . VAL A 1 278 ? 13.932  -40.957 102.157 1.00 35.13  ? 278 VAL A CG1    1 
ATOM   4587  C CG2    . VAL A 1 278 ? 13.665  -40.883 104.618 1.00 38.30  ? 278 VAL A CG2    1 
ATOM   4588  H H      . VAL A 1 278 ? 10.965  -39.678 104.651 1.00 42.76  ? 278 VAL A H      1 
ATOM   4589  H HA     . VAL A 1 278 ? 12.995  -38.706 103.100 1.00 44.78  ? 278 VAL A HA     1 
ATOM   4590  H HB     . VAL A 1 278 ? 12.273  -41.440 103.247 1.00 44.57  ? 278 VAL A HB     1 
ATOM   4591  H HG11   . VAL A 1 278 ? 14.335  -41.835 102.242 1.00 42.54  ? 278 VAL A HG11   1 
ATOM   4592  H HG12   . VAL A 1 278 ? 13.453  -40.892 101.316 1.00 42.54  ? 278 VAL A HG12   1 
ATOM   4593  H HG13   . VAL A 1 278 ? 14.617  -40.272 102.202 1.00 42.54  ? 278 VAL A HG13   1 
ATOM   4594  H HG21   . VAL A 1 278 ? 14.078  -41.760 104.668 1.00 46.35  ? 278 VAL A HG21   1 
ATOM   4595  H HG22   . VAL A 1 278 ? 14.343  -40.193 104.681 1.00 46.35  ? 278 VAL A HG22   1 
ATOM   4596  H HG23   . VAL A 1 278 ? 13.020  -40.780 105.335 1.00 46.35  ? 278 VAL A HG23   1 
ATOM   4597  N N      . PHE A 1 279 ? 11.715  -38.379 101.051 1.00 32.06  ? 279 PHE A N      1 
ATOM   4598  C CA     . PHE A 1 279 ? 10.928  -38.189 99.822  1.00 32.91  ? 279 PHE A CA     1 
ATOM   4599  C C      . PHE A 1 279 ? 11.817  -37.827 98.657  1.00 30.15  ? 279 PHE A C      1 
ATOM   4600  O O      . PHE A 1 279 ? 13.000  -37.589 98.855  1.00 32.91  ? 279 PHE A O      1 
ATOM   4601  C CB     . PHE A 1 279 ? 9.870   -37.095 100.010 1.00 35.78  ? 279 PHE A CB     1 
ATOM   4602  C CG     . PHE A 1 279 ? 10.438  -35.752 100.385 1.00 32.95  ? 279 PHE A CG     1 
ATOM   4603  C CD1    . PHE A 1 279 ? 10.801  -35.476 101.702 1.00 31.02  ? 279 PHE A CD1    1 
ATOM   4604  C CD2    . PHE A 1 279 ? 10.594  -34.760 99.424  1.00 32.00  ? 279 PHE A CD2    1 
ATOM   4605  C CE1    . PHE A 1 279 ? 11.327  -34.241 102.045 1.00 30.74  ? 279 PHE A CE1    1 
ATOM   4606  C CE2    . PHE A 1 279 ? 11.113  -33.520 99.763  1.00 32.56  ? 279 PHE A CE2    1 
ATOM   4607  C CZ     . PHE A 1 279 ? 11.482  -33.262 101.075 1.00 33.09  ? 279 PHE A CZ     1 
ATOM   4608  H H      . PHE A 1 279 ? 12.366  -37.823 101.134 1.00 38.87  ? 279 PHE A H      1 
ATOM   4609  H HA     . PHE A 1 279 ? 10.470  -39.017 99.606  1.00 39.89  ? 279 PHE A HA     1 
ATOM   4610  H HB2    . PHE A 1 279 ? 9.382   -36.988 99.179  1.00 43.33  ? 279 PHE A HB2    1 
ATOM   4611  H HB3    . PHE A 1 279 ? 9.262   -37.367 100.715 1.00 43.33  ? 279 PHE A HB3    1 
ATOM   4612  H HD1    . PHE A 1 279 ? 10.703  -36.131 102.354 1.00 37.62  ? 279 PHE A HD1    1 
ATOM   4613  H HD2    . PHE A 1 279 ? 10.352  -34.931 98.543  1.00 38.79  ? 279 PHE A HD2    1 
ATOM   4614  H HE1    . PHE A 1 279 ? 11.570  -34.066 102.926 1.00 37.28  ? 279 PHE A HE1    1 
ATOM   4615  H HE2    . PHE A 1 279 ? 11.218  -32.864 99.112  1.00 39.46  ? 279 PHE A HE2    1 
ATOM   4616  H HZ     . PHE A 1 279 ? 11.829  -32.431 101.305 1.00 40.10  ? 279 PHE A HZ     1 
ATOM   4617  N N      . ALA A 1 280 ? 11.266  -37.790 97.447  1.00 30.51  ? 280 ALA A N      1 
ATOM   4618  C CA     . ALA A 1 280 ? 12.082  -37.570 96.245  1.00 36.22  ? 280 ALA A CA     1 
ATOM   4619  C C      . ALA A 1 280 ? 11.337  -36.859 95.100  1.00 37.33  ? 280 ALA A C      1 
ATOM   4620  O O      . ALA A 1 280 ? 10.121  -37.033 94.931  1.00 35.12  ? 280 ALA A O      1 
ATOM   4621  C CB     . ALA A 1 280 ? 12.620  -38.895 95.752  1.00 34.15  ? 280 ALA A CB     1 
ATOM   4622  H H      . ALA A 1 280 ? 10.426  -37.889 97.291  1.00 37.01  ? 280 ALA A H      1 
ATOM   4623  H HA     . ALA A 1 280 ? 12.841  -37.017 96.487  1.00 43.85  ? 280 ALA A HA     1 
ATOM   4624  H HB1    . ALA A 1 280 ? 13.158  -38.742 94.960  1.00 41.37  ? 280 ALA A HB1    1 
ATOM   4625  H HB2    . ALA A 1 280 ? 13.165  -39.293 96.450  1.00 41.37  ? 280 ALA A HB2    1 
ATOM   4626  H HB3    . ALA A 1 280 ? 11.876  -39.479 95.540  1.00 41.37  ? 280 ALA A HB3    1 
ATOM   4627  N N      . VAL A 1 281 ? 12.080  -36.094 94.295  1.00 33.52  ? 281 VAL A N      1 
ATOM   4628  C CA     . VAL A 1 281 ? 11.520  -35.404 93.124  1.00 34.54  ? 281 VAL A CA     1 
ATOM   4629  C C      . VAL A 1 281 ? 11.885  -36.113 91.817  1.00 37.10  ? 281 VAL A C      1 
ATOM   4630  O O      . VAL A 1 281 ? 13.049  -36.103 91.400  1.00 40.70  ? 281 VAL A O      1 
ATOM   4631  C CB     . VAL A 1 281 ? 12.013  -33.940 93.041  1.00 34.50  ? 281 VAL A CB     1 
ATOM   4632  C CG1    . VAL A 1 281 ? 11.487  -33.255 91.787  1.00 33.03  ? 281 VAL A CG1    1 
ATOM   4633  C CG2    . VAL A 1 281 ? 11.601  -33.157 94.293  1.00 33.52  ? 281 VAL A CG2    1 
ATOM   4634  H H      . VAL A 1 281 ? 12.922  -35.957 94.406  1.00 40.62  ? 281 VAL A H      1 
ATOM   4635  H HA     . VAL A 1 281 ? 10.553  -35.391 93.198  1.00 41.84  ? 281 VAL A HA     1 
ATOM   4636  H HB     . VAL A 1 281 ? 12.982  -33.939 92.995  1.00 41.79  ? 281 VAL A HB     1 
ATOM   4637  H HG11   . VAL A 1 281 ? 11.813  -32.342 91.766  1.00 40.03  ? 281 VAL A HG11   1 
ATOM   4638  H HG12   . VAL A 1 281 ? 11.803  -33.739 91.008  1.00 40.03  ? 281 VAL A HG12   1 
ATOM   4639  H HG13   . VAL A 1 281 ? 10.517  -33.260 91.810  1.00 40.03  ? 281 VAL A HG13   1 
ATOM   4640  H HG21   . VAL A 1 281 ? 11.923  -32.245 94.214  1.00 40.61  ? 281 VAL A HG21   1 
ATOM   4641  H HG22   . VAL A 1 281 ? 10.634  -33.162 94.364  1.00 40.61  ? 281 VAL A HG22   1 
ATOM   4642  H HG23   . VAL A 1 281 ? 11.993  -33.580 95.073  1.00 40.61  ? 281 VAL A HG23   1 
ATOM   4643  N N      . LYS A 1 282 ? 10.883  -36.709 91.173  1.00 34.47  ? 282 LYS A N      1 
ATOM   4644  C CA     . LYS A 1 282 ? 11.087  -37.515 89.970  1.00 33.55  ? 282 LYS A CA     1 
ATOM   4645  C C      . LYS A 1 282 ? 10.633  -36.808 88.702  1.00 38.71  ? 282 LYS A C      1 
ATOM   4646  O O      . LYS A 1 282 ? 9.513   -36.320 88.635  1.00 45.32  ? 282 LYS A O      1 
ATOM   4647  C CB     . LYS A 1 282 ? 10.340  -38.834 90.097  1.00 32.49  ? 282 LYS A CB     1 
ATOM   4648  C CG     . LYS A 1 282 ? 10.522  -39.752 88.921  1.00 33.53  ? 282 LYS A CG     1 
ATOM   4649  C CD     . LYS A 1 282 ? 9.663   -40.979 89.088  1.00 37.72  ? 282 LYS A CD     1 
ATOM   4650  C CE     . LYS A 1 282 ? 9.750   -41.895 87.886  1.00 39.28  ? 282 LYS A CE     1 
ATOM   4651  N NZ     . LYS A 1 282 ? 9.030   -43.169 88.127  1.00 41.13  ? 282 LYS A NZ     1 
ATOM   4652  H H      . LYS A 1 282 ? 10.060  -36.660 91.418  1.00 41.75  ? 282 LYS A H      1 
ATOM   4653  H HA     . LYS A 1 282 ? 12.032  -37.713 89.880  1.00 40.66  ? 282 LYS A HA     1 
ATOM   4654  H HB2    . LYS A 1 282 ? 10.657  -39.298 90.888  1.00 38.88  ? 282 LYS A HB2    1 
ATOM   4655  H HB3    . LYS A 1 282 ? 9.391   -38.648 90.184  1.00 38.88  ? 282 LYS A HB3    1 
ATOM   4656  H HG2    . LYS A 1 282 ? 10.254  -39.296 88.108  1.00 40.41  ? 282 LYS A HG2    1 
ATOM   4657  H HG3    . LYS A 1 282 ? 11.450  -40.030 88.866  1.00 40.41  ? 282 LYS A HG3    1 
ATOM   4658  H HD2    . LYS A 1 282 ? 9.961   -41.473 89.868  1.00 45.65  ? 282 LYS A HD2    1 
ATOM   4659  H HD3    . LYS A 1 282 ? 8.738   -40.708 89.197  1.00 45.65  ? 282 LYS A HD3    1 
ATOM   4660  H HE2    . LYS A 1 282 ? 9.347   -41.458 87.119  1.00 47.53  ? 282 LYS A HE2    1 
ATOM   4661  H HE3    . LYS A 1 282 ? 10.681  -42.100 87.705  1.00 47.53  ? 282 LYS A HE3    1 
ATOM   4662  H HZ1    . LYS A 1 282 ? 9.093   -43.693 87.410  1.00 49.74  ? 282 LYS A HZ1    1 
ATOM   4663  H HZ2    . LYS A 1 282 ? 9.385   -43.591 88.826  1.00 49.74  ? 282 LYS A HZ2    1 
ATOM   4664  H HZ3    . LYS A 1 282 ? 8.171   -43.006 88.292  1.00 49.74  ? 282 LYS A HZ3    1 
ATOM   4665  N N      . PHE A 1 283 ? 11.497  -36.767 87.692  1.00 35.40  ? 283 PHE A N      1 
ATOM   4666  C CA     . PHE A 1 283 ? 11.163  -36.152 86.407  1.00 33.68  ? 283 PHE A CA     1 
ATOM   4667  C C      . PHE A 1 283 ? 12.037  -36.708 85.261  1.00 37.70  ? 283 PHE A C      1 
ATOM   4668  O O      . PHE A 1 283 ? 13.055  -37.347 85.499  1.00 33.97  ? 283 PHE A O      1 
ATOM   4669  C CB     . PHE A 1 283 ? 11.309  -34.641 86.511  1.00 32.65  ? 283 PHE A CB     1 
ATOM   4670  C CG     . PHE A 1 283 ? 12.673  -34.207 86.923  1.00 33.05  ? 283 PHE A CG     1 
ATOM   4671  C CD1    . PHE A 1 283 ? 13.015  -34.141 88.259  1.00 33.65  ? 283 PHE A CD1    1 
ATOM   4672  C CD2    . PHE A 1 283 ? 13.627  -33.884 85.972  1.00 34.41  ? 283 PHE A CD2    1 
ATOM   4673  C CE1    . PHE A 1 283 ? 14.290  -33.744 88.645  1.00 33.89  ? 283 PHE A CE1    1 
ATOM   4674  C CE2    . PHE A 1 283 ? 14.902  -33.485 86.349  1.00 33.15  ? 283 PHE A CE2    1 
ATOM   4675  C CZ     . PHE A 1 283 ? 15.235  -33.413 87.685  1.00 31.65  ? 283 PHE A CZ     1 
ATOM   4676  H H      . PHE A 1 283 ? 12.292  -37.092 87.725  1.00 42.87  ? 283 PHE A H      1 
ATOM   4677  H HA     . PHE A 1 283 ? 10.237  -36.348 86.197  1.00 40.81  ? 283 PHE A HA     1 
ATOM   4678  H HB2    . PHE A 1 283 ? 11.119  -34.247 85.645  1.00 38.30  ? 283 PHE A HB2    1 
ATOM   4679  H HB3    . PHE A 1 283 ? 10.679  -34.309 87.170  1.00 38.30  ? 283 PHE A HB3    1 
ATOM   4680  H HD1    . PHE A 1 283 ? 12.385  -34.359 88.907  1.00 40.77  ? 283 PHE A HD1    1 
ATOM   4681  H HD2    . PHE A 1 283 ? 13.408  -33.928 85.069  1.00 41.68  ? 283 PHE A HD2    1 
ATOM   4682  H HE1    . PHE A 1 283 ? 14.509  -33.697 89.548  1.00 41.06  ? 283 PHE A HE1    1 
ATOM   4683  H HE2    . PHE A 1 283 ? 15.532  -33.266 85.701  1.00 40.17  ? 283 PHE A HE2    1 
ATOM   4684  H HZ     . PHE A 1 283 ? 16.089  -33.148 87.941  1.00 38.37  ? 283 PHE A HZ     1 
ATOM   4685  N N      . ARG A 1 284 ? 11.608  -36.490 84.021  1.00 45.93  ? 284 ARG A N      1 
ATOM   4686  C CA     . ARG A 1 284 ? 12.272  -37.071 82.853  1.00 47.81  ? 284 ARG A CA     1 
ATOM   4687  C C      . ARG A 1 284 ? 13.610  -36.396 82.575  1.00 43.18  ? 284 ARG A C      1 
ATOM   4688  O O      . ARG A 1 284 ? 13.714  -35.169 82.588  1.00 39.59  ? 284 ARG A O      1 
ATOM   4689  C CB     . ARG A 1 284 ? 11.365  -36.975 81.621  1.00 51.52  ? 284 ARG A CB     1 
ATOM   4690  C CG     . ARG A 1 284 ? 10.023  -37.656 81.818  1.00 53.79  ? 284 ARG A CG     1 
ATOM   4691  C CD     . ARG A 1 284 ? 9.148   -37.605 80.593  1.00 57.23  ? 284 ARG A CD     1 
ATOM   4692  N NE     . ARG A 1 284 ? 7.781   -37.989 80.938  1.00 61.89  ? 284 ARG A NE     1 
ATOM   4693  C CZ     . ARG A 1 284 ? 7.329   -39.238 81.025  1.00 58.84  ? 284 ARG A CZ     1 
ATOM   4694  N NH1    . ARG A 1 284 ? 8.128   -40.275 80.797  1.00 55.66  ? 284 ARG A NH1    1 
ATOM   4695  N NH2    . ARG A 1 284 ? 6.061   -39.447 81.353  1.00 55.09  ? 284 ARG A NH2    1 
ATOM   4696  H H      . ARG A 1 284 ? 10.926  -36.004 83.826  1.00 55.50  ? 284 ARG A H      1 
ATOM   4697  H HA     . ARG A 1 284 ? 12.442  -38.010 83.025  1.00 57.77  ? 284 ARG A HA     1 
ATOM   4698  H HB2    . ARG A 1 284 ? 11.200  -36.040 81.423  1.00 62.21  ? 284 ARG A HB2    1 
ATOM   4699  H HB3    . ARG A 1 284 ? 11.808  -37.399 80.869  1.00 62.21  ? 284 ARG A HB3    1 
ATOM   4700  H HG2    . ARG A 1 284 ? 10.173  -38.588 82.039  1.00 64.94  ? 284 ARG A HG2    1 
ATOM   4701  H HG3    . ARG A 1 284 ? 9.550   -37.216 82.541  1.00 64.94  ? 284 ARG A HG3    1 
ATOM   4702  H HD2    . ARG A 1 284 ? 9.135   -36.702 80.240  1.00 69.07  ? 284 ARG A HD2    1 
ATOM   4703  H HD3    . ARG A 1 284 ? 9.484   -38.226 79.928  1.00 69.07  ? 284 ARG A HD3    1 
ATOM   4704  H HE     . ARG A 1 284 ? 7.222   -37.355 81.098  1.00 74.66  ? 284 ARG A HE     1 
ATOM   4705  H HH11   . ARG A 1 284 ? 8.952   -40.145 80.586  1.00 67.18  ? 284 ARG A HH11   1 
ATOM   4706  H HH12   . ARG A 1 284 ? 7.822   -41.076 80.858  1.00 67.18  ? 284 ARG A HH12   1 
ATOM   4707  H HH21   . ARG A 1 284 ? 5.540   -38.779 81.501  1.00 66.50  ? 284 ARG A HH21   1 
ATOM   4708  H HH22   . ARG A 1 284 ? 5.759   -40.250 81.411  1.00 66.50  ? 284 ARG A HH22   1 
ATOM   4709  N N      . LYS A 1 285 ? 14.623  -37.209 82.292  1.00 41.67  ? 285 LYS A N      1 
ATOM   4710  C CA     . LYS A 1 285 ? 15.965  -36.706 82.047  1.00 42.02  ? 285 LYS A CA     1 
ATOM   4711  C C      . LYS A 1 285 ? 15.988  -35.839 80.801  1.00 47.48  ? 285 LYS A C      1 
ATOM   4712  O O      . LYS A 1 285 ? 15.550  -36.281 79.727  1.00 44.17  ? 285 LYS A O      1 
ATOM   4713  C CB     . LYS A 1 285 ? 16.970  -37.853 81.893  1.00 42.08  ? 285 LYS A CB     1 
ATOM   4714  C CG     . LYS A 1 285 ? 18.321  -37.403 81.312  1.00 39.02  ? 285 LYS A CG     1 
ATOM   4715  C CD     . LYS A 1 285 ? 19.352  -38.513 81.263  1.00 39.41  ? 285 LYS A CD     1 
ATOM   4716  C CE     . LYS A 1 285 ? 20.575  -38.082 80.441  1.00 46.66  ? 285 LYS A CE     1 
ATOM   4717  N NZ     . LYS A 1 285 ? 21.827  -38.892 80.697  1.00 47.31  ? 285 LYS A NZ     1 
ATOM   4718  H H      . LYS A 1 285 ? 14.556  -38.064 82.236  1.00 50.40  ? 285 LYS A H      1 
ATOM   4719  H HA     . LYS A 1 285 ? 16.242  -36.160 82.800  1.00 50.82  ? 285 LYS A HA     1 
ATOM   4720  H HB2    . LYS A 1 285 ? 17.136  -38.245 82.764  1.00 50.89  ? 285 LYS A HB2    1 
ATOM   4721  H HB3    . LYS A 1 285 ? 16.596  -38.520 81.296  1.00 50.89  ? 285 LYS A HB3    1 
ATOM   4722  H HG2    . LYS A 1 285 ? 18.182  -37.085 80.406  1.00 47.22  ? 285 LYS A HG2    1 
ATOM   4723  H HG3    . LYS A 1 285 ? 18.677  -36.689 81.862  1.00 47.22  ? 285 LYS A HG3    1 
ATOM   4724  H HD2    . LYS A 1 285 ? 19.646  -38.720 82.164  1.00 47.69  ? 285 LYS A HD2    1 
ATOM   4725  H HD3    . LYS A 1 285 ? 18.963  -39.297 80.846  1.00 47.69  ? 285 LYS A HD3    1 
ATOM   4726  H HE2    . LYS A 1 285 ? 20.360  -38.165 79.499  1.00 56.38  ? 285 LYS A HE2    1 
ATOM   4727  H HE3    . LYS A 1 285 ? 20.777  -37.156 80.648  1.00 56.38  ? 285 LYS A HE3    1 
ATOM   4728  H HZ1    . LYS A 1 285 ? 22.494  -38.590 80.190  1.00 57.17  ? 285 LYS A HZ1    1 
ATOM   4729  H HZ2    . LYS A 1 285 ? 22.062  -38.826 81.553  1.00 57.17  ? 285 LYS A HZ2    1 
ATOM   4730  H HZ3    . LYS A 1 285 ? 21.681  -39.748 80.503  1.00 57.17  ? 285 LYS A HZ3    1 
ATOM   4731  N N      . PRO A 1 286 ? 16.478  -34.592 80.940  1.00 51.39  ? 286 PRO A N      1 
ATOM   4732  C CA     . PRO A 1 286 ? 16.643  -33.746 79.755  1.00 54.83  ? 286 PRO A CA     1 
ATOM   4733  C C      . PRO A 1 286 ? 17.621  -34.403 78.811  1.00 60.35  ? 286 PRO A C      1 
ATOM   4734  O O      . PRO A 1 286 ? 18.585  -34.968 79.326  1.00 62.87  ? 286 PRO A O      1 
ATOM   4735  C CB     . PRO A 1 286 ? 17.237  -32.451 80.315  1.00 48.45  ? 286 PRO A CB     1 
ATOM   4736  C CG     . PRO A 1 286 ? 17.007  -32.504 81.771  1.00 45.83  ? 286 PRO A CG     1 
ATOM   4737  C CD     . PRO A 1 286 ? 16.991  -33.934 82.152  1.00 45.35  ? 286 PRO A CD     1 
ATOM   4738  H HA     . PRO A 1 286 ? 15.796  -33.575 79.314  1.00 66.18  ? 286 PRO A HA     1 
ATOM   4739  H HB2    . PRO A 1 286 ? 18.187  -32.419 80.121  1.00 58.53  ? 286 PRO A HB2    1 
ATOM   4740  H HB3    . PRO A 1 286 ? 16.782  -31.689 79.925  1.00 58.53  ? 286 PRO A HB3    1 
ATOM   4741  H HG2    . PRO A 1 286 ? 17.726  -32.041 82.227  1.00 55.38  ? 286 PRO A HG2    1 
ATOM   4742  H HG3    . PRO A 1 286 ? 16.154  -32.090 81.977  1.00 55.38  ? 286 PRO A HG3    1 
ATOM   4743  H HD2    . PRO A 1 286 ? 17.889  -34.243 82.351  1.00 54.81  ? 286 PRO A HD2    1 
ATOM   4744  H HD3    . PRO A 1 286 ? 16.389  -34.080 82.898  1.00 54.81  ? 286 PRO A HD3    1 
ATOM   4745  N N      . ASP A 1 287 ? 17.461  -34.293 77.495  1.00 59.71  ? 287 ASP A N      1 
ATOM   4746  C CA     . ASP A 1 287 ? 18.438  -34.951 76.647  1.00 60.03  ? 287 ASP A CA     1 
ATOM   4747  C C      . ASP A 1 287 ? 19.530  -33.953 76.413  1.00 55.72  ? 287 ASP A C      1 
ATOM   4748  O O      . ASP A 1 287 ? 19.428  -33.072 75.568  1.00 55.04  ? 287 ASP A O      1 
ATOM   4749  C CB     . ASP A 1 287 ? 17.840  -35.430 75.329  1.00 65.15  ? 287 ASP A CB     1 
ATOM   4750  C CG     . ASP A 1 287 ? 18.687  -36.499 74.670  1.00 72.12  ? 287 ASP A CG     1 
ATOM   4751  O OD1    . ASP A 1 287 ? 19.444  -37.194 75.385  1.00 77.44  ? 287 ASP A OD1    1 
ATOM   4752  O OD2    . ASP A 1 287 ? 18.599  -36.648 73.435  1.00 73.22  ? 287 ASP A OD2    1 
ATOM   4753  H H      . ASP A 1 287 ? 16.832  -33.869 77.091  1.00 72.04  ? 287 ASP A H      1 
ATOM   4754  H HA     . ASP A 1 287 ? 18.812  -35.715 77.113  1.00 72.42  ? 287 ASP A HA     1 
ATOM   4755  H HB2    . ASP A 1 287 ? 16.960  -35.802 75.496  1.00 78.57  ? 287 ASP A HB2    1 
ATOM   4756  H HB3    . ASP A 1 287 ? 17.774  -34.679 74.719  1.00 78.57  ? 287 ASP A HB3    1 
ATOM   4757  N N      . ILE A 1 288 ? 20.604  -34.162 77.162  1.00 53.55  ? 288 ILE A N      1 
ATOM   4758  C CA     . ILE A 1 288 ? 21.727  -33.246 77.240  1.00 52.49  ? 288 ILE A CA     1 
ATOM   4759  C C      . ILE A 1 288 ? 22.876  -34.059 77.763  1.00 51.53  ? 288 ILE A C      1 
ATOM   4760  O O      . ILE A 1 288 ? 22.650  -35.071 78.425  1.00 55.80  ? 288 ILE A O      1 
ATOM   4761  C CB     . ILE A 1 288 ? 21.481  -32.058 78.204  1.00 46.60  ? 288 ILE A CB     1 
ATOM   4762  C CG1    . ILE A 1 288 ? 21.044  -32.573 79.581  1.00 43.57  ? 288 ILE A CG1    1 
ATOM   4763  C CG2    . ILE A 1 288 ? 20.455  -31.084 77.630  1.00 49.12  ? 288 ILE A CG2    1 
ATOM   4764  C CD1    . ILE A 1 288 ? 20.940  -31.498 80.644  1.00 41.26  ? 288 ILE A CD1    1 
ATOM   4765  H H      . ILE A 1 288 ? 20.706  -34.860 77.654  1.00 64.65  ? 288 ILE A H      1 
ATOM   4766  H HA     . ILE A 1 288 ? 21.948  -32.907 76.359  1.00 63.38  ? 288 ILE A HA     1 
ATOM   4767  H HB     . ILE A 1 288 ? 22.319  -31.581 78.314  1.00 56.31  ? 288 ILE A HB     1 
ATOM   4768  H HG12   . ILE A 1 288 ? 20.172  -32.989 79.495  1.00 52.68  ? 288 ILE A HG12   1 
ATOM   4769  H HG13   . ILE A 1 288 ? 21.691  -33.229 79.887  1.00 52.68  ? 288 ILE A HG13   1 
ATOM   4770  H HG21   . ILE A 1 288 ? 20.326  -30.355 78.257  1.00 59.33  ? 288 ILE A HG21   1 
ATOM   4771  H HG22   . ILE A 1 288 ? 20.785  -30.739 76.785  1.00 59.33  ? 288 ILE A HG22   1 
ATOM   4772  H HG23   . ILE A 1 288 ? 19.617  -31.553 77.491  1.00 59.33  ? 288 ILE A HG23   1 
ATOM   4773  H HD11   . ILE A 1 288 ? 20.660  -31.905 81.479  1.00 49.90  ? 288 ILE A HD11   1 
ATOM   4774  H HD12   . ILE A 1 288 ? 21.807  -31.078 80.755  1.00 49.90  ? 288 ILE A HD12   1 
ATOM   4775  H HD13   . ILE A 1 288 ? 20.286  -30.839 80.362  1.00 49.90  ? 288 ILE A HD13   1 
ATOM   4776  N N      . VAL A 1 289 ? 24.101  -33.616 77.508  1.00 46.90  ? 289 VAL A N      1 
ATOM   4777  C CA     . VAL A 1 289 ? 25.258  -34.347 77.995  1.00 42.80  ? 289 VAL A CA     1 
ATOM   4778  C C      . VAL A 1 289 ? 25.323  -34.162 79.506  1.00 41.19  ? 289 VAL A C      1 
ATOM   4779  O O      . VAL A 1 289 ? 24.768  -33.220 80.052  1.00 38.02  ? 289 VAL A O      1 
ATOM   4780  C CB     . VAL A 1 289 ? 26.555  -33.881 77.317  1.00 41.28  ? 289 VAL A CB     1 
ATOM   4781  C CG1    . VAL A 1 289 ? 26.448  -34.081 75.811  1.00 39.21  ? 289 VAL A CG1    1 
ATOM   4782  C CG2    . VAL A 1 289 ? 26.855  -32.418 77.650  1.00 43.39  ? 289 VAL A CG2    1 
ATOM   4783  H H      . VAL A 1 289 ? 24.285  -32.905 77.062  1.00 56.67  ? 289 VAL A H      1 
ATOM   4784  H HA     . VAL A 1 289 ? 25.141  -35.292 77.809  1.00 51.75  ? 289 VAL A HA     1 
ATOM   4785  H HB     . VAL A 1 289 ? 27.294  -34.421 77.640  1.00 49.93  ? 289 VAL A HB     1 
ATOM   4786  H HG11   . VAL A 1 289 ? 27.272  -33.784 75.394  1.00 47.45  ? 289 VAL A HG11   1 
ATOM   4787  H HG12   . VAL A 1 289 ? 26.304  -35.023 75.628  1.00 47.45  ? 289 VAL A HG12   1 
ATOM   4788  H HG13   . VAL A 1 289 ? 25.701  -33.561 75.477  1.00 47.45  ? 289 VAL A HG13   1 
ATOM   4789  H HG21   . VAL A 1 289 ? 27.678  -32.156 77.208  1.00 52.45  ? 289 VAL A HG21   1 
ATOM   4790  H HG22   . VAL A 1 289 ? 26.121  -31.867 77.337  1.00 52.45  ? 289 VAL A HG22   1 
ATOM   4791  H HG23   . VAL A 1 289 ? 26.952  -32.327 78.611  1.00 52.45  ? 289 VAL A HG23   1 
ATOM   4792  N N      . ASP A 1 290 ? 26.008  -35.065 80.181  1.00 51.35  ? 290 ASP A N      1 
ATOM   4793  C CA     . ASP A 1 290 ? 26.011  -35.068 81.634  1.00 56.81  ? 290 ASP A CA     1 
ATOM   4794  C C      . ASP A 1 290 ? 26.644  -33.805 82.233  1.00 55.70  ? 290 ASP A C      1 
ATOM   4795  O O      . ASP A 1 290 ? 26.209  -33.344 83.292  1.00 61.14  ? 290 ASP A O      1 
ATOM   4796  C CB     . ASP A 1 290 ? 26.712  -36.336 82.127  1.00 60.62  ? 290 ASP A CB     1 
ATOM   4797  C CG     . ASP A 1 290 ? 25.856  -37.595 81.928  1.00 62.95  ? 290 ASP A CG     1 
ATOM   4798  O OD1    . ASP A 1 290 ? 24.661  -37.482 81.546  1.00 64.15  ? 290 ASP A OD1    1 
ATOM   4799  O OD2    . ASP A 1 290 ? 26.390  -38.703 82.155  1.00 60.99  ? 290 ASP A OD2    1 
ATOM   4800  H H      . ASP A 1 290 ? 26.480  -35.688 79.824  1.00 62.01  ? 290 ASP A H      1 
ATOM   4801  H HA     . ASP A 1 290 ? 25.092  -35.106 81.942  1.00 68.57  ? 290 ASP A HA     1 
ATOM   4802  H HB2    . ASP A 1 290 ? 27.539  -36.453 81.633  1.00 73.13  ? 290 ASP A HB2    1 
ATOM   4803  H HB3    . ASP A 1 290 ? 26.900  -36.246 83.074  1.00 73.13  ? 290 ASP A HB3    1 
ATOM   4804  N N      . ASP A 1 291 ? 27.627  -33.224 81.543  1.00 53.05  ? 291 ASP A N      1 
ATOM   4805  C CA     . ASP A 1 291 ? 28.334  -32.042 82.053  1.00 56.24  ? 291 ASP A CA     1 
ATOM   4806  C C      . ASP A 1 291 ? 27.456  -30.800 82.058  1.00 54.48  ? 291 ASP A C      1 
ATOM   4807  O O      . ASP A 1 291 ? 27.876  -29.731 82.502  1.00 53.05  ? 291 ASP A O      1 
ATOM   4808  C CB     . ASP A 1 291 ? 29.596  -31.760 81.247  1.00 63.65  ? 291 ASP A CB     1 
ATOM   4809  C CG     . ASP A 1 291 ? 30.657  -32.803 81.463  1.00 68.59  ? 291 ASP A CG     1 
ATOM   4810  O OD1    . ASP A 1 291 ? 30.823  -33.232 82.631  1.00 66.15  ? 291 ASP A OD1    1 
ATOM   4811  O OD2    . ASP A 1 291 ? 31.335  -33.176 80.479  1.00 72.08  ? 291 ASP A OD2    1 
ATOM   4812  H H      . ASP A 1 291 ? 27.907  -33.495 80.776  1.00 64.05  ? 291 ASP A H      1 
ATOM   4813  H HA     . ASP A 1 291 ? 28.603  -32.214 82.969  1.00 67.88  ? 291 ASP A HA     1 
ATOM   4814  H HB2    . ASP A 1 291 ? 29.374  -31.747 80.303  1.00 76.78  ? 291 ASP A HB2    1 
ATOM   4815  H HB3    . ASP A 1 291 ? 29.959  -30.901 81.516  1.00 76.78  ? 291 ASP A HB3    1 
ATOM   4816  N N      . ASN A 1 292 ? 26.255  -30.938 81.513  1.00 53.16  ? 292 ASN A N      1 
ATOM   4817  C CA     . ASN A 1 292 ? 25.227  -29.920 81.650  1.00 48.51  ? 292 ASN A CA     1 
ATOM   4818  C C      . ASN A 1 292 ? 24.270  -30.405 82.727  1.00 44.42  ? 292 ASN A C      1 
ATOM   4819  O O      . ASN A 1 292 ? 24.086  -29.734 83.735  1.00 46.55  ? 292 ASN A O      1 
ATOM   4820  C CB     . ASN A 1 292 ? 24.517  -29.663 80.327  1.00 46.84  ? 292 ASN A CB     1 
ATOM   4821  C CG     . ASN A 1 292 ? 25.476  -29.250 79.237  1.00 51.68  ? 292 ASN A CG     1 
ATOM   4822  O OD1    . ASN A 1 292 ? 26.684  -29.203 79.443  1.00 49.84  ? 292 ASN A OD1    1 
ATOM   4823  N ND2    . ASN A 1 292 ? 24.946  -28.975 78.062  1.00 59.90  ? 292 ASN A ND2    1 
ATOM   4824  H H      . ASN A 1 292 ? 26.009  -31.622 81.054  1.00 64.18  ? 292 ASN A H      1 
ATOM   4825  H HA     . ASN A 1 292 ? 25.631  -29.090 81.948  1.00 58.60  ? 292 ASN A HA     1 
ATOM   4826  H HB2    . ASN A 1 292 ? 24.070  -30.476 80.044  1.00 56.59  ? 292 ASN A HB2    1 
ATOM   4827  H HB3    . ASN A 1 292 ? 23.870  -28.951 80.447  1.00 56.59  ? 292 ASN A HB3    1 
ATOM   4828  H HD21   . ASN A 1 292 ? 25.451  -28.735 77.409  1.00 72.27  ? 292 ASN A HD21   1 
ATOM   4829  H HD22   . ASN A 1 292 ? 24.096  -29.036 77.949  1.00 72.27  ? 292 ASN A HD22   1 
ATOM   4830  N N      . LEU A 1 293 ? 23.654  -31.560 82.501  1.00 41.07  ? 293 LEU A N      1 
ATOM   4831  C CA     . LEU A 1 293 ? 22.717  -32.129 83.460  1.00 42.55  ? 293 LEU A CA     1 
ATOM   4832  C C      . LEU A 1 293 ? 23.240  -32.160 84.895  1.00 46.70  ? 293 LEU A C      1 
ATOM   4833  O O      . LEU A 1 293 ? 22.502  -31.840 85.822  1.00 49.32  ? 293 LEU A O      1 
ATOM   4834  C CB     . LEU A 1 293 ? 22.323  -33.544 83.063  1.00 43.54  ? 293 LEU A CB     1 
ATOM   4835  C CG     . LEU A 1 293 ? 21.341  -34.165 84.061  1.00 44.41  ? 293 LEU A CG     1 
ATOM   4836  C CD1    . LEU A 1 293 ? 20.011  -33.414 84.027  1.00 45.71  ? 293 LEU A CD1    1 
ATOM   4837  C CD2    . LEU A 1 293 ? 21.131  -35.644 83.769  1.00 44.10  ? 293 LEU A CD2    1 
ATOM   4838  H H      . LEU A 1 293 ? 23.764  -32.037 81.794  1.00 49.68  ? 293 LEU A H      1 
ATOM   4839  H HA     . LEU A 1 293 ? 21.911  -31.589 83.456  1.00 51.46  ? 293 LEU A HA     1 
ATOM   4840  H HB2    . LEU A 1 293 ? 21.897  -33.524 82.191  1.00 52.63  ? 293 LEU A HB2    1 
ATOM   4841  H HB3    . LEU A 1 293 ? 23.117  -34.100 83.034  1.00 52.63  ? 293 LEU A HB3    1 
ATOM   4842  H HG     . LEU A 1 293 ? 21.708  -34.085 84.955  1.00 53.68  ? 293 LEU A HG     1 
ATOM   4843  H HD11   . LEU A 1 293 ? 19.404  -33.820 84.665  1.00 55.24  ? 293 LEU A HD11   1 
ATOM   4844  H HD12   . LEU A 1 293 ? 20.167  -32.486 84.263  1.00 55.24  ? 293 LEU A HD12   1 
ATOM   4845  H HD13   . LEU A 1 293 ? 19.640  -33.470 83.133  1.00 55.24  ? 293 LEU A HD13   1 
ATOM   4846  H HD21   . LEU A 1 293 ? 20.506  -36.008 84.416  1.00 53.31  ? 293 LEU A HD21   1 
ATOM   4847  H HD22   . LEU A 1 293 ? 20.773  -35.741 82.873  1.00 53.31  ? 293 LEU A HD22   1 
ATOM   4848  H HD23   . LEU A 1 293 ? 21.983  -36.103 83.837  1.00 53.31  ? 293 LEU A HD23   1 
ATOM   4849  N N      . TYR A 1 294 ? 24.474  -32.614 85.100  1.00 44.51  ? 294 TYR A N      1 
ATOM   4850  C CA     . TYR A 1 294 ? 24.928  -32.859 86.470  1.00 41.44  ? 294 TYR A CA     1 
ATOM   4851  C C      . TYR A 1 294 ? 25.084  -31.571 87.266  1.00 41.29  ? 294 TYR A C      1 
ATOM   4852  O O      . TYR A 1 294 ? 24.601  -31.489 88.393  1.00 41.69  ? 294 TYR A O      1 
ATOM   4853  C CB     . TYR A 1 294 ? 26.234  -33.668 86.502  1.00 36.45  ? 294 TYR A CB     1 
ATOM   4854  C CG     . TYR A 1 294 ? 25.943  -35.135 86.679  1.00 36.73  ? 294 TYR A CG     1 
ATOM   4855  C CD1    . TYR A 1 294 ? 25.618  -35.643 87.927  1.00 38.24  ? 294 TYR A CD1    1 
ATOM   4856  C CD2    . TYR A 1 294 ? 25.955  -36.000 85.605  1.00 37.43  ? 294 TYR A CD2    1 
ATOM   4857  C CE1    . TYR A 1 294 ? 25.328  -36.973 88.103  1.00 38.96  ? 294 TYR A CE1    1 
ATOM   4858  C CE2    . TYR A 1 294 ? 25.664  -37.334 85.768  1.00 40.65  ? 294 TYR A CE2    1 
ATOM   4859  C CZ     . TYR A 1 294 ? 25.349  -37.818 87.024  1.00 43.91  ? 294 TYR A CZ     1 
ATOM   4860  O OH     . TYR A 1 294 ? 25.062  -39.156 87.204  1.00 47.90  ? 294 TYR A OH     1 
ATOM   4861  H H      . TYR A 1 294 ? 25.052  -32.784 84.486  1.00 53.81  ? 294 TYR A H      1 
ATOM   4862  H HA     . TYR A 1 294 ? 24.253  -33.391 86.920  1.00 50.11  ? 294 TYR A HA     1 
ATOM   4863  H HB2    . TYR A 1 294 ? 26.708  -33.548 85.664  1.00 44.14  ? 294 TYR A HB2    1 
ATOM   4864  H HB3    . TYR A 1 294 ? 26.780  -33.371 87.246  1.00 44.14  ? 294 TYR A HB3    1 
ATOM   4865  H HD1    . TYR A 1 294 ? 25.599  -35.072 88.661  1.00 46.28  ? 294 TYR A HD1    1 
ATOM   4866  H HD2    . TYR A 1 294 ? 26.162  -35.676 84.758  1.00 45.30  ? 294 TYR A HD2    1 
ATOM   4867  H HE1    . TYR A 1 294 ? 25.118  -37.298 88.948  1.00 47.14  ? 294 TYR A HE1    1 
ATOM   4868  H HE2    . TYR A 1 294 ? 25.681  -37.909 85.038  1.00 49.18  ? 294 TYR A HE2    1 
ATOM   4869  H HH     . TYR A 1 294 ? 25.109  -39.560 86.469  1.00 57.87  ? 294 TYR A HH     1 
ATOM   4870  N N      . PRO A 1 295 ? 25.771  -30.574 86.699  1.00 37.67  ? 295 PRO A N      1 
ATOM   4871  C CA     . PRO A 1 295 ? 25.839  -29.274 87.366  1.00 32.76  ? 295 PRO A CA     1 
ATOM   4872  C C      . PRO A 1 295 ? 24.464  -28.687 87.689  1.00 35.25  ? 295 PRO A C      1 
ATOM   4873  O O      . PRO A 1 295 ? 24.329  -27.905 88.631  1.00 38.57  ? 295 PRO A O      1 
ATOM   4874  C CB     . PRO A 1 295 ? 26.548  -28.398 86.342  1.00 36.38  ? 295 PRO A CB     1 
ATOM   4875  C CG     . PRO A 1 295 ? 27.365  -29.325 85.545  1.00 37.98  ? 295 PRO A CG     1 
ATOM   4876  C CD     . PRO A 1 295 ? 26.636  -30.633 85.505  1.00 37.39  ? 295 PRO A CD     1 
ATOM   4877  H HA     . PRO A 1 295 ? 26.371  -29.329 88.175  1.00 39.70  ? 295 PRO A HA     1 
ATOM   4878  H HB2    . PRO A 1 295 ? 25.892  -27.952 85.783  1.00 44.05  ? 295 PRO A HB2    1 
ATOM   4879  H HB3    . PRO A 1 295 ? 27.109  -27.751 86.797  1.00 44.05  ? 295 PRO A HB3    1 
ATOM   4880  H HG2    . PRO A 1 295 ? 27.470  -28.970 84.649  1.00 45.96  ? 295 PRO A HG2    1 
ATOM   4881  H HG3    . PRO A 1 295 ? 28.231  -29.435 85.969  1.00 45.96  ? 295 PRO A HG3    1 
ATOM   4882  H HD2    . PRO A 1 295 ? 26.098  -30.697 84.700  1.00 45.26  ? 295 PRO A HD2    1 
ATOM   4883  H HD3    . PRO A 1 295 ? 27.261  -31.372 85.576  1.00 45.26  ? 295 PRO A HD3    1 
ATOM   4884  N N      . GLN A 1 296 ? 23.456  -29.046 86.902  1.00 34.31  ? 296 GLN A N      1 
ATOM   4885  C CA     . GLN A 1 296 ? 22.098  -28.545 87.115  1.00 32.49  ? 296 GLN A CA     1 
ATOM   4886  C C      . GLN A 1 296 ? 21.350  -29.318 88.190  1.00 32.29  ? 296 GLN A C      1 
ATOM   4887  O O      . GLN A 1 296 ? 20.622  -28.745 88.993  1.00 34.32  ? 296 GLN A O      1 
ATOM   4888  C CB     . GLN A 1 296 ? 21.303  -28.622 85.818  1.00 34.16  ? 296 GLN A CB     1 
ATOM   4889  C CG     . GLN A 1 296 ? 21.820  -27.745 84.691  1.00 34.30  ? 296 GLN A CG     1 
ATOM   4890  C CD     . GLN A 1 296 ? 21.058  -27.990 83.410  1.00 35.21  ? 296 GLN A CD     1 
ATOM   4891  O OE1    . GLN A 1 296 ? 19.857  -27.745 83.330  1.00 34.33  ? 296 GLN A OE1    1 
ATOM   4892  N NE2    . GLN A 1 296 ? 21.732  -28.553 82.429  1.00 41.64  ? 296 GLN A NE2    1 
ATOM   4893  H H      . GLN A 1 296 ? 23.530  -29.581 86.233  1.00 41.56  ? 296 GLN A H      1 
ATOM   4894  H HA     . GLN A 1 296 ? 22.142  -27.615 87.388  1.00 39.38  ? 296 GLN A HA     1 
ATOM   4895  H HB2    . GLN A 1 296 ? 21.316  -29.540 85.503  1.00 41.39  ? 296 GLN A HB2    1 
ATOM   4896  H HB3    . GLN A 1 296 ? 20.388  -28.355 86.000  1.00 41.39  ? 296 GLN A HB3    1 
ATOM   4897  H HG2    . GLN A 1 296 ? 21.712  -26.812 84.936  1.00 41.56  ? 296 GLN A HG2    1 
ATOM   4898  H HG3    . GLN A 1 296 ? 22.755  -27.945 84.532  1.00 41.56  ? 296 GLN A HG3    1 
ATOM   4899  H HE21   . GLN A 1 296 ? 22.560  -28.760 82.539  1.00 50.36  ? 296 GLN A HE21   1 
ATOM   4900  H HE22   . GLN A 1 296 ? 21.345  -28.715 81.678  1.00 50.36  ? 296 GLN A HE22   1 
ATOM   4901  N N      . LEU A 1 297 ? 21.543  -30.627 88.203  1.00 34.05  ? 297 LEU A N      1 
ATOM   4902  C CA     . LEU A 1 297 ? 20.964  -31.464 89.241  1.00 33.70  ? 297 LEU A CA     1 
ATOM   4903  C C      . LEU A 1 297 ? 21.581  -31.089 90.587  1.00 33.22  ? 297 LEU A C      1 
ATOM   4904  O O      . LEU A 1 297 ? 20.925  -31.201 91.633  1.00 31.06  ? 297 LEU A O      1 
ATOM   4905  C CB     . LEU A 1 297 ? 21.192  -32.947 88.940  1.00 36.35  ? 297 LEU A CB     1 
ATOM   4906  C CG     . LEU A 1 297 ? 20.436  -33.542 87.749  1.00 33.13  ? 297 LEU A CG     1 
ATOM   4907  C CD1    . LEU A 1 297 ? 21.022  -34.911 87.393  1.00 32.54  ? 297 LEU A CD1    1 
ATOM   4908  C CD2    . LEU A 1 297 ? 18.957  -33.624 88.022  1.00 29.65  ? 297 LEU A CD2    1 
ATOM   4909  H H      . LEU A 1 297 ? 22.007  -31.058 87.621  1.00 41.25  ? 297 LEU A H      1 
ATOM   4910  H HA     . LEU A 1 297 ? 20.009  -31.304 89.287  1.00 40.83  ? 297 LEU A HA     1 
ATOM   4911  H HB2    . LEU A 1 297 ? 22.139  -33.078 88.771  1.00 44.01  ? 297 LEU A HB2    1 
ATOM   4912  H HB3    . LEU A 1 297 ? 20.935  -33.457 89.725  1.00 44.01  ? 297 LEU A HB3    1 
ATOM   4913  H HG     . LEU A 1 297 ? 20.561  -32.961 86.983  1.00 40.15  ? 297 LEU A HG     1 
ATOM   4914  H HD11   . LEU A 1 297 ? 20.534  -35.275 86.638  1.00 39.44  ? 297 LEU A HD11   1 
ATOM   4915  H HD12   . LEU A 1 297 ? 21.957  -34.803 87.161  1.00 39.44  ? 297 LEU A HD12   1 
ATOM   4916  H HD13   . LEU A 1 297 ? 20.936  -35.500 88.159  1.00 39.44  ? 297 LEU A HD13   1 
ATOM   4917  H HD21   . LEU A 1 297 ? 18.515  -34.004 87.247  1.00 35.97  ? 297 LEU A HD21   1 
ATOM   4918  H HD22   . LEU A 1 297 ? 18.811  -34.187 88.798  1.00 35.97  ? 297 LEU A HD22   1 
ATOM   4919  H HD23   . LEU A 1 297 ? 18.618  -32.731 88.192  1.00 35.97  ? 297 LEU A HD23   1 
ATOM   4920  N N      . GLU A 1 298 ? 22.846  -30.669 90.556  1.00 42.29  ? 298 GLU A N      1 
ATOM   4921  C CA     . GLU A 1 298 ? 23.504  -30.162 91.751  1.00 49.12  ? 298 GLU A CA     1 
ATOM   4922  C C      . GLU A 1 298 ? 22.790  -28.901 92.165  1.00 50.46  ? 298 GLU A C      1 
ATOM   4923  O O      . GLU A 1 298 ? 22.432  -28.757 93.332  1.00 59.80  ? 298 GLU A O      1 
ATOM   4924  C CB     . GLU A 1 298 ? 24.996  -29.915 91.535  1.00 56.81  ? 298 GLU A CB     1 
ATOM   4925  C CG     . GLU A 1 298 ? 25.822  -31.199 91.575  1.00 67.84  ? 298 GLU A CG     1 
ATOM   4926  C CD     . GLU A 1 298 ? 27.243  -31.033 91.047  1.00 78.77  ? 298 GLU A CD     1 
ATOM   4927  O OE1    . GLU A 1 298 ? 27.959  -32.056 90.925  1.00 80.60  ? 298 GLU A OE1    1 
ATOM   4928  O OE2    . GLU A 1 298 ? 27.650  -29.886 90.764  1.00 83.64  ? 298 GLU A OE2    1 
ATOM   4929  H H      . GLU A 1 298 ? 23.342  -30.669 89.854  1.00 51.14  ? 298 GLU A H      1 
ATOM   4930  H HA     . GLU A 1 298 ? 23.408  -30.811 92.466  1.00 59.33  ? 298 GLU A HA     1 
ATOM   4931  H HB2    . GLU A 1 298 ? 25.125  -29.502 90.666  1.00 68.57  ? 298 GLU A HB2    1 
ATOM   4932  H HB3    . GLU A 1 298 ? 25.324  -29.326 92.233  1.00 68.57  ? 298 GLU A HB3    1 
ATOM   4933  H HG2    . GLU A 1 298 ? 25.880  -31.504 92.493  1.00 81.80  ? 298 GLU A HG2    1 
ATOM   4934  H HG3    . GLU A 1 298 ? 25.381  -31.871 91.032  1.00 81.80  ? 298 GLU A HG3    1 
ATOM   4935  N N      . ARG A 1 299 ? 22.568  -27.986 91.225  1.00 39.66  ? 299 ARG A N      1 
ATOM   4936  C CA     . ARG A 1 299 ? 21.923  -26.725 91.581  1.00 34.55  ? 299 ARG A CA     1 
ATOM   4937  C C      . ARG A 1 299 ? 20.493  -26.942 92.055  1.00 33.79  ? 299 ARG A C      1 
ATOM   4938  O O      . ARG A 1 299 ? 20.072  -26.384 93.063  1.00 36.55  ? 299 ARG A O      1 
ATOM   4939  C CB     . ARG A 1 299 ? 21.890  -25.762 90.412  1.00 32.26  ? 299 ARG A CB     1 
ATOM   4940  C CG     . ARG A 1 299 ? 20.821  -24.717 90.591  1.00 31.47  ? 299 ARG A CG     1 
ATOM   4941  C CD     . ARG A 1 299 ? 21.017  -23.579 89.650  1.00 36.65  ? 299 ARG A CD     1 
ATOM   4942  N NE     . ARG A 1 299 ? 20.712  -22.289 90.258  1.00 41.55  ? 299 ARG A NE     1 
ATOM   4943  C CZ     . ARG A 1 299 ? 20.744  -21.135 89.598  1.00 47.26  ? 299 ARG A CZ     1 
ATOM   4944  N NH1    . ARG A 1 299 ? 21.032  -21.121 88.294  1.00 50.76  ? 299 ARG A NH1    1 
ATOM   4945  N NH2    . ARG A 1 299 ? 20.472  -19.999 90.232  1.00 45.48  ? 299 ARG A NH2    1 
ATOM   4946  H H      . ARG A 1 299 ? 22.775  -28.067 90.395  1.00 47.99  ? 299 ARG A H      1 
ATOM   4947  H HA     . ARG A 1 299 ? 22.420  -26.308 92.302  1.00 41.85  ? 299 ARG A HA     1 
ATOM   4948  H HB2    . ARG A 1 299 ? 22.747  -25.312 90.343  1.00 39.11  ? 299 ARG A HB2    1 
ATOM   4949  H HB3    . ARG A 1 299 ? 21.702  -26.253 89.597  1.00 39.11  ? 299 ARG A HB3    1 
ATOM   4950  H HG2    . ARG A 1 299 ? 19.953  -25.113 90.414  1.00 38.15  ? 299 ARG A HG2    1 
ATOM   4951  H HG3    . ARG A 1 299 ? 20.856  -24.373 91.497  1.00 38.15  ? 299 ARG A HG3    1 
ATOM   4952  H HD2    . ARG A 1 299 ? 21.943  -23.564 89.361  1.00 44.37  ? 299 ARG A HD2    1 
ATOM   4953  H HD3    . ARG A 1 299 ? 20.432  -23.697 88.885  1.00 44.37  ? 299 ARG A HD3    1 
ATOM   4954  H HE     . ARG A 1 299 ? 20.601  -22.262 91.111  1.00 50.25  ? 299 ARG A HE     1 
ATOM   4955  H HH11   . ARG A 1 299 ? 21.213  -21.856 87.886  1.00 61.31  ? 299 ARG A HH11   1 
ATOM   4956  H HH12   . ARG A 1 299 ? 21.048  -20.376 87.865  1.00 61.31  ? 299 ARG A HH12   1 
ATOM   4957  H HH21   . ARG A 1 299 ? 20.278  -20.010 91.069  1.00 54.97  ? 299 ARG A HH21   1 
ATOM   4958  H HH22   . ARG A 1 299 ? 20.480  -19.254 89.802  1.00 54.97  ? 299 ARG A HH22   1 
ATOM   4959  N N      . ALA A 1 300 ? 19.744  -27.742 91.306  1.00 31.82  ? 300 ALA A N      1 
ATOM   4960  C CA     . ALA A 1 300 ? 18.349  -28.020 91.630  1.00 31.39  ? 300 ALA A CA     1 
ATOM   4961  C C      . ALA A 1 300 ? 18.206  -28.538 93.058  1.00 34.76  ? 300 ALA A C      1 
ATOM   4962  O O      . ALA A 1 300 ? 17.373  -28.058 93.842  1.00 33.99  ? 300 ALA A O      1 
ATOM   4963  C CB     . ALA A 1 300 ? 17.782  -29.033 90.645  1.00 30.66  ? 300 ALA A CB     1 
ATOM   4964  H H      . ALA A 1 300 ? 20.023  -28.140 90.597  1.00 38.58  ? 300 ALA A H      1 
ATOM   4965  H HA     . ALA A 1 300 ? 17.834  -27.202 91.552  1.00 38.06  ? 300 ALA A HA     1 
ATOM   4966  H HB1    . ALA A 1 300 ? 16.855  -29.208 90.872  1.00 37.19  ? 300 ALA A HB1    1 
ATOM   4967  H HB2    . ALA A 1 300 ? 17.840  -28.667 89.749  1.00 37.19  ? 300 ALA A HB2    1 
ATOM   4968  H HB3    . ALA A 1 300 ? 18.298  -29.852 90.704  1.00 37.19  ? 300 ALA A HB3    1 
ATOM   4969  N N      . SER A 1 301 ? 19.064  -29.495 93.397  1.00 35.01  ? 301 SER A N      1 
ATOM   4970  C CA     . SER A 1 301 ? 19.027  -30.128 94.697  1.00 28.01  ? 301 SER A CA     1 
ATOM   4971  C C      . SER A 1 301 ? 19.381  -29.100 95.750  1.00 29.93  ? 301 SER A C      1 
ATOM   4972  O O      . SER A 1 301 ? 18.888  -29.155 96.861  1.00 36.14  ? 301 SER A O      1 
ATOM   4973  C CB     . SER A 1 301 ? 19.994  -31.301 94.740  1.00 28.87  ? 301 SER A CB     1 
ATOM   4974  O OG     . SER A 1 301 ? 19.943  -31.927 95.999  1.00 35.32  ? 301 SER A OG     1 
ATOM   4975  H H      . SER A 1 301 ? 19.683  -29.794 92.881  1.00 42.41  ? 301 SER A H      1 
ATOM   4976  H HA     . SER A 1 301 ? 18.132  -30.458 94.874  1.00 34.00  ? 301 SER A HA     1 
ATOM   4977  H HB2    . SER A 1 301 ? 19.746  -31.942 94.056  1.00 35.04  ? 301 SER A HB2    1 
ATOM   4978  H HB3    . SER A 1 301 ? 20.894  -30.976 94.583  1.00 35.04  ? 301 SER A HB3    1 
ATOM   4979  H HG     . SER A 1 301 ? 20.478  -32.574 96.019  1.00 42.77  ? 301 SER A HG     1 
ATOM   4980  N N      . ARG A 1 302 ? 20.235  -28.154 95.396  1.00 28.85  ? 302 ARG A N      1 
ATOM   4981  C CA     . ARG A 1 302 ? 20.628  -27.117 96.329  1.00 29.63  ? 302 ARG A CA     1 
ATOM   4982  C C      . ARG A 1 302 ? 19.483  -26.145 96.574  1.00 28.52  ? 302 ARG A C      1 
ATOM   4983  O O      . ARG A 1 302 ? 19.129  -25.887 97.713  1.00 32.80  ? 302 ARG A O      1 
ATOM   4984  C CB     . ARG A 1 302 ? 21.870  -26.398 95.818  1.00 34.73  ? 302 ARG A CB     1 
ATOM   4985  C CG     . ARG A 1 302 ? 22.313  -25.211 96.647  1.00 38.43  ? 302 ARG A CG     1 
ATOM   4986  C CD     . ARG A 1 302 ? 23.597  -24.616 96.067  1.00 39.98  ? 302 ARG A CD     1 
ATOM   4987  N NE     . ARG A 1 302 ? 23.389  -23.604 95.029  1.00 40.66  ? 302 ARG A NE     1 
ATOM   4988  C CZ     . ARG A 1 302 ? 23.720  -23.757 93.743  1.00 47.60  ? 302 ARG A CZ     1 
ATOM   4989  N NH1    . ARG A 1 302 ? 24.238  -24.897 93.291  1.00 46.18  ? 302 ARG A NH1    1 
ATOM   4990  N NH2    . ARG A 1 302 ? 23.507  -22.770 92.885  1.00 51.60  ? 302 ARG A NH2    1 
ATOM   4991  H H      . ARG A 1 302 ? 20.601  -28.091 94.620  1.00 35.02  ? 302 ARG A H      1 
ATOM   4992  H HA     . ARG A 1 302 ? 20.852  -27.530 97.178  1.00 35.95  ? 302 ARG A HA     1 
ATOM   4993  H HB2    . ARG A 1 302 ? 22.605  -27.031 95.798  1.00 42.07  ? 302 ARG A HB2    1 
ATOM   4994  H HB3    . ARG A 1 302 ? 21.692  -26.078 94.920  1.00 42.07  ? 302 ARG A HB3    1 
ATOM   4995  H HG2    . ARG A 1 302 ? 21.623  -24.529 96.632  1.00 46.51  ? 302 ARG A HG2    1 
ATOM   4996  H HG3    . ARG A 1 302 ? 22.489  -25.497 97.557  1.00 46.51  ? 302 ARG A HG3    1 
ATOM   4997  H HD2    . ARG A 1 302 ? 24.098  -24.200 96.787  1.00 48.37  ? 302 ARG A HD2    1 
ATOM   4998  H HD3    . ARG A 1 302 ? 24.122  -25.333 95.678  1.00 48.37  ? 302 ARG A HD3    1 
ATOM   4999  H HE     . ARG A 1 302 ? 23.029  -22.860 95.263  1.00 49.18  ? 302 ARG A HE     1 
ATOM   5000  H HH11   . ARG A 1 302 ? 24.386  -25.547 93.835  1.00 55.81  ? 302 ARG A HH11   1 
ATOM   5001  H HH12   . ARG A 1 302 ? 24.437  -24.979 92.459  1.00 55.81  ? 302 ARG A HH12   1 
ATOM   5002  H HH21   . ARG A 1 302 ? 23.164  -22.029 93.157  1.00 62.31  ? 302 ARG A HH21   1 
ATOM   5003  H HH22   . ARG A 1 302 ? 23.705  -22.872 92.054  1.00 62.31  ? 302 ARG A HH22   1 
ATOM   5004  N N      . LYS A 1 303 ? 18.909  -25.592 95.515  1.00 28.86  ? 303 LYS A N      1 
ATOM   5005  C CA     . LYS A 1 303 ? 17.851  -24.593 95.666  1.00 29.45  ? 303 LYS A CA     1 
ATOM   5006  C C      . LYS A 1 303 ? 16.698  -25.134 96.508  1.00 33.70  ? 303 LYS A C      1 
ATOM   5007  O O      . LYS A 1 303 ? 16.097  -24.419 97.305  1.00 35.36  ? 303 LYS A O      1 
ATOM   5008  C CB     . LYS A 1 303 ? 17.343  -24.148 94.295  1.00 28.12  ? 303 LYS A CB     1 
ATOM   5009  C CG     . LYS A 1 303 ? 18.346  -23.388 93.480  1.00 27.94  ? 303 LYS A CG     1 
ATOM   5010  C CD     . LYS A 1 303 ? 18.737  -22.046 94.110  1.00 32.80  ? 303 LYS A CD     1 
ATOM   5011  C CE     . LYS A 1 303 ? 17.564  -21.048 94.098  1.00 36.42  ? 303 LYS A CE     1 
ATOM   5012  N NZ     . LYS A 1 303 ? 17.809  -19.737 94.811  1.00 35.35  ? 303 LYS A NZ     1 
ATOM   5013  H H      . LYS A 1 303 ? 19.110  -25.775 94.699  1.00 35.02  ? 303 LYS A H      1 
ATOM   5014  H HA     . LYS A 1 303 ? 18.214  -23.816 96.119  1.00 35.73  ? 303 LYS A HA     1 
ATOM   5015  H HB2    . LYS A 1 303 ? 17.086  -24.934 93.788  1.00 34.14  ? 303 LYS A HB2    1 
ATOM   5016  H HB3    . LYS A 1 303 ? 16.571  -23.574 94.421  1.00 34.14  ? 303 LYS A HB3    1 
ATOM   5017  H HG2    . LYS A 1 303 ? 19.151  -23.923 93.392  1.00 33.91  ? 303 LYS A HG2    1 
ATOM   5018  H HG3    . LYS A 1 303 ? 17.971  -23.210 92.604  1.00 33.91  ? 303 LYS A HG3    1 
ATOM   5019  H HD2    . LYS A 1 303 ? 19.003  -22.191 95.031  1.00 39.75  ? 303 LYS A HD2    1 
ATOM   5020  H HD3    . LYS A 1 303 ? 19.470  -21.658 93.606  1.00 39.75  ? 303 LYS A HD3    1 
ATOM   5021  H HE2    . LYS A 1 303 ? 17.348  -20.840 93.175  1.00 44.09  ? 303 LYS A HE2    1 
ATOM   5022  H HE3    . LYS A 1 303 ? 16.799  -21.470 94.521  1.00 44.09  ? 303 LYS A HE3    1 
ATOM   5023  H HZ1    . LYS A 1 303 ? 17.086  -19.221 94.757  1.00 42.81  ? 303 LYS A HZ1    1 
ATOM   5024  H HZ2    . LYS A 1 303 ? 17.994  -19.887 95.669  1.00 42.81  ? 303 LYS A HZ2    1 
ATOM   5025  H HZ3    . LYS A 1 303 ? 18.496  -19.312 94.437  1.00 42.81  ? 303 LYS A HZ3    1 
ATOM   5026  N N      . ILE A 1 304 ? 16.398  -26.410 96.324  1.00 34.70  ? 304 ILE A N      1 
ATOM   5027  C CA     . ILE A 1 304 ? 15.327  -27.052 97.064  1.00 34.08  ? 304 ILE A CA     1 
ATOM   5028  C C      . ILE A 1 304 ? 15.768  -27.368 98.494  1.00 31.12  ? 304 ILE A C      1 
ATOM   5029  O O      . ILE A 1 304 ? 14.977  -27.293 99.424  1.00 30.17  ? 304 ILE A O      1 
ATOM   5030  C CB     . ILE A 1 304 ? 14.875  -28.330 96.340  1.00 32.72  ? 304 ILE A CB     1 
ATOM   5031  C CG1    . ILE A 1 304 ? 14.220  -27.943 95.010  1.00 28.70  ? 304 ILE A CG1    1 
ATOM   5032  C CG2    . ILE A 1 304 ? 13.908  -29.131 97.199  1.00 32.97  ? 304 ILE A CG2    1 
ATOM   5033  C CD1    . ILE A 1 304 ? 13.895  -29.112 94.123  1.00 29.51  ? 304 ILE A CD1    1 
ATOM   5034  H H      . ILE A 1 304 ? 16.805  -26.930 95.772  1.00 42.03  ? 304 ILE A H      1 
ATOM   5035  H HA     . ILE A 1 304 ? 14.569  -26.449 97.110  1.00 41.29  ? 304 ILE A HA     1 
ATOM   5036  H HB     . ILE A 1 304 ? 15.655  -28.877 96.156  1.00 39.65  ? 304 ILE A HB     1 
ATOM   5037  H HG12   . ILE A 1 304 ? 13.392  -27.474 95.196  1.00 34.83  ? 304 ILE A HG12   1 
ATOM   5038  H HG13   . ILE A 1 304 ? 14.824  -27.361 94.523  1.00 34.83  ? 304 ILE A HG13   1 
ATOM   5039  H HG21   . ILE A 1 304 ? 13.643  -29.929 96.714  1.00 39.96  ? 304 ILE A HG21   1 
ATOM   5040  H HG22   . ILE A 1 304 ? 14.350  -29.378 98.026  1.00 39.96  ? 304 ILE A HG22   1 
ATOM   5041  H HG23   . ILE A 1 304 ? 13.129  -28.585 97.389  1.00 39.96  ? 304 ILE A HG23   1 
ATOM   5042  H HD11   . ILE A 1 304 ? 13.486  -28.784 93.307  1.00 35.80  ? 304 ILE A HD11   1 
ATOM   5043  H HD12   . ILE A 1 304 ? 14.715  -29.587 93.915  1.00 35.80  ? 304 ILE A HD12   1 
ATOM   5044  H HD13   . ILE A 1 304 ? 13.280  -29.700 94.589  1.00 35.80  ? 304 ILE A HD13   1 
ATOM   5045  N N      . PHE A 1 305 ? 17.036  -27.715 98.659  1.00 29.85  ? 305 PHE A N      1 
ATOM   5046  C CA     . PHE A 1 305 ? 17.579  -27.962 99.976  1.00 30.96  ? 305 PHE A CA     1 
ATOM   5047  C C      . PHE A 1 305 ? 17.525  -26.700 100.812 1.00 36.59  ? 305 PHE A C      1 
ATOM   5048  O O      . PHE A 1 305 ? 17.155  -26.719 101.984 1.00 44.48  ? 305 PHE A O      1 
ATOM   5049  C CB     . PHE A 1 305 ? 19.019  -28.455 99.894  1.00 33.66  ? 305 PHE A CB     1 
ATOM   5050  C CG     . PHE A 1 305 ? 19.578  -28.844 101.215 1.00 37.41  ? 305 PHE A CG     1 
ATOM   5051  C CD1    . PHE A 1 305 ? 19.983  -27.883 102.124 1.00 35.49  ? 305 PHE A CD1    1 
ATOM   5052  C CD2    . PHE A 1 305 ? 19.649  -30.173 101.574 1.00 40.72  ? 305 PHE A CD2    1 
ATOM   5053  C CE1    . PHE A 1 305 ? 20.481  -28.245 103.349 1.00 35.20  ? 305 PHE A CE1    1 
ATOM   5054  C CE2    . PHE A 1 305 ? 20.140  -30.543 102.799 1.00 40.23  ? 305 PHE A CE2    1 
ATOM   5055  C CZ     . PHE A 1 305 ? 20.560  -29.577 103.690 1.00 37.94  ? 305 PHE A CZ     1 
ATOM   5056  H H      . PHE A 1 305 ? 17.602  -27.813 98.020  1.00 36.21  ? 305 PHE A H      1 
ATOM   5057  H HA     . PHE A 1 305 ? 17.049  -28.643 100.419 1.00 37.55  ? 305 PHE A HA     1 
ATOM   5058  H HB2    . PHE A 1 305 ? 19.053  -29.232 99.315  1.00 40.78  ? 305 PHE A HB2    1 
ATOM   5059  H HB3    . PHE A 1 305 ? 19.574  -27.747 99.531  1.00 40.78  ? 305 PHE A HB3    1 
ATOM   5060  H HD1    . PHE A 1 305 ? 19.933  -26.983 101.895 1.00 42.98  ? 305 PHE A HD1    1 
ATOM   5061  H HD2    . PHE A 1 305 ? 19.369  -30.827 100.974 1.00 49.26  ? 305 PHE A HD2    1 
ATOM   5062  H HE1    . PHE A 1 305 ? 20.761  -27.593 103.950 1.00 42.64  ? 305 PHE A HE1    1 
ATOM   5063  H HE2    . PHE A 1 305 ? 20.195  -31.443 103.027 1.00 48.66  ? 305 PHE A HE2    1 
ATOM   5064  H HZ     . PHE A 1 305 ? 20.896  -29.826 104.521 1.00 45.92  ? 305 PHE A HZ     1 
ATOM   5065  N N      . GLU A 1 306 ? 17.902  -25.594 100.200 1.00 36.68  ? 306 GLU A N      1 
ATOM   5066  C CA     . GLU A 1 306 ? 17.937  -24.323 100.891 1.00 39.11  ? 306 GLU A CA     1 
ATOM   5067  C C      . GLU A 1 306 ? 16.525  -23.913 101.263 1.00 38.82  ? 306 GLU A C      1 
ATOM   5068  O O      . GLU A 1 306 ? 16.295  -23.321 102.326 1.00 43.16  ? 306 GLU A O      1 
ATOM   5069  C CB     . GLU A 1 306 ? 18.587  -23.274 99.995  1.00 47.32  ? 306 GLU A CB     1 
ATOM   5070  C CG     . GLU A 1 306 ? 20.111  -23.322 99.989  1.00 56.46  ? 306 GLU A CG     1 
ATOM   5071  C CD     . GLU A 1 306 ? 20.723  -22.497 98.868  1.00 63.31  ? 306 GLU A CD     1 
ATOM   5072  O OE1    . GLU A 1 306 ? 19.977  -22.082 97.954  1.00 67.61  ? 306 GLU A OE1    1 
ATOM   5073  O OE2    . GLU A 1 306 ? 21.948  -22.255 98.910  1.00 61.72  ? 306 GLU A OE2    1 
ATOM   5074  H H      . GLU A 1 306 ? 18.145  -25.553 99.376  1.00 44.41  ? 306 GLU A H      1 
ATOM   5075  H HA     . GLU A 1 306 ? 18.462  -24.407 101.703 1.00 47.32  ? 306 GLU A HA     1 
ATOM   5076  H HB2    . GLU A 1 306 ? 18.283  -23.410 99.084  1.00 57.18  ? 306 GLU A HB2    1 
ATOM   5077  H HB3    . GLU A 1 306 ? 18.320  -22.393 100.302 1.00 57.18  ? 306 GLU A HB3    1 
ATOM   5078  H HG2    . GLU A 1 306 ? 20.442  -22.973 100.832 1.00 68.14  ? 306 GLU A HG2    1 
ATOM   5079  H HG3    . GLU A 1 306 ? 20.398  -24.242 99.875  1.00 68.14  ? 306 GLU A HG3    1 
ATOM   5080  N N      . PHE A 1 307 ? 15.580  -24.277 100.396 1.00 34.88  ? 307 PHE A N      1 
ATOM   5081  C CA     . PHE A 1 307 ? 14.160  -24.008 100.612 1.00 30.19  ? 307 PHE A CA     1 
ATOM   5082  C C      . PHE A 1 307 ? 13.623  -24.721 101.854 1.00 29.80  ? 307 PHE A C      1 
ATOM   5083  O O      . PHE A 1 307 ? 13.050  -24.088 102.739 1.00 29.43  ? 307 PHE A O      1 
ATOM   5084  C CB     . PHE A 1 307 ? 13.382  -24.410 99.359  1.00 27.11  ? 307 PHE A CB     1 
ATOM   5085  C CG     . PHE A 1 307 ? 11.937  -24.689 99.598  1.00 25.30  ? 307 PHE A CG     1 
ATOM   5086  C CD1    . PHE A 1 307 ? 11.048  -23.665 99.817  1.00 27.24  ? 307 PHE A CD1    1 
ATOM   5087  C CD2    . PHE A 1 307 ? 11.465  -25.979 99.563  1.00 26.01  ? 307 PHE A CD2    1 
ATOM   5088  C CE1    . PHE A 1 307 ? 9.717   -23.925 100.034 1.00 27.30  ? 307 PHE A CE1    1 
ATOM   5089  C CE2    . PHE A 1 307 ? 10.141  -26.247 99.772  1.00 29.90  ? 307 PHE A CE2    1 
ATOM   5090  C CZ     . PHE A 1 307 ? 9.265   -25.220 100.008 1.00 29.74  ? 307 PHE A CZ     1 
ATOM   5091  H H      . PHE A 1 307 ? 15.742  -24.690 99.659  1.00 42.24  ? 307 PHE A H      1 
ATOM   5092  H HA     . PHE A 1 307 ? 14.040  -23.054 100.743 1.00 36.62  ? 307 PHE A HA     1 
ATOM   5093  H HB2    . PHE A 1 307 ? 13.440  -23.689 98.712  1.00 32.93  ? 307 PHE A HB2    1 
ATOM   5094  H HB3    . PHE A 1 307 ? 13.780  -25.214 98.990  1.00 32.93  ? 307 PHE A HB3    1 
ATOM   5095  H HD1    . PHE A 1 307 ? 11.355  -22.788 99.840  1.00 33.08  ? 307 PHE A HD1    1 
ATOM   5096  H HD2    . PHE A 1 307 ? 12.056  -26.680 99.409  1.00 31.60  ? 307 PHE A HD2    1 
ATOM   5097  H HE1    . PHE A 1 307 ? 9.124   -23.226 100.189 1.00 33.15  ? 307 PHE A HE1    1 
ATOM   5098  H HE2    . PHE A 1 307 ? 9.836   -27.125 99.756  1.00 36.27  ? 307 PHE A HE2    1 
ATOM   5099  H HZ     . PHE A 1 307 ? 8.363   -25.400 100.148 1.00 36.08  ? 307 PHE A HZ     1 
ATOM   5100  N N      . LEU A 1 308 ? 13.828  -26.032 101.921 1.00 28.31  ? 308 LEU A N      1 
ATOM   5101  C CA     . LEU A 1 308 ? 13.395  -26.823 103.060 1.00 24.89  ? 308 LEU A CA     1 
ATOM   5102  C C      . LEU A 1 308 ? 14.089  -26.284 104.292 1.00 28.00  ? 308 LEU A C      1 
ATOM   5103  O O      . LEU A 1 308 ? 13.538  -26.295 105.397 1.00 30.55  ? 308 LEU A O      1 
ATOM   5104  C CB     . LEU A 1 308 ? 13.734  -28.291 102.856 1.00 26.97  ? 308 LEU A CB     1 
ATOM   5105  C CG     . LEU A 1 308 ? 12.999  -28.972 101.713 1.00 28.90  ? 308 LEU A CG     1 
ATOM   5106  C CD1    . LEU A 1 308 ? 13.668  -30.290 101.397 1.00 26.09  ? 308 LEU A CD1    1 
ATOM   5107  C CD2    . LEU A 1 308 ? 11.538  -29.153 102.063 1.00 30.39  ? 308 LEU A CD2    1 
ATOM   5108  H H      . LEU A 1 308 ? 14.222  -26.491 101.310 1.00 34.36  ? 308 LEU A H      1 
ATOM   5109  H HA     . LEU A 1 308 ? 12.436  -26.736 103.176 1.00 30.26  ? 308 LEU A HA     1 
ATOM   5110  H HB2    . LEU A 1 308 ? 14.684  -28.365 102.676 1.00 32.76  ? 308 LEU A HB2    1 
ATOM   5111  H HB3    . LEU A 1 308 ? 13.519  -28.772 103.670 1.00 32.76  ? 308 LEU A HB3    1 
ATOM   5112  H HG     . LEU A 1 308 ? 13.051  -28.411 100.923 1.00 35.06  ? 308 LEU A HG     1 
ATOM   5113  H HD11   . LEU A 1 308 ? 13.193  -30.718 100.667 1.00 31.70  ? 308 LEU A HD11   1 
ATOM   5114  H HD12   . LEU A 1 308 ? 14.588  -30.122 101.139 1.00 31.70  ? 308 LEU A HD12   1 
ATOM   5115  H HD13   . LEU A 1 308 ? 13.642  -30.854 102.185 1.00 31.70  ? 308 LEU A HD13   1 
ATOM   5116  H HD21   . LEU A 1 308 ? 11.088  -29.589 101.323 1.00 36.85  ? 308 LEU A HD21   1 
ATOM   5117  H HD22   . LEU A 1 308 ? 11.470  -29.701 102.861 1.00 36.85  ? 308 LEU A HD22   1 
ATOM   5118  H HD23   . LEU A 1 308 ? 11.142  -28.283 102.225 1.00 36.85  ? 308 LEU A HD23   1 
ATOM   5119  N N      . GLU A 1 309 ? 15.306  -25.795 104.084 1.00 32.88  ? 309 GLU A N      1 
ATOM   5120  C CA     . GLU A 1 309 ? 16.077  -25.177 105.154 1.00 39.57  ? 309 GLU A CA     1 
ATOM   5121  C C      . GLU A 1 309 ? 15.416  -23.882 105.603 1.00 37.06  ? 309 GLU A C      1 
ATOM   5122  O O      . GLU A 1 309 ? 15.091  -23.698 106.775 1.00 38.02  ? 309 GLU A O      1 
ATOM   5123  C CB     . GLU A 1 309 ? 17.490  -24.890 104.671 1.00 45.00  ? 309 GLU A CB     1 
ATOM   5124  C CG     . GLU A 1 309 ? 18.517  -25.914 105.056 1.00 56.91  ? 309 GLU A CG     1 
ATOM   5125  C CD     . GLU A 1 309 ? 19.920  -25.395 104.824 1.00 66.68  ? 309 GLU A CD     1 
ATOM   5126  O OE1    . GLU A 1 309 ? 20.231  -25.032 103.664 1.00 66.65  ? 309 GLU A OE1    1 
ATOM   5127  O OE2    . GLU A 1 309 ? 20.705  -25.351 105.795 1.00 70.31  ? 309 GLU A OE2    1 
ATOM   5128  H H      . GLU A 1 309 ? 15.711  -25.809 103.326 1.00 39.85  ? 309 GLU A H      1 
ATOM   5129  H HA     . GLU A 1 309 ? 16.124  -25.780 105.913 1.00 47.87  ? 309 GLU A HA     1 
ATOM   5130  H HB2    . GLU A 1 309 ? 17.480  -24.836 103.703 1.00 54.40  ? 309 GLU A HB2    1 
ATOM   5131  H HB3    . GLU A 1 309 ? 17.775  -24.039 105.040 1.00 54.40  ? 309 GLU A HB3    1 
ATOM   5132  H HG2    . GLU A 1 309 ? 18.422  -26.126 105.998 1.00 68.68  ? 309 GLU A HG2    1 
ATOM   5133  H HG3    . GLU A 1 309 ? 18.393  -26.711 104.517 1.00 68.68  ? 309 GLU A HG3    1 
ATOM   5134  N N      . ARG A 1 310 ? 15.210  -22.990 104.648 1.00 31.68  ? 310 ARG A N      1 
ATOM   5135  C CA     . ARG A 1 310 ? 14.529  -21.728 104.903 1.00 31.84  ? 310 ARG A CA     1 
ATOM   5136  C C      . ARG A 1 310 ? 13.134  -21.916 105.498 1.00 36.91  ? 310 ARG A C      1 
ATOM   5137  O O      . ARG A 1 310 ? 12.630  -21.049 106.202 1.00 36.56  ? 310 ARG A O      1 
ATOM   5138  C CB     . ARG A 1 310 ? 14.421  -20.933 103.607 1.00 30.62  ? 310 ARG A CB     1 
ATOM   5139  C CG     . ARG A 1 310 ? 13.482  -19.752 103.676 1.00 35.44  ? 310 ARG A CG     1 
ATOM   5140  C CD     . ARG A 1 310 ? 13.511  -19.005 102.364 1.00 40.65  ? 310 ARG A CD     1 
ATOM   5141  N NE     . ARG A 1 310 ? 13.082  -19.843 101.245 1.00 41.68  ? 310 ARG A NE     1 
ATOM   5142  C CZ     . ARG A 1 310 ? 13.901  -20.463 100.402 1.00 42.46  ? 310 ARG A CZ     1 
ATOM   5143  N NH1    . ARG A 1 310 ? 15.221  -20.401 100.567 1.00 42.84  ? 310 ARG A NH1    1 
ATOM   5144  N NH2    . ARG A 1 310 ? 13.396  -21.184 99.408  1.00 42.26  ? 310 ARG A NH2    1 
ATOM   5145  H H      . ARG A 1 310 ? 15.458  -23.092 103.830 1.00 38.40  ? 310 ARG A H      1 
ATOM   5146  H HA     . ARG A 1 310 ? 15.055  -21.208 105.531 1.00 38.59  ? 310 ARG A HA     1 
ATOM   5147  H HB2    . ARG A 1 310 ? 15.300  -20.597 103.375 1.00 37.13  ? 310 ARG A HB2    1 
ATOM   5148  H HB3    . ARG A 1 310 ? 14.101  -21.523 102.906 1.00 37.13  ? 310 ARG A HB3    1 
ATOM   5149  H HG2    . ARG A 1 310 ? 12.577  -20.063 103.835 1.00 42.92  ? 310 ARG A HG2    1 
ATOM   5150  H HG3    . ARG A 1 310 ? 13.766  -19.150 104.381 1.00 42.92  ? 310 ARG A HG3    1 
ATOM   5151  H HD2    . ARG A 1 310 ? 12.914  -18.243 102.418 1.00 49.17  ? 310 ARG A HD2    1 
ATOM   5152  H HD3    . ARG A 1 310 ? 14.418  -18.707 102.187 1.00 49.17  ? 310 ARG A HD3    1 
ATOM   5153  H HE     . ARG A 1 310 ? 12.236  -19.943 101.124 1.00 50.40  ? 310 ARG A HE     1 
ATOM   5154  H HH11   . ARG A 1 310 ? 15.553  -19.933 101.208 1.00 51.79  ? 310 ARG A HH11   1 
ATOM   5155  H HH12   . ARG A 1 310 ? 15.743  -20.812 100.021 1.00 51.79  ? 310 ARG A HH12   1 
ATOM   5156  H HH21   . ARG A 1 310 ? 12.543  -21.236 99.306  1.00 51.10  ? 310 ARG A HH21   1 
ATOM   5157  H HH22   . ARG A 1 310 ? 13.920  -21.601 98.870  1.00 51.10  ? 310 ARG A HH22   1 
ATOM   5158  N N      . GLU A 1 311 ? 12.508  -23.046 105.198 1.00 39.46  ? 311 GLU A N      1 
ATOM   5159  C CA     . GLU A 1 311 ? 11.125  -23.275 105.590 1.00 41.48  ? 311 GLU A CA     1 
ATOM   5160  C C      . GLU A 1 311 ? 11.015  -23.959 106.967 1.00 44.81  ? 311 GLU A C      1 
ATOM   5161  O O      . GLU A 1 311 ? 9.921   -24.367 107.381 1.00 43.65  ? 311 GLU A O      1 
ATOM   5162  C CB     . GLU A 1 311 ? 10.421  -24.111 104.522 1.00 43.31  ? 311 GLU A CB     1 
ATOM   5163  C CG     . GLU A 1 311 ? 9.024   -23.648 104.197 1.00 49.17  ? 311 GLU A CG     1 
ATOM   5164  C CD     . GLU A 1 311 ? 9.005   -22.248 103.624 1.00 52.06  ? 311 GLU A CD     1 
ATOM   5165  O OE1    . GLU A 1 311 ? 10.049  -21.828 103.095 1.00 50.55  ? 311 GLU A OE1    1 
ATOM   5166  O OE2    . GLU A 1 311 ? 7.965   -21.560 103.715 1.00 54.92  ? 311 GLU A OE2    1 
ATOM   5167  H H      . GLU A 1 311 ? 12.864  -23.699 104.766 1.00 47.74  ? 311 GLU A H      1 
ATOM   5168  H HA     . GLU A 1 311 ? 10.670  -22.421 105.646 1.00 50.16  ? 311 GLU A HA     1 
ATOM   5169  H HB2    . GLU A 1 311 ? 10.942  -24.074 103.704 1.00 52.37  ? 311 GLU A HB2    1 
ATOM   5170  H HB3    . GLU A 1 311 ? 10.363  -25.028 104.832 1.00 52.37  ? 311 GLU A HB3    1 
ATOM   5171  H HG2    . GLU A 1 311 ? 8.635   -24.248 103.541 1.00 59.40  ? 311 GLU A HG2    1 
ATOM   5172  H HG3    . GLU A 1 311 ? 8.492   -23.650 105.008 1.00 59.40  ? 311 GLU A HG3    1 
ATOM   5173  N N      . ASN A 1 312 ? 12.158  -24.120 107.637 1.00 47.15  ? 312 ASN A N      1 
ATOM   5174  C CA     . ASN A 1 312 ? 12.228  -24.717 108.977 1.00 47.13  ? 312 ASN A CA     1 
ATOM   5175  C C      . ASN A 1 312 ? 11.824  -26.188 109.018 1.00 41.25  ? 312 ASN A C      1 
ATOM   5176  O O      . ASN A 1 312 ? 11.322  -26.664 110.037 1.00 36.83  ? 312 ASN A O      1 
ATOM   5177  C CB     . ASN A 1 312 ? 11.366  -23.942 109.989 1.00 49.12  ? 312 ASN A CB     1 
ATOM   5178  C CG     . ASN A 1 312 ? 11.767  -22.473 110.127 1.00 52.17  ? 312 ASN A CG     1 
ATOM   5179  O OD1    . ASN A 1 312 ? 12.951  -22.132 110.122 1.00 53.15  ? 312 ASN A OD1    1 
ATOM   5180  N ND2    . ASN A 1 312 ? 10.775  -21.603 110.279 1.00 53.74  ? 312 ASN A ND2    1 
ATOM   5181  H H      . ASN A 1 312 ? 12.926  -23.886 107.329 1.00 56.97  ? 312 ASN A H      1 
ATOM   5182  H HA     . ASN A 1 312 ? 13.147  -24.664 109.283 1.00 56.95  ? 312 ASN A HA     1 
ATOM   5183  H HB2    . ASN A 1 312 ? 10.440  -23.973 109.701 1.00 59.34  ? 312 ASN A HB2    1 
ATOM   5184  H HB3    . ASN A 1 312 ? 11.455  -24.359 110.860 1.00 59.34  ? 312 ASN A HB3    1 
ATOM   5185  H HD21   . ASN A 1 312 ? 10.947  -20.765 110.361 1.00 64.88  ? 312 ASN A HD21   1 
ATOM   5186  H HD22   . ASN A 1 312 ? 9.960   -21.879 110.296 1.00 64.88  ? 312 ASN A HD22   1 
ATOM   5187  N N      . PHE A 1 313 ? 12.058  -26.911 107.927 1.00 38.37  ? 313 PHE A N      1 
ATOM   5188  C CA     . PHE A 1 313 ? 11.834  -28.354 107.910 1.00 37.09  ? 313 PHE A CA     1 
ATOM   5189  C C      . PHE A 1 313 ? 13.080  -29.125 108.338 1.00 38.58  ? 313 PHE A C      1 
ATOM   5190  O O      . PHE A 1 313 ? 13.054  -30.357 108.437 1.00 42.38  ? 313 PHE A O      1 
ATOM   5191  C CB     . PHE A 1 313 ? 11.383  -28.807 106.529 1.00 31.67  ? 313 PHE A CB     1 
ATOM   5192  C CG     . PHE A 1 313 ? 9.935   -28.528 106.252 1.00 29.30  ? 313 PHE A CG     1 
ATOM   5193  C CD1    . PHE A 1 313 ? 8.949   -29.215 106.938 1.00 27.31  ? 313 PHE A CD1    1 
ATOM   5194  C CD2    . PHE A 1 313 ? 9.560   -27.589 105.306 1.00 28.65  ? 313 PHE A CD2    1 
ATOM   5195  C CE1    . PHE A 1 313 ? 7.620   -28.975 106.684 1.00 27.86  ? 313 PHE A CE1    1 
ATOM   5196  C CE2    . PHE A 1 313 ? 8.238   -27.339 105.048 1.00 27.38  ? 313 PHE A CE2    1 
ATOM   5197  C CZ     . PHE A 1 313 ? 7.260   -28.033 105.739 1.00 28.94  ? 313 PHE A CZ     1 
ATOM   5198  H H      . PHE A 1 313 ? 12.348  -26.590 107.183 1.00 46.44  ? 313 PHE A H      1 
ATOM   5199  H HA     . PHE A 1 313 ? 11.125  -28.566 108.537 1.00 44.89  ? 313 PHE A HA     1 
ATOM   5200  H HB2    . PHE A 1 313 ? 11.909  -28.343 105.859 1.00 38.40  ? 313 PHE A HB2    1 
ATOM   5201  H HB3    . PHE A 1 313 ? 11.522  -29.764 106.452 1.00 38.40  ? 313 PHE A HB3    1 
ATOM   5202  H HD1    . PHE A 1 313 ? 9.189   -29.850 107.573 1.00 33.16  ? 313 PHE A HD1    1 
ATOM   5203  H HD2    . PHE A 1 313 ? 10.214  -27.123 104.838 1.00 34.77  ? 313 PHE A HD2    1 
ATOM   5204  H HE1    . PHE A 1 313 ? 6.964   -29.440 107.151 1.00 33.83  ? 313 PHE A HE1    1 
ATOM   5205  H HE2    . PHE A 1 313 ? 7.999   -26.705 104.410 1.00 33.24  ? 313 PHE A HE2    1 
ATOM   5206  H HZ     . PHE A 1 313 ? 6.362   -27.865 105.568 1.00 35.11  ? 313 PHE A HZ     1 
ATOM   5207  N N      . MET A 1 314 ? 14.166  -28.394 108.576 1.00 34.46  ? 314 MET A N      1 
ATOM   5208  C CA     . MET A 1 314 ? 15.409  -28.975 109.070 1.00 32.72  ? 314 MET A CA     1 
ATOM   5209  C C      . MET A 1 314 ? 15.850  -30.115 108.188 1.00 32.71  ? 314 MET A C      1 
ATOM   5210  O O      . MET A 1 314 ? 15.826  -31.270 108.615 1.00 32.85  ? 314 MET A O      1 
ATOM   5211  C CB     . MET A 1 314 ? 15.251  -29.479 110.503 1.00 31.76  ? 314 MET A CB     1 
ATOM   5212  C CG     . MET A 1 314 ? 14.636  -28.489 111.453 1.00 34.51  ? 314 MET A CG     1 
ATOM   5213  S SD     . MET A 1 314 ? 14.481  -29.158 113.114 1.00 41.89  ? 314 MET A SD     1 
ATOM   5214  C CE     . MET A 1 314 ? 16.200  -29.408 113.540 1.00 46.66  ? 314 MET A CE     1 
ATOM   5215  H H      . MET A 1 314 ? 14.207  -27.543 108.456 1.00 41.74  ? 314 MET A H      1 
ATOM   5216  H HA     . MET A 1 314 ? 16.097  -28.292 109.068 1.00 39.66  ? 314 MET A HA     1 
ATOM   5217  H HB2    . MET A 1 314 ? 14.685  -30.266 110.494 1.00 38.50  ? 314 MET A HB2    1 
ATOM   5218  H HB3    . MET A 1 314 ? 16.127  -29.711 110.848 1.00 38.50  ? 314 MET A HB3    1 
ATOM   5219  H HG2    . MET A 1 314 ? 15.197  -27.699 111.497 1.00 41.80  ? 314 MET A HG2    1 
ATOM   5220  H HG3    . MET A 1 314 ? 13.750  -28.253 111.138 1.00 41.80  ? 314 MET A HG3    1 
ATOM   5221  H HE1    . MET A 1 314 ? 16.253  -29.775 114.437 1.00 56.38  ? 314 MET A HE1    1 
ATOM   5222  H HE2    . MET A 1 314 ? 16.596  -30.025 112.906 1.00 56.38  ? 314 MET A HE2    1 
ATOM   5223  H HE3    . MET A 1 314 ? 16.661  -28.555 113.504 1.00 56.38  ? 314 MET A HE3    1 
ATOM   5224  N N      . PRO A 1 315 ? 16.256  -29.798 106.952 1.00 32.72  ? 315 PRO A N      1 
ATOM   5225  C CA     . PRO A 1 315 ? 16.804  -30.840 106.094 1.00 32.46  ? 315 PRO A CA     1 
ATOM   5226  C C      . PRO A 1 315 ? 18.113  -31.379 106.649 1.00 34.36  ? 315 PRO A C      1 
ATOM   5227  O O      . PRO A 1 315 ? 18.844  -30.670 107.344 1.00 35.08  ? 315 PRO A O      1 
ATOM   5228  C CB     . PRO A 1 315 ? 17.025  -30.121 104.766 1.00 31.25  ? 315 PRO A CB     1 
ATOM   5229  C CG     . PRO A 1 315 ? 16.226  -28.902 104.857 1.00 31.80  ? 315 PRO A CG     1 
ATOM   5230  C CD     . PRO A 1 315 ? 16.216  -28.502 106.267 1.00 31.36  ? 315 PRO A CD     1 
ATOM   5231  H HA     . PRO A 1 315 ? 16.169  -31.564 105.977 1.00 39.35  ? 315 PRO A HA     1 
ATOM   5232  H HB2    . PRO A 1 315 ? 17.965  -29.908 104.662 1.00 37.89  ? 315 PRO A HB2    1 
ATOM   5233  H HB3    . PRO A 1 315 ? 16.716  -30.681 104.036 1.00 37.89  ? 315 PRO A HB3    1 
ATOM   5234  H HG2    . PRO A 1 315 ? 16.632  -28.210 104.312 1.00 38.56  ? 315 PRO A HG2    1 
ATOM   5235  H HG3    . PRO A 1 315 ? 15.323  -29.086 104.552 1.00 38.56  ? 315 PRO A HG3    1 
ATOM   5236  H HD2    . PRO A 1 315 ? 17.004  -27.978 106.480 1.00 38.02  ? 315 PRO A HD2    1 
ATOM   5237  H HD3    . PRO A 1 315 ? 15.398  -28.026 106.482 1.00 38.02  ? 315 PRO A HD3    1 
ATOM   5238  N N      . LEU A 1 316 ? 18.391  -32.635 106.324 1.00 32.71  ? 316 LEU A N      1 
ATOM   5239  C CA     . LEU A 1 316 ? 19.622  -33.300 106.723 1.00 32.63  ? 316 LEU A CA     1 
ATOM   5240  C C      . LEU A 1 316 ? 20.579  -33.388 105.538 1.00 32.57  ? 316 LEU A C      1 
ATOM   5241  O O      . LEU A 1 316 ? 21.679  -32.838 105.574 1.00 35.91  ? 316 LEU A O      1 
ATOM   5242  C CB     . LEU A 1 316 ? 19.346  -34.698 107.283 1.00 30.43  ? 316 LEU A CB     1 
ATOM   5243  C CG     . LEU A 1 316 ? 18.607  -34.777 108.612 1.00 25.57  ? 316 LEU A CG     1 
ATOM   5244  C CD1    . LEU A 1 316 ? 18.224  -36.199 108.903 1.00 27.89  ? 316 LEU A CD1    1 
ATOM   5245  C CD2    . LEU A 1 316 ? 19.475  -34.225 109.711 1.00 27.43  ? 316 LEU A CD2    1 
ATOM   5246  H H      . LEU A 1 316 ? 17.868  -33.135 105.860 1.00 39.65  ? 316 LEU A H      1 
ATOM   5247  H HA     . LEU A 1 316 ? 20.052  -32.778 107.418 1.00 39.55  ? 316 LEU A HA     1 
ATOM   5248  H HB2    . LEU A 1 316 ? 18.817  -35.185 106.632 1.00 36.91  ? 316 LEU A HB2    1 
ATOM   5249  H HB3    . LEU A 1 316 ? 20.197  -35.148 107.403 1.00 36.91  ? 316 LEU A HB3    1 
ATOM   5250  H HG     . LEU A 1 316 ? 17.797  -34.245 108.564 1.00 31.07  ? 316 LEU A HG     1 
ATOM   5251  H HD11   . LEU A 1 316 ? 17.755  -36.232 109.751 1.00 33.86  ? 316 LEU A HD11   1 
ATOM   5252  H HD12   . LEU A 1 316 ? 17.648  -36.522 108.193 1.00 33.86  ? 316 LEU A HD12   1 
ATOM   5253  H HD13   . LEU A 1 316 ? 19.028  -36.739 108.948 1.00 33.86  ? 316 LEU A HD13   1 
ATOM   5254  H HD21   . LEU A 1 316 ? 18.994  -34.280 110.551 1.00 33.31  ? 316 LEU A HD21   1 
ATOM   5255  H HD22   . LEU A 1 316 ? 20.291  -34.748 109.761 1.00 33.31  ? 316 LEU A HD22   1 
ATOM   5256  H HD23   . LEU A 1 316 ? 19.687  -33.300 109.510 1.00 33.31  ? 316 LEU A HD23   1 
ATOM   5257  N N      . ARG A 1 317 ? 20.167  -34.084 104.487 1.00 32.04  ? 317 ARG A N      1 
ATOM   5258  C CA     . ARG A 1 317 ? 21.034  -34.250 103.339 1.00 35.80  ? 317 ARG A CA     1 
ATOM   5259  C C      . ARG A 1 317 ? 20.204  -34.247 102.064 1.00 34.67  ? 317 ARG A C      1 
ATOM   5260  O O      . ARG A 1 317 ? 18.981  -34.363 102.111 1.00 36.20  ? 317 ARG A O      1 
ATOM   5261  C CB     . ARG A 1 317 ? 21.836  -35.552 103.500 1.00 38.82  ? 317 ARG A CB     1 
ATOM   5262  C CG     . ARG A 1 317 ? 23.329  -35.434 103.181 1.00 36.34  ? 317 ARG A CG     1 
ATOM   5263  C CD     . ARG A 1 317 ? 24.087  -36.610 103.770 1.00 36.39  ? 317 ARG A CD     1 
ATOM   5264  N NE     . ARG A 1 317 ? 25.417  -36.807 103.196 1.00 44.23  ? 317 ARG A NE     1 
ATOM   5265  C CZ     . ARG A 1 317 ? 26.157  -37.903 103.378 1.00 50.12  ? 317 ARG A CZ     1 
ATOM   5266  N NH1    . ARG A 1 317 ? 25.700  -38.910 104.114 1.00 51.69  ? 317 ARG A NH1    1 
ATOM   5267  N NH2    . ARG A 1 317 ? 27.356  -38.004 102.819 1.00 50.19  ? 317 ARG A NH2    1 
ATOM   5268  H H      . ARG A 1 317 ? 19.399  -34.464 104.416 1.00 38.84  ? 317 ARG A H      1 
ATOM   5269  H HA     . ARG A 1 317 ? 21.660  -33.509 103.298 1.00 43.35  ? 317 ARG A HA     1 
ATOM   5270  H HB2    . ARG A 1 317 ? 21.756  -35.852 104.419 1.00 46.98  ? 317 ARG A HB2    1 
ATOM   5271  H HB3    . ARG A 1 317 ? 21.461  -36.221 102.906 1.00 46.98  ? 317 ARG A HB3    1 
ATOM   5272  H HG2    . ARG A 1 317 ? 23.456  -35.436 102.220 1.00 44.00  ? 317 ARG A HG2    1 
ATOM   5273  H HG3    . ARG A 1 317 ? 23.679  -34.616 103.568 1.00 44.00  ? 317 ARG A HG3    1 
ATOM   5274  H HD2    . ARG A 1 317 ? 24.195  -36.466 104.724 1.00 44.06  ? 317 ARG A HD2    1 
ATOM   5275  H HD3    . ARG A 1 317 ? 23.575  -37.420 103.617 1.00 44.06  ? 317 ARG A HD3    1 
ATOM   5276  H HE     . ARG A 1 317 ? 25.728  -36.193 102.680 1.00 53.46  ? 317 ARG A HE     1 
ATOM   5277  H HH11   . ARG A 1 317 ? 24.924  -38.857 104.481 1.00 62.42  ? 317 ARG A HH11   1 
ATOM   5278  H HH12   . ARG A 1 317 ? 26.182  -39.614 104.226 1.00 62.42  ? 317 ARG A HH12   1 
ATOM   5279  H HH21   . ARG A 1 317 ? 27.663  -37.359 102.340 1.00 60.62  ? 317 ARG A HH21   1 
ATOM   5280  H HH22   . ARG A 1 317 ? 27.828  -38.713 102.939 1.00 60.62  ? 317 ARG A HH22   1 
ATOM   5281  N N      . SER A 1 318 ? 20.870  -34.039 100.936 1.00 33.89  ? 318 SER A N      1 
ATOM   5282  C CA     . SER A 1 318 ? 20.227  -34.156 99.642  1.00 33.80  ? 318 SER A CA     1 
ATOM   5283  C C      . SER A 1 318 ? 21.132  -34.890 98.678  1.00 39.76  ? 318 SER A C      1 
ATOM   5284  O O      . SER A 1 318 ? 22.352  -34.760 98.733  1.00 43.36  ? 318 SER A O      1 
ATOM   5285  C CB     . SER A 1 318 ? 19.876  -32.784 99.097  1.00 32.89  ? 318 SER A CB     1 
ATOM   5286  O OG     . SER A 1 318 ? 21.049  -32.060 98.797  1.00 35.01  ? 318 SER A OG     1 
ATOM   5287  H H      . SER A 1 318 ? 21.702  -33.828 100.896 1.00 41.06  ? 318 SER A H      1 
ATOM   5288  H HA     . SER A 1 318 ? 19.407  -34.664 99.737  1.00 40.96  ? 318 SER A HA     1 
ATOM   5289  H HB2    . SER A 1 318 ? 19.352  -32.889 98.287  1.00 39.85  ? 318 SER A HB2    1 
ATOM   5290  H HB3    . SER A 1 318 ? 19.365  -32.299 99.763  1.00 39.85  ? 318 SER A HB3    1 
ATOM   5291  H HG     . SER A 1 318 ? 20.850  -31.301 98.496  1.00 42.41  ? 318 SER A HG     1 
ATOM   5292  N N      . ALA A 1 319 ? 20.522  -35.653 97.783  1.00 43.23  ? 319 ALA A N      1 
ATOM   5293  C CA     . ALA A 1 319 ? 21.255  -36.345 96.737  1.00 44.94  ? 319 ALA A CA     1 
ATOM   5294  C C      . ALA A 1 319 ? 20.528  -36.222 95.411  1.00 41.47  ? 319 ALA A C      1 
ATOM   5295  O O      . ALA A 1 319 ? 19.505  -35.548 95.317  1.00 43.32  ? 319 ALA A O      1 
ATOM   5296  C CB     . ALA A 1 319 ? 21.441  -37.808 97.107  1.00 47.07  ? 319 ALA A CB     1 
ATOM   5297  H H      . ALA A 1 319 ? 19.673  -35.787 97.760  1.00 52.27  ? 319 ALA A H      1 
ATOM   5298  H HA     . ALA A 1 319 ? 22.133  -35.942 96.642  1.00 54.32  ? 319 ALA A HA     1 
ATOM   5299  H HB1    . ALA A 1 319 ? 21.932  -38.252 96.398  1.00 56.88  ? 319 ALA A HB1    1 
ATOM   5300  H HB2    . ALA A 1 319 ? 21.938  -37.862 97.938  1.00 56.88  ? 319 ALA A HB2    1 
ATOM   5301  H HB3    . ALA A 1 319 ? 20.569  -38.219 97.214  1.00 56.88  ? 319 ALA A HB3    1 
ATOM   5302  N N      . PHE A 1 320 ? 21.051  -36.881 94.386  1.00 36.55  ? 320 PHE A N      1 
ATOM   5303  C CA     . PHE A 1 320 ? 20.287  -37.062 93.162  1.00 39.69  ? 320 PHE A CA     1 
ATOM   5304  C C      . PHE A 1 320 ? 20.757  -38.292 92.416  1.00 43.34  ? 320 PHE A C      1 
ATOM   5305  O O      . PHE A 1 320 ? 21.706  -38.950 92.837  1.00 49.13  ? 320 PHE A O      1 
ATOM   5306  C CB     . PHE A 1 320 ? 20.379  -35.824 92.256  1.00 40.30  ? 320 PHE A CB     1 
ATOM   5307  C CG     . PHE A 1 320 ? 21.782  -35.412 91.917  1.00 43.05  ? 320 PHE A CG     1 
ATOM   5308  C CD1    . PHE A 1 320 ? 22.606  -36.233 91.162  1.00 42.47  ? 320 PHE A CD1    1 
ATOM   5309  C CD2    . PHE A 1 320 ? 22.277  -34.194 92.349  1.00 43.33  ? 320 PHE A CD2    1 
ATOM   5310  C CE1    . PHE A 1 320 ? 23.898  -35.853 90.852  1.00 39.30  ? 320 PHE A CE1    1 
ATOM   5311  C CE2    . PHE A 1 320 ? 23.573  -33.808 92.041  1.00 39.71  ? 320 PHE A CE2    1 
ATOM   5312  C CZ     . PHE A 1 320 ? 24.378  -34.639 91.286  1.00 37.84  ? 320 PHE A CZ     1 
ATOM   5313  H H      . PHE A 1 320 ? 21.837  -37.230 94.374  1.00 44.26  ? 320 PHE A H      1 
ATOM   5314  H HA     . PHE A 1 320 ? 19.354  -37.192 93.392  1.00 48.02  ? 320 PHE A HA     1 
ATOM   5315  H HB2    . PHE A 1 320 ? 19.917  -36.012 91.424  1.00 48.75  ? 320 PHE A HB2    1 
ATOM   5316  H HB3    . PHE A 1 320 ? 19.952  -35.077 92.705  1.00 48.75  ? 320 PHE A HB3    1 
ATOM   5317  H HD1    . PHE A 1 320 ? 22.286  -37.054 90.864  1.00 51.35  ? 320 PHE A HD1    1 
ATOM   5318  H HD2    . PHE A 1 320 ? 21.738  -33.631 92.856  1.00 52.39  ? 320 PHE A HD2    1 
ATOM   5319  H HE1    . PHE A 1 320 ? 24.439  -36.413 90.345  1.00 47.56  ? 320 PHE A HE1    1 
ATOM   5320  H HE2    . PHE A 1 320 ? 23.897  -32.988 92.335  1.00 48.04  ? 320 PHE A HE2    1 
ATOM   5321  H HZ     . PHE A 1 320 ? 25.248  -34.381 91.079  1.00 45.80  ? 320 PHE A HZ     1 
ATOM   5322  N N      . LYS A 1 321 ? 20.081  -38.594 91.312  1.00 39.21  ? 321 LYS A N      1 
ATOM   5323  C CA     . LYS A 1 321 ? 20.394  -39.767 90.505  1.00 36.23  ? 321 LYS A CA     1 
ATOM   5324  C C      . LYS A 1 321 ? 19.969  -39.524 89.082  1.00 36.65  ? 321 LYS A C      1 
ATOM   5325  O O      . LYS A 1 321 ? 18.976  -38.839 88.855  1.00 41.61  ? 321 LYS A O      1 
ATOM   5326  C CB     . LYS A 1 321 ? 19.664  -40.985 91.051  1.00 36.99  ? 321 LYS A CB     1 
ATOM   5327  C CG     . LYS A 1 321 ? 20.404  -42.277 90.927  1.00 39.37  ? 321 LYS A CG     1 
ATOM   5328  C CD     . LYS A 1 321 ? 20.279  -42.875 89.575  1.00 43.04  ? 321 LYS A CD     1 
ATOM   5329  C CE     . LYS A 1 321 ? 20.994  -44.203 89.539  1.00 49.17  ? 321 LYS A CE     1 
ATOM   5330  N NZ     . LYS A 1 321 ? 20.489  -45.134 90.594  1.00 52.61  ? 321 LYS A NZ     1 
ATOM   5331  H H      . LYS A 1 321 ? 19.428  -38.128 91.005  1.00 47.44  ? 321 LYS A H      1 
ATOM   5332  H HA     . LYS A 1 321 ? 21.348  -39.937 90.524  1.00 43.87  ? 321 LYS A HA     1 
ATOM   5333  H HB2    . LYS A 1 321 ? 19.485  -40.840 91.993  1.00 44.78  ? 321 LYS A HB2    1 
ATOM   5334  H HB3    . LYS A 1 321 ? 18.825  -41.082 90.572  1.00 44.78  ? 321 LYS A HB3    1 
ATOM   5335  H HG2    . LYS A 1 321 ? 21.345  -42.121 91.101  1.00 47.63  ? 321 LYS A HG2    1 
ATOM   5336  H HG3    . LYS A 1 321 ? 20.047  -42.910 91.570  1.00 47.63  ? 321 LYS A HG3    1 
ATOM   5337  H HD2    . LYS A 1 321 ? 19.343  -43.022 89.369  1.00 52.04  ? 321 LYS A HD2    1 
ATOM   5338  H HD3    . LYS A 1 321 ? 20.686  -42.287 88.920  1.00 52.04  ? 321 LYS A HD3    1 
ATOM   5339  H HE2    . LYS A 1 321 ? 20.851  -44.619 88.674  1.00 59.39  ? 321 LYS A HE2    1 
ATOM   5340  H HE3    . LYS A 1 321 ? 21.941  -44.060 89.689  1.00 59.39  ? 321 LYS A HE3    1 
ATOM   5341  H HZ1    . LYS A 1 321 ? 20.925  -45.908 90.551  1.00 63.53  ? 321 LYS A HZ1    1 
ATOM   5342  H HZ2    . LYS A 1 321 ? 20.613  -44.776 91.400  1.00 63.53  ? 321 LYS A HZ2    1 
ATOM   5343  H HZ3    . LYS A 1 321 ? 19.619  -45.285 90.476  1.00 63.53  ? 321 LYS A HZ3    1 
ATOM   5344  N N      . ALA A 1 322 ? 20.699  -40.066 88.119  1.00 30.94  ? 322 ALA A N      1 
ATOM   5345  C CA     . ALA A 1 322 ? 20.220  -40.047 86.741  1.00 34.08  ? 322 ALA A CA     1 
ATOM   5346  C C      . ALA A 1 322 ? 20.111  -41.471 86.143  1.00 39.20  ? 322 ALA A C      1 
ATOM   5347  O O      . ALA A 1 322 ? 21.115  -42.136 85.844  1.00 42.61  ? 322 ALA A O      1 
ATOM   5348  C CB     . ALA A 1 322 ? 21.126  -39.164 85.891  1.00 33.24  ? 322 ALA A CB     1 
ATOM   5349  H H      . ALA A 1 322 ? 21.462  -40.445 88.231  1.00 37.40  ? 322 ALA A H      1 
ATOM   5350  H HA     . ALA A 1 322 ? 19.333  -39.656 86.727  1.00 41.29  ? 322 ALA A HA     1 
ATOM   5351  H HB1    . ALA A 1 322 ? 20.797  -39.161 84.978  1.00 40.28  ? 322 ALA A HB1    1 
ATOM   5352  H HB2    . ALA A 1 322 ? 21.115  -38.263 86.250  1.00 40.28  ? 322 ALA A HB2    1 
ATOM   5353  H HB3    . ALA A 1 322 ? 22.028  -39.520 85.917  1.00 40.28  ? 322 ALA A HB3    1 
ATOM   5354  N N      . SER A 1 323 ? 18.875  -41.920 85.962  1.00 39.14  ? 323 SER A N      1 
ATOM   5355  C CA     . SER A 1 323 ? 18.587  -43.175 85.291  1.00 40.30  ? 323 SER A CA     1 
ATOM   5356  C C      . SER A 1 323 ? 18.545  -42.875 83.788  1.00 46.40  ? 323 SER A C      1 
ATOM   5357  O O      . SER A 1 323 ? 18.944  -41.792 83.365  1.00 45.61  ? 323 SER A O      1 
ATOM   5358  C CB     . SER A 1 323 ? 17.274  -43.759 85.797  1.00 42.16  ? 323 SER A CB     1 
ATOM   5359  O OG     . SER A 1 323 ? 17.263  -45.161 85.657  1.00 47.19  ? 323 SER A OG     1 
ATOM   5360  H H      . SER A 1 323 ? 18.171  -41.504 86.227  1.00 47.36  ? 323 SER A H      1 
ATOM   5361  H HA     . SER A 1 323 ? 19.299  -43.811 85.463  1.00 48.75  ? 323 SER A HA     1 
ATOM   5362  H HB2    . SER A 1 323 ? 17.169  -43.535 86.735  1.00 50.98  ? 323 SER A HB2    1 
ATOM   5363  H HB3    . SER A 1 323 ? 16.542  -43.385 85.282  1.00 50.98  ? 323 SER A HB3    1 
ATOM   5364  H HG     . SER A 1 323 ? 16.535  -45.472 85.939  1.00 57.02  ? 323 SER A HG     1 
ATOM   5365  N N      . GLU A 1 324 ? 18.091  -43.808 82.965  1.00 56.30  ? 324 GLU A N      1 
ATOM   5366  C CA     . GLU A 1 324 ? 18.011  -43.513 81.537  1.00 68.55  ? 324 GLU A CA     1 
ATOM   5367  C C      . GLU A 1 324 ? 16.817  -42.641 81.204  1.00 72.43  ? 324 GLU A C      1 
ATOM   5368  O O      . GLU A 1 324 ? 16.887  -41.790 80.323  1.00 78.10  ? 324 GLU A O      1 
ATOM   5369  C CB     . GLU A 1 324 ? 17.948  -44.804 80.711  1.00 76.07  ? 324 GLU A CB     1 
ATOM   5370  C CG     . GLU A 1 324 ? 19.317  -45.340 80.327  1.00 81.25  ? 324 GLU A CG     1 
ATOM   5371  C CD     . GLU A 1 324 ? 20.025  -44.430 79.328  1.00 82.41  ? 324 GLU A CD     1 
ATOM   5372  O OE1    . GLU A 1 324 ? 21.098  -43.874 79.668  1.00 81.74  ? 324 GLU A OE1    1 
ATOM   5373  O OE2    . GLU A 1 324 ? 19.486  -44.255 78.212  1.00 79.79  ? 324 GLU A OE2    1 
ATOM   5374  H H      . GLU A 1 324 ? 17.832  -44.595 83.194  1.00 67.95  ? 324 GLU A H      1 
ATOM   5375  H HA     . GLU A 1 324 ? 18.810  -43.032 81.274  1.00 82.65  ? 324 GLU A HA     1 
ATOM   5376  H HB2    . GLU A 1 324 ? 17.495  -45.487 81.229  1.00 91.68  ? 324 GLU A HB2    1 
ATOM   5377  H HB3    . GLU A 1 324 ? 17.457  -44.630 79.893  1.00 91.68  ? 324 GLU A HB3    1 
ATOM   5378  H HG2    . GLU A 1 324 ? 19.869  -45.404 81.122  1.00 97.89  ? 324 GLU A HG2    1 
ATOM   5379  H HG3    . GLU A 1 324 ? 19.214  -46.214 79.920  1.00 97.89  ? 324 GLU A HG3    1 
ATOM   5380  N N      . GLU A 1 325 ? 15.730  -42.848 81.925  1.00 70.42  ? 325 GLU A N      1 
ATOM   5381  C CA     . GLU A 1 325 ? 14.499  -42.110 81.702  1.00 68.75  ? 325 GLU A CA     1 
ATOM   5382  C C      . GLU A 1 325 ? 14.382  -40.948 82.663  1.00 65.83  ? 325 GLU A C      1 
ATOM   5383  O O      . GLU A 1 325 ? 14.260  -39.803 82.244  1.00 67.30  ? 325 GLU A O      1 
ATOM   5384  C CB     . GLU A 1 325 ? 13.302  -43.035 81.829  1.00 72.10  ? 325 GLU A CB     1 
ATOM   5385  C CG     . GLU A 1 325 ? 13.233  -44.024 80.696  1.00 78.67  ? 325 GLU A CG     1 
ATOM   5386  C CD     . GLU A 1 325 ? 12.049  -44.947 80.806  1.00 83.61  ? 325 GLU A CD     1 
ATOM   5387  O OE1    . GLU A 1 325 ? 11.253  -44.766 81.757  1.00 83.39  ? 325 GLU A OE1    1 
ATOM   5388  O OE2    . GLU A 1 325 ? 11.916  -45.846 79.939  1.00 85.01  ? 325 GLU A OE2    1 
ATOM   5389  H H      . GLU A 1 325 ? 15.678  -43.422 82.563  1.00 84.90  ? 325 GLU A H      1 
ATOM   5390  H HA     . GLU A 1 325 ? 14.506  -41.753 80.801  1.00 82.90  ? 325 GLU A HA     1 
ATOM   5391  H HB2    . GLU A 1 325 ? 13.368  -43.531 82.660  1.00 86.92  ? 325 GLU A HB2    1 
ATOM   5392  H HB3    . GLU A 1 325 ? 12.488  -42.506 81.819  1.00 86.92  ? 325 GLU A HB3    1 
ATOM   5393  H HG2    . GLU A 1 325 ? 13.161  -43.541 79.858  1.00 94.79  ? 325 GLU A HG2    1 
ATOM   5394  H HG3    . GLU A 1 325 ? 14.038  -44.566 80.699  1.00 94.79  ? 325 GLU A HG3    1 
ATOM   5395  N N      . PHE A 1 326 ? 14.425  -41.262 83.954  1.00 60.99  ? 326 PHE A N      1 
ATOM   5396  C CA     . PHE A 1 326 ? 14.048  -40.323 84.992  1.00 54.40  ? 326 PHE A CA     1 
ATOM   5397  C C      . PHE A 1 326 ? 15.250  -39.790 85.772  1.00 56.24  ? 326 PHE A C      1 
ATOM   5398  O O      . PHE A 1 326 ? 16.299  -40.432 85.834  1.00 62.43  ? 326 PHE A O      1 
ATOM   5399  C CB     . PHE A 1 326 ? 13.106  -41.009 85.968  1.00 48.59  ? 326 PHE A CB     1 
ATOM   5400  C CG     . PHE A 1 326 ? 11.926  -41.651 85.320  1.00 49.17  ? 326 PHE A CG     1 
ATOM   5401  C CD1    . PHE A 1 326 ? 10.824  -40.903 84.941  1.00 48.19  ? 326 PHE A CD1    1 
ATOM   5402  C CD2    . PHE A 1 326 ? 11.902  -43.021 85.127  1.00 53.99  ? 326 PHE A CD2    1 
ATOM   5403  C CE1    . PHE A 1 326 ? 9.730   -41.505 84.353  1.00 48.14  ? 326 PHE A CE1    1 
ATOM   5404  C CE2    . PHE A 1 326 ? 10.803  -43.633 84.539  1.00 56.23  ? 326 PHE A CE2    1 
ATOM   5405  C CZ     . PHE A 1 326 ? 9.717   -42.870 84.155  1.00 53.33  ? 326 PHE A CZ     1 
ATOM   5406  H H      . PHE A 1 326 ? 14.675  -42.028 84.255  1.00 73.58  ? 326 PHE A H      1 
ATOM   5407  H HA     . PHE A 1 326 ? 13.583  -39.571 84.593  1.00 65.67  ? 326 PHE A HA     1 
ATOM   5408  H HB2    . PHE A 1 326 ? 13.596  -41.699 86.441  1.00 58.70  ? 326 PHE A HB2    1 
ATOM   5409  H HB3    . PHE A 1 326 ? 12.776  -40.350 86.598  1.00 58.70  ? 326 PHE A HB3    1 
ATOM   5410  H HD1    . PHE A 1 326 ? 10.827  -39.982 85.070  1.00 58.21  ? 326 PHE A HD1    1 
ATOM   5411  H HD2    . PHE A 1 326 ? 12.633  -43.536 85.384  1.00 65.17  ? 326 PHE A HD2    1 
ATOM   5412  H HE1    . PHE A 1 326 ? 8.999   -40.991 84.096  1.00 58.16  ? 326 PHE A HE1    1 
ATOM   5413  H HE2    . PHE A 1 326 ? 10.798  -44.553 84.405  1.00 67.87  ? 326 PHE A HE2    1 
ATOM   5414  H HZ     . PHE A 1 326 ? 8.980   -43.277 83.760  1.00 64.39  ? 326 PHE A HZ     1 
ATOM   5415  N N      . CYS A 1 327 ? 15.088  -38.598 86.342  1.00 48.94  ? 327 CYS A N      1 
ATOM   5416  C CA     . CYS A 1 327 ? 16.063  -38.021 87.261  1.00 44.10  ? 327 CYS A CA     1 
ATOM   5417  C C      . CYS A 1 327 ? 15.416  -37.857 88.626  1.00 42.76  ? 327 CYS A C      1 
ATOM   5418  O O      . CYS A 1 327 ? 14.236  -37.517 88.719  1.00 46.50  ? 327 CYS A O      1 
ATOM   5419  C CB     . CYS A 1 327 ? 16.557  -36.666 86.743  1.00 44.23  ? 327 CYS A CB     1 
ATOM   5420  S SG     . CYS A 1 327 ? 17.418  -36.744 85.159  1.00 48.94  ? 327 CYS A SG     1 
ATOM   5421  H H      . CYS A 1 327 ? 14.405  -38.093 86.207  1.00 59.12  ? 327 CYS A H      1 
ATOM   5422  H HA     . CYS A 1 327 ? 16.823  -38.617 87.347  1.00 53.31  ? 327 CYS A HA     1 
ATOM   5423  H HB2    . CYS A 1 327 ? 15.793  -36.078 86.634  1.00 53.46  ? 327 CYS A HB2    1 
ATOM   5424  H HB3    . CYS A 1 327 ? 17.170  -36.290 87.393  1.00 53.46  ? 327 CYS A HB3    1 
ATOM   5425  H HG     . CYS A 1 327 ? 18.379  -37.455 85.271  1.00 59.12  ? 327 CYS A HG     1 
ATOM   5426  N N      . TYR A 1 328 ? 16.194  -38.049 89.685  1.00 39.88  ? 328 TYR A N      1 
ATOM   5427  C CA     . TYR A 1 328 ? 15.660  -38.021 91.046  1.00 38.22  ? 328 TYR A CA     1 
ATOM   5428  C C      . TYR A 1 328 ? 16.427  -37.025 91.896  1.00 41.03  ? 328 TYR A C      1 
ATOM   5429  O O      . TYR A 1 328 ? 17.651  -37.017 91.870  1.00 45.67  ? 328 TYR A O      1 
ATOM   5430  C CB     . TYR A 1 328 ? 15.706  -39.428 91.666  1.00 39.19  ? 328 TYR A CB     1 
ATOM   5431  C CG     . TYR A 1 328 ? 14.970  -40.484 90.843  1.00 46.59  ? 328 TYR A CG     1 
ATOM   5432  C CD1    . TYR A 1 328 ? 15.484  -40.965 89.635  1.00 46.49  ? 328 TYR A CD1    1 
ATOM   5433  C CD2    . TYR A 1 328 ? 13.752  -41.000 91.281  1.00 45.61  ? 328 TYR A CD2    1 
ATOM   5434  C CE1    . TYR A 1 328 ? 14.797  -41.924 88.892  1.00 45.36  ? 328 TYR A CE1    1 
ATOM   5435  C CE2    . TYR A 1 328 ? 13.060  -41.954 90.545  1.00 43.66  ? 328 TYR A CE2    1 
ATOM   5436  C CZ     . TYR A 1 328 ? 13.585  -42.414 89.359  1.00 47.38  ? 328 TYR A CZ     1 
ATOM   5437  O OH     . TYR A 1 328 ? 12.883  -43.362 88.645  1.00 50.57  ? 328 TYR A OH     1 
ATOM   5438  H H      . TYR A 1 328 ? 17.039  -38.199 89.643  1.00 48.24  ? 328 TYR A H      1 
ATOM   5439  H HA     . TYR A 1 328 ? 14.733  -37.738 91.016  1.00 46.26  ? 328 TYR A HA     1 
ATOM   5440  H HB2    . TYR A 1 328 ? 16.633  -39.706 91.744  1.00 47.42  ? 328 TYR A HB2    1 
ATOM   5441  H HB3    . TYR A 1 328 ? 15.297  -39.397 92.545  1.00 47.42  ? 328 TYR A HB3    1 
ATOM   5442  H HD1    . TYR A 1 328 ? 16.295  -40.637 89.320  1.00 56.18  ? 328 TYR A HD1    1 
ATOM   5443  H HD2    . TYR A 1 328 ? 13.390  -40.694 92.080  1.00 55.12  ? 328 TYR A HD2    1 
ATOM   5444  H HE1    . TYR A 1 328 ? 15.150  -42.235 88.089  1.00 54.82  ? 328 TYR A HE1    1 
ATOM   5445  H HE2    . TYR A 1 328 ? 12.248  -42.285 90.855  1.00 52.78  ? 328 TYR A HE2    1 
ATOM   5446  H HH     . TYR A 1 328 ? 12.174  -43.559 89.050  1.00 61.08  ? 328 TYR A HH     1 
ATOM   5447  N N      . LEU A 1 329 ? 15.700  -36.135 92.576  1.00 38.56  ? 329 LEU A N      1 
ATOM   5448  C CA     . LEU A 1 329 ? 16.284  -35.214 93.556  1.00 31.00  ? 329 LEU A CA     1 
ATOM   5449  C C      . LEU A 1 329 ? 15.849  -35.693 94.943  1.00 31.89  ? 329 LEU A C      1 
ATOM   5450  O O      . LEU A 1 329 ? 14.672  -35.612 95.289  1.00 37.60  ? 329 LEU A O      1 
ATOM   5451  C CB     . LEU A 1 329 ? 15.833  -33.774 93.301  1.00 29.38  ? 329 LEU A CB     1 
ATOM   5452  C CG     . LEU A 1 329 ? 16.114  -33.223 91.894  1.00 31.28  ? 329 LEU A CG     1 
ATOM   5453  C CD1    . LEU A 1 329 ? 15.431  -31.883 91.647  1.00 28.79  ? 329 LEU A CD1    1 
ATOM   5454  C CD2    . LEU A 1 329 ? 17.603  -33.078 91.677  1.00 30.55  ? 329 LEU A CD2    1 
ATOM   5455  H H      . LEU A 1 329 ? 14.850  -36.043 92.484  1.00 46.67  ? 329 LEU A H      1 
ATOM   5456  H HA     . LEU A 1 329 ? 17.252  -35.251 93.504  1.00 37.59  ? 329 LEU A HA     1 
ATOM   5457  H HB2    . LEU A 1 329 ? 14.875  -33.724 93.446  1.00 35.65  ? 329 LEU A HB2    1 
ATOM   5458  H HB3    . LEU A 1 329 ? 16.285  -33.196 93.935  1.00 35.65  ? 329 LEU A HB3    1 
ATOM   5459  H HG     . LEU A 1 329 ? 15.778  -33.853 91.238  1.00 37.93  ? 329 LEU A HG     1 
ATOM   5460  H HD11   . LEU A 1 329 ? 15.642  -31.584 90.748  1.00 34.94  ? 329 LEU A HD11   1 
ATOM   5461  H HD12   . LEU A 1 329 ? 14.473  -31.995 91.743  1.00 34.94  ? 329 LEU A HD12   1 
ATOM   5462  H HD13   . LEU A 1 329 ? 15.756  -31.239 92.295  1.00 34.94  ? 329 LEU A HD13   1 
ATOM   5463  H HD21   . LEU A 1 329 ? 17.759  -32.730 90.786  1.00 37.05  ? 329 LEU A HD21   1 
ATOM   5464  H HD22   . LEU A 1 329 ? 17.960  -32.466 92.340  1.00 37.05  ? 329 LEU A HD22   1 
ATOM   5465  H HD23   . LEU A 1 329 ? 18.021  -33.948 91.771  1.00 37.05  ? 329 LEU A HD23   1 
ATOM   5466  N N      . LEU A 1 330 ? 16.796  -36.220 95.714  1.00 30.56  ? 330 LEU A N      1 
ATOM   5467  C CA     . LEU A 1 330 ? 16.520  -36.884 96.997  1.00 32.78  ? 330 LEU A CA     1 
ATOM   5468  C C      . LEU A 1 330 ? 16.610  -35.986 98.241  1.00 32.58  ? 330 LEU A C      1 
ATOM   5469  O O      . LEU A 1 330 ? 17.508  -35.152 98.340  1.00 37.42  ? 330 LEU A O      1 
ATOM   5470  C CB     . LEU A 1 330 ? 17.488  -38.053 97.158  1.00 33.57  ? 330 LEU A CB     1 
ATOM   5471  C CG     . LEU A 1 330 ? 17.292  -39.124 96.102  1.00 28.73  ? 330 LEU A CG     1 
ATOM   5472  C CD1    . LEU A 1 330 ? 18.494  -40.028 96.056  1.00 30.72  ? 330 LEU A CD1    1 
ATOM   5473  C CD2    . LEU A 1 330 ? 16.042  -39.892 96.419  1.00 30.34  ? 330 LEU A CD2    1 
ATOM   5474  H H      . LEU A 1 330 ? 17.632  -36.207 95.513  1.00 37.07  ? 330 LEU A H      1 
ATOM   5475  H HA     . LEU A 1 330 ? 15.621  -37.249 96.967  1.00 39.73  ? 330 LEU A HA     1 
ATOM   5476  H HB2    . LEU A 1 330 ? 18.397  -37.723 97.085  1.00 40.67  ? 330 LEU A HB2    1 
ATOM   5477  H HB3    . LEU A 1 330 ? 17.351  -38.460 98.027  1.00 40.67  ? 330 LEU A HB3    1 
ATOM   5478  H HG     . LEU A 1 330 ? 17.186  -38.707 95.232  1.00 34.87  ? 330 LEU A HG     1 
ATOM   5479  H HD11   . LEU A 1 330 ? 18.352  -40.707 95.377  1.00 37.26  ? 330 LEU A HD11   1 
ATOM   5480  H HD12   . LEU A 1 330 ? 19.277  -39.500 95.838  1.00 37.26  ? 330 LEU A HD12   1 
ATOM   5481  H HD13   . LEU A 1 330 ? 18.606  -40.447 96.924  1.00 37.26  ? 330 LEU A HD13   1 
ATOM   5482  H HD21   . LEU A 1 330 ? 15.913  -40.578 95.745  1.00 36.79  ? 330 LEU A HD21   1 
ATOM   5483  H HD22   . LEU A 1 330 ? 16.136  -40.300 97.294  1.00 36.79  ? 330 LEU A HD22   1 
ATOM   5484  H HD23   . LEU A 1 330 ? 15.288  -39.281 96.418  1.00 36.79  ? 330 LEU A HD23   1 
ATOM   5485  N N      . PHE A 1 331 ? 15.682  -36.135 99.178  1.00 27.41  ? 331 PHE A N      1 
ATOM   5486  C CA     . PHE A 1 331 ? 15.766  -35.381 100.425 1.00 29.24  ? 331 PHE A CA     1 
ATOM   5487  C C      . PHE A 1 331 ? 15.394  -36.189 101.672 1.00 34.19  ? 331 PHE A C      1 
ATOM   5488  O O      . PHE A 1 331 ? 14.634  -37.159 101.610 1.00 39.26  ? 331 PHE A O      1 
ATOM   5489  C CB     . PHE A 1 331 ? 14.875  -34.141 100.338 1.00 29.54  ? 331 PHE A CB     1 
ATOM   5490  C CG     . PHE A 1 331 ? 15.280  -33.182 99.253  1.00 31.38  ? 331 PHE A CG     1 
ATOM   5491  C CD1    . PHE A 1 331 ? 14.899  -33.401 97.940  1.00 31.11  ? 331 PHE A CD1    1 
ATOM   5492  C CD2    . PHE A 1 331 ? 16.035  -32.064 99.543  1.00 32.68  ? 331 PHE A CD2    1 
ATOM   5493  C CE1    . PHE A 1 331 ? 15.264  -32.527 96.949  1.00 32.03  ? 331 PHE A CE1    1 
ATOM   5494  C CE2    . PHE A 1 331 ? 16.398  -31.184 98.551  1.00 31.61  ? 331 PHE A CE2    1 
ATOM   5495  C CZ     . PHE A 1 331 ? 16.016  -31.417 97.257  1.00 32.83  ? 331 PHE A CZ     1 
ATOM   5496  H H      . PHE A 1 331 ? 15.002  -36.657 99.120  1.00 33.28  ? 331 PHE A H      1 
ATOM   5497  H HA     . PHE A 1 331 ? 16.680  -35.077 100.538 1.00 35.48  ? 331 PHE A HA     1 
ATOM   5498  H HB2    . PHE A 1 331 ? 13.964  -34.422 100.162 1.00 35.84  ? 331 PHE A HB2    1 
ATOM   5499  H HB3    . PHE A 1 331 ? 14.916  -33.667 101.183 1.00 35.84  ? 331 PHE A HB3    1 
ATOM   5500  H HD1    . PHE A 1 331 ? 14.390  -34.150 97.728  1.00 37.72  ? 331 PHE A HD1    1 
ATOM   5501  H HD2    . PHE A 1 331 ? 16.297  -31.901 100.421 1.00 39.61  ? 331 PHE A HD2    1 
ATOM   5502  H HE1    . PHE A 1 331 ? 15.003  -32.683 96.070  1.00 38.83  ? 331 PHE A HE1    1 
ATOM   5503  H HE2    . PHE A 1 331 ? 16.908  -30.435 98.757  1.00 38.32  ? 331 PHE A HE2    1 
ATOM   5504  H HZ     . PHE A 1 331 ? 16.264  -30.824 96.586  1.00 39.78  ? 331 PHE A HZ     1 
ATOM   5505  N N      . GLU A 1 332 ? 15.940  -35.767 102.806 1.00 32.19  ? 332 GLU A N      1 
ATOM   5506  C CA     . GLU A 1 332 ? 15.562  -36.301 104.104 1.00 30.83  ? 332 GLU A CA     1 
ATOM   5507  C C      . GLU A 1 332 ? 15.482  -35.150 105.099 1.00 32.96  ? 332 GLU A C      1 
ATOM   5508  O O      . GLU A 1 332 ? 16.430  -34.382 105.238 1.00 29.66  ? 332 GLU A O      1 
ATOM   5509  C CB     . GLU A 1 332 ? 16.559  -37.347 104.584 1.00 36.14  ? 332 GLU A CB     1 
ATOM   5510  C CG     . GLU A 1 332 ? 16.246  -37.878 105.970 1.00 43.29  ? 332 GLU A CG     1 
ATOM   5511  C CD     . GLU A 1 332 ? 17.246  -38.915 106.444 1.00 49.37  ? 332 GLU A CD     1 
ATOM   5512  O OE1    . GLU A 1 332 ? 18.469  -38.715 106.241 1.00 50.85  ? 332 GLU A OE1    1 
ATOM   5513  O OE2    . GLU A 1 332 ? 16.809  -39.918 107.047 1.00 49.77  ? 332 GLU A OE2    1 
ATOM   5514  H H      . GLU A 1 332 ? 16.545  -35.158 102.848 1.00 39.01  ? 332 GLU A H      1 
ATOM   5515  H HA     . GLU A 1 332 ? 14.687  -36.716 104.042 1.00 37.39  ? 332 GLU A HA     1 
ATOM   5516  H HB2    . GLU A 1 332 ? 16.550  -38.096 103.968 1.00 43.76  ? 332 GLU A HB2    1 
ATOM   5517  H HB3    . GLU A 1 332 ? 17.443  -36.950 104.609 1.00 43.76  ? 332 GLU A HB3    1 
ATOM   5518  H HG2    . GLU A 1 332 ? 16.258  -37.141 106.600 1.00 52.34  ? 332 GLU A HG2    1 
ATOM   5519  H HG3    . GLU A 1 332 ? 15.369  -38.291 105.959 1.00 52.34  ? 332 GLU A HG3    1 
ATOM   5520  N N      . CYS A 1 333 ? 14.355  -35.039 105.798 1.00 37.50  ? 333 CYS A N      1 
ATOM   5521  C CA     . CYS A 1 333 ? 14.126  -33.923 106.706 1.00 36.07  ? 333 CYS A CA     1 
ATOM   5522  C C      . CYS A 1 333 ? 13.830  -34.430 108.093 1.00 38.22  ? 333 CYS A C      1 
ATOM   5523  O O      . CYS A 1 333 ? 13.232  -35.501 108.255 1.00 38.27  ? 333 CYS A O      1 
ATOM   5524  C CB     . CYS A 1 333 ? 12.968  -33.059 106.223 1.00 36.20  ? 333 CYS A CB     1 
ATOM   5525  S SG     . CYS A 1 333 ? 13.242  -32.324 104.615 1.00 31.34  ? 333 CYS A SG     1 
ATOM   5526  H H      . CYS A 1 333 ? 13.706  -35.602 105.762 1.00 45.39  ? 333 CYS A H      1 
ATOM   5527  H HA     . CYS A 1 333 ? 14.923  -33.372 106.745 1.00 43.68  ? 333 CYS A HA     1 
ATOM   5528  H HB2    . CYS A 1 333 ? 12.170  -33.607 106.167 1.00 43.84  ? 333 CYS A HB2    1 
ATOM   5529  H HB3    . CYS A 1 333 ? 12.828  -32.339 106.858 1.00 43.84  ? 333 CYS A HB3    1 
ATOM   5530  H HG     . CYS A 1 333 ? 12.284  -31.665 104.318 1.00 38.00  ? 333 CYS A HG     1 
ATOM   5531  N N      . GLN A 1 334 ? 14.192  -33.624 109.092 1.00 38.25  ? 334 GLN A N      1 
ATOM   5532  C CA     . GLN A 1 334 ? 13.975  -34.009 110.477 1.00 37.45  ? 334 GLN A CA     1 
ATOM   5533  C C      . GLN A 1 334 ? 12.509  -33.823 110.780 1.00 36.46  ? 334 GLN A C      1 
ATOM   5534  O O      . GLN A 1 334 ? 11.995  -34.438 111.707 1.00 38.10  ? 334 GLN A O      1 
ATOM   5535  C CB     . GLN A 1 334 ? 14.829  -33.180 111.458 1.00 38.14  ? 334 GLN A CB     1 
ATOM   5536  C CG     . GLN A 1 334 ? 16.353  -33.240 111.241 1.00 38.52  ? 334 GLN A CG     1 
ATOM   5537  C CD     . GLN A 1 334 ? 17.179  -32.827 112.484 1.00 39.08  ? 334 GLN A CD     1 
ATOM   5538  O OE1    . GLN A 1 334 ? 16.844  -33.174 113.625 1.00 38.07  ? 334 GLN A OE1    1 
ATOM   5539  N NE2    . GLN A 1 334 ? 18.270  -32.091 112.255 1.00 39.04  ? 334 GLN A NE2    1 
ATOM   5540  H H      . GLN A 1 334 ? 14.563  -32.855 108.991 1.00 46.30  ? 334 GLN A H      1 
ATOM   5541  H HA     . GLN A 1 334 ? 14.197  -34.946 110.591 1.00 45.33  ? 334 GLN A HA     1 
ATOM   5542  H HB2    . GLN A 1 334 ? 14.563  -32.250 111.385 1.00 46.16  ? 334 GLN A HB2    1 
ATOM   5543  H HB3    . GLN A 1 334 ? 14.653  -33.496 112.358 1.00 46.16  ? 334 GLN A HB3    1 
ATOM   5544  H HG2    . GLN A 1 334 ? 16.601  -34.149 111.009 1.00 46.62  ? 334 GLN A HG2    1 
ATOM   5545  H HG3    . GLN A 1 334 ? 16.589  -32.640 110.516 1.00 46.62  ? 334 GLN A HG3    1 
ATOM   5546  H HE21   . GLN A 1 334 ? 18.480  -31.873 111.450 1.00 47.23  ? 334 GLN A HE21   1 
ATOM   5547  H HE22   . GLN A 1 334 ? 18.763  -31.836 112.912 1.00 47.23  ? 334 GLN A HE22   1 
ATOM   5548  N N      . ILE A 1 335 ? 11.837  -32.998 109.973 1.00 36.92  ? 335 ILE A N      1 
ATOM   5549  C CA     . ILE A 1 335 ? 10.452  -32.618 110.224 1.00 37.55  ? 335 ILE A CA     1 
ATOM   5550  C C      . ILE A 1 335 ? 9.457   -33.186 109.207 1.00 42.25  ? 335 ILE A C      1 
ATOM   5551  O O      . ILE A 1 335 ? 9.427   -32.776 108.055 1.00 41.56  ? 335 ILE A O      1 
ATOM   5552  C CB     . ILE A 1 335 ? 10.306  -31.084 110.235 1.00 34.43  ? 335 ILE A CB     1 
ATOM   5553  C CG1    . ILE A 1 335 ? 11.338  -30.446 111.174 1.00 31.65  ? 335 ILE A CG1    1 
ATOM   5554  C CG2    . ILE A 1 335 ? 8.893   -30.680 110.660 1.00 36.38  ? 335 ILE A CG2    1 
ATOM   5555  C CD1    . ILE A 1 335 ? 11.256  -30.910 112.617 1.00 30.89  ? 335 ILE A CD1    1 
ATOM   5556  H H      . ILE A 1 335 ? 12.170  -32.643 109.265 1.00 44.69  ? 335 ILE A H      1 
ATOM   5557  H HA     . ILE A 1 335 ? 10.195  -32.944 111.100 1.00 45.45  ? 335 ILE A HA     1 
ATOM   5558  H HB     . ILE A 1 335 ? 10.463  -30.754 109.337 1.00 41.70  ? 335 ILE A HB     1 
ATOM   5559  H HG12   . ILE A 1 335 ? 12.227  -30.659 110.848 1.00 38.37  ? 335 ILE A HG12   1 
ATOM   5560  H HG13   . ILE A 1 335 ? 11.210  -29.485 111.168 1.00 38.37  ? 335 ILE A HG13   1 
ATOM   5561  H HG21   . ILE A 1 335 ? 8.828   -29.712 110.659 1.00 44.04  ? 335 ILE A HG21   1 
ATOM   5562  H HG22   . ILE A 1 335 ? 8.256   -31.056 110.033 1.00 44.04  ? 335 ILE A HG22   1 
ATOM   5563  H HG23   . ILE A 1 335 ? 8.722   -31.023 111.551 1.00 44.04  ? 335 ILE A HG23   1 
ATOM   5564  H HD11   . ILE A 1 335 ? 11.941  -30.458 113.134 1.00 37.46  ? 335 ILE A HD11   1 
ATOM   5565  H HD12   . ILE A 1 335 ? 10.378  -30.693 112.969 1.00 37.46  ? 335 ILE A HD12   1 
ATOM   5566  H HD13   . ILE A 1 335 ? 11.397  -31.869 112.648 1.00 37.46  ? 335 ILE A HD13   1 
ATOM   5567  N N      . LYS A 1 336 ? 8.648   -34.136 109.661 1.00 43.51  ? 336 LYS A N      1 
ATOM   5568  C CA     . LYS A 1 336 ? 7.562   -34.727 108.873 1.00 38.17  ? 336 LYS A CA     1 
ATOM   5569  C C      . LYS A 1 336 ? 6.272   -33.888 108.856 1.00 35.66  ? 336 LYS A C      1 
ATOM   5570  O O      . LYS A 1 336 ? 5.486   -33.958 107.912 1.00 41.84  ? 336 LYS A O      1 
ATOM   5571  C CB     . LYS A 1 336 ? 7.258   -36.119 109.414 1.00 35.81  ? 336 LYS A CB     1 
ATOM   5572  C CG     . LYS A 1 336 ? 8.363   -37.098 109.180 1.00 31.81  ? 336 LYS A CG     1 
ATOM   5573  C CD     . LYS A 1 336 ? 8.161   -38.340 110.006 1.00 34.95  ? 336 LYS A CD     1 
ATOM   5574  C CE     . LYS A 1 336 ? 6.871   -39.055 109.693 1.00 38.70  ? 336 LYS A CE     1 
ATOM   5575  N NZ     . LYS A 1 336 ? 6.803   -40.355 110.425 1.00 40.05  ? 336 LYS A NZ     1 
ATOM   5576  H H      . LYS A 1 336 ? 8.708   -34.469 110.451 1.00 52.60  ? 336 LYS A H      1 
ATOM   5577  H HA     . LYS A 1 336 ? 7.862   -34.826 107.956 1.00 46.20  ? 336 LYS A HA     1 
ATOM   5578  H HB2    . LYS A 1 336 ? 7.110   -36.059 110.371 1.00 43.36  ? 336 LYS A HB2    1 
ATOM   5579  H HB3    . LYS A 1 336 ? 6.461   -36.458 108.977 1.00 43.36  ? 336 LYS A HB3    1 
ATOM   5580  H HG2    . LYS A 1 336 ? 8.376   -37.351 108.244 1.00 38.56  ? 336 LYS A HG2    1 
ATOM   5581  H HG3    . LYS A 1 336 ? 9.208   -36.695 109.433 1.00 38.56  ? 336 LYS A HG3    1 
ATOM   5582  H HD2    . LYS A 1 336 ? 8.892   -38.954 109.834 1.00 42.33  ? 336 LYS A HD2    1 
ATOM   5583  H HD3    . LYS A 1 336 ? 8.148   -38.095 110.944 1.00 42.33  ? 336 LYS A HD3    1 
ATOM   5584  H HE2    . LYS A 1 336 ? 6.121   -38.506 109.972 1.00 46.84  ? 336 LYS A HE2    1 
ATOM   5585  H HE3    . LYS A 1 336 ? 6.823   -39.235 108.741 1.00 46.84  ? 336 LYS A HE3    1 
ATOM   5586  H HZ1    . LYS A 1 336 ? 6.040   -40.771 110.235 1.00 48.45  ? 336 LYS A HZ1    1 
ATOM   5587  H HZ2    . LYS A 1 336 ? 7.484   -40.875 110.183 1.00 48.45  ? 336 LYS A HZ2    1 
ATOM   5588  H HZ3    . LYS A 1 336 ? 6.845   -40.212 111.302 1.00 48.45  ? 336 LYS A HZ3    1 
ATOM   5589  N N      . GLU A 1 337 ? 6.042   -33.143 109.931 1.00 30.40  ? 337 GLU A N      1 
ATOM   5590  C CA     . GLU A 1 337 ? 4.870   -32.278 110.073 1.00 35.01  ? 337 GLU A CA     1 
ATOM   5591  C C      . GLU A 1 337 ? 5.197   -31.027 110.886 1.00 40.55  ? 337 GLU A C      1 
ATOM   5592  O O      . GLU A 1 337 ? 5.824   -31.136 111.947 1.00 46.95  ? 337 GLU A O      1 
ATOM   5593  C CB     . GLU A 1 337 ? 3.762   -33.053 110.794 1.00 40.13  ? 337 GLU A CB     1 
ATOM   5594  C CG     . GLU A 1 337 ? 2.398   -32.380 110.899 1.00 45.94  ? 337 GLU A CG     1 
ATOM   5595  C CD     . GLU A 1 337 ? 1.395   -33.228 111.706 1.00 49.95  ? 337 GLU A CD     1 
ATOM   5596  O OE1    . GLU A 1 337 ? 1.609   -33.403 112.933 1.00 49.08  ? 337 GLU A OE1    1 
ATOM   5597  O OE2    . GLU A 1 337 ? 0.390   -33.700 111.132 1.00 49.24  ? 337 GLU A OE2    1 
ATOM   5598  H H      . GLU A 1 337 ? 6.564   -33.120 110.614 1.00 36.87  ? 337 GLU A H      1 
ATOM   5599  H HA     . GLU A 1 337 ? 4.549   -32.010 109.198 1.00 42.40  ? 337 GLU A HA     1 
ATOM   5600  H HB2    . GLU A 1 337 ? 3.631   -33.894 110.329 1.00 48.55  ? 337 GLU A HB2    1 
ATOM   5601  H HB3    . GLU A 1 337 ? 4.062   -33.233 111.699 1.00 48.55  ? 337 GLU A HB3    1 
ATOM   5602  H HG2    . GLU A 1 337 ? 2.498   -31.525 111.345 1.00 55.52  ? 337 GLU A HG2    1 
ATOM   5603  H HG3    . GLU A 1 337 ? 2.037   -32.252 110.008 1.00 55.52  ? 337 GLU A HG3    1 
ATOM   5604  N N      . ILE A 1 338 ? 4.763   -29.852 110.423 1.00 37.66  ? 338 ILE A N      1 
ATOM   5605  C CA     . ILE A 1 338 ? 4.927   -28.616 111.208 1.00 40.57  ? 338 ILE A CA     1 
ATOM   5606  C C      . ILE A 1 338 ? 3.558   -27.956 111.463 1.00 44.70  ? 338 ILE A C      1 
ATOM   5607  O O      . ILE A 1 338 ? 2.585   -28.234 110.746 1.00 49.30  ? 338 ILE A O      1 
ATOM   5608  C CB     . ILE A 1 338 ? 5.886   -27.600 110.531 1.00 34.20  ? 338 ILE A CB     1 
ATOM   5609  C CG1    . ILE A 1 338 ? 6.071   -26.381 111.440 1.00 33.15  ? 338 ILE A CG1    1 
ATOM   5610  C CG2    . ILE A 1 338 ? 5.346   -27.147 109.199 1.00 34.77  ? 338 ILE A CG2    1 
ATOM   5611  C CD1    . ILE A 1 338 ? 7.229   -25.490 111.090 1.00 33.27  ? 338 ILE A CD1    1 
ATOM   5612  H H      . ILE A 1 338 ? 4.373   -29.740 109.665 1.00 45.59  ? 338 ILE A H      1 
ATOM   5613  H HA     . ILE A 1 338 ? 5.306   -28.847 112.071 1.00 49.08  ? 338 ILE A HA     1 
ATOM   5614  H HB     . ILE A 1 338 ? 6.747   -28.025 110.394 1.00 41.43  ? 338 ILE A HB     1 
ATOM   5615  H HG12   . ILE A 1 338 ? 5.266   -25.842 111.400 1.00 40.18  ? 338 ILE A HG12   1 
ATOM   5616  H HG13   . ILE A 1 338 ? 6.207   -26.693 112.349 1.00 40.18  ? 338 ILE A HG13   1 
ATOM   5617  H HG21   . ILE A 1 338 ? 5.968   -26.516 108.805 1.00 42.11  ? 338 ILE A HG21   1 
ATOM   5618  H HG22   . ILE A 1 338 ? 5.246   -27.919 108.620 1.00 42.11  ? 338 ILE A HG22   1 
ATOM   5619  H HG23   . ILE A 1 338 ? 4.484   -26.723 109.335 1.00 42.11  ? 338 ILE A HG23   1 
ATOM   5620  H HD11   . ILE A 1 338 ? 7.262   -24.753 111.719 1.00 40.31  ? 338 ILE A HD11   1 
ATOM   5621  H HD12   . ILE A 1 338 ? 8.050   -26.005 111.141 1.00 40.31  ? 338 ILE A HD12   1 
ATOM   5622  H HD13   . ILE A 1 338 ? 7.106   -25.152 110.189 1.00 40.31  ? 338 ILE A HD13   1 
ATOM   5623  N N      . SER A 1 339 ? 3.484   -27.100 112.488 1.00 39.67  ? 339 SER A N      1 
ATOM   5624  C CA     . SER A 1 339 ? 2.233   -26.452 112.873 1.00 37.30  ? 339 SER A CA     1 
ATOM   5625  C C      . SER A 1 339 ? 1.768   -25.502 111.766 1.00 37.55  ? 339 SER A C      1 
ATOM   5626  O O      . SER A 1 339 ? 2.550   -25.131 110.888 1.00 34.60  ? 339 SER A O      1 
ATOM   5627  C CB     . SER A 1 339 ? 2.397   -25.706 114.194 1.00 38.61  ? 339 SER A CB     1 
ATOM   5628  O OG     . SER A 1 339 ? 3.377   -24.691 114.091 1.00 40.35  ? 339 SER A OG     1 
ATOM   5629  H H      . SER A 1 339 ? 4.155   -26.879 112.979 1.00 48.00  ? 339 SER A H      1 
ATOM   5630  H HA     . SER A 1 339 ? 1.549   -27.130 112.994 1.00 45.15  ? 339 SER A HA     1 
ATOM   5631  H HB2    . SER A 1 339 ? 1.549   -25.301 114.435 1.00 46.72  ? 339 SER A HB2    1 
ATOM   5632  H HB3    . SER A 1 339 ? 2.669   -26.336 114.880 1.00 46.72  ? 339 SER A HB3    1 
ATOM   5633  H HG     . SER A 1 339 ? 3.155   -24.136 113.501 1.00 48.82  ? 339 SER A HG     1 
ATOM   5634  N N      . ARG A 1 340 ? 0.485   -25.152 111.780 1.00 39.07  ? 340 ARG A N      1 
ATOM   5635  C CA     . ARG A 1 340 ? -0.075  -24.298 110.744 1.00 42.42  ? 340 ARG A CA     1 
ATOM   5636  C C      . ARG A 1 340 ? 0.336   -22.846 110.982 1.00 44.81  ? 340 ARG A C      1 
ATOM   5637  O O      . ARG A 1 340 ? 0.459   -22.078 110.022 1.00 48.31  ? 340 ARG A O      1 
ATOM   5638  C CB     . ARG A 1 340 ? -1.604  -24.433 110.696 1.00 46.48  ? 340 ARG A CB     1 
ATOM   5639  C CG     . ARG A 1 340 ? -2.206  -24.090 109.342 1.00 48.84  ? 340 ARG A CG     1 
ATOM   5640  C CD     . ARG A 1 340 ? -2.083  -25.298 108.439 1.00 54.72  ? 340 ARG A CD     1 
ATOM   5641  N NE     . ARG A 1 340 ? -2.101  -24.974 107.012 1.00 62.78  ? 340 ARG A NE     1 
ATOM   5642  C CZ     . ARG A 1 340 ? -1.986  -25.880 106.035 1.00 69.04  ? 340 ARG A CZ     1 
ATOM   5643  N NH1    . ARG A 1 340 ? -1.852  -27.173 106.327 1.00 69.80  ? 340 ARG A NH1    1 
ATOM   5644  N NH2    . ARG A 1 340 ? -2.005  -25.502 104.759 1.00 70.03  ? 340 ARG A NH2    1 
ATOM   5645  H H      . ARG A 1 340 ? -0.081  -25.398 112.379 1.00 47.28  ? 340 ARG A H      1 
ATOM   5646  H HA     . ARG A 1 340 ? 0.277   -24.573 109.883 1.00 51.29  ? 340 ARG A HA     1 
ATOM   5647  H HB2    . ARG A 1 340 ? -1.844  -25.350 110.905 1.00 56.17  ? 340 ARG A HB2    1 
ATOM   5648  H HB3    . ARG A 1 340 ? -1.992  -23.834 111.354 1.00 56.17  ? 340 ARG A HB3    1 
ATOM   5649  H HG2    . ARG A 1 340 ? -3.146  -23.871 109.445 1.00 59.00  ? 340 ARG A HG2    1 
ATOM   5650  H HG3    . ARG A 1 340 ? -1.721  -23.351 108.943 1.00 59.00  ? 340 ARG A HG3    1 
ATOM   5651  H HD2    . ARG A 1 340 ? -1.245  -25.746 108.630 1.00 66.05  ? 340 ARG A HD2    1 
ATOM   5652  H HD3    . ARG A 1 340 ? -2.825  -25.897 108.616 1.00 66.05  ? 340 ARG A HD3    1 
ATOM   5653  H HE     . ARG A 1 340 ? -2.223  -24.153 106.787 1.00 75.73  ? 340 ARG A HE     1 
ATOM   5654  H HH11   . ARG A 1 340 ? -1.837  -27.428 107.148 1.00 84.15  ? 340 ARG A HH11   1 
ATOM   5655  H HH12   . ARG A 1 340 ? -1.779  -27.751 105.695 1.00 84.15  ? 340 ARG A HH12   1 
ATOM   5656  H HH21   . ARG A 1 340 ? -2.093  -24.670 104.558 1.00 84.43  ? 340 ARG A HH21   1 
ATOM   5657  H HH22   . ARG A 1 340 ? -1.934  -26.090 104.135 1.00 84.43  ? 340 ARG A HH22   1 
ATOM   5658  N N      . VAL A 1 341 ? 0.542   -22.482 112.256 1.00 39.95  ? 341 VAL A N      1 
ATOM   5659  C CA     . VAL A 1 341 ? 0.876   -21.102 112.652 1.00 33.21  ? 341 VAL A CA     1 
ATOM   5660  C C      . VAL A 1 341 ? 2.340   -20.886 112.955 1.00 35.10  ? 341 VAL A C      1 
ATOM   5661  O O      . VAL A 1 341 ? 3.018   -21.786 113.445 1.00 29.54  ? 341 VAL A O      1 
ATOM   5662  C CB     . VAL A 1 341 ? 0.105   -20.622 113.897 1.00 30.84  ? 341 VAL A CB     1 
ATOM   5663  C CG1    . VAL A 1 341 ? -1.342  -20.402 113.592 1.00 35.51  ? 341 VAL A CG1    1 
ATOM   5664  C CG2    . VAL A 1 341 ? 0.264   -21.600 115.032 1.00 33.37  ? 341 VAL A CG2    1 
ATOM   5665  H H      . VAL A 1 341 ? 0.493   -23.025 112.921 1.00 48.33  ? 341 VAL A H      1 
ATOM   5666  H HA     . VAL A 1 341 ? 0.641   -20.511 111.920 1.00 40.24  ? 341 VAL A HA     1 
ATOM   5667  H HB     . VAL A 1 341 ? 0.477   -19.774 114.185 1.00 37.40  ? 341 VAL A HB     1 
ATOM   5668  H HG11   . VAL A 1 341 ? -1.792  -20.102 114.398 1.00 43.00  ? 341 VAL A HG11   1 
ATOM   5669  H HG12   . VAL A 1 341 ? -1.420  -19.728 112.899 1.00 43.00  ? 341 VAL A HG12   1 
ATOM   5670  H HG13   . VAL A 1 341 ? -1.731  -21.237 113.288 1.00 43.00  ? 341 VAL A HG13   1 
ATOM   5671  H HG21   . VAL A 1 341 ? -0.230  -21.274 115.800 1.00 40.44  ? 341 VAL A HG21   1 
ATOM   5672  H HG22   . VAL A 1 341 ? -0.084  -22.462 114.756 1.00 40.44  ? 341 VAL A HG22   1 
ATOM   5673  H HG23   . VAL A 1 341 ? 1.205   -21.677 115.252 1.00 40.44  ? 341 VAL A HG23   1 
ATOM   5674  N N      . PHE A 1 342 ? 2.811   -19.678 112.650 1.00 42.11  ? 342 PHE A N      1 
ATOM   5675  C CA     . PHE A 1 342 ? 4.161   -19.228 113.003 1.00 43.34  ? 342 PHE A CA     1 
ATOM   5676  C C      . PHE A 1 342 ? 4.178   -17.766 113.463 1.00 42.25  ? 342 PHE A C      1 
ATOM   5677  O O      . PHE A 1 342 ? 3.135   -17.123 113.510 1.00 47.84  ? 342 PHE A O      1 
ATOM   5678  C CB     . PHE A 1 342 ? 5.116   -19.420 111.823 1.00 42.13  ? 342 PHE A CB     1 
ATOM   5679  C CG     . PHE A 1 342 ? 4.676   -18.739 110.559 1.00 39.97  ? 342 PHE A CG     1 
ATOM   5680  C CD1    . PHE A 1 342 ? 3.711   -19.310 109.750 1.00 42.09  ? 342 PHE A CD1    1 
ATOM   5681  C CD2    . PHE A 1 342 ? 5.225   -17.527 110.183 1.00 36.39  ? 342 PHE A CD2    1 
ATOM   5682  C CE1    . PHE A 1 342 ? 3.305   -18.684 108.588 1.00 43.31  ? 342 PHE A CE1    1 
ATOM   5683  C CE2    . PHE A 1 342 ? 4.826   -16.898 109.025 1.00 35.59  ? 342 PHE A CE2    1 
ATOM   5684  C CZ     . PHE A 1 342 ? 3.867   -17.476 108.226 1.00 41.35  ? 342 PHE A CZ     1 
ATOM   5685  H H      . PHE A 1 342 ? 2.355   -19.084 112.227 1.00 50.92  ? 342 PHE A H      1 
ATOM   5686  H HA     . PHE A 1 342 ? 4.487   -19.771 113.738 1.00 52.40  ? 342 PHE A HA     1 
ATOM   5687  H HB2    . PHE A 1 342 ? 5.985   -19.062 112.064 1.00 50.95  ? 342 PHE A HB2    1 
ATOM   5688  H HB3    . PHE A 1 342 ? 5.193   -20.368 111.636 1.00 50.95  ? 342 PHE A HB3    1 
ATOM   5689  H HD1    . PHE A 1 342 ? 3.332   -20.125 109.991 1.00 50.90  ? 342 PHE A HD1    1 
ATOM   5690  H HD2    . PHE A 1 342 ? 5.876   -17.132 110.718 1.00 44.05  ? 342 PHE A HD2    1 
ATOM   5691  H HE1    . PHE A 1 342 ? 2.656   -19.076 108.049 1.00 52.36  ? 342 PHE A HE1    1 
ATOM   5692  H HE2    . PHE A 1 342 ? 5.205   -16.084 108.784 1.00 43.10  ? 342 PHE A HE2    1 
ATOM   5693  H HZ     . PHE A 1 342 ? 3.595   -17.052 107.444 1.00 50.01  ? 342 PHE A HZ     1 
ATOM   5694  N N      . ARG A 1 343 ? 5.364   -17.256 113.802 1.00 37.02  ? 343 ARG A N      1 
ATOM   5695  C CA     . ARG A 1 343 ? 5.532   -15.875 114.261 1.00 37.38  ? 343 ARG A CA     1 
ATOM   5696  C C      . ARG A 1 343 ? 6.276   -15.019 113.244 1.00 42.46  ? 343 ARG A C      1 
ATOM   5697  O O      . ARG A 1 343 ? 7.469   -15.240 113.041 1.00 45.40  ? 343 ARG A O      1 
ATOM   5698  C CB     . ARG A 1 343 ? 6.362   -15.819 115.554 1.00 38.77  ? 343 ARG A CB     1 
ATOM   5699  C CG     . ARG A 1 343 ? 5.806   -16.483 116.788 1.00 42.32  ? 343 ARG A CG     1 
ATOM   5700  C CD     . ARG A 1 343 ? 6.911   -16.626 117.865 1.00 43.00  ? 343 ARG A CD     1 
ATOM   5701  N NE     . ARG A 1 343 ? 7.624   -15.371 118.153 1.00 43.56  ? 343 ARG A NE     1 
ATOM   5702  C CZ     . ARG A 1 343 ? 7.854   -14.868 119.372 1.00 45.26  ? 343 ARG A CZ     1 
ATOM   5703  N NH1    . ARG A 1 343 ? 7.434   -15.480 120.473 1.00 42.65  ? 343 ARG A NH1    1 
ATOM   5704  N NH2    . ARG A 1 343 ? 8.509   -13.724 119.496 1.00 45.89  ? 343 ARG A NH2    1 
ATOM   5705  H H      . ARG A 1 343 ? 6.100   -17.699 113.774 1.00 44.82  ? 343 ARG A H      1 
ATOM   5706  H HA     . ARG A 1 343 ? 4.664   -15.476 114.429 1.00 45.25  ? 343 ARG A HA     1 
ATOM   5707  H HB2    . ARG A 1 343 ? 7.220   -16.234 115.374 1.00 46.91  ? 343 ARG A HB2    1 
ATOM   5708  H HB3    . ARG A 1 343 ? 6.504   -14.886 115.777 1.00 46.91  ? 343 ARG A HB3    1 
ATOM   5709  H HG2    . ARG A 1 343 ? 5.089   -15.941 117.153 1.00 51.18  ? 343 ARG A HG2    1 
ATOM   5710  H HG3    . ARG A 1 343 ? 5.481   -17.368 116.561 1.00 51.18  ? 343 ARG A HG3    1 
ATOM   5711  H HD2    . ARG A 1 343 ? 6.505   -16.933 118.691 1.00 51.99  ? 343 ARG A HD2    1 
ATOM   5712  H HD3    . ARG A 1 343 ? 7.564   -17.274 117.559 1.00 51.99  ? 343 ARG A HD3    1 
ATOM   5713  H HE     . ARG A 1 343 ? 7.918   -14.922 117.481 1.00 52.66  ? 343 ARG A HE     1 
ATOM   5714  H HH11   . ARG A 1 343 ? 7.005   -16.223 120.415 1.00 51.57  ? 343 ARG A HH11   1 
ATOM   5715  H HH12   . ARG A 1 343 ? 7.593   -15.135 121.244 1.00 51.57  ? 343 ARG A HH12   1 
ATOM   5716  H HH21   . ARG A 1 343 ? 8.788   -13.311 118.795 1.00 55.46  ? 343 ARG A HH21   1 
ATOM   5717  H HH22   . ARG A 1 343 ? 8.657   -13.396 120.277 1.00 55.46  ? 343 ARG A HH22   1 
ATOM   5718  N N      . ARG A 1 344 ? 5.612   -14.054 112.601 1.00 42.06  ? 344 ARG A N      1 
ATOM   5719  C CA     . ARG A 1 344 ? 6.354   -13.051 111.833 1.00 42.76  ? 344 ARG A CA     1 
ATOM   5720  C C      . ARG A 1 344 ? 6.768   -11.916 112.765 1.00 40.70  ? 344 ARG A C      1 
ATOM   5721  O O      . ARG A 1 344 ? 5.992   -11.497 113.621 1.00 43.24  ? 344 ARG A O      1 
ATOM   5722  C CB     . ARG A 1 344 ? 5.570   -12.469 110.654 1.00 46.70  ? 344 ARG A CB     1 
ATOM   5723  C CG     . ARG A 1 344 ? 6.460   -11.486 109.840 1.00 56.76  ? 344 ARG A CG     1 
ATOM   5724  C CD     . ARG A 1 344 ? 5.804   -10.839 108.626 1.00 58.46  ? 344 ARG A CD     1 
ATOM   5725  N NE     . ARG A 1 344 ? 5.578   -11.788 107.542 1.00 61.76  ? 344 ARG A NE     1 
ATOM   5726  C CZ     . ARG A 1 344 ? 4.399   -12.325 107.232 1.00 64.11  ? 344 ARG A CZ     1 
ATOM   5727  N NH1    . ARG A 1 344 ? 3.297   -11.994 107.902 1.00 65.08  ? 344 ARG A NH1    1 
ATOM   5728  N NH2    . ARG A 1 344 ? 4.316   -13.188 106.224 1.00 62.57  ? 344 ARG A NH2    1 
ATOM   5729  H H      . ARG A 1 344 ? 4.758   -13.960 112.592 1.00 50.86  ? 344 ARG A H      1 
ATOM   5730  H HA     . ARG A 1 344 ? 7.161   -13.459 111.481 1.00 51.70  ? 344 ARG A HA     1 
ATOM   5731  H HB2    . ARG A 1 344 ? 5.289   -13.187 110.066 1.00 56.43  ? 344 ARG A HB2    1 
ATOM   5732  H HB3    . ARG A 1 344 ? 4.800   -11.981 110.987 1.00 56.43  ? 344 ARG A HB3    1 
ATOM   5733  H HG2    . ARG A 1 344 ? 6.745   -10.771 110.430 1.00 68.51  ? 344 ARG A HG2    1 
ATOM   5734  H HG3    . ARG A 1 344 ? 7.239   -11.971 109.523 1.00 68.51  ? 344 ARG A HG3    1 
ATOM   5735  H HD2    . ARG A 1 344 ? 4.945   -10.472 108.889 1.00 70.54  ? 344 ARG A HD2    1 
ATOM   5736  H HD3    . ARG A 1 344 ? 6.380   -10.133 108.293 1.00 70.54  ? 344 ARG A HD3    1 
ATOM   5737  H HE     . ARG A 1 344 ? 6.257   -12.019 107.067 1.00 74.50  ? 344 ARG A HE     1 
ATOM   5738  H HH11   . ARG A 1 344 ? 3.343   -11.437 108.555 1.00 78.49  ? 344 ARG A HH11   1 
ATOM   5739  H HH12   . ARG A 1 344 ? 2.542   -12.345 107.688 1.00 78.49  ? 344 ARG A HH12   1 
ATOM   5740  H HH21   . ARG A 1 344 ? 5.022   -13.402 105.783 1.00 75.48  ? 344 ARG A HH21   1 
ATOM   5741  H HH22   . ARG A 1 344 ? 3.556   -13.531 106.014 1.00 75.48  ? 344 ARG A HH22   1 
ATOM   5742  N N      . MET A 1 345 ? 7.982   -11.410 112.570 1.00 39.18  ? 345 MET A N      1 
ATOM   5743  C CA     . MET A 1 345 ? 8.504   -10.291 113.351 1.00 40.58  ? 345 MET A CA     1 
ATOM   5744  C C      . MET A 1 345 ? 7.883   -8.985  112.904 1.00 39.42  ? 345 MET A C      1 
ATOM   5745  O O      . MET A 1 345 ? 7.695   -8.756  111.708 1.00 39.15  ? 345 MET A O      1 
ATOM   5746  C CB     . MET A 1 345 ? 10.015  -10.182 113.209 1.00 41.01  ? 345 MET A CB     1 
ATOM   5747  C CG     . MET A 1 345 ? 10.644  -9.125  114.085 1.00 39.84  ? 345 MET A CG     1 
ATOM   5748  S SD     . MET A 1 345 ? 12.433  -9.112  113.897 1.00 38.64  ? 345 MET A SD     1 
ATOM   5749  C CE     . MET A 1 345 ? 12.603  -8.610  112.183 1.00 43.95  ? 345 MET A CE     1 
ATOM   5750  H H      . MET A 1 345 ? 8.533   -11.703 111.979 1.00 47.41  ? 345 MET A H      1 
ATOM   5751  H HA     . MET A 1 345 ? 8.298   -10.436 114.288 1.00 49.09  ? 345 MET A HA     1 
ATOM   5752  H HB2    . MET A 1 345 ? 10.413  -11.035 113.445 1.00 49.61  ? 345 MET A HB2    1 
ATOM   5753  H HB3    . MET A 1 345 ? 10.227  -9.966  112.287 1.00 49.61  ? 345 MET A HB3    1 
ATOM   5754  H HG2    . MET A 1 345 ? 10.303  -8.253  113.831 1.00 48.20  ? 345 MET A HG2    1 
ATOM   5755  H HG3    . MET A 1 345 ? 10.435  -9.311  115.014 1.00 48.20  ? 345 MET A HG3    1 
ATOM   5756  H HE1    . MET A 1 345 ? 13.546  -8.566  111.959 1.00 53.13  ? 345 MET A HE1    1 
ATOM   5757  H HE2    . MET A 1 345 ? 12.158  -9.261  111.618 1.00 53.13  ? 345 MET A HE2    1 
ATOM   5758  H HE3    . MET A 1 345 ? 12.195  -7.737  112.068 1.00 53.13  ? 345 MET A HE3    1 
ATOM   5759  N N      . GLY A 1 346 ? 7.523   -8.158  113.878 1.00 35.52  ? 346 GLY A N      1 
ATOM   5760  C CA     . GLY A 1 346 ? 6.986   -6.837  113.611 1.00 33.83  ? 346 GLY A CA     1 
ATOM   5761  C C      . GLY A 1 346 ? 7.986   -5.744  113.930 1.00 35.92  ? 346 GLY A C      1 
ATOM   5762  O O      . GLY A 1 346 ? 9.101   -6.026  114.382 1.00 40.16  ? 346 GLY A O      1 
ATOM   5763  H H      . GLY A 1 346 ? 7.583   -8.345  114.716 1.00 43.01  ? 346 GLY A H      1 
ATOM   5764  H HA2    . GLY A 1 346 ? 6.742   -6.769  112.675 1.00 40.99  ? 346 GLY A HA2    1 
ATOM   5765  H HA3    . GLY A 1 346 ? 6.192   -6.695  114.149 1.00 40.99  ? 346 GLY A HA3    1 
ATOM   5766  N N      . PRO A 1 347 ? 7.584   -4.483  113.702 1.00 32.48  ? 347 PRO A N      1 
ATOM   5767  C CA     . PRO A 1 347 ? 8.404   -3.286  113.942 1.00 31.98  ? 347 PRO A CA     1 
ATOM   5768  C C      . PRO A 1 347 ? 8.471   -2.950  115.404 1.00 32.62  ? 347 PRO A C      1 
ATOM   5769  O O      . PRO A 1 347 ? 7.570   -3.347  116.133 1.00 35.22  ? 347 PRO A O      1 
ATOM   5770  C CB     . PRO A 1 347 ? 7.665   -2.194  113.178 1.00 34.08  ? 347 PRO A CB     1 
ATOM   5771  C CG     . PRO A 1 347 ? 6.232   -2.632  113.232 1.00 34.60  ? 347 PRO A CG     1 
ATOM   5772  C CD     . PRO A 1 347 ? 6.240   -4.140  113.207 1.00 31.18  ? 347 PRO A CD     1 
ATOM   5773  H HA     . PRO A 1 347 ? 9.298   -3.397  113.582 1.00 38.65  ? 347 PRO A HA     1 
ATOM   5774  H HB2    . PRO A 1 347 ? 7.784   -1.340  113.623 1.00 41.28  ? 347 PRO A HB2    1 
ATOM   5775  H HB3    . PRO A 1 347 ? 7.983   -2.157  112.263 1.00 41.28  ? 347 PRO A HB3    1 
ATOM   5776  H HG2    . PRO A 1 347 ? 5.826   -2.310  114.052 1.00 41.91  ? 347 PRO A HG2    1 
ATOM   5777  H HG3    . PRO A 1 347 ? 5.758   -2.284  112.460 1.00 41.91  ? 347 PRO A HG3    1 
ATOM   5778  H HD2    . PRO A 1 347 ? 5.560   -4.491  113.803 1.00 37.81  ? 347 PRO A HD2    1 
ATOM   5779  H HD3    . PRO A 1 347 ? 6.121   -4.463  112.301 1.00 37.81  ? 347 PRO A HD3    1 
ATOM   5780  N N      . GLN A 1 348 ? 9.472   -2.187  115.821 1.00 35.43  ? 348 GLN A N      1 
ATOM   5781  C CA     . GLN A 1 348 ? 9.580   -1.809  117.222 1.00 35.21  ? 348 GLN A CA     1 
ATOM   5782  C C      . GLN A 1 348 ? 8.390   -0.929  117.608 1.00 34.80  ? 348 GLN A C      1 
ATOM   5783  O O      . GLN A 1 348 ? 7.964   -0.083  116.829 1.00 36.07  ? 348 GLN A O      1 
ATOM   5784  C CB     . GLN A 1 348 ? 10.899  -1.077  117.455 1.00 38.20  ? 348 GLN A CB     1 
ATOM   5785  C CG     . GLN A 1 348 ? 12.111  -1.862  116.962 1.00 38.28  ? 348 GLN A CG     1 
ATOM   5786  C CD     . GLN A 1 348 ? 13.429  -1.325  117.501 1.00 41.58  ? 348 GLN A CD     1 
ATOM   5787  O OE1    . GLN A 1 348 ? 14.036  -1.925  118.396 1.00 41.50  ? 348 GLN A OE1    1 
ATOM   5788  N NE2    . GLN A 1 348 ? 13.888  -0.194  116.948 1.00 45.29  ? 348 GLN A NE2    1 
ATOM   5789  H H      . GLN A 1 348 ? 10.097  -1.878  115.318 1.00 42.91  ? 348 GLN A H      1 
ATOM   5790  H HA     . GLN A 1 348 ? 9.567   -2.606  117.775 1.00 42.65  ? 348 GLN A HA     1 
ATOM   5791  H HB2    . GLN A 1 348 ? 10.878  -0.230  116.983 1.00 46.24  ? 348 GLN A HB2    1 
ATOM   5792  H HB3    . GLN A 1 348 ? 11.010  -0.922  118.407 1.00 46.24  ? 348 GLN A HB3    1 
ATOM   5793  H HG2    . GLN A 1 348 ? 12.025  -2.785  117.246 1.00 46.33  ? 348 GLN A HG2    1 
ATOM   5794  H HG3    . GLN A 1 348 ? 12.143  -1.815  115.993 1.00 46.33  ? 348 GLN A HG3    1 
ATOM   5795  H HE21   . GLN A 1 348 ? 13.441  0.190   116.322 1.00 54.73  ? 348 GLN A HE21   1 
ATOM   5796  H HE22   . GLN A 1 348 ? 14.628  0.147   117.220 1.00 54.73  ? 348 GLN A HE22   1 
ATOM   5797  N N      . PHE A 1 349 ? 7.908   -1.082  118.839 1.00 35.83  ? 349 PHE A N      1 
ATOM   5798  C CA     . PHE A 1 349 ? 6.692   -0.402  119.310 1.00 38.35  ? 349 PHE A CA     1 
ATOM   5799  C C      . PHE A 1 349 ? 6.758   1.114   119.134 1.00 40.65  ? 349 PHE A C      1 
ATOM   5800  O O      . PHE A 1 349 ? 5.726   1.786   119.015 1.00 38.75  ? 349 PHE A O      1 
ATOM   5801  C CB     . PHE A 1 349 ? 6.455   -0.746  120.786 1.00 36.64  ? 349 PHE A CB     1 
ATOM   5802  C CG     . PHE A 1 349 ? 7.381   -0.029  121.724 1.00 36.98  ? 349 PHE A CG     1 
ATOM   5803  C CD1    . PHE A 1 349 ? 8.694   -0.439  121.861 1.00 38.53  ? 349 PHE A CD1    1 
ATOM   5804  C CD2    . PHE A 1 349 ? 6.950   1.056   122.450 1.00 37.63  ? 349 PHE A CD2    1 
ATOM   5805  C CE1    . PHE A 1 349 ? 9.553   0.214   122.711 1.00 40.56  ? 349 PHE A CE1    1 
ATOM   5806  C CE2    . PHE A 1 349 ? 7.804   1.709   123.308 1.00 38.98  ? 349 PHE A CE2    1 
ATOM   5807  C CZ     . PHE A 1 349 ? 9.108   1.288   123.438 1.00 39.32  ? 349 PHE A CZ     1 
ATOM   5808  H H      . PHE A 1 349 ? 8.272   -1.584  119.435 1.00 43.39  ? 349 PHE A H      1 
ATOM   5809  H HA     . PHE A 1 349 ? 5.933   -0.728  118.801 1.00 46.42  ? 349 PHE A HA     1 
ATOM   5810  H HB2    . PHE A 1 349 ? 5.546   -0.504  121.022 1.00 44.36  ? 349 PHE A HB2    1 
ATOM   5811  H HB3    . PHE A 1 349 ? 6.584   -1.700  120.910 1.00 44.36  ? 349 PHE A HB3    1 
ATOM   5812  H HD1    . PHE A 1 349 ? 9.000   -1.168  121.373 1.00 46.62  ? 349 PHE A HD1    1 
ATOM   5813  H HD2    . PHE A 1 349 ? 6.069   1.343   122.369 1.00 44.82  ? 349 PHE A HD2    1 
ATOM   5814  H HE1    . PHE A 1 349 ? 10.432  -0.075  122.797 1.00 49.06  ? 349 PHE A HE1    1 
ATOM   5815  H HE2    . PHE A 1 349 ? 7.501   2.440   123.797 1.00 46.22  ? 349 PHE A HE2    1 
ATOM   5816  H HZ     . PHE A 1 349 ? 9.686   1.733   124.015 1.00 47.58  ? 349 PHE A HZ     1 
ATOM   5817  N N      . GLU A 1 350 ? 7.984   1.634   119.134 1.00 40.21  ? 350 GLU A N      1 
ATOM   5818  C CA     . GLU A 1 350 ? 8.235   3.066   118.983 1.00 39.90  ? 350 GLU A CA     1 
ATOM   5819  C C      . GLU A 1 350 ? 7.853   3.534   117.581 1.00 40.22  ? 350 GLU A C      1 
ATOM   5820  O O      . GLU A 1 350 ? 7.519   4.698   117.385 1.00 41.70  ? 350 GLU A O      1 
ATOM   5821  C CB     . GLU A 1 350 ? 9.704   3.437   119.269 1.00 41.07  ? 350 GLU A CB     1 
ATOM   5822  C CG     . GLU A 1 350 ? 10.731  2.331   119.093 1.00 40.03  ? 350 GLU A CG     1 
ATOM   5823  C CD     . GLU A 1 350 ? 11.271  1.804   120.409 1.00 39.86  ? 350 GLU A CD     1 
ATOM   5824  O OE1    . GLU A 1 350 ? 11.181  2.519   121.425 1.00 41.00  ? 350 GLU A OE1    1 
ATOM   5825  O OE2    . GLU A 1 350 ? 11.744  0.646   120.439 1.00 38.68  ? 350 GLU A OE2    1 
ATOM   5826  H H      . GLU A 1 350 ? 8.701   1.167   119.221 1.00 48.65  ? 350 GLU A H      1 
ATOM   5827  H HA     . GLU A 1 350 ? 7.680   3.547   119.617 1.00 46.88  ? 350 GLU A HA     1 
ATOM   5828  H HB2    . GLU A 1 350 ? 9.955   4.160   118.673 1.00 47.33  ? 350 GLU A HB2    1 
ATOM   5829  H HB3    . GLU A 1 350 ? 9.766   3.743   120.188 1.00 47.33  ? 350 GLU A HB3    1 
ATOM   5830  H HG2    . GLU A 1 350 ? 10.318  1.590   118.622 1.00 46.08  ? 350 GLU A HG2    1 
ATOM   5831  H HG3    . GLU A 1 350 ? 11.478  2.674   118.579 1.00 46.08  ? 350 GLU A HG3    1 
ATOM   5832  N N      . ASP A 1 351 ? 7.854   2.630   116.609 1.00 38.94  ? 351 ASP A N      1 
ATOM   5833  C CA     . ASP A 1 351 ? 7.810   3.055   115.218 1.00 40.80  ? 351 ASP A CA     1 
ATOM   5834  C C      . ASP A 1 351 ? 6.352   3.214   114.841 1.00 44.66  ? 351 ASP A C      1 
ATOM   5835  O O      . ASP A 1 351 ? 5.653   2.251   114.543 1.00 47.29  ? 351 ASP A O      1 
ATOM   5836  C CB     . ASP A 1 351 ? 8.498   2.002   114.338 1.00 40.88  ? 351 ASP A CB     1 
ATOM   5837  C CG     . ASP A 1 351 ? 8.659   2.437   112.906 1.00 46.34  ? 351 ASP A CG     1 
ATOM   5838  O OD1    . ASP A 1 351 ? 8.064   3.465   112.523 1.00 50.35  ? 351 ASP A OD1    1 
ATOM   5839  O OD2    . ASP A 1 351 ? 9.362   1.721   112.159 1.00 46.20  ? 351 ASP A OD2    1 
ATOM   5840  H H      . ASP A 1 351 ? 7.879   1.779   116.726 1.00 46.44  ? 351 ASP A H      1 
ATOM   5841  H HA     . ASP A 1 351 ? 8.263   3.907   115.113 1.00 49.35  ? 351 ASP A HA     1 
ATOM   5842  H HB2    . ASP A 1 351 ? 9.382   1.822   114.695 1.00 49.45  ? 351 ASP A HB2    1 
ATOM   5843  H HB3    . ASP A 1 351 ? 7.967   1.191   114.345 1.00 49.45  ? 351 ASP A HB3    1 
ATOM   5844  N N      . GLU A 1 352 ? 5.914   4.463   114.793 1.00 49.86  ? 352 GLU A N      1 
ATOM   5845  C CA     . GLU A 1 352 ? 4.496   4.737   114.667 1.00 53.77  ? 352 GLU A CA     1 
ATOM   5846  C C      . GLU A 1 352 ? 3.965   4.199   113.335 1.00 55.16  ? 352 GLU A C      1 
ATOM   5847  O O      . GLU A 1 352 ? 3.215   3.221   113.310 1.00 54.06  ? 352 GLU A O      1 
ATOM   5848  C CB     . GLU A 1 352 ? 4.229   6.256   114.822 1.00 58.85  ? 352 GLU A CB     1 
ATOM   5849  C CG     . GLU A 1 352 ? 4.228   6.745   116.299 1.00 68.92  ? 352 GLU A CG     1 
ATOM   5850  C CD     . GLU A 1 352 ? 4.013   8.266   116.487 1.00 74.43  ? 352 GLU A CD     1 
ATOM   5851  O OE1    . GLU A 1 352 ? 4.916   8.952   117.024 1.00 74.14  ? 352 GLU A OE1    1 
ATOM   5852  O OE2    . GLU A 1 352 ? 2.924   8.771   116.137 1.00 75.39  ? 352 GLU A OE2    1 
ATOM   5853  H H      . GLU A 1 352 ? 6.413   5.162   114.831 1.00 60.23  ? 352 GLU A H      1 
ATOM   5854  H HA     . GLU A 1 352 ? 4.025   4.279   115.380 1.00 64.91  ? 352 GLU A HA     1 
ATOM   5855  H HB2    . GLU A 1 352 ? 4.919   6.745   114.347 1.00 71.01  ? 352 GLU A HB2    1 
ATOM   5856  H HB3    . GLU A 1 352 ? 3.360   6.461   114.441 1.00 71.01  ? 352 GLU A HB3    1 
ATOM   5857  H HG2    . GLU A 1 352 ? 3.517   6.288   116.774 1.00 83.09  ? 352 GLU A HG2    1 
ATOM   5858  H HG3    . GLU A 1 352 ? 5.083   6.520   116.698 1.00 83.09  ? 352 GLU A HG3    1 
ATOM   5859  N N      . ARG A 1 353 ? 4.446   4.779   112.238 1.00 56.26  ? 353 ARG A N      1 
ATOM   5860  C CA     . ARG A 1 353 ? 3.904   4.522   110.903 1.00 52.94  ? 353 ARG A CA     1 
ATOM   5861  C C      . ARG A 1 353 ? 3.875   3.035   110.545 1.00 49.66  ? 353 ARG A C      1 
ATOM   5862  O O      . ARG A 1 353 ? 2.857   2.532   110.073 1.00 48.10  ? 353 ARG A O      1 
ATOM   5863  C CB     . ARG A 1 353 ? 4.684   5.335   109.863 1.00 54.22  ? 353 ARG A CB     1 
ATOM   5864  C CG     . ARG A 1 353 ? 4.317   5.065   108.410 1.00 55.41  ? 353 ARG A CG     1 
ATOM   5865  C CD     . ARG A 1 353 ? 5.067   6.031   107.524 1.00 60.80  ? 353 ARG A CD     1 
ATOM   5866  N NE     . ARG A 1 353 ? 4.980   5.736   106.096 1.00 69.22  ? 353 ARG A NE     1 
ATOM   5867  C CZ     . ARG A 1 353 ? 5.106   6.655   105.134 1.00 73.96  ? 353 ARG A CZ     1 
ATOM   5868  N NH1    . ARG A 1 353 ? 5.293   7.940   105.446 1.00 75.29  ? 353 ARG A NH1    1 
ATOM   5869  N NH2    . ARG A 1 353 ? 5.022   6.298   103.852 1.00 70.05  ? 353 ARG A NH2    1 
ATOM   5870  H H      . ARG A 1 353 ? 5.101   5.336   112.240 1.00 67.91  ? 353 ARG A H      1 
ATOM   5871  H HA     . ARG A 1 353 ? 2.987   4.838   110.884 1.00 63.91  ? 353 ARG A HA     1 
ATOM   5872  H HB2    . ARG A 1 353 ? 4.530   6.278   110.032 1.00 65.46  ? 353 ARG A HB2    1 
ATOM   5873  H HB3    . ARG A 1 353 ? 5.629   5.139   109.966 1.00 65.46  ? 353 ARG A HB3    1 
ATOM   5874  H HG2    . ARG A 1 353 ? 4.572   4.161   108.170 1.00 66.88  ? 353 ARG A HG2    1 
ATOM   5875  H HG3    . ARG A 1 353 ? 3.365   5.200   108.281 1.00 66.88  ? 353 ARG A HG3    1 
ATOM   5876  H HD2    . ARG A 1 353 ? 4.708   6.922   107.663 1.00 73.35  ? 353 ARG A HD2    1 
ATOM   5877  H HD3    . ARG A 1 353 ? 6.005   6.015   107.772 1.00 73.35  ? 353 ARG A HD3    1 
ATOM   5878  H HE     . ARG A 1 353 ? 4.906   4.913   105.859 1.00 83.45  ? 353 ARG A HE     1 
ATOM   5879  H HH11   . ARG A 1 353 ? 5.348   8.179   106.270 1.00 90.74  ? 353 ARG A HH11   1 
ATOM   5880  H HH12   . ARG A 1 353 ? 5.368   8.527   104.822 1.00 90.74  ? 353 ARG A HH12   1 
ATOM   5881  H HH21   . ARG A 1 353 ? 4.896   5.473   103.643 1.00 84.45  ? 353 ARG A HH21   1 
ATOM   5882  H HH22   . ARG A 1 353 ? 5.094   6.892   103.235 1.00 84.45  ? 353 ARG A HH22   1 
ATOM   5883  N N      . ASN A 1 354 ? 4.976   2.332   110.792 1.00 49.48  ? 354 ASN A N      1 
ATOM   5884  C CA     . ASN A 1 354 ? 5.099   0.937   110.386 1.00 48.99  ? 354 ASN A CA     1 
ATOM   5885  C C      . ASN A 1 354 ? 4.276   0.031   111.296 1.00 52.99  ? 354 ASN A C      1 
ATOM   5886  O O      . ASN A 1 354 ? 3.858   -1.052  110.878 1.00 57.05  ? 354 ASN A O      1 
ATOM   5887  C CB     . ASN A 1 354 ? 6.563   0.493   110.408 1.00 47.60  ? 354 ASN A CB     1 
ATOM   5888  C CG     . ASN A 1 354 ? 7.375   1.080   109.267 1.00 48.93  ? 354 ASN A CG     1 
ATOM   5889  O OD1    . ASN A 1 354 ? 6.927   1.108   108.121 1.00 49.68  ? 354 ASN A OD1    1 
ATOM   5890  N ND2    . ASN A 1 354 ? 8.578   1.551   109.577 1.00 49.01  ? 354 ASN A ND2    1 
ATOM   5891  H H      . ASN A 1 354 ? 5.669   2.642   111.195 1.00 59.77  ? 354 ASN A H      1 
ATOM   5892  H HA     . ASN A 1 354 ? 4.766   0.838   109.481 1.00 59.18  ? 354 ASN A HA     1 
ATOM   5893  H HB2    . ASN A 1 354 ? 6.968   0.780   111.241 1.00 57.51  ? 354 ASN A HB2    1 
ATOM   5894  H HB3    . ASN A 1 354 ? 6.601   -0.473  110.336 1.00 57.51  ? 354 ASN A HB3    1 
ATOM   5895  H HD21   . ASN A 1 354 ? 9.077   1.894   108.965 1.00 59.21  ? 354 ASN A HD21   1 
ATOM   5896  H HD22   . ASN A 1 354 ? 8.859   1.514   110.389 1.00 59.21  ? 354 ASN A HD22   1 
ATOM   5897  N N      . VAL A 1 355 ? 4.062   0.457   112.542 1.00 49.10  ? 355 VAL A N      1 
ATOM   5898  C CA     . VAL A 1 355 ? 3.163   -0.264  113.438 1.00 45.07  ? 355 VAL A CA     1 
ATOM   5899  C C      . VAL A 1 355 ? 1.704   -0.111  113.003 1.00 49.21  ? 355 VAL A C      1 
ATOM   5900  O O      . VAL A 1 355 ? 0.972   -1.095  112.983 1.00 53.39  ? 355 VAL A O      1 
ATOM   5901  C CB     . VAL A 1 355 ? 3.315   0.186   114.903 1.00 42.70  ? 355 VAL A CB     1 
ATOM   5902  C CG1    . VAL A 1 355 ? 2.116   -0.235  115.738 1.00 44.49  ? 355 VAL A CG1    1 
ATOM   5903  C CG2    . VAL A 1 355 ? 4.574   -0.409  115.502 1.00 40.00  ? 355 VAL A CG2    1 
ATOM   5904  H H      . VAL A 1 355 ? 4.423   1.156   112.889 1.00 59.31  ? 355 VAL A H      1 
ATOM   5905  H HA     . VAL A 1 355 ? 3.382   -1.209  113.399 1.00 54.48  ? 355 VAL A HA     1 
ATOM   5906  H HB     . VAL A 1 355 ? 3.388   1.152   114.936 1.00 51.63  ? 355 VAL A HB     1 
ATOM   5907  H HG11   . VAL A 1 355 ? 2.247   0.065   116.651 1.00 53.77  ? 355 VAL A HG11   1 
ATOM   5908  H HG12   . VAL A 1 355 ? 1.316   0.171   115.368 1.00 53.77  ? 355 VAL A HG12   1 
ATOM   5909  H HG13   . VAL A 1 355 ? 2.038   -1.201  115.714 1.00 53.77  ? 355 VAL A HG13   1 
ATOM   5910  H HG21   . VAL A 1 355 ? 4.653   -0.115  116.423 1.00 48.39  ? 355 VAL A HG21   1 
ATOM   5911  H HG22   . VAL A 1 355 ? 4.513   -1.376  115.467 1.00 48.39  ? 355 VAL A HG22   1 
ATOM   5912  H HG23   . VAL A 1 355 ? 5.340   -0.106  114.991 1.00 48.39  ? 355 VAL A HG23   1 
ATOM   5913  N N      . LYS A 1 356 ? 1.278   1.098   112.634 1.00 52.14  ? 356 LYS A N      1 
ATOM   5914  C CA     . LYS A 1 356 ? -0.103  1.281   112.186 1.00 51.22  ? 356 LYS A CA     1 
ATOM   5915  C C      . LYS A 1 356 ? -0.410  0.322   111.050 1.00 52.47  ? 356 LYS A C      1 
ATOM   5916  O O      . LYS A 1 356 ? -1.493  -0.254  110.998 1.00 55.50  ? 356 LYS A O      1 
ATOM   5917  C CB     . LYS A 1 356 ? -0.376  2.711   111.698 1.00 49.27  ? 356 LYS A CB     1 
ATOM   5918  C CG     . LYS A 1 356 ? -0.477  3.815   112.750 1.00 50.68  ? 356 LYS A CG     1 
ATOM   5919  C CD     . LYS A 1 356 ? -0.964  5.112   112.068 1.00 55.73  ? 356 LYS A CD     1 
ATOM   5920  C CE     . LYS A 1 356 ? -0.886  6.370   112.948 1.00 61.79  ? 356 LYS A CE     1 
ATOM   5921  N NZ     . LYS A 1 356 ? -1.929  6.463   114.012 1.00 62.95  ? 356 LYS A NZ     1 
ATOM   5922  H H      . LYS A 1 356 ? 1.756   1.813   112.633 1.00 62.96  ? 356 LYS A H      1 
ATOM   5923  H HA     . LYS A 1 356 ? -0.707  1.088   112.920 1.00 61.85  ? 356 LYS A HA     1 
ATOM   5924  H HB2    . LYS A 1 356 ? 0.339   2.962   111.093 1.00 59.52  ? 356 LYS A HB2    1 
ATOM   5925  H HB3    . LYS A 1 356 ? -1.215  2.706   111.212 1.00 59.52  ? 356 LYS A HB3    1 
ATOM   5926  H HG2    . LYS A 1 356 ? -1.118  3.561   113.432 1.00 61.21  ? 356 LYS A HG2    1 
ATOM   5927  H HG3    . LYS A 1 356 ? 0.396   3.976   113.141 1.00 61.21  ? 356 LYS A HG3    1 
ATOM   5928  H HD2    . LYS A 1 356 ? -0.420  5.271   111.281 1.00 67.27  ? 356 LYS A HD2    1 
ATOM   5929  H HD3    . LYS A 1 356 ? -1.891  4.995   111.806 1.00 67.27  ? 356 LYS A HD3    1 
ATOM   5930  H HE2    . LYS A 1 356 ? -0.020  6.387   113.386 1.00 74.54  ? 356 LYS A HE2    1 
ATOM   5931  H HE3    . LYS A 1 356 ? -0.978  7.150   112.380 1.00 74.54  ? 356 LYS A HE3    1 
ATOM   5932  H HZ1    . LYS A 1 356 ? -1.821  7.213   114.479 1.00 75.93  ? 356 LYS A HZ1    1 
ATOM   5933  H HZ2    . LYS A 1 356 ? -2.739  6.466   113.644 1.00 75.93  ? 356 LYS A HZ2    1 
ATOM   5934  H HZ3    . LYS A 1 356 ? -1.864  5.768   114.564 1.00 75.93  ? 356 LYS A HZ3    1 
ATOM   5935  N N      . LYS A 1 357 ? 0.560   0.139   110.157 1.00 48.19  ? 357 LYS A N      1 
ATOM   5936  C CA     . LYS A 1 357 ? 0.395   -0.735  108.998 1.00 45.66  ? 357 LYS A CA     1 
ATOM   5937  C C      . LYS A 1 357 ? 0.456   -2.211  109.358 1.00 44.38  ? 357 LYS A C      1 
ATOM   5938  O O      . LYS A 1 357 ? -0.187  -3.041  108.716 1.00 46.72  ? 357 LYS A O      1 
ATOM   5939  C CB     . LYS A 1 357 ? 1.447   -0.399  107.938 1.00 45.75  ? 357 LYS A CB     1 
ATOM   5940  C CG     . LYS A 1 357 ? 1.116   0.891   107.201 1.00 48.22  ? 357 LYS A CG     1 
ATOM   5941  C CD     . LYS A 1 357 ? 2.218   1.345   106.254 1.00 48.79  ? 357 LYS A CD     1 
ATOM   5942  C CE     . LYS A 1 357 ? 2.433   0.374   105.112 1.00 45.93  ? 357 LYS A CE     1 
ATOM   5943  N NZ     . LYS A 1 357 ? 3.480   0.881   104.198 1.00 47.07  ? 357 LYS A NZ     1 
ATOM   5944  H H      . LYS A 1 357 ? 1.333   0.514   110.201 1.00 58.22  ? 357 LYS A H      1 
ATOM   5945  H HA     . LYS A 1 357 ? -0.477  -0.566  108.607 1.00 55.18  ? 357 LYS A HA     1 
ATOM   5946  H HB2    . LYS A 1 357 ? 2.309   -0.289  108.368 1.00 55.29  ? 357 LYS A HB2    1 
ATOM   5947  H HB3    . LYS A 1 357 ? 1.485   -1.118  107.288 1.00 55.29  ? 357 LYS A HB3    1 
ATOM   5948  H HG2    . LYS A 1 357 ? 0.310   0.755   106.678 1.00 58.26  ? 357 LYS A HG2    1 
ATOM   5949  H HG3    . LYS A 1 357 ? 0.972   1.596   107.851 1.00 58.26  ? 357 LYS A HG3    1 
ATOM   5950  H HD2    . LYS A 1 357 ? 1.977   2.205   105.876 1.00 58.94  ? 357 LYS A HD2    1 
ATOM   5951  H HD3    . LYS A 1 357 ? 3.050   1.419   106.747 1.00 58.94  ? 357 LYS A HD3    1 
ATOM   5952  H HE2    . LYS A 1 357 ? 2.720   -0.482  105.465 1.00 55.50  ? 357 LYS A HE2    1 
ATOM   5953  H HE3    . LYS A 1 357 ? 1.608   0.276   104.611 1.00 55.50  ? 357 LYS A HE3    1 
ATOM   5954  H HZ1    . LYS A 1 357 ? 3.603   0.307   103.529 1.00 56.88  ? 357 LYS A HZ1    1 
ATOM   5955  H HZ2    . LYS A 1 357 ? 3.236   1.668   103.863 1.00 56.88  ? 357 LYS A HZ2    1 
ATOM   5956  H HZ3    . LYS A 1 357 ? 4.247   0.979   104.639 1.00 56.88  ? 357 LYS A HZ3    1 
ATOM   5957  N N      . PHE A 1 358 ? 1.252   -2.545  110.363 1.00 41.74  ? 358 PHE A N      1 
ATOM   5958  C CA     . PHE A 1 358 ? 1.409   -3.938  110.739 1.00 38.12  ? 358 PHE A CA     1 
ATOM   5959  C C      . PHE A 1 358 ? 0.150   -4.445  111.412 1.00 35.25  ? 358 PHE A C      1 
ATOM   5960  O O      . PHE A 1 358 ? -0.245  -5.589  111.235 1.00 34.32  ? 358 PHE A O      1 
ATOM   5961  C CB     . PHE A 1 358 ? 2.603   -4.126  111.673 1.00 37.08  ? 358 PHE A CB     1 
ATOM   5962  C CG     . PHE A 1 358 ? 2.884   -5.560  111.991 1.00 37.45  ? 358 PHE A CG     1 
ATOM   5963  C CD1    . PHE A 1 358 ? 3.375   -6.408  111.011 1.00 35.56  ? 358 PHE A CD1    1 
ATOM   5964  C CD2    . PHE A 1 358 ? 2.646   -6.065  113.254 1.00 36.67  ? 358 PHE A CD2    1 
ATOM   5965  C CE1    . PHE A 1 358 ? 3.631   -7.725  111.289 1.00 33.41  ? 358 PHE A CE1    1 
ATOM   5966  C CE2    . PHE A 1 358 ? 2.904   -7.387  113.543 1.00 34.24  ? 358 PHE A CE2    1 
ATOM   5967  C CZ     . PHE A 1 358 ? 3.396   -8.218  112.561 1.00 34.37  ? 358 PHE A CZ     1 
ATOM   5968  H H      . PHE A 1 358 ? 1.708   -1.991  110.837 1.00 50.47  ? 358 PHE A H      1 
ATOM   5969  H HA     . PHE A 1 358 ? 1.562   -4.469  109.941 1.00 46.14  ? 358 PHE A HA     1 
ATOM   5970  H HB2    . PHE A 1 358 ? 3.393   -3.753  111.251 1.00 44.89  ? 358 PHE A HB2    1 
ATOM   5971  H HB3    . PHE A 1 358 ? 2.425   -3.664  112.507 1.00 44.89  ? 358 PHE A HB3    1 
ATOM   5972  H HD1    . PHE A 1 358 ? 3.536   -6.079  110.156 1.00 43.07  ? 358 PHE A HD1    1 
ATOM   5973  H HD2    . PHE A 1 358 ? 2.316   -5.504  113.919 1.00 44.40  ? 358 PHE A HD2    1 
ATOM   5974  H HE1    . PHE A 1 358 ? 3.964   -8.285  110.626 1.00 40.48  ? 358 PHE A HE1    1 
ATOM   5975  H HE2    . PHE A 1 358 ? 2.744   -7.718  114.397 1.00 41.48  ? 358 PHE A HE2    1 
ATOM   5976  H HZ     . PHE A 1 358 ? 3.569   -9.112  112.752 1.00 41.64  ? 358 PHE A HZ     1 
ATOM   5977  N N      . LEU A 1 359 ? -0.482  -3.570  112.176 1.00 37.72  ? 359 LEU A N      1 
ATOM   5978  C CA     . LEU A 1 359 ? -1.640  -3.941  112.971 1.00 39.92  ? 359 LEU A CA     1 
ATOM   5979  C C      . LEU A 1 359 ? -2.934  -3.839  112.196 1.00 44.10  ? 359 LEU A C      1 
ATOM   5980  O O      . LEU A 1 359 ? -3.989  -4.171  112.720 1.00 46.21  ? 359 LEU A O      1 
ATOM   5981  C CB     . LEU A 1 359 ? -1.717  -3.087  114.227 1.00 37.52  ? 359 LEU A CB     1 
ATOM   5982  C CG     . LEU A 1 359 ? -0.472  -3.184  115.116 1.00 36.66  ? 359 LEU A CG     1 
ATOM   5983  C CD1    . LEU A 1 359 ? -0.635  -2.349  116.365 1.00 38.76  ? 359 LEU A CD1    1 
ATOM   5984  C CD2    . LEU A 1 359 ? -0.146  -4.611  115.485 1.00 36.57  ? 359 LEU A CD2    1 
ATOM   5985  H H      . LEU A 1 359 ? -0.257  -2.743  112.252 1.00 45.65  ? 359 LEU A H      1 
ATOM   5986  H HA     . LEU A 1 359 ? -1.539  -4.864  113.251 1.00 48.30  ? 359 LEU A HA     1 
ATOM   5987  H HB2    . LEU A 1 359 ? -1.825  -2.158  113.967 1.00 45.41  ? 359 LEU A HB2    1 
ATOM   5988  H HB3    . LEU A 1 359 ? -2.480  -3.372  114.753 1.00 45.41  ? 359 LEU A HB3    1 
ATOM   5989  H HG     . LEU A 1 359 ? 0.286   -2.830  114.624 1.00 44.39  ? 359 LEU A HG     1 
ATOM   5990  H HD11   . LEU A 1 359 ? 0.166   -2.430  116.906 1.00 46.90  ? 359 LEU A HD11   1 
ATOM   5991  H HD12   . LEU A 1 359 ? -0.770  -1.422  116.110 1.00 46.90  ? 359 LEU A HD12   1 
ATOM   5992  H HD13   . LEU A 1 359 ? -1.404  -2.671  116.861 1.00 46.90  ? 359 LEU A HD13   1 
ATOM   5993  H HD21   . LEU A 1 359 ? 0.646   -4.619  116.045 1.00 44.28  ? 359 LEU A HD21   1 
ATOM   5994  H HD22   . LEU A 1 359 ? -0.897  -4.991  115.968 1.00 44.28  ? 359 LEU A HD22   1 
ATOM   5995  H HD23   . LEU A 1 359 ? 0.017   -5.118  114.674 1.00 44.28  ? 359 LEU A HD23   1 
ATOM   5996  N N      . SER A 1 360 ? -2.861  -3.349  110.963 1.00 49.17  ? 360 SER A N      1 
ATOM   5997  C CA     . SER A 1 360 ? -4.053  -3.183  110.143 1.00 52.89  ? 360 SER A CA     1 
ATOM   5998  C C      . SER A 1 360 ? -4.424  -4.482  109.457 1.00 54.69  ? 360 SER A C      1 
ATOM   5999  O O      . SER A 1 360 ? -5.598  -4.854  109.438 1.00 56.43  ? 360 SER A O      1 
ATOM   6000  C CB     . SER A 1 360 ? -3.844  -2.101  109.081 1.00 54.57  ? 360 SER A CB     1 
ATOM   6001  O OG     . SER A 1 360 ? -3.139  -2.616  107.963 1.00 53.83  ? 360 SER A OG     1 
ATOM   6002  H H      . SER A 1 360 ? -2.131  -3.106  110.577 1.00 59.39  ? 360 SER A H      1 
ATOM   6003  H HA     . SER A 1 360 ? -4.795  -2.915  110.708 1.00 63.86  ? 360 SER A HA     1 
ATOM   6004  H HB2    . SER A 1 360 ? -4.709  -1.776  108.786 1.00 65.87  ? 360 SER A HB2    1 
ATOM   6005  H HB3    . SER A 1 360 ? -3.332  -1.374  109.469 1.00 65.87  ? 360 SER A HB3    1 
ATOM   6006  H HG     . SER A 1 360 ? -2.386  -2.901  108.204 1.00 64.99  ? 360 SER A HG     1 
ATOM   6007  N N      . ARG A 1 361 ? -3.414  -5.183  108.937 1.00 54.16  ? 361 ARG A N      1 
ATOM   6008  C CA     . ARG A 1 361 ? -3.626  -6.405  108.156 1.00 59.70  ? 361 ARG A CA     1 
ATOM   6009  C C      . ARG A 1 361 ? -4.519  -7.418  108.849 1.00 67.92  ? 361 ARG A C      1 
ATOM   6010  O O      . ARG A 1 361 ? -4.427  -7.628  110.057 1.00 69.73  ? 361 ARG A O      1 
ATOM   6011  C CB     . ARG A 1 361 ? -2.284  -7.065  107.818 1.00 60.94  ? 361 ARG A CB     1 
ATOM   6012  C CG     . ARG A 1 361 ? -2.412  -8.343  106.970 1.00 64.69  ? 361 ARG A CG     1 
ATOM   6013  C CD     . ARG A 1 361 ? -1.056  -8.997  106.714 1.00 66.29  ? 361 ARG A CD     1 
ATOM   6014  N NE     . ARG A 1 361 ? -1.149  -10.227 105.923 1.00 68.98  ? 361 ARG A NE     1 
ATOM   6015  C CZ     . ARG A 1 361 ? -1.409  -11.438 106.426 1.00 69.98  ? 361 ARG A CZ     1 
ATOM   6016  N NH1    . ARG A 1 361 ? -1.615  -11.604 107.724 1.00 67.22  ? 361 ARG A NH1    1 
ATOM   6017  N NH2    . ARG A 1 361 ? -1.467  -12.496 105.627 1.00 71.13  ? 361 ARG A NH2    1 
ATOM   6018  H H      . ARG A 1 361 ? -2.585  -4.969  109.024 1.00 65.38  ? 361 ARG A H      1 
ATOM   6019  H HA     . ARG A 1 361 ? -4.053  -6.165  107.319 1.00 72.03  ? 361 ARG A HA     1 
ATOM   6020  H HB2    . ARG A 1 361 ? -1.742  -6.433  107.320 1.00 73.52  ? 361 ARG A HB2    1 
ATOM   6021  H HB3    . ARG A 1 361 ? -1.836  -7.302  108.645 1.00 73.52  ? 361 ARG A HB3    1 
ATOM   6022  H HG2    . ARG A 1 361 ? -2.972  -8.981  107.439 1.00 78.01  ? 361 ARG A HG2    1 
ATOM   6023  H HG3    . ARG A 1 361 ? -2.806  -8.118  106.113 1.00 78.01  ? 361 ARG A HG3    1 
ATOM   6024  H HD2    . ARG A 1 361 ? -0.492  -8.373  106.230 1.00 79.94  ? 361 ARG A HD2    1 
ATOM   6025  H HD3    . ARG A 1 361 ? -0.648  -9.219  107.566 1.00 79.94  ? 361 ARG A HD3    1 
ATOM   6026  H HE     . ARG A 1 361 ? -1.028  -10.166 105.074 1.00 83.16  ? 361 ARG A HE     1 
ATOM   6027  H HH11   . ARG A 1 361 ? -1.580  -10.928 108.255 1.00 81.06  ? 361 ARG A HH11   1 
ATOM   6028  H HH12   . ARG A 1 361 ? -1.783  -12.387 108.036 1.00 81.06  ? 361 ARG A HH12   1 
ATOM   6029  H HH21   . ARG A 1 361 ? -1.337  -12.404 104.782 1.00 85.75  ? 361 ARG A HH21   1 
ATOM   6030  H HH22   . ARG A 1 361 ? -1.638  -13.273 105.955 1.00 85.75  ? 361 ARG A HH22   1 
ATOM   6031  N N      . ASN A 1 362 ? -5.370  -8.064  108.059 1.00 76.54  ? 362 ASN A N      1 
ATOM   6032  C CA     . ASN A 1 362 ? -6.323  -9.013  108.602 1.00 81.76  ? 362 ASN A CA     1 
ATOM   6033  C C      . ASN A 1 362 ? -5.681  -10.340 108.931 1.00 71.64  ? 362 ASN A C      1 
ATOM   6034  O O      . ASN A 1 362 ? -5.176  -11.044 108.047 1.00 71.65  ? 362 ASN A O      1 
ATOM   6035  C CB     . ASN A 1 362 ? -7.481  -9.244  107.633 1.00 93.52  ? 362 ASN A CB     1 
ATOM   6036  C CG     . ASN A 1 362 ? -8.685  -9.895  108.308 1.00 100.89 ? 362 ASN A CG     1 
ATOM   6037  O OD1    . ASN A 1 362 ? -8.793  -9.911  109.535 1.00 102.23 ? 362 ASN A OD1    1 
ATOM   6038  N ND2    . ASN A 1 362 ? -9.594  -10.438 107.504 1.00 103.36 ? 362 ASN A ND2    1 
ATOM   6039  H H      . ASN A 1 362 ? -5.413  -7.968  107.205 1.00 92.24  ? 362 ASN A H      1 
ATOM   6040  H HA     . ASN A 1 362 ? -6.691  -8.651  109.423 1.00 98.51  ? 362 ASN A HA     1 
ATOM   6041  H HB2    . ASN A 1 362 ? -7.765  -8.391  107.269 1.00 112.62 ? 362 ASN A HB2    1 
ATOM   6042  H HB3    . ASN A 1 362 ? -7.184  -9.829  106.918 1.00 112.62 ? 362 ASN A HB3    1 
ATOM   6043  H HD21   . ASN A 1 362 ? -10.290 -10.817 107.837 1.00 124.42 ? 362 ASN A HD21   1 
ATOM   6044  H HD22   . ASN A 1 362 ? -9.485  -10.410 106.652 1.00 124.42 ? 362 ASN A HD22   1 
ATOM   6045  N N      . ARG A 1 363 ? -5.744  -10.669 110.219 1.00 61.54  ? 363 ARG A N      1 
ATOM   6046  C CA     . ARG A 1 363 ? -5.142  -11.870 110.774 1.00 50.94  ? 363 ARG A CA     1 
ATOM   6047  C C      . ARG A 1 363 ? -6.141  -12.521 111.711 1.00 49.51  ? 363 ARG A C      1 
ATOM   6048  O O      . ARG A 1 363 ? -6.870  -11.836 112.429 1.00 48.71  ? 363 ARG A O      1 
ATOM   6049  C CB     . ARG A 1 363 ? -3.849  -11.542 111.518 1.00 46.54  ? 363 ARG A CB     1 
ATOM   6050  C CG     . ARG A 1 363 ? -2.640  -11.411 110.607 1.00 44.95  ? 363 ARG A CG     1 
ATOM   6051  C CD     . ARG A 1 363 ? -1.377  -11.084 111.380 1.00 45.41  ? 363 ARG A CD     1 
ATOM   6052  N NE     . ARG A 1 363 ? -1.126  -9.643  111.421 1.00 50.93  ? 363 ARG A NE     1 
ATOM   6053  C CZ     . ARG A 1 363 ? -0.265  -8.993  110.637 1.00 49.85  ? 363 ARG A CZ     1 
ATOM   6054  N NH1    . ARG A 1 363 ? 0.455   -9.643  109.720 1.00 49.53  ? 363 ARG A NH1    1 
ATOM   6055  N NH2    . ARG A 1 363 ? -0.122  -7.679  110.775 1.00 45.43  ? 363 ARG A NH2    1 
ATOM   6056  H H      . ARG A 1 363 ? -6.147  -10.191 110.810 1.00 74.24  ? 363 ARG A H      1 
ATOM   6057  H HA     . ARG A 1 363 ? -4.937  -12.492 110.059 1.00 61.52  ? 363 ARG A HA     1 
ATOM   6058  H HB2    . ARG A 1 363 ? -3.962  -10.699 111.985 1.00 56.24  ? 363 ARG A HB2    1 
ATOM   6059  H HB3    . ARG A 1 363 ? -3.666  -12.249 112.156 1.00 56.24  ? 363 ARG A HB3    1 
ATOM   6060  H HG2    . ARG A 1 363 ? -2.501  -12.250 110.141 1.00 54.33  ? 363 ARG A HG2    1 
ATOM   6061  H HG3    . ARG A 1 363 ? -2.798  -10.697 109.969 1.00 54.33  ? 363 ARG A HG3    1 
ATOM   6062  H HD2    . ARG A 1 363 ? -1.470  -11.402 112.292 1.00 54.89  ? 363 ARG A HD2    1 
ATOM   6063  H HD3    . ARG A 1 363 ? -0.620  -11.511 110.951 1.00 54.89  ? 363 ARG A HD3    1 
ATOM   6064  H HE     . ARG A 1 363 ? -1.567  -9.180  111.996 1.00 61.51  ? 363 ARG A HE     1 
ATOM   6065  H HH11   . ARG A 1 363 ? 0.368   -10.493 109.628 1.00 59.83  ? 363 ARG A HH11   1 
ATOM   6066  H HH12   . ARG A 1 363 ? 1.006   -9.211  109.221 1.00 59.83  ? 363 ARG A HH12   1 
ATOM   6067  H HH21   . ARG A 1 363 ? -0.584  -7.256  111.364 1.00 54.91  ? 363 ARG A HH21   1 
ATOM   6068  H HH22   . ARG A 1 363 ? 0.429   -7.252  110.272 1.00 54.91  ? 363 ARG A HH22   1 
ATOM   6069  N N      . ALA A 1 364 ? -6.173  -13.846 111.696 1.00 46.97  ? 364 ALA A N      1 
ATOM   6070  C CA     . ALA A 1 364 ? -7.128  -14.607 112.493 1.00 45.90  ? 364 ALA A CA     1 
ATOM   6071  C C      . ALA A 1 364 ? -6.879  -14.471 114.005 1.00 46.04  ? 364 ALA A C      1 
ATOM   6072  O O      . ALA A 1 364 ? -7.811  -14.575 114.807 1.00 44.39  ? 364 ALA A O      1 
ATOM   6073  C CB     . ALA A 1 364 ? -7.090  -16.074 112.077 1.00 43.58  ? 364 ALA A CB     1 
ATOM   6074  H H      . ALA A 1 364 ? -5.644  -14.336 111.226 1.00 56.76  ? 364 ALA A H      1 
ATOM   6075  H HA     . ALA A 1 364 ? -8.020  -14.272 112.311 1.00 55.47  ? 364 ALA A HA     1 
ATOM   6076  H HB1    . ALA A 1 364 ? -7.728  -16.570 112.613 1.00 52.68  ? 364 ALA A HB1    1 
ATOM   6077  H HB2    . ALA A 1 364 ? -7.322  -16.142 111.138 1.00 52.68  ? 364 ALA A HB2    1 
ATOM   6078  H HB3    . ALA A 1 364 ? -6.195  -16.419 112.223 1.00 52.68  ? 364 ALA A HB3    1 
ATOM   6079  N N      . PHE A 1 365 ? -5.622  -14.240 114.381 1.00 46.16  ? 365 PHE A N      1 
ATOM   6080  C CA     . PHE A 1 365 ? -5.232  -14.132 115.787 1.00 44.85  ? 365 PHE A CA     1 
ATOM   6081  C C      . PHE A 1 365 ? -4.680  -12.752 116.114 1.00 48.24  ? 365 PHE A C      1 
ATOM   6082  O O      . PHE A 1 365 ? -3.996  -12.136 115.298 1.00 47.47  ? 365 PHE A O      1 
ATOM   6083  C CB     . PHE A 1 365 ? -4.186  -15.198 116.117 1.00 42.26  ? 365 PHE A CB     1 
ATOM   6084  C CG     . PHE A 1 365 ? -4.693  -16.599 115.983 1.00 42.18  ? 365 PHE A CG     1 
ATOM   6085  C CD1    . PHE A 1 365 ? -5.341  -17.219 117.040 1.00 45.16  ? 365 PHE A CD1    1 
ATOM   6086  C CD2    . PHE A 1 365 ? -4.550  -17.289 114.793 1.00 43.68  ? 365 PHE A CD2    1 
ATOM   6087  C CE1    . PHE A 1 365 ? -5.813  -18.509 116.915 1.00 47.37  ? 365 PHE A CE1    1 
ATOM   6088  C CE2    . PHE A 1 365 ? -5.029  -18.581 114.657 1.00 43.20  ? 365 PHE A CE2    1 
ATOM   6089  C CZ     . PHE A 1 365 ? -5.663  -19.191 115.712 1.00 44.08  ? 365 PHE A CZ     1 
ATOM   6090  H H      . PHE A 1 365 ? -4.967  -14.141 113.833 1.00 55.79  ? 365 PHE A H      1 
ATOM   6091  H HA     . PHE A 1 365 ? -6.009  -14.288 116.346 1.00 54.21  ? 365 PHE A HA     1 
ATOM   6092  H HB2    . PHE A 1 365 ? -3.433  -15.096 115.513 1.00 51.10  ? 365 PHE A HB2    1 
ATOM   6093  H HB3    . PHE A 1 365 ? -3.892  -15.075 117.033 1.00 51.10  ? 365 PHE A HB3    1 
ATOM   6094  H HD1    . PHE A 1 365 ? -5.445  -16.766 117.845 1.00 54.59  ? 365 PHE A HD1    1 
ATOM   6095  H HD2    . PHE A 1 365 ? -4.123  -16.880 114.075 1.00 52.80  ? 365 PHE A HD2    1 
ATOM   6096  H HE1    . PHE A 1 365 ? -6.244  -18.918 117.631 1.00 57.24  ? 365 PHE A HE1    1 
ATOM   6097  H HE2    . PHE A 1 365 ? -4.921  -19.036 113.853 1.00 52.24  ? 365 PHE A HE2    1 
ATOM   6098  H HZ     . PHE A 1 365 ? -5.981  -20.061 115.626 1.00 53.29  ? 365 PHE A HZ     1 
ATOM   6099  N N      . ARG A 1 366 ? -4.962  -12.288 117.324 1.00 54.30  ? 366 ARG A N      1 
ATOM   6100  C CA     . ARG A 1 366 ? -4.547  -10.964 117.761 1.00 59.00  ? 366 ARG A CA     1 
ATOM   6101  C C      . ARG A 1 366 ? -3.019  -10.923 117.938 1.00 57.70  ? 366 ARG A C      1 
ATOM   6102  O O      . ARG A 1 366 ? -2.455  -11.808 118.574 1.00 61.13  ? 366 ARG A O      1 
ATOM   6103  C CB     . ARG A 1 366 ? -5.287  -10.644 119.056 1.00 66.32  ? 366 ARG A CB     1 
ATOM   6104  C CG     . ARG A 1 366 ? -5.002  -9.314  119.704 1.00 73.67  ? 366 ARG A CG     1 
ATOM   6105  C CD     . ARG A 1 366 ? -5.946  -9.155  120.894 1.00 78.10  ? 366 ARG A CD     1 
ATOM   6106  N NE     . ARG A 1 366 ? -5.665  -10.193 121.885 1.00 81.63  ? 366 ARG A NE     1 
ATOM   6107  C CZ     . ARG A 1 366 ? -4.857  -10.058 122.933 1.00 81.55  ? 366 ARG A CZ     1 
ATOM   6108  N NH1    . ARG A 1 366 ? -4.233  -8.911  123.182 1.00 80.06  ? 366 ARG A NH1    1 
ATOM   6109  N NH2    . ARG A 1 366 ? -4.670  -11.088 123.742 1.00 79.55  ? 366 ARG A NH2    1 
ATOM   6110  H H      . ARG A 1 366 ? -5.398  -12.728 117.920 1.00 65.55  ? 366 ARG A H      1 
ATOM   6111  H HA     . ARG A 1 366 ? -4.798  -10.308 117.092 1.00 71.19  ? 366 ARG A HA     1 
ATOM   6112  H HB2    . ARG A 1 366 ? -6.239  -10.673 118.873 1.00 79.97  ? 366 ARG A HB2    1 
ATOM   6113  H HB3    . ARG A 1 366 ? -5.066  -11.330 119.705 1.00 79.97  ? 366 ARG A HB3    1 
ATOM   6114  H HG2    . ARG A 1 366 ? -4.087  -9.291  120.023 1.00 88.79  ? 366 ARG A HG2    1 
ATOM   6115  H HG3    . ARG A 1 366 ? -5.168  -8.597  119.073 1.00 88.79  ? 366 ARG A HG3    1 
ATOM   6116  H HD2    . ARG A 1 366 ? -5.808  -8.287  121.306 1.00 94.11  ? 366 ARG A HD2    1 
ATOM   6117  H HD3    . ARG A 1 366 ? -6.865  -9.250  120.597 1.00 94.11  ? 366 ARG A HD3    1 
ATOM   6118  H HE     . ARG A 1 366 ? -6.053  -10.953 121.781 1.00 98.35  ? 366 ARG A HE     1 
ATOM   6119  H HH11   . ARG A 1 366 ? -4.344  -8.238  122.657 1.00 96.46  ? 366 ARG A HH11   1 
ATOM   6120  H HH12   . ARG A 1 366 ? -3.717  -8.841  123.866 1.00 96.46  ? 366 ARG A HH12   1 
ATOM   6121  H HH21   . ARG A 1 366 ? -5.074  -11.832 123.590 1.00 95.86  ? 366 ARG A HH21   1 
ATOM   6122  H HH22   . ARG A 1 366 ? -4.158  -11.009 124.428 1.00 95.86  ? 366 ARG A HH22   1 
ATOM   6123  N N      . PRO A 1 367 ? -2.340  -9.904  117.366 1.00 51.14  ? 367 PRO A N      1 
ATOM   6124  C CA     . PRO A 1 367 ? -0.884  -9.775  117.546 1.00 45.71  ? 367 PRO A CA     1 
ATOM   6125  C C      . PRO A 1 367 ? -0.428  -9.489  118.974 1.00 43.38  ? 367 PRO A C      1 
ATOM   6126  O O      . PRO A 1 367 ? -1.259  -9.289  119.871 1.00 41.31  ? 367 PRO A O      1 
ATOM   6127  C CB     . PRO A 1 367 ? -0.524  -8.585  116.649 1.00 39.60  ? 367 PRO A CB     1 
ATOM   6128  C CG     . PRO A 1 367 ? -1.539  -8.579  115.606 1.00 41.75  ? 367 PRO A CG     1 
ATOM   6129  C CD     . PRO A 1 367 ? -2.817  -9.030  116.279 1.00 48.85  ? 367 PRO A CD     1 
ATOM   6130  H HA     . PRO A 1 367 ? -0.433  -10.569 117.219 1.00 55.24  ? 367 PRO A HA     1 
ATOM   6131  H HB2    . PRO A 1 367 ? -0.557  -7.764  117.165 1.00 47.91  ? 367 PRO A HB2    1 
ATOM   6132  H HB3    . PRO A 1 367 ? 0.359   -8.717  116.268 1.00 47.91  ? 367 PRO A HB3    1 
ATOM   6133  H HG2    . PRO A 1 367 ? -1.638  -7.682  115.252 1.00 50.49  ? 367 PRO A HG2    1 
ATOM   6134  H HG3    . PRO A 1 367 ? -1.287  -9.198  114.903 1.00 50.49  ? 367 PRO A HG3    1 
ATOM   6135  H HD2    . PRO A 1 367 ? -3.294  -8.268  116.643 1.00 59.01  ? 367 PRO A HD2    1 
ATOM   6136  H HD3    . PRO A 1 367 ? -3.368  -9.532  115.658 1.00 59.01  ? 367 PRO A HD3    1 
ATOM   6137  N N      . PHE A 1 368 ? 0.889   -9.448  119.174 1.00 38.02  ? 368 PHE A N      1 
ATOM   6138  C CA     . PHE A 1 368 ? 1.417   -9.224  120.505 1.00 35.56  ? 368 PHE A CA     1 
ATOM   6139  C C      . PHE A 1 368 ? 2.824   -8.621  120.518 1.00 36.33  ? 368 PHE A C      1 
ATOM   6140  O O      . PHE A 1 368 ? 3.636   -8.809  119.585 1.00 32.36  ? 368 PHE A O      1 
ATOM   6141  C CB     . PHE A 1 368 ? 1.415   -10.533 121.271 1.00 35.19  ? 368 PHE A CB     1 
ATOM   6142  C CG     . PHE A 1 368 ? 2.341   -11.548 120.717 1.00 33.47  ? 368 PHE A CG     1 
ATOM   6143  C CD1    . PHE A 1 368 ? 3.665   -11.564 121.097 1.00 35.00  ? 368 PHE A CD1    1 
ATOM   6144  C CD2    . PHE A 1 368 ? 1.897   -12.483 119.819 1.00 35.35  ? 368 PHE A CD2    1 
ATOM   6145  C CE1    . PHE A 1 368 ? 4.532   -12.505 120.603 1.00 33.36  ? 368 PHE A CE1    1 
ATOM   6146  C CE2    . PHE A 1 368 ? 2.758   -13.436 119.312 1.00 35.37  ? 368 PHE A CE2    1 
ATOM   6147  C CZ     . PHE A 1 368 ? 4.082   -13.443 119.703 1.00 34.07  ? 368 PHE A CZ     1 
ATOM   6148  H H      . PHE A 1 368 ? 1.486   -9.546  118.561 1.00 46.01  ? 368 PHE A H      1 
ATOM   6149  H HA     . PHE A 1 368 ? 0.830   -8.609  120.971 1.00 43.06  ? 368 PHE A HA     1 
ATOM   6150  H HB2    . PHE A 1 368 ? 1.678   -10.359 122.188 1.00 42.62  ? 368 PHE A HB2    1 
ATOM   6151  H HB3    . PHE A 1 368 ? 0.519   -10.906 121.251 1.00 42.62  ? 368 PHE A HB3    1 
ATOM   6152  H HD1    . PHE A 1 368 ? 3.974   -10.935 121.708 1.00 42.39  ? 368 PHE A HD1    1 
ATOM   6153  H HD2    . PHE A 1 368 ? 1.004   -12.483 119.557 1.00 42.81  ? 368 PHE A HD2    1 
ATOM   6154  H HE1    . PHE A 1 368 ? 5.424   -12.504 120.869 1.00 40.43  ? 368 PHE A HE1    1 
ATOM   6155  H HE2    . PHE A 1 368 ? 2.448   -14.067 118.704 1.00 42.83  ? 368 PHE A HE2    1 
ATOM   6156  H HZ     . PHE A 1 368 ? 4.667   -14.080 119.361 1.00 41.28  ? 368 PHE A HZ     1 
ATOM   6157  N N      . ILE A 1 369 ? 3.096   -7.906  121.610 1.00 36.69  ? 369 ILE A N      1 
ATOM   6158  C CA     . ILE A 1 369 ? 4.387   -7.290  121.840 1.00 36.04  ? 369 ILE A CA     1 
ATOM   6159  C C      . ILE A 1 369 ? 5.223   -8.252  122.661 1.00 37.08  ? 369 ILE A C      1 
ATOM   6160  O O      . ILE A 1 369 ? 4.758   -8.794  123.673 1.00 34.91  ? 369 ILE A O      1 
ATOM   6161  C CB     . ILE A 1 369 ? 4.257   -5.964  122.573 1.00 37.36  ? 369 ILE A CB     1 
ATOM   6162  C CG1    . ILE A 1 369 ? 3.501   -4.966  121.705 1.00 36.63  ? 369 ILE A CG1    1 
ATOM   6163  C CG2    . ILE A 1 369 ? 5.634   -5.434  122.963 1.00 37.11  ? 369 ILE A CG2    1 
ATOM   6164  C CD1    . ILE A 1 369 ? 3.126   -3.717  122.448 1.00 41.45  ? 369 ILE A CD1    1 
ATOM   6165  H H      . ILE A 1 369 ? 2.531   -7.766  122.243 1.00 44.42  ? 369 ILE A H      1 
ATOM   6166  H HA     . ILE A 1 369 ? 4.831   -7.135  120.992 1.00 43.64  ? 369 ILE A HA     1 
ATOM   6167  H HB     . ILE A 1 369 ? 3.746   -6.112  123.384 1.00 45.22  ? 369 ILE A HB     1 
ATOM   6168  H HG12   . ILE A 1 369 ? 4.061   -4.712  120.955 1.00 44.35  ? 369 ILE A HG12   1 
ATOM   6169  H HG13   . ILE A 1 369 ? 2.685   -5.381  121.384 1.00 44.35  ? 369 ILE A HG13   1 
ATOM   6170  H HG21   . ILE A 1 369 ? 5.527   -4.589  123.428 1.00 44.93  ? 369 ILE A HG21   1 
ATOM   6171  H HG22   . ILE A 1 369 ? 6.067   -6.079  123.543 1.00 44.93  ? 369 ILE A HG22   1 
ATOM   6172  H HG23   . ILE A 1 369 ? 6.161   -5.305  122.159 1.00 44.93  ? 369 ILE A HG23   1 
ATOM   6173  H HD11   . ILE A 1 369 ? 2.650   -3.123  121.847 1.00 50.13  ? 369 ILE A HD11   1 
ATOM   6174  H HD12   . ILE A 1 369 ? 2.558   -3.955  123.198 1.00 50.13  ? 369 ILE A HD12   1 
ATOM   6175  H HD13   . ILE A 1 369 ? 3.934   -3.286  122.768 1.00 50.13  ? 369 ILE A HD13   1 
ATOM   6176  N N      . GLU A 1 370 ? 6.444   -8.488  122.191 1.00 38.97  ? 370 GLU A N      1 
ATOM   6177  C CA     . GLU A 1 370 ? 7.423   -9.293  122.914 1.00 40.62  ? 370 GLU A CA     1 
ATOM   6178  C C      . GLU A 1 370 ? 8.786   -8.649  122.720 1.00 39.87  ? 370 GLU A C      1 
ATOM   6179  O O      . GLU A 1 370 ? 9.159   -8.316  121.593 1.00 42.03  ? 370 GLU A O      1 
ATOM   6180  C CB     . GLU A 1 370 ? 7.415   -10.742 122.411 1.00 44.09  ? 370 GLU A CB     1 
ATOM   6181  C CG     . GLU A 1 370 ? 8.440   -11.678 123.059 1.00 46.00  ? 370 GLU A CG     1 
ATOM   6182  C CD     . GLU A 1 370 ? 8.136   -13.140 122.761 1.00 51.46  ? 370 GLU A CD     1 
ATOM   6183  O OE1    . GLU A 1 370 ? 9.022   -13.856 122.236 1.00 51.82  ? 370 GLU A OE1    1 
ATOM   6184  O OE2    . GLU A 1 370 ? 6.998   -13.570 123.047 1.00 55.52  ? 370 GLU A OE2    1 
ATOM   6185  H H      . GLU A 1 370 ? 6.735   -8.186  121.440 1.00 47.15  ? 370 GLU A H      1 
ATOM   6186  H HA     . GLU A 1 370 ? 7.212   -9.292  123.860 1.00 49.14  ? 370 GLU A HA     1 
ATOM   6187  H HB2    . GLU A 1 370 ? 6.536   -11.117 122.575 1.00 53.30  ? 370 GLU A HB2    1 
ATOM   6188  H HB3    . GLU A 1 370 ? 7.590   -10.736 121.457 1.00 53.30  ? 370 GLU A HB3    1 
ATOM   6189  H HG2    . GLU A 1 370 ? 9.323   -11.474 122.711 1.00 55.59  ? 370 GLU A HG2    1 
ATOM   6190  H HG3    . GLU A 1 370 ? 8.422   -11.554 124.021 1.00 55.59  ? 370 GLU A HG3    1 
ATOM   6191  N N      . ASN A 1 371 ? 9.508   -8.464  123.823 1.00 40.07  ? 371 ASN A N      1 
ATOM   6192  C CA     . ASN A 1 371 ? 10.828  -7.830  123.816 1.00 43.48  ? 371 ASN A CA     1 
ATOM   6193  C C      . ASN A 1 371 ? 10.828  -6.552  122.966 1.00 51.32  ? 371 ASN A C      1 
ATOM   6194  O O      . ASN A 1 371 ? 11.701  -6.327  122.122 1.00 51.83  ? 371 ASN A O      1 
ATOM   6195  C CB     . ASN A 1 371 ? 11.918  -8.798  123.335 1.00 42.89  ? 371 ASN A CB     1 
ATOM   6196  C CG     . ASN A 1 371 ? 12.410  -9.729  124.439 1.00 45.84  ? 371 ASN A CG     1 
ATOM   6197  O OD1    . ASN A 1 371 ? 12.341  -9.401  125.623 1.00 47.82  ? 371 ASN A OD1    1 
ATOM   6198  N ND2    . ASN A 1 371 ? 12.960  -10.876 124.045 1.00 43.17  ? 371 ASN A ND2    1 
ATOM   6199  H H      . ASN A 1 371 ? 9.248   -8.702  124.607 1.00 48.48  ? 371 ASN A H      1 
ATOM   6200  H HA     . ASN A 1 371 ? 11.048  -7.573  124.725 1.00 52.57  ? 371 ASN A HA     1 
ATOM   6201  H HB2    . ASN A 1 371 ? 11.561  -9.345  122.618 1.00 51.85  ? 371 ASN A HB2    1 
ATOM   6202  H HB3    . ASN A 1 371 ? 12.677  -8.285  123.015 1.00 51.85  ? 371 ASN A HB3    1 
ATOM   6203  H HD21   . ASN A 1 371 ? 13.252  -11.435 124.629 1.00 52.20  ? 371 ASN A HD21   1 
ATOM   6204  H HD22   . ASN A 1 371 ? 13.022  -11.058 123.207 1.00 52.20  ? 371 ASN A HD22   1 
ATOM   6205  N N      . GLY A 1 372 ? 9.805   -5.735  123.185 1.00 56.22  ? 372 GLY A N      1 
ATOM   6206  C CA     . GLY A 1 372 ? 9.758   -4.393  122.646 1.00 58.08  ? 372 GLY A CA     1 
ATOM   6207  C C      . GLY A 1 372 ? 9.428   -4.288  121.175 1.00 54.75  ? 372 GLY A C      1 
ATOM   6208  O O      . GLY A 1 372 ? 9.679   -3.247  120.565 1.00 60.17  ? 372 GLY A O      1 
ATOM   6209  H H      . GLY A 1 372 ? 9.115   -5.943  123.654 1.00 67.86  ? 372 GLY A H      1 
ATOM   6210  H HA2    . GLY A 1 372 ? 9.094   -3.883  123.135 1.00 70.09  ? 372 GLY A HA2    1 
ATOM   6211  H HA3    . GLY A 1 372 ? 10.620  -3.970  122.786 1.00 70.09  ? 372 GLY A HA3    1 
ATOM   6212  N N      . ARG A 1 373 ? 8.840   -5.333  120.602 1.00 43.36  ? 373 ARG A N      1 
ATOM   6213  C CA     . ARG A 1 373 ? 8.349   -5.219  119.237 1.00 41.24  ? 373 ARG A CA     1 
ATOM   6214  C C      . ARG A 1 373 ? 7.200   -6.165  119.000 1.00 39.81  ? 373 ARG A C      1 
ATOM   6215  O O      . ARG A 1 373 ? 6.990   -7.142  119.723 1.00 45.54  ? 373 ARG A O      1 
ATOM   6216  C CB     . ARG A 1 373 ? 9.453   -5.473  118.212 1.00 44.12  ? 373 ARG A CB     1 
ATOM   6217  C CG     . ARG A 1 373 ? 9.759   -6.919  117.947 1.00 44.15  ? 373 ARG A CG     1 
ATOM   6218  C CD     . ARG A 1 373 ? 11.118  -7.073  117.265 1.00 41.79  ? 373 ARG A CD     1 
ATOM   6219  N NE     . ARG A 1 373 ? 11.173  -6.384  115.972 1.00 38.59  ? 373 ARG A NE     1 
ATOM   6220  C CZ     . ARG A 1 373 ? 12.229  -5.714  115.510 1.00 39.48  ? 373 ARG A CZ     1 
ATOM   6221  N NH1    . ARG A 1 373 ? 13.353  -5.641  116.222 1.00 40.86  ? 373 ARG A NH1    1 
ATOM   6222  N NH2    . ARG A 1 373 ? 12.171  -5.127  114.316 1.00 38.22  ? 373 ARG A NH2    1 
ATOM   6223  H H      . ARG A 1 373 ? 8.717   -6.100  120.971 1.00 52.42  ? 373 ARG A H      1 
ATOM   6224  H HA     . ARG A 1 373 ? 8.021   -4.317  119.099 1.00 49.88  ? 373 ARG A HA     1 
ATOM   6225  H HB2    . ARG A 1 373 ? 9.190   -5.071  117.370 1.00 53.34  ? 373 ARG A HB2    1 
ATOM   6226  H HB3    . ARG A 1 373 ? 10.269  -5.055  118.530 1.00 53.34  ? 373 ARG A HB3    1 
ATOM   6227  H HG2    . ARG A 1 373 ? 9.783   -7.403  118.788 1.00 53.38  ? 373 ARG A HG2    1 
ATOM   6228  H HG3    . ARG A 1 373 ? 9.080   -7.291  117.363 1.00 53.38  ? 373 ARG A HG3    1 
ATOM   6229  H HD2    . ARG A 1 373 ? 11.805  -6.696  117.836 1.00 50.53  ? 373 ARG A HD2    1 
ATOM   6230  H HD3    . ARG A 1 373 ? 11.292  -8.015  117.111 1.00 50.53  ? 373 ARG A HD3    1 
ATOM   6231  H HE     . ARG A 1 373 ? 10.472  -6.414  115.475 1.00 46.69  ? 373 ARG A HE     1 
ATOM   6232  H HH11   . ARG A 1 373 ? 13.399  -6.020  116.993 1.00 49.43  ? 373 ARG A HH11   1 
ATOM   6233  H HH12   . ARG A 1 373 ? 14.030  -5.209  115.915 1.00 49.43  ? 373 ARG A HH12   1 
ATOM   6234  H HH21   . ARG A 1 373 ? 11.450  -5.172  113.850 1.00 46.26  ? 373 ARG A HH21   1 
ATOM   6235  H HH22   . ARG A 1 373 ? 12.852  -4.697  114.015 1.00 46.26  ? 373 ARG A HH22   1 
ATOM   6236  N N      . TRP A 1 374 ? 6.450   -5.846  117.964 1.00 36.16  ? 374 TRP A N      1 
ATOM   6237  C CA     . TRP A 1 374 ? 5.219   -6.539  117.676 1.00 37.08  ? 374 TRP A CA     1 
ATOM   6238  C C      . TRP A 1 374 ? 5.474   -7.872  117.006 1.00 36.90  ? 374 TRP A C      1 
ATOM   6239  O O      . TRP A 1 374 ? 6.450   -8.031  116.275 1.00 36.35  ? 374 TRP A O      1 
ATOM   6240  C CB     . TRP A 1 374 ? 4.347   -5.642  116.802 1.00 34.46  ? 374 TRP A CB     1 
ATOM   6241  C CG     . TRP A 1 374 ? 3.741   -4.495  117.574 1.00 36.59  ? 374 TRP A CG     1 
ATOM   6242  C CD1    . TRP A 1 374 ? 4.285   -3.259  117.771 1.00 37.49  ? 374 TRP A CD1    1 
ATOM   6243  C CD2    . TRP A 1 374 ? 2.465   -4.478  118.222 1.00 37.41  ? 374 TRP A CD2    1 
ATOM   6244  N NE1    . TRP A 1 374 ? 3.435   -2.481  118.517 1.00 36.54  ? 374 TRP A NE1    1 
ATOM   6245  C CE2    . TRP A 1 374 ? 2.312   -3.207  118.808 1.00 37.51  ? 374 TRP A CE2    1 
ATOM   6246  C CE3    . TRP A 1 374 ? 1.442   -5.419  118.373 1.00 35.22  ? 374 TRP A CE3    1 
ATOM   6247  C CZ2    . TRP A 1 374 ? 1.181   -2.852  119.523 1.00 36.37  ? 374 TRP A CZ2    1 
ATOM   6248  C CZ3    . TRP A 1 374 ? 0.321   -5.063  119.084 1.00 34.06  ? 374 TRP A CZ3    1 
ATOM   6249  C CH2    . TRP A 1 374 ? 0.198   -3.792  119.651 1.00 34.72  ? 374 TRP A CH2    1 
ATOM   6250  H H      . TRP A 1 374 ? 6.638   -5.220  117.405 1.00 43.78  ? 374 TRP A H      1 
ATOM   6251  H HA     . TRP A 1 374 ? 4.745   -6.705  118.506 1.00 44.88  ? 374 TRP A HA     1 
ATOM   6252  H HB2    . TRP A 1 374 ? 4.889   -5.270  116.089 1.00 41.75  ? 374 TRP A HB2    1 
ATOM   6253  H HB3    . TRP A 1 374 ? 3.623   -6.169  116.429 1.00 41.75  ? 374 TRP A HB3    1 
ATOM   6254  H HD1    . TRP A 1 374 ? 5.117   -2.987  117.457 1.00 45.37  ? 374 TRP A HD1    1 
ATOM   6255  H HE1    . TRP A 1 374 ? 3.583   -1.670  118.761 1.00 44.24  ? 374 TRP A HE1    1 
ATOM   6256  H HE3    . TRP A 1 374 ? 1.519   -6.267  118.000 1.00 42.65  ? 374 TRP A HE3    1 
ATOM   6257  H HZ2    . TRP A 1 374 ? 1.094   -2.007  119.900 1.00 44.03  ? 374 TRP A HZ2    1 
ATOM   6258  H HZ3    . TRP A 1 374 ? -0.366  -5.680  119.194 1.00 41.26  ? 374 TRP A HZ3    1 
ATOM   6259  H HH2    . TRP A 1 374 ? -0.571  -3.581  120.128 1.00 42.05  ? 374 TRP A HH2    1 
ATOM   6260  N N      . TRP A 1 375 ? 4.610   -8.837  117.288 1.00 40.04  ? 375 TRP A N      1 
ATOM   6261  C CA     . TRP A 1 375 ? 4.667   -10.123 116.612 1.00 44.38  ? 375 TRP A CA     1 
ATOM   6262  C C      . TRP A 1 375 ? 3.254   -10.521 116.280 1.00 45.97  ? 375 TRP A C      1 
ATOM   6263  O O      . TRP A 1 375 ? 2.314   -10.180 117.000 1.00 52.37  ? 375 TRP A O      1 
ATOM   6264  C CB     . TRP A 1 375 ? 5.336   -11.196 117.474 1.00 43.76  ? 375 TRP A CB     1 
ATOM   6265  C CG     . TRP A 1 375 ? 6.793   -10.986 117.624 1.00 46.14  ? 375 TRP A CG     1 
ATOM   6266  C CD1    . TRP A 1 375 ? 7.407   -10.127 118.488 1.00 49.21  ? 375 TRP A CD1    1 
ATOM   6267  C CD2    . TRP A 1 375 ? 7.840   -11.624 116.879 1.00 46.22  ? 375 TRP A CD2    1 
ATOM   6268  N NE1    . TRP A 1 375 ? 8.769   -10.193 118.329 1.00 50.21  ? 375 TRP A NE1    1 
ATOM   6269  C CE2    . TRP A 1 375 ? 9.061   -11.103 117.348 1.00 47.40  ? 375 TRP A CE2    1 
ATOM   6270  C CE3    . TRP A 1 375 ? 7.863   -12.584 115.864 1.00 45.05  ? 375 TRP A CE3    1 
ATOM   6271  C CZ2    . TRP A 1 375 ? 10.290  -11.514 116.840 1.00 44.53  ? 375 TRP A CZ2    1 
ATOM   6272  C CZ3    . TRP A 1 375 ? 9.080   -12.991 115.364 1.00 41.05  ? 375 TRP A CZ3    1 
ATOM   6273  C CH2    . TRP A 1 375 ? 10.279  -12.461 115.856 1.00 41.20  ? 375 TRP A CH2    1 
ATOM   6274  H H      . TRP A 1 375 ? 3.979   -8.771  117.868 1.00 48.44  ? 375 TRP A H      1 
ATOM   6275  H HA     . TRP A 1 375 ? 5.166   -10.034 115.785 1.00 53.64  ? 375 TRP A HA     1 
ATOM   6276  H HB2    . TRP A 1 375 ? 4.938   -11.184 118.358 1.00 52.90  ? 375 TRP A HB2    1 
ATOM   6277  H HB3    . TRP A 1 375 ? 5.199   -12.063 117.060 1.00 52.90  ? 375 TRP A HB3    1 
ATOM   6278  H HD1    . TRP A 1 375 ? 6.967   -9.573  119.091 1.00 59.44  ? 375 TRP A HD1    1 
ATOM   6279  H HE1    . TRP A 1 375 ? 9.347   -9.737  118.775 1.00 60.65  ? 375 TRP A HE1    1 
ATOM   6280  H HE3    . TRP A 1 375 ? 7.072   -12.944 115.535 1.00 54.45  ? 375 TRP A HE3    1 
ATOM   6281  H HZ2    . TRP A 1 375 ? 11.088  -11.164 117.165 1.00 53.83  ? 375 TRP A HZ2    1 
ATOM   6282  H HZ3    . TRP A 1 375 ? 9.106   -13.630 114.689 1.00 49.65  ? 375 TRP A HZ3    1 
ATOM   6283  H HH2    . TRP A 1 375 ? 11.086  -12.751 115.495 1.00 49.83  ? 375 TRP A HH2    1 
ATOM   6284  N N      . ALA A 1 376 ? 3.111   -11.226 115.170 1.00 38.26  ? 376 ALA A N      1 
ATOM   6285  C CA     . ALA A 1 376 ? 1.819   -11.693 114.734 1.00 37.43  ? 376 ALA A CA     1 
ATOM   6286  C C      . ALA A 1 376 ? 1.893   -13.186 114.442 1.00 36.82  ? 376 ALA A C      1 
ATOM   6287  O O      . ALA A 1 376 ? 2.940   -13.719 114.073 1.00 36.08  ? 376 ALA A O      1 
ATOM   6288  C CB     . ALA A 1 376 ? 1.357   -10.917 113.516 1.00 35.78  ? 376 ALA A CB     1 
ATOM   6289  H H      . ALA A 1 376 ? 3.759   -11.448 114.649 1.00 46.30  ? 376 ALA A H      1 
ATOM   6290  H HA     . ALA A 1 376 ? 1.173   -11.555 115.444 1.00 45.31  ? 376 ALA A HA     1 
ATOM   6291  H HB1    . ALA A 1 376 ? 0.488   -11.249 113.242 1.00 43.33  ? 376 ALA A HB1    1 
ATOM   6292  H HB2    . ALA A 1 376 ? 1.296   -9.977  113.746 1.00 43.33  ? 376 ALA A HB2    1 
ATOM   6293  H HB3    . ALA A 1 376 ? 2.000   -11.042 112.801 1.00 43.33  ? 376 ALA A HB3    1 
ATOM   6294  N N      . PHE A 1 377 ? 0.769   -13.853 114.643 1.00 32.06  ? 377 PHE A N      1 
ATOM   6295  C CA     . PHE A 1 377 ? 0.615   -15.239 114.263 1.00 33.58  ? 377 PHE A CA     1 
ATOM   6296  C C      . PHE A 1 377 ? 0.116   -15.301 112.832 1.00 37.39  ? 377 PHE A C      1 
ATOM   6297  O O      . PHE A 1 377 ? -0.866  -14.659 112.499 1.00 34.27  ? 377 PHE A O      1 
ATOM   6298  C CB     . PHE A 1 377 ? -0.357  -15.939 115.199 1.00 34.17  ? 377 PHE A CB     1 
ATOM   6299  C CG     . PHE A 1 377 ? 0.196   -16.177 116.565 1.00 31.04  ? 377 PHE A CG     1 
ATOM   6300  C CD1    . PHE A 1 377 ? 1.263   -17.030 116.749 1.00 28.83  ? 377 PHE A CD1    1 
ATOM   6301  C CD2    . PHE A 1 377 ? -0.357  -15.552 117.664 1.00 31.26  ? 377 PHE A CD2    1 
ATOM   6302  C CE1    . PHE A 1 377 ? 1.772   -17.257 118.005 1.00 29.02  ? 377 PHE A CE1    1 
ATOM   6303  C CE2    . PHE A 1 377 ? 0.144   -15.779 118.922 1.00 33.75  ? 377 PHE A CE2    1 
ATOM   6304  C CZ     . PHE A 1 377 ? 1.212   -16.633 119.094 1.00 32.57  ? 377 PHE A CZ     1 
ATOM   6305  H H      . PHE A 1 377 ? 0.067   -13.515 115.007 1.00 38.86  ? 377 PHE A H      1 
ATOM   6306  H HA     . PHE A 1 377 ? 1.473   -15.689 114.313 1.00 40.69  ? 377 PHE A HA     1 
ATOM   6307  H HB2    . PHE A 1 377 ? -1.152  -15.391 115.291 1.00 41.40  ? 377 PHE A HB2    1 
ATOM   6308  H HB3    . PHE A 1 377 ? -0.592  -16.800 114.819 1.00 41.40  ? 377 PHE A HB3    1 
ATOM   6309  H HD1    . PHE A 1 377 ? 1.643   -17.457 116.015 1.00 34.99  ? 377 PHE A HD1    1 
ATOM   6310  H HD2    . PHE A 1 377 ? -1.079  -14.978 117.553 1.00 37.90  ? 377 PHE A HD2    1 
ATOM   6311  H HE1    . PHE A 1 377 ? 2.492   -17.834 118.118 1.00 35.22  ? 377 PHE A HE1    1 
ATOM   6312  H HE2    . PHE A 1 377 ? -0.234  -15.353 119.657 1.00 40.89  ? 377 PHE A HE2    1 
ATOM   6313  H HZ     . PHE A 1 377 ? 1.555   -16.783 119.945 1.00 39.48  ? 377 PHE A HZ     1 
ATOM   6314  N N      . GLU A 1 378 ? 0.805   -16.060 111.992 1.00 46.44  ? 378 GLU A N      1 
ATOM   6315  C CA     . GLU A 1 378 ? 0.472   -16.170 110.575 1.00 55.30  ? 378 GLU A CA     1 
ATOM   6316  C C      . GLU A 1 378 ? 0.224   -17.639 110.233 1.00 48.21  ? 378 GLU A C      1 
ATOM   6317  O O      . GLU A 1 378 ? 0.314   -18.481 111.117 1.00 41.23  ? 378 GLU A O      1 
ATOM   6318  C CB     . GLU A 1 378 ? 1.598   -15.592 109.713 1.00 67.69  ? 378 GLU A CB     1 
ATOM   6319  C CG     . GLU A 1 378 ? 1.955   -14.132 109.994 1.00 73.73  ? 378 GLU A CG     1 
ATOM   6320  C CD     . GLU A 1 378 ? 0.957   -13.141 109.417 1.00 79.56  ? 378 GLU A CD     1 
ATOM   6321  O OE1    . GLU A 1 378 ? 1.349   -11.971 109.189 1.00 79.54  ? 378 GLU A OE1    1 
ATOM   6322  O OE2    . GLU A 1 378 ? -0.212  -13.524 109.189 1.00 81.97  ? 378 GLU A OE2    1 
ATOM   6323  H H      . GLU A 1 378 ? 1.486   -16.533 112.222 1.00 56.11  ? 378 GLU A H      1 
ATOM   6324  H HA     . GLU A 1 378 ? -0.340  -15.672 110.393 1.00 66.75  ? 378 GLU A HA     1 
ATOM   6325  H HB2    . GLU A 1 378 ? 2.399   -16.121 109.859 1.00 81.62  ? 378 GLU A HB2    1 
ATOM   6326  H HB3    . GLU A 1 378 ? 1.335   -15.654 108.781 1.00 81.62  ? 378 GLU A HB3    1 
ATOM   6327  H HG2    . GLU A 1 378 ? 1.987   -13.996 110.954 1.00 88.87  ? 378 GLU A HG2    1 
ATOM   6328  H HG3    . GLU A 1 378 ? 2.822   -13.940 109.604 1.00 88.87  ? 378 GLU A HG3    1 
ATOM   6329  N N      . MET A 1 379 ? -0.149  -17.925 108.981 1.00 46.79  ? 379 MET A N      1 
ATOM   6330  C CA     . MET A 1 379 ? -0.548  -19.279 108.558 1.00 45.17  ? 379 MET A CA     1 
ATOM   6331  C C      . MET A 1 379 ? 0.189   -19.766 107.297 1.00 43.68  ? 379 MET A C      1 
ATOM   6332  O O      . MET A 1 379 ? 0.072   -19.150 106.231 1.00 49.67  ? 379 MET A O      1 
ATOM   6333  C CB     . MET A 1 379 ? -2.059  -19.334 108.297 1.00 45.46  ? 379 MET A CB     1 
ATOM   6334  C CG     . MET A 1 379 ? -2.926  -18.851 109.457 1.00 46.63  ? 379 MET A CG     1 
ATOM   6335  S SD     . MET A 1 379 ? -3.146  -20.085 110.760 1.00 68.62  ? 379 MET A SD     1 
ATOM   6336  C CE     . MET A 1 379 ? -4.381  -21.169 110.039 1.00 61.70  ? 379 MET A CE     1 
ATOM   6337  H H      . MET A 1 379 ? -0.181  -17.344 108.347 1.00 56.54  ? 379 MET A H      1 
ATOM   6338  H HA     . MET A 1 379 ? -0.355  -19.895 109.282 1.00 54.60  ? 379 MET A HA     1 
ATOM   6339  H HB2    . MET A 1 379 ? -2.260  -18.777 107.529 1.00 54.94  ? 379 MET A HB2    1 
ATOM   6340  H HB3    . MET A 1 379 ? -2.307  -20.252 108.109 1.00 54.94  ? 379 MET A HB3    1 
ATOM   6341  H HG2    . MET A 1 379 ? -2.511  -18.070 109.854 1.00 56.34  ? 379 MET A HG2    1 
ATOM   6342  H HG3    . MET A 1 379 ? -3.804  -18.619 109.115 1.00 56.34  ? 379 MET A HG3    1 
ATOM   6343  H HE1    . MET A 1 379 ? -4.579  -21.882 110.665 1.00 74.43  ? 379 MET A HE1    1 
ATOM   6344  H HE2    . MET A 1 379 ? -5.184  -20.655 109.858 1.00 74.43  ? 379 MET A HE2    1 
ATOM   6345  H HE3    . MET A 1 379 ? -4.032  -21.540 109.214 1.00 74.43  ? 379 MET A HE3    1 
ATOM   6346  N N      . ARG A 1 380 ? 0.941   -20.859 107.402 1.00 40.15  ? 380 ARG A N      1 
ATOM   6347  C CA     . ARG A 1 380 ? 1.657   -21.371 106.229 1.00 44.57  ? 380 ARG A CA     1 
ATOM   6348  C C      . ARG A 1 380 ? 0.753   -22.202 105.306 1.00 47.19  ? 380 ARG A C      1 
ATOM   6349  O O      . ARG A 1 380 ? -0.218  -22.826 105.750 1.00 41.62  ? 380 ARG A O      1 
ATOM   6350  C CB     . ARG A 1 380 ? 2.873   -22.191 106.648 1.00 42.05  ? 380 ARG A CB     1 
ATOM   6351  C CG     . ARG A 1 380 ? 2.669   -23.060 107.855 1.00 43.76  ? 380 ARG A CG     1 
ATOM   6352  C CD     . ARG A 1 380 ? 3.898   -23.917 108.101 1.00 48.74  ? 380 ARG A CD     1 
ATOM   6353  N NE     . ARG A 1 380 ? 5.002   -23.183 108.729 1.00 49.58  ? 380 ARG A NE     1 
ATOM   6354  C CZ     . ARG A 1 380 ? 5.129   -23.001 110.046 1.00 49.29  ? 380 ARG A CZ     1 
ATOM   6355  N NH1    . ARG A 1 380 ? 4.222   -23.486 110.884 1.00 52.39  ? 380 ARG A NH1    1 
ATOM   6356  N NH2    . ARG A 1 380 ? 6.166   -22.336 110.538 1.00 46.26  ? 380 ARG A NH2    1 
ATOM   6357  H H      . ARG A 1 380 ? 1.054   -21.316 108.122 1.00 48.57  ? 380 ARG A H      1 
ATOM   6358  H HA     . ARG A 1 380 ? 1.980   -20.615 105.714 1.00 53.87  ? 380 ARG A HA     1 
ATOM   6359  H HB2    . ARG A 1 380 ? 3.124   -22.770 105.911 1.00 50.86  ? 380 ARG A HB2    1 
ATOM   6360  H HB3    . ARG A 1 380 ? 3.602   -21.583 106.846 1.00 50.86  ? 380 ARG A HB3    1 
ATOM   6361  H HG2    . ARG A 1 380 ? 2.521   -22.502 108.635 1.00 52.90  ? 380 ARG A HG2    1 
ATOM   6362  H HG3    . ARG A 1 380 ? 1.910   -23.646 107.708 1.00 52.90  ? 380 ARG A HG3    1 
ATOM   6363  H HD2    . ARG A 1 380 ? 3.657   -24.651 108.687 1.00 58.88  ? 380 ARG A HD2    1 
ATOM   6364  H HD3    . ARG A 1 380 ? 4.215   -24.262 107.252 1.00 58.88  ? 380 ARG A HD3    1 
ATOM   6365  H HE     . ARG A 1 380 ? 5.592   -22.826 108.215 1.00 59.89  ? 380 ARG A HE     1 
ATOM   6366  H HH11   . ARG A 1 380 ? 3.547   -23.923 110.580 1.00 63.26  ? 380 ARG A HH11   1 
ATOM   6367  H HH12   . ARG A 1 380 ? 4.310   -23.365 111.730 1.00 63.26  ? 380 ARG A HH12   1 
ATOM   6368  H HH21   . ARG A 1 380 ? 6.761   -22.013 110.007 1.00 55.90  ? 380 ARG A HH21   1 
ATOM   6369  H HH22   . ARG A 1 380 ? 6.238   -22.219 111.387 1.00 55.90  ? 380 ARG A HH22   1 
ATOM   6370  N N      . LYS A 1 381 ? 1.079   -22.189 104.014 1.00 48.67  ? 381 LYS A N      1 
ATOM   6371  C CA     . LYS A 1 381 ? 0.257   -22.851 103.002 1.00 52.57  ? 381 LYS A CA     1 
ATOM   6372  C C      . LYS A 1 381 ? 0.472   -24.364 102.975 1.00 58.07  ? 381 LYS A C      1 
ATOM   6373  O O      . LYS A 1 381 ? -0.298  -25.090 102.338 1.00 63.11  ? 381 LYS A O      1 
ATOM   6374  C CB     . LYS A 1 381 ? 0.546   -22.281 101.617 1.00 53.63  ? 381 LYS A CB     1 
ATOM   6375  C CG     . LYS A 1 381 ? 0.401   -20.774 101.524 1.00 54.82  ? 381 LYS A CG     1 
ATOM   6376  C CD     . LYS A 1 381 ? -1.016  -20.294 101.295 1.00 56.87  ? 381 LYS A CD     1 
ATOM   6377  C CE     . LYS A 1 381 ? -1.053  -18.767 101.405 1.00 63.02  ? 381 LYS A CE     1 
ATOM   6378  N NZ     . LYS A 1 381 ? -0.690  -18.278 102.794 1.00 66.13  ? 381 LYS A NZ     1 
ATOM   6379  H H      . LYS A 1 381 ? 1.777   -21.801 103.696 1.00 58.79  ? 381 LYS A H      1 
ATOM   6380  H HA     . LYS A 1 381 ? -0.678  -22.687 103.203 1.00 63.47  ? 381 LYS A HA     1 
ATOM   6381  H HB2    . LYS A 1 381 ? 1.457   -22.506 101.371 1.00 64.75  ? 381 LYS A HB2    1 
ATOM   6382  H HB3    . LYS A 1 381 ? -0.071  -22.677 100.982 1.00 64.75  ? 381 LYS A HB3    1 
ATOM   6383  H HG2    . LYS A 1 381 ? 0.715   -20.381 102.353 1.00 66.17  ? 381 LYS A HG2    1 
ATOM   6384  H HG3    . LYS A 1 381 ? 0.942   -20.456 100.785 1.00 66.17  ? 381 LYS A HG3    1 
ATOM   6385  H HD2    . LYS A 1 381 ? -1.309  -20.550 100.406 1.00 68.63  ? 381 LYS A HD2    1 
ATOM   6386  H HD3    . LYS A 1 381 ? -1.602  -20.669 101.971 1.00 68.63  ? 381 LYS A HD3    1 
ATOM   6387  H HE2    . LYS A 1 381 ? -0.418  -18.389 100.777 1.00 76.02  ? 381 LYS A HE2    1 
ATOM   6388  H HE3    . LYS A 1 381 ? -1.949  -18.456 101.201 1.00 76.02  ? 381 LYS A HE3    1 
ATOM   6389  H HZ1    . LYS A 1 381 ? -0.721  -17.389 102.822 1.00 79.75  ? 381 LYS A HZ1    1 
ATOM   6390  H HZ2    . LYS A 1 381 ? -1.262  -18.606 103.391 1.00 79.75  ? 381 LYS A HZ2    1 
ATOM   6391  H HZ3    . LYS A 1 381 ? 0.133   -18.545 103.005 1.00 79.75  ? 381 LYS A HZ3    1 
ATOM   6392  N N      . PHE A 1 382 ? 1.542   -24.833 103.616 1.00 55.82  ? 382 PHE A N      1 
ATOM   6393  C CA     . PHE A 1 382 ? 1.856   -26.261 103.621 1.00 51.13  ? 382 PHE A CA     1 
ATOM   6394  C C      . PHE A 1 382 ? 2.487   -26.643 104.949 1.00 42.99  ? 382 PHE A C      1 
ATOM   6395  O O      . PHE A 1 382 ? 3.346   -25.930 105.454 1.00 44.24  ? 382 PHE A O      1 
ATOM   6396  C CB     . PHE A 1 382 ? 2.812   -26.612 102.479 1.00 52.29  ? 382 PHE A CB     1 
ATOM   6397  C CG     . PHE A 1 382 ? 3.932   -25.613 102.288 1.00 48.04  ? 382 PHE A CG     1 
ATOM   6398  C CD1    . PHE A 1 382 ? 5.038   -25.635 103.117 1.00 45.18  ? 382 PHE A CD1    1 
ATOM   6399  C CD2    . PHE A 1 382 ? 3.869   -24.646 101.301 1.00 47.82  ? 382 PHE A CD2    1 
ATOM   6400  C CE1    . PHE A 1 382 ? 6.062   -24.736 102.957 1.00 44.98  ? 382 PHE A CE1    1 
ATOM   6401  C CE2    . PHE A 1 382 ? 4.896   -23.735 101.143 1.00 49.79  ? 382 PHE A CE2    1 
ATOM   6402  C CZ     . PHE A 1 382 ? 5.994   -23.784 101.975 1.00 48.31  ? 382 PHE A CZ     1 
ATOM   6403  H H      . PHE A 1 382 ? 2.100   -24.347 104.054 1.00 67.37  ? 382 PHE A H      1 
ATOM   6404  H HA     . PHE A 1 382 ? 1.040   -26.774 103.508 1.00 61.75  ? 382 PHE A HA     1 
ATOM   6405  H HB2    . PHE A 1 382 ? 3.214   -27.475 102.662 1.00 63.13  ? 382 PHE A HB2    1 
ATOM   6406  H HB3    . PHE A 1 382 ? 2.309   -26.653 101.651 1.00 63.13  ? 382 PHE A HB3    1 
ATOM   6407  H HD1    . PHE A 1 382 ? 5.096   -26.279 103.786 1.00 54.60  ? 382 PHE A HD1    1 
ATOM   6408  H HD2    . PHE A 1 382 ? 3.131   -24.611 100.737 1.00 57.77  ? 382 PHE A HD2    1 
ATOM   6409  H HE1    . PHE A 1 382 ? 6.800   -24.768 103.521 1.00 54.37  ? 382 PHE A HE1    1 
ATOM   6410  H HE2    . PHE A 1 382 ? 4.847   -23.092 100.473 1.00 60.14  ? 382 PHE A HE2    1 
ATOM   6411  H HZ     . PHE A 1 382 ? 6.687   -23.172 101.869 1.00 58.36  ? 382 PHE A HZ     1 
ATOM   6412  N N      . THR A 1 383 ? 2.049   -27.757 105.522 1.00 36.07  ? 383 THR A N      1 
ATOM   6413  C CA     . THR A 1 383 ? 2.575   -28.239 106.796 1.00 29.10  ? 383 THR A CA     1 
ATOM   6414  C C      . THR A 1 383 ? 3.588   -29.388 106.729 1.00 30.33  ? 383 THR A C      1 
ATOM   6415  O O      . THR A 1 383 ? 4.103   -29.821 107.762 1.00 28.93  ? 383 THR A O      1 
ATOM   6416  C CB     . THR A 1 383 ? 1.429   -28.623 107.672 1.00 32.27  ? 383 THR A CB     1 
ATOM   6417  O OG1    . THR A 1 383 ? 0.559   -29.500 106.947 1.00 30.18  ? 383 THR A OG1    1 
ATOM   6418  C CG2    . THR A 1 383 ? 0.674   -27.364 108.038 1.00 33.88  ? 383 THR A CG2    1 
ATOM   6419  H H      . THR A 1 383 ? 1.438   -28.261 105.188 1.00 43.67  ? 383 THR A H      1 
ATOM   6420  H HA     . THR A 1 383 ? 3.024   -27.496 107.229 1.00 35.31  ? 383 THR A HA     1 
ATOM   6421  H HB     . THR A 1 383 ? 1.749   -29.054 108.480 1.00 39.11  ? 383 THR A HB     1 
ATOM   6422  H HG1    . THR A 1 383 ? -0.090  -29.725 107.429 1.00 36.60  ? 383 THR A HG1    1 
ATOM   6423  H HG21   . THR A 1 383 ? -0.079  -27.584 108.610 1.00 41.05  ? 383 THR A HG21   1 
ATOM   6424  H HG22   . THR A 1 383 ? 1.260   -26.752 108.510 1.00 41.05  ? 383 THR A HG22   1 
ATOM   6425  H HG23   . THR A 1 383 ? 0.345   -26.930 107.236 1.00 41.05  ? 383 THR A HG23   1 
ATOM   6426  N N      . THR A 1 384 ? 3.866   -29.889 105.527 1.00 36.30  ? 384 THR A N      1 
ATOM   6427  C CA     . THR A 1 384 ? 4.798   -31.009 105.359 1.00 36.21  ? 384 THR A CA     1 
ATOM   6428  C C      . THR A 1 384 ? 5.800   -30.751 104.228 1.00 32.83  ? 384 THR A C      1 
ATOM   6429  O O      . THR A 1 384 ? 5.501   -30.011 103.286 1.00 30.37  ? 384 THR A O      1 
ATOM   6430  C CB     . THR A 1 384 ? 4.058   -32.314 105.051 1.00 35.17  ? 384 THR A CB     1 
ATOM   6431  O OG1    . THR A 1 384 ? 3.493   -32.237 103.735 1.00 36.90  ? 384 THR A OG1    1 
ATOM   6432  C CG2    . THR A 1 384 ? 2.967   -32.576 106.083 1.00 33.47  ? 384 THR A CG2    1 
ATOM   6433  H H      . THR A 1 384 ? 3.529   -29.599 104.790 1.00 43.95  ? 384 THR A H      1 
ATOM   6434  H HA     . THR A 1 384 ? 5.296   -31.132 106.182 1.00 43.84  ? 384 THR A HA     1 
ATOM   6435  H HB     . THR A 1 384 ? 4.687   -33.051 105.084 1.00 42.59  ? 384 THR A HB     1 
ATOM   6436  H HG1    . THR A 1 384 ? 3.084   -32.949 103.556 1.00 44.67  ? 384 THR A HG1    1 
ATOM   6437  H HG21   . THR A 1 384 ? 2.507   -33.405 105.876 1.00 40.55  ? 384 THR A HG21   1 
ATOM   6438  H HG22   . THR A 1 384 ? 3.357   -32.646 106.968 1.00 40.55  ? 384 THR A HG22   1 
ATOM   6439  H HG23   . THR A 1 384 ? 2.324   -31.850 106.078 1.00 40.55  ? 384 THR A HG23   1 
ATOM   6440  N N      . PRO A 1 385 ? 6.991   -31.371 104.316 1.00 26.27  ? 385 PRO A N      1 
ATOM   6441  C CA     . PRO A 1 385 ? 8.067   -31.119 103.343 1.00 24.86  ? 385 PRO A CA     1 
ATOM   6442  C C      . PRO A 1 385 ? 7.656   -31.405 101.893 1.00 30.26  ? 385 PRO A C      1 
ATOM   6443  O O      . PRO A 1 385 ? 7.955   -30.610 100.997 1.00 26.25  ? 385 PRO A O      1 
ATOM   6444  C CB     . PRO A 1 385 ? 9.172   -32.077 103.785 1.00 24.90  ? 385 PRO A CB     1 
ATOM   6445  C CG     . PRO A 1 385 ? 8.842   -32.438 105.187 1.00 23.93  ? 385 PRO A CG     1 
ATOM   6446  C CD     . PRO A 1 385 ? 7.371   -32.392 105.305 1.00 23.07  ? 385 PRO A CD     1 
ATOM   6447  H HA     . PRO A 1 385 ? 8.384   -30.205 103.416 1.00 30.22  ? 385 PRO A HA     1 
ATOM   6448  H HB2    . PRO A 1 385 ? 9.166   -32.865 103.219 1.00 30.27  ? 385 PRO A HB2    1 
ATOM   6449  H HB3    . PRO A 1 385 ? 10.031  -31.628 103.740 1.00 30.27  ? 385 PRO A HB3    1 
ATOM   6450  H HG2    . PRO A 1 385 ? 9.168   -33.332 105.375 1.00 29.10  ? 385 PRO A HG2    1 
ATOM   6451  H HG3    . PRO A 1 385 ? 9.250   -31.796 105.789 1.00 29.10  ? 385 PRO A HG3    1 
ATOM   6452  H HD2    . PRO A 1 385 ? 6.985   -33.250 105.071 1.00 28.07  ? 385 PRO A HD2    1 
ATOM   6453  H HD3    . PRO A 1 385 ? 7.110   -32.114 106.197 1.00 28.07  ? 385 PRO A HD3    1 
ATOM   6454  N N      . GLU A 1 386 ? 6.971   -32.533 101.686 1.00 35.35  ? 386 GLU A N      1 
ATOM   6455  C CA     . GLU A 1 386 ? 6.508   -32.959 100.366 1.00 33.59  ? 386 GLU A CA     1 
ATOM   6456  C C      . GLU A 1 386 ? 5.525   -31.942 99.789  1.00 36.87  ? 386 GLU A C      1 
ATOM   6457  O O      . GLU A 1 386 ? 5.507   -31.716 98.591  1.00 34.86  ? 386 GLU A O      1 
ATOM   6458  C CB     . GLU A 1 386 ? 5.839   -34.336 100.436 1.00 37.67  ? 386 GLU A CB     1 
ATOM   6459  C CG     . GLU A 1 386 ? 6.730   -35.499 100.920 1.00 38.31  ? 386 GLU A CG     1 
ATOM   6460  C CD     . GLU A 1 386 ? 6.684   -35.725 102.441 1.00 39.28  ? 386 GLU A CD     1 
ATOM   6461  O OE1    . GLU A 1 386 ? 6.362   -34.790 103.217 1.00 37.20  ? 386 GLU A OE1    1 
ATOM   6462  O OE2    . GLU A 1 386 ? 6.942   -36.872 102.861 1.00 39.18  ? 386 GLU A OE2    1 
ATOM   6463  H H      . GLU A 1 386 ? 6.758   -33.081 102.314 1.00 42.81  ? 386 GLU A H      1 
ATOM   6464  H HA     . GLU A 1 386 ? 7.267   -33.021 99.765  1.00 40.70  ? 386 GLU A HA     1 
ATOM   6465  H HB2    . GLU A 1 386 ? 5.085   -34.278 101.043 1.00 45.60  ? 386 GLU A HB2    1 
ATOM   6466  H HB3    . GLU A 1 386 ? 5.521   -34.566 99.549  1.00 45.60  ? 386 GLU A HB3    1 
ATOM   6467  H HG2    . GLU A 1 386 ? 6.436   -36.318 100.490 1.00 46.37  ? 386 GLU A HG2    1 
ATOM   6468  H HG3    . GLU A 1 386 ? 7.649   -35.312 100.676 1.00 46.37  ? 386 GLU A HG3    1 
ATOM   6469  N N      . GLU A 1 387 ? 4.658   -31.389 100.640 1.00 46.31  ? 387 GLU A N      1 
ATOM   6470  C CA     . GLU A 1 387 ? 3.718   -30.338 100.233 1.00 50.55  ? 387 GLU A CA     1 
ATOM   6471  C C      . GLU A 1 387 ? 4.423   -29.066 99.758  1.00 46.94  ? 387 GLU A C      1 
ATOM   6472  O O      . GLU A 1 387 ? 4.091   -28.517 98.717  1.00 52.04  ? 387 GLU A O      1 
ATOM   6473  C CB     . GLU A 1 387 ? 2.784   -29.961 101.386 1.00 59.74  ? 387 GLU A CB     1 
ATOM   6474  C CG     . GLU A 1 387 ? 1.686   -30.959 101.711 1.00 69.43  ? 387 GLU A CG     1 
ATOM   6475  C CD     . GLU A 1 387 ? 0.893   -30.542 102.949 1.00 74.99  ? 387 GLU A CD     1 
ATOM   6476  O OE1    . GLU A 1 387 ? 1.206   -29.464 103.503 1.00 74.79  ? 387 GLU A OE1    1 
ATOM   6477  O OE2    . GLU A 1 387 ? -0.017  -31.291 103.383 1.00 76.60  ? 387 GLU A OE2    1 
ATOM   6478  H H      . GLU A 1 387 ? 4.594   -31.607 101.469 1.00 55.97  ? 387 GLU A H      1 
ATOM   6479  H HA     . GLU A 1 387 ? 3.173   -30.669 99.502  1.00 61.05  ? 387 GLU A HA     1 
ATOM   6480  H HB2    . GLU A 1 387 ? 3.320   -29.850 102.187 1.00 72.08  ? 387 GLU A HB2    1 
ATOM   6481  H HB3    . GLU A 1 387 ? 2.354   -29.120 101.167 1.00 72.08  ? 387 GLU A HB3    1 
ATOM   6482  H HG2    . GLU A 1 387 ? 1.072   -31.014 100.962 1.00 83.70  ? 387 GLU A HG2    1 
ATOM   6483  H HG3    . GLU A 1 387 ? 2.083   -31.827 101.884 1.00 83.70  ? 387 GLU A HG3    1 
ATOM   6484  N N      . GLY A 1 388 ? 5.403   -28.603 100.525 1.00 40.44  ? 388 GLY A N      1 
ATOM   6485  C CA     . GLY A 1 388 ? 6.084   -27.365 100.208 1.00 37.23  ? 388 GLY A CA     1 
ATOM   6486  C C      . GLY A 1 388 ? 6.906   -27.447 98.932  1.00 39.87  ? 388 GLY A C      1 
ATOM   6487  O O      . GLY A 1 388 ? 6.990   -26.481 98.169  1.00 42.50  ? 388 GLY A O      1 
ATOM   6488  H H      . GLY A 1 388 ? 5.690   -28.992 101.236 1.00 48.92  ? 388 GLY A H      1 
ATOM   6489  H HA2    . GLY A 1 388 ? 5.430   -26.656 100.104 1.00 45.07  ? 388 GLY A HA2    1 
ATOM   6490  H HA3    . GLY A 1 388 ? 6.677   -27.129 100.938 1.00 45.07  ? 388 GLY A HA3    1 
ATOM   6491  N N      . VAL A 1 389 ? 7.522   -28.600 98.693  1.00 36.51  ? 389 VAL A N      1 
ATOM   6492  C CA     . VAL A 1 389 ? 8.354   -28.781 97.507  1.00 32.38  ? 389 VAL A CA     1 
ATOM   6493  C C      . VAL A 1 389 ? 7.451   -28.858 96.251  1.00 31.82  ? 389 VAL A C      1 
ATOM   6494  O O      . VAL A 1 389 ? 7.835   -28.363 95.183  1.00 30.48  ? 389 VAL A O      1 
ATOM   6495  C CB     . VAL A 1 389 ? 9.250   -30.038 97.641  1.00 28.84  ? 389 VAL A CB     1 
ATOM   6496  C CG1    . VAL A 1 389 ? 10.028  -30.278 96.370  1.00 28.26  ? 389 VAL A CG1    1 
ATOM   6497  C CG2    . VAL A 1 389 ? 10.233  -29.875 98.800  1.00 27.55  ? 389 VAL A CG2    1 
ATOM   6498  H H      . VAL A 1 389 ? 7.475   -29.292 99.201  1.00 44.20  ? 389 VAL A H      1 
ATOM   6499  H HA     . VAL A 1 389 ? 8.934   -28.010 97.410  1.00 39.24  ? 389 VAL A HA     1 
ATOM   6500  H HB     . VAL A 1 389 ? 8.696   -30.815 97.814  1.00 35.00  ? 389 VAL A HB     1 
ATOM   6501  H HG11   . VAL A 1 389 ? 10.579  -31.068 96.481  1.00 34.31  ? 389 VAL A HG11   1 
ATOM   6502  H HG12   . VAL A 1 389 ? 9.404   -30.409 95.638  1.00 34.31  ? 389 VAL A HG12   1 
ATOM   6503  H HG13   . VAL A 1 389 ? 10.588  -29.506 96.193  1.00 34.31  ? 389 VAL A HG13   1 
ATOM   6504  H HG21   . VAL A 1 389 ? 10.782  -30.673 98.862  1.00 33.45  ? 389 VAL A HG21   1 
ATOM   6505  H HG22   . VAL A 1 389 ? 10.793  -29.101 98.632  1.00 33.45  ? 389 VAL A HG22   1 
ATOM   6506  H HG23   . VAL A 1 389 ? 9.734   -29.751 99.622  1.00 33.45  ? 389 VAL A HG23   1 
ATOM   6507  N N      . ARG A 1 390 ? 6.278   -29.493 96.374  1.00 28.13  ? 390 ARG A N      1 
ATOM   6508  C CA     . ARG A 1 390 ? 5.264   -29.428 95.320  1.00 27.90  ? 390 ARG A CA     1 
ATOM   6509  C C      . ARG A 1 390 ? 5.016   -27.982 94.993  1.00 30.79  ? 390 ARG A C      1 
ATOM   6510  O O      . ARG A 1 390 ? 5.016   -27.578 93.838  1.00 37.29  ? 390 ARG A O      1 
ATOM   6511  C CB     . ARG A 1 390 ? 3.919   -30.031 95.726  1.00 32.24  ? 390 ARG A CB     1 
ATOM   6512  C CG     . ARG A 1 390 ? 2.898   -29.967 94.572  1.00 34.48  ? 390 ARG A CG     1 
ATOM   6513  C CD     . ARG A 1 390 ? 1.450   -30.184 94.968  1.00 37.22  ? 390 ARG A CD     1 
ATOM   6514  N NE     . ARG A 1 390 ? 1.183   -31.403 95.722  1.00 43.23  ? 390 ARG A NE     1 
ATOM   6515  C CZ     . ARG A 1 390 ? 0.831   -31.431 97.008  1.00 46.04  ? 390 ARG A CZ     1 
ATOM   6516  N NH1    . ARG A 1 390 ? 0.716   -30.301 97.714  1.00 38.41  ? 390 ARG A NH1    1 
ATOM   6517  N NH2    . ARG A 1 390 ? 0.595   -32.601 97.600  1.00 48.55  ? 390 ARG A NH2    1 
ATOM   6518  H H      . ARG A 1 390 ? 6.048   -29.965 97.056  1.00 34.14  ? 390 ARG A H      1 
ATOM   6519  H HA     . ARG A 1 390 ? 5.584   -29.881 94.525  1.00 33.88  ? 390 ARG A HA     1 
ATOM   6520  H HB2    . ARG A 1 390 ? 4.046   -30.961 95.968  1.00 39.08  ? 390 ARG A HB2    1 
ATOM   6521  H HB3    . ARG A 1 390 ? 3.560   -29.534 96.477  1.00 39.08  ? 390 ARG A HB3    1 
ATOM   6522  H HG2    . ARG A 1 390 ? 2.958   -29.092 94.158  1.00 41.77  ? 390 ARG A HG2    1 
ATOM   6523  H HG3    . ARG A 1 390 ? 3.127   -30.650 93.922  1.00 41.77  ? 390 ARG A HG3    1 
ATOM   6524  H HD2    . ARG A 1 390 ? 1.166   -29.436 95.516  1.00 45.05  ? 390 ARG A HD2    1 
ATOM   6525  H HD3    . ARG A 1 390 ? 0.913   -30.218 94.161  1.00 45.05  ? 390 ARG A HD3    1 
ATOM   6526  H HE     . ARG A 1 390 ? 1.258   -32.154 95.310  1.00 52.26  ? 390 ARG A HE     1 
ATOM   6527  H HH11   . ARG A 1 390 ? 0.863   -29.542 97.337  1.00 46.48  ? 390 ARG A HH11   1 
ATOM   6528  H HH12   . ARG A 1 390 ? 0.491   -30.333 98.543  1.00 46.48  ? 390 ARG A HH12   1 
ATOM   6529  H HH21   . ARG A 1 390 ? 0.672   -33.332 97.154  1.00 58.66  ? 390 ARG A HH21   1 
ATOM   6530  H HH22   . ARG A 1 390 ? 0.375   -32.626 98.431  1.00 58.66  ? 390 ARG A HH22   1 
ATOM   6531  N N      . SER A 1 391 ? 4.760   -27.218 96.047  1.00 27.20  ? 391 SER A N      1 
ATOM   6532  C CA     . SER A 1 391 ? 4.436   -25.811 95.928  1.00 31.54  ? 391 SER A CA     1 
ATOM   6533  C C      . SER A 1 391 ? 5.592   -25.039 95.350  1.00 32.57  ? 391 SER A C      1 
ATOM   6534  O O      . SER A 1 391 ? 5.406   -24.249 94.418  1.00 36.43  ? 391 SER A O      1 
ATOM   6535  C CB     . SER A 1 391 ? 4.083   -25.253 97.313  1.00 35.16  ? 391 SER A CB     1 
ATOM   6536  O OG     . SER A 1 391 ? 4.031   -23.838 97.337  1.00 35.15  ? 391 SER A OG     1 
ATOM   6537  H H      . SER A 1 391 ? 4.769   -27.502 96.858  1.00 33.03  ? 391 SER A H      1 
ATOM   6538  H HA     . SER A 1 391 ? 3.668   -25.702 95.346  1.00 38.24  ? 391 SER A HA     1 
ATOM   6539  H HB2    . SER A 1 391 ? 3.215   -25.599 97.574  1.00 42.58  ? 391 SER A HB2    1 
ATOM   6540  H HB3    . SER A 1 391 ? 4.755   -25.549 97.947  1.00 42.58  ? 391 SER A HB3    1 
ATOM   6541  H HG     . SER A 1 391 ? 3.835   -23.570 98.109  1.00 42.57  ? 391 SER A HG     1 
ATOM   6542  N N      . TYR A 1 392 ? 6.787   -25.320 95.865  1.00 28.02  ? 392 TYR A N      1 
ATOM   6543  C CA     . TYR A 1 392 ? 7.981   -24.580 95.487  1.00 28.08  ? 392 TYR A CA     1 
ATOM   6544  C C      . TYR A 1 392 ? 8.462   -24.917 94.099  1.00 28.78  ? 392 TYR A C      1 
ATOM   6545  O O      . TYR A 1 392 ? 8.770   -24.032 93.306  1.00 28.91  ? 392 TYR A O      1 
ATOM   6546  C CB     . TYR A 1 392 ? 9.104   -24.846 96.474  1.00 30.79  ? 392 TYR A CB     1 
ATOM   6547  C CG     . TYR A 1 392 ? 10.416  -24.247 96.041  1.00 29.98  ? 392 TYR A CG     1 
ATOM   6548  C CD1    . TYR A 1 392 ? 10.683  -22.899 96.246  1.00 28.60  ? 392 TYR A CD1    1 
ATOM   6549  C CD2    . TYR A 1 392 ? 11.401  -25.035 95.456  1.00 31.71  ? 392 TYR A CD2    1 
ATOM   6550  C CE1    . TYR A 1 392 ? 11.881  -22.344 95.859  1.00 32.18  ? 392 TYR A CE1    1 
ATOM   6551  C CE2    . TYR A 1 392 ? 12.615  -24.490 95.068  1.00 31.01  ? 392 TYR A CE2    1 
ATOM   6552  C CZ     . TYR A 1 392 ? 12.847  -23.143 95.270  1.00 32.68  ? 392 TYR A CZ     1 
ATOM   6553  O OH     . TYR A 1 392 ? 14.043  -22.582 94.888  1.00 30.52  ? 392 TYR A OH     1 
ATOM   6554  H H      . TYR A 1 392 ? 6.931   -25.941 96.442  1.00 34.02  ? 392 TYR A H      1 
ATOM   6555  H HA     . TYR A 1 392 ? 7.782   -23.631 95.510  1.00 34.09  ? 392 TYR A HA     1 
ATOM   6556  H HB2    . TYR A 1 392 ? 8.867   -24.461 97.333  1.00 37.34  ? 392 TYR A HB2    1 
ATOM   6557  H HB3    . TYR A 1 392 ? 9.226   -25.804 96.563  1.00 37.34  ? 392 TYR A HB3    1 
ATOM   6558  H HD1    . TYR A 1 392 ? 10.035  -22.359 96.638  1.00 34.71  ? 392 TYR A HD1    1 
ATOM   6559  H HD2    . TYR A 1 392 ? 11.240  -25.940 95.318  1.00 38.44  ? 392 TYR A HD2    1 
ATOM   6560  H HE1    . TYR A 1 392 ? 12.043  -21.439 95.996  1.00 39.01  ? 392 TYR A HE1    1 
ATOM   6561  H HE2    . TYR A 1 392 ? 13.264  -25.025 94.669  1.00 37.60  ? 392 TYR A HE2    1 
ATOM   6562  H HH     . TYR A 1 392 ? 14.047  -21.762 95.071  1.00 37.01  ? 392 TYR A HH     1 
ATOM   6563  N N      . ALA A 1 393 ? 8.544   -26.206 93.813  1.00 29.08  ? 393 ALA A N      1 
ATOM   6564  C CA     . ALA A 1 393 ? 8.993   -26.647 92.505  1.00 31.18  ? 393 ALA A CA     1 
ATOM   6565  C C      . ALA A 1 393 ? 8.029   -26.205 91.392  1.00 36.10  ? 393 ALA A C      1 
ATOM   6566  O O      . ALA A 1 393 ? 8.451   -25.890 90.279  1.00 40.47  ? 393 ALA A O      1 
ATOM   6567  C CB     . ALA A 1 393 ? 9.143   -28.156 92.494  1.00 29.77  ? 393 ALA A CB     1 
ATOM   6568  H H      . ALA A 1 393 ? 8.346   -26.843 94.356  1.00 35.28  ? 393 ALA A H      1 
ATOM   6569  H HA     . ALA A 1 393 ? 9.862   -26.258 92.322  1.00 37.81  ? 393 ALA A HA     1 
ATOM   6570  H HB1    . ALA A 1 393 ? 9.443   -28.436 91.615  1.00 36.11  ? 393 ALA A HB1    1 
ATOM   6571  H HB2    . ALA A 1 393 ? 9.796   -28.412 93.164  1.00 36.11  ? 393 ALA A HB2    1 
ATOM   6572  H HB3    . ALA A 1 393 ? 8.285   -28.560 92.695  1.00 36.11  ? 393 ALA A HB3    1 
ATOM   6573  N N      . SER A 1 394 ? 6.743   -26.131 91.705  1.00 33.65  ? 394 SER A N      1 
ATOM   6574  C CA     . SER A 1 394 ? 5.751   -25.798 90.705  1.00 28.45  ? 394 SER A CA     1 
ATOM   6575  C C      . SER A 1 394 ? 5.857   -24.340 90.309  1.00 31.65  ? 394 SER A C      1 
ATOM   6576  O O      . SER A 1 394 ? 5.805   -24.010 89.136  1.00 35.77  ? 394 SER A O      1 
ATOM   6577  C CB     . SER A 1 394 ? 4.367   -26.108 91.233  1.00 28.21  ? 394 SER A CB     1 
ATOM   6578  O OG     . SER A 1 394 ? 4.297   -27.472 91.583  1.00 28.01  ? 394 SER A OG     1 
ATOM   6579  H H      . SER A 1 394 ? 6.421   -26.270 92.491  1.00 40.78  ? 394 SER A H      1 
ATOM   6580  H HA     . SER A 1 394 ? 5.902   -26.338 89.914  1.00 34.53  ? 394 SER A HA     1 
ATOM   6581  H HB2    . SER A 1 394 ? 4.194   -25.566 92.019  1.00 33.11  ? 394 SER A HB2    1 
ATOM   6582  H HB3    . SER A 1 394 ? 3.711   -25.920 90.544  1.00 33.11  ? 394 SER A HB3    1 
ATOM   6583  H HG     . SER A 1 394 ? 4.866   -27.646 92.176  1.00 33.69  ? 394 SER A HG     1 
ATOM   6584  N N      . THR A 1 395 ? 6.000   -23.460 91.288  1.00 31.37  ? 395 THR A N      1 
ATOM   6585  C CA     . THR A 1 395 ? 6.084   -22.039 90.993  1.00 33.69  ? 395 THR A CA     1 
ATOM   6586  C C      . THR A 1 395 ? 7.511   -21.674 90.540  1.00 38.14  ? 395 THR A C      1 
ATOM   6587  O O      . THR A 1 395 ? 7.685   -20.941 89.569  1.00 43.48  ? 395 THR A O      1 
ATOM   6588  C CB     . THR A 1 395 ? 5.691   -21.171 92.226  1.00 45.27  ? 395 THR A CB     1 
ATOM   6589  O OG1    . THR A 1 395 ? 6.655   -21.339 93.267  1.00 48.94  ? 395 THR A OG1    1 
ATOM   6590  C CG2    . THR A 1 395 ? 4.280   -21.529 92.758  1.00 41.97  ? 395 THR A CG2    1 
ATOM   6591  H H      . THR A 1 395 ? 6.050   -23.656 92.123  1.00 38.04  ? 395 THR A H      1 
ATOM   6592  H HA     . THR A 1 395 ? 5.475   -21.828 90.268  1.00 40.81  ? 395 THR A HA     1 
ATOM   6593  H HB     . THR A 1 395 ? 5.679   -20.238 91.959  1.00 54.71  ? 395 THR A HB     1 
ATOM   6594  H HG1    . THR A 1 395 ? 7.414   -21.102 92.997  1.00 59.12  ? 395 THR A HG1    1 
ATOM   6595  H HG21   . THR A 1 395 ? 4.064   -20.973 93.523  1.00 50.75  ? 395 THR A HG21   1 
ATOM   6596  H HG22   . THR A 1 395 ? 3.618   -21.382 92.065  1.00 50.75  ? 395 THR A HG22   1 
ATOM   6597  H HG23   . THR A 1 395 ? 4.254   -22.460 93.027  1.00 50.75  ? 395 THR A HG23   1 
ATOM   6598  N N      . HIS A 1 396 ? 8.522   -22.206 91.228  1.00 35.23  ? 396 HIS A N      1 
ATOM   6599  C CA     . HIS A 1 396 ? 9.925   -21.824 91.002  1.00 31.76  ? 396 HIS A CA     1 
ATOM   6600  C C      . HIS A 1 396 ? 10.741  -22.704 90.058  1.00 32.33  ? 396 HIS A C      1 
ATOM   6601  O O      . HIS A 1 396 ? 11.958  -22.654 90.091  1.00 35.72  ? 396 HIS A O      1 
ATOM   6602  C CB     . HIS A 1 396 ? 10.665  -21.695 92.332  1.00 33.35  ? 396 HIS A CB     1 
ATOM   6603  C CG     . HIS A 1 396 ? 10.242  -20.501 93.124  1.00 32.76  ? 396 HIS A CG     1 
ATOM   6604  N ND1    . HIS A 1 396 ? 9.324   -20.566 94.149  1.00 33.50  ? 396 HIS A ND1    1 
ATOM   6605  C CD2    . HIS A 1 396 ? 10.574  -19.194 93.002  1.00 31.60  ? 396 HIS A CD2    1 
ATOM   6606  C CE1    . HIS A 1 396 ? 9.129   -19.356 94.640  1.00 32.87  ? 396 HIS A CE1    1 
ATOM   6607  N NE2    . HIS A 1 396 ? 9.872   -18.505 93.957  1.00 30.92  ? 396 HIS A NE2    1 
ATOM   6608  H H      . HIS A 1 396 ? 8.423   -22.801 91.842  1.00 42.67  ? 396 HIS A H      1 
ATOM   6609  H HA     . HIS A 1 396 ? 9.919   -20.938 90.607  1.00 38.50  ? 396 HIS A HA     1 
ATOM   6610  H HB2    . HIS A 1 396 ? 10.490  -22.485 92.867  1.00 40.41  ? 396 HIS A HB2    1 
ATOM   6611  H HB3    . HIS A 1 396 ? 11.616  -21.617 92.158  1.00 40.41  ? 396 HIS A HB3    1 
ATOM   6612  H HD1    . HIS A 1 396 ? 8.946   -21.284 94.432  1.00 40.59  ? 396 HIS A HD1    1 
ATOM   6613  H HD2    . HIS A 1 396 ? 11.171  -18.832 92.387  1.00 38.31  ? 396 HIS A HD2    1 
ATOM   6614  H HE1    . HIS A 1 396 ? 8.562   -19.140 95.344  1.00 39.84  ? 396 HIS A HE1    1 
ATOM   6615  H HE2    . HIS A 1 396 ? 9.916   -17.658 94.096  1.00 37.49  ? 396 HIS A HE2    1 
ATOM   6616  N N      . TRP A 1 397 ? 10.101  -23.562 89.279  1.00 34.37  ? 397 TRP A N      1 
ATOM   6617  C CA     . TRP A 1 397 ? 10.832  -24.499 88.428  1.00 34.67  ? 397 TRP A CA     1 
ATOM   6618  C C      . TRP A 1 397 ? 11.988  -23.857 87.640  1.00 37.67  ? 397 TRP A C      1 
ATOM   6619  O O      . TRP A 1 397 ? 13.009  -24.500 87.397  1.00 38.69  ? 397 TRP A O      1 
ATOM   6620  C CB     . TRP A 1 397 ? 9.860   -25.155 87.452  1.00 34.21  ? 397 TRP A CB     1 
ATOM   6621  C CG     . TRP A 1 397 ? 9.133   -24.154 86.631  1.00 36.61  ? 397 TRP A CG     1 
ATOM   6622  C CD1    . TRP A 1 397 ? 7.909   -23.626 86.896  1.00 37.13  ? 397 TRP A CD1    1 
ATOM   6623  C CD2    . TRP A 1 397 ? 9.581   -23.539 85.418  1.00 39.21  ? 397 TRP A CD2    1 
ATOM   6624  N NE1    . TRP A 1 397 ? 7.560   -22.722 85.924  1.00 39.40  ? 397 TRP A NE1    1 
ATOM   6625  C CE2    . TRP A 1 397 ? 8.569   -22.651 85.003  1.00 42.19  ? 397 TRP A CE2    1 
ATOM   6626  C CE3    . TRP A 1 397 ? 10.732  -23.657 84.641  1.00 39.85  ? 397 TRP A CE3    1 
ATOM   6627  C CZ2    . TRP A 1 397 ? 8.680   -21.876 83.853  1.00 42.88  ? 397 TRP A CZ2    1 
ATOM   6628  C CZ3    . TRP A 1 397 ? 10.836  -22.892 83.497  1.00 43.11  ? 397 TRP A CZ3    1 
ATOM   6629  C CH2    . TRP A 1 397 ? 9.814   -22.013 83.113  1.00 43.26  ? 397 TRP A CH2    1 
ATOM   6630  H H      . TRP A 1 397 ? 9.245   -23.624 89.221  1.00 41.63  ? 397 TRP A H      1 
ATOM   6631  H HA     . TRP A 1 397 ? 11.208  -25.197 88.987  1.00 42.00  ? 397 TRP A HA     1 
ATOM   6632  H HB2    . TRP A 1 397 ? 10.354  -25.736 86.853  1.00 41.45  ? 397 TRP A HB2    1 
ATOM   6633  H HB3    . TRP A 1 397 ? 9.205   -25.668 87.951  1.00 41.45  ? 397 TRP A HB3    1 
ATOM   6634  H HD1    . TRP A 1 397 ? 7.384   -23.845 87.632  1.00 44.94  ? 397 TRP A HD1    1 
ATOM   6635  H HE1    . TRP A 1 397 ? 6.827   -22.273 85.899  1.00 47.67  ? 397 TRP A HE1    1 
ATOM   6636  H HE3    . TRP A 1 397 ? 11.417  -24.234 84.891  1.00 48.22  ? 397 TRP A HE3    1 
ATOM   6637  H HZ2    . TRP A 1 397 ? 7.999   -21.298 83.593  1.00 51.85  ? 397 TRP A HZ2    1 
ATOM   6638  H HZ3    . TRP A 1 397 ? 11.600  -22.959 82.971  1.00 52.13  ? 397 TRP A HZ3    1 
ATOM   6639  H HH2    . TRP A 1 397 ? 9.912   -21.513 82.335  1.00 52.30  ? 397 TRP A HH2    1 
ATOM   6640  N N      . HIS A 1 398 ? 11.849  -22.585 87.280  1.00 38.93  ? 398 HIS A N      1 
ATOM   6641  C CA     . HIS A 1 398 ? 12.821  -21.910 86.412  1.00 40.69  ? 398 HIS A CA     1 
ATOM   6642  C C      . HIS A 1 398 ? 14.213  -21.707 87.039  1.00 39.74  ? 398 HIS A C      1 
ATOM   6643  O O      . HIS A 1 398 ? 15.193  -21.540 86.316  1.00 36.50  ? 398 HIS A O      1 
ATOM   6644  C CB     . HIS A 1 398 ? 12.275  -20.555 85.975  1.00 45.20  ? 398 HIS A CB     1 
ATOM   6645  C CG     . HIS A 1 398 ? 12.970  -19.978 84.779  1.00 47.08  ? 398 HIS A CG     1 
ATOM   6646  N ND1    . HIS A 1 398 ? 14.289  -19.580 84.806  1.00 44.48  ? 398 HIS A ND1    1 
ATOM   6647  C CD2    . HIS A 1 398 ? 12.520  -19.701 83.531  1.00 47.98  ? 398 HIS A CD2    1 
ATOM   6648  C CE1    . HIS A 1 398 ? 14.629  -19.105 83.621  1.00 45.46  ? 398 HIS A CE1    1 
ATOM   6649  N NE2    . HIS A 1 398 ? 13.572  -19.163 82.830  1.00 47.01  ? 398 HIS A NE2    1 
ATOM   6650  H H      . HIS A 1 398 ? 11.195  -22.083 87.525  1.00 47.11  ? 398 HIS A H      1 
ATOM   6651  H HA     . HIS A 1 398 ? 12.940  -22.447 85.613  1.00 49.22  ? 398 HIS A HA     1 
ATOM   6652  H HB2    . HIS A 1 398 ? 11.336  -20.653 85.753  1.00 54.63  ? 398 HIS A HB2    1 
ATOM   6653  H HB3    . HIS A 1 398 ? 12.376  -19.927 86.708  1.00 54.63  ? 398 HIS A HB3    1 
ATOM   6654  H HD1    . HIS A 1 398 ? 14.813  -19.644 85.485  1.00 53.77  ? 398 HIS A HD1    1 
ATOM   6655  H HD2    . HIS A 1 398 ? 11.662  -19.855 83.207  1.00 57.97  ? 398 HIS A HD2    1 
ATOM   6656  H HE1    . HIS A 1 398 ? 15.467  -18.777 83.386  1.00 54.94  ? 398 HIS A HE1    1 
ATOM   6657  H HE2    . HIS A 1 398 ? 13.547  -18.908 82.009  1.00 56.80  ? 398 HIS A HE2    1 
ATOM   6658  N N      . THR A 1 399 ? 14.294  -21.635 88.366  1.00 41.89  ? 399 THR A N      1 
ATOM   6659  C CA     . THR A 1 399 ? 15.581  -21.435 89.040  1.00 41.27  ? 399 THR A CA     1 
ATOM   6660  C C      . THR A 1 399 ? 16.260  -22.786 89.316  1.00 38.40  ? 399 THR A C      1 
ATOM   6661  O O      . THR A 1 399 ? 17.319  -22.838 89.941  1.00 41.80  ? 399 THR A O      1 
ATOM   6662  C CB     . THR A 1 399 ? 15.434  -20.609 90.371  1.00 38.31  ? 399 THR A CB     1 
ATOM   6663  O OG1    . THR A 1 399 ? 16.731  -20.282 90.891  1.00 37.35  ? 399 THR A OG1    1 
ATOM   6664  C CG2    . THR A 1 399 ? 14.638  -21.356 91.429  1.00 35.06  ? 399 THR A CG2    1 
ATOM   6665  H H      . THR A 1 399 ? 13.623  -21.698 88.900  1.00 50.66  ? 399 THR A H      1 
ATOM   6666  H HA     . THR A 1 399 ? 16.162  -20.932 88.448  1.00 49.91  ? 399 THR A HA     1 
ATOM   6667  H HB     . THR A 1 399 ? 14.961  -19.785 90.174  1.00 46.36  ? 399 THR A HB     1 
ATOM   6668  H HG1    . THR A 1 399 ? 17.161  -20.985 91.052  1.00 45.21  ? 399 THR A HG1    1 
ATOM   6669  H HG21   . THR A 1 399 ? 14.568  -20.818 92.233  1.00 42.46  ? 399 THR A HG21   1 
ATOM   6670  H HG22   . THR A 1 399 ? 13.746  -21.547 91.099  1.00 42.46  ? 399 THR A HG22   1 
ATOM   6671  H HG23   . THR A 1 399 ? 15.079  -22.192 91.646  1.00 42.46  ? 399 THR A HG23   1 
ATOM   6672  N N      . LEU A 1 400 ? 15.661  -23.865 88.820  1.00 30.15  ? 400 LEU A N      1 
ATOM   6673  C CA     . LEU A 1 400 ? 16.168  -25.218 89.042  1.00 30.14  ? 400 LEU A CA     1 
ATOM   6674  C C      . LEU A 1 400 ? 17.201  -25.637 88.007  1.00 32.81  ? 400 LEU A C      1 
ATOM   6675  O O      . LEU A 1 400 ? 17.528  -26.813 87.889  1.00 35.30  ? 400 LEU A O      1 
ATOM   6676  C CB     . LEU A 1 400 ? 15.026  -26.226 89.055  1.00 31.18  ? 400 LEU A CB     1 
ATOM   6677  C CG     . LEU A 1 400 ? 13.964  -26.044 90.159  1.00 31.60  ? 400 LEU A CG     1 
ATOM   6678  C CD1    . LEU A 1 400 ? 12.990  -27.209 90.122  1.00 30.48  ? 400 LEU A CD1    1 
ATOM   6679  C CD2    . LEU A 1 400 ? 14.549  -25.883 91.574  1.00 29.51  ? 400 LEU A CD2    1 
ATOM   6680  H H      . LEU A 1 400 ? 14.947  -23.840 88.342  1.00 36.57  ? 400 LEU A H      1 
ATOM   6681  H HA     . LEU A 1 400 ? 16.596  -25.248 89.912  1.00 36.56  ? 400 LEU A HA     1 
ATOM   6682  H HB2    . LEU A 1 400 ? 14.567  -26.176 88.202  1.00 37.81  ? 400 LEU A HB2    1 
ATOM   6683  H HB3    . LEU A 1 400 ? 15.405  -27.113 89.163  1.00 37.81  ? 400 LEU A HB3    1 
ATOM   6684  H HG     . LEU A 1 400 ? 13.459  -25.239 89.964  1.00 38.31  ? 400 LEU A HG     1 
ATOM   6685  H HD11   . LEU A 1 400 ? 12.326  -27.087 90.819  1.00 36.97  ? 400 LEU A HD11   1 
ATOM   6686  H HD12   . LEU A 1 400 ? 12.558  -27.232 89.254  1.00 36.97  ? 400 LEU A HD12   1 
ATOM   6687  H HD13   . LEU A 1 400 ? 13.478  -28.033 90.271  1.00 36.97  ? 400 LEU A HD13   1 
ATOM   6688  H HD21   . LEU A 1 400 ? 13.820  -25.774 92.206  1.00 35.81  ? 400 LEU A HD21   1 
ATOM   6689  H HD22   . LEU A 1 400 ? 15.063  -26.676 91.795  1.00 35.81  ? 400 LEU A HD22   1 
ATOM   6690  H HD23   . LEU A 1 400 ? 15.122  -25.101 91.592  1.00 35.81  ? 400 LEU A HD23   1 
ATOM   6691  N N      . GLY A 1 401 ? 17.655  -24.677 87.215  1.00 34.54  ? 401 GLY A N      1 
ATOM   6692  C CA     . GLY A 1 401 ? 18.595  -24.925 86.142  1.00 34.79  ? 401 GLY A CA     1 
ATOM   6693  C C      . GLY A 1 401 ? 17.785  -24.872 84.872  1.00 43.37  ? 401 GLY A C      1 
ATOM   6694  O O      . GLY A 1 401 ? 16.597  -25.176 84.889  1.00 44.48  ? 401 GLY A O      1 
ATOM   6695  H H      . GLY A 1 401 ? 17.424  -23.851 87.284  1.00 41.84  ? 401 GLY A H      1 
ATOM   6696  H HA2    . GLY A 1 401 ? 19.284  -24.242 86.122  1.00 42.14  ? 401 GLY A HA2    1 
ATOM   6697  H HA3    . GLY A 1 401 ? 19.002  -25.801 86.236  1.00 42.14  ? 401 GLY A HA3    1 
ATOM   6698  N N      . LYS A 1 402 ? 18.399  -24.444 83.779  1.00 49.24  ? 402 LYS A N      1 
ATOM   6699  C CA     . LYS A 1 402 ? 17.663  -24.226 82.538  1.00 48.39  ? 402 LYS A CA     1 
ATOM   6700  C C      . LYS A 1 402 ? 16.939  -25.500 82.071  1.00 46.81  ? 402 LYS A C      1 
ATOM   6701  O O      . LYS A 1 402 ? 15.709  -25.583 82.104  1.00 47.82  ? 402 LYS A O      1 
ATOM   6702  C CB     . LYS A 1 402 ? 18.609  -23.735 81.446  1.00 47.70  ? 402 LYS A CB     1 
ATOM   6703  C CG     . LYS A 1 402 ? 17.897  -23.400 80.160  1.00 53.70  ? 402 LYS A CG     1 
ATOM   6704  C CD     . LYS A 1 402 ? 18.859  -22.987 79.093  1.00 61.79  ? 402 LYS A CD     1 
ATOM   6705  C CE     . LYS A 1 402 ? 18.147  -22.741 77.758  1.00 67.94  ? 402 LYS A CE     1 
ATOM   6706  N NZ     . LYS A 1 402 ? 19.100  -22.609 76.595  1.00 70.39  ? 402 LYS A NZ     1 
ATOM   6707  H H      . LYS A 1 402 ? 19.240  -24.272 83.726  1.00 59.47  ? 402 LYS A H      1 
ATOM   6708  H HA     . LYS A 1 402 ? 16.994  -23.539 82.686  1.00 58.46  ? 402 LYS A HA     1 
ATOM   6709  H HB2    . LYS A 1 402 ? 19.060  -22.934 81.755  1.00 57.64  ? 402 LYS A HB2    1 
ATOM   6710  H HB3    . LYS A 1 402 ? 19.259  -24.430 81.256  1.00 57.64  ? 402 LYS A HB3    1 
ATOM   6711  H HG2    . LYS A 1 402 ? 17.415  -24.181 79.848  1.00 64.83  ? 402 LYS A HG2    1 
ATOM   6712  H HG3    . LYS A 1 402 ? 17.283  -22.666 80.316  1.00 64.83  ? 402 LYS A HG3    1 
ATOM   6713  H HD2    . LYS A 1 402 ? 19.299  -22.164 79.359  1.00 74.53  ? 402 LYS A HD2    1 
ATOM   6714  H HD3    . LYS A 1 402 ? 19.514  -23.690 78.963  1.00 74.53  ? 402 LYS A HD3    1 
ATOM   6715  H HE2    . LYS A 1 402 ? 17.554  -23.486 77.575  1.00 81.92  ? 402 LYS A HE2    1 
ATOM   6716  H HE3    . LYS A 1 402 ? 17.636  -21.919 77.820  1.00 81.92  ? 402 LYS A HE3    1 
ATOM   6717  H HZ1    . LYS A 1 402 ? 18.644  -22.467 75.843  1.00 84.85  ? 402 LYS A HZ1    1 
ATOM   6718  H HZ2    . LYS A 1 402 ? 19.653  -21.925 76.731  1.00 84.85  ? 402 LYS A HZ2    1 
ATOM   6719  H HZ3    . LYS A 1 402 ? 19.578  -23.354 76.507  1.00 84.85  ? 402 LYS A HZ3    1 
ATOM   6720  N N      . ASN A 1 403 ? 17.724  -26.496 81.666  1.00 42.04  ? 403 ASN A N      1 
ATOM   6721  C CA     . ASN A 1 403 ? 17.202  -27.725 81.094  1.00 37.60  ? 403 ASN A CA     1 
ATOM   6722  C C      . ASN A 1 403 ? 16.456  -28.589 82.107  1.00 36.85  ? 403 ASN A C      1 
ATOM   6723  O O      . ASN A 1 403 ? 15.380  -29.085 81.809  1.00 38.47  ? 403 ASN A O      1 
ATOM   6724  C CB     . ASN A 1 403 ? 18.344  -28.536 80.493  1.00 40.46  ? 403 ASN A CB     1 
ATOM   6725  C CG     . ASN A 1 403 ? 19.157  -27.746 79.483  1.00 43.55  ? 403 ASN A CG     1 
ATOM   6726  O OD1    . ASN A 1 403 ? 20.296  -27.365 79.750  1.00 42.02  ? 403 ASN A OD1    1 
ATOM   6727  N ND2    . ASN A 1 403 ? 18.576  -27.495 78.316  1.00 45.98  ? 403 ASN A ND2    1 
ATOM   6728  H H      . ASN A 1 403 ? 18.583  -26.478 81.716  1.00 50.84  ? 403 ASN A H      1 
ATOM   6729  H HA     . ASN A 1 403 ? 16.585  -27.501 80.380  1.00 45.51  ? 403 ASN A HA     1 
ATOM   6730  H HB2    . ASN A 1 403 ? 18.941  -28.817 81.204  1.00 48.95  ? 403 ASN A HB2    1 
ATOM   6731  H HB3    . ASN A 1 403 ? 17.977  -29.312 80.041  1.00 48.95  ? 403 ASN A HB3    1 
ATOM   6732  H HD21   . ASN A 1 403 ? 18.997  -27.051 77.712  1.00 55.57  ? 403 ASN A HD21   1 
ATOM   6733  H HD22   . ASN A 1 403 ? 17.778  -27.778 78.164  1.00 55.57  ? 403 ASN A HD22   1 
ATOM   6734  N N      . VAL A 1 404 ? 17.011  -28.765 83.303  1.00 38.68  ? 404 VAL A N      1 
ATOM   6735  C CA     . VAL A 1 404 ? 16.333  -29.541 84.349  1.00 37.54  ? 404 VAL A CA     1 
ATOM   6736  C C      . VAL A 1 404 ? 15.024  -28.873 84.751  1.00 39.18  ? 404 VAL A C      1 
ATOM   6737  O O      . VAL A 1 404 ? 13.963  -29.496 84.737  1.00 37.01  ? 404 VAL A O      1 
ATOM   6738  C CB     . VAL A 1 404 ? 17.237  -29.714 85.603  1.00 32.98  ? 404 VAL A CB     1 
ATOM   6739  C CG1    . VAL A 1 404 ? 16.437  -30.162 86.835  1.00 29.65  ? 404 VAL A CG1    1 
ATOM   6740  C CG2    . VAL A 1 404 ? 18.350  -30.712 85.309  1.00 32.66  ? 404 VAL A CG2    1 
ATOM   6741  H H      . VAL A 1 404 ? 17.776  -28.449 83.537  1.00 46.80  ? 404 VAL A H      1 
ATOM   6742  H HA     . VAL A 1 404 ? 16.126  -30.424 84.003  1.00 45.44  ? 404 VAL A HA     1 
ATOM   6743  H HB     . VAL A 1 404 ? 17.650  -28.862 85.811  1.00 39.97  ? 404 VAL A HB     1 
ATOM   6744  H HG11   . VAL A 1 404 ? 17.042  -30.256 87.588  1.00 35.64  ? 404 VAL A HG11   1 
ATOM   6745  H HG12   . VAL A 1 404 ? 15.763  -29.493 87.034  1.00 35.64  ? 404 VAL A HG12   1 
ATOM   6746  H HG13   . VAL A 1 404 ? 16.012  -31.013 86.644  1.00 35.64  ? 404 VAL A HG13   1 
ATOM   6747  H HG21   . VAL A 1 404 ? 18.904  -30.808 86.099  1.00 39.59  ? 404 VAL A HG21   1 
ATOM   6748  H HG22   . VAL A 1 404 ? 17.955  -31.566 85.075  1.00 39.59  ? 404 VAL A HG22   1 
ATOM   6749  H HG23   . VAL A 1 404 ? 18.883  -30.380 84.569  1.00 39.59  ? 404 VAL A HG23   1 
ATOM   6750  N N      . GLY A 1 405 ? 15.110  -27.591 85.083  1.00 47.30  ? 405 GLY A N      1 
ATOM   6751  C CA     . GLY A 1 405 ? 13.950  -26.813 85.475  1.00 50.31  ? 405 GLY A CA     1 
ATOM   6752  C C      . GLY A 1 405 ? 12.867  -26.790 84.419  1.00 54.84  ? 405 GLY A C      1 
ATOM   6753  O O      . GLY A 1 405 ? 11.687  -26.701 84.755  1.00 55.54  ? 405 GLY A O      1 
ATOM   6754  H H      . GLY A 1 405 ? 15.844  -27.144 85.089  1.00 57.15  ? 405 GLY A H      1 
ATOM   6755  H HA2    . GLY A 1 405 ? 13.575  -27.184 86.289  1.00 60.76  ? 405 GLY A HA2    1 
ATOM   6756  H HA3    . GLY A 1 405 ? 14.222  -25.899 85.652  1.00 60.76  ? 405 GLY A HA3    1 
ATOM   6757  N N      . GLU A 1 406 ? 13.259  -26.874 83.147  1.00 56.52  ? 406 GLU A N      1 
ATOM   6758  C CA     . GLU A 1 406 ? 12.285  -26.931 82.055  1.00 58.81  ? 406 GLU A CA     1 
ATOM   6759  C C      . GLU A 1 406 ? 11.526  -28.249 82.017  1.00 56.43  ? 406 GLU A C      1 
ATOM   6760  O O      . GLU A 1 406 ? 10.315  -28.249 81.802  1.00 61.67  ? 406 GLU A O      1 
ATOM   6761  C CB     . GLU A 1 406 ? 12.951  -26.702 80.703  1.00 63.26  ? 406 GLU A CB     1 
ATOM   6762  C CG     . GLU A 1 406 ? 13.177  -25.242 80.365  1.00 68.13  ? 406 GLU A CG     1 
ATOM   6763  C CD     . GLU A 1 406 ? 14.195  -25.049 79.245  1.00 72.00  ? 406 GLU A CD     1 
ATOM   6764  O OE1    . GLU A 1 406 ? 14.767  -23.943 79.154  1.00 71.46  ? 406 GLU A OE1    1 
ATOM   6765  O OE2    . GLU A 1 406 ? 14.416  -25.994 78.448  1.00 71.04  ? 406 GLU A OE2    1 
ATOM   6766  H H      . GLU A 1 406 ? 14.079  -26.900 82.890  1.00 68.22  ? 406 GLU A H      1 
ATOM   6767  H HA     . GLU A 1 406 ? 11.636  -26.222 82.185  1.00 70.96  ? 406 GLU A HA     1 
ATOM   6768  H HB2    . GLU A 1 406 ? 13.815  -27.143 80.703  1.00 76.30  ? 406 GLU A HB2    1 
ATOM   6769  H HB3    . GLU A 1 406 ? 12.389  -27.083 80.011  1.00 76.30  ? 406 GLU A HB3    1 
ATOM   6770  H HG2    . GLU A 1 406 ? 12.337  -24.850 80.079  1.00 82.15  ? 406 GLU A HG2    1 
ATOM   6771  H HG3    . GLU A 1 406 ? 13.507  -24.783 81.153  1.00 82.15  ? 406 GLU A HG3    1 
ATOM   6772  N N      . SER A 1 407 ? 12.219  -29.369 82.200  1.00 47.74  ? 407 SER A N      1 
ATOM   6773  C CA     . SER A 1 407 ? 11.536  -30.663 82.243  1.00 44.10  ? 407 SER A CA     1 
ATOM   6774  C C      . SER A 1 407 ? 10.664  -30.731 83.508  1.00 47.41  ? 407 SER A C      1 
ATOM   6775  O O      . SER A 1 407 ? 9.559   -31.277 83.468  1.00 50.42  ? 407 SER A O      1 
ATOM   6776  C CB     . SER A 1 407 ? 12.519  -31.835 82.202  1.00 41.25  ? 407 SER A CB     1 
ATOM   6777  O OG     . SER A 1 407 ? 11.842  -33.064 82.418  1.00 39.37  ? 407 SER A OG     1 
ATOM   6778  H H      . SER A 1 407 ? 13.072  -29.411 82.300  1.00 57.68  ? 407 SER A H      1 
ATOM   6779  H HA     . SER A 1 407 ? 10.951  -30.736 81.473  1.00 53.31  ? 407 SER A HA     1 
ATOM   6780  H HB2    . SER A 1 407 ? 12.948  -31.858 81.332  1.00 49.89  ? 407 SER A HB2    1 
ATOM   6781  H HB3    . SER A 1 407 ? 13.185  -31.714 82.897  1.00 49.89  ? 407 SER A HB3    1 
ATOM   6782  H HG     . SER A 1 407 ? 12.388  -33.701 82.393  1.00 47.63  ? 407 SER A HG     1 
ATOM   6783  N N      . ILE A 1 408 ? 11.160  -30.182 84.622  1.00 47.41  ? 408 ILE A N      1 
ATOM   6784  C CA     . ILE A 1 408 ? 10.381  -30.153 85.855  1.00 46.56  ? 408 ILE A CA     1 
ATOM   6785  C C      . ILE A 1 408 ? 9.126   -29.320 85.634  1.00 48.74  ? 408 ILE A C      1 
ATOM   6786  O O      . ILE A 1 408 ? 8.102   -29.543 86.284  1.00 49.88  ? 408 ILE A O      1 
ATOM   6787  C CB     . ILE A 1 408 ? 11.179  -29.588 87.058  1.00 46.84  ? 408 ILE A CB     1 
ATOM   6788  C CG1    . ILE A 1 408 ? 12.117  -30.659 87.619  1.00 45.16  ? 408 ILE A CG1    1 
ATOM   6789  C CG2    . ILE A 1 408 ? 10.245  -29.150 88.192  1.00 46.72  ? 408 ILE A CG2    1 
ATOM   6790  C CD1    . ILE A 1 408 ? 13.042  -30.178 88.728  1.00 42.20  ? 408 ILE A CD1    1 
ATOM   6791  H H      . ILE A 1 408 ? 11.939  -29.823 84.686  1.00 57.29  ? 408 ILE A H      1 
ATOM   6792  H HA     . ILE A 1 408 ? 10.106  -31.056 86.076  1.00 56.26  ? 408 ILE A HA     1 
ATOM   6793  H HB     . ILE A 1 408 ? 11.704  -28.827 86.764  1.00 56.59  ? 408 ILE A HB     1 
ATOM   6794  H HG12   . ILE A 1 408 ? 11.580  -31.383 87.977  1.00 54.59  ? 408 ILE A HG12   1 
ATOM   6795  H HG13   . ILE A 1 408 ? 12.673  -30.992 86.897  1.00 54.59  ? 408 ILE A HG13   1 
ATOM   6796  H HG21   . ILE A 1 408 ? 10.779  -28.803 88.924  1.00 56.46  ? 408 ILE A HG21   1 
ATOM   6797  H HG22   . ILE A 1 408 ? 9.650   -28.459 87.861  1.00 56.46  ? 408 ILE A HG22   1 
ATOM   6798  H HG23   . ILE A 1 408 ? 9.731   -29.916 88.491  1.00 56.46  ? 408 ILE A HG23   1 
ATOM   6799  H HD11   . ILE A 1 408 ? 13.596  -30.919 89.020  1.00 51.03  ? 408 ILE A HD11   1 
ATOM   6800  H HD12   . ILE A 1 408 ? 13.600  -29.463 88.386  1.00 51.03  ? 408 ILE A HD12   1 
ATOM   6801  H HD13   . ILE A 1 408 ? 12.505  -29.854 89.468  1.00 51.03  ? 408 ILE A HD13   1 
ATOM   6802  N N      . ARG A 1 409 ? 9.207   -28.338 84.745  1.00 42.97  ? 409 ARG A N      1 
ATOM   6803  C CA     . ARG A 1 409 ? 8.040   -27.523 84.463  1.00 40.48  ? 409 ARG A CA     1 
ATOM   6804  C C      . ARG A 1 409 ? 7.024   -28.368 83.701  1.00 44.03  ? 409 ARG A C      1 
ATOM   6805  O O      . ARG A 1 409 ? 5.820   -28.241 83.919  1.00 43.47  ? 409 ARG A O      1 
ATOM   6806  C CB     . ARG A 1 409 ? 8.399   -26.255 83.685  1.00 39.22  ? 409 ARG A CB     1 
ATOM   6807  C CG     . ARG A 1 409 ? 7.171   -25.383 83.359  1.00 40.56  ? 409 ARG A CG     1 
ATOM   6808  C CD     . ARG A 1 409 ? 7.336   -24.494 82.126  1.00 48.95  ? 409 ARG A CD     1 
ATOM   6809  N NE     . ARG A 1 409 ? 8.048   -25.176 81.055  1.00 57.50  ? 409 ARG A NE     1 
ATOM   6810  C CZ     . ARG A 1 409 ? 8.978   -24.611 80.293  1.00 62.82  ? 409 ARG A CZ     1 
ATOM   6811  N NH1    . ARG A 1 409 ? 9.266   -23.318 80.415  1.00 64.76  ? 409 ARG A NH1    1 
ATOM   6812  N NH2    . ARG A 1 409 ? 9.598   -25.337 79.372  1.00 61.93  ? 409 ARG A NH2    1 
ATOM   6813  H H      . ARG A 1 409 ? 9.912   -28.128 84.300  1.00 51.96  ? 409 ARG A H      1 
ATOM   6814  H HA     . ARG A 1 409 ? 7.635   -27.254 85.302  1.00 48.97  ? 409 ARG A HA     1 
ATOM   6815  H HB2    . ARG A 1 409 ? 9.012   -25.722 84.215  1.00 47.46  ? 409 ARG A HB2    1 
ATOM   6816  H HB3    . ARG A 1 409 ? 8.818   -26.507 82.847  1.00 47.46  ? 409 ARG A HB3    1 
ATOM   6817  H HG2    . ARG A 1 409 ? 6.410   -25.964 83.204  1.00 49.06  ? 409 ARG A HG2    1 
ATOM   6818  H HG3    . ARG A 1 409 ? 6.991   -24.804 84.117  1.00 49.06  ? 409 ARG A HG3    1 
ATOM   6819  H HD2    . ARG A 1 409 ? 6.460   -24.243 81.795  1.00 59.13  ? 409 ARG A HD2    1 
ATOM   6820  H HD3    . ARG A 1 409 ? 7.841   -23.703 82.369  1.00 59.13  ? 409 ARG A HD3    1 
ATOM   6821  H HE     . ARG A 1 409 ? 7.853   -26.000 80.905  1.00 69.39  ? 409 ARG A HE     1 
ATOM   6822  H HH11   . ARG A 1 409 ? 8.873   -22.846 81.017  1.00 78.10  ? 409 ARG A HH11   1 
ATOM   6823  H HH12   . ARG A 1 409 ? 9.861   -22.960 79.908  1.00 78.10  ? 409 ARG A HH12   1 
ATOM   6824  H HH21   . ARG A 1 409 ? 9.402   -26.169 79.278  1.00 74.71  ? 409 ARG A HH21   1 
ATOM   6825  H HH22   . ARG A 1 409 ? 10.180  -24.971 78.856  1.00 74.71  ? 409 ARG A HH22   1 
ATOM   6826  N N      . GLU A 1 410 ? 7.488   -29.225 82.799  1.00 49.49  ? 410 GLU A N      1 
ATOM   6827  C CA     . GLU A 1 410 ? 6.550   -29.967 81.954  1.00 55.79  ? 410 GLU A CA     1 
ATOM   6828  C C      . GLU A 1 410 ? 6.143   -31.320 82.556  1.00 54.81  ? 410 GLU A C      1 
ATOM   6829  O O      . GLU A 1 410 ? 5.241   -31.979 82.038  1.00 62.84  ? 410 GLU A O      1 
ATOM   6830  C CB     . GLU A 1 410 ? 7.120   -30.138 80.538  1.00 58.91  ? 410 GLU A CB     1 
ATOM   6831  C CG     . GLU A 1 410 ? 8.402   -30.924 80.454  1.00 63.11  ? 410 GLU A CG     1 
ATOM   6832  C CD     . GLU A 1 410 ? 9.250   -30.541 79.247  1.00 69.51  ? 410 GLU A CD     1 
ATOM   6833  O OE1    . GLU A 1 410 ? 8.890   -29.567 78.546  1.00 68.09  ? 410 GLU A OE1    1 
ATOM   6834  O OE2    . GLU A 1 410 ? 10.287  -31.205 79.005  1.00 75.51  ? 410 GLU A OE2    1 
ATOM   6835  H H      . GLU A 1 410 ? 8.319   -29.395 82.656  1.00 59.78  ? 410 GLU A H      1 
ATOM   6836  H HA     . GLU A 1 410 ? 5.740   -29.439 81.873  1.00 67.34  ? 410 GLU A HA     1 
ATOM   6837  H HB2    . GLU A 1 410 ? 6.460   -30.596 79.994  1.00 71.08  ? 410 GLU A HB2    1 
ATOM   6838  H HB3    . GLU A 1 410 ? 7.292   -29.258 80.167  1.00 71.08  ? 410 GLU A HB3    1 
ATOM   6839  H HG2    . GLU A 1 410 ? 8.926   -30.761 81.253  1.00 76.12  ? 410 GLU A HG2    1 
ATOM   6840  H HG3    . GLU A 1 410 ? 8.190   -31.868 80.383  1.00 76.12  ? 410 GLU A HG3    1 
ATOM   6841  N N      . TYR A 1 411 ? 6.772   -31.713 83.657  1.00 38.55  ? 411 TYR A N      1 
ATOM   6842  C CA     . TYR A 1 411 ? 6.263   -32.818 84.471  1.00 36.09  ? 411 TYR A CA     1 
ATOM   6843  C C      . TYR A 1 411 ? 7.144   -33.049 85.677  1.00 36.54  ? 411 TYR A C      1 
ATOM   6844  O O      . TYR A 1 411 ? 8.351   -32.842 85.621  1.00 41.73  ? 411 TYR A O      1 
ATOM   6845  C CB     . TYR A 1 411 ? 6.176   -34.119 83.653  1.00 37.73  ? 411 TYR A CB     1 
ATOM   6846  C CG     . TYR A 1 411 ? 6.191   -35.378 84.495  1.00 37.92  ? 411 TYR A CG     1 
ATOM   6847  C CD1    . TYR A 1 411 ? 5.040   -35.823 85.135  1.00 38.59  ? 411 TYR A CD1    1 
ATOM   6848  C CD2    . TYR A 1 411 ? 7.357   -36.114 84.658  1.00 38.21  ? 411 TYR A CD2    1 
ATOM   6849  C CE1    . TYR A 1 411 ? 5.050   -36.965 85.918  1.00 37.80  ? 411 TYR A CE1    1 
ATOM   6850  C CE2    . TYR A 1 411 ? 7.380   -37.263 85.437  1.00 37.40  ? 411 TYR A CE2    1 
ATOM   6851  C CZ     . TYR A 1 411 ? 6.222   -37.686 86.068  1.00 38.49  ? 411 TYR A CZ     1 
ATOM   6852  O OH     . TYR A 1 411 ? 6.229   -38.829 86.851  1.00 40.28  ? 411 TYR A OH     1 
ATOM   6853  H H      . TYR A 1 411 ? 7.496   -31.359 83.958  1.00 46.65  ? 411 TYR A H      1 
ATOM   6854  H HA     . TYR A 1 411 ? 5.372   -32.598 84.785  1.00 43.70  ? 411 TYR A HA     1 
ATOM   6855  H HB2    . TYR A 1 411 ? 5.350   -34.113 83.145  1.00 45.66  ? 411 TYR A HB2    1 
ATOM   6856  H HB3    . TYR A 1 411 ? 6.933   -34.158 83.048  1.00 45.66  ? 411 TYR A HB3    1 
ATOM   6857  H HD1    . TYR A 1 411 ? 4.251   -35.340 85.042  1.00 46.69  ? 411 TYR A HD1    1 
ATOM   6858  H HD2    . TYR A 1 411 ? 8.138   -35.831 84.239  1.00 46.24  ? 411 TYR A HD2    1 
ATOM   6859  H HE1    . TYR A 1 411 ? 4.271   -37.248 86.339  1.00 45.75  ? 411 TYR A HE1    1 
ATOM   6860  H HE2    . TYR A 1 411 ? 8.169   -37.744 85.537  1.00 45.28  ? 411 TYR A HE2    1 
ATOM   6861  H HH     . TYR A 1 411 ? 6.998   -39.168 86.858  1.00 48.73  ? 411 TYR A HH     1 
ATOM   6862  N N      . PHE A 1 412 ? 6.549   -33.597 86.724  1.00 35.63  ? 412 PHE A N      1 
ATOM   6863  C CA     . PHE A 1 412 ? 7.284   -34.019 87.897  1.00 36.32  ? 412 PHE A CA     1 
ATOM   6864  C C      . PHE A 1 412 ? 6.307   -34.600 88.892  1.00 36.78  ? 412 PHE A C      1 
ATOM   6865  O O      . PHE A 1 412 ? 5.094   -34.383 88.776  1.00 37.33  ? 412 PHE A O      1 
ATOM   6866  C CB     . PHE A 1 412 ? 8.069   -32.859 88.525  1.00 38.01  ? 412 PHE A CB     1 
ATOM   6867  C CG     . PHE A 1 412 ? 7.259   -32.002 89.453  1.00 40.64  ? 412 PHE A CG     1 
ATOM   6868  C CD1    . PHE A 1 412 ? 6.404   -31.032 88.956  1.00 42.07  ? 412 PHE A CD1    1 
ATOM   6869  C CD2    . PHE A 1 412 ? 7.370   -32.146 90.834  1.00 40.48  ? 412 PHE A CD2    1 
ATOM   6870  C CE1    . PHE A 1 412 ? 5.668   -30.230 89.826  1.00 43.26  ? 412 PHE A CE1    1 
ATOM   6871  C CE2    . PHE A 1 412 ? 6.634   -31.349 91.700  1.00 36.98  ? 412 PHE A CE2    1 
ATOM   6872  C CZ     . PHE A 1 412 ? 5.789   -30.393 91.201  1.00 37.79  ? 412 PHE A CZ     1 
ATOM   6873  H H      . PHE A 1 412 ? 5.702   -33.737 86.778  1.00 43.14  ? 412 PHE A H      1 
ATOM   6874  H HA     . PHE A 1 412 ? 7.914   -34.713 87.648  1.00 43.98  ? 412 PHE A HA     1 
ATOM   6875  H HB2    . PHE A 1 412 ? 8.811   -33.224 89.032  1.00 46.01  ? 412 PHE A HB2    1 
ATOM   6876  H HB3    . PHE A 1 412 ? 8.405   -32.290 87.815  1.00 46.01  ? 412 PHE A HB3    1 
ATOM   6877  H HD1    . PHE A 1 412 ? 6.320   -30.916 88.037  1.00 50.87  ? 412 PHE A HD1    1 
ATOM   6878  H HD2    . PHE A 1 412 ? 7.943   -32.790 91.182  1.00 48.97  ? 412 PHE A HD2    1 
ATOM   6879  H HE1    . PHE A 1 412 ? 5.093   -29.584 89.485  1.00 52.30  ? 412 PHE A HE1    1 
ATOM   6880  H HE2    . PHE A 1 412 ? 6.718   -31.461 92.619  1.00 44.77  ? 412 PHE A HE2    1 
ATOM   6881  H HZ     . PHE A 1 412 ? 5.294   -29.859 91.780  1.00 45.74  ? 412 PHE A HZ     1 
ATOM   6882  N N      . GLU A 1 413 ? 6.860   -35.353 89.846  1.00 36.55  ? 413 GLU A N      1 
ATOM   6883  C CA     . GLU A 1 413 ? 6.105   -36.091 90.861  1.00 38.03  ? 413 GLU A CA     1 
ATOM   6884  C C      . GLU A 1 413 ? 6.912   -36.206 92.142  1.00 35.72  ? 413 GLU A C      1 
ATOM   6885  O O      . GLU A 1 413 ? 8.118   -36.405 92.069  1.00 42.16  ? 413 GLU A O      1 
ATOM   6886  C CB     . GLU A 1 413 ? 5.753   -37.487 90.340  1.00 41.63  ? 413 GLU A CB     1 
ATOM   6887  C CG     . GLU A 1 413 ? 4.956   -38.341 91.307  1.00 43.18  ? 413 GLU A CG     1 
ATOM   6888  C CD     . GLU A 1 413 ? 4.733   -39.754 90.788  1.00 46.86  ? 413 GLU A CD     1 
ATOM   6889  O OE1    . GLU A 1 413 ? 4.187   -40.578 91.567  1.00 50.60  ? 413 GLU A OE1    1 
ATOM   6890  O OE2    . GLU A 1 413 ? 5.121   -40.040 89.622  1.00 40.61  ? 413 GLU A OE2    1 
ATOM   6891  H H      . GLU A 1 413 ? 7.710   -35.456 89.926  1.00 44.25  ? 413 GLU A H      1 
ATOM   6892  H HA     . GLU A 1 413 ? 5.281   -35.619 91.058  1.00 46.03  ? 413 GLU A HA     1 
ATOM   6893  H HB2    . GLU A 1 413 ? 5.228   -37.392 89.530  1.00 50.34  ? 413 GLU A HB2    1 
ATOM   6894  H HB3    . GLU A 1 413 ? 6.576   -37.960 90.141  1.00 50.34  ? 413 GLU A HB3    1 
ATOM   6895  H HG2    . GLU A 1 413 ? 5.436   -38.401 92.147  1.00 52.21  ? 413 GLU A HG2    1 
ATOM   6896  H HG3    . GLU A 1 413 ? 4.088   -37.932 91.449  1.00 52.21  ? 413 GLU A HG3    1 
ATOM   6897  N N      . ILE A 1 414 ? 6.261   -36.094 93.305  1.00 35.76  ? 414 ILE A N      1 
ATOM   6898  C CA     . ILE A 1 414 ? 6.929   -36.289 94.613  1.00 34.94  ? 414 ILE A CA     1 
ATOM   6899  C C      . ILE A 1 414 ? 6.676   -37.689 95.162  1.00 35.38  ? 414 ILE A C      1 
ATOM   6900  O O      . ILE A 1 414 ? 5.536   -38.012 95.498  1.00 42.43  ? 414 ILE A O      1 
ATOM   6901  C CB     . ILE A 1 414 ? 6.430   -35.292 95.690  1.00 32.48  ? 414 ILE A CB     1 
ATOM   6902  C CG1    . ILE A 1 414 ? 6.655   -33.835 95.271  1.00 34.86  ? 414 ILE A CG1    1 
ATOM   6903  C CG2    . ILE A 1 414 ? 7.088   -35.569 97.036  1.00 29.11  ? 414 ILE A CG2    1 
ATOM   6904  C CD1    . ILE A 1 414 ? 8.089   -33.417 95.169  1.00 35.66  ? 414 ILE A CD1    1 
ATOM   6905  H H      . ILE A 1 414 ? 5.425   -35.904 93.370  1.00 43.31  ? 414 ILE A H      1 
ATOM   6906  H HA     . ILE A 1 414 ? 7.886   -36.171 94.507  1.00 42.32  ? 414 ILE A HA     1 
ATOM   6907  H HB     . ILE A 1 414 ? 5.475   -35.425 95.795  1.00 39.37  ? 414 ILE A HB     1 
ATOM   6908  H HG12   . ILE A 1 414 ? 6.248   -33.698 94.401  1.00 42.22  ? 414 ILE A HG12   1 
ATOM   6909  H HG13   . ILE A 1 414 ? 6.228   -33.257 95.923  1.00 42.22  ? 414 ILE A HG13   1 
ATOM   6910  H HG21   . ILE A 1 414 ? 6.756   -34.930 97.686  1.00 35.32  ? 414 ILE A HG21   1 
ATOM   6911  H HG22   . ILE A 1 414 ? 6.868   -36.471 97.315  1.00 35.32  ? 414 ILE A HG22   1 
ATOM   6912  H HG23   . ILE A 1 414 ? 8.049   -35.476 96.941  1.00 35.32  ? 414 ILE A HG23   1 
ATOM   6913  H HD11   . ILE A 1 414 ? 8.128   -32.486 94.900  1.00 43.19  ? 414 ILE A HD11   1 
ATOM   6914  H HD12   . ILE A 1 414 ? 8.513   -33.530 96.034  1.00 43.19  ? 414 ILE A HD12   1 
ATOM   6915  H HD13   . ILE A 1 414 ? 8.533   -33.972 94.508  1.00 43.19  ? 414 ILE A HD13   1 
ATOM   6916  N N      . ILE A 1 415 ? 7.719   -38.497 95.309  1.00 31.82  ? 415 ILE A N      1 
ATOM   6917  C CA     . ILE A 1 415 ? 7.558   -39.851 95.847  1.00 34.92  ? 415 ILE A CA     1 
ATOM   6918  C C      . ILE A 1 415 ? 8.026   -39.961 97.295  1.00 39.28  ? 415 ILE A C      1 
ATOM   6919  O O      . ILE A 1 415 ? 8.983   -39.293 97.702  1.00 44.88  ? 415 ILE A O      1 
ATOM   6920  C CB     . ILE A 1 415 ? 8.351   -40.884 95.037  1.00 42.30  ? 415 ILE A CB     1 
ATOM   6921  C CG1    . ILE A 1 415 ? 8.278   -40.582 93.543  1.00 45.66  ? 415 ILE A CG1    1 
ATOM   6922  C CG2    . ILE A 1 415 ? 7.861   -42.292 95.348  1.00 45.89  ? 415 ILE A CG2    1 
ATOM   6923  C CD1    . ILE A 1 415 ? 6.885   -40.574 92.993  1.00 48.67  ? 415 ILE A CD1    1 
ATOM   6924  H H      . ILE A 1 415 ? 8.529   -38.291 95.107  1.00 38.57  ? 415 ILE A H      1 
ATOM   6925  H HA     . ILE A 1 415 ? 6.620   -40.096 95.813  1.00 42.30  ? 415 ILE A HA     1 
ATOM   6926  H HB     . ILE A 1 415 ? 9.280   -40.825 95.308  1.00 51.15  ? 415 ILE A HB     1 
ATOM   6927  H HG12   . ILE A 1 415 ? 8.665   -39.707 93.383  1.00 55.18  ? 415 ILE A HG12   1 
ATOM   6928  H HG13   . ILE A 1 415 ? 8.782   -41.257 93.063  1.00 55.18  ? 415 ILE A HG13   1 
ATOM   6929  H HG21   . ILE A 1 415 ? 8.376   -42.927 94.825  1.00 55.46  ? 415 ILE A HG21   1 
ATOM   6930  H HG22   . ILE A 1 415 ? 7.983   -42.466 96.294  1.00 55.46  ? 415 ILE A HG22   1 
ATOM   6931  H HG23   . ILE A 1 415 ? 6.922   -42.357 95.117  1.00 55.46  ? 415 ILE A HG23   1 
ATOM   6932  H HD11   . ILE A 1 415 ? 6.922   -40.375 92.044  1.00 58.79  ? 415 ILE A HD11   1 
ATOM   6933  H HD12   . ILE A 1 415 ? 6.485   -41.447 93.134  1.00 58.79  ? 415 ILE A HD12   1 
ATOM   6934  H HD13   . ILE A 1 415 ? 6.368   -39.895 93.454  1.00 58.79  ? 415 ILE A HD13   1 
ATOM   6935  N N      . SER A 1 416 ? 7.356   -40.807 98.071  1.00 37.67  ? 416 SER A N      1 
ATOM   6936  C CA     . SER A 1 416 ? 7.760   -41.051 99.453  1.00 41.22  ? 416 SER A CA     1 
ATOM   6937  C C      . SER A 1 416 ? 7.269   -42.431 99.881  1.00 49.01  ? 416 SER A C      1 
ATOM   6938  O O      . SER A 1 416 ? 6.417   -43.029 99.216  1.00 53.51  ? 416 SER A O      1 
ATOM   6939  C CB     . SER A 1 416 ? 7.245   -39.957 100.394 1.00 39.70  ? 416 SER A CB     1 
ATOM   6940  O OG     . SER A 1 416 ? 5.851   -40.049 100.609 1.00 41.89  ? 416 SER A OG     1 
ATOM   6941  H H      . SER A 1 416 ? 6.663   -41.252 97.822  1.00 45.60  ? 416 SER A H      1 
ATOM   6942  H HA     . SER A 1 416 ? 8.729   -41.052 99.501  1.00 49.86  ? 416 SER A HA     1 
ATOM   6943  H HB2    . SER A 1 416 ? 7.698   -40.042 101.248 1.00 48.03  ? 416 SER A HB2    1 
ATOM   6944  H HB3    . SER A 1 416 ? 7.443   -39.092 100.003 1.00 48.03  ? 416 SER A HB3    1 
ATOM   6945  H HG     . SER A 1 416 ? 5.599   -39.438 101.127 1.00 50.66  ? 416 SER A HG     1 
ATOM   6946  N N      . GLY A 1 417 ? 7.821   -42.932 100.984 1.00 50.18  ? 417 GLY A N      1 
ATOM   6947  C CA     . GLY A 1 417 ? 7.439   -44.225 101.532 1.00 56.13  ? 417 GLY A CA     1 
ATOM   6948  C C      . GLY A 1 417 ? 7.659   -45.374 100.552 1.00 64.84  ? 417 GLY A C      1 
ATOM   6949  O O      . GLY A 1 417 ? 8.648   -45.387 99.813  1.00 65.98  ? 417 GLY A O      1 
ATOM   6950  H H      . GLY A 1 417 ? 8.430   -42.531 101.440 1.00 60.61  ? 417 GLY A H      1 
ATOM   6951  H HA2    . GLY A 1 417 ? 7.960   -44.401 102.331 1.00 67.74  ? 417 GLY A HA2    1 
ATOM   6952  H HA3    . GLY A 1 417 ? 6.501   -44.206 101.775 1.00 67.74  ? 417 GLY A HA3    1 
ATOM   6953  N N      . GLU A 1 418 ? 6.731   -46.326 100.510 1.00 73.06  ? 418 GLU A N      1 
ATOM   6954  C CA     . GLU A 1 418 ? 6.968   -47.576 99.781  1.00 78.31  ? 418 GLU A CA     1 
ATOM   6955  C C      . GLU A 1 418 ? 7.155   -47.374 98.269  1.00 74.66  ? 418 GLU A C      1 
ATOM   6956  O O      . GLU A 1 418 ? 7.916   -48.110 97.645  1.00 74.63  ? 418 GLU A O      1 
ATOM   6957  C CB     . GLU A 1 418 ? 5.838   -48.586 100.052 1.00 86.41  ? 418 GLU A CB     1 
ATOM   6958  C CG     . GLU A 1 418 ? 5.305   -48.629 101.506 1.00 94.46  ? 418 GLU A CG     1 
ATOM   6959  C CD     . GLU A 1 418 ? 6.327   -49.181 102.509 1.00 94.24  ? 418 GLU A CD     1 
ATOM   6960  O OE1    . GLU A 1 418 ? 6.204   -48.896 103.725 1.00 90.62  ? 418 GLU A OE1    1 
ATOM   6961  O OE2    . GLU A 1 418 ? 7.254   -49.906 102.081 1.00 95.23  ? 418 GLU A OE2    1 
ATOM   6962  H H      . GLU A 1 418 ? 5.962   -46.277 100.892 1.00 88.06  ? 418 GLU A H      1 
ATOM   6963  H HA     . GLU A 1 418 ? 7.788   -47.969 100.118 1.00 94.36  ? 418 GLU A HA     1 
ATOM   6964  H HB2    . GLU A 1 418 ? 5.089   -48.369 99.476  1.00 104.08 ? 418 GLU A HB2    1 
ATOM   6965  H HB3    . GLU A 1 418 ? 6.164   -49.474 99.837  1.00 104.08 ? 418 GLU A HB3    1 
ATOM   6966  H HG2    . GLU A 1 418 ? 5.072   -47.729 101.782 1.00 113.74 ? 418 GLU A HG2    1 
ATOM   6967  H HG3    . GLU A 1 418 ? 4.520   -49.198 101.537 1.00 113.74 ? 418 GLU A HG3    1 
ATOM   6968  N N      . LYS A 1 419 ? 6.489   -46.384 97.679  1.00 70.18  ? 419 LYS A N      1 
ATOM   6969  C CA     . LYS A 1 419 ? 6.647   -46.148 96.244  1.00 64.21  ? 419 LYS A CA     1 
ATOM   6970  C C      . LYS A 1 419 ? 8.051   -45.634 95.959  1.00 56.65  ? 419 LYS A C      1 
ATOM   6971  O O      . LYS A 1 419 ? 8.576   -45.802 94.858  1.00 48.83  ? 419 LYS A O      1 
ATOM   6972  C CB     . LYS A 1 419 ? 5.616   -45.147 95.707  1.00 65.11  ? 419 LYS A CB     1 
ATOM   6973  C CG     . LYS A 1 419 ? 5.782   -44.916 94.197  1.00 68.81  ? 419 LYS A CG     1 
ATOM   6974  C CD     . LYS A 1 419 ? 4.573   -44.281 93.495  1.00 69.11  ? 419 LYS A CD     1 
ATOM   6975  C CE     . LYS A 1 419 ? 4.921   -43.996 92.024  1.00 65.99  ? 419 LYS A CE     1 
ATOM   6976  N NZ     . LYS A 1 419 ? 3.747   -43.769 91.153  1.00 61.67  ? 419 LYS A NZ     1 
ATOM   6977  H H      . LYS A 1 419 ? 5.950   -45.845 98.076  1.00 84.61  ? 419 LYS A H      1 
ATOM   6978  H HA     . LYS A 1 419 ? 6.530   -46.985 95.769  1.00 77.44  ? 419 LYS A HA     1 
ATOM   6979  H HB2    . LYS A 1 419 ? 4.723   -45.492 95.865  1.00 78.53  ? 419 LYS A HB2    1 
ATOM   6980  H HB3    . LYS A 1 419 ? 5.731   -44.296 96.159  1.00 78.53  ? 419 LYS A HB3    1 
ATOM   6981  H HG2    . LYS A 1 419 ? 6.542   -44.329 94.058  1.00 82.96  ? 419 LYS A HG2    1 
ATOM   6982  H HG3    . LYS A 1 419 ? 5.951   -45.771 93.772  1.00 82.96  ? 419 LYS A HG3    1 
ATOM   6983  H HD2    . LYS A 1 419 ? 3.822   -44.893 93.523  1.00 83.33  ? 419 LYS A HD2    1 
ATOM   6984  H HD3    . LYS A 1 419 ? 4.348   -43.443 93.929  1.00 83.33  ? 419 LYS A HD3    1 
ATOM   6985  H HE2    . LYS A 1 419 ? 5.475   -43.201 91.984  1.00 79.58  ? 419 LYS A HE2    1 
ATOM   6986  H HE3    . LYS A 1 419 ? 5.410   -44.754 91.668  1.00 79.58  ? 419 LYS A HE3    1 
ATOM   6987  H HZ1    . LYS A 1 419 ? 4.014   -43.610 90.319  1.00 74.39  ? 419 LYS A HZ1    1 
ATOM   6988  H HZ2    . LYS A 1 419 ? 3.222   -44.488 91.157  1.00 74.39  ? 419 LYS A HZ2    1 
ATOM   6989  H HZ3    . LYS A 1 419 ? 3.282   -43.069 91.446  1.00 74.39  ? 419 LYS A HZ3    1 
ATOM   6990  N N      . LEU A 1 420 ? 8.647   -45.003 96.966  1.00 56.67  ? 420 LEU A N      1 
ATOM   6991  C CA     . LEU A 1 420 ? 9.962   -44.403 96.827  1.00 51.61  ? 420 LEU A CA     1 
ATOM   6992  C C      . LEU A 1 420 ? 10.989  -45.523 96.824  1.00 51.56  ? 420 LEU A C      1 
ATOM   6993  O O      . LEU A 1 420 ? 11.950  -45.496 96.055  1.00 55.26  ? 420 LEU A O      1 
ATOM   6994  C CB     . LEU A 1 420 ? 10.222  -43.406 97.960  1.00 45.16  ? 420 LEU A CB     1 
ATOM   6995  C CG     . LEU A 1 420 ? 11.548  -42.657 97.974  1.00 40.77  ? 420 LEU A CG     1 
ATOM   6996  C CD1    . LEU A 1 420 ? 11.758  -41.927 96.670  1.00 43.86  ? 420 LEU A CD1    1 
ATOM   6997  C CD2    . LEU A 1 420 ? 11.563  -41.683 99.117  1.00 36.00  ? 420 LEU A CD2    1 
ATOM   6998  H H      . LEU A 1 420 ? 8.302   -44.909 97.748  1.00 68.39  ? 420 LEU A H      1 
ATOM   6999  H HA     . LEU A 1 420 ? 10.017  -43.931 95.981  1.00 62.32  ? 420 LEU A HA     1 
ATOM   7000  H HB2    . LEU A 1 420 ? 9.521   -42.735 97.931  1.00 54.58  ? 420 LEU A HB2    1 
ATOM   7001  H HB3    . LEU A 1 420 ? 10.163  -43.888 98.799  1.00 54.58  ? 420 LEU A HB3    1 
ATOM   7002  H HG     . LEU A 1 420 ? 12.275  -43.287 98.095  1.00 49.32  ? 420 LEU A HG     1 
ATOM   7003  H HD11   . LEU A 1 420 ? 12.607  -41.459 96.704  1.00 53.02  ? 420 LEU A HD11   1 
ATOM   7004  H HD12   . LEU A 1 420 ? 11.763  -42.571 95.945  1.00 53.02  ? 420 LEU A HD12   1 
ATOM   7005  H HD13   . LEU A 1 420 ? 11.035  -41.292 96.545  1.00 53.02  ? 420 LEU A HD13   1 
ATOM   7006  H HD21   . LEU A 1 420 ? 12.411  -41.212 99.118  1.00 43.59  ? 420 LEU A HD21   1 
ATOM   7007  H HD22   . LEU A 1 420 ? 10.834  -41.054 99.005  1.00 43.59  ? 420 LEU A HD22   1 
ATOM   7008  H HD23   . LEU A 1 420 ? 11.455  -42.171 99.948  1.00 43.59  ? 420 LEU A HD23   1 
ATOM   7009  N N      . PHE A 1 421 ? 10.795  -46.489 97.716  1.00 48.04  ? 421 PHE A N      1 
ATOM   7010  C CA     . PHE A 1 421 ? 11.715  -47.615 97.853  1.00 47.37  ? 421 PHE A CA     1 
ATOM   7011  C C      . PHE A 1 421 ? 11.640  -48.578 96.654  1.00 48.94  ? 421 PHE A C      1 
ATOM   7012  O O      . PHE A 1 421 ? 12.526  -49.416 96.455  1.00 48.78  ? 421 PHE A O      1 
ATOM   7013  C CB     . PHE A 1 421 ? 11.424  -48.374 99.152  1.00 45.99  ? 421 PHE A CB     1 
ATOM   7014  C CG     . PHE A 1 421 ? 11.460  -47.513 100.391 1.00 40.69  ? 421 PHE A CG     1 
ATOM   7015  C CD1    . PHE A 1 421 ? 12.256  -46.383 100.450 1.00 39.15  ? 421 PHE A CD1    1 
ATOM   7016  C CD2    . PHE A 1 421 ? 10.694  -47.849 101.499 1.00 40.35  ? 421 PHE A CD2    1 
ATOM   7017  C CE1    . PHE A 1 421 ? 12.288  -45.600 101.592 1.00 39.93  ? 421 PHE A CE1    1 
ATOM   7018  C CE2    . PHE A 1 421 ? 10.715  -47.069 102.649 1.00 42.29  ? 421 PHE A CE2    1 
ATOM   7019  C CZ     . PHE A 1 421 ? 11.510  -45.945 102.699 1.00 40.87  ? 421 PHE A CZ     1 
ATOM   7020  H H      . PHE A 1 421 ? 10.130  -46.516 98.261  1.00 58.04  ? 421 PHE A H      1 
ATOM   7021  H HA     . PHE A 1 421 ? 12.622  -47.274 97.904  1.00 57.23  ? 421 PHE A HA     1 
ATOM   7022  H HB2    . PHE A 1 421 ? 10.540  -48.767 99.091  1.00 55.58  ? 421 PHE A HB2    1 
ATOM   7023  H HB3    . PHE A 1 421 ? 12.088  -49.073 99.259  1.00 55.58  ? 421 PHE A HB3    1 
ATOM   7024  H HD1    . PHE A 1 421 ? 12.776  -46.147 99.716  1.00 47.38  ? 421 PHE A HD1    1 
ATOM   7025  H HD2    . PHE A 1 421 ? 10.155  -48.606 101.470 1.00 48.81  ? 421 PHE A HD2    1 
ATOM   7026  H HE1    . PHE A 1 421 ? 12.825  -44.842 101.620 1.00 48.31  ? 421 PHE A HE1    1 
ATOM   7027  H HE2    . PHE A 1 421 ? 10.195  -47.307 103.383 1.00 51.14  ? 421 PHE A HE2    1 
ATOM   7028  H HZ     . PHE A 1 421 ? 11.530  -45.419 103.466 1.00 49.43  ? 421 PHE A HZ     1 
ATOM   7029  N N      . LYS A 1 422 ? 10.586  -48.439 95.855  1.00 53.16  ? 422 LYS A N      1 
ATOM   7030  C CA     . LYS A 1 422 ? 10.426  -49.220 94.629  1.00 61.15  ? 422 LYS A CA     1 
ATOM   7031  C C      . LYS A 1 422 ? 11.267  -48.690 93.471  1.00 68.49  ? 422 LYS A C      1 
ATOM   7032  O O      . LYS A 1 422 ? 11.557  -49.423 92.531  1.00 70.48  ? 422 LYS A O      1 
ATOM   7033  C CB     . LYS A 1 422 ? 8.960   -49.217 94.188  1.00 65.07  ? 422 LYS A CB     1 
ATOM   7034  C CG     . LYS A 1 422 ? 8.002   -50.058 95.010  1.00 68.18  ? 422 LYS A CG     1 
ATOM   7035  C CD     . LYS A 1 422 ? 6.582   -49.831 94.514  1.00 69.01  ? 422 LYS A CD     1 
ATOM   7036  C CE     . LYS A 1 422 ? 5.555   -50.576 95.336  1.00 70.72  ? 422 LYS A CE     1 
ATOM   7037  N NZ     . LYS A 1 422 ? 4.170   -50.228 94.898  1.00 71.11  ? 422 LYS A NZ     1 
ATOM   7038  H H      . LYS A 1 422 ? 9.939   -47.892 96.002  1.00 64.18  ? 422 LYS A H      1 
ATOM   7039  H HA     . LYS A 1 422 ? 10.689  -50.138 94.800  1.00 73.76  ? 422 LYS A HA     1 
ATOM   7040  H HB2    . LYS A 1 422 ? 8.637   -48.303 94.217  1.00 78.47  ? 422 LYS A HB2    1 
ATOM   7041  H HB3    . LYS A 1 422 ? 8.918   -49.544 93.276  1.00 78.47  ? 422 LYS A HB3    1 
ATOM   7042  H HG2    . LYS A 1 422 ? 8.221   -50.997 94.908  1.00 82.20  ? 422 LYS A HG2    1 
ATOM   7043  H HG3    . LYS A 1 422 ? 8.052   -49.793 95.942  1.00 82.20  ? 422 LYS A HG3    1 
ATOM   7044  H HD2    . LYS A 1 422 ? 6.377   -48.885 94.563  1.00 83.20  ? 422 LYS A HD2    1 
ATOM   7045  H HD3    . LYS A 1 422 ? 6.514   -50.140 93.597  1.00 83.20  ? 422 LYS A HD3    1 
ATOM   7046  H HE2    . LYS A 1 422 ? 5.681   -51.531 95.222  1.00 85.26  ? 422 LYS A HE2    1 
ATOM   7047  H HE3    . LYS A 1 422 ? 5.651   -50.332 96.270  1.00 85.26  ? 422 LYS A HE3    1 
ATOM   7048  H HZ1    . LYS A 1 422 ? 3.575   -50.672 95.389  1.00 85.72  ? 422 LYS A HZ1    1 
ATOM   7049  H HZ2    . LYS A 1 422 ? 4.031   -49.354 94.996  1.00 85.72  ? 422 LYS A HZ2    1 
ATOM   7050  H HZ3    . LYS A 1 422 ? 4.058   -50.445 94.042  1.00 85.72  ? 422 LYS A HZ3    1 
ATOM   7051  N N      . GLU A 1 423 ? 11.638  -47.414 93.538  1.00 68.57  ? 423 GLU A N      1 
ATOM   7052  C CA     . GLU A 1 423 ? 12.417  -46.752 92.487  1.00 65.01  ? 423 GLU A CA     1 
ATOM   7053  C C      . GLU A 1 423 ? 13.887  -47.162 92.540  1.00 62.26  ? 423 GLU A C      1 
ATOM   7054  O O      . GLU A 1 423 ? 14.342  -47.678 93.567  1.00 67.58  ? 423 GLU A O      1 
ATOM   7055  C CB     . GLU A 1 423 ? 12.311  -45.236 92.627  1.00 68.20  ? 423 GLU A CB     1 
ATOM   7056  C CG     . GLU A 1 423 ? 10.893  -44.693 92.683  1.00 72.52  ? 423 GLU A CG     1 
ATOM   7057  C CD     . GLU A 1 423 ? 10.191  -44.715 91.349  1.00 74.76  ? 423 GLU A CD     1 
ATOM   7058  O OE1    . GLU A 1 423 ? 10.885  -44.728 90.310  1.00 77.56  ? 423 GLU A OE1    1 
ATOM   7059  O OE2    . GLU A 1 423 ? 8.941   -44.705 91.346  1.00 72.35  ? 423 GLU A OE2    1 
ATOM   7060  H H      . GLU A 1 423 ? 11.447  -46.896 94.198  1.00 82.67  ? 423 GLU A H      1 
ATOM   7061  H HA     . GLU A 1 423 ? 12.062  -47.003 91.620  1.00 78.40  ? 423 GLU A HA     1 
ATOM   7062  H HB2    . GLU A 1 423 ? 12.758  -44.970 93.446  1.00 82.23  ? 423 GLU A HB2    1 
ATOM   7063  H HB3    . GLU A 1 423 ? 12.752  -44.825 91.867  1.00 82.23  ? 423 GLU A HB3    1 
ATOM   7064  H HG2    . GLU A 1 423 ? 10.374  -45.231 93.301  1.00 87.42  ? 423 GLU A HG2    1 
ATOM   7065  H HG3    . GLU A 1 423 ? 10.921  -43.773 92.989  1.00 87.42  ? 423 GLU A HG3    1 
ATOM   7066  N N      . PRO A 1 424 ? 14.644  -46.933 91.443  1.00 52.59  ? 424 PRO A N      1 
ATOM   7067  C CA     . PRO A 1 424 ? 16.044  -47.382 91.457  1.00 51.35  ? 424 PRO A CA     1 
ATOM   7068  C C      . PRO A 1 424 ? 16.982  -46.358 92.108  1.00 51.66  ? 424 PRO A C      1 
ATOM   7069  O O      . PRO A 1 424 ? 18.084  -46.083 91.612  1.00 51.68  ? 424 PRO A O      1 
ATOM   7070  C CB     . PRO A 1 424 ? 16.374  -47.533 89.958  1.00 50.77  ? 424 PRO A CB     1 
ATOM   7071  C CG     . PRO A 1 424 ? 15.073  -47.338 89.225  1.00 51.25  ? 424 PRO A CG     1 
ATOM   7072  C CD     . PRO A 1 424 ? 14.253  -46.464 90.109  1.00 50.45  ? 424 PRO A CD     1 
ATOM   7073  H HA     . PRO A 1 424 ? 16.129  -48.240 91.902  1.00 62.01  ? 424 PRO A HA     1 
ATOM   7074  H HB2    . PRO A 1 424 ? 17.017  -46.855 89.697  1.00 61.32  ? 424 PRO A HB2    1 
ATOM   7075  H HB3    . PRO A 1 424 ? 16.729  -48.421 89.792  1.00 61.32  ? 424 PRO A HB3    1 
ATOM   7076  H HG2    . PRO A 1 424 ? 15.240  -46.904 88.374  1.00 61.89  ? 424 PRO A HG2    1 
ATOM   7077  H HG3    . PRO A 1 424 ? 14.640  -48.196 89.094  1.00 61.89  ? 424 PRO A HG3    1 
ATOM   7078  H HD2    . PRO A 1 424 ? 14.494  -45.533 89.990  1.00 60.93  ? 424 PRO A HD2    1 
ATOM   7079  H HD3    . PRO A 1 424 ? 13.307  -46.615 89.957  1.00 60.93  ? 424 PRO A HD3    1 
ATOM   7080  N N      . VAL A 1 425 ? 16.530  -45.826 93.240  1.00 51.49  ? 425 VAL A N      1 
ATOM   7081  C CA     . VAL A 1 425 ? 17.285  -44.878 94.046  1.00 46.06  ? 425 VAL A CA     1 
ATOM   7082  C C      . VAL A 1 425 ? 17.865  -45.511 95.305  1.00 49.58  ? 425 VAL A C      1 
ATOM   7083  O O      . VAL A 1 425 ? 18.459  -44.814 96.126  1.00 48.54  ? 425 VAL A O      1 
ATOM   7084  C CB     . VAL A 1 425 ? 16.407  -43.697 94.427  1.00 41.38  ? 425 VAL A CB     1 
ATOM   7085  C CG1    . VAL A 1 425 ? 16.008  -42.942 93.172  1.00 41.86  ? 425 VAL A CG1    1 
ATOM   7086  C CG2    . VAL A 1 425 ? 15.160  -44.171 95.167  1.00 42.56  ? 425 VAL A CG2    1 
ATOM   7087  H H      . VAL A 1 425 ? 15.758  -46.008 93.572  1.00 62.18  ? 425 VAL A H      1 
ATOM   7088  H HA     . VAL A 1 425 ? 18.025  -44.539 93.518  1.00 55.67  ? 425 VAL A HA     1 
ATOM   7089  H HB     . VAL A 1 425 ? 16.902  -43.097 95.006  1.00 50.05  ? 425 VAL A HB     1 
ATOM   7090  H HG11   . VAL A 1 425 ? 15.448  -42.190 93.422  1.00 50.62  ? 425 VAL A HG11   1 
ATOM   7091  H HG12   . VAL A 1 425 ? 16.809  -42.624 92.727  1.00 50.62  ? 425 VAL A HG12   1 
ATOM   7092  H HG13   . VAL A 1 425 ? 15.518  -43.539 92.586  1.00 50.62  ? 425 VAL A HG13   1 
ATOM   7093  H HG21   . VAL A 1 425 ? 14.619  -43.399 95.398  1.00 51.46  ? 425 VAL A HG21   1 
ATOM   7094  H HG22   . VAL A 1 425 ? 14.658  -44.767 94.590  1.00 51.46  ? 425 VAL A HG22   1 
ATOM   7095  H HG23   . VAL A 1 425 ? 15.430  -44.639 95.973  1.00 51.46  ? 425 VAL A HG23   1 
ATOM   7096  N N      . THR A 1 426 ? 17.652  -46.817 95.475  1.00 51.93  ? 426 THR A N      1 
ATOM   7097  C CA     . THR A 1 426 ? 17.985  -47.506 96.727  1.00 51.19  ? 426 THR A CA     1 
ATOM   7098  C C      . THR A 1 426 ? 19.436  -47.324 97.153  1.00 51.07  ? 426 THR A C      1 
ATOM   7099  O O      . THR A 1 426 ? 19.717  -47.118 98.323  1.00 51.40  ? 426 THR A O      1 
ATOM   7100  C CB     . THR A 1 426 ? 17.716  -49.018 96.623  1.00 51.26  ? 426 THR A CB     1 
ATOM   7101  O OG1    . THR A 1 426 ? 18.450  -49.544 95.515  1.00 55.39  ? 426 THR A OG1    1 
ATOM   7102  C CG2    . THR A 1 426 ? 16.233  -49.303 96.414  1.00 49.59  ? 426 THR A CG2    1 
ATOM   7103  H H      . THR A 1 426 ? 17.313  -47.332 94.876  1.00 62.71  ? 426 THR A H      1 
ATOM   7104  H HA     . THR A 1 426 ? 17.423  -47.153 97.434  1.00 61.82  ? 426 THR A HA     1 
ATOM   7105  H HB     . THR A 1 426 ? 18.003  -49.455 97.440  1.00 61.90  ? 426 THR A HB     1 
ATOM   7106  H HG1    . THR A 1 426 ? 19.272  -49.412 95.627  1.00 66.86  ? 426 THR A HG1    1 
ATOM   7107  H HG21   . THR A 1 426 ? 16.086  -50.260 96.351  1.00 59.90  ? 426 THR A HG21   1 
ATOM   7108  H HG22   . THR A 1 426 ? 15.720  -48.953 97.159  1.00 59.90  ? 426 THR A HG22   1 
ATOM   7109  H HG23   . THR A 1 426 ? 15.927  -48.883 95.595  1.00 59.90  ? 426 THR A HG23   1 
ATOM   7110  N N      . ALA A 1 427 ? 20.361  -47.358 96.209  1.00 50.99  ? 427 ALA A N      1 
ATOM   7111  C CA     . ALA A 1 427 ? 21.762  -47.189 96.557  1.00 49.19  ? 427 ALA A CA     1 
ATOM   7112  C C      . ALA A 1 427 ? 22.062  -45.782 97.061  1.00 48.21  ? 427 ALA A C      1 
ATOM   7113  O O      . ALA A 1 427 ? 22.851  -45.595 97.982  1.00 49.21  ? 427 ALA A O      1 
ATOM   7114  C CB     . ALA A 1 427 ? 22.623  -47.496 95.365  1.00 52.21  ? 427 ALA A CB     1 
ATOM   7115  H H      . ALA A 1 427 ? 20.209  -47.475 95.371  1.00 61.57  ? 427 ALA A H      1 
ATOM   7116  H HA     . ALA A 1 427 ? 21.991  -47.815 97.262  1.00 59.41  ? 427 ALA A HA     1 
ATOM   7117  H HB1    . ALA A 1 427 ? 23.554  -47.380 95.610  1.00 63.05  ? 427 ALA A HB1    1 
ATOM   7118  H HB2    . ALA A 1 427 ? 22.464  -48.413 95.090  1.00 63.05  ? 427 ALA A HB2    1 
ATOM   7119  H HB3    . ALA A 1 427 ? 22.391  -46.889 94.645  1.00 63.05  ? 427 ALA A HB3    1 
ATOM   7120  N N      . GLU A 1 428 ? 21.406  -44.800 96.459  1.00 47.63  ? 428 GLU A N      1 
ATOM   7121  C CA     . GLU A 1 428 ? 21.650  -43.399 96.764  1.00 47.58  ? 428 GLU A CA     1 
ATOM   7122  C C      . GLU A 1 428 ? 21.121  -43.078 98.146  1.00 47.19  ? 428 GLU A C      1 
ATOM   7123  O O      . GLU A 1 428 ? 21.778  -42.402 98.937  1.00 50.89  ? 428 GLU A O      1 
ATOM   7124  C CB     . GLU A 1 428 ? 20.989  -42.494 95.722  1.00 52.51  ? 428 GLU A CB     1 
ATOM   7125  C CG     . GLU A 1 428 ? 21.607  -42.569 94.326  1.00 59.93  ? 428 GLU A CG     1 
ATOM   7126  C CD     . GLU A 1 428 ? 21.397  -43.915 93.623  1.00 65.25  ? 428 GLU A CD     1 
ATOM   7127  O OE1    . GLU A 1 428 ? 20.533  -44.713 94.046  1.00 67.26  ? 428 GLU A OE1    1 
ATOM   7128  O OE2    . GLU A 1 428 ? 22.102  -44.175 92.627  1.00 65.49  ? 428 GLU A OE2    1 
ATOM   7129  H H      . GLU A 1 428 ? 20.802  -44.923 95.858  1.00 57.55  ? 428 GLU A H      1 
ATOM   7130  H HA     . GLU A 1 428 ? 22.605  -43.229 96.755  1.00 57.49  ? 428 GLU A HA     1 
ATOM   7131  H HB2    . GLU A 1 428 ? 20.055  -42.743 95.643  1.00 63.40  ? 428 GLU A HB2    1 
ATOM   7132  H HB3    . GLU A 1 428 ? 21.056  -41.574 96.023  1.00 63.40  ? 428 GLU A HB3    1 
ATOM   7133  H HG2    . GLU A 1 428 ? 21.208  -41.881 93.771  1.00 72.30  ? 428 GLU A HG2    1 
ATOM   7134  H HG3    . GLU A 1 428 ? 22.562  -42.419 94.399  1.00 72.30  ? 428 GLU A HG3    1 
ATOM   7135  N N      . LEU A 1 429 ? 19.918  -43.565 98.423  1.00 43.18  ? 429 LEU A N      1 
ATOM   7136  C CA     . LEU A 1 429 ? 19.292  -43.377 99.722  1.00 39.64  ? 429 LEU A CA     1 
ATOM   7137  C C      . LEU A 1 429 ? 20.203  -43.937 100.809 1.00 40.43  ? 429 LEU A C      1 
ATOM   7138  O O      . LEU A 1 429 ? 20.244  -43.419 101.919 1.00 45.27  ? 429 LEU A O      1 
ATOM   7139  C CB     . LEU A 1 429 ? 17.914  -44.047 99.764  1.00 36.41  ? 429 LEU A CB     1 
ATOM   7140  C CG     . LEU A 1 429 ? 16.805  -43.396 98.922  1.00 35.70  ? 429 LEU A CG     1 
ATOM   7141  C CD1    . LEU A 1 429 ? 15.554  -44.263 98.852  1.00 33.09  ? 429 LEU A CD1    1 
ATOM   7142  C CD2    . LEU A 1 429 ? 16.450  -42.013 99.473  1.00 38.46  ? 429 LEU A CD2    1 
ATOM   7143  H H      . LEU A 1 429 ? 19.439  -44.014 97.867  1.00 52.21  ? 429 LEU A H      1 
ATOM   7144  H HA     . LEU A 1 429 ? 19.173  -42.428 99.884  1.00 47.96  ? 429 LEU A HA     1 
ATOM   7145  H HB2    . LEU A 1 429 ? 18.012  -44.960 99.453  1.00 44.08  ? 429 LEU A HB2    1 
ATOM   7146  H HB3    . LEU A 1 429 ? 17.609  -44.053 100.685 1.00 44.08  ? 429 LEU A HB3    1 
ATOM   7147  H HG     . LEU A 1 429 ? 17.132  -43.277 98.016  1.00 43.23  ? 429 LEU A HG     1 
ATOM   7148  H HD11   . LEU A 1 429 ? 14.887  -43.810 98.312  1.00 40.10  ? 429 LEU A HD11   1 
ATOM   7149  H HD12   . LEU A 1 429 ? 15.783  -45.115 98.450  1.00 40.10  ? 429 LEU A HD12   1 
ATOM   7150  H HD13   . LEU A 1 429 ? 15.215  -44.400 99.750  1.00 40.10  ? 429 LEU A HD13   1 
ATOM   7151  H HD21   . LEU A 1 429 ? 15.750  -41.625 98.925  1.00 46.54  ? 429 LEU A HD21   1 
ATOM   7152  H HD22   . LEU A 1 429 ? 16.141  -42.108 100.387 1.00 46.54  ? 429 LEU A HD22   1 
ATOM   7153  H HD23   . LEU A 1 429 ? 17.240  -41.451 99.446  1.00 46.54  ? 429 LEU A HD23   1 
ATOM   7154  N N      . CYS A 1 430 ? 20.920  -45.007 100.495 1.00 38.03  ? 430 CYS A N      1 
ATOM   7155  C CA     . CYS A 1 430 ? 21.829  -45.605 101.456 1.00 38.81  ? 430 CYS A CA     1 
ATOM   7156  C C      . CYS A 1 430 ? 23.017  -44.694 101.746 1.00 42.76  ? 430 CYS A C      1 
ATOM   7157  O O      . CYS A 1 430 ? 23.315  -44.410 102.911 1.00 44.04  ? 430 CYS A O      1 
ATOM   7158  C CB     . CYS A 1 430 ? 22.306  -46.962 100.956 1.00 40.91  ? 430 CYS A CB     1 
ATOM   7159  S SG     . CYS A 1 430 ? 21.044  -48.239 101.150 1.00 57.17  ? 430 CYS A SG     1 
ATOM   7160  H H      . CYS A 1 430 ? 20.898  -45.404 99.732  1.00 46.03  ? 430 CYS A H      1 
ATOM   7161  H HA     . CYS A 1 430 ? 21.354  -45.746 102.290 1.00 46.96  ? 430 CYS A HA     1 
ATOM   7162  H HB2    . CYS A 1 430 ? 22.526  -46.895 100.014 1.00 49.48  ? 430 CYS A HB2    1 
ATOM   7163  H HB3    . CYS A 1 430 ? 23.088  -47.231 101.463 1.00 49.48  ? 430 CYS A HB3    1 
ATOM   7164  H HG     . CYS A 1 430 ? 20.071  -47.924 100.522 1.00 68.99  ? 430 CYS A HG     1 
ATOM   7165  N N      . GLU A 1 431 ? 23.682  -44.221 100.696 1.00 43.77  ? 431 GLU A N      1 
ATOM   7166  C CA     . GLU A 1 431 ? 24.816  -43.320 100.875 1.00 47.50  ? 431 GLU A CA     1 
ATOM   7167  C C      . GLU A 1 431 ? 24.426  -42.066 101.613 1.00 51.64  ? 431 GLU A C      1 
ATOM   7168  O O      . GLU A 1 431 ? 25.159  -41.580 102.477 1.00 52.65  ? 431 GLU A O      1 
ATOM   7169  C CB     . GLU A 1 431 ? 25.418  -42.937 99.523  1.00 51.66  ? 431 GLU A CB     1 
ATOM   7170  C CG     . GLU A 1 431 ? 26.464  -41.838 99.612  1.00 59.31  ? 431 GLU A CG     1 
ATOM   7171  C CD     . GLU A 1 431 ? 27.576  -42.164 100.589 1.00 66.60  ? 431 GLU A CD     1 
ATOM   7172  O OE1    . GLU A 1 431 ? 28.145  -43.274 100.482 1.00 67.18  ? 431 GLU A OE1    1 
ATOM   7173  O OE2    . GLU A 1 431 ? 27.870  -41.312 101.471 1.00 68.08  ? 431 GLU A OE2    1 
ATOM   7174  H H      . GLU A 1 431 ? 23.500  -44.405 99.876  1.00 52.91  ? 431 GLU A H      1 
ATOM   7175  H HA     . GLU A 1 431 ? 25.501  -43.772 101.392 1.00 57.39  ? 431 GLU A HA     1 
ATOM   7176  H HB2    . GLU A 1 431 ? 25.841  -43.719 99.136  1.00 62.38  ? 431 GLU A HB2    1 
ATOM   7177  H HB3    . GLU A 1 431 ? 24.707  -42.625 98.941  1.00 62.38  ? 431 GLU A HB3    1 
ATOM   7178  H HG2    . GLU A 1 431 ? 26.861  -41.709 98.736  1.00 71.56  ? 431 GLU A HG2    1 
ATOM   7179  H HG3    . GLU A 1 431 ? 26.036  -41.018 99.906  1.00 71.56  ? 431 GLU A HG3    1 
ATOM   7180  N N      . MET A 1 432 ? 23.244  -41.566 101.290 1.00 55.11  ? 432 MET A N      1 
ATOM   7181  C CA     . MET A 1 432 ? 22.746  -40.360 101.911 1.00 51.44  ? 432 MET A CA     1 
ATOM   7182  C C      . MET A 1 432 ? 22.580  -40.529 103.418 1.00 45.51  ? 432 MET A C      1 
ATOM   7183  O O      . MET A 1 432 ? 23.015  -39.685 104.205 1.00 45.10  ? 432 MET A O      1 
ATOM   7184  C CB     . MET A 1 432 ? 21.415  -39.987 101.291 1.00 47.49  ? 432 MET A CB     1 
ATOM   7185  C CG     . MET A 1 432 ? 20.997  -38.599 101.608 1.00 48.03  ? 432 MET A CG     1 
ATOM   7186  S SD     . MET A 1 432 ? 19.599  -38.154 100.608 1.00 65.40  ? 432 MET A SD     1 
ATOM   7187  C CE     . MET A 1 432 ? 18.386  -39.313 101.253 1.00 56.49  ? 432 MET A CE     1 
ATOM   7188  H H      . MET A 1 432 ? 22.711  -41.911 100.710 1.00 66.53  ? 432 MET A H      1 
ATOM   7189  H HA     . MET A 1 432 ? 23.370  -39.637 101.741 1.00 62.12  ? 432 MET A HA     1 
ATOM   7190  H HB2    . MET A 1 432 ? 21.484  -40.066 100.326 1.00 57.38  ? 432 MET A HB2    1 
ATOM   7191  H HB3    . MET A 1 432 ? 20.732  -40.590 101.624 1.00 57.38  ? 432 MET A HB3    1 
ATOM   7192  H HG2    . MET A 1 432 ? 20.741  -38.542 102.542 1.00 58.03  ? 432 MET A HG2    1 
ATOM   7193  H HG3    . MET A 1 432 ? 21.724  -37.987 101.414 1.00 58.03  ? 432 MET A HG3    1 
ATOM   7194  H HE1    . MET A 1 432 ? 17.546  -39.183 100.786 1.00 68.17  ? 432 MET A HE1    1 
ATOM   7195  H HE2    . MET A 1 432 ? 18.707  -40.217 101.111 1.00 68.17  ? 432 MET A HE2    1 
ATOM   7196  H HE3    . MET A 1 432 ? 18.267  -39.149 102.201 1.00 68.17  ? 432 MET A HE3    1 
ATOM   7197  N N      . MET A 1 433 ? 21.982  -41.646 103.811 1.00 36.66  ? 433 MET A N      1 
ATOM   7198  C CA     . MET A 1 433 ? 21.729  -41.898 105.211 1.00 31.79  ? 433 MET A CA     1 
ATOM   7199  C C      . MET A 1 433 ? 22.937  -42.494 105.889 1.00 32.07  ? 433 MET A C      1 
ATOM   7200  O O      . MET A 1 433 ? 23.040  -42.435 107.106 1.00 32.33  ? 433 MET A O      1 
ATOM   7201  C CB     . MET A 1 433 ? 20.521  -42.818 105.371 1.00 32.04  ? 433 MET A CB     1 
ATOM   7202  C CG     . MET A 1 433 ? 19.217  -42.194 104.867 1.00 32.64  ? 433 MET A CG     1 
ATOM   7203  S SD     . MET A 1 433 ? 17.767  -43.271 104.942 1.00 43.47  ? 433 MET A SD     1 
ATOM   7204  C CE     . MET A 1 433 ? 16.729  -42.461 103.724 1.00 52.05  ? 433 MET A CE     1 
ATOM   7205  H H      . MET A 1 433 ? 21.715  -42.271 103.284 1.00 44.38  ? 433 MET A H      1 
ATOM   7206  H HA     . MET A 1 433 ? 21.516  -41.057 105.643 1.00 38.53  ? 433 MET A HA     1 
ATOM   7207  H HB2    . MET A 1 433 ? 20.676  -43.632 104.867 1.00 38.84  ? 433 MET A HB2    1 
ATOM   7208  H HB3    . MET A 1 433 ? 20.408  -43.028 106.311 1.00 38.84  ? 433 MET A HB3    1 
ATOM   7209  H HG2    . MET A 1 433 ? 19.025  -41.409 105.403 1.00 39.55  ? 433 MET A HG2    1 
ATOM   7210  H HG3    . MET A 1 433 ? 19.339  -41.933 103.941 1.00 39.55  ? 433 MET A HG3    1 
ATOM   7211  H HE1    . MET A 1 433 ? 15.890  -42.943 103.653 1.00 62.85  ? 433 MET A HE1    1 
ATOM   7212  H HE2    . MET A 1 433 ? 16.564  -41.548 104.007 1.00 62.85  ? 433 MET A HE2    1 
ATOM   7213  H HE3    . MET A 1 433 ? 17.186  -42.465 102.868 1.00 62.85  ? 433 MET A HE3    1 
ATOM   7214  N N      . GLY A 1 434 ? 23.881  -43.019 105.116 1.00 35.21  ? 434 GLY A N      1 
ATOM   7215  C CA     . GLY A 1 434 ? 25.047  -43.654 105.715 1.00 34.79  ? 434 GLY A CA     1 
ATOM   7216  C C      . GLY A 1 434 ? 24.680  -44.988 106.333 1.00 36.05  ? 434 GLY A C      1 
ATOM   7217  O O      . GLY A 1 434 ? 24.911  -45.222 107.524 1.00 32.65  ? 434 GLY A O      1 
ATOM   7218  H H      . GLY A 1 434 ? 23.872  -43.021 104.256 1.00 42.64  ? 434 GLY A H      1 
ATOM   7219  H HA2    . GLY A 1 434 ? 25.725  -43.800 105.037 1.00 42.14  ? 434 GLY A HA2    1 
ATOM   7220  H HA3    . GLY A 1 434 ? 25.414  -43.080 106.406 1.00 42.14  ? 434 GLY A HA3    1 
ATOM   7221  N N      . VAL A 1 435 ? 24.037  -45.830 105.528 1.00 41.53  ? 435 VAL A N      1 
ATOM   7222  C CA     . VAL A 1 435 ? 23.576  -47.151 105.960 1.00 47.45  ? 435 VAL A CA     1 
ATOM   7223  C C      . VAL A 1 435 ? 24.711  -48.167 105.977 1.00 53.07  ? 435 VAL A C      1 
ATOM   7224  O O      . VAL A 1 435 ? 25.483  -48.219 105.022 1.00 59.57  ? 435 VAL A O      1 
ATOM   7225  C CB     . VAL A 1 435 ? 22.462  -47.684 105.020 1.00 43.31  ? 435 VAL A CB     1 
ATOM   7226  C CG1    . VAL A 1 435 ? 22.006  -49.096 105.439 1.00 42.43  ? 435 VAL A CG1    1 
ATOM   7227  C CG2    . VAL A 1 435 ? 21.279  -46.724 104.996 1.00 42.71  ? 435 VAL A CG2    1 
ATOM   7228  H H      . VAL A 1 435 ? 23.852  -45.656 104.706 1.00 50.23  ? 435 VAL A H      1 
ATOM   7229  H HA     . VAL A 1 435 ? 23.213  -47.086 106.857 1.00 57.33  ? 435 VAL A HA     1 
ATOM   7230  H HB     . VAL A 1 435 ? 22.814  -47.742 104.118 1.00 52.37  ? 435 VAL A HB     1 
ATOM   7231  H HG11   . VAL A 1 435 ? 21.311  -49.396 104.832 1.00 51.31  ? 435 VAL A HG11   1 
ATOM   7232  H HG12   . VAL A 1 435 ? 22.765  -49.698 105.397 1.00 51.31  ? 435 VAL A HG12   1 
ATOM   7233  H HG13   . VAL A 1 435 ? 21.661  -49.060 106.345 1.00 51.31  ? 435 VAL A HG13   1 
ATOM   7234  H HG21   . VAL A 1 435 ? 20.598  -47.078 104.404 1.00 51.64  ? 435 VAL A HG21   1 
ATOM   7235  H HG22   . VAL A 1 435 ? 20.924  -46.639 105.895 1.00 51.64  ? 435 VAL A HG22   1 
ATOM   7236  H HG23   . VAL A 1 435 ? 21.581  -45.860 104.676 1.00 51.64  ? 435 VAL A HG23   1 
ATOM   7237  N N      . LYS A 1 436 ? 24.820  -48.962 107.046 1.00 51.10  ? 436 LYS A N      1 
ATOM   7238  C CA     . LYS A 1 436 ? 25.865  -49.992 107.120 1.00 50.75  ? 436 LYS A CA     1 
ATOM   7239  C C      . LYS A 1 436 ? 25.405  -51.411 106.694 1.00 63.38  ? 436 LYS A C      1 
ATOM   7240  O O      . LYS A 1 436 ? 24.240  -51.628 106.361 1.00 62.49  ? 436 LYS A O      1 
ATOM   7241  C CB     . LYS A 1 436 ? 26.464  -50.036 108.526 1.00 46.37  ? 436 LYS A CB     1 
ATOM   7242  C CG     . LYS A 1 436 ? 27.023  -48.681 108.967 1.00 44.69  ? 436 LYS A CG     1 
ATOM   7243  C CD     . LYS A 1 436 ? 28.331  -48.806 109.751 1.00 45.44  ? 436 LYS A CD     1 
ATOM   7244  C CE     . LYS A 1 436 ? 29.471  -49.169 108.768 1.00 48.91  ? 436 LYS A CE     1 
ATOM   7245  N NZ     . LYS A 1 436 ? 30.833  -49.184 109.363 1.00 50.55  ? 436 LYS A NZ     1 
ATOM   7246  H H      . LYS A 1 436 ? 24.308  -48.926 107.736 1.00 61.71  ? 436 LYS A H      1 
ATOM   7247  H HA     . LYS A 1 436 ? 26.579  -49.735 106.516 1.00 61.29  ? 436 LYS A HA     1 
ATOM   7248  H HB2    . LYS A 1 436 ? 25.774  -50.296 109.157 1.00 56.04  ? 436 LYS A HB2    1 
ATOM   7249  H HB3    . LYS A 1 436 ? 27.189  -50.680 108.542 1.00 56.04  ? 436 LYS A HB3    1 
ATOM   7250  H HG2    . LYS A 1 436 ? 27.195  -48.139 108.180 1.00 54.02  ? 436 LYS A HG2    1 
ATOM   7251  H HG3    . LYS A 1 436 ? 26.373  -48.241 109.537 1.00 54.02  ? 436 LYS A HG3    1 
ATOM   7252  H HD2    . LYS A 1 436 ? 28.542  -47.959 110.175 1.00 54.92  ? 436 LYS A HD2    1 
ATOM   7253  H HD3    . LYS A 1 436 ? 28.252  -49.511 110.412 1.00 54.92  ? 436 LYS A HD3    1 
ATOM   7254  H HE2    . LYS A 1 436 ? 29.299  -50.054 108.410 1.00 59.08  ? 436 LYS A HE2    1 
ATOM   7255  H HE3    . LYS A 1 436 ? 29.474  -48.521 108.047 1.00 59.08  ? 436 LYS A HE3    1 
ATOM   7256  H HZ1    . LYS A 1 436 ? 31.433  -49.400 108.742 1.00 61.05  ? 436 LYS A HZ1    1 
ATOM   7257  H HZ2    . LYS A 1 436 ? 31.031  -48.380 109.689 1.00 61.05  ? 436 LYS A HZ2    1 
ATOM   7258  H HZ3    . LYS A 1 436 ? 30.871  -49.782 110.021 1.00 61.05  ? 436 LYS A HZ3    1 
ATOM   7259  N N      . ASP A 1 437 ? 26.340  -52.365 106.713 1.00 73.18  ? 437 ASP A N      1 
ATOM   7260  C CA     . ASP A 1 437 ? 26.098  -53.731 106.234 1.00 81.89  ? 437 ASP A CA     1 
ATOM   7261  C C      . ASP A 1 437 ? 25.010  -54.441 107.036 1.00 82.84  ? 437 ASP A C      1 
ATOM   7262  O O      . ASP A 1 437 ? 24.723  -55.618 106.799 1.00 81.59  ? 437 ASP A O      1 
ATOM   7263  C CB     . ASP A 1 437 ? 27.393  -54.561 106.286 1.00 87.94  ? 437 ASP A CB     1 
ATOM   7264  C CG     . ASP A 1 437 ? 28.555  -53.902 105.545 1.00 90.43  ? 437 ASP A CG     1 
ATOM   7265  O OD1    . ASP A 1 437 ? 28.300  -53.089 104.634 1.00 91.09  ? 437 ASP A OD1    1 
ATOM   7266  O OD2    . ASP A 1 437 ? 29.727  -54.197 105.879 1.00 89.26  ? 437 ASP A OD2    1 
ATOM   7267  H H      . ASP A 1 437 ? 27.140  -52.243 107.005 1.00 88.20  ? 437 ASP A H      1 
ATOM   7268  H HA     . ASP A 1 437 ? 25.808  -53.691 105.309 1.00 98.65  ? 437 ASP A HA     1 
ATOM   7269  H HB2    . ASP A 1 437 ? 27.656  -54.676 107.212 1.00 105.92 ? 437 ASP A HB2    1 
ATOM   7270  H HB3    . ASP A 1 437 ? 27.230  -55.425 105.878 1.00 105.92 ? 437 ASP A HB3    1 
ATOM   7271  P P      . G   B 2 1   ? 24.044  -23.197 70.861  1.00 108.21 ? 1   G   B P      1 
ATOM   7272  O OP1    . G   B 2 1   ? 25.362  -22.690 70.407  1.00 109.31 ? 1   G   B OP1    1 
ATOM   7273  O OP2    . G   B 2 1   ? 23.244  -24.036 69.929  1.00 108.42 ? 1   G   B OP2    1 
ATOM   7274  O "O5'"  . G   B 2 1   ? 24.333  -24.057 72.172  1.00 98.61  ? 1   G   B "O5'"  1 
ATOM   7275  C "C5'"  . G   B 2 1   ? 24.151  -23.504 73.469  1.00 99.86  ? 1   G   B "C5'"  1 
ATOM   7276  C "C4'"  . G   B 2 1   ? 24.238  -24.560 74.544  1.00 96.43  ? 1   G   B "C4'"  1 
ATOM   7277  O "O4'"  . G   B 2 1   ? 25.547  -25.196 74.503  1.00 95.10  ? 1   G   B "O4'"  1 
ATOM   7278  C "C3'"  . G   B 2 1   ? 24.116  -24.070 75.982  1.00 95.01  ? 1   G   B "C3'"  1 
ATOM   7279  O "O3'"  . G   B 2 1   ? 22.768  -23.829 76.410  1.00 88.59  ? 1   G   B "O3'"  1 
ATOM   7280  C "C2'"  . G   B 2 1   ? 24.819  -25.172 76.758  1.00 98.44  ? 1   G   B "C2'"  1 
ATOM   7281  O "O2'"  . G   B 2 1   ? 23.983  -26.314 76.890  1.00 105.57 ? 1   G   B "O2'"  1 
ATOM   7282  C "C1'"  . G   B 2 1   ? 25.973  -25.506 75.815  1.00 93.47  ? 1   G   B "C1'"  1 
ATOM   7283  N N9     . G   B 2 1   ? 27.167  -24.697 76.122  1.00 94.13  ? 1   G   B N9     1 
ATOM   7284  C C8     . G   B 2 1   ? 27.499  -23.490 75.552  1.00 99.42  ? 1   G   B C8     1 
ATOM   7285  N N7     . G   B 2 1   ? 28.609  -22.987 76.017  1.00 98.71  ? 1   G   B N7     1 
ATOM   7286  C C5     . G   B 2 1   ? 29.034  -23.914 76.959  1.00 90.24  ? 1   G   B C5     1 
ATOM   7287  C C6     . G   B 2 1   ? 30.183  -23.903 77.786  1.00 76.57  ? 1   G   B C6     1 
ATOM   7288  O O6     . G   B 2 1   ? 31.071  -23.046 77.855  1.00 73.64  ? 1   G   B O6     1 
ATOM   7289  N N1     . G   B 2 1   ? 30.234  -25.030 78.598  1.00 69.21  ? 1   G   B N1     1 
ATOM   7290  C C2     . G   B 2 1   ? 29.306  -26.041 78.606  1.00 68.22  ? 1   G   B C2     1 
ATOM   7291  N N2     . G   B 2 1   ? 29.538  -27.042 79.466  1.00 59.66  ? 1   G   B N2     1 
ATOM   7292  N N3     . G   B 2 1   ? 28.228  -26.067 77.837  1.00 78.72  ? 1   G   B N3     1 
ATOM   7293  C C4     . G   B 2 1   ? 28.154  -24.977 77.042  1.00 89.29  ? 1   G   B C4     1 
ATOM   7294  H "H5'"  . G   B 2 1   ? 23.280  -23.079 73.512  1.00 120.22 ? 1   G   B "H5'"  1 
ATOM   7295  H "H5''" . G   B 2 1   ? 24.836  -22.835 73.626  1.00 120.22 ? 1   G   B "H5''" 1 
ATOM   7296  H "H4'"  . G   B 2 1   ? 23.557  -25.231 74.381  1.00 116.10 ? 1   G   B "H4'"  1 
ATOM   7297  H "H3'"  . G   B 2 1   ? 24.624  -23.249 76.077  1.00 114.40 ? 1   G   B "H3'"  1 
ATOM   7298  H "H2'"  . G   B 2 1   ? 25.140  -24.857 77.617  1.00 118.51 ? 1   G   B "H2'"  1 
ATOM   7299  H "HO2'" . G   B 2 1   ? 23.180  -26.069 76.876  1.00 127.08 ? 1   G   B "HO2'" 1 
ATOM   7300  H "H1'"  . G   B 2 1   ? 26.188  -26.449 75.878  1.00 112.56 ? 1   G   B "H1'"  1 
ATOM   7301  H H8     . G   B 2 1   ? 26.987  -23.078 74.894  1.00 119.70 ? 1   G   B H8     1 
ATOM   7302  H H1     . G   B 2 1   ? 30.903  -25.102 79.133  1.00 83.45  ? 1   G   B H1     1 
ATOM   7303  H H21    . G   B 2 1   ? 30.237  -27.027 79.966  1.00 71.98  ? 1   G   B H21    1 
ATOM   7304  H H22    . G   B 2 1   ? 28.987  -27.701 79.518  1.00 71.98  ? 1   G   B H22    1 
ATOM   7305  P P      . G   B 2 2   ? 22.459  -22.681 77.509  1.00 81.25  ? 2   G   B P      1 
ATOM   7306  O OP1    . G   B 2 2   ? 21.066  -22.234 77.656  1.00 68.07  ? 2   G   B OP1    1 
ATOM   7307  O OP2    . G   B 2 2   ? 23.420  -21.620 77.102  1.00 77.84  ? 2   G   B OP2    1 
ATOM   7308  O "O5'"  . G   B 2 2   ? 22.961  -23.311 78.894  1.00 73.32  ? 2   G   B "O5'"  1 
ATOM   7309  C "C5'"  . G   B 2 2   ? 22.334  -24.453 79.470  1.00 67.47  ? 2   G   B "C5'"  1 
ATOM   7310  C "C4'"  . G   B 2 2   ? 23.228  -25.176 80.459  1.00 59.89  ? 2   G   B "C4'"  1 
ATOM   7311  O "O4'"  . G   B 2 2   ? 24.479  -25.561 79.828  1.00 59.45  ? 2   G   B "O4'"  1 
ATOM   7312  C "C3'"  . G   B 2 2   ? 23.671  -24.404 81.692  1.00 59.56  ? 2   G   B "C3'"  1 
ATOM   7313  O "O3'"  . G   B 2 2   ? 22.675  -24.309 82.700  1.00 59.16  ? 2   G   B "O3'"  1 
ATOM   7314  C "C2'"  . G   B 2 2   ? 24.910  -25.181 82.122  1.00 63.30  ? 2   G   B "C2'"  1 
ATOM   7315  O "O2'"  . G   B 2 2   ? 24.582  -26.395 82.779  1.00 64.12  ? 2   G   B "O2'"  1 
ATOM   7316  C "C1'"  . G   B 2 2   ? 25.528  -25.510 80.772  1.00 58.21  ? 2   G   B "C1'"  1 
ATOM   7317  N N9     . G   B 2 2   ? 26.464  -24.449 80.387  1.00 59.75  ? 2   G   B N9     1 
ATOM   7318  C C8     . G   B 2 2   ? 26.252  -23.418 79.517  1.00 62.18  ? 2   G   B C8     1 
ATOM   7319  N N7     . G   B 2 2   ? 27.275  -22.619 79.414  1.00 63.21  ? 2   G   B N7     1 
ATOM   7320  C C5     . G   B 2 2   ? 28.212  -23.143 80.291  1.00 61.32  ? 2   G   B C5     1 
ATOM   7321  C C6     . G   B 2 2   ? 29.525  -22.701 80.608  1.00 61.46  ? 2   G   B C6     1 
ATOM   7322  O O6     . G   B 2 2   ? 30.152  -21.720 80.177  1.00 63.35  ? 2   G   B O6     1 
ATOM   7323  N N1     . G   B 2 2   ? 30.116  -23.537 81.546  1.00 59.60  ? 2   G   B N1     1 
ATOM   7324  C C2     . G   B 2 2   ? 29.532  -24.650 82.103  1.00 58.95  ? 2   G   B C2     1 
ATOM   7325  N N2     . G   B 2 2   ? 30.292  -25.310 82.995  1.00 57.05  ? 2   G   B N2     1 
ATOM   7326  N N3     . G   B 2 2   ? 28.307  -25.073 81.818  1.00 57.81  ? 2   G   B N3     1 
ATOM   7327  C C4     . G   B 2 2   ? 27.716  -24.272 80.908  1.00 59.17  ? 2   G   B C4     1 
ATOM   7328  H "H5'"  . G   B 2 2   ? 22.092  -25.068 78.760  1.00 81.36  ? 2   G   B "H5'"  1 
ATOM   7329  H "H5''" . G   B 2 2   ? 21.527  -24.170 79.928  1.00 81.36  ? 2   G   B "H5''" 1 
ATOM   7330  H "H4'"  . G   B 2 2   ? 22.772  -25.981 80.750  1.00 69.91  ? 2   G   B "H4'"  1 
ATOM   7331  H "H3'"  . G   B 2 2   ? 23.936  -23.510 81.426  1.00 69.52  ? 2   G   B "H3'"  1 
ATOM   7332  H "H2'"  . G   B 2 2   ? 25.504  -24.632 82.658  1.00 76.35  ? 2   G   B "H2'"  1 
ATOM   7333  H "HO2'" . G   B 2 2   ? 23.824  -26.318 83.133  1.00 77.34  ? 2   G   B "HO2'" 1 
ATOM   7334  H "H1'"  . G   B 2 2   ? 25.987  -26.364 80.812  1.00 67.90  ? 2   G   B "H1'"  1 
ATOM   7335  H H8     . G   B 2 2   ? 25.465  -23.308 79.035  1.00 72.66  ? 2   G   B H8     1 
ATOM   7336  H H1     . G   B 2 2   ? 30.915  -23.343 81.799  1.00 71.91  ? 2   G   B H1     1 
ATOM   7337  H H21    . G   B 2 2   ? 31.085  -25.031 83.174  1.00 68.85  ? 2   G   B H21    1 
ATOM   7338  H H22    . G   B 2 2   ? 29.984  -26.012 83.386  1.00 68.85  ? 2   G   B H22    1 
ATOM   7339  P P      . C   B 2 3   ? 22.652  -23.060 83.722  1.00 59.92  ? 3   C   B P      1 
ATOM   7340  O OP1    . C   B 2 3   ? 21.427  -23.176 84.552  1.00 59.51  ? 3   C   B OP1    1 
ATOM   7341  O OP2    . C   B 2 3   ? 22.937  -21.818 82.955  1.00 62.22  ? 3   C   B OP2    1 
ATOM   7342  O "O5'"  . C   B 2 3   ? 23.856  -23.341 84.731  1.00 58.60  ? 3   C   B "O5'"  1 
ATOM   7343  C "C5'"  . C   B 2 3   ? 23.811  -24.437 85.637  1.00 56.15  ? 3   C   B "C5'"  1 
ATOM   7344  C "C4'"  . C   B 2 3   ? 25.167  -24.739 86.231  1.00 54.93  ? 3   C   B "C4'"  1 
ATOM   7345  O "O4'"  . C   B 2 3   ? 26.151  -24.883 85.172  1.00 55.23  ? 3   C   B "O4'"  1 
ATOM   7346  C "C3'"  . C   B 2 3   ? 25.755  -23.672 87.144  1.00 55.59  ? 3   C   B "C3'"  1 
ATOM   7347  O "O3'"  . C   B 2 3   ? 25.247  -23.737 88.463  1.00 54.77  ? 3   C   B "O3'"  1 
ATOM   7348  C "C2'"  . C   B 2 3   ? 27.250  -23.944 87.055  1.00 55.00  ? 3   C   B "C2'"  1 
ATOM   7349  O "O2'"  . C   B 2 3   ? 27.627  -25.024 87.893  1.00 52.99  ? 3   C   B "O2'"  1 
ATOM   7350  C "C1'"  . C   B 2 3   ? 27.397  -24.375 85.597  1.00 55.35  ? 3   C   B "C1'"  1 
ATOM   7351  N N1     . C   B 2 3   ? 27.771  -23.244 84.719  1.00 59.99  ? 3   C   B N1     1 
ATOM   7352  C C2     . C   B 2 3   ? 29.110  -22.835 84.661  1.00 65.55  ? 3   C   B C2     1 
ATOM   7353  O O2     . C   B 2 3   ? 29.964  -23.426 85.341  1.00 67.85  ? 3   C   B O2     1 
ATOM   7354  N N3     . C   B 2 3   ? 29.449  -21.801 83.851  1.00 67.03  ? 3   C   B N3     1 
ATOM   7355  C C4     . C   B 2 3   ? 28.515  -21.175 83.127  1.00 64.80  ? 3   C   B C4     1 
ATOM   7356  N N4     . C   B 2 3   ? 28.900  -20.163 82.343  1.00 65.77  ? 3   C   B N4     1 
ATOM   7357  C C5     . C   B 2 3   ? 27.146  -21.571 83.172  1.00 61.32  ? 3   C   B C5     1 
ATOM   7358  C C6     . C   B 2 3   ? 26.823  -22.595 83.974  1.00 59.20  ? 3   C   B C6     1 
ATOM   7359  H "H5'"  . C   B 2 3   ? 23.493  -25.223 85.164  1.00 66.16  ? 3   C   B "H5'"  1 
ATOM   7360  H "H5''" . C   B 2 3   ? 23.192  -24.228 86.354  1.00 66.16  ? 3   C   B "H5''" 1 
ATOM   7361  H "H4'"  . C   B 2 3   ? 25.113  -25.574 86.723  1.00 64.20  ? 3   C   B "H4'"  1 
ATOM   7362  H "H3'"  . C   B 2 3   ? 25.568  -22.796 86.772  1.00 64.75  ? 3   C   B "H3'"  1 
ATOM   7363  H "H2'"  . C   B 2 3   ? 27.769  -23.146 87.242  1.00 64.05  ? 3   C   B "H2'"  1 
ATOM   7364  H "HO2'" . C   B 2 3   ? 27.547  -24.789 88.695  1.00 61.63  ? 3   C   B "HO2'" 1 
ATOM   7365  H "H1'"  . C   B 2 3   ? 28.069  -25.071 85.532  1.00 65.02  ? 3   C   B "H1'"  1 
ATOM   7366  H H41    . C   B 2 3   ? 28.319  -19.743 81.867  1.00 79.32  ? 3   C   B H41    1 
ATOM   7367  H H42    . C   B 2 3   ? 29.728  -19.932 82.315  1.00 79.32  ? 3   C   B H42    1 
ATOM   7368  H H5     . C   B 2 3   ? 26.501  -21.135 82.664  1.00 72.94  ? 3   C   B H5     1 
ATOM   7369  H H6     . C   B 2 3   ? 25.938  -22.875 84.020  1.00 70.59  ? 3   C   B H6     1 
ATOM   7370  P P      . C   B 2 4   ? 24.790  -22.397 89.223  1.00 56.16  ? 4   C   B P      1 
ATOM   7371  O OP1    . C   B 2 4   ? 24.177  -22.800 90.513  1.00 55.02  ? 4   C   B OP1    1 
ATOM   7372  O OP2    . C   B 2 4   ? 24.065  -21.521 88.272  1.00 58.08  ? 4   C   B OP2    1 
ATOM   7373  O "O5'"  . C   B 2 4   ? 26.152  -21.661 89.566  1.00 56.77  ? 4   C   B "O5'"  1 
ATOM   7374  C "C5'"  . C   B 2 4   ? 27.149  -22.307 90.337  1.00 55.38  ? 4   C   B "C5'"  1 
ATOM   7375  C "C4'"  . C   B 2 4   ? 28.492  -21.636 90.189  1.00 56.33  ? 4   C   B "C4'"  1 
ATOM   7376  O "O4'"  . C   B 2 4   ? 28.943  -21.687 88.808  1.00 56.99  ? 4   C   B "O4'"  1 
ATOM   7377  C "C3'"  . C   B 2 4   ? 28.546  -20.157 90.512  1.00 58.31  ? 4   C   B "C3'"  1 
ATOM   7378  O "O3'"  . C   B 2 4   ? 28.510  -19.880 91.901  1.00 60.40  ? 4   C   B "O3'"  1 
ATOM   7379  C "C2'"  . C   B 2 4   ? 29.833  -19.735 89.818  1.00 59.37  ? 4   C   B "C2'"  1 
ATOM   7380  O "O2'"  . C   B 2 4   ? 30.969  -20.174 90.545  1.00 58.45  ? 4   C   B "O2'"  1 
ATOM   7381  C "C1'"  . C   B 2 4   ? 29.766  -20.567 88.543  1.00 58.81  ? 4   C   B "C1'"  1 
ATOM   7382  N N1     . C   B 2 4   ? 29.243  -19.815 87.379  1.00 60.67  ? 4   C   B N1     1 
ATOM   7383  C C2     . C   B 2 4   ? 30.070  -18.825 86.825  1.00 62.90  ? 4   C   B C2     1 
ATOM   7384  O O2     . C   B 2 4   ? 31.176  -18.589 87.339  1.00 62.77  ? 4   C   B O2     1 
ATOM   7385  N N3     . C   B 2 4   ? 29.654  -18.128 85.742  1.00 65.48  ? 4   C   B N3     1 
ATOM   7386  C C4     . C   B 2 4   ? 28.467  -18.393 85.199  1.00 64.50  ? 4   C   B C4     1 
ATOM   7387  N N4     . C   B 2 4   ? 28.110  -17.673 84.129  1.00 66.58  ? 4   C   B N4     1 
ATOM   7388  C C5     . C   B 2 4   ? 27.609  -19.404 85.737  1.00 62.51  ? 4   C   B C5     1 
ATOM   7389  C C6     . C   B 2 4   ? 28.033  -20.091 86.810  1.00 60.65  ? 4   C   B C6     1 
ATOM   7390  H "H5'"  . C   B 2 4   ? 27.224  -23.230 90.048  1.00 64.50  ? 4   C   B "H5'"  1 
ATOM   7391  H "H5''" . C   B 2 4   ? 26.888  -22.289 91.271  1.00 64.50  ? 4   C   B "H5''" 1 
ATOM   7392  H "H4'"  . C   B 2 4   ? 29.136  -22.101 90.745  1.00 65.65  ? 4   C   B "H4'"  1 
ATOM   7393  H "H3'"  . C   B 2 4   ? 27.798  -19.714 90.083  1.00 70.32  ? 4   C   B "H3'"  1 
ATOM   7394  H "H2'"  . C   B 2 4   ? 29.856  -18.783 89.633  1.00 69.30  ? 4   C   B "H2'"  1 
ATOM   7395  H "HO2'" . C   B 2 4   ? 31.028  -19.729 91.255  1.00 68.19  ? 4   C   B "HO2'" 1 
ATOM   7396  H "H1'"  . C   B 2 4   ? 30.658  -20.882 88.331  1.00 68.62  ? 4   C   B "H1'"  1 
ATOM   7397  H H41    . C   B 2 4   ? 27.352  -17.813 83.750  1.00 77.94  ? 4   C   B H41    1 
ATOM   7398  H H42    . C   B 2 4   ? 28.640  -17.069 83.821  1.00 77.94  ? 4   C   B H42    1 
ATOM   7399  H H5     . C   B 2 4   ? 26.782  -19.583 85.352  1.00 73.06  ? 4   C   B H5     1 
ATOM   7400  H H6     . C   B 2 4   ? 27.494  -20.755 87.174  1.00 70.83  ? 4   C   B H6     1 
ATOM   7401  P P      . G   B 2 5   ? 27.837  -18.517 92.426  1.00 76.16  ? 5   G   B P      1 
ATOM   7402  O OP1    . G   B 2 5   ? 27.821  -18.553 93.912  1.00 74.66  ? 5   G   B OP1    1 
ATOM   7403  O OP2    . G   B 2 5   ? 26.580  -18.287 91.667  1.00 72.10  ? 5   G   B OP2    1 
ATOM   7404  O "O5'"  . G   B 2 5   ? 28.874  -17.394 91.991  1.00 61.77  ? 5   G   B "O5'"  1 
ATOM   7405  C "C5'"  . G   B 2 5   ? 30.198  -17.394 92.497  1.00 61.75  ? 5   G   B "C5'"  1 
ATOM   7406  C "C4'"  . G   B 2 5   ? 30.993  -16.263 91.909  1.00 64.01  ? 5   G   B "C4'"  1 
ATOM   7407  O "O4'"  . G   B 2 5   ? 31.117  -16.439 90.478  1.00 65.76  ? 5   G   B "O4'"  1 
ATOM   7408  C "C3'"  . G   B 2 5   ? 30.358  -14.896 92.061  1.00 69.89  ? 5   G   B "C3'"  1 
ATOM   7409  O "O3'"  . G   B 2 5   ? 30.593  -14.345 93.340  1.00 73.98  ? 5   G   B "O3'"  1 
ATOM   7410  C "C2'"  . G   B 2 5   ? 30.964  -14.104 90.909  1.00 68.92  ? 5   G   B "C2'"  1 
ATOM   7411  O "O2'"  . G   B 2 5   ? 32.247  -13.590 91.244  1.00 69.26  ? 5   G   B "O2'"  1 
ATOM   7412  C "C1'"  . G   B 2 5   ? 31.108  -15.183 89.831  1.00 70.53  ? 5   G   B "C1'"  1 
ATOM   7413  N N9     . G   B 2 5   ? 29.998  -15.168 88.850  1.00 75.79  ? 5   G   B N9     1 
ATOM   7414  C C8     . G   B 2 5   ? 28.826  -15.889 88.926  1.00 76.04  ? 5   G   B C8     1 
ATOM   7415  N N7     . G   B 2 5   ? 28.024  -15.681 87.914  1.00 77.04  ? 5   G   B N7     1 
ATOM   7416  C C5     . G   B 2 5   ? 28.704  -14.769 87.110  1.00 78.02  ? 5   G   B C5     1 
ATOM   7417  C C6     . G   B 2 5   ? 28.337  -14.164 85.872  1.00 75.82  ? 5   G   B C6     1 
ATOM   7418  O O6     . G   B 2 5   ? 27.305  -14.310 85.206  1.00 73.55  ? 5   G   B O6     1 
ATOM   7419  N N1     . G   B 2 5   ? 29.318  -13.301 85.403  1.00 77.92  ? 5   G   B N1     1 
ATOM   7420  C C2     . G   B 2 5   ? 30.507  -13.041 86.036  1.00 79.87  ? 5   G   B C2     1 
ATOM   7421  N N2     . G   B 2 5   ? 31.328  -12.172 85.419  1.00 78.53  ? 5   G   B N2     1 
ATOM   7422  N N3     . G   B 2 5   ? 30.860  -13.595 87.189  1.00 82.20  ? 5   G   B N3     1 
ATOM   7423  C C4     . G   B 2 5   ? 29.924  -14.444 87.673  1.00 79.11  ? 5   G   B C4     1 
ATOM   7424  H "H5'"  . G   B 2 5   ? 30.626  -18.236 92.273  1.00 72.15  ? 5   G   B "H5'"  1 
ATOM   7425  H "H5''" . G   B 2 5   ? 30.171  -17.298 93.462  1.00 72.15  ? 5   G   B "H5''" 1 
ATOM   7426  H "H4'"  . G   B 2 5   ? 31.877  -16.251 92.308  1.00 76.96  ? 5   G   B "H4'"  1 
ATOM   7427  H "H3'"  . G   B 2 5   ? 29.401  -14.975 91.922  1.00 84.26  ? 5   G   B "H3'"  1 
ATOM   7428  H "H2'"  . G   B 2 5   ? 30.367  -13.398 90.617  1.00 83.10  ? 5   G   B "H2'"  1 
ATOM   7429  H "HO2'" . G   B 2 5   ? 32.371  -13.681 92.070  1.00 81.84  ? 5   G   B "HO2'" 1 
ATOM   7430  H "H1'"  . G   B 2 5   ? 31.949  -15.059 89.364  1.00 85.03  ? 5   G   B "H1'"  1 
ATOM   7431  H H8     . G   B 2 5   ? 28.623  -16.463 89.629  1.00 91.64  ? 5   G   B H8     1 
ATOM   7432  H H1     . G   B 2 5   ? 29.169  -12.897 84.658  1.00 93.89  ? 5   G   B H1     1 
ATOM   7433  H H21    . G   B 2 5   ? 31.094  -11.815 84.672  1.00 94.63  ? 5   G   B H21    1 
ATOM   7434  H H22    . G   B 2 5   ? 32.087  -11.972 85.772  1.00 94.63  ? 5   G   B H22    1 
ATOM   7435  P P      . C   B 2 6   ? 29.541  -13.323 93.985  1.00 94.82  ? 6   C   B P      1 
ATOM   7436  O OP1    . C   B 2 6   ? 29.724  -13.369 95.460  1.00 93.22  ? 6   C   B OP1    1 
ATOM   7437  O OP2    . C   B 2 6   ? 28.181  -13.599 93.439  1.00 90.19  ? 6   C   B OP2    1 
ATOM   7438  O "O5'"  . C   B 2 6   ? 30.068  -11.918 93.455  1.00 107.68 ? 6   C   B "O5'"  1 
ATOM   7439  C "C5'"  . C   B 2 6   ? 29.251  -11.089 92.647  1.00 108.70 ? 6   C   B "C5'"  1 
ATOM   7440  C "C4'"  . C   B 2 6   ? 30.055  -10.344 91.615  1.00 107.02 ? 6   C   B "C4'"  1 
ATOM   7441  O "O4'"  . C   B 2 6   ? 30.238  -11.181 90.438  1.00 100.14 ? 6   C   B "O4'"  1 
ATOM   7442  C "C3'"  . C   B 2 6   ? 29.394  -9.085  91.077  1.00 112.64 ? 6   C   B "C3'"  1 
ATOM   7443  O "O3'"  . C   B 2 6   ? 29.571  -7.960  91.922  1.00 114.01 ? 6   C   B "O3'"  1 
ATOM   7444  C "C2'"  . C   B 2 6   ? 30.018  -8.948  89.696  1.00 113.51 ? 6   C   B "C2'"  1 
ATOM   7445  O "O2'"  . C   B 2 6   ? 31.341  -8.432  89.772  1.00 115.95 ? 6   C   B "O2'"  1 
ATOM   7446  C "C1'"  . C   B 2 6   ? 30.082  -10.409 89.266  1.00 104.89 ? 6   C   B "C1'"  1 
ATOM   7447  N N1     . C   B 2 6   ? 28.827  -10.830 88.602  1.00 101.23 ? 6   C   B N1     1 
ATOM   7448  C C2     . C   B 2 6   ? 28.514  -10.346 87.322  1.00 98.79  ? 6   C   B C2     1 
ATOM   7449  O O2     . C   B 2 6   ? 29.290  -9.571  86.737  1.00 94.00  ? 6   C   B O2     1 
ATOM   7450  N N3     . C   B 2 6   ? 27.358  -10.738 86.744  1.00 101.55 ? 6   C   B N3     1 
ATOM   7451  C C4     . C   B 2 6   ? 26.537  -11.570 87.388  1.00 104.47 ? 6   C   B C4     1 
ATOM   7452  N N4     . C   B 2 6   ? 25.407  -11.931 86.780  1.00 109.85 ? 6   C   B N4     1 
ATOM   7453  C C5     . C   B 2 6   ? 26.826  -12.072 88.687  1.00 101.23 ? 6   C   B C5     1 
ATOM   7454  C C6     . C   B 2 6   ? 27.970  -11.678 89.252  1.00 100.81 ? 6   C   B C6     1 
ATOM   7455  H "H5'"  . C   B 2 6   ? 28.793  -10.448 93.213  1.00 130.84 ? 6   C   B "H5'"  1 
ATOM   7456  H "H5''" . C   B 2 6   ? 28.591  -11.639 92.196  1.00 130.84 ? 6   C   B "H5''" 1 
ATOM   7457  H "H4'"  . C   B 2 6   ? 30.923  -10.118 91.986  1.00 128.81 ? 6   C   B "H4'"  1 
ATOM   7458  H "H3'"  . C   B 2 6   ? 28.443  -9.251  90.974  1.00 135.56 ? 6   C   B "H3'"  1 
ATOM   7459  H "H2'"  . C   B 2 6   ? 29.459  -8.425  89.100  1.00 136.60 ? 6   C   B "H2'"  1 
ATOM   7460  H "HO2'" . C   B 2 6   ? 31.307  -7.627  90.009  1.00 139.54 ? 6   C   B "HO2'" 1 
ATOM   7461  H "H1'"  . C   B 2 6   ? 30.836  -10.549 88.673  1.00 126.25 ? 6   C   B "H1'"  1 
ATOM   7462  H H41    . C   B 2 6   ? 24.860  -12.466 87.173  1.00 132.21 ? 6   C   B H41    1 
ATOM   7463  H H42    . C   B 2 6   ? 25.224  -11.629 85.996  1.00 132.21 ? 6   C   B H42    1 
ATOM   7464  H H5     . C   B 2 6   ? 26.243  -12.651 89.124  1.00 121.87 ? 6   C   B H5     1 
ATOM   7465  H H6     . C   B 2 6   ? 28.190  -11.988 90.101  1.00 121.36 ? 6   C   B H6     1 
ATOM   7466  P P      . G   B 2 7   ? 28.298  -7.106  92.408  1.00 107.24 ? 7   G   B P      1 
ATOM   7467  O OP1    . G   B 2 7   ? 28.763  -6.189  93.478  1.00 110.19 ? 7   G   B OP1    1 
ATOM   7468  O OP2    . G   B 2 7   ? 27.176  -8.030  92.705  1.00 107.03 ? 7   G   B OP2    1 
ATOM   7469  O "O5'"  . G   B 2 7   ? 27.914  -6.242  91.123  1.00 132.28 ? 7   G   B "O5'"  1 
ATOM   7470  C "C5'"  . G   B 2 7   ? 28.870  -5.382  90.517  1.00 134.88 ? 7   G   B "C5'"  1 
ATOM   7471  C "C4'"  . G   B 2 7   ? 28.364  -4.772  89.230  1.00 138.36 ? 7   G   B "C4'"  1 
ATOM   7472  O "O4'"  . G   B 2 7   ? 28.426  -5.743  88.150  1.00 137.79 ? 7   G   B "O4'"  1 
ATOM   7473  C "C3'"  . G   B 2 7   ? 26.915  -4.310  89.206  1.00 140.58 ? 7   G   B "C3'"  1 
ATOM   7474  O "O3'"  . G   B 2 7   ? 26.685  -3.085  89.880  1.00 144.25 ? 7   G   B "O3'"  1 
ATOM   7475  C "C2'"  . G   B 2 7   ? 26.631  -4.250  87.713  1.00 140.60 ? 7   G   B "C2'"  1 
ATOM   7476  O "O2'"  . G   B 2 7   ? 27.214  -3.092  87.128  1.00 140.12 ? 7   G   B "O2'"  1 
ATOM   7477  C "C1'"  . G   B 2 7   ? 27.384  -5.488  87.223  1.00 140.17 ? 7   G   B "C1'"  1 
ATOM   7478  N N9     . G   B 2 7   ? 26.498  -6.670  87.149  1.00 139.71 ? 7   G   B N9     1 
ATOM   7479  C C8     . G   B 2 7   ? 26.401  -7.701  88.053  1.00 138.22 ? 7   G   B C8     1 
ATOM   7480  N N7     . G   B 2 7   ? 25.515  -8.600  87.717  1.00 138.32 ? 7   G   B N7     1 
ATOM   7481  C C5     . G   B 2 7   ? 24.986  -8.137  86.519  1.00 140.17 ? 7   G   B C5     1 
ATOM   7482  C C6     . G   B 2 7   ? 23.981  -8.691  85.675  1.00 139.27 ? 7   G   B C6     1 
ATOM   7483  O O6     . G   B 2 7   ? 23.336  -9.738  85.824  1.00 134.89 ? 7   G   B O6     1 
ATOM   7484  N N1     . G   B 2 7   ? 23.751  -7.893  84.556  1.00 142.85 ? 7   G   B N1     1 
ATOM   7485  C C2     . G   B 2 7   ? 24.397  -6.710  84.285  1.00 146.21 ? 7   G   B C2     1 
ATOM   7486  N N2     . G   B 2 7   ? 24.042  -6.079  83.154  1.00 149.02 ? 7   G   B N2     1 
ATOM   7487  N N3     . G   B 2 7   ? 25.335  -6.190  85.062  1.00 146.45 ? 7   G   B N3     1 
ATOM   7488  C C4     . G   B 2 7   ? 25.579  -6.945  86.157  1.00 142.05 ? 7   G   B C4     1 
ATOM   7489  H "H5'"  . G   B 2 7   ? 29.674  -5.891  90.328  1.00 162.25 ? 7   G   B "H5'"  1 
ATOM   7490  H "H5''" . G   B 2 7   ? 29.089  -4.669  91.137  1.00 162.25 ? 7   G   B "H5''" 1 
ATOM   7491  H "H4'"  . G   B 2 7   ? 28.931  -4.019  89.002  1.00 166.42 ? 7   G   B "H4'"  1 
ATOM   7492  H "H3'"  . G   B 2 7   ? 26.359  -4.998  89.605  1.00 169.09 ? 7   G   B "H3'"  1 
ATOM   7493  H "H2'"  . G   B 2 7   ? 25.681  -4.312  87.526  1.00 169.11 ? 7   G   B "H2'"  1 
ATOM   7494  H "HO2'" . G   B 2 7   ? 27.017  -3.070  86.312  1.00 168.54 ? 7   G   B "HO2'" 1 
ATOM   7495  H "H1'"  . G   B 2 7   ? 27.764  -5.312  86.349  1.00 168.60 ? 7   G   B "H1'"  1 
ATOM   7496  H H8     . G   B 2 7   ? 26.918  -7.755  88.824  1.00 166.26 ? 7   G   B H8     1 
ATOM   7497  H H1     . G   B 2 7   ? 23.155  -8.158  83.995  1.00 171.81 ? 7   G   B H1     1 
ATOM   7498  H H21    . G   B 2 7   ? 23.433  -6.414  82.648  1.00 179.21 ? 7   G   B H21    1 
ATOM   7499  H H22    . G   B 2 7   ? 24.423  -5.340  82.937  1.00 179.21 ? 7   G   B H22    1 
ATOM   7500  P P      . G   B 2 8   ? 25.233  -2.776  90.503  1.00 105.20 ? 8   G   B P      1 
ATOM   7501  O OP1    . G   B 2 8   ? 25.340  -1.567  91.357  1.00 107.06 ? 8   G   B OP1    1 
ATOM   7502  O OP2    . G   B 2 8   ? 24.709  -4.037  91.083  1.00 102.79 ? 8   G   B OP2    1 
ATOM   7503  O "O5'"  . G   B 2 8   ? 24.332  -2.416  89.238  1.00 110.40 ? 8   G   B "O5'"  1 
ATOM   7504  C "C5'"  . G   B 2 8   ? 24.715  -1.395  88.326  1.00 114.18 ? 8   G   B "C5'"  1 
ATOM   7505  C "C4'"  . G   B 2 8   ? 23.873  -1.435  87.076  1.00 114.46 ? 8   G   B "C4'"  1 
ATOM   7506  O "O4'"  . G   B 2 8   ? 24.094  -2.687  86.363  1.00 114.21 ? 8   G   B "O4'"  1 
ATOM   7507  C "C3'"  . G   B 2 8   ? 22.372  -1.418  87.302  1.00 109.21 ? 8   G   B "C3'"  1 
ATOM   7508  O "O3'"  . G   B 2 8   ? 21.846  -0.145  87.603  1.00 101.28 ? 8   G   B "O3'"  1 
ATOM   7509  C "C2'"  . G   B 2 8   ? 21.848  -2.036  86.018  1.00 113.55 ? 8   G   B "C2'"  1 
ATOM   7510  O "O2'"  . G   B 2 8   ? 21.933  -1.131  84.924  1.00 115.97 ? 8   G   B "O2'"  1 
ATOM   7511  C "C1'"  . G   B 2 8   ? 22.869  -3.149  85.822  1.00 112.63 ? 8   G   B "C1'"  1 
ATOM   7512  N N9     . G   B 2 8   ? 22.449  -4.355  86.561  1.00 107.65 ? 8   G   B N9     1 
ATOM   7513  C C8     . G   B 2 8   ? 22.871  -4.826  87.787  1.00 101.29 ? 8   G   B C8     1 
ATOM   7514  N N7     . G   B 2 8   ? 22.262  -5.922  88.158  1.00 94.87  ? 8   G   B N7     1 
ATOM   7515  C C5     . G   B 2 8   ? 21.374  -6.177  87.123  1.00 97.81  ? 8   G   B C5     1 
ATOM   7516  C C6     . G   B 2 8   ? 20.438  -7.225  86.944  1.00 96.65  ? 8   G   B C6     1 
ATOM   7517  O O6     . G   B 2 8   ? 20.195  -8.179  87.698  1.00 91.23  ? 8   G   B O6     1 
ATOM   7518  N N1     . G   B 2 8   ? 19.747  -7.084  85.739  1.00 103.31 ? 8   G   B N1     1 
ATOM   7519  C C2     . G   B 2 8   ? 19.932  -6.068  84.824  1.00 108.28 ? 8   G   B C2     1 
ATOM   7520  N N2     . G   B 2 8   ? 19.178  -6.092  83.715  1.00 111.92 ? 8   G   B N2     1 
ATOM   7521  N N3     . G   B 2 8   ? 20.801  -5.090  84.980  1.00 107.90 ? 8   G   B N3     1 
ATOM   7522  C C4     . G   B 2 8   ? 21.475  -5.214  86.140  1.00 104.94 ? 8   G   B C4     1 
ATOM   7523  H "H5'"  . G   B 2 8   ? 25.647  -1.518  88.085  1.00 137.41 ? 8   G   B "H5'"  1 
ATOM   7524  H "H5''" . G   B 2 8   ? 24.609  -0.531  88.753  1.00 137.41 ? 8   G   B "H5''" 1 
ATOM   7525  H "H4'"  . G   B 2 8   ? 24.118  -0.693  86.502  1.00 137.74 ? 8   G   B "H4'"  1 
ATOM   7526  H "H3'"  . G   B 2 8   ? 22.165  -2.016  88.037  1.00 131.44 ? 8   G   B "H3'"  1 
ATOM   7527  H "H2'"  . G   B 2 8   ? 20.952  -2.390  86.129  1.00 136.66 ? 8   G   B "H2'"  1 
ATOM   7528  H "HO2'" . G   B 2 8   ? 21.935  -0.345  85.220  1.00 139.55 ? 8   G   B "HO2'" 1 
ATOM   7529  H "H1'"  . G   B 2 8   ? 22.972  -3.350  84.878  1.00 135.55 ? 8   G   B "H1'"  1 
ATOM   7530  H H8     . G   B 2 8   ? 23.533  -4.413  88.292  1.00 121.94 ? 8   G   B H8     1 
ATOM   7531  H H1     . G   B 2 8   ? 19.157  -7.680  85.551  1.00 124.36 ? 8   G   B H1     1 
ATOM   7532  H H21    . G   B 2 8   ? 18.606  -6.723  83.598  1.00 134.70 ? 8   G   B H21    1 
ATOM   7533  H H22    . G   B 2 8   ? 19.266  -5.476  83.122  1.00 134.70 ? 8   G   B H22    1 
ATOM   7534  P P      . C   B 2 9   ? 20.554  -0.052  88.545  1.00 99.77  ? 9   C   B P      1 
ATOM   7535  O OP1    . C   B 2 9   ? 20.360  1.366   88.932  1.00 105.81 ? 9   C   B OP1    1 
ATOM   7536  O OP2    . C   B 2 9   ? 20.648  -1.089  89.602  1.00 97.86  ? 9   C   B OP2    1 
ATOM   7537  O "O5'"  . C   B 2 9   ? 19.365  -0.457  87.575  1.00 102.10 ? 9   C   B "O5'"  1 
ATOM   7538  C "C5'"  . C   B 2 9   ? 19.111  0.299   86.405  1.00 107.70 ? 9   C   B "C5'"  1 
ATOM   7539  C "C4'"  . C   B 2 9   ? 18.075  -0.359  85.534  1.00 111.61 ? 9   C   B "C4'"  1 
ATOM   7540  O "O4'"  . C   B 2 9   ? 18.519  -1.692  85.168  1.00 112.87 ? 9   C   B "O4'"  1 
ATOM   7541  C "C3'"  . C   B 2 9   ? 16.709  -0.595  86.162  1.00 113.16 ? 9   C   B "C3'"  1 
ATOM   7542  O "O3'"  . C   B 2 9   ? 15.897  0.568   86.216  1.00 119.78 ? 9   C   B "O3'"  1 
ATOM   7543  C "C2'"  . C   B 2 9   ? 16.148  -1.706  85.286  1.00 111.19 ? 9   C   B "C2'"  1 
ATOM   7544  O "O2'"  . C   B 2 9   ? 15.700  -1.199  84.036  1.00 110.30 ? 9   C   B "O2'"  1 
ATOM   7545  C "C1'"  . C   B 2 9   ? 17.401  -2.552  85.054  1.00 112.21 ? 9   C   B "C1'"  1 
ATOM   7546  N N1     . C   B 2 9   ? 17.521  -3.630  86.064  1.00 108.12 ? 9   C   B N1     1 
ATOM   7547  C C2     . C   B 2 9   ? 16.893  -4.854  85.822  1.00 103.17 ? 9   C   B C2     1 
ATOM   7548  O O2     . C   B 2 9   ? 16.268  -5.017  84.763  1.00 99.24  ? 9   C   B O2     1 
ATOM   7549  N N3     . C   B 2 9   ? 16.988  -5.835  86.749  1.00 104.61 ? 9   C   B N3     1 
ATOM   7550  C C4     . C   B 2 9   ? 17.665  -5.631  87.881  1.00 105.67 ? 9   C   B C4     1 
ATOM   7551  N N4     . C   B 2 9   ? 17.730  -6.635  88.764  1.00 102.82 ? 9   C   B N4     1 
ATOM   7552  C C5     . C   B 2 9   ? 18.308  -4.388  88.155  1.00 107.15 ? 9   C   B C5     1 
ATOM   7553  C C6     . C   B 2 9   ? 18.207  -3.426  87.230  1.00 108.68 ? 9   C   B C6     1 
ATOM   7554  H "H5'"  . C   B 2 9   ? 19.935  0.390   85.902  1.00 129.63 ? 9   C   B "H5'"  1 
ATOM   7555  H "H5''" . C   B 2 9   ? 18.796  1.180   86.659  1.00 129.63 ? 9   C   B "H5''" 1 
ATOM   7556  H "H4'"  . C   B 2 9   ? 17.962  0.167   84.727  1.00 134.32 ? 9   C   B "H4'"  1 
ATOM   7557  H "H3'"  . C   B 2 9   ? 16.832  -0.936  87.062  1.00 136.18 ? 9   C   B "H3'"  1 
ATOM   7558  H "H2'"  . C   B 2 9   ? 15.457  -2.209  85.744  1.00 133.82 ? 9   C   B "H2'"  1 
ATOM   7559  H "HO2'" . C   B 2 9   ? 15.012  -0.733  84.161  1.00 132.75 ? 9   C   B "HO2'" 1 
ATOM   7560  H "H1'"  . C   B 2 9   ? 17.375  -2.939  84.165  1.00 135.04 ? 9   C   B "H1'"  1 
ATOM   7561  H H41    . C   B 2 9   ? 18.159  -6.531  89.502  1.00 123.77 ? 9   C   B H41    1 
ATOM   7562  H H42    . C   B 2 9   ? 17.341  -7.383  88.594  1.00 123.77 ? 9   C   B H42    1 
ATOM   7563  H H5     . C   B 2 9   ? 18.780  -4.252  88.944  1.00 128.97 ? 9   C   B H5     1 
ATOM   7564  H H6     . C   B 2 9   ? 18.616  -2.604  87.381  1.00 130.81 ? 9   C   B H6     1 
ATOM   7565  P P      . A   B 2 10  ? 14.875  0.800   87.444  1.00 101.59 ? 10  A   B P      1 
ATOM   7566  O OP1    . A   B 2 10  ? 14.320  2.176   87.320  1.00 99.43  ? 10  A   B OP1    1 
ATOM   7567  O OP2    . A   B 2 10  ? 15.530  0.383   88.715  1.00 94.26  ? 10  A   B OP2    1 
ATOM   7568  O "O5'"  . A   B 2 10  ? 13.685  -0.212  87.137  1.00 107.31 ? 10  A   B "O5'"  1 
ATOM   7569  C "C5'"  . A   B 2 10  ? 12.892  -0.067  85.967  1.00 107.59 ? 10  A   B "C5'"  1 
ATOM   7570  C "C4'"  . A   B 2 10  ? 11.878  -1.174  85.852  1.00 105.75 ? 10  A   B "C4'"  1 
ATOM   7571  O "O4'"  . A   B 2 10  ? 12.547  -2.438  85.584  1.00 104.30 ? 10  A   B "O4'"  1 
ATOM   7572  C "C3'"  . A   B 2 10  ? 11.069  -1.459  87.106  1.00 103.98 ? 10  A   B "C3'"  1 
ATOM   7573  O "O3'"  . A   B 2 10  ? 10.023  -0.534  87.343  1.00 104.44 ? 10  A   B "O3'"  1 
ATOM   7574  C "C2'"  . A   B 2 10  ? 10.607  -2.888  86.866  1.00 101.26 ? 10  A   B "C2'"  1 
ATOM   7575  O "O2'"  . A   B 2 10  ? 9.539   -2.943  85.928  1.00 102.08 ? 10  A   B "O2'"  1 
ATOM   7576  C "C1'"  . A   B 2 10  ? 11.860  -3.490  86.238  1.00 99.28  ? 10  A   B "C1'"  1 
ATOM   7577  N N9     . A   B 2 10  ? 12.740  -4.059  87.277  1.00 92.19  ? 10  A   B N9     1 
ATOM   7578  C C8     . A   B 2 10  ? 13.776  -3.441  87.935  1.00 91.59  ? 10  A   B C8     1 
ATOM   7579  N N7     . A   B 2 10  ? 14.368  -4.200  88.824  1.00 87.99  ? 10  A   B N7     1 
ATOM   7580  C C5     . A   B 2 10  ? 13.662  -5.391  88.756  1.00 85.31  ? 10  A   B C5     1 
ATOM   7581  C C6     . A   B 2 10  ? 13.799  -6.602  89.450  1.00 83.64  ? 10  A   B C6     1 
ATOM   7582  N N6     . A   B 2 10  ? 14.729  -6.808  90.386  1.00 82.03  ? 10  A   B N6     1 
ATOM   7583  N N1     . A   B 2 10  ? 12.935  -7.599  89.141  1.00 83.18  ? 10  A   B N1     1 
ATOM   7584  C C2     . A   B 2 10  ? 12.004  -7.387  88.197  1.00 81.81  ? 10  A   B C2     1 
ATOM   7585  N N3     . A   B 2 10  ? 11.778  -6.290  87.476  1.00 84.45  ? 10  A   B N3     1 
ATOM   7586  C C4     . A   B 2 10  ? 12.652  -5.321  87.810  1.00 86.06  ? 10  A   B C4     1 
ATOM   7587  H "H5'"  . A   B 2 10  ? 13.471  -0.084  85.189  1.00 129.50 ? 10  A   B "H5'"  1 
ATOM   7588  H "H5''" . A   B 2 10  ? 12.430  0.785   86.000  1.00 129.50 ? 10  A   B "H5''" 1 
ATOM   7589  H "H4'"  . A   B 2 10  ? 11.272  -0.974  85.122  1.00 127.29 ? 10  A   B "H4'"  1 
ATOM   7590  H "H3'"  . A   B 2 10  ? 11.668  -1.451  87.869  1.00 125.17 ? 10  A   B "H3'"  1 
ATOM   7591  H "H2'"  . A   B 2 10  ? 10.378  -3.332  87.698  1.00 121.90 ? 10  A   B "H2'"  1 
ATOM   7592  H "HO2'" . A   B 2 10  ? 8.851   -2.610  86.277  1.00 122.88 ? 10  A   B "HO2'" 1 
ATOM   7593  H "H1'"  . A   B 2 10  ? 11.615  -4.176  85.598  1.00 119.52 ? 10  A   B "H1'"  1 
ATOM   7594  H H8     . A   B 2 10  ? 14.040  -2.567  87.759  1.00 110.30 ? 10  A   B H8     1 
ATOM   7595  H H61    . A   B 2 10  ? 14.775  -7.568  90.787  1.00 98.82  ? 10  A   B H61    1 
ATOM   7596  H H62    . A   B 2 10  ? 15.281  -6.181  90.589  1.00 98.82  ? 10  A   B H62    1 
ATOM   7597  H H2     . A   B 2 10  ? 11.436  -8.103  88.026  1.00 98.24  ? 10  A   B H2     1 
ATOM   7598  P P      . G   B 2 11  ? 9.197   -0.610  88.723  1.00 131.28 ? 11  G   B P      1 
ATOM   7599  O OP1    . G   B 2 11  ? 8.678   0.741   89.052  1.00 134.08 ? 11  G   B OP1    1 
ATOM   7600  O OP2    . G   B 2 11  ? 10.000  -1.344  89.739  1.00 124.36 ? 11  G   B OP2    1 
ATOM   7601  O "O5'"  . G   B 2 11  ? 7.942   -1.503  88.339  1.00 119.98 ? 11  G   B "O5'"  1 
ATOM   7602  C "C5'"  . G   B 2 11  ? 7.236   -2.213  89.335  1.00 113.90 ? 11  G   B "C5'"  1 
ATOM   7603  C "C4'"  . G   B 2 11  ? 7.105   -3.664  88.970  1.00 107.14 ? 11  G   B "C4'"  1 
ATOM   7604  O "O4'"  . G   B 2 11  ? 8.366   -4.173  88.452  1.00 101.02 ? 11  G   B "O4'"  1 
ATOM   7605  C "C3'"  . G   B 2 11  ? 6.807   -4.588  90.127  1.00 105.55 ? 11  G   B "C3'"  1 
ATOM   7606  O "O3'"  . G   B 2 11  ? 5.471   -4.535  90.569  1.00 102.41 ? 11  G   B "O3'"  1 
ATOM   7607  C "C2'"  . G   B 2 11  ? 7.258   -5.923  89.576  1.00 106.10 ? 11  G   B "C2'"  1 
ATOM   7608  O "O2'"  . G   B 2 11  ? 6.361   -6.384  88.575  1.00 108.73 ? 11  G   B "O2'"  1 
ATOM   7609  C "C1'"  . G   B 2 11  ? 8.561   -5.498  88.908  1.00 103.36 ? 11  G   B "C1'"  1 
ATOM   7610  N N9     . G   B 2 11  ? 9.695   -5.501  89.863  1.00 107.19 ? 11  G   B N9     1 
ATOM   7611  C C8     . G   B 2 11  ? 10.575  -4.469  90.110  1.00 110.09 ? 11  G   B C8     1 
ATOM   7612  N N7     . G   B 2 11  ? 11.482  -4.752  91.008  1.00 110.09 ? 11  G   B N7     1 
ATOM   7613  C C5     . G   B 2 11  ? 11.191  -6.056  91.397  1.00 107.55 ? 11  G   B C5     1 
ATOM   7614  C C6     . G   B 2 11  ? 11.828  -6.909  92.349  1.00 102.77 ? 11  G   B C6     1 
ATOM   7615  O O6     . G   B 2 11  ? 12.808  -6.684  93.067  1.00 103.39 ? 11  G   B O6     1 
ATOM   7616  N N1     . G   B 2 11  ? 11.213  -8.152  92.434  1.00 97.91  ? 11  G   B N1     1 
ATOM   7617  C C2     . G   B 2 11  ? 10.120  -8.534  91.699  1.00 97.16  ? 11  G   B C2     1 
ATOM   7618  N N2     . G   B 2 11  ? 9.664   -9.777  91.920  1.00 91.76  ? 11  G   B N2     1 
ATOM   7619  N N3     . G   B 2 11  ? 9.517   -7.756  90.811  1.00 102.26 ? 11  G   B N3     1 
ATOM   7620  C C4     . G   B 2 11  ? 10.094  -6.533  90.702  1.00 106.85 ? 11  G   B C4     1 
ATOM   7621  H "H5'"  . G   B 2 11  ? 6.350   -1.829  89.434  1.00 137.08 ? 11  G   B "H5'"  1 
ATOM   7622  H "H5''" . G   B 2 11  ? 7.711   -2.138  90.177  1.00 137.08 ? 11  G   B "H5''" 1 
ATOM   7623  H "H4'"  . G   B 2 11  ? 6.417   -3.764  88.294  1.00 128.96 ? 11  G   B "H4'"  1 
ATOM   7624  H "H3'"  . G   B 2 11  ? 7.385   -4.350  90.869  1.00 127.05 ? 11  G   B "H3'"  1 
ATOM   7625  H "H2'"  . G   B 2 11  ? 7.404   -6.578  90.276  1.00 127.70 ? 11  G   B "H2'"  1 
ATOM   7626  H "HO2'" . G   B 2 11  ? 5.606   -6.040  88.705  1.00 130.86 ? 11  G   B "HO2'" 1 
ATOM   7627  H "H1'"  . G   B 2 11  ? 8.756   -6.082  88.158  1.00 124.42 ? 11  G   B "H1'"  1 
ATOM   7628  H H8     . G   B 2 11  ? 10.532  -3.649  89.672  1.00 132.50 ? 11  G   B H8     1 
ATOM   7629  H H1     . G   B 2 11  ? 11.540  -8.722  92.988  1.00 117.88 ? 11  G   B H1     1 
ATOM   7630  H H21    . G   B 2 11  ? 10.055  -10.282 92.496  1.00 110.50 ? 11  G   B H21    1 
ATOM   7631  H H22    . G   B 2 11  ? 8.982   -10.068 91.486  1.00 110.50 ? 11  G   B H22    1 
ATOM   7632  P P      . G   B 2 12  ? 5.199   -4.332  92.136  1.00 134.09 ? 12  G   B P      1 
ATOM   7633  O OP1    . G   B 2 12  ? 3.782   -3.928  92.318  1.00 137.06 ? 12  G   B OP1    1 
ATOM   7634  O OP2    . G   B 2 12  ? 6.269   -3.476  92.709  1.00 130.27 ? 12  G   B OP2    1 
ATOM   7635  O "O5'"  . G   B 2 12  ? 5.383   -5.800  92.716  1.00 104.80 ? 12  G   B "O5'"  1 
ATOM   7636  C "C5'"  . G   B 2 12  ? 4.594   -6.861  92.208  1.00 106.37 ? 12  G   B "C5'"  1 
ATOM   7637  C "C4'"  . G   B 2 12  ? 4.879   -8.139  92.939  1.00 109.59 ? 12  G   B "C4'"  1 
ATOM   7638  O "O4'"  . G   B 2 12  ? 6.282   -8.473  92.780  1.00 111.83 ? 12  G   B "O4'"  1 
ATOM   7639  C "C3'"  . G   B 2 12  ? 4.680   -8.106  94.446  1.00 113.63 ? 12  G   B "C3'"  1 
ATOM   7640  O "O3'"  . G   B 2 12  ? 3.319   -8.230  94.847  1.00 116.03 ? 12  G   B "O3'"  1 
ATOM   7641  C "C2'"  . G   B 2 12  ? 5.582   -9.243  94.910  1.00 112.14 ? 12  G   B "C2'"  1 
ATOM   7642  O "O2'"  . G   B 2 12  ? 4.975   -10.511 94.697  1.00 110.65 ? 12  G   B "O2'"  1 
ATOM   7643  C "C1'"  . G   B 2 12  ? 6.762   -9.100  93.950  1.00 110.76 ? 12  G   B "C1'"  1 
ATOM   7644  N N9     . G   B 2 12  ? 7.850   -8.278  94.516  1.00 108.38 ? 12  G   B N9     1 
ATOM   7645  C C8     . G   B 2 12  ? 8.083   -6.942  94.296  1.00 107.06 ? 12  G   B C8     1 
ATOM   7646  N N7     . G   B 2 12  ? 9.129   -6.498  94.938  1.00 108.42 ? 12  G   B N7     1 
ATOM   7647  C C5     . G   B 2 12  ? 9.616   -7.605  95.624  1.00 109.82 ? 12  G   B C5     1 
ATOM   7648  C C6     . G   B 2 12  ? 10.735  -7.745  96.493  1.00 112.29 ? 12  G   B C6     1 
ATOM   7649  O O6     . G   B 2 12  ? 11.553  -6.888  96.851  1.00 115.93 ? 12  G   B O6     1 
ATOM   7650  N N1     . G   B 2 12  ? 10.865  -9.045  96.972  1.00 109.95 ? 12  G   B N1     1 
ATOM   7651  C C2     . G   B 2 12  ? 10.028  -10.087 96.660  1.00 108.62 ? 12  G   B C2     1 
ATOM   7652  N N2     . G   B 2 12  ? 10.323  -11.269 97.228  1.00 104.64 ? 12  G   B N2     1 
ATOM   7653  N N3     . G   B 2 12  ? 8.983   -9.971  95.850  1.00 109.09 ? 12  G   B N3     1 
ATOM   7654  C C4     . G   B 2 12  ? 8.836   -8.713  95.373  1.00 108.87 ? 12  G   B C4     1 
ATOM   7655  H "H5'"  . G   B 2 12  ? 4.790   -6.982  91.266  1.00 128.04 ? 12  G   B "H5'"  1 
ATOM   7656  H "H5''" . G   B 2 12  ? 3.655   -6.638  92.311  1.00 128.04 ? 12  G   B "H5''" 1 
ATOM   7657  H "H4'"  . G   B 2 12  ? 4.337   -8.850  92.561  1.00 131.90 ? 12  G   B "H4'"  1 
ATOM   7658  H "H3'"  . G   B 2 12  ? 5.031   -7.269  94.789  1.00 136.75 ? 12  G   B "H3'"  1 
ATOM   7659  H "H2'"  . G   B 2 12  ? 5.858   -9.126  95.832  1.00 134.96 ? 12  G   B "H2'"  1 
ATOM   7660  H "HO2'" . G   B 2 12  ? 5.488   -11.111 94.985  1.00 133.17 ? 12  G   B "HO2'" 1 
ATOM   7661  H "H1'"  . G   B 2 12  ? 7.105   -9.980  93.727  1.00 133.30 ? 12  G   B "H1'"  1 
ATOM   7662  H H8     . G   B 2 12  ? 7.553   -6.412  93.746  1.00 128.87 ? 12  G   B H8     1 
ATOM   7663  H H1     . G   B 2 12  ? 11.520  -9.207  97.506  1.00 132.33 ? 12  G   B H1     1 
ATOM   7664  H H21    . G   B 2 12  ? 11.002  -11.337 97.752  1.00 125.96 ? 12  G   B H21    1 
ATOM   7665  H H22    . G   B 2 12  ? 9.833   -11.957 97.068  1.00 125.96 ? 12  G   B H22    1 
ATOM   7666  P P      . U   B 2 13  ? 2.805   -7.589  96.238  1.00 100.36 ? 13  U   B P      1 
ATOM   7667  O OP1    . U   B 2 13  ? 1.356   -7.883  96.376  1.00 100.11 ? 13  U   B OP1    1 
ATOM   7668  O OP2    . U   B 2 13  ? 3.222   -6.162  96.309  1.00 95.67  ? 13  U   B OP2    1 
ATOM   7669  O "O5'"  . U   B 2 13  ? 3.575   -8.443  97.349  1.00 89.51  ? 13  U   B "O5'"  1 
ATOM   7670  C "C5'"  . U   B 2 13  ? 3.416   -9.856  97.411  1.00 85.20  ? 13  U   B "C5'"  1 
ATOM   7671  C "C4'"  . U   B 2 13  ? 4.465   -10.530 98.270  1.00 81.35  ? 13  U   B "C4'"  1 
ATOM   7672  O "O4'"  . U   B 2 13  ? 5.797   -10.354 97.711  1.00 78.30  ? 13  U   B "O4'"  1 
ATOM   7673  C "C3'"  . U   B 2 13  ? 4.594   -10.019 99.693  1.00 79.11  ? 13  U   B "C3'"  1 
ATOM   7674  O "O3'"  . U   B 2 13  ? 3.574   -10.514 100.540 1.00 76.01  ? 13  U   B "O3'"  1 
ATOM   7675  C "C2'"  . U   B 2 13  ? 6.001   -10.468 100.073 1.00 76.42  ? 13  U   B "C2'"  1 
ATOM   7676  O "O2'"  . U   B 2 13  ? 6.035   -11.853 100.399 1.00 68.87  ? 13  U   B "O2'"  1 
ATOM   7677  C "C1'"  . U   B 2 13  ? 6.747   -10.250 98.753  1.00 76.50  ? 13  U   B "C1'"  1 
ATOM   7678  N N1     . U   B 2 13  ? 7.385   -8.909  98.685  1.00 78.07  ? 13  U   B N1     1 
ATOM   7679  C C2     . U   B 2 13  ? 8.614   -8.724  99.297  1.00 83.53  ? 13  U   B C2     1 
ATOM   7680  O O2     . U   B 2 13  ? 9.202   -9.620  99.883  1.00 88.95  ? 13  U   B O2     1 
ATOM   7681  N N3     . U   B 2 13  ? 9.141   -7.452  99.196  1.00 82.52  ? 13  U   B N3     1 
ATOM   7682  C C4     . U   B 2 13  ? 8.576   -6.361  98.564  1.00 79.63  ? 13  U   B C4     1 
ATOM   7683  O O4     . U   B 2 13  ? 9.169   -5.278  98.555  1.00 76.19  ? 13  U   B O4     1 
ATOM   7684  C C5     . U   B 2 13  ? 7.307   -6.628  97.958  1.00 80.20  ? 13  U   B C5     1 
ATOM   7685  C C6     . U   B 2 13  ? 6.774   -7.856  98.041  1.00 78.52  ? 13  U   B C6     1 
ATOM   7686  H "H5'"  . U   B 2 13  ? 3.471   -10.216 96.512  1.00 102.63 ? 13  U   B "H5'"  1 
ATOM   7687  H "H5''" . U   B 2 13  ? 2.539   -10.056 97.775  1.00 102.63 ? 13  U   B "H5''" 1 
ATOM   7688  H "H4'"  . U   B 2 13  ? 4.269   -11.480 98.302  1.00 98.01  ? 13  U   B "H4'"  1 
ATOM   7689  H "H3'"  . U   B 2 13  ? 4.560   -9.050  99.686  1.00 95.33  ? 13  U   B "H3'"  1 
ATOM   7690  H "H2'"  . U   B 2 13  ? 6.370   -9.921  100.784 1.00 92.10  ? 13  U   B "H2'"  1 
ATOM   7691  H "HO2'" . U   B 2 13  ? 5.625   -11.974 101.122 1.00 83.03  ? 13  U   B "HO2'" 1 
ATOM   7692  H "H1'"  . U   B 2 13  ? 7.424   -10.937 98.646  1.00 92.18  ? 13  U   B "H1'"  1 
ATOM   7693  H H3     . U   B 2 13  ? 9.905   -7.324  99.570  1.00 99.42  ? 13  U   B H3     1 
ATOM   7694  H H5     . U   B 2 13  ? 6.853   -5.952  97.510  1.00 96.63  ? 13  U   B H5     1 
ATOM   7695  H H6     . U   B 2 13  ? 5.948   -8.004  97.641  1.00 94.62  ? 13  U   B H6     1 
ATOM   7696  P P      . U   B 2 14  ? 2.709   -9.496  101.429 1.00 73.67  ? 14  U   B P      1 
ATOM   7697  O OP1    . U   B 2 14  ? 1.590   -10.234 102.078 1.00 72.56  ? 14  U   B OP1    1 
ATOM   7698  O OP2    . U   B 2 14  ? 2.428   -8.286  100.604 1.00 73.17  ? 14  U   B OP2    1 
ATOM   7699  O "O5'"  . U   B 2 14  ? 3.706   -9.112  102.608 1.00 89.51  ? 14  U   B "O5'"  1 
ATOM   7700  C "C5'"  . U   B 2 14  ? 4.453   -10.107 103.298 1.00 80.87  ? 14  U   B "C5'"  1 
ATOM   7701  C "C4'"  . U   B 2 14  ? 5.520   -9.488  104.166 1.00 74.98  ? 14  U   B "C4'"  1 
ATOM   7702  O "O4'"  . U   B 2 14  ? 6.685   -9.157  103.363 1.00 74.88  ? 14  U   B "O4'"  1 
ATOM   7703  C "C3'"  . U   B 2 14  ? 5.144   -8.173  104.831 1.00 71.28  ? 14  U   B "C3'"  1 
ATOM   7704  O "O3'"  . U   B 2 14  ? 4.380   -8.343  106.002 1.00 70.16  ? 14  U   B "O3'"  1 
ATOM   7705  C "C2'"  . U   B 2 14  ? 6.492   -7.523  105.066 1.00 70.93  ? 14  U   B "C2'"  1 
ATOM   7706  O "O2'"  . U   B 2 14  ? 7.145   -8.095  106.192 1.00 69.02  ? 14  U   B "O2'"  1 
ATOM   7707  C "C1'"  . U   B 2 14  ? 7.222   -7.920  103.785 1.00 74.55  ? 14  U   B "C1'"  1 
ATOM   7708  N N1     . U   B 2 14  ? 6.968   -6.934  102.713 1.00 75.37  ? 14  U   B N1     1 
ATOM   7709  C C2     . U   B 2 14  ? 7.852   -5.898  102.540 1.00 80.95  ? 14  U   B C2     1 
ATOM   7710  O O2     . U   B 2 14  ? 8.853   -5.766  103.221 1.00 80.81  ? 14  U   B O2     1 
ATOM   7711  N N3     . U   B 2 14  ? 7.518   -5.033  101.526 1.00 88.32  ? 14  U   B N3     1 
ATOM   7712  C C4     . U   B 2 14  ? 6.412   -5.091  100.695 1.00 88.29  ? 14  U   B C4     1 
ATOM   7713  O O4     . U   B 2 14  ? 6.244   -4.234  99.821  1.00 91.61  ? 14  U   B O4     1 
ATOM   7714  C C5     . U   B 2 14  ? 5.542   -6.192  100.948 1.00 82.31  ? 14  U   B C5     1 
ATOM   7715  C C6     . U   B 2 14  ? 5.850   -7.042  101.925 1.00 76.72  ? 14  U   B C6     1 
ATOM   7716  H "H5'"  . U   B 2 14  ? 4.872   -10.695 102.650 1.00 97.43  ? 14  U   B "H5'"  1 
ATOM   7717  H "H5''" . U   B 2 14  ? 3.852   -10.626 103.855 1.00 97.43  ? 14  U   B "H5''" 1 
ATOM   7718  H "H4'"  . U   B 2 14  ? 5.779   -10.125 104.850 1.00 90.36  ? 14  U   B "H4'"  1 
ATOM   7719  H "H3'"  . U   B 2 14  ? 4.639   -7.634  104.201 1.00 85.93  ? 14  U   B "H3'"  1 
ATOM   7720  H "H2'"  . U   B 2 14  ? 6.414   -6.559  105.145 1.00 85.50  ? 14  U   B "H2'"  1 
ATOM   7721  H "HO2'" . U   B 2 14  ? 6.734   -7.870  106.889 1.00 82.19  ? 14  U   B "HO2'" 1 
ATOM   7722  H "H1'"  . U   B 2 14  ? 8.174   -8.003  103.950 1.00 89.85  ? 14  U   B "H1'"  1 
ATOM   7723  H H3     . U   B 2 14  ? 8.059   -4.378  101.393 1.00 106.37 ? 14  U   B H3     1 
ATOM   7724  H H5     . U   B 2 14  ? 4.773   -6.314  100.439 1.00 99.17  ? 14  U   B H5     1 
ATOM   7725  H H6     . U   B 2 14  ? 5.274   -7.756  102.081 1.00 92.46  ? 14  U   B H6     1 
ATOM   7726  P P      . C   B 2 15  ? 3.108   -7.403  106.249 1.00 70.79  ? 15  C   B P      1 
ATOM   7727  O OP1    . C   B 2 15  ? 2.287   -8.032  107.314 1.00 70.46  ? 15  C   B OP1    1 
ATOM   7728  O OP2    . C   B 2 15  ? 2.494   -7.061  104.939 1.00 71.96  ? 15  C   B OP2    1 
ATOM   7729  O "O5'"  . C   B 2 15  ? 3.735   -6.069  106.831 1.00 71.81  ? 15  C   B "O5'"  1 
ATOM   7730  C "C5'"  . C   B 2 15  ? 2.932   -4.919  106.983 1.00 73.24  ? 15  C   B "C5'"  1 
ATOM   7731  C "C4'"  . C   B 2 15  ? 3.756   -3.762  107.455 1.00 74.18  ? 15  C   B "C4'"  1 
ATOM   7732  O "O4'"  . C   B 2 15  ? 4.301   -4.050  108.766 1.00 73.27  ? 15  C   B "O4'"  1 
ATOM   7733  C "C3'"  . C   B 2 15  ? 4.989   -3.429  106.637 1.00 74.71  ? 15  C   B "C3'"  1 
ATOM   7734  O "O3'"  . C   B 2 15  ? 4.706   -2.757  105.421 1.00 76.17  ? 15  C   B "O3'"  1 
ATOM   7735  C "C2'"  . C   B 2 15  ? 5.797   -2.600  107.626 1.00 75.29  ? 15  C   B "C2'"  1 
ATOM   7736  O "O2'"  . C   B 2 15  ? 5.284   -1.278  107.735 1.00 77.36  ? 15  C   B "O2'"  1 
ATOM   7737  C "C1'"  . C   B 2 15  ? 5.511   -3.335  108.935 1.00 73.91  ? 15  C   B "C1'"  1 
ATOM   7738  N N1     . C   B 2 15  ? 6.614   -4.251  109.318 1.00 72.61  ? 15  C   B N1     1 
ATOM   7739  C C2     . C   B 2 15  ? 7.802   -3.649  109.754 1.00 73.18  ? 15  C   B C2     1 
ATOM   7740  O O2     . C   B 2 15  ? 7.883   -2.413  109.790 1.00 74.73  ? 15  C   B O2     1 
ATOM   7741  N N3     . C   B 2 15  ? 8.846   -4.410  110.124 1.00 72.17  ? 15  C   B N3     1 
ATOM   7742  C C4     . C   B 2 15  ? 8.741   -5.723  110.088 1.00 70.60  ? 15  C   B C4     1 
ATOM   7743  N N4     . C   B 2 15  ? 9.820   -6.394  110.474 1.00 69.76  ? 15  C   B N4     1 
ATOM   7744  C C5     . C   B 2 15  ? 7.551   -6.374  109.649 1.00 69.99  ? 15  C   B C5     1 
ATOM   7745  C C6     . C   B 2 15  ? 6.516   -5.609  109.275 1.00 71.04  ? 15  C   B C6     1 
ATOM   7746  H "H5'"  . C   B 2 15  ? 2.234   -5.100  107.631 1.00 85.93  ? 15  C   B "H5'"  1 
ATOM   7747  H "H5''" . C   B 2 15  ? 2.527   -4.696  106.130 1.00 85.93  ? 15  C   B "H5''" 1 
ATOM   7748  H "H4'"  . C   B 2 15  ? 3.192   -2.974  107.512 1.00 87.07  ? 15  C   B "H4'"  1 
ATOM   7749  H "H3'"  . C   B 2 15  ? 5.471   -4.248  106.441 1.00 87.70  ? 15  C   B "H3'"  1 
ATOM   7750  H "H2'"  . C   B 2 15  ? 6.743   -2.606  107.412 1.00 90.73  ? 15  C   B "H2'"  1 
ATOM   7751  H "HO2'" . C   B 2 15  ? 5.436   -0.866  107.019 1.00 93.23  ? 15  C   B "HO2'" 1 
ATOM   7752  H "H1'"  . C   B 2 15  ? 5.391   -2.680  109.640 1.00 88.76  ? 15  C   B "H1'"  1 
ATOM   7753  H H41    . C   B 2 15  ? 9.815   -7.254  110.473 1.00 81.76  ? 15  C   B H41    1 
ATOM   7754  H H42    . C   B 2 15  ? 10.524  -5.969  110.726 1.00 81.76  ? 15  C   B H42    1 
ATOM   7755  H H5     . C   B 2 15  ? 7.495   -7.302  109.624 1.00 82.03  ? 15  C   B H5     1 
ATOM   7756  H H6     . C   B 2 15  ? 5.725   -6.007  108.991 1.00 83.29  ? 15  C   B H6     1 
ATOM   7757  P P      . G   B 2 16  ? 5.451   -3.169  104.052 1.00 77.86  ? 16  G   B P      1 
ATOM   7758  O OP1    . G   B 2 16  ? 4.941   -2.244  103.015 1.00 81.61  ? 16  G   B OP1    1 
ATOM   7759  O OP2    . G   B 2 16  ? 5.354   -4.635  103.830 1.00 79.30  ? 16  G   B OP2    1 
ATOM   7760  O "O5'"  . G   B 2 16  ? 6.980   -2.789  104.292 1.00 76.39  ? 16  G   B "O5'"  1 
ATOM   7761  C "C5'"  . G   B 2 16  ? 7.386   -1.430  104.334 1.00 78.19  ? 16  G   B "C5'"  1 
ATOM   7762  C "C4'"  . G   B 2 16  ? 8.716   -1.265  105.024 1.00 78.03  ? 16  G   B "C4'"  1 
ATOM   7763  O "O4'"  . G   B 2 16  ? 8.688   -1.945  106.306 1.00 76.51  ? 16  G   B "O4'"  1 
ATOM   7764  C "C3'"  . G   B 2 16  ? 9.914   -1.864  104.303 1.00 81.00  ? 16  G   B "C3'"  1 
ATOM   7765  O "O3'"  . G   B 2 16  ? 10.439  -0.997  103.305 1.00 84.26  ? 16  G   B "O3'"  1 
ATOM   7766  C "C2'"  . G   B 2 16  ? 10.888  -2.132  105.446 1.00 82.52  ? 16  G   B "C2'"  1 
ATOM   7767  O "O2'"  . G   B 2 16  ? 11.572  -0.945  105.828 1.00 87.91  ? 16  G   B "O2'"  1 
ATOM   7768  C "C1'"  . G   B 2 16  ? 9.941   -2.531  106.575 1.00 76.62  ? 16  G   B "C1'"  1 
ATOM   7769  N N9     . G   B 2 16  ? 9.758   -3.993  106.683 1.00 75.03  ? 16  G   B N9     1 
ATOM   7770  C C8     . G   B 2 16  ? 8.724   -4.716  106.141 1.00 76.92  ? 16  G   B C8     1 
ATOM   7771  N N7     . G   B 2 16  ? 8.794   -5.993  106.397 1.00 78.40  ? 16  G   B N7     1 
ATOM   7772  C C5     . G   B 2 16  ? 9.948   -6.131  107.158 1.00 75.44  ? 16  G   B C5     1 
ATOM   7773  C C6     . G   B 2 16  ? 10.534  -7.296  107.726 1.00 71.63  ? 16  G   B C6     1 
ATOM   7774  O O6     . G   B 2 16  ? 10.144  -8.475  107.668 1.00 68.78  ? 16  G   B O6     1 
ATOM   7775  N N1     . G   B 2 16  ? 11.693  -6.983  108.428 1.00 69.40  ? 16  G   B N1     1 
ATOM   7776  C C2     . G   B 2 16  ? 12.220  -5.727  108.554 1.00 70.99  ? 16  G   B C2     1 
ATOM   7777  N N2     . G   B 2 16  ? 13.349  -5.641  109.269 1.00 71.11  ? 16  G   B N2     1 
ATOM   7778  N N3     . G   B 2 16  ? 11.686  -4.639  108.030 1.00 72.47  ? 16  G   B N3     1 
ATOM   7779  C C4     . G   B 2 16  ? 10.555  -4.906  107.348 1.00 72.88  ? 16  G   B C4     1 
ATOM   7780  H "H5'"  . G   B 2 16  ? 6.717   -0.915  104.811 1.00 93.39  ? 16  G   B "H5'"  1 
ATOM   7781  H "H5''" . G   B 2 16  ? 7.457   -1.093  103.427 1.00 93.39  ? 16  G   B "H5''" 1 
ATOM   7782  H "H4'"  . G   B 2 16  ? 8.878   -0.321  105.172 1.00 93.08  ? 16  G   B "H4'"  1 
ATOM   7783  H "H3'"  . G   B 2 16  ? 9.656   -2.705  103.896 1.00 97.59  ? 16  G   B "H3'"  1 
ATOM   7784  H "H2'"  . G   B 2 16  ? 11.505  -2.849  105.229 1.00 99.41  ? 16  G   B "H2'"  1 
ATOM   7785  H "HO2'" . G   B 2 16  ? 11.593  -0.419  105.173 1.00 105.88 ? 16  G   B "HO2'" 1 
ATOM   7786  H "H1'"  . G   B 2 16  ? 10.281  -2.187  107.416 1.00 92.34  ? 16  G   B "H1'"  1 
ATOM   7787  H H8     . G   B 2 16  ? 8.041   -4.333  105.639 1.00 92.69  ? 16  G   B H8     1 
ATOM   7788  H H1     . G   B 2 16  ? 12.118  -7.631  108.800 1.00 82.68  ? 16  G   B H1     1 
ATOM   7789  H H21    . G   B 2 16  ? 13.697  -6.350  109.610 1.00 85.71  ? 16  G   B H21    1 
ATOM   7790  H H22    . G   B 2 16  ? 13.726  -4.877  109.388 1.00 85.71  ? 16  G   B H22    1 
ATOM   7791  P P      . A   B 2 17  ? 10.267  -1.299  101.730 1.00 111.09 ? 17  A   B P      1 
ATOM   7792  O OP1    . A   B 2 17  ? 9.808   -0.042  101.092 1.00 117.32 ? 17  A   B OP1    1 
ATOM   7793  O OP2    . A   B 2 17  ? 9.467   -2.530  101.525 1.00 109.92 ? 17  A   B OP2    1 
ATOM   7794  O "O5'"  . A   B 2 17  ? 11.757  -1.535  101.223 1.00 104.10 ? 17  A   B "O5'"  1 
ATOM   7795  C "C5'"  . A   B 2 17  ? 12.272  -2.845  101.045 1.00 108.60 ? 17  A   B "C5'"  1 
ATOM   7796  C "C4'"  . A   B 2 17  ? 13.358  -3.149  102.041 1.00 110.88 ? 17  A   B "C4'"  1 
ATOM   7797  O "O4'"  . A   B 2 17  ? 12.744  -3.717  103.229 1.00 112.01 ? 17  A   B "O4'"  1 
ATOM   7798  C "C3'"  . A   B 2 17  ? 14.381  -4.195  101.610 1.00 110.95 ? 17  A   B "C3'"  1 
ATOM   7799  O "O3'"  . A   B 2 17  ? 15.456  -3.694  100.821 1.00 109.90 ? 17  A   B "O3'"  1 
ATOM   7800  C "C2'"  . A   B 2 17  ? 14.844  -4.773  102.939 1.00 113.69 ? 17  A   B "C2'"  1 
ATOM   7801  O "O2'"  . A   B 2 17  ? 15.794  -3.921  103.563 1.00 115.50 ? 17  A   B "O2'"  1 
ATOM   7802  C "C1'"  . A   B 2 17  ? 13.550  -4.750  103.749 1.00 113.99 ? 17  A   B "C1'"  1 
ATOM   7803  N N9     . A   B 2 17  ? 12.805  -6.021  103.637 1.00 117.77 ? 17  A   B N9     1 
ATOM   7804  C C8     . A   B 2 17  ? 11.992  -6.426  102.604 1.00 120.61 ? 17  A   B C8     1 
ATOM   7805  N N7     . A   B 2 17  ? 11.465  -7.616  102.775 1.00 120.02 ? 17  A   B N7     1 
ATOM   7806  C C5     . A   B 2 17  ? 11.966  -8.028  104.007 1.00 117.56 ? 17  A   B C5     1 
ATOM   7807  C C6     . A   B 2 17  ? 11.786  -9.207  104.765 1.00 114.18 ? 17  A   B C6     1 
ATOM   7808  N N6     . A   B 2 17  ? 11.022  -10.237 104.386 1.00 113.69 ? 17  A   B N6     1 
ATOM   7809  N N1     . A   B 2 17  ? 12.434  -9.298  105.948 1.00 109.79 ? 17  A   B N1     1 
ATOM   7810  C C2     . A   B 2 17  ? 13.208  -8.274  106.330 1.00 110.49 ? 17  A   B C2     1 
ATOM   7811  N N3     . A   B 2 17  ? 13.446  -7.114  105.717 1.00 112.71 ? 17  A   B N3     1 
ATOM   7812  C C4     . A   B 2 17  ? 12.794  -7.055  104.545 1.00 115.88 ? 17  A   B C4     1 
ATOM   7813  H "H5'"  . A   B 2 17  ? 12.633  -2.925  100.148 1.00 130.71 ? 17  A   B "H5'"  1 
ATOM   7814  H "H5''" . A   B 2 17  ? 11.552  -3.486  101.155 1.00 130.71 ? 17  A   B "H5''" 1 
ATOM   7815  H "H4'"  . A   B 2 17  ? 13.817  -2.328  102.278 1.00 133.45 ? 17  A   B "H4'"  1 
ATOM   7816  H "H3'"  . A   B 2 17  ? 13.925  -4.889  101.110 1.00 133.53 ? 17  A   B "H3'"  1 
ATOM   7817  H "H2'"  . A   B 2 17  ? 15.183  -5.676  102.837 1.00 136.82 ? 17  A   B "H2'"  1 
ATOM   7818  H "HO2'" . A   B 2 17  ? 16.507  -3.934  103.117 1.00 138.99 ? 17  A   B "HO2'" 1 
ATOM   7819  H "H1'"  . A   B 2 17  ? 13.750  -4.569  104.681 1.00 137.18 ? 17  A   B "H1'"  1 
ATOM   7820  H H8     . A   B 2 17  ? 11.827  -5.902  101.854 1.00 145.13 ? 17  A   B H8     1 
ATOM   7821  H H61    . A   B 2 17  ? 10.953  -10.930 104.890 1.00 136.82 ? 17  A   B H61    1 
ATOM   7822  H H62    . A   B 2 17  ? 10.599  -10.206 103.638 1.00 136.82 ? 17  A   B H62    1 
ATOM   7823  H H2     . A   B 2 17  ? 13.626  -8.379  107.154 1.00 132.98 ? 17  A   B H2     1 
ATOM   7824  P P      . G   B 2 18  ? 15.454  -2.222  100.163 1.00 148.70 ? 18  G   B P      1 
ATOM   7825  O OP1    . G   B 2 18  ? 15.475  -1.189  101.225 1.00 153.42 ? 18  G   B OP1    1 
ATOM   7826  O OP2    . G   B 2 18  ? 14.468  -2.157  99.057  1.00 149.09 ? 18  G   B OP2    1 
ATOM   7827  O "O5'"  . G   B 2 18  ? 16.883  -2.132  99.475  1.00 162.48 ? 18  G   B "O5'"  1 
ATOM   7828  C "C5'"  . G   B 2 18  ? 18.059  -1.954  100.251 1.00 163.19 ? 18  G   B "C5'"  1 
ATOM   7829  C "C4'"  . G   B 2 18  ? 19.180  -2.851  99.782  1.00 161.95 ? 18  G   B "C4'"  1 
ATOM   7830  O "O4'"  . G   B 2 18  ? 20.440  -2.370  100.328 1.00 159.29 ? 18  G   B "O4'"  1 
ATOM   7831  C "C3'"  . G   B 2 18  ? 19.102  -4.308  100.230 1.00 160.61 ? 18  G   B "C3'"  1 
ATOM   7832  O "O3'"  . G   B 2 18  ? 18.202  -5.087  99.437  1.00 162.24 ? 18  G   B "O3'"  1 
ATOM   7833  C "C2'"  . G   B 2 18  ? 20.568  -4.732  100.227 1.00 156.72 ? 18  G   B "C2'"  1 
ATOM   7834  O "O2'"  . G   B 2 18  ? 21.050  -4.973  98.912  1.00 156.44 ? 18  G   B "O2'"  1 
ATOM   7835  C "C1'"  . G   B 2 18  ? 21.235  -3.458  100.743 1.00 155.57 ? 18  G   B "C1'"  1 
ATOM   7836  N N9     . G   B 2 18  ? 21.314  -3.404  102.216 1.00 149.90 ? 18  G   B N9     1 
ATOM   7837  C C8     . G   B 2 18  ? 20.489  -2.676  103.037 1.00 146.41 ? 18  G   B C8     1 
ATOM   7838  N N7     . G   B 2 18  ? 20.785  -2.791  104.300 1.00 143.78 ? 18  G   B N7     1 
ATOM   7839  C C5     . G   B 2 18  ? 21.877  -3.642  104.318 1.00 144.10 ? 18  G   B C5     1 
ATOM   7840  C C6     . G   B 2 18  ? 22.637  -4.134  105.408 1.00 144.18 ? 18  G   B C6     1 
ATOM   7841  O O6     . G   B 2 18  ? 22.494  -3.910  106.615 1.00 145.16 ? 18  G   B O6     1 
ATOM   7842  N N1     . G   B 2 18  ? 23.658  -4.971  104.975 1.00 144.18 ? 18  G   B N1     1 
ATOM   7843  C C2     . G   B 2 18  ? 23.915  -5.291  103.664 1.00 144.61 ? 18  G   B C2     1 
ATOM   7844  N N2     . G   B 2 18  ? 24.948  -6.114  103.443 1.00 142.92 ? 18  G   B N2     1 
ATOM   7845  N N3     . G   B 2 18  ? 23.215  -4.841  102.639 1.00 146.37 ? 18  G   B N3     1 
ATOM   7846  C C4     . G   B 2 18  ? 22.219  -4.026  103.038 1.00 147.08 ? 18  G   B C4     1 
ATOM   7847  H "H5'"  . G   B 2 18  ? 17.859  -2.158  101.178 1.00 196.22 ? 18  G   B "H5'"  1 
ATOM   7848  H "H5''" . G   B 2 18  ? 18.345  -1.030  100.185 1.00 196.22 ? 18  G   B "H5''" 1 
ATOM   7849  H "H4'"  . G   B 2 18  ? 19.224  -2.820  98.814  1.00 194.73 ? 18  G   B "H4'"  1 
ATOM   7850  H "H3'"  . G   B 2 18  ? 18.786  -4.326  101.146 1.00 193.13 ? 18  G   B "H3'"  1 
ATOM   7851  H "H2'"  . G   B 2 18  ? 20.728  -5.484  100.817 1.00 188.45 ? 18  G   B "H2'"  1 
ATOM   7852  H "HO2'" . G   B 2 18  ? 21.212  -5.793  98.827  1.00 188.12 ? 18  G   B "HO2'" 1 
ATOM   7853  H "H1'"  . G   B 2 18  ? 22.124  -3.376  100.363 1.00 187.07 ? 18  G   B "H1'"  1 
ATOM   7854  H H8     . G   B 2 18  ? 19.785  -2.156  102.722 1.00 176.08 ? 18  G   B H8     1 
ATOM   7855  H H1     . G   B 2 18  ? 24.170  -5.315  105.575 1.00 173.40 ? 18  G   B H1     1 
ATOM   7856  H H21    . G   B 2 18  ? 25.409  -6.413  104.105 1.00 171.90 ? 18  G   B H21    1 
ATOM   7857  H H22    . G   B 2 18  ? 25.150  -6.345  102.640 1.00 171.90 ? 18  G   B H22    1 
ATOM   7858  P P      . U   B 2 19  ? 18.622  -6.439  98.662  1.00 125.56 ? 19  U   B P      1 
ATOM   7859  O OP1    . U   B 2 19  ? 19.659  -6.120  97.650  1.00 125.25 ? 19  U   B OP1    1 
ATOM   7860  O OP2    . U   B 2 19  ? 17.363  -7.092  98.221  1.00 125.59 ? 19  U   B OP2    1 
ATOM   7861  O "O5'"  . U   B 2 19  ? 19.268  -7.374  99.776  1.00 130.57 ? 19  U   B "O5'"  1 
ATOM   7862  C "C5'"  . U   B 2 19  ? 19.700  -8.690  99.455  1.00 127.86 ? 19  U   B "C5'"  1 
ATOM   7863  C "C4'"  . U   B 2 19  ? 20.315  -9.359  100.655 1.00 124.78 ? 19  U   B "C4'"  1 
ATOM   7864  O "O4'"  . U   B 2 19  ? 20.262  -8.435  101.766 1.00 123.29 ? 19  U   B "O4'"  1 
ATOM   7865  C "C3'"  . U   B 2 19  ? 19.613  -10.625 101.142 1.00 121.51 ? 19  U   B "C3'"  1 
ATOM   7866  O "O3'"  . U   B 2 19  ? 20.173  -11.800 100.561 1.00 121.94 ? 19  U   B "O3'"  1 
ATOM   7867  C "C2'"  . U   B 2 19  ? 19.806  -10.602 102.660 1.00 120.21 ? 19  U   B "C2'"  1 
ATOM   7868  O "O2'"  . U   B 2 19  ? 20.960  -11.334 103.042 1.00 120.92 ? 19  U   B "O2'"  1 
ATOM   7869  C "C1'"  . U   B 2 19  ? 20.039  -9.119  102.968 1.00 123.02 ? 19  U   B "C1'"  1 
ATOM   7870  N N1     . U   B 2 19  ? 18.946  -8.444  103.712 1.00 127.71 ? 19  U   B N1     1 
ATOM   7871  C C2     . U   B 2 19  ? 17.591  -8.698  103.503 1.00 123.05 ? 19  U   B C2     1 
ATOM   7872  O O2     . U   B 2 19  ? 17.142  -9.480  102.677 1.00 117.75 ? 19  U   B O2     1 
ATOM   7873  N N3     . U   B 2 19  ? 16.759  -7.954  104.311 1.00 122.11 ? 19  U   B N3     1 
ATOM   7874  C C4     . U   B 2 19  ? 17.126  -7.028  105.278 1.00 123.18 ? 19  U   B C4     1 
ATOM   7875  O O4     . U   B 2 19  ? 16.261  -6.440  105.930 1.00 123.16 ? 19  U   B O4     1 
ATOM   7876  C C5     . U   B 2 19  ? 18.531  -6.833  105.436 1.00 124.32 ? 19  U   B C5     1 
ATOM   7877  C C6     . U   B 2 19  ? 19.361  -7.533  104.664 1.00 127.96 ? 19  U   B C6     1 
ATOM   7878  H "H5'"  . U   B 2 19  ? 20.357  -8.645  98.743  1.00 153.83 ? 19  U   B "H5'"  1 
ATOM   7879  H "H5''" . U   B 2 19  ? 18.939  -9.210  99.155  1.00 153.83 ? 19  U   B "H5''" 1 
ATOM   7880  H "H4'"  . U   B 2 19  ? 21.243  -9.567  100.461 1.00 150.13 ? 19  U   B "H4'"  1 
ATOM   7881  H "H3'"  . U   B 2 19  ? 18.667  -10.575 100.932 1.00 146.20 ? 19  U   B "H3'"  1 
ATOM   7882  H "H2'"  . U   B 2 19  ? 19.016  -10.931 103.117 1.00 144.64 ? 19  U   B "H2'"  1 
ATOM   7883  H "HO2'" . U   B 2 19  ? 20.836  -12.148 102.875 1.00 145.49 ? 19  U   B "HO2'" 1 
ATOM   7884  H "H1'"  . U   B 2 19  ? 20.846  -9.051  103.502 1.00 148.01 ? 19  U   B "H1'"  1 
ATOM   7885  H H3     . U   B 2 19  ? 15.915  -8.081  104.206 1.00 146.92 ? 19  U   B H3     1 
ATOM   7886  H H5     . U   B 2 19  ? 18.860  -6.230  106.063 1.00 149.58 ? 19  U   B H5     1 
ATOM   7887  H H6     . U   B 2 19  ? 20.275  -7.402  104.774 1.00 153.94 ? 19  U   B H6     1 
ATOM   7888  P P      . C   B 2 20  ? 19.769  -12.341 99.095  1.00 112.46 ? 20  C   B P      1 
ATOM   7889  O OP1    . C   B 2 20  ? 20.658  -13.501 98.832  1.00 106.71 ? 20  C   B OP1    1 
ATOM   7890  O OP2    . C   B 2 20  ? 19.734  -11.228 98.114  1.00 112.59 ? 20  C   B OP2    1 
ATOM   7891  O "O5'"  . C   B 2 20  ? 18.291  -12.919 99.274  1.00 121.32 ? 20  C   B "O5'"  1 
ATOM   7892  C "C5'"  . C   B 2 20  ? 18.053  -14.114 100.009 1.00 114.76 ? 20  C   B "C5'"  1 
ATOM   7893  C "C4'"  . C   B 2 20  ? 16.581  -14.447 100.080 1.00 108.69 ? 20  C   B "C4'"  1 
ATOM   7894  O "O4'"  . C   B 2 20  ? 15.887  -13.451 100.879 1.00 107.13 ? 20  C   B "O4'"  1 
ATOM   7895  C "C3'"  . C   B 2 20  ? 15.838  -14.445 98.754  1.00 107.49 ? 20  C   B "C3'"  1 
ATOM   7896  O "O3'"  . C   B 2 20  ? 16.017  -15.646 98.018  1.00 109.22 ? 20  C   B "O3'"  1 
ATOM   7897  C "C2'"  . C   B 2 20  ? 14.399  -14.177 99.180  1.00 102.69 ? 20  C   B "C2'"  1 
ATOM   7898  O "O2'"  . C   B 2 20  ? 13.780  -15.352 99.685  1.00 95.05  ? 20  C   B "O2'"  1 
ATOM   7899  C "C1'"  . C   B 2 20  ? 14.606  -13.204 100.340 1.00 106.73 ? 20  C   B "C1'"  1 
ATOM   7900  N N1     . C   B 2 20  ? 14.533  -11.781 99.926  1.00 111.49 ? 20  C   B N1     1 
ATOM   7901  C C2     . C   B 2 20  ? 13.326  -11.248 99.445  1.00 116.07 ? 20  C   B C2     1 
ATOM   7902  O O2     . C   B 2 20  ? 12.329  -11.976 99.339  1.00 119.43 ? 20  C   B O2     1 
ATOM   7903  N N3     . C   B 2 20  ? 13.268  -9.947  99.085  1.00 116.51 ? 20  C   B N3     1 
ATOM   7904  C C4     . C   B 2 20  ? 14.347  -9.179  99.200  1.00 118.23 ? 20  C   B C4     1 
ATOM   7905  N N4     . C   B 2 20  ? 14.243  -7.901  98.835  1.00 123.89 ? 20  C   B N4     1 
ATOM   7906  C C5     . C   B 2 20  ? 15.583  -9.682  99.697  1.00 114.47 ? 20  C   B C5     1 
ATOM   7907  C C6     . C   B 2 20  ? 15.629  -10.971 100.049 1.00 111.40 ? 20  C   B C6     1 
ATOM   7908  H "H5'"  . C   B 2 20  ? 18.395  -14.004 100.909 1.00 138.10 ? 20  C   B "H5'"  1 
ATOM   7909  H "H5''" . C   B 2 20  ? 18.521  -14.847 99.580  1.00 138.10 ? 20  C   B "H5''" 1 
ATOM   7910  H "H4'"  . C   B 2 20  ? 16.476  -15.316 100.498 1.00 130.81 ? 20  C   B "H4'"  1 
ATOM   7911  H "H3'"  . C   B 2 20  ? 16.151  -13.699 98.219  1.00 129.37 ? 20  C   B "H3'"  1 
ATOM   7912  H "H2'"  . C   B 2 20  ? 13.882  -13.774 98.465  1.00 123.62 ? 20  C   B "H2'"  1 
ATOM   7913  H "HO2'" . C   B 2 20  ? 13.659  -15.264 100.512 1.00 114.45 ? 20  C   B "HO2'" 1 
ATOM   7914  H "H1'"  . C   B 2 20  ? 13.936  -13.373 101.021 1.00 128.47 ? 20  C   B "H1'"  1 
ATOM   7915  H H41    . C   B 2 20  ? 14.923  -7.379  98.898  1.00 149.06 ? 20  C   B H41    1 
ATOM   7916  H H42    . C   B 2 20  ? 13.495  -7.598  98.537  1.00 149.06 ? 20  C   B H42    1 
ATOM   7917  H H5     . C   B 2 20  ? 16.331  -9.134  99.773  1.00 137.75 ? 20  C   B H5     1 
ATOM   7918  H H6     . C   B 2 20  ? 16.424  -11.327 100.376 1.00 134.07 ? 20  C   B H6     1 
ATOM   7919  P P      . C   B 2 21  ? 15.955  -15.628 96.409  1.00 96.69  ? 21  C   B P      1 
ATOM   7920  O OP1    . C   B 2 21  ? 16.192  -16.997 95.868  1.00 92.20  ? 21  C   B OP1    1 
ATOM   7921  O OP2    . C   B 2 21  ? 16.799  -14.503 95.933  1.00 93.59  ? 21  C   B OP2    1 
ATOM   7922  O "O5'"  . C   B 2 21  ? 14.437  -15.260 96.114  1.00 95.10  ? 21  C   B "O5'"  1 
ATOM   7923  C "C5'"  . C   B 2 21  ? 13.387  -16.145 96.472  1.00 91.06  ? 21  C   B "C5'"  1 
ATOM   7924  C "C4'"  . C   B 2 21  ? 12.106  -15.754 95.787  1.00 93.00  ? 21  C   B "C4'"  1 
ATOM   7925  O "O4'"  . C   B 2 21  ? 11.639  -14.482 96.318  1.00 94.00  ? 21  C   B "O4'"  1 
ATOM   7926  C "C3'"  . C   B 2 21  ? 12.217  -15.508 94.288  1.00 98.85  ? 21  C   B "C3'"  1 
ATOM   7927  O "O3'"  . C   B 2 21  ? 12.224  -16.700 93.512  1.00 103.73 ? 21  C   B "O3'"  1 
ATOM   7928  C "C2'"  . C   B 2 21  ? 11.039  -14.580 94.024  1.00 94.79  ? 21  C   B "C2'"  1 
ATOM   7929  O "O2'"  . C   B 2 21  ? 9.806   -15.289 93.979  1.00 85.91  ? 21  C   B "O2'"  1 
ATOM   7930  C "C1'"  . C   B 2 21  ? 11.073  -13.706 95.278  1.00 96.67  ? 21  C   B "C1'"  1 
ATOM   7931  N N1     . C   B 2 21  ? 11.904  -12.489 95.082  1.00 97.16  ? 21  C   B N1     1 
ATOM   7932  C C2     . C   B 2 21  ? 11.479  -11.511 94.166  1.00 98.14  ? 21  C   B C2     1 
ATOM   7933  O O2     . C   B 2 21  ? 10.421  -11.674 93.538  1.00 96.94  ? 21  C   B O2     1 
ATOM   7934  N N3     . C   B 2 21  ? 12.226  -10.398 93.974  1.00 99.46  ? 21  C   B N3     1 
ATOM   7935  C C4     . C   B 2 21  ? 13.360  -10.231 94.652  1.00 98.08  ? 21  C   B C4     1 
ATOM   7936  N N4     . C   B 2 21  ? 14.055  -9.114  94.426  1.00 97.63  ? 21  C   B N4     1 
ATOM   7937  C C5     . C   B 2 21  ? 13.824  -11.204 95.589  1.00 95.78  ? 21  C   B C5     1 
ATOM   7938  C C6     . C   B 2 21  ? 13.076  -12.303 95.772  1.00 94.27  ? 21  C   B C6     1 
ATOM   7939  H "H5'"  . C   B 2 21  ? 13.258  -16.116 97.433  1.00 109.66 ? 21  C   B "H5'"  1 
ATOM   7940  H "H5''" . C   B 2 21  ? 13.627  -17.048 96.209  1.00 109.66 ? 21  C   B "H5''" 1 
ATOM   7941  H "H4'"  . C   B 2 21  ? 11.435  -16.435 95.951  1.00 112.00 ? 21  C   B "H4'"  1 
ATOM   7942  H "H3'"  . C   B 2 21  ? 13.039  -15.022 94.114  1.00 119.01 ? 21  C   B "H3'"  1 
ATOM   7943  H "H2'"  . C   B 2 21  ? 11.177  -14.052 93.222  1.00 114.13 ? 21  C   B "H2'"  1 
ATOM   7944  H "HO2'" . C   B 2 21  ? 9.347   -15.082 94.651  1.00 103.48 ? 21  C   B "HO2'" 1 
ATOM   7945  H "H1'"  . C   B 2 21  ? 10.170  -13.448 95.520  1.00 116.39 ? 21  C   B "H1'"  1 
ATOM   7946  H H41    . C   B 2 21  ? 14.792  -8.973  94.846  1.00 117.55 ? 21  C   B H41    1 
ATOM   7947  H H42    . C   B 2 21  ? 13.765  -8.535  93.859  1.00 117.55 ? 21  C   B H42    1 
ATOM   7948  H H5     . C   B 2 21  ? 14.617  -11.079 96.059  1.00 115.33 ? 21  C   B H5     1 
ATOM   7949  H H6     . C   B 2 21  ? 13.357  -12.951 96.377  1.00 113.52 ? 21  C   B H6     1 
ATOM   7950  P P      . U   B 2 22  ? 13.214  -16.858 92.249  1.00 96.40  ? 22  U   B P      1 
ATOM   7951  O OP1    . U   B 2 22  ? 13.286  -18.289 91.863  1.00 98.36  ? 22  U   B OP1    1 
ATOM   7952  O OP2    . U   B 2 22  ? 14.459  -16.092 92.503  1.00 98.48  ? 22  U   B OP2    1 
ATOM   7953  O "O5'"  . U   B 2 22  ? 12.464  -16.100 91.078  1.00 94.44  ? 22  U   B "O5'"  1 
ATOM   7954  C "C5'"  . U   B 2 22  ? 11.063  -16.221 90.904  1.00 100.11 ? 22  U   B "C5'"  1 
ATOM   7955  C "C4'"  . U   B 2 22  ? 10.521  -15.042 90.141  1.00 110.22 ? 22  U   B "C4'"  1 
ATOM   7956  O "O4'"  . U   B 2 22  ? 10.457  -13.867 91.006  1.00 111.12 ? 22  U   B "O4'"  1 
ATOM   7957  C "C3'"  . U   B 2 22  ? 11.366  -14.568 88.966  1.00 115.16 ? 22  U   B "C3'"  1 
ATOM   7958  O "O3'"  . U   B 2 22  ? 11.271  -15.386 87.810  1.00 119.04 ? 22  U   B "O3'"  1 
ATOM   7959  C "C2'"  . U   B 2 22  ? 10.879  -13.137 88.802  1.00 112.53 ? 22  U   B "C2'"  1 
ATOM   7960  O "O2'"  . U   B 2 22  ? 9.562   -13.089 88.263  1.00 107.94 ? 22  U   B "O2'"  1 
ATOM   7961  C "C1'"  . U   B 2 22  ? 10.821  -12.715 90.266  1.00 111.87 ? 22  U   B "C1'"  1 
ATOM   7962  N N1     . U   B 2 22  ? 12.153  -12.260 90.736  1.00 110.91 ? 22  U   B N1     1 
ATOM   7963  C C2     . U   B 2 22  ? 12.589  -11.019 90.318  1.00 114.03 ? 22  U   B C2     1 
ATOM   7964  O O2     . U   B 2 22  ? 11.920  -10.292 89.600  1.00 115.97 ? 22  U   B O2     1 
ATOM   7965  N N3     . U   B 2 22  ? 13.836  -10.659 90.776  1.00 113.38 ? 22  U   B N3     1 
ATOM   7966  C C4     . U   B 2 22  ? 14.678  -11.397 91.585  1.00 107.60 ? 22  U   B C4     1 
ATOM   7967  O O4     . U   B 2 22  ? 15.771  -10.930 91.911  1.00 105.89 ? 22  U   B O4     1 
ATOM   7968  C C5     . U   B 2 22  ? 14.167  -12.675 91.970  1.00 103.58 ? 22  U   B C5     1 
ATOM   7969  C C6     . U   B 2 22  ? 12.958  -13.047 91.537  1.00 106.09 ? 22  U   B C6     1 
ATOM   7970  H "H5'"  . U   B 2 22  ? 10.635  -16.264 91.773  1.00 120.53 ? 22  U   B "H5'"  1 
ATOM   7971  H "H5''" . U   B 2 22  ? 10.871  -17.035 90.412  1.00 120.53 ? 22  U   B "H5''" 1 
ATOM   7972  H "H4'"  . U   B 2 22  ? 9.628   -15.251 89.825  1.00 132.65 ? 22  U   B "H4'"  1 
ATOM   7973  H "H3'"  . U   B 2 22  ? 12.294  -14.545 89.247  1.00 138.59 ? 22  U   B "H3'"  1 
ATOM   7974  H "H2'"  . U   B 2 22  ? 11.504  -12.596 88.295  1.00 135.43 ? 22  U   B "H2'"  1 
ATOM   7975  H "HO2'" . U   B 2 22  ? 9.030   -12.839 88.863  1.00 129.92 ? 22  U   B "HO2'" 1 
ATOM   7976  H "H1'"  . U   B 2 22  ? 10.162  -12.014 90.389  1.00 134.64 ? 22  U   B "H1'"  1 
ATOM   7977  H H3     . U   B 2 22  ? 14.123  -9.886  90.531  1.00 136.45 ? 22  U   B H3     1 
ATOM   7978  H H5     . U   B 2 22  ? 14.667  -13.238 92.516  1.00 124.69 ? 22  U   B H5     1 
ATOM   7979  H H6     . U   B 2 22  ? 12.636  -13.880 91.797  1.00 127.70 ? 22  U   B H6     1 
ATOM   7980  P P      . G   B 2 23  ? 12.559  -16.196 87.265  1.00 102.19 ? 23  G   B P      1 
ATOM   7981  O OP1    . G   B 2 23  ? 12.103  -17.577 86.978  1.00 103.17 ? 23  G   B OP1    1 
ATOM   7982  O OP2    . G   B 2 23  ? 13.746  -16.023 88.147  1.00 94.93  ? 23  G   B OP2    1 
ATOM   7983  O "O5'"  . G   B 2 23  ? 12.867  -15.492 85.872  1.00 97.24  ? 23  G   B "O5'"  1 
ATOM   7984  C "C5'"  . G   B 2 23  ? 11.844  -15.350 84.900  1.00 96.31  ? 23  G   B "C5'"  1 
ATOM   7985  C "C4'"  . G   B 2 23  ? 11.701  -13.921 84.453  1.00 98.89  ? 23  G   B "C4'"  1 
ATOM   7986  O "O4'"  . G   B 2 23  ? 11.528  -13.053 85.603  1.00 100.29 ? 23  G   B "O4'"  1 
ATOM   7987  C "C3'"  . G   B 2 23  ? 12.896  -13.316 83.741  1.00 105.36 ? 23  G   B "C3'"  1 
ATOM   7988  O "O3'"  . G   B 2 23  ? 13.038  -13.745 82.399  1.00 108.52 ? 23  G   B "O3'"  1 
ATOM   7989  C "C2'"  . G   B 2 23  ? 12.627  -11.828 83.898  1.00 111.12 ? 23  G   B "C2'"  1 
ATOM   7990  O "O2'"  . G   B 2 23  ? 11.597  -11.394 83.020  1.00 117.40 ? 23  G   B "O2'"  1 
ATOM   7991  C "C1'"  . G   B 2 23  ? 12.093  -11.784 85.327  1.00 107.06 ? 23  G   B "C1'"  1 
ATOM   7992  N N9     . G   B 2 23  ? 13.167  -11.487 86.299  1.00 107.65 ? 23  G   B N9     1 
ATOM   7993  C C8     . G   B 2 23  ? 13.756  -12.299 87.242  1.00 103.20 ? 23  G   B C8     1 
ATOM   7994  N N7     . G   B 2 23  ? 14.686  -11.700 87.939  1.00 102.37 ? 23  G   B N7     1 
ATOM   7995  C C5     . G   B 2 23  ? 14.728  -10.414 87.416  1.00 108.67 ? 23  G   B C5     1 
ATOM   7996  C C6     . G   B 2 23  ? 15.542  -9.300  87.759  1.00 111.26 ? 23  G   B C6     1 
ATOM   7997  O O6     . G   B 2 23  ? 16.425  -9.221  88.625  1.00 111.34 ? 23  G   B O6     1 
ATOM   7998  N N1     . G   B 2 23  ? 15.245  -8.190  86.970  1.00 114.61 ? 23  G   B N1     1 
ATOM   7999  C C2     . G   B 2 23  ? 14.290  -8.153  85.978  1.00 116.55 ? 23  G   B C2     1 
ATOM   8000  N N2     . G   B 2 23  ? 14.148  -6.989  85.325  1.00 119.02 ? 23  G   B N2     1 
ATOM   8001  N N3     . G   B 2 23  ? 13.525  -9.181  85.650  1.00 115.23 ? 23  G   B N3     1 
ATOM   8002  C C4     . G   B 2 23  ? 13.797  -10.270 86.405  1.00 111.97 ? 23  G   B C4     1 
ATOM   8003  H "H5'"  . G   B 2 23  ? 11.003  -15.648 85.281  1.00 115.97 ? 23  G   B "H5'"  1 
ATOM   8004  H "H5''" . G   B 2 23  ? 12.057  -15.903 84.132  1.00 115.97 ? 23  G   B "H5''" 1 
ATOM   8005  H "H4'"  . G   B 2 23  ? 10.922  -13.846 83.880  1.00 119.06 ? 23  G   B "H4'"  1 
ATOM   8006  H "H3'"  . G   B 2 23  ? 13.702  -13.543 84.231  1.00 126.82 ? 23  G   B "H3'"  1 
ATOM   8007  H "H2'"  . G   B 2 23  ? 13.436  -11.302 83.800  1.00 133.74 ? 23  G   B "H2'"  1 
ATOM   8008  H "HO2'" . G   B 2 23  ? 11.505  -11.959 82.405  1.00 141.27 ? 23  G   B "HO2'" 1 
ATOM   8009  H "H1'"  . G   B 2 23  ? 11.404  -11.104 85.392  1.00 128.86 ? 23  G   B "H1'"  1 
ATOM   8010  H H8     . G   B 2 23  ? 13.505  -13.184 87.381  1.00 124.23 ? 23  G   B H8     1 
ATOM   8011  H H1     . G   B 2 23  ? 15.694  -7.471  87.113  1.00 137.93 ? 23  G   B H1     1 
ATOM   8012  H H21    . G   B 2 23  ? 14.642  -6.317  85.533  1.00 143.22 ? 23  G   B H21    1 
ATOM   8013  H H22    . G   B 2 23  ? 13.564  -6.916  84.699  1.00 143.22 ? 23  G   B H22    1 
ATOM   8014  P P      . C   B 2 24  ? 14.498  -14.083 81.806  1.00 104.27 ? 24  C   B P      1 
ATOM   8015  O OP1    . C   B 2 24  ? 14.300  -15.039 80.683  1.00 109.90 ? 24  C   B OP1    1 
ATOM   8016  O OP2    . C   B 2 24  ? 15.419  -14.429 82.928  1.00 89.80  ? 24  C   B OP2    1 
ATOM   8017  O "O5'"  . C   B 2 24  ? 14.985  -12.707 81.163  1.00 102.18 ? 24  C   B "O5'"  1 
ATOM   8018  C "C5'"  . C   B 2 24  ? 14.145  -11.970 80.283  1.00 102.33 ? 24  C   B "C5'"  1 
ATOM   8019  C "C4'"  . C   B 2 24  ? 14.430  -10.490 80.357  1.00 104.23 ? 24  C   B "C4'"  1 
ATOM   8020  O "O4'"  . C   B 2 24  ? 14.215  -10.003 81.712  1.00 104.75 ? 24  C   B "O4'"  1 
ATOM   8021  C "C3'"  . C   B 2 24  ? 15.857  -10.073 80.051  1.00 100.83 ? 24  C   B "C3'"  1 
ATOM   8022  O "O3'"  . C   B 2 24  ? 16.158  -10.064 78.670  1.00 97.35  ? 24  C   B "O3'"  1 
ATOM   8023  C "C2'"  . C   B 2 24  ? 15.946  -8.718  80.737  1.00 102.17 ? 24  C   B "C2'"  1 
ATOM   8024  O "O2'"  . C   B 2 24  ? 15.246  -7.716  80.006  1.00 100.02 ? 24  C   B "O2'"  1 
ATOM   8025  C "C1'"  . C   B 2 24  ? 15.177  -9.011  82.021  1.00 103.55 ? 24  C   B "C1'"  1 
ATOM   8026  N N1     . C   B 2 24  ? 16.064  -9.533  83.092  1.00 99.17  ? 24  C   B N1     1 
ATOM   8027  C C2     . C   B 2 24  ? 16.920  -8.649  83.754  1.00 101.59 ? 24  C   B C2     1 
ATOM   8028  O O2     . C   B 2 24  ? 16.922  -7.453  83.429  1.00 109.59 ? 24  C   B O2     1 
ATOM   8029  N N3     . C   B 2 24  ? 17.731  -9.107  84.731  1.00 95.14  ? 24  C   B N3     1 
ATOM   8030  C C4     . C   B 2 24  ? 17.715  -10.393 85.063  1.00 91.03  ? 24  C   B C4     1 
ATOM   8031  N N4     . C   B 2 24  ? 18.536  -10.789 86.038  1.00 91.59  ? 24  C   B N4     1 
ATOM   8032  C C5     . C   B 2 24  ? 16.858  -11.324 84.411  1.00 88.80  ? 24  C   B C5     1 
ATOM   8033  C C6     . C   B 2 24  ? 16.061  -10.856 83.443  1.00 92.27  ? 24  C   B C6     1 
ATOM   8034  H "H5'"  . C   B 2 24  ? 13.219  -12.127 80.524  1.00 123.18 ? 24  C   B "H5'"  1 
ATOM   8035  H "H5''" . C   B 2 24  ? 14.293  -12.276 79.375  1.00 123.18 ? 24  C   B "H5''" 1 
ATOM   8036  H "H4'"  . C   B 2 24  ? 13.829  -10.023 79.755  1.00 125.46 ? 24  C   B "H4'"  1 
ATOM   8037  H "H3'"  . C   B 2 24  ? 16.463  -10.687 80.496  1.00 121.39 ? 24  C   B "H3'"  1 
ATOM   8038  H "H2'"  . C   B 2 24  ? 16.865  -8.464  80.918  1.00 122.99 ? 24  C   B "H2'"  1 
ATOM   8039  H "HO2'" . C   B 2 24  ? 15.665  -7.551  79.297  1.00 120.41 ? 24  C   B "HO2'" 1 
ATOM   8040  H "H1'"  . C   B 2 24  ? 14.731  -8.206  82.327  1.00 124.65 ? 24  C   B "H1'"  1 
ATOM   8041  H H41    . C   B 2 24  ? 18.551  -11.615 86.279  1.00 110.29 ? 24  C   B H41    1 
ATOM   8042  H H42    . C   B 2 24  ? 19.050  -10.219 86.425  1.00 110.29 ? 24  C   B H42    1 
ATOM   8043  H H5     . C   B 2 24  ? 16.852  -12.223 84.649  1.00 106.95 ? 24  C   B H5     1 
ATOM   8044  H H6     . C   B 2 24  ? 15.488  -11.442 83.003  1.00 111.11 ? 24  C   B H6     1 
ATOM   8045  P P      . C   B 2 25  ? 17.305  -11.035 78.104  1.00 125.02 ? 25  C   B P      1 
ATOM   8046  O OP1    . C   B 2 25  ? 16.893  -11.466 76.745  1.00 125.40 ? 25  C   B OP1    1 
ATOM   8047  O OP2    . C   B 2 25  ? 17.655  -12.056 79.126  1.00 119.55 ? 25  C   B OP2    1 
ATOM   8048  O "O5'"  . C   B 2 25  ? 18.557  -10.071 77.935  1.00 116.25 ? 25  C   B "O5'"  1 
ATOM   8049  C "C5'"  . C   B 2 25  ? 18.464  -8.934  77.098  1.00 118.34 ? 25  C   B "C5'"  1 
ATOM   8050  C "C4'"  . C   B 2 25  ? 19.339  -7.815  77.589  1.00 119.54 ? 25  C   B "C4'"  1 
ATOM   8051  O "O4'"  . C   B 2 25  ? 19.011  -7.474  78.965  1.00 120.49 ? 25  C   B "O4'"  1 
ATOM   8052  C "C3'"  . C   B 2 25  ? 20.822  -8.108  77.649  1.00 115.44 ? 25  C   B "C3'"  1 
ATOM   8053  O "O3'"  . C   B 2 25  ? 21.452  -8.109  76.382  1.00 115.28 ? 25  C   B "O3'"  1 
ATOM   8054  C "C2'"  . C   B 2 25  ? 21.306  -7.025  78.596  1.00 117.91 ? 25  C   B "C2'"  1 
ATOM   8055  O "O2'"  . C   B 2 25  ? 21.324  -5.755  77.958  1.00 120.31 ? 25  C   B "O2'"  1 
ATOM   8056  C "C1'"  . C   B 2 25  ? 20.181  -7.030  79.628  1.00 118.55 ? 25  C   B "C1'"  1 
ATOM   8057  N N1     . C   B 2 25  ? 20.486  -7.947  80.745  1.00 113.18 ? 25  C   B N1     1 
ATOM   8058  C C2     . C   B 2 25  ? 21.529  -7.593  81.600  1.00 111.63 ? 25  C   B C2     1 
ATOM   8059  O O2     . C   B 2 25  ? 22.147  -6.538  81.394  1.00 114.58 ? 25  C   B O2     1 
ATOM   8060  N N3     . C   B 2 25  ? 21.850  -8.405  82.625  1.00 107.70 ? 25  C   B N3     1 
ATOM   8061  C C4     . C   B 2 25  ? 21.168  -9.529  82.813  1.00 107.23 ? 25  C   B C4     1 
ATOM   8062  N N4     . C   B 2 25  ? 21.522  -10.298 83.843  1.00 105.50 ? 25  C   B N4     1 
ATOM   8063  C C5     . C   B 2 25  ? 20.098  -9.918  81.955  1.00 108.76 ? 25  C   B C5     1 
ATOM   8064  C C6     . C   B 2 25  ? 19.793  -9.105  80.939  1.00 111.15 ? 25  C   B C6     1 
ATOM   8065  H "H5'"  . C   B 2 25  ? 17.543  -8.630  77.079  1.00 142.40 ? 25  C   B "H5'"  1 
ATOM   8066  H "H5''" . C   B 2 25  ? 18.736  -9.178  76.200  1.00 142.40 ? 25  C   B "H5''" 1 
ATOM   8067  H "H4'"  . C   B 2 25  ? 19.195  -7.036  77.029  1.00 143.84 ? 25  C   B "H4'"  1 
ATOM   8068  H "H3'"  . C   B 2 25  ? 20.956  -8.973  78.066  1.00 138.92 ? 25  C   B "H3'"  1 
ATOM   8069  H "H2'"  . C   B 2 25  ? 22.162  -7.247  78.995  1.00 141.88 ? 25  C   B "H2'"  1 
ATOM   8070  H "HO2'" . C   B 2 25  ? 20.714  -5.278  78.282  1.00 144.76 ? 25  C   B "HO2'" 1 
ATOM   8071  H "H1'"  . C   B 2 25  ? 20.044  -6.132  79.968  1.00 142.64 ? 25  C   B "H1'"  1 
ATOM   8072  H H41    . C   B 2 25  ? 21.103  -11.034 83.995  1.00 127.00 ? 25  C   B H41    1 
ATOM   8073  H H42    . C   B 2 25  ? 22.170  -10.059 84.356  1.00 127.00 ? 25  C   B H42    1 
ATOM   8074  H H5     . C   B 2 25  ? 19.629  -10.708 82.097  1.00 130.90 ? 25  C   B H5     1 
ATOM   8075  H H6     . C   B 2 25  ? 19.100  -9.329  80.361  1.00 133.77 ? 25  C   B H6     1 
ATOM   8076  P P      . G   B 2 26  ? 22.731  -9.051  76.131  1.00 115.78 ? 26  G   B P      1 
ATOM   8077  O OP1    . G   B 2 26  ? 23.121  -8.945  74.703  1.00 118.81 ? 26  G   B OP1    1 
ATOM   8078  O OP2    . G   B 2 26  ? 22.495  -10.387 76.730  1.00 112.07 ? 26  G   B OP2    1 
ATOM   8079  O "O5'"  . G   B 2 26  ? 23.857  -8.361  77.008  1.00 124.02 ? 26  G   B "O5'"  1 
ATOM   8080  C "C5'"  . G   B 2 26  ? 24.080  -6.963  76.919  1.00 128.58 ? 26  G   B "C5'"  1 
ATOM   8081  C "C4'"  . G   B 2 26  ? 25.058  -6.502  77.963  1.00 128.55 ? 26  G   B "C4'"  1 
ATOM   8082  O "O4'"  . G   B 2 26  ? 24.459  -6.479  79.291  1.00 126.64 ? 26  G   B "O4'"  1 
ATOM   8083  C "C3'"  . G   B 2 26  ? 26.257  -7.403  78.137  1.00 121.55 ? 26  G   B "C3'"  1 
ATOM   8084  O "O3'"  . G   B 2 26  ? 27.188  -7.287  77.089  1.00 114.29 ? 26  G   B "O3'"  1 
ATOM   8085  C "C2'"  . G   B 2 26  ? 26.763  -6.995  79.509  1.00 124.87 ? 26  G   B "C2'"  1 
ATOM   8086  O "O2'"  . G   B 2 26  ? 27.432  -5.742  79.470  1.00 129.68 ? 26  G   B "O2'"  1 
ATOM   8087  C "C1'"  . G   B 2 26  ? 25.439  -6.832  80.253  1.00 123.37 ? 26  G   B "C1'"  1 
ATOM   8088  N N9     . G   B 2 26  ? 25.050  -8.105  80.874  1.00 117.05 ? 26  G   B N9     1 
ATOM   8089  C C8     . G   B 2 26  ? 24.129  -9.017  80.426  1.00 114.05 ? 26  G   B C8     1 
ATOM   8090  N N7     . G   B 2 26  ? 24.043  -10.061 81.198  1.00 112.10 ? 26  G   B N7     1 
ATOM   8091  C C5     . G   B 2 26  ? 24.978  -9.827  82.202  1.00 113.76 ? 26  G   B C5     1 
ATOM   8092  C C6     . G   B 2 26  ? 25.345  -10.603 83.335  1.00 112.47 ? 26  G   B C6     1 
ATOM   8093  O O6     . G   B 2 26  ? 24.902  -11.704 83.688  1.00 110.57 ? 26  G   B O6     1 
ATOM   8094  N N1     . G   B 2 26  ? 26.344  -9.985  84.089  1.00 110.81 ? 26  G   B N1     1 
ATOM   8095  C C2     . G   B 2 26  ? 26.919  -8.771  83.801  1.00 109.01 ? 26  G   B C2     1 
ATOM   8096  N N2     . G   B 2 26  ? 27.866  -8.340  84.650  1.00 101.67 ? 26  G   B N2     1 
ATOM   8097  N N3     . G   B 2 26  ? 26.583  -8.039  82.751  1.00 114.11 ? 26  G   B N3     1 
ATOM   8098  C C4     . G   B 2 26  ? 25.617  -8.625  82.006  1.00 115.19 ? 26  G   B C4     1 
ATOM   8099  H "H5'"  . G   B 2 26  ? 23.238  -6.498  77.044  1.00 154.68 ? 26  G   B "H5'"  1 
ATOM   8100  H "H5''" . G   B 2 26  ? 24.432  -6.753  76.039  1.00 154.68 ? 26  G   B "H5''" 1 
ATOM   8101  H "H4'"  . G   B 2 26  ? 25.363  -5.610  77.739  1.00 154.65 ? 26  G   B "H4'"  1 
ATOM   8102  H "H3'"  . G   B 2 26  ? 25.951  -8.323  78.180  1.00 146.25 ? 26  G   B "H3'"  1 
ATOM   8103  H "H2'"  . G   B 2 26  ? 27.313  -7.687  79.908  1.00 150.24 ? 26  G   B "H2'"  1 
ATOM   8104  H "HO2'" . G   B 2 26  ? 27.951  -5.689  80.128  1.00 156.00 ? 26  G   B "HO2'" 1 
ATOM   8105  H "H1'"  . G   B 2 26  ? 25.514  -6.138  80.926  1.00 148.43 ? 26  G   B "H1'"  1 
ATOM   8106  H H8     . G   B 2 26  ? 23.610  -8.894  79.663  1.00 137.25 ? 26  G   B H8     1 
ATOM   8107  H H1     . G   B 2 26  ? 26.621  -10.397 84.792  1.00 133.37 ? 26  G   B H1     1 
ATOM   8108  H H21    . G   B 2 26  ? 28.083  -8.818  85.332  1.00 122.40 ? 26  G   B H21    1 
ATOM   8109  H H22    . G   B 2 26  ? 28.257  -7.586  84.513  1.00 122.40 ? 26  G   B H22    1 
ATOM   8110  P P      . C   B 2 27  ? 28.055  -8.566  76.689  1.00 149.63 ? 27  C   B P      1 
ATOM   8111  O OP1    . C   B 2 27  ? 28.784  -8.249  75.434  1.00 151.13 ? 27  C   B OP1    1 
ATOM   8112  O OP2    . C   B 2 27  ? 27.195  -9.777  76.749  1.00 146.45 ? 27  C   B OP2    1 
ATOM   8113  O "O5'"  . C   B 2 27  ? 29.096  -8.640  77.886  1.00 137.61 ? 27  C   B "O5'"  1 
ATOM   8114  C "C5'"  . C   B 2 27  ? 29.841  -7.487  78.250  1.00 136.97 ? 27  C   B "C5'"  1 
ATOM   8115  C "C4'"  . C   B 2 27  ? 30.603  -7.705  79.526  1.00 131.29 ? 27  C   B "C4'"  1 
ATOM   8116  O "O4'"  . C   B 2 27  ? 29.686  -7.836  80.642  1.00 126.63 ? 27  C   B "O4'"  1 
ATOM   8117  C "C3'"  . C   B 2 27  ? 31.434  -8.973  79.587  1.00 128.95 ? 27  C   B "C3'"  1 
ATOM   8118  O "O3'"  . C   B 2 27  ? 32.662  -8.861  78.888  1.00 131.11 ? 27  C   B "O3'"  1 
ATOM   8119  C "C2'"  . C   B 2 27  ? 31.585  -9.181  81.086  1.00 126.39 ? 27  C   B "C2'"  1 
ATOM   8120  O "O2'"  . C   B 2 27  ? 32.561  -8.308  81.633  1.00 129.56 ? 27  C   B "O2'"  1 
ATOM   8121  C "C1'"  . C   B 2 27  ? 30.208  -8.753  81.582  1.00 124.36 ? 27  C   B "C1'"  1 
ATOM   8122  N N1     . C   B 2 27  ? 29.296  -9.913  81.679  1.00 119.21 ? 27  C   B N1     1 
ATOM   8123  C C2     . C   B 2 27  ? 29.409  -10.732 82.801  1.00 114.50 ? 27  C   B C2     1 
ATOM   8124  O O2     . C   B 2 27  ? 30.247  -10.446 83.670  1.00 114.44 ? 27  C   B O2     1 
ATOM   8125  N N3     . C   B 2 27  ? 28.599  -11.804 82.911  1.00 111.25 ? 27  C   B N3     1 
ATOM   8126  C C4     . C   B 2 27  ? 27.718  -12.075 81.952  1.00 112.08 ? 27  C   B C4     1 
ATOM   8127  N N4     . C   B 2 27  ? 26.941  -13.145 82.120  1.00 112.44 ? 27  C   B N4     1 
ATOM   8128  C C5     . C   B 2 27  ? 27.583  -11.259 80.794  1.00 114.01 ? 27  C   B C5     1 
ATOM   8129  C C6     . C   B 2 27  ? 28.392  -10.200 80.696  1.00 117.91 ? 27  C   B C6     1 
ATOM   8130  H "H5'"  . C   B 2 27  ? 29.232  -6.741  78.368  1.00 164.76 ? 27  C   B "H5'"  1 
ATOM   8131  H "H5''" . C   B 2 27  ? 30.466  -7.276  77.539  1.00 164.76 ? 27  C   B "H5''" 1 
ATOM   8132  H "H4'"  . C   B 2 27  ? 31.182  -6.942  79.682  1.00 157.94 ? 27  C   B "H4'"  1 
ATOM   8133  H "H3'"  . C   B 2 27  ? 30.921  -9.708  79.214  1.00 155.14 ? 27  C   B "H3'"  1 
ATOM   8134  H "H2'"  . C   B 2 27  ? 31.769  -10.109 81.302  1.00 152.06 ? 27  C   B "H2'"  1 
ATOM   8135  H "HO2'" . C   B 2 27  ? 33.321  -8.542  81.361  1.00 155.86 ? 27  C   B "HO2'" 1 
ATOM   8136  H "H1'"  . C   B 2 27  ? 30.289  -8.325  82.449  1.00 149.62 ? 27  C   B "H1'"  1 
ATOM   8137  H H41    . C   B 2 27  ? 26.359  -13.353 81.522  1.00 135.31 ? 27  C   B H41    1 
ATOM   8138  H H42    . C   B 2 27  ? 27.022  -13.628 82.827  1.00 135.31 ? 27  C   B H42    1 
ATOM   8139  H H5     . C   B 2 27  ? 26.961  -11.458 80.132  1.00 137.21 ? 27  C   B H5     1 
ATOM   8140  H H6     . C   B 2 27  ? 28.333  -9.646  79.951  1.00 141.88 ? 27  C   B H6     1 
ATOM   8141  P P      . G   B 2 28  ? 32.753  -9.223  77.320  1.00 132.41 ? 28  G   B P      1 
ATOM   8142  O OP1    . G   B 2 28  ? 33.681  -8.248  76.694  1.00 134.99 ? 28  G   B OP1    1 
ATOM   8143  O OP2    . G   B 2 28  ? 31.409  -9.423  76.725  1.00 132.71 ? 28  G   B OP2    1 
ATOM   8144  O "O5'"  . G   B 2 28  ? 33.452  -10.647 77.308  1.00 121.04 ? 28  G   B "O5'"  1 
ATOM   8145  C "C5'"  . G   B 2 28  ? 33.253  -11.552 78.374  1.00 114.70 ? 28  G   B "C5'"  1 
ATOM   8146  C "C4'"  . G   B 2 28  ? 34.333  -11.438 79.422  1.00 115.05 ? 28  G   B "C4'"  1 
ATOM   8147  O "O4'"  . G   B 2 28  ? 33.705  -11.255 80.714  1.00 115.22 ? 28  G   B "O4'"  1 
ATOM   8148  C "C3'"  . G   B 2 28  ? 35.215  -12.679 79.556  1.00 113.90 ? 28  G   B "C3'"  1 
ATOM   8149  O "O3'"  . G   B 2 28  ? 36.411  -12.584 78.785  1.00 120.52 ? 28  G   B "O3'"  1 
ATOM   8150  C "C2'"  . G   B 2 28  ? 35.458  -12.809 81.063  1.00 108.34 ? 28  G   B "C2'"  1 
ATOM   8151  O "O2'"  . G   B 2 28  ? 36.591  -12.059 81.485  1.00 108.08 ? 28  G   B "O2'"  1 
ATOM   8152  C "C1'"  . G   B 2 28  ? 34.201  -12.174 81.651  1.00 109.22 ? 28  G   B "C1'"  1 
ATOM   8153  N N9     . G   B 2 28  ? 33.103  -13.125 81.919  1.00 100.94 ? 28  G   B N9     1 
ATOM   8154  C C8     . G   B 2 28  ? 32.035  -13.327 81.077  1.00 99.52  ? 28  G   B C8     1 
ATOM   8155  N N7     . G   B 2 28  ? 31.163  -14.180 81.532  1.00 93.50  ? 28  G   B N7     1 
ATOM   8156  C C5     . G   B 2 28  ? 31.680  -14.550 82.764  1.00 88.49  ? 28  G   B C5     1 
ATOM   8157  C C6     . G   B 2 28  ? 31.166  -15.456 83.721  1.00 83.43  ? 28  G   B C6     1 
ATOM   8158  O O6     . G   B 2 28  ? 30.127  -16.126 83.664  1.00 81.41  ? 28  G   B O6     1 
ATOM   8159  N N1     . G   B 2 28  ? 31.995  -15.543 84.830  1.00 82.03  ? 28  G   B N1     1 
ATOM   8160  C C2     . G   B 2 28  ? 33.166  -14.847 84.994  1.00 86.72  ? 28  G   B C2     1 
ATOM   8161  N N2     . G   B 2 28  ? 33.824  -15.069 86.140  1.00 86.20  ? 28  G   B N2     1 
ATOM   8162  N N3     . G   B 2 28  ? 33.661  -13.996 84.110  1.00 90.02  ? 28  G   B N3     1 
ATOM   8163  C C4     . G   B 2 28  ? 32.870  -13.900 83.026  1.00 91.95  ? 28  G   B C4     1 
ATOM   8164  H "H5'"  . G   B 2 28  ? 33.248  -12.456 78.024  1.00 138.03 ? 28  G   B "H5'"  1 
ATOM   8165  H "H5''" . G   B 2 28  ? 32.394  -11.369 78.786  1.00 138.03 ? 28  G   B "H5''" 1 
ATOM   8166  H "H4'"  . G   B 2 28  ? 34.890  -10.669 79.225  1.00 138.45 ? 28  G   B "H4'"  1 
ATOM   8167  H "H3'"  . G   B 2 28  ? 34.712  -13.452 79.255  1.00 137.07 ? 28  G   B "H3'"  1 
ATOM   8168  H "H2'"  . G   B 2 28  ? 35.534  -13.739 81.326  1.00 130.40 ? 28  G   B "H2'"  1 
ATOM   8169  H "HO2'" . G   B 2 28  ? 37.286  -12.416 81.177  1.00 130.09 ? 28  G   B "HO2'" 1 
ATOM   8170  H "H1'"  . G   B 2 28  ? 34.429  -11.707 82.470  1.00 131.45 ? 28  G   B "H1'"  1 
ATOM   8171  H H8     . G   B 2 28  ? 31.950  -12.904 80.253  1.00 119.81 ? 28  G   B H8     1 
ATOM   8172  H H1     . G   B 2 28  ? 31.757  -16.074 85.463  1.00 98.83  ? 28  G   B H1     1 
ATOM   8173  H H21    . G   B 2 28  ? 33.507  -15.621 86.718  1.00 103.84 ? 28  G   B H21    1 
ATOM   8174  H H22    . G   B 2 28  ? 34.564  -14.660 86.297  1.00 103.84 ? 28  G   B H22    1 
ATOM   8175  P P      . A   B 2 29  ? 36.401  -12.060 77.254  1.00 186.98 ? 29  A   B P      1 
ATOM   8176  O OP1    . A   B 2 29  ? 35.954  -10.651 77.186  1.00 190.21 ? 29  A   B OP1    1 
ATOM   8177  O OP2    . A   B 2 29  ? 35.807  -13.091 76.372  1.00 184.65 ? 29  A   B OP2    1 
ATOM   8178  O "O5'"  . A   B 2 29  ? 37.941  -11.922 76.891  1.00 179.60 ? 29  A   B "O5'"  1 
ATOM   8179  C "C5'"  . A   B 2 29  ? 38.674  -10.805 77.377  1.00 180.29 ? 29  A   B "C5'"  1 
ATOM   8180  C "C4'"  . A   B 2 29  ? 40.047  -10.708 76.773  1.00 180.78 ? 29  A   B "C4'"  1 
ATOM   8181  O "O4'"  . A   B 2 29  ? 39.900  -10.313 75.382  1.00 184.73 ? 29  A   B "O4'"  1 
ATOM   8182  C "C3'"  . A   B 2 29  ? 40.912  -9.633  77.407  1.00 182.11 ? 29  A   B "C3'"  1 
ATOM   8183  O "O3'"  . A   B 2 29  ? 42.290  -9.994  77.186  1.00 183.05 ? 29  A   B "O3'"  1 
ATOM   8184  C "C2'"  . A   B 2 29  ? 40.470  -8.405  76.624  1.00 186.58 ? 29  A   B "C2'"  1 
ATOM   8185  O "O2'"  . A   B 2 29  ? 41.305  -7.271  76.704  1.00 190.06 ? 29  A   B "O2'"  1 
ATOM   8186  C "C1'"  . A   B 2 29  ? 40.372  -8.986  75.218  1.00 187.89 ? 29  A   B "C1'"  1 
ATOM   8187  N N9     . A   B 2 29  ? 39.439  -8.283  74.344  1.00 190.00 ? 29  A   B N9     1 
ATOM   8188  C C8     . A   B 2 29  ? 38.362  -8.801  73.671  1.00 187.85 ? 29  A   B C8     1 
ATOM   8189  N N7     . A   B 2 29  ? 37.730  -7.912  72.947  1.00 192.20 ? 29  A   B N7     1 
ATOM   8190  C C5     . A   B 2 29  ? 38.447  -6.738  73.155  1.00 197.19 ? 29  A   B C5     1 
ATOM   8191  C C6     . A   B 2 29  ? 38.295  -5.424  72.670  1.00 203.68 ? 29  A   B C6     1 
ATOM   8192  N N6     . A   B 2 29  ? 37.320  -5.051  71.837  1.00 207.49 ? 29  A   B N6     1 
ATOM   8193  N N1     . A   B 2 29  ? 39.187  -4.491  73.077  1.00 205.99 ? 29  A   B N1     1 
ATOM   8194  C C2     . A   B 2 29  ? 40.165  -4.859  73.915  1.00 202.99 ? 29  A   B C2     1 
ATOM   8195  N N3     . A   B 2 29  ? 40.412  -6.059  74.439  1.00 198.07 ? 29  A   B N3     1 
ATOM   8196  C C4     . A   B 2 29  ? 39.510  -6.959  74.008  1.00 195.33 ? 29  A   B C4     1 
ATOM   8197  H "H5'"  . A   B 2 29  ? 38.760  -10.881 78.340  1.00 216.74 ? 29  A   B "H5'"  1 
ATOM   8198  H "H5''" . A   B 2 29  ? 38.184  -9.994  77.169  1.00 216.74 ? 29  A   B "H5''" 1 
ATOM   8199  H "H4'"  . A   B 2 29  ? 40.494  -11.568 76.827  1.00 217.32 ? 29  A   B "H4'"  1 
ATOM   8200  H "H3'"  . A   B 2 29  ? 40.717  -9.538  78.353  1.00 218.92 ? 29  A   B "H3'"  1 
ATOM   8201  H "H2'"  . A   B 2 29  ? 39.580  -8.155  76.918  1.00 224.29 ? 29  A   B "H2'"  1 
ATOM   8202  H "H1'"  . A   B 2 29  ? 41.252  -9.002  74.810  1.00 225.86 ? 29  A   B "H1'"  1 
ATOM   8203  H H8     . A   B 2 29  ? 38.104  -9.693  73.727  1.00 225.81 ? 29  A   B H8     1 
ATOM   8204  H H61    . A   B 2 29  ? 37.270  -4.234  71.573  1.00 249.38 ? 29  A   B H61    1 
ATOM   8205  H H62    . A   B 2 29  ? 36.743  -5.627  71.565  1.00 249.38 ? 29  A   B H62    1 
ATOM   8206  H H2     . A   B 2 29  ? 40.753  -4.184  74.165  1.00 243.98 ? 29  A   B H2     1 
ATOM   8207  P P      . U   B 2 30  ? 43.514  -8.948  77.051  1.00 210.44 ? 30  U   B P      1 
ATOM   8208  O OP1    . U   B 2 30  ? 43.204  -7.894  76.057  1.00 215.90 ? 30  U   B OP1    1 
ATOM   8209  O OP2    . U   B 2 30  ? 44.747  -9.750  76.873  1.00 208.60 ? 30  U   B OP2    1 
ATOM   8210  O "O5'"  . U   B 2 30  ? 43.652  -8.273  78.483  1.00 212.76 ? 30  U   B "O5'"  1 
ATOM   8211  C "C5'"  . U   B 2 30  ? 43.029  -8.813  79.637  1.00 209.23 ? 30  U   B "C5'"  1 
ATOM   8212  C "C4'"  . U   B 2 30  ? 43.597  -10.145 80.053  1.00 205.98 ? 30  U   B "C4'"  1 
ATOM   8213  O "O4'"  . U   B 2 30  ? 44.793  -9.881  80.832  1.00 204.28 ? 30  U   B "O4'"  1 
ATOM   8214  C "C3'"  . U   B 2 30  ? 42.672  -10.947 80.971  1.00 203.62 ? 30  U   B "C3'"  1 
ATOM   8215  O "O3'"  . U   B 2 30  ? 41.927  -11.926 80.261  1.00 204.56 ? 30  U   B "O3'"  1 
ATOM   8216  C "C2'"  . U   B 2 30  ? 43.605  -11.537 82.026  1.00 198.36 ? 30  U   B "C2'"  1 
ATOM   8217  O "O2'"  . U   B 2 30  ? 44.151  -12.778 81.600  1.00 196.86 ? 30  U   B "O2'"  1 
ATOM   8218  C "C1'"  . U   B 2 30  ? 44.717  -10.497 82.089  1.00 198.57 ? 30  U   B "C1'"  1 
ATOM   8219  N N1     . U   B 2 30  ? 44.456  -9.427  83.086  1.00 194.60 ? 30  U   B N1     1 
ATOM   8220  C C2     . U   B 2 30  ? 45.556  -8.919  83.752  1.00 193.18 ? 30  U   B C2     1 
ATOM   8221  O O2     . U   B 2 30  ? 46.696  -9.307  83.562  1.00 192.66 ? 30  U   B O2     1 
ATOM   8222  N N3     . U   B 2 30  ? 45.278  -7.924  84.649  1.00 192.97 ? 30  U   B N3     1 
ATOM   8223  C C4     . U   B 2 30  ? 44.044  -7.395  84.950  1.00 192.84 ? 30  U   B C4     1 
ATOM   8224  O O4     . U   B 2 30  ? 43.969  -6.502  85.792  1.00 193.67 ? 30  U   B O4     1 
ATOM   8225  C C5     . U   B 2 30  ? 42.951  -7.962  84.224  1.00 192.56 ? 30  U   B C5     1 
ATOM   8226  C C6     . U   B 2 30  ? 43.194  -8.930  83.338  1.00 192.65 ? 30  U   B C6     1 
ATOM   8227  H "H5'"  . U   B 2 30  ? 42.082  -8.922  79.457  1.00 251.46 ? 30  U   B "H5'"  1 
ATOM   8228  H "H5''" . U   B 2 30  ? 43.136  -8.187  80.370  1.00 251.46 ? 30  U   B "H5''" 1 
ATOM   8229  H "H4'"  . U   B 2 30  ? 43.823  -10.669 79.269  1.00 247.57 ? 30  U   B "H4'"  1 
ATOM   8230  H "H3'"  . U   B 2 30  ? 42.055  -10.337 81.405  1.00 244.74 ? 30  U   B "H3'"  1 
ATOM   8231  H "H2'"  . U   B 2 30  ? 43.157  -11.623 82.882  1.00 238.42 ? 30  U   B "H2'"  1 
ATOM   8232  H "HO2'" . U   B 2 30  ? 43.537  -13.350 81.566  1.00 236.62 ? 30  U   B "HO2'" 1 
ATOM   8233  H "H1'"  . U   B 2 30  ? 45.560  -10.932 82.291  1.00 238.67 ? 30  U   B "H1'"  1 
ATOM   8234  H H3     . U   B 2 30  ? 45.949  -7.597  85.076  1.00 231.95 ? 30  U   B H3     1 
ATOM   8235  H H5     . U   B 2 30  ? 42.082  -7.661  84.368  1.00 231.46 ? 30  U   B H5     1 
ATOM   8236  H H6     . U   B 2 30  ? 42.475  -9.293  82.872  1.00 231.58 ? 30  U   B H6     1 
ATOM   8237  P P      . C   B 2 31  ? 40.317  -11.967 80.304  1.00 193.86 ? 31  C   B P      1 
ATOM   8238  O OP1    . C   B 2 31  ? 39.919  -12.728 79.094  1.00 192.74 ? 31  C   B OP1    1 
ATOM   8239  O OP2    . C   B 2 31  ? 39.771  -10.605 80.567  1.00 196.13 ? 31  C   B OP2    1 
ATOM   8240  O "O5'"  . C   B 2 31  ? 39.971  -12.906 81.545  1.00 189.47 ? 31  C   B "O5'"  1 
ATOM   8241  C "C5'"  . C   B 2 31  ? 40.955  -13.745 82.141  1.00 184.94 ? 31  C   B "C5'"  1 
ATOM   8242  C "C4'"  . C   B 2 31  ? 41.368  -14.884 81.237  1.00 180.24 ? 31  C   B "C4'"  1 
ATOM   8243  O "O4'"  . C   B 2 31  ? 42.744  -15.271 81.533  1.00 178.08 ? 31  C   B "O4'"  1 
ATOM   8244  C "C3'"  . C   B 2 31  ? 40.589  -16.169 81.438  1.00 173.11 ? 31  C   B "C3'"  1 
ATOM   8245  O "O3'"  . C   B 2 31  ? 39.313  -16.198 80.835  1.00 171.41 ? 31  C   B "O3'"  1 
ATOM   8246  C "C2'"  . C   B 2 31  ? 41.555  -17.229 80.946  1.00 170.72 ? 31  C   B "C2'"  1 
ATOM   8247  O "O2'"  . C   B 2 31  ? 41.614  -17.257 79.527  1.00 171.67 ? 31  C   B "O2'"  1 
ATOM   8248  C "C1'"  . C   B 2 31  ? 42.867  -16.683 81.499  1.00 171.69 ? 31  C   B "C1'"  1 
ATOM   8249  N N1     . C   B 2 31  ? 43.100  -17.165 82.883  1.00 164.00 ? 31  C   B N1     1 
ATOM   8250  C C2     . C   B 2 31  ? 43.351  -18.526 83.111  1.00 157.65 ? 31  C   B C2     1 
ATOM   8251  O O2     . C   B 2 31  ? 43.390  -19.305 82.146  1.00 158.09 ? 31  C   B O2     1 
ATOM   8252  N N3     . C   B 2 31  ? 43.540  -18.969 84.376  1.00 151.96 ? 31  C   B N3     1 
ATOM   8253  C C4     . C   B 2 31  ? 43.489  -18.114 85.396  1.00 150.84 ? 31  C   B C4     1 
ATOM   8254  N N4     . C   B 2 31  ? 43.686  -18.588 86.626  1.00 145.91 ? 31  C   B N4     1 
ATOM   8255  C C5     . C   B 2 31  ? 43.235  -16.726 85.200  1.00 156.79 ? 31  C   B C5     1 
ATOM   8256  C C6     . C   B 2 31  ? 43.047  -16.300 83.944  1.00 162.40 ? 31  C   B C6     1 
ATOM   8257  H "H5'"  . C   B 2 31  ? 40.597  -14.112 82.965  1.00 222.32 ? 31  C   B "H5'"  1 
ATOM   8258  H "H5''" . C   B 2 31  ? 41.737  -13.210 82.350  1.00 222.32 ? 31  C   B "H5''" 1 
ATOM   8259  H "H4'"  . C   B 2 31  ? 41.302  -14.605 80.310  1.00 216.68 ? 31  C   B "H4'"  1 
ATOM   8260  H "H3'"  . C   B 2 31  ? 40.467  -16.297 82.392  1.00 208.12 ? 31  C   B "H3'"  1 
ATOM   8261  H "H2'"  . C   B 2 31  ? 41.348  -18.101 81.317  1.00 205.25 ? 31  C   B "H2'"  1 
ATOM   8262  H "HO2'" . C   B 2 31  ? 42.362  -16.967 79.279  1.00 206.39 ? 31  C   B "HO2'" 1 
ATOM   8263  H "H1'"  . C   B 2 31  ? 43.605  -16.940 80.925  1.00 206.41 ? 31  C   B "H1'"  1 
ATOM   8264  H H41    . C   B 2 31  ? 43.658  -18.056 87.301  1.00 175.49 ? 31  C   B H41    1 
ATOM   8265  H H42    . C   B 2 31  ? 43.841  -19.425 86.744  1.00 175.49 ? 31  C   B H42    1 
ATOM   8266  H H5     . C   B 2 31  ? 43.202  -16.137 85.919  1.00 188.54 ? 31  C   B H5     1 
ATOM   8267  H H6     . C   B 2 31  ? 42.874  -15.400 83.789  1.00 195.27 ? 31  C   B H6     1 
ATOM   8268  P P      . G   B 2 32  ? 38.028  -16.481 81.758  1.00 90.77  ? 32  G   B P      1 
ATOM   8269  O OP1    . G   B 2 32  ? 36.979  -17.094 80.899  1.00 94.02  ? 32  G   B OP1    1 
ATOM   8270  O OP2    . G   B 2 32  ? 37.736  -15.240 82.534  1.00 88.77  ? 32  G   B OP2    1 
ATOM   8271  O "O5'"  . G   B 2 32  ? 38.496  -17.637 82.760  1.00 70.78  ? 32  G   B "O5'"  1 
ATOM   8272  C "C5'"  . G   B 2 32  ? 39.214  -17.355 83.961  1.00 69.17  ? 32  G   B "C5'"  1 
ATOM   8273  C "C4'"  . G   B 2 32  ? 38.717  -18.170 85.121  1.00 60.04  ? 32  G   B "C4'"  1 
ATOM   8274  O "O4'"  . G   B 2 32  ? 37.484  -17.591 85.629  1.00 57.86  ? 32  G   B "O4'"  1 
ATOM   8275  C "C3'"  . G   B 2 32  ? 38.366  -19.621 84.804  1.00 55.79  ? 32  G   B "C3'"  1 
ATOM   8276  O "O3'"  . G   B 2 32  ? 39.495  -20.479 84.852  1.00 55.17  ? 32  G   B "O3'"  1 
ATOM   8277  C "C2'"  . G   B 2 32  ? 37.329  -19.936 85.860  1.00 54.12  ? 32  G   B "C2'"  1 
ATOM   8278  O "O2'"  . G   B 2 32  ? 37.963  -20.176 87.109  1.00 51.28  ? 32  G   B "O2'"  1 
ATOM   8279  C "C1'"  . G   B 2 32  ? 36.565  -18.612 85.917  1.00 55.49  ? 32  G   B "C1'"  1 
ATOM   8280  N N9     . G   B 2 32  ? 35.524  -18.533 84.879  1.00 56.27  ? 32  G   B N9     1 
ATOM   8281  C C8     . G   B 2 32  ? 35.587  -17.741 83.758  1.00 59.68  ? 32  G   B C8     1 
ATOM   8282  N N7     . G   B 2 32  ? 34.546  -17.850 82.985  1.00 60.51  ? 32  G   B N7     1 
ATOM   8283  C C5     . G   B 2 32  ? 33.751  -18.767 83.644  1.00 60.35  ? 32  G   B C5     1 
ATOM   8284  C C6     . G   B 2 32  ? 32.491  -19.274 83.277  1.00 68.31  ? 32  G   B C6     1 
ATOM   8285  O O6     . G   B 2 32  ? 31.832  -18.991 82.269  1.00 76.02  ? 32  G   B O6     1 
ATOM   8286  N N1     . G   B 2 32  ? 32.018  -20.188 84.222  1.00 65.16  ? 32  G   B N1     1 
ATOM   8287  C C2     . G   B 2 32  ? 32.675  -20.568 85.370  1.00 58.18  ? 32  G   B C2     1 
ATOM   8288  N N2     . G   B 2 32  ? 32.042  -21.471 86.135  1.00 53.97  ? 32  G   B N2     1 
ATOM   8289  N N3     . G   B 2 32  ? 33.860  -20.095 85.731  1.00 55.50  ? 32  G   B N3     1 
ATOM   8290  C C4     . G   B 2 32  ? 34.331  -19.206 84.820  1.00 57.61  ? 32  G   B C4     1 
ATOM   8291  H "H5'"  . G   B 2 32  ? 39.116  -16.413 84.173  1.00 83.40  ? 32  G   B "H5'"  1 
ATOM   8292  H "H5''" . G   B 2 32  ? 40.153  -17.549 83.819  1.00 83.40  ? 32  G   B "H5''" 1 
ATOM   8293  H "H4'"  . G   B 2 32  ? 39.385  -18.155 85.825  1.00 72.44  ? 32  G   B "H4'"  1 
ATOM   8294  H "H3'"  . G   B 2 32  ? 37.959  -19.670 83.926  1.00 66.67  ? 32  G   B "H3'"  1 
ATOM   8295  H "H2'"  . G   B 2 32  ? 36.756  -20.672 85.593  1.00 65.34  ? 32  G   B "H2'"  1 
ATOM   8296  H "HO2'" . G   B 2 32  ? 38.752  -20.429 86.972  1.00 59.58  ? 32  G   B "HO2'" 1 
ATOM   8297  H "H1'"  . G   B 2 32  ? 36.178  -18.480 86.796  1.00 66.98  ? 32  G   B "H1'"  1 
ATOM   8298  H H8     . G   B 2 32  ? 36.307  -17.184 83.568  1.00 69.86  ? 32  G   B H8     1 
ATOM   8299  H H1     . G   B 2 32  ? 31.252  -20.548 84.070  1.00 78.58  ? 32  G   B H1     1 
ATOM   8300  H H21    . G   B 2 32  ? 31.273  -21.774 85.896  1.00 65.16  ? 32  G   B H21    1 
ATOM   8301  H H22    . G   B 2 32  ? 32.405  -21.747 86.864  1.00 65.16  ? 32  G   B H22    1 
ATOM   8302  P P      . C   B 2 33  ? 39.660  -21.710 83.828  1.00 55.16  ? 33  C   B P      1 
ATOM   8303  O OP1    . C   B 2 33  ? 41.001  -22.308 84.060  1.00 55.32  ? 33  C   B OP1    1 
ATOM   8304  O OP2    . C   B 2 33  ? 39.271  -21.251 82.469  1.00 57.84  ? 33  C   B OP2    1 
ATOM   8305  O "O5'"  . C   B 2 33  ? 38.580  -22.775 84.309  1.00 52.10  ? 33  C   B "O5'"  1 
ATOM   8306  C "C5'"  . C   B 2 33  ? 38.578  -23.280 85.637  1.00 49.40  ? 33  C   B "C5'"  1 
ATOM   8307  C "C4'"  . C   B 2 33  ? 37.302  -24.023 85.907  1.00 47.11  ? 33  C   B "C4'"  1 
ATOM   8308  O "O4'"  . C   B 2 33  ? 36.195  -23.128 85.683  1.00 47.79  ? 33  C   B "O4'"  1 
ATOM   8309  C "C3'"  . C   B 2 33  ? 37.039  -25.190 84.980  1.00 47.14  ? 33  C   B "C3'"  1 
ATOM   8310  O "O3'"  . C   B 2 33  ? 37.641  -26.368 85.447  1.00 45.86  ? 33  C   B "O3'"  1 
ATOM   8311  C "C2'"  . C   B 2 33  ? 35.524  -25.274 84.918  1.00 46.12  ? 33  C   B "C2'"  1 
ATOM   8312  O "O2'"  . C   B 2 33  ? 35.013  -26.052 85.988  1.00 52.42  ? 33  C   B "O2'"  1 
ATOM   8313  C "C1'"  . C   B 2 33  ? 35.115  -23.817 85.106  1.00 47.23  ? 33  C   B "C1'"  1 
ATOM   8314  N N1     . C   B 2 33  ? 34.763  -23.141 83.845  1.00 50.04  ? 33  C   B N1     1 
ATOM   8315  C C2     . C   B 2 33  ? 33.559  -23.477 83.260  1.00 50.18  ? 33  C   B C2     1 
ATOM   8316  O O2     . C   B 2 33  ? 32.874  -24.349 83.816  1.00 47.87  ? 33  C   B O2     1 
ATOM   8317  N N3     . C   B 2 33  ? 33.198  -22.855 82.114  1.00 53.06  ? 33  C   B N3     1 
ATOM   8318  C C4     . C   B 2 33  ? 33.988  -21.925 81.573  1.00 55.65  ? 33  C   B C4     1 
ATOM   8319  N N4     . C   B 2 33  ? 33.600  -21.334 80.442  1.00 58.71  ? 33  C   B N4     1 
ATOM   8320  C C5     . C   B 2 33  ? 35.222  -21.559 82.170  1.00 55.47  ? 33  C   B C5     1 
ATOM   8321  C C6     . C   B 2 33  ? 35.566  -22.184 83.301  1.00 52.66  ? 33  C   B C6     1 
ATOM   8322  H "H5'"  . C   B 2 33  ? 38.659  -22.543 86.261  1.00 58.04  ? 33  C   B "H5'"  1 
ATOM   8323  H "H5''" . C   B 2 33  ? 39.330  -23.882 85.752  1.00 58.04  ? 33  C   B "H5''" 1 
ATOM   8324  H "H4'"  . C   B 2 33  ? 37.291  -24.329 86.828  1.00 54.58  ? 33  C   B "H4'"  1 
ATOM   8325  H "H3'"  . C   B 2 33  ? 37.385  -24.982 84.098  1.00 54.61  ? 33  C   B "H3'"  1 
ATOM   8326  H "H2'"  . C   B 2 33  ? 35.227  -25.614 84.059  1.00 54.48  ? 33  C   B "H2'"  1 
ATOM   8327  H "HO2'" . C   B 2 33  ? 34.586  -25.552 86.510  1.00 63.29  ? 33  C   B "HO2'" 1 
ATOM   8328  H "H1'"  . C   B 2 33  ? 34.356  -23.776 85.708  1.00 55.10  ? 33  C   B "H1'"  1 
ATOM   8329  H H41    . C   B 2 33  ? 34.096  -20.733 80.079  1.00 68.50  ? 33  C   B H41    1 
ATOM   8330  H H42    . C   B 2 33  ? 32.854  -21.555 80.075  1.00 68.50  ? 33  C   B H42    1 
ATOM   8331  H H5     . C   B 2 33  ? 35.770  -20.912 81.789  1.00 65.69  ? 33  C   B H5     1 
ATOM   8332  H H6     . C   B 2 33  ? 36.367  -21.965 83.719  1.00 61.24  ? 33  C   B H6     1 
ATOM   8333  P P      . C   B 2 34  ? 38.415  -27.289 84.406  1.00 47.66  ? 34  C   B P      1 
ATOM   8334  O OP1    . C   B 2 34  ? 39.231  -28.279 85.151  1.00 49.99  ? 34  C   B OP1    1 
ATOM   8335  O OP2    . C   B 2 34  ? 39.075  -26.401 83.412  1.00 50.60  ? 34  C   B OP2    1 
ATOM   8336  O "O5'"  . C   B 2 34  ? 37.241  -28.091 83.701  1.00 47.34  ? 34  C   B "O5'"  1 
ATOM   8337  C "C5'"  . C   B 2 34  ? 36.642  -29.198 84.348  1.00 45.17  ? 34  C   B "C5'"  1 
ATOM   8338  C "C4'"  . C   B 2 34  ? 35.413  -29.657 83.614  1.00 45.31  ? 34  C   B "C4'"  1 
ATOM   8339  O "O4'"  . C   B 2 34  ? 34.470  -28.558 83.522  1.00 45.34  ? 34  C   B "O4'"  1 
ATOM   8340  C "C3'"  . C   B 2 34  ? 35.617  -30.088 82.168  1.00 53.36  ? 34  C   B "C3'"  1 
ATOM   8341  O "O3'"  . C   B 2 34  ? 36.108  -31.416 82.047  1.00 55.24  ? 34  C   B "O3'"  1 
ATOM   8342  C "C2'"  . C   B 2 34  ? 34.228  -29.897 81.570  1.00 58.09  ? 34  C   B "C2'"  1 
ATOM   8343  O "O2'"  . C   B 2 34  ? 33.378  -30.991 81.884  1.00 62.90  ? 34  C   B "O2'"  1 
ATOM   8344  C "C1'"  . C   B 2 34  ? 33.741  -28.651 82.315  1.00 50.96  ? 34  C   B "C1'"  1 
ATOM   8345  N N1     . C   B 2 34  ? 33.958  -27.420 81.521  1.00 54.22  ? 34  C   B N1     1 
ATOM   8346  C C2     . C   B 2 34  ? 32.966  -27.023 80.633  1.00 57.38  ? 34  C   B C2     1 
ATOM   8347  O O2     . C   B 2 34  ? 31.932  -27.699 80.560  1.00 63.44  ? 34  C   B O2     1 
ATOM   8348  N N3     . C   B 2 34  ? 33.147  -25.910 79.886  1.00 59.20  ? 34  C   B N3     1 
ATOM   8349  C C4     . C   B 2 34  ? 34.271  -25.203 79.993  1.00 59.65  ? 34  C   B C4     1 
ATOM   8350  N N4     . C   B 2 34  ? 34.406  -24.110 79.237  1.00 59.94  ? 34  C   B N4     1 
ATOM   8351  C C5     . C   B 2 34  ? 35.310  -25.593 80.883  1.00 62.40  ? 34  C   B C5     1 
ATOM   8352  C C6     . C   B 2 34  ? 35.113  -26.699 81.616  1.00 60.71  ? 34  C   B C6     1 
ATOM   8353  H "H5'"  . C   B 2 34  ? 36.396  -28.944 85.251  1.00 52.25  ? 34  C   B "H5'"  1 
ATOM   8354  H "H5''" . C   B 2 34  ? 37.280  -29.928 84.386  1.00 52.25  ? 34  C   B "H5''" 1 
ATOM   8355  H "H4'"  . C   B 2 34  ? 35.003  -30.385 84.106  1.00 53.04  ? 34  C   B "H4'"  1 
ATOM   8356  H "H3'"  . C   B 2 34  ? 36.237  -29.479 81.738  1.00 64.43  ? 34  C   B "H3'"  1 
ATOM   8357  H "H2'"  . C   B 2 34  ? 34.273  -29.742 80.614  1.00 70.09  ? 34  C   B "H2'"  1 
ATOM   8358  H "HO2'" . C   B 2 34  ? 33.647  -31.673 81.474  1.00 75.87  ? 34  C   B "HO2'" 1 
ATOM   8359  H "H1'"  . C   B 2 34  ? 32.797  -28.743 82.515  1.00 61.55  ? 34  C   B "H1'"  1 
ATOM   8360  H H41    . C   B 2 34  ? 35.123  -23.638 79.289  1.00 72.31  ? 34  C   B H41    1 
ATOM   8361  H H42    . C   B 2 34  ? 33.776  -23.879 78.699  1.00 72.31  ? 34  C   B H42    1 
ATOM   8362  H H5     . C   B 2 34  ? 36.094  -25.098 80.957  1.00 75.27  ? 34  C   B H5     1 
ATOM   8363  H H6     . C   B 2 34  ? 35.775  -26.976 82.208  1.00 73.25  ? 34  C   B H6     1 
ATOM   8364  P P      . A   B 2 35  ? 37.478  -31.734 81.259  1.00 105.18 ? 35  A   B P      1 
ATOM   8365  O OP1    . A   B 2 35  ? 38.216  -32.782 82.009  1.00 102.30 ? 35  A   B OP1    1 
ATOM   8366  O OP2    . A   B 2 35  ? 38.190  -30.483 80.911  1.00 110.33 ? 35  A   B OP2    1 
ATOM   8367  O "O5'"  . A   B 2 35  ? 36.974  -32.347 79.888  1.00 102.69 ? 35  A   B "O5'"  1 
ATOM   8368  C "C5'"  . A   B 2 35  ? 36.131  -31.592 79.034  1.00 107.00 ? 35  A   B "C5'"  1 
ATOM   8369  C "C4'"  . A   B 2 35  ? 35.066  -32.454 78.410  1.00 115.01 ? 35  A   B "C4'"  1 
ATOM   8370  O "O4'"  . A   B 2 35  ? 33.869  -31.648 78.221  1.00 119.43 ? 35  A   B "O4'"  1 
ATOM   8371  C "C3'"  . A   B 2 35  ? 35.429  -33.023 77.039  1.00 119.13 ? 35  A   B "C3'"  1 
ATOM   8372  O "O3'"  . A   B 2 35  ? 34.900  -34.345 76.885  1.00 118.38 ? 35  A   B "O3'"  1 
ATOM   8373  C "C2'"  . A   B 2 35  ? 34.757  -32.043 76.074  1.00 123.15 ? 35  A   B "C2'"  1 
ATOM   8374  O "O2'"  . A   B 2 35  ? 34.431  -32.586 74.813  1.00 127.34 ? 35  A   B "O2'"  1 
ATOM   8375  C "C1'"  . A   B 2 35  ? 33.507  -31.631 76.852  1.00 123.05 ? 35  A   B "C1'"  1 
ATOM   8376  N N9     . A   B 2 35  ? 32.992  -30.290 76.520  1.00 124.69 ? 35  A   B N9     1 
ATOM   8377  C C8     . A   B 2 35  ? 31.839  -30.009 75.822  1.00 124.88 ? 35  A   B C8     1 
ATOM   8378  N N7     . A   B 2 35  ? 31.607  -28.726 75.659  1.00 124.36 ? 35  A   B N7     1 
ATOM   8379  C C5     . A   B 2 35  ? 32.674  -28.103 76.293  1.00 121.15 ? 35  A   B C5     1 
ATOM   8380  C C6     . A   B 2 35  ? 33.008  -26.741 76.467  1.00 115.67 ? 35  A   B C6     1 
ATOM   8381  N N6     . A   B 2 35  ? 32.275  -25.722 76.007  1.00 114.05 ? 35  A   B N6     1 
ATOM   8382  N N1     . A   B 2 35  ? 34.141  -26.454 77.141  1.00 114.66 ? 35  A   B N1     1 
ATOM   8383  C C2     . A   B 2 35  ? 34.880  -27.470 77.604  1.00 116.59 ? 35  A   B C2     1 
ATOM   8384  N N3     . A   B 2 35  ? 34.671  -28.784 77.504  1.00 120.26 ? 35  A   B N3     1 
ATOM   8385  C C4     . A   B 2 35  ? 33.539  -29.050 76.824  1.00 122.82 ? 35  A   B C4     1 
ATOM   8386  H "H5'"  . A   B 2 35  ? 36.667  -31.191 78.332  1.00 128.79 ? 35  A   B "H5'"  1 
ATOM   8387  H "H5''" . A   B 2 35  ? 35.707  -30.888 79.550  1.00 128.79 ? 35  A   B "H5''" 1 
ATOM   8388  H "H4'"  . A   B 2 35  ? 34.861  -33.186 79.012  1.00 138.41 ? 35  A   B "H4'"  1 
ATOM   8389  H "H3'"  . A   B 2 35  ? 36.391  -33.021 76.913  1.00 143.34 ? 35  A   B "H3'"  1 
ATOM   8390  H "H2'"  . A   B 2 35  ? 35.329  -31.269 75.952  1.00 148.17 ? 35  A   B "H2'"  1 
ATOM   8391  H "HO2'" . A   B 2 35  ? 33.596  -32.583 74.722  1.00 153.20 ? 35  A   B "HO2'" 1 
ATOM   8392  H "H1'"  . A   B 2 35  ? 32.808  -32.286 76.701  1.00 148.05 ? 35  A   B "H1'"  1 
ATOM   8393  H H8     . A   B 2 35  ? 31.274  -30.670 75.494  1.00 150.25 ? 35  A   B H8     1 
ATOM   8394  H H61    . A   B 2 35  ? 32.531  -24.913 76.145  1.00 137.25 ? 35  A   B H61    1 
ATOM   8395  H H62    . A   B 2 35  ? 31.549  -25.876 75.574  1.00 137.25 ? 35  A   B H62    1 
ATOM   8396  H H2     . A   B 2 35  ? 35.650  -27.224 78.063  1.00 140.30 ? 35  A   B H2     1 
ATOM   8397  P P      . C   B 2 36  ? 35.853  -35.570 76.438  1.00 158.33 ? 36  C   B P      1 
ATOM   8398  O OP1    . C   B 2 36  ? 36.556  -35.194 75.185  1.00 159.93 ? 36  C   B OP1    1 
ATOM   8399  O OP2    . C   B 2 36  ? 35.038  -36.811 76.444  1.00 158.99 ? 36  C   B OP2    1 
ATOM   8400  O "O5'"  . C   B 2 36  ? 36.945  -35.685 77.599  1.00 158.50 ? 36  C   B "O5'"  1 
ATOM   8401  C "C5'"  . C   B 2 36  ? 36.581  -35.623 78.978  1.00 155.75 ? 36  C   B "C5'"  1 
ATOM   8402  C "C4'"  . C   B 2 36  ? 37.195  -36.748 79.785  1.00 155.00 ? 36  C   B "C4'"  1 
ATOM   8403  O "O4'"  . C   B 2 36  ? 38.649  -36.694 79.684  1.00 157.12 ? 36  C   B "O4'"  1 
ATOM   8404  C "C3'"  . C   B 2 36  ? 36.869  -36.735 81.284  1.00 148.65 ? 36  C   B "C3'"  1 
ATOM   8405  O "O3'"  . C   B 2 36  ? 36.661  -38.067 81.753  1.00 147.89 ? 36  C   B "O3'"  1 
ATOM   8406  C "C2'"  . C   B 2 36  ? 38.138  -36.155 81.910  1.00 145.70 ? 36  C   B "C2'"  1 
ATOM   8407  O "O2'"  . C   B 2 36  ? 38.359  -36.522 83.257  1.00 137.66 ? 36  C   B "O2'"  1 
ATOM   8408  C "C1'"  . C   B 2 36  ? 39.217  -36.708 80.982  1.00 152.30 ? 36  C   B "C1'"  1 
ATOM   8409  N N1     . C   B 2 36  ? 40.468  -35.925 80.968  1.00 149.84 ? 36  C   B N1     1 
ATOM   8410  C C2     . C   B 2 36  ? 41.628  -36.439 81.575  1.00 146.58 ? 36  C   B C2     1 
ATOM   8411  O O2     . C   B 2 36  ? 41.601  -37.555 82.121  1.00 144.33 ? 36  C   B O2     1 
ATOM   8412  N N3     . C   B 2 36  ? 42.766  -35.702 81.556  1.00 145.09 ? 36  C   B N3     1 
ATOM   8413  C C4     . C   B 2 36  ? 42.783  -34.505 80.970  1.00 143.33 ? 36  C   B C4     1 
ATOM   8414  N N4     . C   B 2 36  ? 43.928  -33.818 80.976  1.00 141.81 ? 36  C   B N4     1 
ATOM   8415  C C5     . C   B 2 36  ? 41.622  -33.960 80.348  1.00 145.01 ? 36  C   B C5     1 
ATOM   8416  C C6     . C   B 2 36  ? 40.502  -34.693 80.372  1.00 147.17 ? 36  C   B C6     1 
ATOM   8417  H "H5'"  . C   B 2 36  ? 35.616  -35.675 79.051  1.00 187.29 ? 36  C   B "H5'"  1 
ATOM   8418  H "H5''" . C   B 2 36  ? 36.879  -34.776 79.344  1.00 187.29 ? 36  C   B "H5''" 1 
ATOM   8419  H "H4'"  . C   B 2 36  ? 36.892  -37.592 79.414  1.00 186.39 ? 36  C   B "H4'"  1 
ATOM   8420  H "H3'"  . C   B 2 36  ? 36.101  -36.173 81.469  1.00 178.77 ? 36  C   B "H3'"  1 
ATOM   8421  H "H2'"  . C   B 2 36  ? 38.119  -35.188 81.839  1.00 175.23 ? 36  C   B "H2'"  1 
ATOM   8422  H "HO2'" . C   B 2 36  ? 37.746  -36.200 83.732  1.00 165.59 ? 36  C   B "HO2'" 1 
ATOM   8423  H "H1'"  . C   B 2 36  ? 39.416  -37.624 81.234  1.00 183.15 ? 36  C   B "H1'"  1 
ATOM   8424  H H41    . C   B 2 36  ? 43.966  -33.043 80.605  1.00 170.56 ? 36  C   B H41    1 
ATOM   8425  H H42    . C   B 2 36  ? 44.626  -34.151 81.352  1.00 170.56 ? 36  C   B H42    1 
ATOM   8426  H H5     . C   B 2 36  ? 41.642  -33.124 79.940  1.00 174.41 ? 36  C   B H5     1 
ATOM   8427  H H6     . C   B 2 36  ? 39.731  -34.359 79.973  1.00 176.99 ? 36  C   B H6     1 
ATOM   8428  N N      . VAL C 1 3   ? -13.505 14.009  125.091 1.00 69.77  ? 3   VAL C N      1 
ATOM   8429  C CA     . VAL C 1 3   ? -12.547 13.631  126.125 1.00 68.58  ? 3   VAL C CA     1 
ATOM   8430  C C      . VAL C 1 3   ? -12.916 14.278  127.454 1.00 73.34  ? 3   VAL C C      1 
ATOM   8431  O O      . VAL C 1 3   ? -12.749 13.668  128.499 1.00 65.63  ? 3   VAL C O      1 
ATOM   8432  C CB     . VAL C 1 3   ? -11.091 14.032  125.741 1.00 62.41  ? 3   VAL C CB     1 
ATOM   8433  C CG1    . VAL C 1 3   ? -10.975 15.553  125.515 1.00 60.37  ? 3   VAL C CG1    1 
ATOM   8434  C CG2    . VAL C 1 3   ? -10.092 13.558  126.794 1.00 60.35  ? 3   VAL C CG2    1 
ATOM   8435  H HA     . VAL C 1 3   ? -12.572 12.668  126.242 1.00 82.68  ? 3   VAL C HA     1 
ATOM   8436  H HB     . VAL C 1 3   ? -10.862 13.595  124.905 1.00 75.29  ? 3   VAL C HB     1 
ATOM   8437  H HG11   . VAL C 1 3   ? -10.059 15.768  125.278 1.00 72.84  ? 3   VAL C HG11   1 
ATOM   8438  H HG12   . VAL C 1 3   ? -11.572 15.812  124.796 1.00 72.84  ? 3   VAL C HG12   1 
ATOM   8439  H HG13   . VAL C 1 3   ? -11.222 16.013  126.332 1.00 72.84  ? 3   VAL C HG13   1 
ATOM   8440  H HG21   . VAL C 1 3   ? -9.199  13.824  126.524 1.00 72.81  ? 3   VAL C HG21   1 
ATOM   8441  H HG22   . VAL C 1 3   ? -10.315 13.965  127.646 1.00 72.81  ? 3   VAL C HG22   1 
ATOM   8442  H HG23   . VAL C 1 3   ? -10.143 12.592  126.865 1.00 72.81  ? 3   VAL C HG23   1 
ATOM   8443  N N      . GLU C 1 4   ? -13.420 15.506  127.415 1.00 91.44  ? 4   GLU C N      1 
ATOM   8444  C CA     . GLU C 1 4   ? -13.759 16.222  128.640 1.00 101.94 ? 4   GLU C CA     1 
ATOM   8445  C C      . GLU C 1 4   ? -14.784 15.411  129.416 1.00 103.03 ? 4   GLU C C      1 
ATOM   8446  O O      . GLU C 1 4   ? -14.556 15.042  130.565 1.00 100.58 ? 4   GLU C O      1 
ATOM   8447  C CB     . GLU C 1 4   ? -14.288 17.626  128.346 1.00 110.85 ? 4   GLU C CB     1 
ATOM   8448  C CG     . GLU C 1 4   ? -14.581 18.463  129.602 1.00 113.74 ? 4   GLU C CG     1 
ATOM   8449  C CD     . GLU C 1 4   ? -13.368 18.643  130.511 1.00 115.38 ? 4   GLU C CD     1 
ATOM   8450  O OE1    . GLU C 1 4   ? -12.239 18.765  129.990 1.00 114.65 ? 4   GLU C OE1    1 
ATOM   8451  O OE2    . GLU C 1 4   ? -13.549 18.666  131.750 1.00 117.24 ? 4   GLU C OE2    1 
ATOM   8452  H H      . GLU C 1 4   ? -13.575 15.948  126.693 1.00 110.12 ? 4   GLU C H      1 
ATOM   8453  H HA     . GLU C 1 4   ? -12.963 16.308  129.188 1.00 122.72 ? 4   GLU C HA     1 
ATOM   8454  H HB2    . GLU C 1 4   ? -13.627 18.104  127.821 1.00 133.41 ? 4   GLU C HB2    1 
ATOM   8455  H HB3    . GLU C 1 4   ? -15.113 17.549  127.843 1.00 133.41 ? 4   GLU C HB3    1 
ATOM   8456  H HG2    . GLU C 1 4   ? -14.881 19.344  129.329 1.00 136.88 ? 4   GLU C HG2    1 
ATOM   8457  H HG3    . GLU C 1 4   ? -15.275 18.023  130.117 1.00 136.88 ? 4   GLU C HG3    1 
ATOM   8458  N N      . GLU C 1 5   ? -15.910 15.125  128.773 1.00 105.17 ? 5   GLU C N      1 
ATOM   8459  C CA     . GLU C 1 5   ? -17.006 14.449  129.445 1.00 105.08 ? 5   GLU C CA     1 
ATOM   8460  C C      . GLU C 1 5   ? -16.640 12.989  129.694 1.00 97.56  ? 5   GLU C C      1 
ATOM   8461  O O      . GLU C 1 5   ? -17.199 12.342  130.583 1.00 100.76 ? 5   GLU C O      1 
ATOM   8462  C CB     . GLU C 1 5   ? -18.282 14.533  128.608 1.00 112.01 ? 5   GLU C CB     1 
ATOM   8463  C CG     . GLU C 1 5   ? -19.561 14.266  129.391 1.00 118.19 ? 5   GLU C CG     1 
ATOM   8464  C CD     . GLU C 1 5   ? -20.227 15.539  129.889 1.00 123.18 ? 5   GLU C CD     1 
ATOM   8465  O OE1    . GLU C 1 5   ? -20.448 16.459  129.071 1.00 124.21 ? 5   GLU C OE1    1 
ATOM   8466  O OE2    . GLU C 1 5   ? -20.531 15.618  131.099 1.00 124.64 ? 5   GLU C OE2    1 
ATOM   8467  H H      . GLU C 1 5   ? -16.063 15.312  127.947 1.00 126.59 ? 5   GLU C H      1 
ATOM   8468  H HA     . GLU C 1 5   ? -17.171 14.874  130.301 1.00 126.49 ? 5   GLU C HA     1 
ATOM   8469  H HB2    . GLU C 1 5   ? -18.348 15.423  128.229 1.00 134.81 ? 5   GLU C HB2    1 
ATOM   8470  H HB3    . GLU C 1 5   ? -18.230 13.877  127.895 1.00 134.81 ? 5   GLU C HB3    1 
ATOM   8471  H HG2    . GLU C 1 5   ? -20.192 13.804  128.817 1.00 142.22 ? 5   GLU C HG2    1 
ATOM   8472  H HG3    . GLU C 1 5   ? -19.350 13.717  130.162 1.00 142.22 ? 5   GLU C HG3    1 
ATOM   8473  N N      . ILE C 1 6   ? -15.705 12.470  128.900 1.00 83.93  ? 6   ILE C N      1 
ATOM   8474  C CA     . ILE C 1 6   ? -15.224 11.104  129.084 1.00 72.99  ? 6   ILE C CA     1 
ATOM   8475  C C      . ILE C 1 6   ? -14.501 11.028  130.435 1.00 68.09  ? 6   ILE C C      1 
ATOM   8476  O O      . ILE C 1 6   ? -14.773 10.152  131.259 1.00 65.69  ? 6   ILE C O      1 
ATOM   8477  C CB     . ILE C 1 6   ? -14.268 10.660  127.943 1.00 63.75  ? 6   ILE C CB     1 
ATOM   8478  C CG1    . ILE C 1 6   ? -14.941 10.777  126.567 1.00 66.28  ? 6   ILE C CG1    1 
ATOM   8479  C CG2    . ILE C 1 6   ? -13.769 9.247   128.181 1.00 63.11  ? 6   ILE C CG2    1 
ATOM   8480  C CD1    . ILE C 1 6   ? -16.208 9.960   126.404 1.00 66.44  ? 6   ILE C CD1    1 
ATOM   8481  H H      . ILE C 1 6   ? -15.334 12.889  128.247 1.00 101.11 ? 6   ILE C H      1 
ATOM   8482  H HA     . ILE C 1 6   ? -15.980 10.496  129.106 1.00 87.97  ? 6   ILE C HA     1 
ATOM   8483  H HB     . ILE C 1 6   ? -13.500 11.252  127.950 1.00 76.89  ? 6   ILE C HB     1 
ATOM   8484  H HG12   . ILE C 1 6   ? -15.170 11.707  126.414 1.00 79.93  ? 6   ILE C HG12   1 
ATOM   8485  H HG13   . ILE C 1 6   ? -14.312 10.481  125.890 1.00 79.93  ? 6   ILE C HG13   1 
ATOM   8486  H HG21   . ILE C 1 6   ? -13.176 8.995   127.456 1.00 76.12  ? 6   ILE C HG21   1 
ATOM   8487  H HG22   . ILE C 1 6   ? -13.291 9.219   129.025 1.00 76.12  ? 6   ILE C HG22   1 
ATOM   8488  H HG23   . ILE C 1 6   ? -14.529 8.644   128.211 1.00 76.12  ? 6   ILE C HG23   1 
ATOM   8489  H HD11   . ILE C 1 6   ? -16.559 10.097  125.510 1.00 80.12  ? 6   ILE C HD11   1 
ATOM   8490  H HD12   . ILE C 1 6   ? -15.998 9.023   126.538 1.00 80.12  ? 6   ILE C HD12   1 
ATOM   8491  H HD13   . ILE C 1 6   ? -16.858 10.251  127.063 1.00 80.12  ? 6   ILE C HD13   1 
ATOM   8492  N N      . LEU C 1 7   ? -13.568 11.957  130.641 1.00 68.64  ? 7   LEU C N      1 
ATOM   8493  C CA     . LEU C 1 7   ? -12.788 12.031  131.877 1.00 67.39  ? 7   LEU C CA     1 
ATOM   8494  C C      . LEU C 1 7   ? -13.630 12.339  133.112 1.00 71.41  ? 7   LEU C C      1 
ATOM   8495  O O      . LEU C 1 7   ? -13.303 11.883  134.205 1.00 69.49  ? 7   LEU C O      1 
ATOM   8496  C CB     . LEU C 1 7   ? -11.671 13.069  131.762 1.00 64.69  ? 7   LEU C CB     1 
ATOM   8497  C CG     . LEU C 1 7   ? -10.597 12.835  130.694 1.00 63.28  ? 7   LEU C CG     1 
ATOM   8498  C CD1    . LEU C 1 7   ? -9.508  13.898  130.837 1.00 62.88  ? 7   LEU C CD1    1 
ATOM   8499  C CD2    . LEU C 1 7   ? -10.006 11.425  130.742 1.00 59.86  ? 7   LEU C CD2    1 
ATOM   8500  H H      . LEU C 1 7   ? -13.365 12.568  130.070 1.00 82.76  ? 7   LEU C H      1 
ATOM   8501  H HA     . LEU C 1 7   ? -12.368 11.169  132.023 1.00 81.25  ? 7   LEU C HA     1 
ATOM   8502  H HB2    . LEU C 1 7   ? -12.078 13.928  131.572 1.00 78.02  ? 7   LEU C HB2    1 
ATOM   8503  H HB3    . LEU C 1 7   ? -11.216 13.115  132.617 1.00 78.02  ? 7   LEU C HB3    1 
ATOM   8504  H HG     . LEU C 1 7   ? -11.003 12.950  129.821 1.00 76.32  ? 7   LEU C HG     1 
ATOM   8505  H HD11   . LEU C 1 7   ? -8.830  13.747  130.160 1.00 75.85  ? 7   LEU C HD11   1 
ATOM   8506  H HD12   . LEU C 1 7   ? -9.906  14.775  130.719 1.00 75.85  ? 7   LEU C HD12   1 
ATOM   8507  H HD13   . LEU C 1 7   ? -9.115  13.829  131.721 1.00 75.85  ? 7   LEU C HD13   1 
ATOM   8508  H HD21   . LEU C 1 7   ? -9.336  11.340  130.046 1.00 72.22  ? 7   LEU C HD21   1 
ATOM   8509  H HD22   . LEU C 1 7   ? -9.600  11.282  131.611 1.00 72.22  ? 7   LEU C HD22   1 
ATOM   8510  H HD23   . LEU C 1 7   ? -10.716 10.780  130.598 1.00 72.22  ? 7   LEU C HD23   1 
ATOM   8511  N N      . GLU C 1 8   ? -14.697 13.118  132.951 1.00 79.25  ? 8   GLU C N      1 
ATOM   8512  C CA     . GLU C 1 8   ? -15.526 13.485  134.097 1.00 83.08  ? 8   GLU C CA     1 
ATOM   8513  C C      . GLU C 1 8   ? -16.240 12.251  134.645 1.00 81.42  ? 8   GLU C C      1 
ATOM   8514  O O      . GLU C 1 8   ? -16.323 12.059  135.864 1.00 78.83  ? 8   GLU C O      1 
ATOM   8515  C CB     . GLU C 1 8   ? -16.557 14.548  133.704 1.00 88.03  ? 8   GLU C CB     1 
ATOM   8516  C CG     . GLU C 1 8   ? -15.986 15.928  133.421 1.00 89.71  ? 8   GLU C CG     1 
ATOM   8517  C CD     . GLU C 1 8   ? -17.068 16.954  133.125 1.00 92.43  ? 8   GLU C CD     1 
ATOM   8518  O OE1    . GLU C 1 8   ? -18.261 16.578  133.124 1.00 91.91  ? 8   GLU C OE1    1 
ATOM   8519  O OE2    . GLU C 1 8   ? -16.723 18.129  132.873 1.00 93.39  ? 8   GLU C OE2    1 
ATOM   8520  H H      . GLU C 1 8   ? -14.960 13.443  132.200 1.00 95.50  ? 8   GLU C H      1 
ATOM   8521  H HA     . GLU C 1 8   ? -14.964 13.849  134.798 1.00 100.09 ? 8   GLU C HA     1 
ATOM   8522  H HB2    . GLU C 1 8   ? -17.015 14.252  132.901 1.00 106.03 ? 8   GLU C HB2    1 
ATOM   8523  H HB3    . GLU C 1 8   ? -17.197 14.640  134.427 1.00 106.03 ? 8   GLU C HB3    1 
ATOM   8524  H HG2    . GLU C 1 8   ? -15.488 16.230  134.197 1.00 108.04 ? 8   GLU C HG2    1 
ATOM   8525  H HG3    . GLU C 1 8   ? -15.401 15.877  132.649 1.00 108.04 ? 8   GLU C HG3    1 
ATOM   8526  N N      . LYS C 1 9   ? -16.730 11.409  133.735 1.00 79.71  ? 9   LYS C N      1 
ATOM   8527  C CA     . LYS C 1 9   ? -17.394 10.163  134.107 1.00 76.87  ? 9   LYS C CA     1 
ATOM   8528  C C      . LYS C 1 9   ? -16.456 9.267   134.903 1.00 71.26  ? 9   LYS C C      1 
ATOM   8529  O O      . LYS C 1 9   ? -16.829 8.737   135.944 1.00 75.79  ? 9   LYS C O      1 
ATOM   8530  C CB     . LYS C 1 9   ? -17.885 9.415   132.859 1.00 79.30  ? 9   LYS C CB     1 
ATOM   8531  C CG     . LYS C 1 9   ? -19.000 10.113  132.066 1.00 84.41  ? 9   LYS C CG     1 
ATOM   8532  C CD     . LYS C 1 9   ? -19.157 9.510   130.659 1.00 86.30  ? 9   LYS C CD     1 
ATOM   8533  C CE     . LYS C 1 9   ? -20.104 10.317  129.768 1.00 86.92  ? 9   LYS C CE     1 
ATOM   8534  N NZ     . LYS C 1 9   ? -20.188 9.761   128.384 1.00 83.99  ? 9   LYS C NZ     1 
ATOM   8535  H H      . LYS C 1 9   ? -16.690 11.541  132.886 1.00 96.04  ? 9   LYS C H      1 
ATOM   8536  H HA     . LYS C 1 9   ? -18.164 10.365  134.662 1.00 92.64  ? 9   LYS C HA     1 
ATOM   8537  H HB2    . LYS C 1 9   ? -17.133 9.294   132.258 1.00 95.54  ? 9   LYS C HB2    1 
ATOM   8538  H HB3    . LYS C 1 9   ? -18.222 8.548   133.133 1.00 95.54  ? 9   LYS C HB3    1 
ATOM   8539  H HG2    . LYS C 1 9   ? -19.841 10.008  132.538 1.00 101.68 ? 9   LYS C HG2    1 
ATOM   8540  H HG3    . LYS C 1 9   ? -18.783 11.054  131.971 1.00 101.68 ? 9   LYS C HG3    1 
ATOM   8541  H HD2    . LYS C 1 9   ? -18.288 9.485   130.227 1.00 103.95 ? 9   LYS C HD2    1 
ATOM   8542  H HD3    . LYS C 1 9   ? -19.513 8.611   130.738 1.00 103.95 ? 9   LYS C HD3    1 
ATOM   8543  H HE2    . LYS C 1 9   ? -20.993 10.301  130.154 1.00 104.69 ? 9   LYS C HE2    1 
ATOM   8544  H HE3    . LYS C 1 9   ? -19.782 11.230  129.707 1.00 104.69 ? 9   LYS C HE3    1 
ATOM   8545  H HZ1    . LYS C 1 9   ? -20.745 10.252  127.893 1.00 101.18 ? 9   LYS C HZ1    1 
ATOM   8546  H HZ2    . LYS C 1 9   ? -19.383 9.770   128.004 1.00 101.18 ? 9   LYS C HZ2    1 
ATOM   8547  H HZ3    . LYS C 1 9   ? -20.487 8.923   128.411 1.00 101.18 ? 9   LYS C HZ3    1 
ATOM   8548  N N      . ALA C 1 10  ? -15.229 9.126   134.416 1.00 62.90  ? 10  ALA C N      1 
ATOM   8549  C CA     . ALA C 1 10  ? -14.243 8.226   135.018 1.00 59.75  ? 10  ALA C CA     1 
ATOM   8550  C C      . ALA C 1 10  ? -13.806 8.595   136.440 1.00 60.09  ? 10  ALA C C      1 
ATOM   8551  O O      . ALA C 1 10  ? -13.464 7.718   137.243 1.00 56.43  ? 10  ALA C O      1 
ATOM   8552  C CB     . ALA C 1 10  ? -13.015 8.157   134.119 1.00 59.08  ? 10  ALA C CB     1 
ATOM   8553  H H      . ALA C 1 10  ? -14.935 9.547   133.726 1.00 75.87  ? 10  ALA C H      1 
ATOM   8554  H HA     . ALA C 1 10  ? -14.626 7.336   135.055 1.00 72.09  ? 10  ALA C HA     1 
ATOM   8555  H HB1    . ALA C 1 10  ? -12.364 7.560   134.520 1.00 71.29  ? 10  ALA C HB1    1 
ATOM   8556  H HB2    . ALA C 1 10  ? -13.280 7.821   133.248 1.00 71.29  ? 10  ALA C HB2    1 
ATOM   8557  H HB3    . ALA C 1 10  ? -12.638 9.046   134.030 1.00 71.29  ? 10  ALA C HB3    1 
ATOM   8558  N N      . LEU C 1 11  ? -13.830 9.889   136.743 1.00 65.85  ? 11  LEU C N      1 
ATOM   8559  C CA     . LEU C 1 11  ? -13.383 10.395  138.037 1.00 71.04  ? 11  LEU C CA     1 
ATOM   8560  C C      . LEU C 1 11  ? -13.964 9.616   139.208 1.00 76.61  ? 11  LEU C C      1 
ATOM   8561  O O      . LEU C 1 11  ? -13.245 9.211   140.122 1.00 77.15  ? 11  LEU C O      1 
ATOM   8562  C CB     . LEU C 1 11  ? -13.769 11.871  138.169 1.00 72.99  ? 11  LEU C CB     1 
ATOM   8563  C CG     . LEU C 1 11  ? -12.998 12.882  137.323 1.00 72.76  ? 11  LEU C CG     1 
ATOM   8564  C CD1    . LEU C 1 11  ? -13.653 14.253  137.381 1.00 73.27  ? 11  LEU C CD1    1 
ATOM   8565  C CD2    . LEU C 1 11  ? -11.567 12.959  137.798 1.00 71.39  ? 11  LEU C CD2    1 
ATOM   8566  H H      . LEU C 1 11  ? -14.106 10.503  136.208 1.00 79.41  ? 11  LEU C H      1 
ATOM   8567  H HA     . LEU C 1 11  ? -12.416 10.331  138.085 1.00 85.64  ? 11  LEU C HA     1 
ATOM   8568  H HB2    . LEU C 1 11  ? -14.706 11.958  137.931 1.00 87.98  ? 11  LEU C HB2    1 
ATOM   8569  H HB3    . LEU C 1 11  ? -13.652 12.129  139.097 1.00 87.98  ? 11  LEU C HB3    1 
ATOM   8570  H HG     . LEU C 1 11  ? -12.995 12.587  136.399 1.00 87.70  ? 11  LEU C HG     1 
ATOM   8571  H HD11   . LEU C 1 11  ? -13.141 14.870  136.835 1.00 88.32  ? 11  LEU C HD11   1 
ATOM   8572  H HD12   . LEU C 1 11  ? -14.559 14.184  137.042 1.00 88.32  ? 11  LEU C HD12   1 
ATOM   8573  H HD13   . LEU C 1 11  ? -13.666 14.557  138.301 1.00 88.32  ? 11  LEU C HD13   1 
ATOM   8574  H HD21   . LEU C 1 11  ? -11.088 13.604  137.254 1.00 86.06  ? 11  LEU C HD21   1 
ATOM   8575  H HD22   . LEU C 1 11  ? -11.558 13.239  138.727 1.00 86.06  ? 11  LEU C HD22   1 
ATOM   8576  H HD23   . LEU C 1 11  ? -11.158 12.084  137.712 1.00 86.06  ? 11  LEU C HD23   1 
ATOM   8577  N N      . GLU C 1 12  ? -15.265 9.377   139.144 1.00 81.12  ? 12  GLU C N      1 
ATOM   8578  C CA     . GLU C 1 12  ? -15.977 8.738   140.235 1.00 84.56  ? 12  GLU C CA     1 
ATOM   8579  C C      . GLU C 1 12  ? -15.372 7.371   140.541 1.00 76.43  ? 12  GLU C C      1 
ATOM   8580  O O      . GLU C 1 12  ? -15.333 6.950   141.702 1.00 80.86  ? 12  GLU C O      1 
ATOM   8581  C CB     . GLU C 1 12  ? -17.461 8.627   139.886 1.00 92.68  ? 12  GLU C CB     1 
ATOM   8582  C CG     . GLU C 1 12  ? -18.064 9.975   139.477 1.00 98.05  ? 12  GLU C CG     1 
ATOM   8583  C CD     . GLU C 1 12  ? -19.544 9.902   139.155 1.00 103.84 ? 12  GLU C CD     1 
ATOM   8584  O OE1    . GLU C 1 12  ? -20.170 10.975  139.000 1.00 106.01 ? 12  GLU C OE1    1 
ATOM   8585  O OE2    . GLU C 1 12  ? -20.074 8.776   139.031 1.00 106.30 ? 12  GLU C OE2    1 
ATOM   8586  H H      . GLU C 1 12  ? -15.762 9.577   138.472 1.00 97.73  ? 12  GLU C H      1 
ATOM   8587  H HA     . GLU C 1 12  ? -15.895 9.288   141.030 1.00 101.86 ? 12  GLU C HA     1 
ATOM   8588  H HB2    . GLU C 1 12  ? -17.568 8.012   139.144 1.00 111.60 ? 12  GLU C HB2    1 
ATOM   8589  H HB3    . GLU C 1 12  ? -17.946 8.303   140.660 1.00 111.60 ? 12  GLU C HB3    1 
ATOM   8590  H HG2    . GLU C 1 12  ? -17.949 10.605  140.206 1.00 118.05 ? 12  GLU C HG2    1 
ATOM   8591  H HG3    . GLU C 1 12  ? -17.603 10.298  138.687 1.00 118.05 ? 12  GLU C HG3    1 
ATOM   8592  N N      . LEU C 1 13  ? -14.855 6.712   139.502 1.00 63.54  ? 13  LEU C N      1 
ATOM   8593  C CA     . LEU C 1 13  ? -14.315 5.351   139.623 1.00 57.20  ? 13  LEU C CA     1 
ATOM   8594  C C      . LEU C 1 13  ? -12.977 5.309   140.340 1.00 53.82  ? 13  LEU C C      1 
ATOM   8595  O O      . LEU C 1 13  ? -12.667 4.355   141.058 1.00 52.13  ? 13  LEU C O      1 
ATOM   8596  C CB     . LEU C 1 13  ? -14.137 4.720   138.244 1.00 55.78  ? 13  LEU C CB     1 
ATOM   8597  C CG     . LEU C 1 13  ? -15.336 4.740   137.308 1.00 56.41  ? 13  LEU C CG     1 
ATOM   8598  C CD1    . LEU C 1 13  ? -14.940 4.134   135.963 1.00 54.54  ? 13  LEU C CD1    1 
ATOM   8599  C CD2    . LEU C 1 13  ? -16.509 3.984   137.939 1.00 59.05  ? 13  LEU C CD2    1 
ATOM   8600  H H      . LEU C 1 13  ? -14.804 7.033   138.706 1.00 76.64  ? 13  LEU C H      1 
ATOM   8601  H HA     . LEU C 1 13  ? -14.942 4.807   140.124 1.00 69.04  ? 13  LEU C HA     1 
ATOM   8602  H HB2    . LEU C 1 13  ? -13.415 5.183   137.792 1.00 67.33  ? 13  LEU C HB2    1 
ATOM   8603  H HB3    . LEU C 1 13  ? -13.890 3.790   138.369 1.00 67.33  ? 13  LEU C HB3    1 
ATOM   8604  H HG     . LEU C 1 13  ? -15.610 5.659   137.159 1.00 68.08  ? 13  LEU C HG     1 
ATOM   8605  H HD11   . LEU C 1 13  ? -15.708 4.150   135.371 1.00 65.83  ? 13  LEU C HD11   1 
ATOM   8606  H HD12   . LEU C 1 13  ? -14.217 4.657   135.582 1.00 65.83  ? 13  LEU C HD12   1 
ATOM   8607  H HD13   . LEU C 1 13  ? -14.649 3.220   136.103 1.00 65.83  ? 13  LEU C HD13   1 
ATOM   8608  H HD21   . LEU C 1 13  ? -17.263 4.007   137.330 1.00 71.25  ? 13  LEU C HD21   1 
ATOM   8609  H HD22   . LEU C 1 13  ? -16.241 3.066   138.101 1.00 71.25  ? 13  LEU C HD22   1 
ATOM   8610  H HD23   . LEU C 1 13  ? -16.746 4.412   138.776 1.00 71.25  ? 13  LEU C HD23   1 
ATOM   8611  N N      . VAL C 1 14  ? -12.162 6.323   140.083 1.00 52.80  ? 14  VAL C N      1 
ATOM   8612  C CA     . VAL C 1 14  ? -10.810 6.359   140.613 1.00 49.72  ? 14  VAL C CA     1 
ATOM   8613  C C      . VAL C 1 14  ? -10.752 7.132   141.931 1.00 47.98  ? 14  VAL C C      1 
ATOM   8614  O O      . VAL C 1 14  ? -9.781  7.015   142.670 1.00 48.01  ? 14  VAL C O      1 
ATOM   8615  C CB     . VAL C 1 14  ? -9.825  6.959   139.572 1.00 45.04  ? 14  VAL C CB     1 
ATOM   8616  C CG1    . VAL C 1 14  ? -9.657  6.016   138.396 1.00 44.46  ? 14  VAL C CG1    1 
ATOM   8617  C CG2    . VAL C 1 14  ? -10.292 8.330   139.106 1.00 45.71  ? 14  VAL C CG2    1 
ATOM   8618  H H      . VAL C 1 14  ? -12.370 7.005   139.601 1.00 63.75  ? 14  VAL C H      1 
ATOM   8619  H HA     . VAL C 1 14  ? -10.526 5.449   140.795 1.00 60.05  ? 14  VAL C HA     1 
ATOM   8620  H HB     . VAL C 1 14  ? -8.957  7.068   139.991 1.00 54.44  ? 14  VAL C HB     1 
ATOM   8621  H HG11   . VAL C 1 14  ? -9.039  6.412   137.761 1.00 52.91  ? 14  VAL C HG11   1 
ATOM   8622  H HG12   . VAL C 1 14  ? -9.306  5.171   138.716 1.00 52.91  ? 14  VAL C HG12   1 
ATOM   8623  H HG13   . VAL C 1 14  ? -10.520 5.879   137.976 1.00 52.91  ? 14  VAL C HG13   1 
ATOM   8624  H HG21   . VAL C 1 14  ? -9.658  8.676   138.459 1.00 55.25  ? 14  VAL C HG21   1 
ATOM   8625  H HG22   . VAL C 1 14  ? -11.168 8.243   138.697 1.00 55.25  ? 14  VAL C HG22   1 
ATOM   8626  H HG23   . VAL C 1 14  ? -10.342 8.924   139.871 1.00 55.25  ? 14  VAL C HG23   1 
ATOM   8627  N N      . ILE C 1 15  ? -11.812 7.863   142.265 1.00 49.03  ? 15  ILE C N      1 
ATOM   8628  C CA     . ILE C 1 15  ? -11.765 8.753   143.430 1.00 52.69  ? 15  ILE C CA     1 
ATOM   8629  C C      . ILE C 1 15  ? -12.421 8.130   144.662 1.00 57.46  ? 15  ILE C C      1 
ATOM   8630  O O      . ILE C 1 15  ? -13.599 7.757   144.610 1.00 57.55  ? 15  ILE C O      1 
ATOM   8631  C CB     . ILE C 1 15  ? -12.453 10.097  143.132 1.00 52.65  ? 15  ILE C CB     1 
ATOM   8632  C CG1    . ILE C 1 15  ? -11.605 10.889  142.136 1.00 50.69  ? 15  ILE C CG1    1 
ATOM   8633  C CG2    . ILE C 1 15  ? -12.629 10.914  144.412 1.00 53.00  ? 15  ILE C CG2    1 
ATOM   8634  C CD1    . ILE C 1 15  ? -12.241 12.154  141.651 1.00 51.47  ? 15  ILE C CD1    1 
ATOM   8635  H H      . ILE C 1 15  ? -12.561 7.865   141.842 1.00 59.23  ? 15  ILE C H      1 
ATOM   8636  H HA     . ILE C 1 15  ? -10.837 8.935   143.647 1.00 63.62  ? 15  ILE C HA     1 
ATOM   8637  H HB     . ILE C 1 15  ? -13.325 9.927   142.741 1.00 63.57  ? 15  ILE C HB     1 
ATOM   8638  H HG12   . ILE C 1 15  ? -10.766 11.125  142.562 1.00 61.21  ? 15  ILE C HG12   1 
ATOM   8639  H HG13   . ILE C 1 15  ? -11.433 10.330  141.362 1.00 61.21  ? 15  ILE C HG13   1 
ATOM   8640  H HG21   . ILE C 1 15  ? -13.064 11.753  144.193 1.00 63.99  ? 15  ILE C HG21   1 
ATOM   8641  H HG22   . ILE C 1 15  ? -13.175 10.410  145.035 1.00 63.99  ? 15  ILE C HG22   1 
ATOM   8642  H HG23   . ILE C 1 15  ? -11.756 11.085  144.799 1.00 63.99  ? 15  ILE C HG23   1 
ATOM   8643  H HD11   . ILE C 1 15  ? -11.640 12.591  141.028 1.00 62.15  ? 15  ILE C HD11   1 
ATOM   8644  H HD12   . ILE C 1 15  ? -13.077 11.938  141.208 1.00 62.15  ? 15  ILE C HD12   1 
ATOM   8645  H HD13   . ILE C 1 15  ? -12.410 12.734  142.410 1.00 62.15  ? 15  ILE C HD13   1 
ATOM   8646  N N      . PRO C 1 16  ? -11.669 8.039   145.781 1.00 64.06  ? 16  PRO C N      1 
ATOM   8647  C CA     . PRO C 1 16  ? -12.269 7.467   146.988 1.00 68.18  ? 16  PRO C CA     1 
ATOM   8648  C C      . PRO C 1 16  ? -13.483 8.285   147.408 1.00 76.27  ? 16  PRO C C      1 
ATOM   8649  O O      . PRO C 1 16  ? -13.391 9.516   147.438 1.00 75.38  ? 16  PRO C O      1 
ATOM   8650  C CB     . PRO C 1 16  ? -11.141 7.552   148.022 1.00 66.48  ? 16  PRO C CB     1 
ATOM   8651  C CG     . PRO C 1 16  ? -9.897  7.624   147.232 1.00 64.46  ? 16  PRO C CG     1 
ATOM   8652  C CD     . PRO C 1 16  ? -10.248 8.371   145.988 1.00 63.44  ? 16  PRO C CD     1 
ATOM   8653  H HA     . PRO C 1 16  ? -12.523 6.542   146.846 1.00 82.20  ? 16  PRO C HA     1 
ATOM   8654  H HB2    . PRO C 1 16  ? -11.251 8.350   148.561 1.00 80.17  ? 16  PRO C HB2    1 
ATOM   8655  H HB3    . PRO C 1 16  ? -11.148 6.758   148.578 1.00 80.17  ? 16  PRO C HB3    1 
ATOM   8656  H HG2    . PRO C 1 16  ? -9.219  8.101   147.736 1.00 77.74  ? 16  PRO C HG2    1 
ATOM   8657  H HG3    . PRO C 1 16  ? -9.596  6.727   147.018 1.00 77.74  ? 16  PRO C HG3    1 
ATOM   8658  H HD2    . PRO C 1 16  ? -10.140 9.325   146.124 1.00 76.51  ? 16  PRO C HD2    1 
ATOM   8659  H HD3    . PRO C 1 16  ? -9.714  8.055   145.242 1.00 76.51  ? 16  PRO C HD3    1 
ATOM   8660  N N      . ASP C 1 17  ? -14.600 7.626   147.708 1.00 83.35  ? 17  ASP C N      1 
ATOM   8661  C CA     . ASP C 1 17  ? -15.793 8.352   148.131 1.00 88.65  ? 17  ASP C CA     1 
ATOM   8662  C C      . ASP C 1 17  ? -15.697 8.816   149.581 1.00 87.93  ? 17  ASP C C      1 
ATOM   8663  O O      . ASP C 1 17  ? -14.767 8.455   150.304 1.00 86.57  ? 17  ASP C O      1 
ATOM   8664  C CB     . ASP C 1 17  ? -17.056 7.504   147.911 1.00 94.85  ? 17  ASP C CB     1 
ATOM   8665  C CG     . ASP C 1 17  ? -16.905 6.078   148.383 1.00 98.65  ? 17  ASP C CG     1 
ATOM   8666  O OD1    . ASP C 1 17  ? -16.355 5.859   149.481 1.00 100.25 ? 17  ASP C OD1    1 
ATOM   8667  O OD2    . ASP C 1 17  ? -17.358 5.175   147.646 1.00 99.81  ? 17  ASP C OD2    1 
ATOM   8668  H H      . ASP C 1 17  ? -14.692 6.772   147.674 1.00 100.41 ? 17  ASP C H      1 
ATOM   8669  H HA     . ASP C 1 17  ? -15.878 9.146   147.579 1.00 106.77 ? 17  ASP C HA     1 
ATOM   8670  H HB2    . ASP C 1 17  ? -17.793 7.904   148.399 1.00 114.21 ? 17  ASP C HB2    1 
ATOM   8671  H HB3    . ASP C 1 17  ? -17.261 7.484   146.963 1.00 114.21 ? 17  ASP C HB3    1 
ATOM   8672  N N      . GLU C 1 18  ? -16.696 9.596   149.992 1.00 89.07  ? 18  GLU C N      1 
ATOM   8673  C CA     . GLU C 1 18  ? -16.696 10.313  151.268 1.00 86.11  ? 18  GLU C CA     1 
ATOM   8674  C C      . GLU C 1 18  ? -16.594 9.343   152.424 1.00 84.25  ? 18  GLU C C      1 
ATOM   8675  O O      . GLU C 1 18  ? -15.886 9.580   153.401 1.00 81.80  ? 18  GLU C O      1 
ATOM   8676  C CB     . GLU C 1 18  ? -17.965 11.161  151.398 1.00 88.12  ? 18  GLU C CB     1 
ATOM   8677  C CG     . GLU C 1 18  ? -18.118 12.198  150.286 1.00 89.20  ? 18  GLU C CG     1 
ATOM   8678  C CD     . GLU C 1 18  ? -19.435 12.951  150.341 1.00 92.10  ? 18  GLU C CD     1 
ATOM   8679  O OE1    . GLU C 1 18  ? -20.352 12.506  151.067 1.00 94.23  ? 18  GLU C OE1    1 
ATOM   8680  O OE2    . GLU C 1 18  ? -19.552 13.989  149.651 1.00 91.18  ? 18  GLU C OE2    1 
ATOM   8681  H H      . GLU C 1 18  ? -17.410 9.731   149.532 1.00 107.28 ? 18  GLU C H      1 
ATOM   8682  H HA     . GLU C 1 18  ? -15.929 10.907  151.301 1.00 103.72 ? 18  GLU C HA     1 
ATOM   8683  H HB2    . GLU C 1 18  ? -18.738 10.576  151.367 1.00 106.14 ? 18  GLU C HB2    1 
ATOM   8684  H HB3    . GLU C 1 18  ? -17.942 11.634  152.244 1.00 106.14 ? 18  GLU C HB3    1 
ATOM   8685  H HG2    . GLU C 1 18  ? -17.401 12.847  150.362 1.00 107.43 ? 18  GLU C HG2    1 
ATOM   8686  H HG3    . GLU C 1 18  ? -18.067 11.748  149.429 1.00 107.43 ? 18  GLU C HG3    1 
ATOM   8687  N N      . GLU C 1 19  ? -17.330 8.251   152.292 1.00 87.72  ? 19  GLU C N      1 
ATOM   8688  C CA     . GLU C 1 19  ? -17.417 7.232   153.322 1.00 95.54  ? 19  GLU C CA     1 
ATOM   8689  C C      . GLU C 1 19  ? -16.120 6.436   153.460 1.00 92.37  ? 19  GLU C C      1 
ATOM   8690  O O      . GLU C 1 19  ? -15.821 5.914   154.539 1.00 94.71  ? 19  GLU C O      1 
ATOM   8691  C CB     . GLU C 1 19  ? -18.614 6.335   152.996 1.00 102.58 ? 19  GLU C CB     1 
ATOM   8692  C CG     . GLU C 1 19  ? -18.545 5.674   151.621 1.00 103.16 ? 19  GLU C CG     1 
ATOM   8693  C CD     . GLU C 1 19  ? -19.797 4.883   151.290 1.00 104.80 ? 19  GLU C CD     1 
ATOM   8694  O OE1    . GLU C 1 19  ? -20.529 4.498   152.228 1.00 105.46 ? 19  GLU C OE1    1 
ATOM   8695  O OE2    . GLU C 1 19  ? -20.066 4.674   150.086 1.00 104.91 ? 19  GLU C OE2    1 
ATOM   8696  H H      . GLU C 1 19  ? -17.801 8.073   151.594 1.00 105.65 ? 19  GLU C H      1 
ATOM   8697  H HA     . GLU C 1 19  ? -17.592 7.663   154.173 1.00 115.04 ? 19  GLU C HA     1 
ATOM   8698  H HB2    . GLU C 1 19  ? -18.664 5.629   153.660 1.00 123.49 ? 19  GLU C HB2    1 
ATOM   8699  H HB3    . GLU C 1 19  ? -19.422 6.870   153.026 1.00 123.49 ? 19  GLU C HB3    1 
ATOM   8700  H HG2    . GLU C 1 19  ? -18.436 6.362   150.945 1.00 124.18 ? 19  GLU C HG2    1 
ATOM   8701  H HG3    . GLU C 1 19  ? -17.790 5.065   151.600 1.00 124.18 ? 19  GLU C HG3    1 
ATOM   8702  N N      . GLU C 1 20  ? -15.344 6.358   152.382 1.00 85.39  ? 20  GLU C N      1 
ATOM   8703  C CA     . GLU C 1 20  ? -14.005 5.789   152.468 1.00 81.10  ? 20  GLU C CA     1 
ATOM   8704  C C      . GLU C 1 20  ? -13.091 6.812   153.119 1.00 75.91  ? 20  GLU C C      1 
ATOM   8705  O O      . GLU C 1 20  ? -12.253 6.470   153.949 1.00 76.16  ? 20  GLU C O      1 
ATOM   8706  C CB     . GLU C 1 20  ? -13.442 5.392   151.107 1.00 81.15  ? 20  GLU C CB     1 
ATOM   8707  C CG     . GLU C 1 20  ? -12.026 4.831   151.234 1.00 82.00  ? 20  GLU C CG     1 
ATOM   8708  C CD     . GLU C 1 20  ? -11.553 4.070   150.004 1.00 82.88  ? 20  GLU C CD     1 
ATOM   8709  O OE1    . GLU C 1 20  ? -11.923 4.456   148.871 1.00 84.75  ? 20  GLU C OE1    1 
ATOM   8710  O OE2    . GLU C 1 20  ? -10.812 3.075   150.181 1.00 80.66  ? 20  GLU C OE2    1 
ATOM   8711  H H      . GLU C 1 20  ? -15.568 6.626   151.596 1.00 102.86 ? 20  GLU C H      1 
ATOM   8712  H HA     . GLU C 1 20  ? -14.027 4.999   153.030 1.00 97.71  ? 20  GLU C HA     1 
ATOM   8713  H HB2    . GLU C 1 20  ? -14.007 4.708   150.714 1.00 97.77  ? 20  GLU C HB2    1 
ATOM   8714  H HB3    . GLU C 1 20  ? -13.410 6.173   150.533 1.00 97.77  ? 20  GLU C HB3    1 
ATOM   8715  H HG2    . GLU C 1 20  ? -11.411 5.566   151.382 1.00 98.79  ? 20  GLU C HG2    1 
ATOM   8716  H HG3    . GLU C 1 20  ? -11.998 4.222   151.988 1.00 98.79  ? 20  GLU C HG3    1 
ATOM   8717  N N      . VAL C 1 21  ? -13.242 8.066   152.699 1.00 70.05  ? 21  VAL C N      1 
ATOM   8718  C CA     . VAL C 1 21  ? -12.498 9.181   153.279 1.00 64.43  ? 21  VAL C CA     1 
ATOM   8719  C C      . VAL C 1 21  ? -12.813 9.352   154.764 1.00 70.54  ? 21  VAL C C      1 
ATOM   8720  O O      . VAL C 1 21  ? -11.923 9.696   155.545 1.00 70.98  ? 21  VAL C O      1 
ATOM   8721  C CB     . VAL C 1 21  ? -12.790 10.506  152.534 1.00 62.11  ? 21  VAL C CB     1 
ATOM   8722  C CG1    . VAL C 1 21  ? -12.135 11.701  153.236 1.00 61.30  ? 21  VAL C CG1    1 
ATOM   8723  C CG2    . VAL C 1 21  ? -12.314 10.415  151.093 1.00 62.02  ? 21  VAL C CG2    1 
ATOM   8724  H H      . VAL C 1 21  ? -13.778 8.300   152.068 1.00 84.45  ? 21  VAL C H      1 
ATOM   8725  H HA     . VAL C 1 21  ? -11.549 8.999   153.197 1.00 77.70  ? 21  VAL C HA     1 
ATOM   8726  H HB     . VAL C 1 21  ? -13.749 10.656  152.522 1.00 74.93  ? 21  VAL C HB     1 
ATOM   8727  H HG11   . VAL C 1 21  ? -12.341 12.510  152.741 1.00 73.95  ? 21  VAL C HG11   1 
ATOM   8728  H HG12   . VAL C 1 21  ? -12.485 11.768  154.138 1.00 73.95  ? 21  VAL C HG12   1 
ATOM   8729  H HG13   . VAL C 1 21  ? -11.175 11.564  153.262 1.00 73.95  ? 21  VAL C HG13   1 
ATOM   8730  H HG21   . VAL C 1 21  ? -12.505 11.253  150.644 1.00 74.81  ? 21  VAL C HG21   1 
ATOM   8731  H HG22   . VAL C 1 21  ? -11.358 10.247  151.087 1.00 74.81  ? 21  VAL C HG22   1 
ATOM   8732  H HG23   . VAL C 1 21  ? -12.781 9.689   150.652 1.00 74.81  ? 21  VAL C HG23   1 
ATOM   8733  N N      . ARG C 1 22  ? -14.072 9.140   155.150 1.00 76.80  ? 22  ARG C N      1 
ATOM   8734  C CA     . ARG C 1 22  ? -14.469 9.289   156.551 1.00 79.33  ? 22  ARG C CA     1 
ATOM   8735  C C      . ARG C 1 22  ? -13.788 8.227   157.399 1.00 79.29  ? 22  ARG C C      1 
ATOM   8736  O O      . ARG C 1 22  ? -13.274 8.521   158.480 1.00 80.72  ? 22  ARG C O      1 
ATOM   8737  C CB     . ARG C 1 22  ? -15.984 9.178   156.725 1.00 81.32  ? 22  ARG C CB     1 
ATOM   8738  C CG     . ARG C 1 22  ? -16.445 9.404   158.166 1.00 85.02  ? 22  ARG C CG     1 
ATOM   8739  C CD     . ARG C 1 22  ? -17.907 9.069   158.353 1.00 90.12  ? 22  ARG C CD     1 
ATOM   8740  N NE     . ARG C 1 22  ? -18.165 7.636   158.221 1.00 93.54  ? 22  ARG C NE     1 
ATOM   8741  C CZ     . ARG C 1 22  ? -18.280 6.788   159.243 1.00 97.45  ? 22  ARG C CZ     1 
ATOM   8742  N NH1    . ARG C 1 22  ? -18.164 7.210   160.499 1.00 100.22 ? 22  ARG C NH1    1 
ATOM   8743  N NH2    . ARG C 1 22  ? -18.521 5.503   159.012 1.00 97.25  ? 22  ARG C NH2    1 
ATOM   8744  H H      . ARG C 1 22  ? -14.712 8.909   154.623 1.00 92.55  ? 22  ARG C H      1 
ATOM   8745  H HA     . ARG C 1 22  ? -14.189 10.161  156.872 1.00 95.58  ? 22  ARG C HA     1 
ATOM   8746  H HB2    . ARG C 1 22  ? -16.415 9.843   156.166 1.00 97.98  ? 22  ARG C HB2    1 
ATOM   8747  H HB3    . ARG C 1 22  ? -16.267 8.289   156.458 1.00 97.98  ? 22  ARG C HB3    1 
ATOM   8748  H HG2    . ARG C 1 22  ? -15.927 8.838   158.759 1.00 102.42 ? 22  ARG C HG2    1 
ATOM   8749  H HG3    . ARG C 1 22  ? -16.317 10.337  158.398 1.00 102.42 ? 22  ARG C HG3    1 
ATOM   8750  H HD2    . ARG C 1 22  ? -18.185 9.345   159.241 1.00 108.54 ? 22  ARG C HD2    1 
ATOM   8751  H HD3    . ARG C 1 22  ? -18.429 9.534   157.680 1.00 108.54 ? 22  ARG C HD3    1 
ATOM   8752  H HE     . ARG C 1 22  ? -18.250 7.318   157.427 1.00 112.64 ? 22  ARG C HE     1 
ATOM   8753  H HH11   . ARG C 1 22  ? -18.010 8.040   160.661 1.00 120.65 ? 22  ARG C HH11   1 
ATOM   8754  H HH12   . ARG C 1 22  ? -18.241 6.652   161.149 1.00 120.65 ? 22  ARG C HH12   1 
ATOM   8755  H HH21   . ARG C 1 22  ? -18.598 5.219   158.204 1.00 117.09 ? 22  ARG C HH21   1 
ATOM   8756  H HH22   . ARG C 1 22  ? -18.595 4.955   159.670 1.00 117.09 ? 22  ARG C HH22   1 
ATOM   8757  N N      . LYS C 1 23  ? -13.817 6.988   156.918 1.00 76.66  ? 23  LYS C N      1 
ATOM   8758  C CA     . LYS C 1 23  ? -13.138 5.896   157.599 1.00 78.46  ? 23  LYS C CA     1 
ATOM   8759  C C      . LYS C 1 23  ? -11.652 6.235   157.746 1.00 79.36  ? 23  LYS C C      1 
ATOM   8760  O O      . LYS C 1 23  ? -11.034 5.924   158.769 1.00 82.96  ? 23  LYS C O      1 
ATOM   8761  C CB     . LYS C 1 23  ? -13.327 4.576   156.843 1.00 78.97  ? 23  LYS C CB     1 
ATOM   8762  C CG     . LYS C 1 23  ? -14.498 3.742   157.353 1.00 84.67  ? 23  LYS C CG     1 
ATOM   8763  C CD     . LYS C 1 23  ? -14.232 3.164   158.747 1.00 88.93  ? 23  LYS C CD     1 
ATOM   8764  C CE     . LYS C 1 23  ? -15.445 2.396   159.283 1.00 91.36  ? 23  LYS C CE     1 
ATOM   8765  N NZ     . LYS C 1 23  ? -15.252 1.892   160.676 1.00 92.25  ? 23  LYS C NZ     1 
ATOM   8766  H H      . LYS C 1 23  ? -14.224 6.755   156.198 1.00 92.39  ? 23  LYS C H      1 
ATOM   8767  H HA     . LYS C 1 23  ? -13.514 5.791   158.487 1.00 94.54  ? 23  LYS C HA     1 
ATOM   8768  H HB2    . LYS C 1 23  ? -13.487 4.772   155.907 1.00 95.15  ? 23  LYS C HB2    1 
ATOM   8769  H HB3    . LYS C 1 23  ? -12.521 4.044   156.936 1.00 95.15  ? 23  LYS C HB3    1 
ATOM   8770  H HG2    . LYS C 1 23  ? -15.289 4.302   157.404 1.00 102.00 ? 23  LYS C HG2    1 
ATOM   8771  H HG3    . LYS C 1 23  ? -14.651 3.003   156.744 1.00 102.00 ? 23  LYS C HG3    1 
ATOM   8772  H HD2    . LYS C 1 23  ? -13.482 2.551   158.701 1.00 107.10 ? 23  LYS C HD2    1 
ATOM   8773  H HD3    . LYS C 1 23  ? -14.036 3.889   159.361 1.00 107.10 ? 23  LYS C HD3    1 
ATOM   8774  H HE2    . LYS C 1 23  ? -16.215 2.985   159.282 1.00 110.02 ? 23  LYS C HE2    1 
ATOM   8775  H HE3    . LYS C 1 23  ? -15.612 1.632   158.709 1.00 110.02 ? 23  LYS C HE3    1 
ATOM   8776  H HZ1    . LYS C 1 23  ? -15.979 1.455   160.944 1.00 111.09 ? 23  LYS C HZ1    1 
ATOM   8777  H HZ2    . LYS C 1 23  ? -14.554 1.340   160.706 1.00 111.09 ? 23  LYS C HZ2    1 
ATOM   8778  H HZ3    . LYS C 1 23  ? -15.105 2.574   161.229 1.00 111.09 ? 23  LYS C HZ3    1 
ATOM   8779  N N      . GLY C 1 24  ? -11.100 6.880   156.713 1.00 71.23  ? 24  GLY C N      1 
ATOM   8780  C CA     . GLY C 1 24  ? -9.692  7.258   156.652 1.00 66.45  ? 24  GLY C CA     1 
ATOM   8781  C C      . GLY C 1 24  ? -9.341  8.414   157.575 1.00 71.99  ? 24  GLY C C      1 
ATOM   8782  O O      . GLY C 1 24  ? -8.296  8.406   158.235 1.00 70.74  ? 24  GLY C O      1 
ATOM   8783  H H      . GLY C 1 24  ? -11.542 7.115   156.013 1.00 85.87  ? 24  GLY C H      1 
ATOM   8784  H HA2    . GLY C 1 24  ? -9.145  6.496   156.898 1.00 80.13  ? 24  GLY C HA2    1 
ATOM   8785  H HA3    . GLY C 1 24  ? -9.468  7.514   155.744 1.00 80.13  ? 24  GLY C HA3    1 
ATOM   8786  N N      . ARG C 1 25  ? -10.210 9.421   157.608 1.00 83.06  ? 25  ARG C N      1 
ATOM   8787  C CA     . ARG C 1 25  ? -10.025 10.575  158.478 1.00 90.38  ? 25  ARG C CA     1 
ATOM   8788  C C      . ARG C 1 25  ? -10.076 10.112  159.928 1.00 91.95  ? 25  ARG C C      1 
ATOM   8789  O O      . ARG C 1 25  ? -9.233  10.471  160.746 1.00 92.63  ? 25  ARG C O      1 
ATOM   8790  C CB     . ARG C 1 25  ? -11.109 11.617  158.215 1.00 95.22  ? 25  ARG C CB     1 
ATOM   8791  C CG     . ARG C 1 25  ? -10.892 12.948  158.906 1.00 97.93  ? 25  ARG C CG     1 
ATOM   8792  C CD     . ARG C 1 25  ? -12.021 13.906  158.572 1.00 101.09 ? 25  ARG C CD     1 
ATOM   8793  N NE     . ARG C 1 25  ? -12.223 14.012  157.129 1.00 103.10 ? 25  ARG C NE     1 
ATOM   8794  C CZ     . ARG C 1 25  ? -11.567 14.845  156.325 1.00 101.87 ? 25  ARG C CZ     1 
ATOM   8795  N NH1    . ARG C 1 25  ? -10.654 15.681  156.807 1.00 100.26 ? 25  ARG C NH1    1 
ATOM   8796  N NH2    . ARG C 1 25  ? -11.839 14.846  155.027 1.00 100.65 ? 25  ARG C NH2    1 
ATOM   8797  H H      . ARG C 1 25  ? -10.924 9.457   157.129 1.00 100.06 ? 25  ARG C H      1 
ATOM   8798  H HA     . ARG C 1 25  ? -9.159  10.977  158.310 1.00 108.85 ? 25  ARG C HA     1 
ATOM   8799  H HB2    . ARG C 1 25  ? -11.151 11.786  157.261 1.00 114.66 ? 25  ARG C HB2    1 
ATOM   8800  H HB3    . ARG C 1 25  ? -11.959 11.263  158.521 1.00 114.66 ? 25  ARG C HB3    1 
ATOM   8801  H HG2    . ARG C 1 25  ? -10.875 12.815  159.867 1.00 117.91 ? 25  ARG C HG2    1 
ATOM   8802  H HG3    . ARG C 1 25  ? -10.057 13.338  158.603 1.00 117.91 ? 25  ARG C HG3    1 
ATOM   8803  H HD2    . ARG C 1 25  ? -12.844 13.583  158.971 1.00 121.70 ? 25  ARG C HD2    1 
ATOM   8804  H HD3    . ARG C 1 25  ? -11.805 14.788  158.914 1.00 121.70 ? 25  ARG C HD3    1 
ATOM   8805  H HE     . ARG C 1 25  ? -12.812 13.497  156.772 1.00 124.11 ? 25  ARG C HE     1 
ATOM   8806  H HH11   . ARG C 1 25  ? -10.475 15.684  157.648 1.00 120.71 ? 25  ARG C HH11   1 
ATOM   8807  H HH12   . ARG C 1 25  ? -10.239 16.216  156.277 1.00 120.71 ? 25  ARG C HH12   1 
ATOM   8808  H HH21   . ARG C 1 25  ? -12.431 14.308  154.711 1.00 121.17 ? 25  ARG C HH21   1 
ATOM   8809  H HH22   . ARG C 1 25  ? -11.423 15.384  154.500 1.00 121.17 ? 25  ARG C HH22   1 
ATOM   8810  N N      . GLU C 1 26  ? -11.082 9.296   160.219 1.00 92.48  ? 26  GLU C N      1 
ATOM   8811  C CA     . GLU C 1 26  ? -11.281 8.703   161.536 1.00 93.15  ? 26  GLU C CA     1 
ATOM   8812  C C      . GLU C 1 26  ? -10.088 7.878   161.983 1.00 88.06  ? 26  GLU C C      1 
ATOM   8813  O O      . GLU C 1 26  ? -9.599  8.025   163.104 1.00 89.88  ? 26  GLU C O      1 
ATOM   8814  C CB     . GLU C 1 26  ? -12.518 7.818   161.497 1.00 95.61  ? 26  GLU C CB     1 
ATOM   8815  C CG     . GLU C 1 26  ? -13.810 8.589   161.464 1.00 99.32  ? 26  GLU C CG     1 
ATOM   8816  C CD     . GLU C 1 26  ? -15.001 7.689   161.262 1.00 104.77 ? 26  GLU C CD     1 
ATOM   8817  O OE1    . GLU C 1 26  ? -14.800 6.534   160.824 1.00 102.79 ? 26  GLU C OE1    1 
ATOM   8818  O OE2    . GLU C 1 26  ? -16.136 8.137   161.530 1.00 110.72 ? 26  GLU C OE2    1 
ATOM   8819  H H      . GLU C 1 26  ? -11.683 9.064   159.650 1.00 111.37 ? 26  GLU C H      1 
ATOM   8820  H HA     . GLU C 1 26  ? -11.427 9.406   162.187 1.00 112.17 ? 26  GLU C HA     1 
ATOM   8821  H HB2    . GLU C 1 26  ? -12.483 7.265   160.701 1.00 115.12 ? 26  GLU C HB2    1 
ATOM   8822  H HB3    . GLU C 1 26  ? -12.527 7.257   162.288 1.00 115.12 ? 26  GLU C HB3    1 
ATOM   8823  H HG2    . GLU C 1 26  ? -13.924 9.056   162.307 1.00 119.58 ? 26  GLU C HG2    1 
ATOM   8824  H HG3    . GLU C 1 26  ? -13.784 9.224   160.731 1.00 119.58 ? 26  GLU C HG3    1 
ATOM   8825  N N      . ALA C 1 27  ? -9.635  7.003   161.093 1.00 82.46  ? 27  ALA C N      1 
ATOM   8826  C CA     . ALA C 1 27  ? -8.520  6.111   161.376 1.00 82.43  ? 27  ALA C CA     1 
ATOM   8827  C C      . ALA C 1 27  ? -7.215  6.878   161.524 1.00 85.33  ? 27  ALA C C      1 
ATOM   8828  O O      . ALA C 1 27  ? -6.286  6.399   162.166 1.00 82.36  ? 27  ALA C O      1 
ATOM   8829  C CB     . ALA C 1 27  ? -8.394  5.066   160.285 1.00 78.45  ? 27  ALA C CB     1 
ATOM   8830  H H      . ALA C 1 27  ? -9.963  6.906   160.303 1.00 99.34  ? 27  ALA C H      1 
ATOM   8831  H HA     . ALA C 1 27  ? -8.692  5.650   162.212 1.00 99.31  ? 27  ALA C HA     1 
ATOM   8832  H HB1    . ALA C 1 27  ? -7.648  4.483   160.492 1.00 94.53  ? 27  ALA C HB1    1 
ATOM   8833  H HB2    . ALA C 1 27  ? -9.216  4.552   160.245 1.00 94.53  ? 27  ALA C HB2    1 
ATOM   8834  H HB3    . ALA C 1 27  ? -8.241  5.513   159.438 1.00 94.53  ? 27  ALA C HB3    1 
ATOM   8835  N N      . GLU C 1 28  ? -7.143  8.054   160.907 1.00 95.02  ? 28  GLU C N      1 
ATOM   8836  C CA     . GLU C 1 28  ? -5.979  8.929   161.033 1.00 101.57 ? 28  GLU C CA     1 
ATOM   8837  C C      . GLU C 1 28  ? -6.034  9.685   162.346 1.00 104.31 ? 28  GLU C C      1 
ATOM   8838  O O      . GLU C 1 28  ? -5.034  9.845   163.041 1.00 105.18 ? 28  GLU C O      1 
ATOM   8839  C CB     . GLU C 1 28  ? -5.923  9.915   159.859 1.00 102.84 ? 28  GLU C CB     1 
ATOM   8840  C CG     . GLU C 1 28  ? -4.779  10.931  159.919 1.00 104.30 ? 28  GLU C CG     1 
ATOM   8841  C CD     . GLU C 1 28  ? -5.109  12.241  159.211 1.00 106.22 ? 28  GLU C CD     1 
ATOM   8842  O OE1    . GLU C 1 28  ? -5.879  12.222  158.225 1.00 104.09 ? 28  GLU C OE1    1 
ATOM   8843  O OE2    . GLU C 1 28  ? -4.590  13.294  159.640 1.00 109.04 ? 28  GLU C OE2    1 
ATOM   8844  H H      . GLU C 1 28  ? -7.763  8.373   160.404 1.00 114.42 ? 28  GLU C H      1 
ATOM   8845  H HA     . GLU C 1 28  ? -5.171  8.393   161.022 1.00 122.27 ? 28  GLU C HA     1 
ATOM   8846  H HB2    . GLU C 1 28  ? -5.822  9.409   159.037 1.00 123.80 ? 28  GLU C HB2    1 
ATOM   8847  H HB3    . GLU C 1 28  ? -6.755  10.412  159.834 1.00 123.80 ? 28  GLU C HB3    1 
ATOM   8848  H HG2    . GLU C 1 28  ? -4.586  11.133  160.848 1.00 125.56 ? 28  GLU C HG2    1 
ATOM   8849  H HG3    . GLU C 1 28  ? -3.996  10.549  159.494 1.00 125.56 ? 28  GLU C HG3    1 
ATOM   8850  N N      . GLU C 1 29  ? -7.233  10.144  162.663 1.00 101.38 ? 29  GLU C N      1 
ATOM   8851  C CA     . GLU C 1 29  ? -7.478  10.975  163.821 1.00 100.36 ? 29  GLU C CA     1 
ATOM   8852  C C      . GLU C 1 29  ? -7.119  10.226  165.106 1.00 94.71  ? 29  GLU C C      1 
ATOM   8853  O O      . GLU C 1 29  ? -6.575  10.804  166.047 1.00 96.12  ? 29  GLU C O      1 
ATOM   8854  C CB     . GLU C 1 29  ? -8.949  11.389  163.796 1.00 107.39 ? 29  GLU C CB     1 
ATOM   8855  C CG     . GLU C 1 29  ? -9.333  12.605  164.588 1.00 115.10 ? 29  GLU C CG     1 
ATOM   8856  C CD     . GLU C 1 29  ? -10.794 12.957  164.365 1.00 119.27 ? 29  GLU C CD     1 
ATOM   8857  O OE1    . GLU C 1 29  ? -11.671 12.204  164.842 1.00 122.24 ? 29  GLU C OE1    1 
ATOM   8858  O OE2    . GLU C 1 29  ? -11.062 13.968  163.681 1.00 118.09 ? 29  GLU C OE2    1 
ATOM   8859  H H      . GLU C 1 29  ? -7.942  9.981   162.204 1.00 122.05 ? 29  GLU C H      1 
ATOM   8860  H HA     . GLU C 1 29  ? -6.932  11.775  163.768 1.00 120.82 ? 29  GLU C HA     1 
ATOM   8861  H HB2    . GLU C 1 29  ? -9.198  11.560  162.874 1.00 129.26 ? 29  GLU C HB2    1 
ATOM   8862  H HB3    . GLU C 1 29  ? -9.476  10.650  164.136 1.00 129.26 ? 29  GLU C HB3    1 
ATOM   8863  H HG2    . GLU C 1 29  ? -9.201  12.429  165.532 1.00 138.51 ? 29  GLU C HG2    1 
ATOM   8864  H HG3    . GLU C 1 29  ? -8.791  13.358  164.305 1.00 138.51 ? 29  GLU C HG3    1 
ATOM   8865  N N      . GLU C 1 30  ? -7.396  8.926   165.123 1.00 88.02  ? 30  GLU C N      1 
ATOM   8866  C CA     . GLU C 1 30  ? -7.053  8.078   166.260 1.00 85.28  ? 30  GLU C CA     1 
ATOM   8867  C C      . GLU C 1 30  ? -5.585  7.684   166.254 1.00 86.44  ? 30  GLU C C      1 
ATOM   8868  O O      . GLU C 1 30  ? -4.926  7.693   167.289 1.00 83.59  ? 30  GLU C O      1 
ATOM   8869  C CB     . GLU C 1 30  ? -7.922  6.821   166.272 1.00 84.83  ? 30  GLU C CB     1 
ATOM   8870  C CG     . GLU C 1 30  ? -7.617  5.860   167.426 1.00 88.92  ? 30  GLU C CG     1 
ATOM   8871  C CD     . GLU C 1 30  ? -7.879  6.450   168.813 1.00 90.47  ? 30  GLU C CD     1 
ATOM   8872  O OE1    . GLU C 1 30  ? -7.261  5.968   169.785 1.00 90.59  ? 30  GLU C OE1    1 
ATOM   8873  O OE2    . GLU C 1 30  ? -8.696  7.386   168.935 1.00 89.82  ? 30  GLU C OE2    1 
ATOM   8874  H H      . GLU C 1 30  ? -7.787  8.506   164.482 1.00 106.01 ? 30  GLU C H      1 
ATOM   8875  H HA     . GLU C 1 30  ? -7.226  8.568   167.080 1.00 102.73 ? 30  GLU C HA     1 
ATOM   8876  H HB2    . GLU C 1 30  ? -8.852  7.086   166.347 1.00 102.19 ? 30  GLU C HB2    1 
ATOM   8877  H HB3    . GLU C 1 30  ? -7.784  6.339   165.442 1.00 102.19 ? 30  GLU C HB3    1 
ATOM   8878  H HG2    . GLU C 1 30  ? -8.173  5.071   167.331 1.00 107.10 ? 30  GLU C HG2    1 
ATOM   8879  H HG3    . GLU C 1 30  ? -6.681  5.609   167.384 1.00 107.10 ? 30  GLU C HG3    1 
ATOM   8880  N N      . LEU C 1 31  ? -5.074  7.348   165.077 1.00 94.22  ? 31  LEU C N      1 
ATOM   8881  C CA     . LEU C 1 31  ? -3.676  6.968   164.936 1.00 99.01  ? 31  LEU C CA     1 
ATOM   8882  C C      . LEU C 1 31  ? -2.802  8.088   165.491 1.00 95.84  ? 31  LEU C C      1 
ATOM   8883  O O      . LEU C 1 31  ? -1.954  7.866   166.359 1.00 100.04 ? 31  LEU C O      1 
ATOM   8884  C CB     . LEU C 1 31  ? -3.338  6.689   163.468 1.00 99.05  ? 31  LEU C CB     1 
ATOM   8885  C CG     . LEU C 1 31  ? -2.240  5.663   163.182 1.00 99.43  ? 31  LEU C CG     1 
ATOM   8886  C CD1    . LEU C 1 31  ? -2.671  4.277   163.638 1.00 102.18 ? 31  LEU C CD1    1 
ATOM   8887  C CD2    . LEU C 1 31  ? -1.886  5.650   161.708 1.00 95.91  ? 31  LEU C CD2    1 
ATOM   8888  H H      . LEU C 1 31  ? -5.519  7.332   164.341 1.00 113.45 ? 31  LEU C H      1 
ATOM   8889  H HA     . LEU C 1 31  ? -3.506  6.162   165.449 1.00 119.20 ? 31  LEU C HA     1 
ATOM   8890  H HB2    . LEU C 1 31  ? -4.144  6.373   163.030 1.00 119.25 ? 31  LEU C HB2    1 
ATOM   8891  H HB3    . LEU C 1 31  ? -3.061  7.524   163.060 1.00 119.25 ? 31  LEU C HB3    1 
ATOM   8892  H HG     . LEU C 1 31  ? -1.444  5.907   163.679 1.00 119.71 ? 31  LEU C HG     1 
ATOM   8893  H HD11   . LEU C 1 31  ? -1.959  3.646   163.446 1.00 123.00 ? 31  LEU C HD11   1 
ATOM   8894  H HD12   . LEU C 1 31  ? -2.845  4.299   164.592 1.00 123.00 ? 31  LEU C HD12   1 
ATOM   8895  H HD13   . LEU C 1 31  ? -3.475  4.023   163.160 1.00 123.00 ? 31  LEU C HD13   1 
ATOM   8896  H HD21   . LEU C 1 31  ? -1.189  4.993   161.557 1.00 115.48 ? 31  LEU C HD21   1 
ATOM   8897  H HD22   . LEU C 1 31  ? -2.676  5.420   161.196 1.00 115.48 ? 31  LEU C HD22   1 
ATOM   8898  H HD23   . LEU C 1 31  ? -1.571  6.531   161.452 1.00 115.48 ? 31  LEU C HD23   1 
ATOM   8899  N N      . ARG C 1 32  ? -3.031  9.294   164.985 1.00 87.73  ? 32  ARG C N      1 
ATOM   8900  C CA     . ARG C 1 32  ? -2.336  10.485  165.451 1.00 83.70  ? 32  ARG C CA     1 
ATOM   8901  C C      . ARG C 1 32  ? -2.513  10.739  166.956 1.00 90.94  ? 32  ARG C C      1 
ATOM   8902  O O      . ARG C 1 32  ? -1.646  11.340  167.587 1.00 90.04  ? 32  ARG C O      1 
ATOM   8903  C CB     . ARG C 1 32  ? -2.819  11.691  164.638 1.00 78.93  ? 32  ARG C CB     1 
ATOM   8904  C CG     . ARG C 1 32  ? -2.316  13.026  165.131 1.00 81.01  ? 32  ARG C CG     1 
ATOM   8905  C CD     . ARG C 1 32  ? -2.547  14.140  164.115 1.00 80.17  ? 32  ARG C CD     1 
ATOM   8906  N NE     . ARG C 1 32  ? -1.526  14.151  163.064 1.00 76.28  ? 32  ARG C NE     1 
ATOM   8907  C CZ     . ARG C 1 32  ? -1.641  13.571  161.870 1.00 72.75  ? 32  ARG C CZ     1 
ATOM   8908  N NH1    . ARG C 1 32  ? -2.749  12.921  161.532 1.00 72.62  ? 32  ARG C NH1    1 
ATOM   8909  N NH2    . ARG C 1 32  ? -0.636  13.652  161.002 1.00 68.68  ? 32  ARG C NH2    1 
ATOM   8910  H H      . ARG C 1 32  ? -3.597  9.450   164.357 1.00 105.66 ? 32  ARG C H      1 
ATOM   8911  H HA     . ARG C 1 32  ? -1.388  10.377  165.281 1.00 100.83 ? 32  ARG C HA     1 
ATOM   8912  H HB2    . ARG C 1 32  ? -2.520  11.586  163.721 1.00 95.10  ? 32  ARG C HB2    1 
ATOM   8913  H HB3    . ARG C 1 32  ? -3.788  11.715  164.665 1.00 95.10  ? 32  ARG C HB3    1 
ATOM   8914  H HG2    . ARG C 1 32  ? -2.785  13.260  165.947 1.00 97.61  ? 32  ARG C HG2    1 
ATOM   8915  H HG3    . ARG C 1 32  ? -1.363  12.964  165.299 1.00 97.61  ? 32  ARG C HG3    1 
ATOM   8916  H HD2    . ARG C 1 32  ? -3.411  14.012  163.694 1.00 96.59  ? 32  ARG C HD2    1 
ATOM   8917  H HD3    . ARG C 1 32  ? -2.520  14.995  164.571 1.00 96.59  ? 32  ARG C HD3    1 
ATOM   8918  H HE     . ARG C 1 32  ? -0.792  14.566  163.232 1.00 91.93  ? 32  ARG C HE     1 
ATOM   8919  H HH11   . ARG C 1 32  ? -3.402  12.866  162.089 1.00 87.54  ? 32  ARG C HH11   1 
ATOM   8920  H HH12   . ARG C 1 32  ? -2.812  12.553  160.757 1.00 87.54  ? 32  ARG C HH12   1 
ATOM   8921  H HH21   . ARG C 1 32  ? 0.083   14.073  161.214 1.00 82.80  ? 32  ARG C HH21   1 
ATOM   8922  H HH22   . ARG C 1 32  ? -0.706  13.282  160.228 1.00 82.80  ? 32  ARG C HH22   1 
ATOM   8923  N N      . ARG C 1 33  ? -3.618  10.276  167.534 1.00 100.07 ? 33  ARG C N      1 
ATOM   8924  C CA     . ARG C 1 33  ? -3.849  10.438  168.972 1.00 105.72 ? 33  ARG C CA     1 
ATOM   8925  C C      . ARG C 1 33  ? -3.040  9.458   169.823 1.00 104.84 ? 33  ARG C C      1 
ATOM   8926  O O      . ARG C 1 33  ? -2.622  9.783   170.933 1.00 109.56 ? 33  ARG C O      1 
ATOM   8927  C CB     . ARG C 1 33  ? -5.332  10.255  169.303 1.00 111.27 ? 33  ARG C CB     1 
ATOM   8928  C CG     . ARG C 1 33  ? -5.671  10.525  170.772 1.00 115.96 ? 33  ARG C CG     1 
ATOM   8929  C CD     . ARG C 1 33  ? -7.166  10.434  171.050 1.00 117.80 ? 33  ARG C CD     1 
ATOM   8930  N NE     . ARG C 1 33  ? -7.938  11.315  170.179 1.00 118.06 ? 33  ARG C NE     1 
ATOM   8931  C CZ     . ARG C 1 33  ? -8.649  10.907  169.128 1.00 117.58 ? 33  ARG C CZ     1 
ATOM   8932  N NH1    . ARG C 1 33  ? -8.700  9.622   168.796 1.00 117.20 ? 33  ARG C NH1    1 
ATOM   8933  N NH2    . ARG C 1 33  ? -9.314  11.789  168.396 1.00 115.63 ? 33  ARG C NH2    1 
ATOM   8934  H H      . ARG C 1 33  ? -4.250  9.866   167.119 1.00 120.48 ? 33  ARG C H      1 
ATOM   8935  H HA     . ARG C 1 33  ? -3.595  11.337  169.231 1.00 127.26 ? 33  ARG C HA     1 
ATOM   8936  H HB2    . ARG C 1 33  ? -5.852  10.868  168.760 1.00 133.92 ? 33  ARG C HB2    1 
ATOM   8937  H HB3    . ARG C 1 33  ? -5.587  9.341   169.103 1.00 133.92 ? 33  ARG C HB3    1 
ATOM   8938  H HG2    . ARG C 1 33  ? -5.221  9.869   171.327 1.00 139.55 ? 33  ARG C HG2    1 
ATOM   8939  H HG3    . ARG C 1 33  ? -5.375  11.419  171.006 1.00 139.55 ? 33  ARG C HG3    1 
ATOM   8940  H HD2    . ARG C 1 33  ? -7.463  9.523   170.899 1.00 141.75 ? 33  ARG C HD2    1 
ATOM   8941  H HD3    . ARG C 1 33  ? -7.335  10.693  171.969 1.00 141.75 ? 33  ARG C HD3    1 
ATOM   8942  H HE     . ARG C 1 33  ? -7.934  12.157  170.356 1.00 142.06 ? 33  ARG C HE     1 
ATOM   8943  H HH11   . ARG C 1 33  ? -8.271  9.040   169.262 1.00 141.03 ? 33  ARG C HH11   1 
ATOM   8944  H HH12   . ARG C 1 33  ? -9.162  9.372   168.115 1.00 141.03 ? 33  ARG C HH12   1 
ATOM   8945  H HH21   . ARG C 1 33  ? -9.289  12.624  168.601 1.00 139.15 ? 33  ARG C HH21   1 
ATOM   8946  H HH22   . ARG C 1 33  ? -9.774  11.527  167.718 1.00 139.15 ? 33  ARG C HH22   1 
ATOM   8947  N N      . ARG C 1 34  ? -2.833  8.255   169.300 1.00 96.08  ? 34  ARG C N      1 
ATOM   8948  C CA     . ARG C 1 34  ? -2.155  7.192   170.039 1.00 95.32  ? 34  ARG C CA     1 
ATOM   8949  C C      . ARG C 1 34  ? -0.638  7.369   170.107 1.00 92.44  ? 34  ARG C C      1 
ATOM   8950  O O      . ARG C 1 34  ? 0.003   6.947   171.071 1.00 96.08  ? 34  ARG C O      1 
ATOM   8951  C CB     . ARG C 1 34  ? -2.481  5.841   169.399 1.00 96.01  ? 34  ARG C CB     1 
ATOM   8952  C CG     . ARG C 1 34  ? -3.933  5.423   169.565 1.00 98.82  ? 34  ARG C CG     1 
ATOM   8953  C CD     . ARG C 1 34  ? -4.248  4.119   168.837 1.00 97.93  ? 34  ARG C CD     1 
ATOM   8954  N NE     . ARG C 1 34  ? -5.689  3.868   168.796 1.00 99.06  ? 34  ARG C NE     1 
ATOM   8955  C CZ     . ARG C 1 34  ? -6.253  2.755   168.336 1.00 96.41  ? 34  ARG C CZ     1 
ATOM   8956  N NH1    . ARG C 1 34  ? -5.503  1.762   167.871 1.00 95.24  ? 34  ARG C NH1    1 
ATOM   8957  N NH2    . ARG C 1 34  ? -7.575  2.636   168.342 1.00 94.81  ? 34  ARG C NH2    1 
ATOM   8958  H H      . ARG C 1 34  ? -3.079  8.025   168.509 1.00 115.69 ? 34  ARG C H      1 
ATOM   8959  H HA     . ARG C 1 34  ? -2.492  7.179   170.948 1.00 114.78 ? 34  ARG C HA     1 
ATOM   8960  H HB2    . ARG C 1 34  ? -2.293  5.891   168.448 1.00 115.60 ? 34  ARG C HB2    1 
ATOM   8961  H HB3    . ARG C 1 34  ? -1.926  5.158   169.808 1.00 115.60 ? 34  ARG C HB3    1 
ATOM   8962  H HG2    . ARG C 1 34  ? -4.120  5.295   170.508 1.00 118.98 ? 34  ARG C HG2    1 
ATOM   8963  H HG3    . ARG C 1 34  ? -4.506  6.117   169.204 1.00 118.98 ? 34  ARG C HG3    1 
ATOM   8964  H HD2    . ARG C 1 34  ? -3.923  4.174   167.925 1.00 117.91 ? 34  ARG C HD2    1 
ATOM   8965  H HD3    . ARG C 1 34  ? -3.824  3.381   169.302 1.00 117.91 ? 34  ARG C HD3    1 
ATOM   8966  H HE     . ARG C 1 34  ? -6.209  4.486   169.092 1.00 119.26 ? 34  ARG C HE     1 
ATOM   8967  H HH11   . ARG C 1 34  ? -4.646  1.836   167.865 1.00 114.67 ? 34  ARG C HH11   1 
ATOM   8968  H HH12   . ARG C 1 34  ? -5.874  1.045   167.576 1.00 114.67 ? 34  ARG C HH12   1 
ATOM   8969  H HH21   . ARG C 1 34  ? -8.063  3.277   168.644 1.00 114.16 ? 34  ARG C HH21   1 
ATOM   8970  H HH22   . ARG C 1 34  ? -7.944  1.918   168.048 1.00 114.16 ? 34  ARG C HH22   1 
ATOM   8971  N N      . LEU C 1 35  ? -0.070  7.992   169.081 1.00 83.60  ? 35  LEU C N      1 
ATOM   8972  C CA     . LEU C 1 35  ? 1.371   8.213   169.007 1.00 81.71  ? 35  LEU C CA     1 
ATOM   8973  C C      . LEU C 1 35  ? 1.795   9.395   169.877 1.00 84.17  ? 35  LEU C C      1 
ATOM   8974  O O      . LEU C 1 35  ? 2.920   9.451   170.382 1.00 84.48  ? 35  LEU C O      1 
ATOM   8975  C CB     . LEU C 1 35  ? 1.790   8.460   167.559 1.00 77.18  ? 35  LEU C CB     1 
ATOM   8976  C CG     . LEU C 1 35  ? 1.942   7.213   166.687 1.00 75.26  ? 35  LEU C CG     1 
ATOM   8977  C CD1    . LEU C 1 35  ? 2.023   7.620   165.219 1.00 71.68  ? 35  LEU C CD1    1 
ATOM   8978  C CD2    . LEU C 1 35  ? 3.158   6.389   167.099 1.00 76.52  ? 35  LEU C CD2    1 
ATOM   8979  H H      . LEU C 1 35  ? -0.504  8.300   168.405 1.00 100.71 ? 35  LEU C H      1 
ATOM   8980  H HA     . LEU C 1 35  ? 1.832   7.421   169.326 1.00 98.44  ? 35  LEU C HA     1 
ATOM   8981  H HB2    . LEU C 1 35  ? 1.123   9.026   167.141 1.00 92.48  ? 35  LEU C HB2    1 
ATOM   8982  H HB3    . LEU C 1 35  ? 2.645   8.917   167.562 1.00 92.48  ? 35  LEU C HB3    1 
ATOM   8983  H HG     . LEU C 1 35  ? 1.155   6.656   166.798 1.00 89.60  ? 35  LEU C HG     1 
ATOM   8984  H HD11   . LEU C 1 35  ? 2.119   6.822   164.675 1.00 85.24  ? 35  LEU C HD11   1 
ATOM   8985  H HD12   . LEU C 1 35  ? 1.209   8.090   164.976 1.00 85.24  ? 35  LEU C HD12   1 
ATOM   8986  H HD13   . LEU C 1 35  ? 2.790   8.200   165.094 1.00 85.24  ? 35  LEU C HD13   1 
ATOM   8987  H HD21   . LEU C 1 35  ? 3.220   5.609   166.525 1.00 89.87  ? 35  LEU C HD21   1 
ATOM   8988  H HD22   . LEU C 1 35  ? 3.955   6.934   167.005 1.00 89.87  ? 35  LEU C HD22   1 
ATOM   8989  H HD23   . LEU C 1 35  ? 3.054   6.112   168.023 1.00 89.87  ? 35  LEU C HD23   1 
ATOM   8990  N N      . ASP C 1 36  ? 0.882   10.347  170.028 1.00 93.66  ? 36  ASP C N      1 
ATOM   8991  C CA     . ASP C 1 36  ? 1.104   11.514  170.867 1.00 100.16 ? 36  ASP C CA     1 
ATOM   8992  C C      . ASP C 1 36  ? 1.064   11.149  172.351 1.00 111.86 ? 36  ASP C C      1 
ATOM   8993  O O      . ASP C 1 36  ? 1.513   11.923  173.195 1.00 110.40 ? 36  ASP C O      1 
ATOM   8994  C CB     . ASP C 1 36  ? 0.051   12.573  170.554 1.00 99.01  ? 36  ASP C CB     1 
ATOM   8995  C CG     . ASP C 1 36  ? 0.195   13.133  169.162 1.00 95.06  ? 36  ASP C CG     1 
ATOM   8996  O OD1    . ASP C 1 36  ? 1.049   12.614  168.416 1.00 93.82  ? 36  ASP C OD1    1 
ATOM   8997  O OD2    . ASP C 1 36  ? -0.562  14.060  168.804 1.00 93.66  ? 36  ASP C OD2    1 
ATOM   8998  H H      . ASP C 1 36  ? 0.110   10.337  169.648 1.00 112.78 ? 36  ASP C H      1 
ATOM   8999  H HA     . ASP C 1 36  ? 1.978   11.886  170.670 1.00 120.59 ? 36  ASP C HA     1 
ATOM   9000  H HB2    . ASP C 1 36  ? -0.831  12.176  170.629 1.00 119.21 ? 36  ASP C HB2    1 
ATOM   9001  H HB3    . ASP C 1 36  ? 0.141   13.306  171.184 1.00 119.21 ? 36  ASP C HB3    1 
ATOM   9002  N N      . GLU C 1 37  ? 0.537   9.967   172.664 1.00 122.57 ? 37  GLU C N      1 
ATOM   9003  C CA     . GLU C 1 37  ? 0.551   9.469   174.038 1.00 130.91 ? 37  GLU C CA     1 
ATOM   9004  C C      . GLU C 1 37  ? 1.935   8.957   174.396 1.00 125.71 ? 37  GLU C C      1 
ATOM   9005  O O      . GLU C 1 37  ? 2.365   9.075   175.544 1.00 135.55 ? 37  GLU C O      1 
ATOM   9006  C CB     . GLU C 1 37  ? -0.498  8.371   174.256 1.00 137.15 ? 37  GLU C CB     1 
ATOM   9007  C CG     . GLU C 1 37  ? -0.787  8.090   175.742 1.00 146.00 ? 37  GLU C CG     1 
ATOM   9008  C CD     . GLU C 1 37  ? -1.392  9.267   176.490 1.00 148.36 ? 37  GLU C CD     1 
ATOM   9009  O OE1    . GLU C 1 37  ? -1.925  10.184  175.833 1.00 149.02 ? 37  GLU C OE1    1 
ATOM   9010  O OE2    . GLU C 1 37  ? -1.318  9.281   177.740 1.00 148.34 ? 37  GLU C OE2    1 
ATOM   9011  H H      . GLU C 1 37  ? 0.166   9.434   172.100 1.00 147.48 ? 37  GLU C H      1 
ATOM   9012  H HA     . GLU C 1 37  ? 0.341   10.202  174.638 1.00 157.48 ? 37  GLU C HA     1 
ATOM   9013  H HB2    . GLU C 1 37  ? -1.329  8.644   173.837 1.00 164.97 ? 37  GLU C HB2    1 
ATOM   9014  H HB3    . GLU C 1 37  ? -0.179  7.549   173.853 1.00 164.97 ? 37  GLU C HB3    1 
ATOM   9015  H HG2    . GLU C 1 37  ? -1.411  7.349   175.802 1.00 175.59 ? 37  GLU C HG2    1 
ATOM   9016  H HG3    . GLU C 1 37  ? 0.044   7.855   176.182 1.00 175.59 ? 37  GLU C HG3    1 
ATOM   9017  N N      . LEU C 1 38  ? 2.630   8.392   173.416 1.00 108.36 ? 38  LEU C N      1 
ATOM   9018  C CA     . LEU C 1 38  ? 3.959   7.855   173.655 1.00 100.08 ? 38  LEU C CA     1 
ATOM   9019  C C      . LEU C 1 38  ? 4.994   8.913   173.320 1.00 96.94  ? 38  LEU C C      1 
ATOM   9020  O O      . LEU C 1 38  ? 6.191   8.661   173.422 1.00 97.88  ? 38  LEU C O      1 
ATOM   9021  C CB     . LEU C 1 38  ? 4.200   6.600   172.825 1.00 95.85  ? 38  LEU C CB     1 
ATOM   9022  C CG     . LEU C 1 38  ? 3.160   5.501   172.998 1.00 96.54  ? 38  LEU C CG     1 
ATOM   9023  C CD1    . LEU C 1 38  ? 3.505   4.337   172.092 1.00 94.71  ? 38  LEU C CD1    1 
ATOM   9024  C CD2    . LEU C 1 38  ? 3.056   5.056   174.442 1.00 100.89 ? 38  LEU C CD2    1 
ATOM   9025  H H      . LEU C 1 38  ? 2.354   8.307   172.606 1.00 130.43 ? 38  LEU C H      1 
ATOM   9026  H HA     . LEU C 1 38  ? 4.049   7.625   174.592 1.00 120.49 ? 38  LEU C HA     1 
ATOM   9027  H HB2    . LEU C 1 38  ? 4.210   6.848   171.888 1.00 115.41 ? 38  LEU C HB2    1 
ATOM   9028  H HB3    . LEU C 1 38  ? 5.061   6.229   173.072 1.00 115.41 ? 38  LEU C HB3    1 
ATOM   9029  H HG     . LEU C 1 38  ? 2.293   5.843   172.728 1.00 116.23 ? 38  LEU C HG     1 
ATOM   9030  H HD11   . LEU C 1 38  ? 2.840   3.641   172.206 1.00 114.04 ? 38  LEU C HD11   1 
ATOM   9031  H HD12   . LEU C 1 38  ? 3.509   4.645   171.172 1.00 114.04 ? 38  LEU C HD12   1 
ATOM   9032  H HD13   . LEU C 1 38  ? 4.383   4.000   172.331 1.00 114.04 ? 38  LEU C HD13   1 
ATOM   9033  H HD21   . LEU C 1 38  ? 2.386   4.358   174.510 1.00 121.46 ? 38  LEU C HD21   1 
ATOM   9034  H HD22   . LEU C 1 38  ? 3.918   4.717   174.730 1.00 121.46 ? 38  LEU C HD22   1 
ATOM   9035  H HD23   . LEU C 1 38  ? 2.800   5.815   174.989 1.00 121.46 ? 38  LEU C HD23   1 
ATOM   9036  N N      . GLY C 1 39  ? 4.524   10.099  172.932 1.00 91.83  ? 39  GLY C N      1 
ATOM   9037  C CA     . GLY C 1 39  ? 5.395   11.237  172.691 1.00 91.15  ? 39  GLY C CA     1 
ATOM   9038  C C      . GLY C 1 39  ? 6.474   10.880  171.695 1.00 88.49  ? 39  GLY C C      1 
ATOM   9039  O O      . GLY C 1 39  ? 7.650   11.179  171.893 1.00 89.35  ? 39  GLY C O      1 
ATOM   9040  H H      . GLY C 1 39  ? 3.691   10.267  172.801 1.00 108.24 ? 39  GLY C H      1 
ATOM   9041  H HA2    . GLY C 1 39  ? 4.878   11.978  172.340 1.00 107.43 ? 39  GLY C HA2    1 
ATOM   9042  H HA3    . GLY C 1 39  ? 5.814   11.512  173.522 1.00 107.43 ? 39  GLY C HA3    1 
ATOM   9043  N N      . VAL C 1 40  ? 6.054   10.266  170.599 1.00 85.37  ? 40  VAL C N      1 
ATOM   9044  C CA     . VAL C 1 40  ? 6.973   9.827   169.567 1.00 82.82  ? 40  VAL C CA     1 
ATOM   9045  C C      . VAL C 1 40  ? 6.975   10.800  168.407 1.00 82.71  ? 40  VAL C C      1 
ATOM   9046  O O      . VAL C 1 40  ? 5.929   11.336  168.041 1.00 78.41  ? 40  VAL C O      1 
ATOM   9047  C CB     . VAL C 1 40  ? 6.573   8.428   169.039 1.00 81.56  ? 40  VAL C CB     1 
ATOM   9048  C CG1    . VAL C 1 40  ? 7.647   7.863   168.109 1.00 79.58  ? 40  VAL C CG1    1 
ATOM   9049  C CG2    . VAL C 1 40  ? 6.290   7.489   170.197 1.00 84.82  ? 40  VAL C CG2    1 
ATOM   9050  H H      . VAL C 1 40  ? 5.229   10.091  170.428 1.00 100.49 ? 40  VAL C H      1 
ATOM   9051  H HA     . VAL C 1 40  ? 7.871   9.776   169.931 1.00 97.43  ? 40  VAL C HA     1 
ATOM   9052  H HB     . VAL C 1 40  ? 5.755   8.514   168.525 1.00 95.92  ? 40  VAL C HB     1 
ATOM   9053  H HG11   . VAL C 1 40  ? 7.366   6.989   167.797 1.00 93.54  ? 40  VAL C HG11   1 
ATOM   9054  H HG12   . VAL C 1 40  ? 7.760   8.464   167.356 1.00 93.54  ? 40  VAL C HG12   1 
ATOM   9055  H HG13   . VAL C 1 40  ? 8.481   7.788   168.600 1.00 93.54  ? 40  VAL C HG13   1 
ATOM   9056  H HG21   . VAL C 1 40  ? 6.042   6.620   169.845 1.00 99.83  ? 40  VAL C HG21   1 
ATOM   9057  H HG22   . VAL C 1 40  ? 7.090   7.410   170.740 1.00 99.83  ? 40  VAL C HG22   1 
ATOM   9058  H HG23   . VAL C 1 40  ? 5.564   7.852   170.727 1.00 99.83  ? 40  VAL C HG23   1 
ATOM   9059  N N      . GLU C 1 41  ? 8.148   11.020  167.821 1.00 93.70  ? 41  GLU C N      1 
ATOM   9060  C CA     . GLU C 1 41  ? 8.238   11.845  166.629 1.00 99.09  ? 41  GLU C CA     1 
ATOM   9061  C C      . GLU C 1 41  ? 7.897   11.020  165.408 1.00 94.62  ? 41  GLU C C      1 
ATOM   9062  O O      . GLU C 1 41  ? 8.389   9.900   165.249 1.00 94.38  ? 41  GLU C O      1 
ATOM   9063  C CB     . GLU C 1 41  ? 9.628   12.449  166.455 1.00 105.07 ? 41  GLU C CB     1 
ATOM   9064  C CG     . GLU C 1 41  ? 9.686   13.419  165.280 1.00 106.84 ? 41  GLU C CG     1 
ATOM   9065  C CD     . GLU C 1 41  ? 11.023  14.120  165.141 1.00 111.60 ? 41  GLU C CD     1 
ATOM   9066  O OE1    . GLU C 1 41  ? 11.976  13.749  165.864 1.00 114.87 ? 41  GLU C OE1    1 
ATOM   9067  O OE2    . GLU C 1 41  ? 11.118  15.042  164.298 1.00 111.11 ? 41  GLU C OE2    1 
ATOM   9068  H H      . GLU C 1 41  ? 8.900   10.704  168.093 1.00 112.83 ? 41  GLU C H      1 
ATOM   9069  H HA     . GLU C 1 41  ? 7.598   12.571  166.693 1.00 119.30 ? 41  GLU C HA     1 
ATOM   9070  H HB2    . GLU C 1 41  ? 9.867   12.934  167.260 1.00 126.47 ? 41  GLU C HB2    1 
ATOM   9071  H HB3    . GLU C 1 41  ? 10.266  11.737  166.292 1.00 126.47 ? 41  GLU C HB3    1 
ATOM   9072  H HG2    . GLU C 1 41  ? 9.521   12.928  164.459 1.00 128.60 ? 41  GLU C HG2    1 
ATOM   9073  H HG3    . GLU C 1 41  ? 9.004   14.098  165.400 1.00 128.60 ? 41  GLU C HG3    1 
ATOM   9074  N N      . TYR C 1 42  ? 7.048   11.576  164.550 1.00 91.25  ? 42  TYR C N      1 
ATOM   9075  C CA     . TYR C 1 42  ? 6.624   10.884  163.344 1.00 86.68  ? 42  TYR C CA     1 
ATOM   9076  C C      . TYR C 1 42  ? 6.178   11.869  162.288 1.00 82.61  ? 42  TYR C C      1 
ATOM   9077  O O      . TYR C 1 42  ? 6.086   13.068  162.542 1.00 84.92  ? 42  TYR C O      1 
ATOM   9078  C CB     . TYR C 1 42  ? 5.465   9.943   163.643 1.00 86.53  ? 42  TYR C CB     1 
ATOM   9079  C CG     . TYR C 1 42  ? 4.267   10.698  164.155 1.00 88.56  ? 42  TYR C CG     1 
ATOM   9080  C CD1    . TYR C 1 42  ? 3.383   11.314  163.278 1.00 85.91  ? 42  TYR C CD1    1 
ATOM   9081  C CD2    . TYR C 1 42  ? 4.024   10.808  165.515 1.00 94.68  ? 42  TYR C CD2    1 
ATOM   9082  C CE1    . TYR C 1 42  ? 2.294   12.018  163.741 1.00 87.94  ? 42  TYR C CE1    1 
ATOM   9083  C CE2    . TYR C 1 42  ? 2.932   11.503  165.989 1.00 96.55  ? 42  TYR C CE2    1 
ATOM   9084  C CZ     . TYR C 1 42  ? 2.072   12.106  165.097 1.00 92.74  ? 42  TYR C CZ     1 
ATOM   9085  O OH     . TYR C 1 42  ? 0.985   12.801  165.561 1.00 92.50  ? 42  TYR C OH     1 
ATOM   9086  H H      . TYR C 1 42  ? 6.703   12.358  164.646 1.00 109.89 ? 42  TYR C H      1 
ATOM   9087  H HA     . TYR C 1 42  ? 7.363   10.363  162.990 1.00 104.40 ? 42  TYR C HA     1 
ATOM   9088  H HB2    . TYR C 1 42  ? 5.209   9.481   162.830 1.00 104.23 ? 42  TYR C HB2    1 
ATOM   9089  H HB3    . TYR C 1 42  ? 5.736   9.306   164.322 1.00 104.23 ? 42  TYR C HB3    1 
ATOM   9090  H HD1    . TYR C 1 42  ? 3.534   11.256  162.362 1.00 103.49 ? 42  TYR C HD1    1 
ATOM   9091  H HD2    . TYR C 1 42  ? 4.605   10.402  166.118 1.00 114.00 ? 42  TYR C HD2    1 
ATOM   9092  H HE1    . TYR C 1 42  ? 1.709   12.423  163.143 1.00 105.91 ? 42  TYR C HE1    1 
ATOM   9093  H HE2    . TYR C 1 42  ? 2.779   11.568  166.904 1.00 116.25 ? 42  TYR C HE2    1 
ATOM   9094  H HH     . TYR C 1 42  ? 0.967   12.777  166.401 1.00 111.39 ? 42  TYR C HH     1 
ATOM   9095  N N      . VAL C 1 43  ? 5.867   11.338  161.112 1.00 73.98  ? 43  VAL C N      1 
ATOM   9096  C CA     . VAL C 1 43  ? 5.233   12.105  160.054 1.00 66.91  ? 43  VAL C CA     1 
ATOM   9097  C C      . VAL C 1 43  ? 4.448   11.132  159.182 1.00 66.19  ? 43  VAL C C      1 
ATOM   9098  O O      . VAL C 1 43  ? 4.903   10.013  158.945 1.00 62.54  ? 43  VAL C O      1 
ATOM   9099  C CB     . VAL C 1 43  ? 6.257   12.881  159.216 1.00 62.56  ? 43  VAL C CB     1 
ATOM   9100  C CG1    . VAL C 1 43  ? 7.310   11.928  158.639 1.00 59.73  ? 43  VAL C CG1    1 
ATOM   9101  C CG2    . VAL C 1 43  ? 5.555   13.676  158.117 1.00 61.94  ? 43  VAL C CG2    1 
ATOM   9102  H H      . VAL C 1 43  ? 6.016   10.518  160.901 1.00 89.17  ? 43  VAL C H      1 
ATOM   9103  H HA     . VAL C 1 43  ? 4.611   12.740  160.443 1.00 80.68  ? 43  VAL C HA     1 
ATOM   9104  H HB     . VAL C 1 43  ? 6.715   13.513  159.791 1.00 75.47  ? 43  VAL C HB     1 
ATOM   9105  H HG11   . VAL C 1 43  ? 7.945   12.440  158.114 1.00 72.06  ? 43  VAL C HG11   1 
ATOM   9106  H HG12   . VAL C 1 43  ? 7.767   11.483  159.370 1.00 72.06  ? 43  VAL C HG12   1 
ATOM   9107  H HG13   . VAL C 1 43  ? 6.868   11.272  158.077 1.00 72.06  ? 43  VAL C HG13   1 
ATOM   9108  H HG21   . VAL C 1 43  ? 6.221   14.157  157.601 1.00 74.72  ? 43  VAL C HG21   1 
ATOM   9109  H HG22   . VAL C 1 43  ? 5.072   13.061  157.542 1.00 74.72  ? 43  VAL C HG22   1 
ATOM   9110  H HG23   . VAL C 1 43  ? 4.937   14.302  158.526 1.00 74.72  ? 43  VAL C HG23   1 
ATOM   9111  N N      . PHE C 1 44  ? 3.283   11.559  158.703 1.00 71.44  ? 44  PHE C N      1 
ATOM   9112  C CA     . PHE C 1 44  ? 2.482   10.754  157.781 1.00 70.99  ? 44  PHE C CA     1 
ATOM   9113  C C      . PHE C 1 44  ? 2.904   10.993  156.341 1.00 67.27  ? 44  PHE C C      1 
ATOM   9114  O O      . PHE C 1 44  ? 3.158   12.133  155.952 1.00 69.76  ? 44  PHE C O      1 
ATOM   9115  C CB     . PHE C 1 44  ? 1.000   11.071  157.946 1.00 73.02  ? 44  PHE C CB     1 
ATOM   9116  C CG     . PHE C 1 44  ? 0.390   10.483  159.181 1.00 76.45  ? 44  PHE C CG     1 
ATOM   9117  C CD1    . PHE C 1 44  ? 0.787   10.907  160.433 1.00 80.22  ? 44  PHE C CD1    1 
ATOM   9118  C CD2    . PHE C 1 44  ? -0.592  9.512   159.087 1.00 76.54  ? 44  PHE C CD2    1 
ATOM   9119  C CE1    . PHE C 1 44  ? 0.220   10.365  161.570 1.00 82.78  ? 44  PHE C CE1    1 
ATOM   9120  C CE2    . PHE C 1 44  ? -1.163  8.968   160.221 1.00 77.72  ? 44  PHE C CE2    1 
ATOM   9121  C CZ     . PHE C 1 44  ? -0.757  9.392   161.462 1.00 80.63  ? 44  PHE C CZ     1 
ATOM   9122  H H      . PHE C 1 44  ? 2.930   12.319  158.898 1.00 86.11  ? 44  PHE C H      1 
ATOM   9123  H HA     . PHE C 1 44  ? 2.614   9.814   157.983 1.00 85.58  ? 44  PHE C HA     1 
ATOM   9124  H HB2    . PHE C 1 44  ? 0.889   12.034  157.990 1.00 88.01  ? 44  PHE C HB2    1 
ATOM   9125  H HB3    . PHE C 1 44  ? 0.518   10.719  157.181 1.00 88.01  ? 44  PHE C HB3    1 
ATOM   9126  H HD1    . PHE C 1 44  ? 1.445   11.560  160.512 1.00 96.65  ? 44  PHE C HD1    1 
ATOM   9127  H HD2    . PHE C 1 44  ? -0.869  9.220   158.249 1.00 92.24  ? 44  PHE C HD2    1 
ATOM   9128  H HE1    . PHE C 1 44  ? 0.496   10.655  162.410 1.00 99.72  ? 44  PHE C HE1    1 
ATOM   9129  H HE2    . PHE C 1 44  ? -1.820  8.314   160.143 1.00 93.66  ? 44  PHE C HE2    1 
ATOM   9130  H HZ     . PHE C 1 44  ? -1.140  9.027   162.228 1.00 97.15  ? 44  PHE C HZ     1 
ATOM   9131  N N      . VAL C 1 45  ? 2.998   9.921   155.559 1.00 62.61  ? 45  VAL C N      1 
ATOM   9132  C CA     . VAL C 1 45  ? 3.506   10.026  154.191 1.00 59.83  ? 45  VAL C CA     1 
ATOM   9133  C C      . VAL C 1 45  ? 2.737   9.177   153.189 1.00 57.13  ? 45  VAL C C      1 
ATOM   9134  O O      . VAL C 1 45  ? 1.719   8.557   153.515 1.00 59.92  ? 45  VAL C O      1 
ATOM   9135  C CB     . VAL C 1 45  ? 4.998   9.616   154.110 1.00 58.91  ? 45  VAL C CB     1 
ATOM   9136  C CG1    . VAL C 1 45  ? 5.841   10.472  155.052 1.00 60.27  ? 45  VAL C CG1    1 
ATOM   9137  C CG2    . VAL C 1 45  ? 5.171   8.131   154.418 1.00 59.55  ? 45  VAL C CG2    1 
ATOM   9138  H H      . VAL C 1 45  ? 2.775   9.124   155.794 1.00 75.52  ? 45  VAL C H      1 
ATOM   9139  H HA     . VAL C 1 45  ? 3.439   10.950  153.906 1.00 72.19  ? 45  VAL C HA     1 
ATOM   9140  H HB     . VAL C 1 45  ? 5.316   9.770   153.206 1.00 71.08  ? 45  VAL C HB     1 
ATOM   9141  H HG11   . VAL C 1 45  ? 6.769   10.197  154.982 1.00 72.71  ? 45  VAL C HG11   1 
ATOM   9142  H HG12   . VAL C 1 45  ? 5.752   11.403  154.796 1.00 72.71  ? 45  VAL C HG12   1 
ATOM   9143  H HG13   . VAL C 1 45  ? 5.525   10.346  155.960 1.00 72.71  ? 45  VAL C HG13   1 
ATOM   9144  H HG21   . VAL C 1 45  ? 6.113   7.905   154.360 1.00 71.85  ? 45  VAL C HG21   1 
ATOM   9145  H HG22   . VAL C 1 45  ? 4.843   7.955   155.314 1.00 71.85  ? 45  VAL C HG22   1 
ATOM   9146  H HG23   . VAL C 1 45  ? 4.665   7.614   153.772 1.00 71.85  ? 45  VAL C HG23   1 
ATOM   9147  N N      . GLY C 1 46  ? 3.240   9.169   151.960 1.00 48.43  ? 46  GLY C N      1 
ATOM   9148  C CA     . GLY C 1 46  ? 2.727   8.283   150.942 1.00 48.42  ? 46  GLY C CA     1 
ATOM   9149  C C      . GLY C 1 46  ? 1.491   8.799   150.254 1.00 46.10  ? 46  GLY C C      1 
ATOM   9150  O O      . GLY C 1 46  ? 1.138   9.964   150.382 1.00 46.11  ? 46  GLY C O      1 
ATOM   9151  H H      . GLY C 1 46  ? 3.884   9.673   151.694 1.00 58.51  ? 46  GLY C H      1 
ATOM   9152  H HA2    . GLY C 1 46  ? 3.411   8.140   150.269 1.00 58.49  ? 46  GLY C HA2    1 
ATOM   9153  H HA3    . GLY C 1 46  ? 2.514   7.426   151.344 1.00 58.49  ? 46  GLY C HA3    1 
ATOM   9154  N N      . SER C 1 47  ? 0.830   7.905   149.526 1.00 50.87  ? 47  SER C N      1 
ATOM   9155  C CA     . SER C 1 47  ? -0.324  8.269   148.727 1.00 50.49  ? 47  SER C CA     1 
ATOM   9156  C C      . SER C 1 47  ? -1.430  8.863   149.581 1.00 51.75  ? 47  SER C C      1 
ATOM   9157  O O      . SER C 1 47  ? -2.125  9.773   149.137 1.00 52.77  ? 47  SER C O      1 
ATOM   9158  C CB     . SER C 1 47  ? -0.854  7.041   147.975 1.00 49.30  ? 47  SER C CB     1 
ATOM   9159  O OG     . SER C 1 47  ? -1.036  5.930   148.842 1.00 51.25  ? 47  SER C OG     1 
ATOM   9160  H H      . SER C 1 47  ? 1.037   7.072   149.479 1.00 61.44  ? 47  SER C H      1 
ATOM   9161  H HA     . SER C 1 47  ? -0.060  8.933   148.072 1.00 60.97  ? 47  SER C HA     1 
ATOM   9162  H HB2    . SER C 1 47  ? -1.707  7.266   147.571 1.00 59.55  ? 47  SER C HB2    1 
ATOM   9163  H HB3    . SER C 1 47  ? -0.217  6.798   147.285 1.00 59.55  ? 47  SER C HB3    1 
ATOM   9164  H HG     . SER C 1 47  ? -1.326  5.272   148.408 1.00 61.89  ? 47  SER C HG     1 
ATOM   9165  N N      . TYR C 1 48  ? -1.578  8.376   150.811 1.00 52.12  ? 48  TYR C N      1 
ATOM   9166  C CA     . TYR C 1 48  ? -2.640  8.871   151.680 1.00 51.12  ? 48  TYR C CA     1 
ATOM   9167  C C      . TYR C 1 48  ? -2.351  10.297  152.145 1.00 52.91  ? 48  TYR C C      1 
ATOM   9168  O O      . TYR C 1 48  ? -3.222  11.167  152.082 1.00 53.47  ? 48  TYR C O      1 
ATOM   9169  C CB     . TYR C 1 48  ? -2.842  7.957   152.893 1.00 54.10  ? 48  TYR C CB     1 
ATOM   9170  C CG     . TYR C 1 48  ? -3.908  8.499   153.820 1.00 58.31  ? 48  TYR C CG     1 
ATOM   9171  C CD1    . TYR C 1 48  ? -5.255  8.260   153.575 1.00 59.23  ? 48  TYR C CD1    1 
ATOM   9172  C CD2    . TYR C 1 48  ? -3.573  9.281   154.920 1.00 58.86  ? 48  TYR C CD2    1 
ATOM   9173  C CE1    . TYR C 1 48  ? -6.238  8.776   154.405 1.00 58.91  ? 48  TYR C CE1    1 
ATOM   9174  C CE2    . TYR C 1 48  ? -4.551  9.798   155.760 1.00 57.99  ? 48  TYR C CE2    1 
ATOM   9175  C CZ     . TYR C 1 48  ? -5.881  9.546   155.496 1.00 59.14  ? 48  TYR C CZ     1 
ATOM   9176  O OH     . TYR C 1 48  ? -6.852  10.064  156.328 1.00 62.46  ? 48  TYR C OH     1 
ATOM   9177  H H      . TYR C 1 48  ? -1.084  7.767   151.162 1.00 62.93  ? 48  TYR C H      1 
ATOM   9178  H HA     . TYR C 1 48  ? -3.471  8.886   151.179 1.00 61.73  ? 48  TYR C HA     1 
ATOM   9179  H HB2    . TYR C 1 48  ? -3.121  7.079   152.589 1.00 65.32  ? 48  TYR C HB2    1 
ATOM   9180  H HB3    . TYR C 1 48  ? -2.011  7.894   153.388 1.00 65.32  ? 48  TYR C HB3    1 
ATOM   9181  H HD1    . TYR C 1 48  ? -5.502  7.747   152.840 1.00 71.46  ? 48  TYR C HD1    1 
ATOM   9182  H HD2    . TYR C 1 48  ? -2.678  9.458   155.098 1.00 71.02  ? 48  TYR C HD2    1 
ATOM   9183  H HE1    . TYR C 1 48  ? -7.135  8.604   154.229 1.00 71.08  ? 48  TYR C HE1    1 
ATOM   9184  H HE2    . TYR C 1 48  ? -4.311  10.318  156.493 1.00 69.98  ? 48  TYR C HE2    1 
ATOM   9185  H HH     . TYR C 1 48  ? -6.495  10.508  156.945 1.00 75.35  ? 48  TYR C HH     1 
ATOM   9186  N N      . ALA C 1 49  ? -1.127  10.529  152.611 1.00 50.75  ? 49  ALA C N      1 
ATOM   9187  C CA     . ALA C 1 49  ? -0.717  11.843  153.113 1.00 51.12  ? 49  ALA C CA     1 
ATOM   9188  C C      . ALA C 1 49  ? -0.845  12.949  152.057 1.00 50.93  ? 49  ALA C C      1 
ATOM   9189  O O      . ALA C 1 49  ? -1.129  14.101  152.388 1.00 52.30  ? 49  ALA C O      1 
ATOM   9190  C CB     . ALA C 1 49  ? 0.711   11.778  153.625 1.00 53.91  ? 49  ALA C CB     1 
ATOM   9191  H H      . ALA C 1 49  ? -0.506  9.935   152.649 1.00 61.29  ? 49  ALA C H      1 
ATOM   9192  H HA     . ALA C 1 49  ? -1.287  12.081  153.860 1.00 61.73  ? 49  ALA C HA     1 
ATOM   9193  H HB1    . ALA C 1 49  ? 0.968   12.653  153.953 1.00 65.08  ? 49  ALA C HB1    1 
ATOM   9194  H HB2    . ALA C 1 49  ? 0.760   11.127  154.342 1.00 65.08  ? 49  ALA C HB2    1 
ATOM   9195  H HB3    . ALA C 1 49  ? 1.295   11.512  152.897 1.00 65.08  ? 49  ALA C HB3    1 
ATOM   9196  N N      . ARG C 1 50  ? -0.582  12.609  150.799 1.00 54.02  ? 50  ARG C N      1 
ATOM   9197  C CA     . ARG C 1 50  ? -0.709  13.562  149.701 1.00 55.21  ? 50  ARG C CA     1 
ATOM   9198  C C      . ARG C 1 50  ? -2.120  13.533  149.137 1.00 58.57  ? 50  ARG C C      1 
ATOM   9199  O O      . ARG C 1 50  ? -2.425  14.247  148.187 1.00 58.85  ? 50  ARG C O      1 
ATOM   9200  C CB     . ARG C 1 50  ? 0.290   13.253  148.588 1.00 53.45  ? 50  ARG C CB     1 
ATOM   9201  C CG     . ARG C 1 50  ? 1.728   13.258  149.032 1.00 51.19  ? 50  ARG C CG     1 
ATOM   9202  C CD     . ARG C 1 50  ? 2.636   12.889  147.886 1.00 48.88  ? 50  ARG C CD     1 
ATOM   9203  N NE     . ARG C 1 50  ? 3.675   11.945  148.305 1.00 51.43  ? 50  ARG C NE     1 
ATOM   9204  C CZ     . ARG C 1 50  ? 3.600   10.620  148.176 1.00 54.54  ? 50  ARG C CZ     1 
ATOM   9205  N NH1    . ARG C 1 50  ? 2.525   10.047  147.637 1.00 53.12  ? 50  ARG C NH1    1 
ATOM   9206  N NH2    . ARG C 1 50  ? 4.608   9.858   148.593 1.00 57.57  ? 50  ARG C NH2    1 
ATOM   9207  H H      . ARG C 1 50  ? -0.327  11.825  150.553 1.00 65.22  ? 50  ARG C H      1 
ATOM   9208  H HA     . ARG C 1 50  ? -0.531  14.457  150.031 1.00 66.65  ? 50  ARG C HA     1 
ATOM   9209  H HB2    . ARG C 1 50  ? 0.094   12.373  148.230 1.00 64.53  ? 50  ARG C HB2    1 
ATOM   9210  H HB3    . ARG C 1 50  ? 0.194   13.920  147.890 1.00 64.53  ? 50  ARG C HB3    1 
ATOM   9211  H HG2    . ARG C 1 50  ? 1.968   14.145  149.342 1.00 61.82  ? 50  ARG C HG2    1 
ATOM   9212  H HG3    . ARG C 1 50  ? 1.849   12.607  149.742 1.00 61.82  ? 50  ARG C HG3    1 
ATOM   9213  H HD2    . ARG C 1 50  ? 2.113   12.473  147.184 1.00 59.05  ? 50  ARG C HD2    1 
ATOM   9214  H HD3    . ARG C 1 50  ? 3.070   13.690  147.552 1.00 59.05  ? 50  ARG C HD3    1 
ATOM   9215  H HE     . ARG C 1 50  ? 4.388   12.270  148.660 1.00 62.11  ? 50  ARG C HE     1 
ATOM   9216  H HH11   . ARG C 1 50  ? 1.870   10.533  147.366 1.00 64.14  ? 50  ARG C HH11   1 
ATOM   9217  H HH12   . ARG C 1 50  ? 2.487   9.191   147.559 1.00 64.14  ? 50  ARG C HH12   1 
ATOM   9218  H HH21   . ARG C 1 50  ? 5.305   10.221  148.943 1.00 69.48  ? 50  ARG C HH21   1 
ATOM   9219  H HH22   . ARG C 1 50  ? 4.563   9.003   148.512 1.00 69.48  ? 50  ARG C HH22   1 
ATOM   9220  N N      . ASN C 1 51  ? -2.969  12.686  149.706 1.00 64.84  ? 51  ASN C N      1 
ATOM   9221  C CA     . ASN C 1 51  ? -4.353  12.579  149.265 1.00 71.19  ? 51  ASN C CA     1 
ATOM   9222  C C      . ASN C 1 51  ? -4.435  12.138  147.798 1.00 67.66  ? 51  ASN C C      1 
ATOM   9223  O O      . ASN C 1 51  ? -5.415  12.427  147.106 1.00 70.12  ? 51  ASN C O      1 
ATOM   9224  C CB     . ASN C 1 51  ? -5.060  13.927  149.462 1.00 78.12  ? 51  ASN C CB     1 
ATOM   9225  C CG     . ASN C 1 51  ? -6.567  13.823  149.364 1.00 84.35  ? 51  ASN C CG     1 
ATOM   9226  O OD1    . ASN C 1 51  ? -7.184  12.938  149.961 1.00 87.44  ? 51  ASN C OD1    1 
ATOM   9227  N ND2    . ASN C 1 51  ? -7.172  14.730  148.601 1.00 84.60  ? 51  ASN C ND2    1 
ATOM   9228  H H      . ASN C 1 51  ? -2.767  12.158  150.354 1.00 78.20  ? 51  ASN C H      1 
ATOM   9229  H HA     . ASN C 1 51  ? -4.810  11.916  149.806 1.00 85.82  ? 51  ASN C HA     1 
ATOM   9230  H HB2    . ASN C 1 51  ? -4.840  14.273  150.341 1.00 94.13  ? 51  ASN C HB2    1 
ATOM   9231  H HB3    . ASN C 1 51  ? -4.757  14.544  148.778 1.00 94.13  ? 51  ASN C HB3    1 
ATOM   9232  H HD21   . ASN C 1 51  ? -8.027  14.715  148.512 1.00 101.91 ? 51  ASN C HD21   1 
ATOM   9233  H HD22   . ASN C 1 51  ? -6.707  15.330  148.196 1.00 101.91 ? 51  ASN C HD22   1 
ATOM   9234  N N      . THR C 1 52  ? -3.400  11.436  147.339 1.00 60.54  ? 52  THR C N      1 
ATOM   9235  C CA     . THR C 1 52  ? -3.343  10.916  145.971 1.00 57.51  ? 52  THR C CA     1 
ATOM   9236  C C      . THR C 1 52  ? -3.726  9.435   145.828 1.00 58.01  ? 52  THR C C      1 
ATOM   9237  O O      . THR C 1 52  ? -3.659  8.877   144.728 1.00 58.63  ? 52  THR C O      1 
ATOM   9238  C CB     . THR C 1 52  ? -1.921  11.097  145.386 1.00 51.10  ? 52  THR C CB     1 
ATOM   9239  O OG1    . THR C 1 52  ? -0.973  10.380  146.190 1.00 49.35  ? 52  THR C OG1    1 
ATOM   9240  C CG2    . THR C 1 52  ? -1.535  12.560  145.360 1.00 50.32  ? 52  THR C CG2    1 
ATOM   9241  H H      . THR C 1 52  ? -2.706  11.243  147.809 1.00 73.04  ? 52  THR C H      1 
ATOM   9242  H HA     . THR C 1 52  ? -3.954  11.430  145.421 1.00 69.40  ? 52  THR C HA     1 
ATOM   9243  H HB     . THR C 1 52  ? -1.899  10.756  144.478 1.00 61.71  ? 52  THR C HB     1 
ATOM   9244  H HG1    . THR C 1 52  ? -0.200  10.476  145.875 1.00 59.61  ? 52  THR C HG1    1 
ATOM   9245  H HG21   . THR C 1 52  ? -0.643  12.661  144.992 1.00 60.77  ? 52  THR C HG21   1 
ATOM   9246  H HG22   . THR C 1 52  ? -2.161  13.058  144.810 1.00 60.77  ? 52  THR C HG22   1 
ATOM   9247  H HG23   . THR C 1 52  ? -1.548  12.922  146.259 1.00 60.77  ? 52  THR C HG23   1 
ATOM   9248  N N      . TRP C 1 53  ? -4.104  8.793   146.928 1.00 55.52  ? 53  TRP C N      1 
ATOM   9249  C CA     . TRP C 1 53  ? -4.316  7.350   146.912 1.00 56.96  ? 53  TRP C CA     1 
ATOM   9250  C C      . TRP C 1 53  ? -5.589  7.068   146.106 1.00 57.22  ? 53  TRP C C      1 
ATOM   9251  O O      . TRP C 1 53  ? -6.484  7.910   146.029 1.00 60.64  ? 53  TRP C O      1 
ATOM   9252  C CB     . TRP C 1 53  ? -4.397  6.766   148.335 1.00 60.87  ? 53  TRP C CB     1 
ATOM   9253  C CG     . TRP C 1 53  ? -5.774  6.687   148.907 1.00 63.57  ? 53  TRP C CG     1 
ATOM   9254  C CD1    . TRP C 1 53  ? -6.629  5.632   148.806 1.00 63.97  ? 53  TRP C CD1    1 
ATOM   9255  C CD2    . TRP C 1 53  ? -6.470  7.698   149.647 1.00 62.82  ? 53  TRP C CD2    1 
ATOM   9256  N NE1    . TRP C 1 53  ? -7.814  5.917   149.442 1.00 63.49  ? 53  TRP C NE1    1 
ATOM   9257  C CE2    . TRP C 1 53  ? -7.741  7.179   149.967 1.00 62.87  ? 53  TRP C CE2    1 
ATOM   9258  C CE3    . TRP C 1 53  ? -6.143  8.988   150.071 1.00 60.56  ? 53  TRP C CE3    1 
ATOM   9259  C CZ2    . TRP C 1 53  ? -8.683  7.905   150.693 1.00 62.13  ? 53  TRP C CZ2    1 
ATOM   9260  C CZ3    . TRP C 1 53  ? -7.082  9.706   150.791 1.00 62.96  ? 53  TRP C CZ3    1 
ATOM   9261  C CH2    . TRP C 1 53  ? -8.335  9.162   151.094 1.00 64.00  ? 53  TRP C CH2    1 
ATOM   9262  H H      . TRP C 1 53  ? -4.243  9.166   147.691 1.00 67.01  ? 53  TRP C H      1 
ATOM   9263  H HA     . TRP C 1 53  ? -3.572  6.926   146.457 1.00 68.74  ? 53  TRP C HA     1 
ATOM   9264  H HB2    . TRP C 1 53  ? -4.035  5.867   148.321 1.00 73.44  ? 53  TRP C HB2    1 
ATOM   9265  H HB3    . TRP C 1 53  ? -3.866  7.321   148.927 1.00 73.44  ? 53  TRP C HB3    1 
ATOM   9266  H HD1    . TRP C 1 53  ? -6.438  4.833   148.371 1.00 77.16  ? 53  TRP C HD1    1 
ATOM   9267  H HE1    . TRP C 1 53  ? -8.489  5.388   149.502 1.00 76.57  ? 53  TRP C HE1    1 
ATOM   9268  H HE3    . TRP C 1 53  ? -5.313  9.357   149.874 1.00 73.07  ? 53  TRP C HE3    1 
ATOM   9269  H HZ2    . TRP C 1 53  ? -9.517  7.546   150.896 1.00 74.94  ? 53  TRP C HZ2    1 
ATOM   9270  H HZ3    . TRP C 1 53  ? -6.876  10.565  151.080 1.00 75.95  ? 53  TRP C HZ3    1 
ATOM   9271  H HH2    . TRP C 1 53  ? -8.945  9.668   151.580 1.00 77.19  ? 53  TRP C HH2    1 
ATOM   9272  N N      . LEU C 1 54  ? -5.613  5.923   145.435 1.00 51.66  ? 54  LEU C N      1 
ATOM   9273  C CA     . LEU C 1 54  ? -6.697  5.546   144.530 1.00 50.27  ? 54  LEU C CA     1 
ATOM   9274  C C      . LEU C 1 54  ? -7.942  5.027   145.249 1.00 55.97  ? 54  LEU C C      1 
ATOM   9275  O O      . LEU C 1 54  ? -7.862  4.606   146.400 1.00 58.78  ? 54  LEU C O      1 
ATOM   9276  C CB     . LEU C 1 54  ? -6.205  4.481   143.563 1.00 48.68  ? 54  LEU C CB     1 
ATOM   9277  C CG     . LEU C 1 54  ? -7.016  4.305   142.287 1.00 46.52  ? 54  LEU C CG     1 
ATOM   9278  C CD1    . LEU C 1 54  ? -7.060  5.586   141.464 1.00 46.43  ? 54  LEU C CD1    1 
ATOM   9279  C CD2    . LEU C 1 54  ? -6.415  3.178   141.480 1.00 45.95  ? 54  LEU C CD2    1 
ATOM   9280  H H      . LEU C 1 54  ? -4.994  5.328   145.489 1.00 62.39  ? 54  LEU C H      1 
ATOM   9281  H HA     . LEU C 1 54  ? -6.956  6.324   144.011 1.00 60.71  ? 54  LEU C HA     1 
ATOM   9282  H HB2    . LEU C 1 54  ? -5.299  4.705   143.300 1.00 58.80  ? 54  LEU C HB2    1 
ATOM   9283  H HB3    . LEU C 1 54  ? -6.205  3.628   144.025 1.00 58.80  ? 54  LEU C HB3    1 
ATOM   9284  H HG     . LEU C 1 54  ? -7.926  4.061   142.518 1.00 56.22  ? 54  LEU C HG     1 
ATOM   9285  H HD11   . LEU C 1 54  ? -7.585  5.429   140.664 1.00 56.11  ? 54  LEU C HD11   1 
ATOM   9286  H HD12   . LEU C 1 54  ? -7.468  6.288   141.995 1.00 56.11  ? 54  LEU C HD12   1 
ATOM   9287  H HD13   . LEU C 1 54  ? -6.155  5.837   141.223 1.00 56.11  ? 54  LEU C HD13   1 
ATOM   9288  H HD21   . LEU C 1 54  ? -6.930  3.063   140.666 1.00 55.53  ? 54  LEU C HD21   1 
ATOM   9289  H HD22   . LEU C 1 54  ? -5.496  3.401   141.262 1.00 55.53  ? 54  LEU C HD22   1 
ATOM   9290  H HD23   . LEU C 1 54  ? -6.442  2.364   142.006 1.00 55.53  ? 54  LEU C HD23   1 
ATOM   9291  N N      . LYS C 1 55  ? -9.092  5.073   144.574 1.00 60.58  ? 55  LYS C N      1 
ATOM   9292  C CA     . LYS C 1 55  ? -10.349 4.561   145.136 1.00 65.29  ? 55  LYS C CA     1 
ATOM   9293  C C      . LYS C 1 55  ? -10.221 3.086   145.536 1.00 64.32  ? 55  LYS C C      1 
ATOM   9294  O O      . LYS C 1 55  ? -9.804  2.253   144.734 1.00 67.07  ? 55  LYS C O      1 
ATOM   9295  C CB     . LYS C 1 55  ? -11.495 4.710   144.122 1.00 69.21  ? 55  LYS C CB     1 
ATOM   9296  C CG     . LYS C 1 55  ? -12.864 4.235   144.635 1.00 73.54  ? 55  LYS C CG     1 
ATOM   9297  C CD     . LYS C 1 55  ? -13.992 4.559   143.641 1.00 72.48  ? 55  LYS C CD     1 
ATOM   9298  C CE     . LYS C 1 55  ? -15.383 4.329   144.209 1.00 72.91  ? 55  LYS C CE     1 
ATOM   9299  N NZ     . LYS C 1 55  ? -15.661 5.159   145.421 1.00 76.65  ? 55  LYS C NZ     1 
ATOM   9300  H H      . LYS C 1 55  ? -9.173  5.398   143.782 1.00 73.09  ? 55  LYS C H      1 
ATOM   9301  H HA     . LYS C 1 55  ? -10.576 5.072   145.928 1.00 78.74  ? 55  LYS C HA     1 
ATOM   9302  H HB2    . LYS C 1 55  ? -11.579 5.647   143.884 1.00 83.44  ? 55  LYS C HB2    1 
ATOM   9303  H HB3    . LYS C 1 55  ? -11.280 4.190   143.332 1.00 83.44  ? 55  LYS C HB3    1 
ATOM   9304  H HG2    . LYS C 1 55  ? -12.841 3.274   144.764 1.00 88.64  ? 55  LYS C HG2    1 
ATOM   9305  H HG3    . LYS C 1 55  ? -13.063 4.681   145.474 1.00 88.64  ? 55  LYS C HG3    1 
ATOM   9306  H HD2    . LYS C 1 55  ? -13.925 5.492   143.384 1.00 87.36  ? 55  LYS C HD2    1 
ATOM   9307  H HD3    . LYS C 1 55  ? -13.893 3.994   142.859 1.00 87.36  ? 55  LYS C HD3    1 
ATOM   9308  H HE2    . LYS C 1 55  ? -16.041 4.557   143.533 1.00 87.88  ? 55  LYS C HE2    1 
ATOM   9309  H HE3    . LYS C 1 55  ? -15.473 3.396   144.458 1.00 87.88  ? 55  LYS C HE3    1 
ATOM   9310  H HZ1    . LYS C 1 55  ? -16.483 4.994   145.720 1.00 92.38  ? 55  LYS C HZ1    1 
ATOM   9311  H HZ2    . LYS C 1 55  ? -15.075 4.965   146.062 1.00 92.38  ? 55  LYS C HZ2    1 
ATOM   9312  H HZ3    . LYS C 1 55  ? -15.594 6.023   145.220 1.00 92.38  ? 55  LYS C HZ3    1 
ATOM   9313  N N      . GLY C 1 56  ? -10.580 2.763   146.773 1.00 64.37  ? 56  GLY C N      1 
ATOM   9314  C CA     . GLY C 1 56  ? -10.512 1.389   147.254 1.00 67.67  ? 56  GLY C CA     1 
ATOM   9315  C C      . GLY C 1 56  ? -9.114  0.875   147.572 1.00 67.74  ? 56  GLY C C      1 
ATOM   9316  O O      . GLY C 1 56  ? -8.941  -0.296  147.917 1.00 68.36  ? 56  GLY C O      1 
ATOM   9317  H H      . GLY C 1 56  ? -10.869 3.324   147.357 1.00 77.63  ? 56  GLY C H      1 
ATOM   9318  H HA2    . GLY C 1 56  ? -11.046 1.313   148.060 1.00 81.59  ? 56  GLY C HA2    1 
ATOM   9319  H HA3    . GLY C 1 56  ? -10.898 0.804   146.584 1.00 81.59  ? 56  GLY C HA3    1 
ATOM   9320  N N      . SER C 1 57  ? -8.121  1.748   147.416 1.00 64.64  ? 57  SER C N      1 
ATOM   9321  C CA     . SER C 1 57  ? -6.712  1.445   147.690 1.00 60.56  ? 57  SER C CA     1 
ATOM   9322  C C      . SER C 1 57  ? -6.210  1.928   149.057 1.00 57.36  ? 57  SER C C      1 
ATOM   9323  O O      . SER C 1 57  ? -5.005  1.915   149.308 1.00 56.82  ? 57  SER C O      1 
ATOM   9324  C CB     . SER C 1 57  ? -5.828  2.049   146.600 1.00 61.63  ? 57  SER C CB     1 
ATOM   9325  O OG     . SER C 1 57  ? -4.481  1.647   146.778 1.00 62.20  ? 57  SER C OG     1 
ATOM   9326  H H      . SER C 1 57  ? -8.242  2.554   147.141 1.00 77.96  ? 57  SER C H      1 
ATOM   9327  H HA     . SER C 1 57  ? -6.595  0.483   147.661 1.00 73.06  ? 57  SER C HA     1 
ATOM   9328  H HB2    . SER C 1 57  ? -6.139  1.743   145.734 1.00 74.35  ? 57  SER C HB2    1 
ATOM   9329  H HB3    . SER C 1 57  ? -5.879  3.016   146.650 1.00 74.35  ? 57  SER C HB3    1 
ATOM   9330  H HG     . SER C 1 57  ? -3.999  1.982   146.177 1.00 75.03  ? 57  SER C HG     1 
ATOM   9331  N N      . LEU C 1 58  ? -7.112  2.394   149.914 1.00 61.95  ? 58  LEU C N      1 
ATOM   9332  C CA     . LEU C 1 58  ? -6.720  3.129   151.119 1.00 64.65  ? 58  LEU C CA     1 
ATOM   9333  C C      . LEU C 1 58  ? -5.722  2.406   152.028 1.00 64.85  ? 58  LEU C C      1 
ATOM   9334  O O      . LEU C 1 58  ? -5.976  1.304   152.519 1.00 64.56  ? 58  LEU C O      1 
ATOM   9335  C CB     . LEU C 1 58  ? -7.975  3.467   151.935 1.00 65.87  ? 58  LEU C CB     1 
ATOM   9336  C CG     . LEU C 1 58  ? -7.767  4.129   153.301 1.00 66.40  ? 58  LEU C CG     1 
ATOM   9337  C CD1    . LEU C 1 58  ? -7.131  5.504   153.149 1.00 66.43  ? 58  LEU C CD1    1 
ATOM   9338  C CD2    . LEU C 1 58  ? -9.084  4.217   154.060 1.00 66.34  ? 58  LEU C CD2    1 
ATOM   9339  H H      . LEU C 1 58  ? -7.962  2.300   149.822 1.00 74.73  ? 58  LEU C H      1 
ATOM   9340  H HA     . LEU C 1 58  ? -6.312  3.967   150.849 1.00 77.97  ? 58  LEU C HA     1 
ATOM   9341  H HB2    . LEU C 1 58  ? -8.523  4.069   151.407 1.00 79.44  ? 58  LEU C HB2    1 
ATOM   9342  H HB3    . LEU C 1 58  ? -8.465  2.644   152.089 1.00 79.44  ? 58  LEU C HB3    1 
ATOM   9343  H HG     . LEU C 1 58  ? -7.162  3.580   153.823 1.00 80.07  ? 58  LEU C HG     1 
ATOM   9344  H HD11   . LEU C 1 58  ? -7.012  5.896   154.028 1.00 80.11  ? 58  LEU C HD11   1 
ATOM   9345  H HD12   . LEU C 1 58  ? -6.271  5.407   152.711 1.00 80.11  ? 58  LEU C HD12   1 
ATOM   9346  H HD13   . LEU C 1 58  ? -7.714  6.064   152.613 1.00 80.11  ? 58  LEU C HD13   1 
ATOM   9347  H HD21   . LEU C 1 58  ? -8.925  4.638   154.919 1.00 79.99  ? 58  LEU C HD21   1 
ATOM   9348  H HD22   . LEU C 1 58  ? -9.712  4.746   153.543 1.00 79.99  ? 58  LEU C HD22   1 
ATOM   9349  H HD23   . LEU C 1 58  ? -9.434  3.321   154.190 1.00 79.99  ? 58  LEU C HD23   1 
ATOM   9350  N N      . GLU C 1 59  ? -4.579  3.061   152.232 1.00 65.24  ? 59  GLU C N      1 
ATOM   9351  C CA     . GLU C 1 59  ? -3.561  2.614   153.177 1.00 65.99  ? 59  GLU C CA     1 
ATOM   9352  C C      . GLU C 1 59  ? -2.816  3.816   153.781 1.00 63.60  ? 59  GLU C C      1 
ATOM   9353  O O      . GLU C 1 59  ? -2.403  4.732   153.063 1.00 65.28  ? 59  GLU C O      1 
ATOM   9354  C CB     . GLU C 1 59  ? -2.593  1.661   152.487 1.00 69.94  ? 59  GLU C CB     1 
ATOM   9355  C CG     . GLU C 1 59  ? -1.819  0.766   153.419 1.00 75.20  ? 59  GLU C CG     1 
ATOM   9356  C CD     . GLU C 1 59  ? -1.087  -0.318  152.660 1.00 78.60  ? 59  GLU C CD     1 
ATOM   9357  O OE1    . GLU C 1 59  ? -0.679  -0.063  151.503 1.00 77.24  ? 59  GLU C OE1    1 
ATOM   9358  O OE2    . GLU C 1 59  ? -0.930  -1.427  153.213 1.00 80.52  ? 59  GLU C OE2    1 
ATOM   9359  H H      . GLU C 1 59  ? -4.368  3.787   151.822 1.00 78.67  ? 59  GLU C H      1 
ATOM   9360  H HA     . GLU C 1 59  ? -3.992  2.133   153.901 1.00 79.58  ? 59  GLU C HA     1 
ATOM   9361  H HB2    . GLU C 1 59  ? -3.096  1.092   151.883 1.00 84.31  ? 59  GLU C HB2    1 
ATOM   9362  H HB3    . GLU C 1 59  ? -1.951  2.184   151.982 1.00 84.31  ? 59  GLU C HB3    1 
ATOM   9363  H HG2    . GLU C 1 59  ? -1.164  1.295   153.902 1.00 90.63  ? 59  GLU C HG2    1 
ATOM   9364  H HG3    . GLU C 1 59  ? -2.432  0.342   154.040 1.00 90.63  ? 59  GLU C HG3    1 
ATOM   9365  N N      . ILE C 1 60  ? -2.645  3.797   155.098 1.00 62.48  ? 60  ILE C N      1 
ATOM   9366  C CA     . ILE C 1 60  ? -1.945  4.859   155.821 1.00 61.63  ? 60  ILE C CA     1 
ATOM   9367  C C      . ILE C 1 60  ? -0.477  4.513   156.089 1.00 64.83  ? 60  ILE C C      1 
ATOM   9368  O O      . ILE C 1 60  ? -0.170  3.465   156.656 1.00 66.69  ? 60  ILE C O      1 
ATOM   9369  C CB     . ILE C 1 60  ? -2.647  5.158   157.169 1.00 59.38  ? 60  ILE C CB     1 
ATOM   9370  C CG1    . ILE C 1 60  ? -4.036  5.757   156.911 1.00 60.76  ? 60  ILE C CG1    1 
ATOM   9371  C CG2    . ILE C 1 60  ? -1.812  6.104   158.021 1.00 58.92  ? 60  ILE C CG2    1 
ATOM   9372  C CD1    . ILE C 1 60  ? -4.871  6.010   158.159 1.00 63.36  ? 60  ILE C CD1    1 
ATOM   9373  H H      . ILE C 1 60  ? -2.931  3.167   155.608 1.00 75.36  ? 60  ILE C H      1 
ATOM   9374  H HA     . ILE C 1 60  ? -1.968  5.669   155.287 1.00 74.35  ? 60  ILE C HA     1 
ATOM   9375  H HB     . ILE C 1 60  ? -2.756  4.323   157.651 1.00 71.64  ? 60  ILE C HB     1 
ATOM   9376  H HG12   . ILE C 1 60  ? -3.925  6.606   156.456 1.00 73.30  ? 60  ILE C HG12   1 
ATOM   9377  H HG13   . ILE C 1 60  ? -4.534  5.147   156.344 1.00 73.30  ? 60  ILE C HG13   1 
ATOM   9378  H HG21   . ILE C 1 60  ? -2.277  6.270   158.855 1.00 71.09  ? 60  ILE C HG21   1 
ATOM   9379  H HG22   . ILE C 1 60  ? -0.952  5.692   158.198 1.00 71.09  ? 60  ILE C HG22   1 
ATOM   9380  H HG23   . ILE C 1 60  ? -1.688  6.936   157.539 1.00 71.09  ? 60  ILE C HG23   1 
ATOM   9381  H HD11   . ILE C 1 60  ? -5.725  6.387   157.895 1.00 76.42  ? 60  ILE C HD11   1 
ATOM   9382  H HD12   . ILE C 1 60  ? -5.008  5.169   158.622 1.00 76.42  ? 60  ILE C HD12   1 
ATOM   9383  H HD13   . ILE C 1 60  ? -4.398  6.632   158.734 1.00 76.42  ? 60  ILE C HD13   1 
ATOM   9384  N N      . ASP C 1 61  ? 0.423   5.415   155.704 1.00 66.63  ? 61  ASP C N      1 
ATOM   9385  C CA     . ASP C 1 61  ? 1.844   5.246   155.984 1.00 66.94  ? 61  ASP C CA     1 
ATOM   9386  C C      . ASP C 1 61  ? 2.291   6.239   157.046 1.00 63.84  ? 61  ASP C C      1 
ATOM   9387  O O      . ASP C 1 61  ? 2.061   7.442   156.912 1.00 62.67  ? 61  ASP C O      1 
ATOM   9388  C CB     . ASP C 1 61  ? 2.673   5.433   154.706 1.00 67.38  ? 61  ASP C CB     1 
ATOM   9389  C CG     . ASP C 1 61  ? 2.364   4.388   153.648 1.00 67.71  ? 61  ASP C CG     1 
ATOM   9390  O OD1    . ASP C 1 61  ? 1.975   3.260   154.021 1.00 68.53  ? 61  ASP C OD1    1 
ATOM   9391  O OD2    . ASP C 1 61  ? 2.502   4.697   152.445 1.00 66.40  ? 61  ASP C OD2    1 
ATOM   9392  H H      . ASP C 1 61  ? 0.234   6.137   155.277 1.00 80.34  ? 61  ASP C H      1 
ATOM   9393  H HA     . ASP C 1 61  ? 2.001   4.349   156.320 1.00 80.72  ? 61  ASP C HA     1 
ATOM   9394  H HB2    . ASP C 1 61  ? 2.482   6.307   154.331 1.00 81.25  ? 61  ASP C HB2    1 
ATOM   9395  H HB3    . ASP C 1 61  ? 3.615   5.366   154.928 1.00 81.25  ? 61  ASP C HB3    1 
ATOM   9396  N N      . VAL C 1 62  ? 2.977   5.723   158.064 1.00 62.91  ? 62  VAL C N      1 
ATOM   9397  C CA     . VAL C 1 62  ? 3.471   6.526   159.181 1.00 67.03  ? 62  VAL C CA     1 
ATOM   9398  C C      . VAL C 1 62  ? 4.931   6.204   159.478 1.00 70.27  ? 62  VAL C C      1 
ATOM   9399  O O      . VAL C 1 62  ? 5.258   5.069   159.824 1.00 72.27  ? 62  VAL C O      1 
ATOM   9400  C CB     . VAL C 1 62  ? 2.663   6.269   160.470 1.00 68.01  ? 62  VAL C CB     1 
ATOM   9401  C CG1    . VAL C 1 62  ? 3.115   7.220   161.569 1.00 68.59  ? 62  VAL C CG1    1 
ATOM   9402  C CG2    . VAL C 1 62  ? 1.169   6.413   160.220 1.00 67.38  ? 62  VAL C CG2    1 
ATOM   9403  H H      . VAL C 1 62  ? 3.173   4.888   158.132 1.00 75.89  ? 62  VAL C H      1 
ATOM   9404  H HA     . VAL C 1 62  ? 3.403   7.467   158.957 1.00 80.83  ? 62  VAL C HA     1 
ATOM   9405  H HB     . VAL C 1 62  ? 2.830   5.363   160.771 1.00 82.00  ? 62  VAL C HB     1 
ATOM   9406  H HG11   . VAL C 1 62  ? 2.597   7.045   162.370 1.00 82.70  ? 62  VAL C HG11   1 
ATOM   9407  H HG12   . VAL C 1 62  ? 4.057   7.074   161.745 1.00 82.70  ? 62  VAL C HG12   1 
ATOM   9408  H HG13   . VAL C 1 62  ? 2.971   8.134   161.275 1.00 82.70  ? 62  VAL C HG13   1 
ATOM   9409  H HG21   . VAL C 1 62  ? 0.694   6.246   161.049 1.00 81.25  ? 62  VAL C HG21   1 
ATOM   9410  H HG22   . VAL C 1 62  ? 0.987   7.314   159.910 1.00 81.25  ? 62  VAL C HG22   1 
ATOM   9411  H HG23   . VAL C 1 62  ? 0.898   5.769   159.547 1.00 81.25  ? 62  VAL C HG23   1 
ATOM   9412  N N      . PHE C 1 63  ? 5.805   7.199   159.378 1.00 73.38  ? 63  PHE C N      1 
ATOM   9413  C CA     . PHE C 1 63  ? 7.217   6.965   159.636 1.00 73.82  ? 63  PHE C CA     1 
ATOM   9414  C C      . PHE C 1 63  ? 7.637   7.513   160.998 1.00 75.51  ? 63  PHE C C      1 
ATOM   9415  O O      . PHE C 1 63  ? 7.465   8.699   161.287 1.00 76.83  ? 63  PHE C O      1 
ATOM   9416  C CB     . PHE C 1 63  ? 8.058   7.585   158.524 1.00 73.24  ? 63  PHE C CB     1 
ATOM   9417  C CG     . PHE C 1 63  ? 8.222   6.694   157.325 1.00 72.05  ? 63  PHE C CG     1 
ATOM   9418  C CD1    . PHE C 1 63  ? 7.135   6.393   156.517 1.00 71.64  ? 63  PHE C CD1    1 
ATOM   9419  C CD2    . PHE C 1 63  ? 9.456   6.152   157.008 1.00 72.67  ? 63  PHE C CD2    1 
ATOM   9420  C CE1    . PHE C 1 63  ? 7.278   5.568   155.410 1.00 69.95  ? 63  PHE C CE1    1 
ATOM   9421  C CE2    . PHE C 1 63  ? 9.606   5.324   155.905 1.00 72.08  ? 63  PHE C CE2    1 
ATOM   9422  C CZ     . PHE C 1 63  ? 8.514   5.034   155.105 1.00 70.05  ? 63  PHE C CZ     1 
ATOM   9423  H H      . PHE C 1 63  ? 5.608   8.009   159.164 1.00 88.45  ? 63  PHE C H      1 
ATOM   9424  H HA     . PHE C 1 63  ? 7.382   6.009   159.636 1.00 88.98  ? 63  PHE C HA     1 
ATOM   9425  H HB2    . PHE C 1 63  ? 7.632   8.405   158.229 1.00 88.28  ? 63  PHE C HB2    1 
ATOM   9426  H HB3    . PHE C 1 63  ? 8.942   7.781   158.872 1.00 88.28  ? 63  PHE C HB3    1 
ATOM   9427  H HD1    . PHE C 1 63  ? 6.300   6.750   156.718 1.00 86.35  ? 63  PHE C HD1    1 
ATOM   9428  H HD2    . PHE C 1 63  ? 10.193  6.343   157.543 1.00 87.59  ? 63  PHE C HD2    1 
ATOM   9429  H HE1    . PHE C 1 63  ? 6.542   5.375   154.875 1.00 84.33  ? 63  PHE C HE1    1 
ATOM   9430  H HE2    . PHE C 1 63  ? 10.440  4.967   155.701 1.00 86.89  ? 63  PHE C HE2    1 
ATOM   9431  H HZ     . PHE C 1 63  ? 8.613   4.481   154.364 1.00 84.45  ? 63  PHE C HZ     1 
ATOM   9432  N N      . LEU C 1 64  ? 8.216   6.636   161.814 1.00 68.91  ? 64  LEU C N      1 
ATOM   9433  C CA     . LEU C 1 64  ? 8.728   7.002   163.127 1.00 68.47  ? 64  LEU C CA     1 
ATOM   9434  C C      . LEU C 1 64  ? 10.142  7.508   162.950 1.00 71.14  ? 64  LEU C C      1 
ATOM   9435  O O      . LEU C 1 64  ? 11.001  6.778   162.447 1.00 68.08  ? 64  LEU C O      1 
ATOM   9436  C CB     . LEU C 1 64  ? 8.710   5.806   164.086 1.00 70.94  ? 64  LEU C CB     1 
ATOM   9437  C CG     . LEU C 1 64  ? 7.422   4.994   164.232 1.00 71.10  ? 64  LEU C CG     1 
ATOM   9438  C CD1    . LEU C 1 64  ? 7.672   3.754   165.070 1.00 73.62  ? 64  LEU C CD1    1 
ATOM   9439  C CD2    . LEU C 1 64  ? 6.329   5.837   164.865 1.00 71.90  ? 64  LEU C CD2    1 
ATOM   9440  H H      . LEU C 1 64  ? 8.325   5.804   161.623 1.00 83.08  ? 64  LEU C H      1 
ATOM   9441  H HA     . LEU C 1 64  ? 8.186   7.713   163.505 1.00 82.55  ? 64  LEU C HA     1 
ATOM   9442  H HB2    . LEU C 1 64  ? 9.399   5.187   163.797 1.00 84.49  ? 64  LEU C HB2    1 
ATOM   9443  H HB3    . LEU C 1 64  ? 8.935   6.134   164.970 1.00 84.49  ? 64  LEU C HB3    1 
ATOM   9444  H HG     . LEU C 1 64  ? 7.119   4.713   163.355 1.00 83.37  ? 64  LEU C HG     1 
ATOM   9445  H HD11   . LEU C 1 64  ? 6.845   3.255   165.150 1.00 86.39  ? 64  LEU C HD11   1 
ATOM   9446  H HD12   . LEU C 1 64  ? 8.346   3.210   164.633 1.00 86.39  ? 64  LEU C HD12   1 
ATOM   9447  H HD13   . LEU C 1 64  ? 7.983   4.025   165.948 1.00 86.39  ? 64  LEU C HD13   1 
ATOM   9448  H HD21   . LEU C 1 64  ? 5.525   5.301   164.946 1.00 84.33  ? 64  LEU C HD21   1 
ATOM   9449  H HD22   . LEU C 1 64  ? 6.623   6.128   165.742 1.00 84.33  ? 64  LEU C HD22   1 
ATOM   9450  H HD23   . LEU C 1 64  ? 6.157   6.607   164.300 1.00 84.33  ? 64  LEU C HD23   1 
ATOM   9451  N N      . LEU C 1 65  ? 10.389  8.742   163.381 1.00 77.27  ? 65  LEU C N      1 
ATOM   9452  C CA     . LEU C 1 65  ? 11.665  9.399   163.109 1.00 81.24  ? 65  LEU C CA     1 
ATOM   9453  C C      . LEU C 1 65  ? 12.624  9.351   164.297 1.00 83.99  ? 65  LEU C C      1 
ATOM   9454  O O      . LEU C 1 65  ? 12.428  10.036  165.305 1.00 82.04  ? 65  LEU C O      1 
ATOM   9455  C CB     . LEU C 1 65  ? 11.417  10.857  162.699 1.00 80.99  ? 65  LEU C CB     1 
ATOM   9456  C CG     . LEU C 1 65  ? 10.574  11.065  161.434 1.00 74.72  ? 65  LEU C CG     1 
ATOM   9457  C CD1    . LEU C 1 65  ? 10.437  12.554  161.131 1.00 72.19  ? 65  LEU C CD1    1 
ATOM   9458  C CD2    . LEU C 1 65  ? 11.160  10.318  160.238 1.00 70.76  ? 65  LEU C CD2    1 
ATOM   9459  H H      . LEU C 1 65  ? 9.835   9.220   163.833 1.00 93.11  ? 65  LEU C H      1 
ATOM   9460  H HA     . LEU C 1 65  ? 12.094  8.950   162.364 1.00 97.88  ? 65  LEU C HA     1 
ATOM   9461  H HB2    . LEU C 1 65  ? 10.960  11.306  163.428 1.00 97.58  ? 65  LEU C HB2    1 
ATOM   9462  H HB3    . LEU C 1 65  ? 12.276  11.282  162.547 1.00 97.58  ? 65  LEU C HB3    1 
ATOM   9463  H HG     . LEU C 1 65  ? 9.684   10.714  161.593 1.00 90.06  ? 65  LEU C HG     1 
ATOM   9464  H HD11   . LEU C 1 65  ? 9.902   12.665  160.329 1.00 87.02  ? 65  LEU C HD11   1 
ATOM   9465  H HD12   . LEU C 1 65  ? 10.004  12.990  161.881 1.00 87.02  ? 65  LEU C HD12   1 
ATOM   9466  H HD13   . LEU C 1 65  ? 11.321  12.931  160.994 1.00 87.02  ? 65  LEU C HD13   1 
ATOM   9467  H HD21   . LEU C 1 65  ? 10.599  10.476  159.462 1.00 85.30  ? 65  LEU C HD21   1 
ATOM   9468  H HD22   . LEU C 1 65  ? 12.057  10.646  160.070 1.00 85.30  ? 65  LEU C HD22   1 
ATOM   9469  H HD23   . LEU C 1 65  ? 11.186  9.370   160.440 1.00 85.30  ? 65  LEU C HD23   1 
ATOM   9470  N N      . PHE C 1 66  ? 13.669  8.536   164.154 1.00 94.61  ? 66  PHE C N      1 
ATOM   9471  C CA     . PHE C 1 66  ? 14.686  8.394   165.187 1.00 99.10  ? 66  PHE C CA     1 
ATOM   9472  C C      . PHE C 1 66  ? 15.913  9.241   164.895 1.00 100.22 ? 66  PHE C C      1 
ATOM   9473  O O      . PHE C 1 66  ? 16.369  9.315   163.757 1.00 98.90  ? 66  PHE C O      1 
ATOM   9474  C CB     . PHE C 1 66  ? 15.128  6.937   165.342 1.00 100.11 ? 66  PHE C CB     1 
ATOM   9475  C CG     . PHE C 1 66  ? 14.095  6.049   165.968 1.00 99.99  ? 66  PHE C CG     1 
ATOM   9476  C CD1    . PHE C 1 66  ? 13.858  6.102   167.330 1.00 102.10 ? 66  PHE C CD1    1 
ATOM   9477  C CD2    . PHE C 1 66  ? 13.387  5.139   165.207 1.00 98.74  ? 66  PHE C CD2    1 
ATOM   9478  C CE1    . PHE C 1 66  ? 12.913  5.280   167.919 1.00 103.06 ? 66  PHE C CE1    1 
ATOM   9479  C CE2    . PHE C 1 66  ? 12.444  4.311   165.793 1.00 99.10  ? 66  PHE C CE2    1 
ATOM   9480  C CZ     . PHE C 1 66  ? 12.208  4.383   167.150 1.00 100.75 ? 66  PHE C CZ     1 
ATOM   9481  H H      . PHE C 1 66  ? 13.810  8.050   163.459 1.00 113.92 ? 66  PHE C H      1 
ATOM   9482  H HA     . PHE C 1 66  ? 14.316  8.687   166.035 1.00 119.31 ? 66  PHE C HA     1 
ATOM   9483  H HB2    . PHE C 1 66  ? 15.334  6.579   164.465 1.00 120.52 ? 66  PHE C HB2    1 
ATOM   9484  H HB3    . PHE C 1 66  ? 15.919  6.909   165.902 1.00 120.52 ? 66  PHE C HB3    1 
ATOM   9485  H HD1    . PHE C 1 66  ? 14.330  6.707   167.855 1.00 122.91 ? 66  PHE C HD1    1 
ATOM   9486  H HD2    . PHE C 1 66  ? 13.540  5.087   164.292 1.00 118.88 ? 66  PHE C HD2    1 
ATOM   9487  H HE1    . PHE C 1 66  ? 12.759  5.330   168.834 1.00 124.07 ? 66  PHE C HE1    1 
ATOM   9488  H HE2    . PHE C 1 66  ? 11.968  3.707   165.270 1.00 119.31 ? 66  PHE C HE2    1 
ATOM   9489  H HZ     . PHE C 1 66  ? 11.574  3.828   167.543 1.00 121.29 ? 66  PHE C HZ     1 
ATOM   9490  N N      . PRO C 1 67  ? 16.447  9.897   165.930 1.00 97.35  ? 67  PRO C N      1 
ATOM   9491  C CA     . PRO C 1 67  ? 17.761  10.536  165.830 1.00 99.14  ? 67  PRO C CA     1 
ATOM   9492  C C      . PRO C 1 67  ? 18.844  9.498   165.538 1.00 101.58 ? 67  PRO C C      1 
ATOM   9493  O O      . PRO C 1 67  ? 18.574  8.313   165.720 1.00 99.59  ? 67  PRO C O      1 
ATOM   9494  C CB     . PRO C 1 67  ? 17.952  11.159  167.217 1.00 101.82 ? 67  PRO C CB     1 
ATOM   9495  C CG     . PRO C 1 67  ? 16.576  11.380  167.726 1.00 100.66 ? 67  PRO C CG     1 
ATOM   9496  C CD     . PRO C 1 67  ? 15.763  10.245  167.190 1.00 98.33  ? 67  PRO C CD     1 
ATOM   9497  H HA     . PRO C 1 67  ? 17.765  11.227  165.149 1.00 119.36 ? 67  PRO C HA     1 
ATOM   9498  H HB2    . PRO C 1 67  ? 18.436  10.544  167.790 1.00 122.57 ? 67  PRO C HB2    1 
ATOM   9499  H HB3    . PRO C 1 67  ? 18.428  12.001  167.136 1.00 122.57 ? 67  PRO C HB3    1 
ATOM   9500  H HG2    . PRO C 1 67  ? 16.581  11.369  168.696 1.00 121.18 ? 67  PRO C HG2    1 
ATOM   9501  H HG3    . PRO C 1 67  ? 16.239  12.228  167.396 1.00 121.18 ? 67  PRO C HG3    1 
ATOM   9502  H HD2    . PRO C 1 67  ? 15.784  9.495   167.804 1.00 118.39 ? 67  PRO C HD2    1 
ATOM   9503  H HD3    . PRO C 1 67  ? 14.854  10.535  167.013 1.00 118.39 ? 67  PRO C HD3    1 
ATOM   9504  N N      . GLU C 1 68  ? 20.025  9.911   165.079 1.00 106.32 ? 68  GLU C N      1 
ATOM   9505  C CA     . GLU C 1 68  ? 21.079  8.944   164.761 1.00 109.86 ? 68  GLU C CA     1 
ATOM   9506  C C      . GLU C 1 68  ? 21.846  8.538   166.027 1.00 108.62 ? 68  GLU C C      1 
ATOM   9507  O O      . GLU C 1 68  ? 22.792  7.748   165.972 1.00 112.10 ? 68  GLU C O      1 
ATOM   9508  C CB     . GLU C 1 68  ? 22.053  9.474   163.707 1.00 112.27 ? 68  GLU C CB     1 
ATOM   9509  C CG     . GLU C 1 68  ? 22.877  8.337   163.082 1.00 113.37 ? 68  GLU C CG     1 
ATOM   9510  C CD     . GLU C 1 68  ? 23.709  8.763   161.900 1.00 114.82 ? 68  GLU C CD     1 
ATOM   9511  O OE1    . GLU C 1 68  ? 23.707  9.970   161.573 1.00 117.31 ? 68  GLU C OE1    1 
ATOM   9512  O OE2    . GLU C 1 68  ? 24.378  7.885   161.308 1.00 113.49 ? 68  GLU C OE2    1 
ATOM   9513  H H      . GLU C 1 68  ? 20.240  10.733  164.944 1.00 127.97 ? 68  GLU C H      1 
ATOM   9514  H HA     . GLU C 1 68  ? 20.665  8.144   164.400 1.00 132.23 ? 68  GLU C HA     1 
ATOM   9515  H HB2    . GLU C 1 68  ? 21.554  9.912   163.001 1.00 135.11 ? 68  GLU C HB2    1 
ATOM   9516  H HB3    . GLU C 1 68  ? 22.666  10.100  164.124 1.00 135.11 ? 68  GLU C HB3    1 
ATOM   9517  H HG2    . GLU C 1 68  ? 23.478  7.981   163.755 1.00 136.44 ? 68  GLU C HG2    1 
ATOM   9518  H HG3    . GLU C 1 68  ? 22.271  7.641   162.782 1.00 136.44 ? 68  GLU C HG3    1 
ATOM   9519  N N      . GLU C 1 69  ? 21.420  9.060   167.173 1.00 100.76 ? 69  GLU C N      1 
ATOM   9520  C CA     . GLU C 1 69  ? 22.049  8.715   168.439 1.00 98.20  ? 69  GLU C CA     1 
ATOM   9521  C C      . GLU C 1 69  ? 21.759  7.247   168.749 1.00 99.86  ? 69  GLU C C      1 
ATOM   9522  O O      . GLU C 1 69  ? 22.339  6.667   169.670 1.00 100.69 ? 69  GLU C O      1 
ATOM   9523  C CB     . GLU C 1 69  ? 21.536  9.619   169.560 1.00 98.54  ? 69  GLU C CB     1 
ATOM   9524  C CG     . GLU C 1 69  ? 22.067  11.047  169.510 1.00 100.73 ? 69  GLU C CG     1 
ATOM   9525  C CD     . GLU C 1 69  ? 21.579  11.830  168.300 1.00 97.77  ? 69  GLU C CD     1 
ATOM   9526  O OE1    . GLU C 1 69  ? 20.822  11.266  167.490 1.00 94.52  ? 69  GLU C OE1    1 
ATOM   9527  O OE2    . GLU C 1 69  ? 21.954  13.015  168.158 1.00 98.05  ? 69  GLU C OE2    1 
ATOM   9528  H H      . GLU C 1 69  ? 20.768  9.616   167.242 1.00 121.30 ? 69  GLU C H      1 
ATOM   9529  H HA     . GLU C 1 69  ? 23.009  8.830   168.366 1.00 118.24 ? 69  GLU C HA     1 
ATOM   9530  H HB2    . GLU C 1 69  ? 20.568  9.663   169.506 1.00 118.64 ? 69  GLU C HB2    1 
ATOM   9531  H HB3    . GLU C 1 69  ? 21.798  9.237   170.412 1.00 118.64 ? 69  GLU C HB3    1 
ATOM   9532  H HG2    . GLU C 1 69  ? 21.778  11.518  170.306 1.00 121.26 ? 69  GLU C HG2    1 
ATOM   9533  H HG3    . GLU C 1 69  ? 23.036  11.020  169.476 1.00 121.26 ? 69  GLU C HG3    1 
ATOM   9534  N N      . PHE C 1 70  ? 20.858  6.656   167.965 1.00 103.34 ? 70  PHE C N      1 
ATOM   9535  C CA     . PHE C 1 70  ? 20.480  5.257   168.102 1.00 109.14 ? 70  PHE C CA     1 
ATOM   9536  C C      . PHE C 1 70  ? 21.270  4.406   167.105 1.00 113.10 ? 70  PHE C C      1 
ATOM   9537  O O      . PHE C 1 70  ? 22.046  4.937   166.303 1.00 111.40 ? 70  PHE C O      1 
ATOM   9538  C CB     . PHE C 1 70  ? 18.980  5.082   167.852 1.00 106.85 ? 70  PHE C CB     1 
ATOM   9539  C CG     . PHE C 1 70  ? 18.105  5.859   168.797 1.00 107.50 ? 70  PHE C CG     1 
ATOM   9540  C CD1    . PHE C 1 70  ? 17.988  7.237   168.683 1.00 109.03 ? 70  PHE C CD1    1 
ATOM   9541  C CD2    . PHE C 1 70  ? 17.380  5.213   169.781 1.00 106.49 ? 70  PHE C CD2    1 
ATOM   9542  C CE1    . PHE C 1 70  ? 17.181  7.955   169.543 1.00 108.96 ? 70  PHE C CE1    1 
ATOM   9543  C CE2    . PHE C 1 70  ? 16.570  5.927   170.641 1.00 106.86 ? 70  PHE C CE2    1 
ATOM   9544  C CZ     . PHE C 1 70  ? 16.469  7.301   170.519 1.00 107.69 ? 70  PHE C CZ     1 
ATOM   9545  H H      . PHE C 1 70  ? 20.442  7.060   167.330 1.00 124.40 ? 70  PHE C H      1 
ATOM   9546  H HA     . PHE C 1 70  ? 20.683  4.951   169.000 1.00 131.36 ? 70  PHE C HA     1 
ATOM   9547  H HB2    . PHE C 1 70  ? 18.778  5.378   166.951 1.00 128.61 ? 70  PHE C HB2    1 
ATOM   9548  H HB3    . PHE C 1 70  ? 18.756  4.142   167.946 1.00 128.61 ? 70  PHE C HB3    1 
ATOM   9549  H HD1    . PHE C 1 70  ? 18.468  7.684   168.023 1.00 131.22 ? 70  PHE C HD1    1 
ATOM   9550  H HD2    . PHE C 1 70  ? 17.444  4.289   169.868 1.00 128.17 ? 70  PHE C HD2    1 
ATOM   9551  H HE1    . PHE C 1 70  ? 17.115  8.879   169.458 1.00 131.15 ? 70  PHE C HE1    1 
ATOM   9552  H HE2    . PHE C 1 70  ? 16.090  5.483   171.303 1.00 128.62 ? 70  PHE C HE2    1 
ATOM   9553  H HZ     . PHE C 1 70  ? 15.925  7.782   171.100 1.00 129.62 ? 70  PHE C HZ     1 
ATOM   9554  N N      . SER C 1 71  ? 21.051  3.091   167.155 1.00 117.60 ? 71  SER C N      1 
ATOM   9555  C CA     . SER C 1 71  ? 21.700  2.141   166.252 1.00 116.93 ? 71  SER C CA     1 
ATOM   9556  C C      . SER C 1 71  ? 20.630  1.240   165.643 1.00 115.74 ? 71  SER C C      1 
ATOM   9557  O O      . SER C 1 71  ? 19.451  1.375   165.975 1.00 112.15 ? 71  SER C O      1 
ATOM   9558  C CB     . SER C 1 71  ? 22.748  1.309   166.992 1.00 118.62 ? 71  SER C CB     1 
ATOM   9559  O OG     . SER C 1 71  ? 22.195  0.705   168.148 1.00 119.52 ? 71  SER C OG     1 
ATOM   9560  H H      . SER C 1 71  ? 20.519  2.718   167.718 1.00 141.51 ? 71  SER C H      1 
ATOM   9561  H HA     . SER C 1 71  ? 22.140  2.625   165.535 1.00 140.70 ? 71  SER C HA     1 
ATOM   9562  H HB2    . SER C 1 71  ? 23.075  0.614   166.399 1.00 142.74 ? 71  SER C HB2    1 
ATOM   9563  H HB3    . SER C 1 71  ? 23.480  1.888   167.258 1.00 142.74 ? 71  SER C HB3    1 
ATOM   9564  H HG     . SER C 1 71  ? 22.781  0.252   168.544 1.00 143.81 ? 71  SER C HG     1 
ATOM   9565  N N      . LYS C 1 72  ? 21.032  0.325   164.762 1.00 117.29 ? 72  LYS C N      1 
ATOM   9566  C CA     . LYS C 1 72  ? 20.073  -0.564  164.099 1.00 117.71 ? 72  LYS C CA     1 
ATOM   9567  C C      . LYS C 1 72  ? 19.262  -1.415  165.075 1.00 119.04 ? 72  LYS C C      1 
ATOM   9568  O O      . LYS C 1 72  ? 18.098  -1.722  164.809 1.00 117.56 ? 72  LYS C O      1 
ATOM   9569  C CB     . LYS C 1 72  ? 20.783  -1.496  163.107 1.00 119.21 ? 72  LYS C CB     1 
ATOM   9570  C CG     . LYS C 1 72  ? 19.862  -2.582  162.527 1.00 119.63 ? 72  LYS C CG     1 
ATOM   9571  C CD     . LYS C 1 72  ? 20.565  -3.482  161.524 1.00 119.76 ? 72  LYS C CD     1 
ATOM   9572  C CE     . LYS C 1 72  ? 19.721  -4.718  161.212 1.00 119.11 ? 72  LYS C CE     1 
ATOM   9573  N NZ     . LYS C 1 72  ? 18.357  -4.383  160.708 1.00 115.86 ? 72  LYS C NZ     1 
ATOM   9574  H H      . LYS C 1 72  ? 21.850  0.198   164.530 1.00 141.14 ? 72  LYS C H      1 
ATOM   9575  H HA     . LYS C 1 72  ? 19.447  -0.021  163.595 1.00 141.64 ? 72  LYS C HA     1 
ATOM   9576  H HB2    . LYS C 1 72  ? 21.123  -0.968  162.368 1.00 143.44 ? 72  LYS C HB2    1 
ATOM   9577  H HB3    . LYS C 1 72  ? 21.516  -1.939  163.561 1.00 143.44 ? 72  LYS C HB3    1 
ATOM   9578  H HG2    . LYS C 1 72  ? 19.536  -3.139  163.252 1.00 143.95 ? 72  LYS C HG2    1 
ATOM   9579  H HG3    . LYS C 1 72  ? 19.117  -2.155  162.076 1.00 143.95 ? 72  LYS C HG3    1 
ATOM   9580  H HD2    . LYS C 1 72  ? 20.708  -2.993  160.699 1.00 144.10 ? 72  LYS C HD2    1 
ATOM   9581  H HD3    . LYS C 1 72  ? 21.412  -3.775  161.894 1.00 144.10 ? 72  LYS C HD3    1 
ATOM   9582  H HE2    . LYS C 1 72  ? 20.171  -5.242  160.531 1.00 143.32 ? 72  LYS C HE2    1 
ATOM   9583  H HE3    . LYS C 1 72  ? 19.620  -5.243  162.021 1.00 143.32 ? 72  LYS C HE3    1 
ATOM   9584  H HZ1    . LYS C 1 72  ? 17.904  -5.130  160.540 1.00 139.42 ? 72  LYS C HZ1    1 
ATOM   9585  H HZ2    . LYS C 1 72  ? 17.916  -3.908  161.317 1.00 139.42 ? 72  LYS C HZ2    1 
ATOM   9586  H HZ3    . LYS C 1 72  ? 18.419  -3.907  159.958 1.00 139.42 ? 72  LYS C HZ3    1 
ATOM   9587  N N      . GLU C 1 73  ? 19.868  -1.783  166.201 1.00 122.62 ? 73  GLU C N      1 
ATOM   9588  C CA     . GLU C 1 73  ? 19.216  -2.668  167.166 1.00 124.37 ? 73  GLU C CA     1 
ATOM   9589  C C      . GLU C 1 73  ? 18.076  -1.975  167.902 1.00 120.60 ? 73  GLU C C      1 
ATOM   9590  O O      . GLU C 1 73  ? 17.026  -2.571  168.153 1.00 120.89 ? 73  GLU C O      1 
ATOM   9591  C CB     . GLU C 1 73  ? 20.228  -3.191  168.195 1.00 130.83 ? 73  GLU C CB     1 
ATOM   9592  C CG     . GLU C 1 73  ? 21.444  -3.908  167.613 1.00 133.22 ? 73  GLU C CG     1 
ATOM   9593  C CD     . GLU C 1 73  ? 22.587  -4.016  168.610 1.00 136.69 ? 73  GLU C CD     1 
ATOM   9594  O OE1    . GLU C 1 73  ? 22.428  -3.550  169.759 1.00 136.91 ? 73  GLU C OE1    1 
ATOM   9595  O OE2    . GLU C 1 73  ? 23.645  -4.572  168.246 1.00 138.79 ? 73  GLU C OE2    1 
ATOM   9596  H H      . GLU C 1 73  ? 20.658  -1.534  166.431 1.00 147.53 ? 73  GLU C H      1 
ATOM   9597  H HA     . GLU C 1 73  ? 18.848  -3.431  166.694 1.00 149.63 ? 73  GLU C HA     1 
ATOM   9598  H HB2    . GLU C 1 73  ? 20.555  -2.439  168.714 1.00 157.39 ? 73  GLU C HB2    1 
ATOM   9599  H HB3    . GLU C 1 73  ? 19.775  -3.816  168.782 1.00 157.39 ? 73  GLU C HB3    1 
ATOM   9600  H HG2    . GLU C 1 73  ? 21.187  -4.806  167.351 1.00 160.26 ? 73  GLU C HG2    1 
ATOM   9601  H HG3    . GLU C 1 73  ? 21.764  -3.415  166.841 1.00 160.26 ? 73  GLU C HG3    1 
ATOM   9602  N N      . GLU C 1 74  ? 18.298  -0.711  168.246 1.00 117.20 ? 74  GLU C N      1 
ATOM   9603  C CA     . GLU C 1 74  ? 17.346  0.058   169.038 1.00 111.96 ? 74  GLU C CA     1 
ATOM   9604  C C      . GLU C 1 74  ? 16.212  0.589   168.149 1.00 103.51 ? 74  GLU C C      1 
ATOM   9605  O O      . GLU C 1 74  ? 15.148  0.963   168.643 1.00 101.57 ? 74  GLU C O      1 
ATOM   9606  C CB     . GLU C 1 74  ? 18.077  1.186   169.778 1.00 111.87 ? 74  GLU C CB     1 
ATOM   9607  C CG     . GLU C 1 74  ? 19.086  0.648   170.822 1.00 115.23 ? 74  GLU C CG     1 
ATOM   9608  C CD     . GLU C 1 74  ? 18.435  -0.048  172.012 1.00 116.72 ? 74  GLU C CD     1 
ATOM   9609  O OE1    . GLU C 1 74  ? 18.873  -1.169  172.358 1.00 116.07 ? 74  GLU C OE1    1 
ATOM   9610  O OE2    . GLU C 1 74  ? 17.488  0.513   172.600 1.00 117.69 ? 74  GLU C OE2    1 
ATOM   9611  H H      . GLU C 1 74  ? 19.003  -0.270  168.028 1.00 141.04 ? 74  GLU C H      1 
ATOM   9612  H HA     . GLU C 1 74  ? 16.951  -0.526  169.704 1.00 134.74 ? 74  GLU C HA     1 
ATOM   9613  H HB2    . GLU C 1 74  ? 18.566  1.723   169.134 1.00 134.63 ? 74  GLU C HB2    1 
ATOM   9614  H HB3    . GLU C 1 74  ? 17.426  1.735   170.242 1.00 134.63 ? 74  GLU C HB3    1 
ATOM   9615  H HG2    . GLU C 1 74  ? 19.671  0.007   170.388 1.00 138.67 ? 74  GLU C HG2    1 
ATOM   9616  H HG3    . GLU C 1 74  ? 19.608  1.390   171.163 1.00 138.67 ? 74  GLU C HG3    1 
ATOM   9617  N N      . LEU C 1 75  ? 16.442  0.590   166.838 1.00 99.73  ? 75  LEU C N      1 
ATOM   9618  C CA     . LEU C 1 75  ? 15.425  0.999   165.871 1.00 96.39  ? 75  LEU C CA     1 
ATOM   9619  C C      . LEU C 1 75  ? 14.278  -0.005  165.858 1.00 100.46 ? 75  LEU C C      1 
ATOM   9620  O O      . LEU C 1 75  ? 13.111  0.386   165.878 1.00 98.44  ? 75  LEU C O      1 
ATOM   9621  C CB     . LEU C 1 75  ? 16.020  1.118   164.467 1.00 91.36  ? 75  LEU C CB     1 
ATOM   9622  C CG     . LEU C 1 75  ? 16.130  2.549   163.940 1.00 88.97  ? 75  LEU C CG     1 
ATOM   9623  C CD1    . LEU C 1 75  ? 17.107  3.353   164.790 1.00 93.14  ? 75  LEU C CD1    1 
ATOM   9624  C CD2    . LEU C 1 75  ? 16.534  2.582   162.473 1.00 85.06  ? 75  LEU C CD2    1 
ATOM   9625  H H      . LEU C 1 75  ? 17.188  0.356   166.479 1.00 120.07 ? 75  LEU C H      1 
ATOM   9626  H HA     . LEU C 1 75  ? 15.070  1.865   166.126 1.00 116.06 ? 75  LEU C HA     1 
ATOM   9627  H HB2    . LEU C 1 75  ? 16.913  0.739   164.475 1.00 110.02 ? 75  LEU C HB2    1 
ATOM   9628  H HB3    . LEU C 1 75  ? 15.460  0.621   163.850 1.00 110.02 ? 75  LEU C HB3    1 
ATOM   9629  H HG     . LEU C 1 75  ? 15.260  2.973   164.014 1.00 107.16 ? 75  LEU C HG     1 
ATOM   9630  H HD11   . LEU C 1 75  ? 17.161  4.256   164.440 1.00 112.16 ? 75  LEU C HD11   1 
ATOM   9631  H HD12   . LEU C 1 75  ? 16.786  3.372   165.706 1.00 112.16 ? 75  LEU C HD12   1 
ATOM   9632  H HD13   . LEU C 1 75  ? 17.979  2.930   164.753 1.00 112.16 ? 75  LEU C HD13   1 
ATOM   9633  H HD21   . LEU C 1 75  ? 16.592  3.506   162.183 1.00 102.46 ? 75  LEU C HD21   1 
ATOM   9634  H HD22   . LEU C 1 75  ? 17.397  2.150   162.374 1.00 102.46 ? 75  LEU C HD22   1 
ATOM   9635  H HD23   . LEU C 1 75  ? 15.866  2.112   161.951 1.00 102.46 ? 75  LEU C HD23   1 
ATOM   9636  N N      . ARG C 1 76  ? 14.608  -1.295  165.801 1.00 106.76 ? 76  ARG C N      1 
ATOM   9637  C CA     . ARG C 1 76  ? 13.590  -2.344  165.814 1.00 108.66 ? 76  ARG C CA     1 
ATOM   9638  C C      . ARG C 1 76  ? 12.763  -2.319  167.095 1.00 111.42 ? 76  ARG C C      1 
ATOM   9639  O O      . ARG C 1 76  ? 11.543  -2.468  167.043 1.00 109.31 ? 76  ARG C O      1 
ATOM   9640  C CB     . ARG C 1 76  ? 14.198  -3.739  165.662 1.00 112.30 ? 76  ARG C CB     1 
ATOM   9641  C CG     . ARG C 1 76  ? 14.446  -4.182  164.233 1.00 111.50 ? 76  ARG C CG     1 
ATOM   9642  C CD     . ARG C 1 76  ? 15.029  -5.596  164.199 1.00 115.45 ? 76  ARG C CD     1 
ATOM   9643  N NE     . ARG C 1 76  ? 14.119  -6.581  164.787 1.00 118.64 ? 76  ARG C NE     1 
ATOM   9644  C CZ     . ARG C 1 76  ? 14.463  -7.824  165.118 1.00 121.25 ? 76  ARG C CZ     1 
ATOM   9645  N NH1    . ARG C 1 76  ? 15.703  -8.250  164.933 1.00 121.84 ? 76  ARG C NH1    1 
ATOM   9646  N NH2    . ARG C 1 76  ? 13.566  -8.645  165.645 1.00 122.88 ? 76  ARG C NH2    1 
ATOM   9647  H H      . ARG C 1 76  ? 15.415  -1.588  165.755 1.00 128.50 ? 76  ARG C H      1 
ATOM   9648  H HA     . ARG C 1 76  ? 12.986  -2.201  165.069 1.00 130.78 ? 76  ARG C HA     1 
ATOM   9649  H HB2    . ARG C 1 76  ? 15.050  -3.755  166.125 1.00 135.15 ? 76  ARG C HB2    1 
ATOM   9650  H HB3    . ARG C 1 76  ? 13.597  -4.383  166.067 1.00 135.15 ? 76  ARG C HB3    1 
ATOM   9651  H HG2    . ARG C 1 76  ? 13.607  -4.184  163.746 1.00 134.19 ? 76  ARG C HG2    1 
ATOM   9652  H HG3    . ARG C 1 76  ? 15.080  -3.579  163.814 1.00 134.19 ? 76  ARG C HG3    1 
ATOM   9653  H HD2    . ARG C 1 76  ? 15.195  -5.850  163.277 1.00 138.93 ? 76  ARG C HD2    1 
ATOM   9654  H HD3    . ARG C 1 76  ? 15.858  -5.611  164.703 1.00 138.93 ? 76  ARG C HD3    1 
ATOM   9655  H HE     . ARG C 1 76  ? 13.306  -6.340  164.928 1.00 142.76 ? 76  ARG C HE     1 
ATOM   9656  H HH11   . ARG C 1 76  ? 16.292  -7.724  164.592 1.00 146.60 ? 76  ARG C HH11   1 
ATOM   9657  H HH12   . ARG C 1 76  ? 15.919  -9.053  165.151 1.00 146.60 ? 76  ARG C HH12   1 
ATOM   9658  H HH21   . ARG C 1 76  ? 12.759  -8.377  165.771 1.00 147.85 ? 76  ARG C HH21   1 
ATOM   9659  H HH22   . ARG C 1 76  ? 13.791  -9.447  165.861 1.00 147.85 ? 76  ARG C HH22   1 
ATOM   9660  N N      . GLU C 1 77  ? 13.419  -2.131  168.241 1.00 114.54 ? 77  GLU C N      1 
ATOM   9661  C CA     . GLU C 1 77  ? 12.724  -2.235  169.522 1.00 116.88 ? 77  GLU C CA     1 
ATOM   9662  C C      . GLU C 1 77  ? 11.685  -1.129  169.647 1.00 110.79 ? 77  GLU C C      1 
ATOM   9663  O O      . GLU C 1 77  ? 10.501  -1.414  169.825 1.00 111.47 ? 77  GLU C O      1 
ATOM   9664  C CB     . GLU C 1 77  ? 13.718  -2.172  170.693 1.00 123.11 ? 77  GLU C CB     1 
ATOM   9665  C CG     . GLU C 1 77  ? 13.094  -2.414  172.079 1.00 126.94 ? 77  GLU C CG     1 
ATOM   9666  C CD     . GLU C 1 77  ? 14.080  -2.218  173.230 1.00 130.39 ? 77  GLU C CD     1 
ATOM   9667  O OE1    . GLU C 1 77  ? 15.289  -2.035  172.971 1.00 130.87 ? 77  GLU C OE1    1 
ATOM   9668  O OE2    . GLU C 1 77  ? 13.641  -2.247  174.399 1.00 133.01 ? 77  GLU C OE2    1 
ATOM   9669  H H      . GLU C 1 77  ? 14.256  -1.945  168.303 1.00 137.83 ? 77  GLU C H      1 
ATOM   9670  H HA     . GLU C 1 77  ? 12.263  -3.088  169.565 1.00 140.65 ? 77  GLU C HA     1 
ATOM   9671  H HB2    . GLU C 1 77  ? 14.401  -2.847  170.557 1.00 148.12 ? 77  GLU C HB2    1 
ATOM   9672  H HB3    . GLU C 1 77  ? 14.127  -1.292  170.705 1.00 148.12 ? 77  GLU C HB3    1 
ATOM   9673  H HG2    . GLU C 1 77  ? 12.360  -1.792  172.206 1.00 152.72 ? 77  GLU C HG2    1 
ATOM   9674  H HG3    . GLU C 1 77  ? 12.764  -3.325  172.120 1.00 152.72 ? 77  GLU C HG3    1 
ATOM   9675  N N      . ARG C 1 78  ? 12.101  0.125   169.534 1.00 104.48 ? 78  ARG C N      1 
ATOM   9676  C CA     . ARG C 1 78  ? 11.138  1.206   169.667 1.00 100.50 ? 78  ARG C CA     1 
ATOM   9677  C C      . ARG C 1 78  ? 10.311  1.418   168.404 1.00 95.70  ? 78  ARG C C      1 
ATOM   9678  O O      . ARG C 1 78  ? 9.315   2.125   168.440 1.00 93.56  ? 78  ARG C O      1 
ATOM   9679  C CB     . ARG C 1 78  ? 11.831  2.513   170.049 1.00 101.29 ? 78  ARG C CB     1 
ATOM   9680  C CG     . ARG C 1 78  ? 12.482  2.505   171.423 1.00 105.92 ? 78  ARG C CG     1 
ATOM   9681  C CD     . ARG C 1 78  ? 11.416  2.324   172.503 1.00 108.58 ? 78  ARG C CD     1 
ATOM   9682  N NE     . ARG C 1 78  ? 11.943  2.480   173.854 1.00 113.80 ? 78  ARG C NE     1 
ATOM   9683  C CZ     . ARG C 1 78  ? 12.105  3.660   174.451 1.00 116.55 ? 78  ARG C CZ     1 
ATOM   9684  N NH1    . ARG C 1 78  ? 11.788  4.781   173.806 1.00 113.09 ? 78  ARG C NH1    1 
ATOM   9685  N NH2    . ARG C 1 78  ? 12.582  3.732   175.692 1.00 121.04 ? 78  ARG C NH2    1 
ATOM   9686  H H      . ARG C 1 78  ? 12.911  0.372   169.385 1.00 125.77 ? 78  ARG C H      1 
ATOM   9687  H HA     . ARG C 1 78  ? 10.523  0.982   170.383 1.00 120.99 ? 78  ARG C HA     1 
ATOM   9688  H HB2    . ARG C 1 78  ? 12.524  2.699   169.397 1.00 121.93 ? 78  ARG C HB2    1 
ATOM   9689  H HB3    . ARG C 1 78  ? 11.174  3.227   170.040 1.00 121.93 ? 78  ARG C HB3    1 
ATOM   9690  H HG2    . ARG C 1 78  ? 13.109  1.767   171.482 1.00 127.50 ? 78  ARG C HG2    1 
ATOM   9691  H HG3    . ARG C 1 78  ? 12.935  3.349   171.574 1.00 127.50 ? 78  ARG C HG3    1 
ATOM   9692  H HD2    . ARG C 1 78  ? 10.721  2.989   172.375 1.00 130.68 ? 78  ARG C HD2    1 
ATOM   9693  H HD3    . ARG C 1 78  ? 11.040  1.433   172.430 1.00 130.68 ? 78  ARG C HD3    1 
ATOM   9694  H HE     . ARG C 1 78  ? 12.050  1.771   174.329 1.00 136.95 ? 78  ARG C HE     1 
ATOM   9695  H HH11   . ARG C 1 78  ? 11.476  4.743   173.005 1.00 136.10 ? 78  ARG C HH11   1 
ATOM   9696  H HH12   . ARG C 1 78  ? 11.893  5.543   174.191 1.00 136.10 ? 78  ARG C HH12   1 
ATOM   9697  H HH21   . ARG C 1 78  ? 12.791  3.013   176.115 1.00 145.64 ? 78  ARG C HH21   1 
ATOM   9698  H HH22   . ARG C 1 78  ? 12.688  4.498   176.069 1.00 145.64 ? 78  ARG C HH22   1 
ATOM   9699  N N      . GLY C 1 79  ? 10.686  0.787   167.298 1.00 93.51  ? 79  GLY C N      1 
ATOM   9700  C CA     . GLY C 1 79  ? 9.873   0.896   166.102 1.00 89.91  ? 79  GLY C CA     1 
ATOM   9701  C C      . GLY C 1 79  ? 8.801   -0.170  166.003 1.00 89.75  ? 79  GLY C C      1 
ATOM   9702  O O      . GLY C 1 79  ? 7.739   0.060   165.417 1.00 87.42  ? 79  GLY C O      1 
ATOM   9703  H H      . GLY C 1 79  ? 11.390  0.300   167.217 1.00 112.60 ? 79  GLY C H      1 
ATOM   9704  H HA2    . GLY C 1 79  ? 9.441   1.764   166.087 1.00 108.29 ? 79  GLY C HA2    1 
ATOM   9705  H HA3    . GLY C 1 79  ? 10.444  0.827   165.320 1.00 108.29 ? 79  GLY C HA3    1 
ATOM   9706  N N      . LEU C 1 80  ? 9.081   -1.342  166.562 1.00 93.74  ? 80  LEU C N      1 
ATOM   9707  C CA     . LEU C 1 80  ? 8.094   -2.413  166.646 1.00 95.01  ? 80  LEU C CA     1 
ATOM   9708  C C      . LEU C 1 80  ? 7.194   -2.239  167.861 1.00 94.87  ? 80  LEU C C      1 
ATOM   9709  O O      . LEU C 1 80  ? 5.992   -2.505  167.801 1.00 95.37  ? 80  LEU C O      1 
ATOM   9710  C CB     . LEU C 1 80  ? 8.772   -3.785  166.666 1.00 100.37 ? 80  LEU C CB     1 
ATOM   9711  C CG     . LEU C 1 80  ? 9.471   -4.198  165.364 1.00 101.11 ? 80  LEU C CG     1 
ATOM   9712  C CD1    . LEU C 1 80  ? 10.155  -5.544  165.513 1.00 101.15 ? 80  LEU C CD1    1 
ATOM   9713  C CD2    . LEU C 1 80  ? 8.484   -4.253  164.204 1.00 101.69 ? 80  LEU C CD2    1 
ATOM   9714  H H      . LEU C 1 80  ? 9.844   -1.545  166.904 1.00 112.88 ? 80  LEU C H      1 
ATOM   9715  H HA     . LEU C 1 80  ? 7.530   -2.376  165.857 1.00 114.40 ? 80  LEU C HA     1 
ATOM   9716  H HB2    . LEU C 1 80  ? 9.441   -3.786  167.368 1.00 120.83 ? 80  LEU C HB2    1 
ATOM   9717  H HB3    . LEU C 1 80  ? 8.099   -4.457  166.860 1.00 120.83 ? 80  LEU C HB3    1 
ATOM   9718  H HG     . LEU C 1 80  ? 10.150  -3.539  165.148 1.00 121.73 ? 80  LEU C HG     1 
ATOM   9719  H HD11   . LEU C 1 80  ? 10.586  -5.774  164.675 1.00 121.77 ? 80  LEU C HD11   1 
ATOM   9720  H HD12   . LEU C 1 80  ? 10.817  -5.484  166.220 1.00 121.77 ? 80  LEU C HD12   1 
ATOM   9721  H HD13   . LEU C 1 80  ? 9.489   -6.212  165.738 1.00 121.77 ? 80  LEU C HD13   1 
ATOM   9722  H HD21   . LEU C 1 80  ? 8.958   -4.516  163.399 1.00 122.42 ? 80  LEU C HD21   1 
ATOM   9723  H HD22   . LEU C 1 80  ? 7.793   -4.903  164.408 1.00 122.42 ? 80  LEU C HD22   1 
ATOM   9724  H HD23   . LEU C 1 80  ? 8.089   -3.376  164.084 1.00 122.42 ? 80  LEU C HD23   1 
ATOM   9725  N N      . GLU C 1 81  ? 7.785   -1.834  168.980 1.00 93.46  ? 81  GLU C N      1 
ATOM   9726  C CA     . GLU C 1 81  ? 7.021   -1.712  170.208 1.00 94.65  ? 81  GLU C CA     1 
ATOM   9727  C C      . GLU C 1 81  ? 6.052   -0.538  170.139 1.00 92.85  ? 81  GLU C C      1 
ATOM   9728  O O      . GLU C 1 81  ? 4.982   -0.577  170.746 1.00 94.50  ? 81  GLU C O      1 
ATOM   9729  C CB     . GLU C 1 81  ? 7.954   -1.547  171.404 1.00 99.43  ? 81  GLU C CB     1 
ATOM   9730  C CG     . GLU C 1 81  ? 7.278   -1.823  172.725 1.00 104.22 ? 81  GLU C CG     1 
ATOM   9731  C CD     . GLU C 1 81  ? 6.714   -3.226  172.779 1.00 106.19 ? 81  GLU C CD     1 
ATOM   9732  O OE1    . GLU C 1 81  ? 7.365   -4.145  172.234 1.00 105.59 ? 81  GLU C OE1    1 
ATOM   9733  O OE2    . GLU C 1 81  ? 5.610   -3.403  173.337 1.00 107.81 ? 81  GLU C OE2    1 
ATOM   9734  H H      . GLU C 1 81  ? 8.616   -1.626  169.052 1.00 112.54 ? 81  GLU C H      1 
ATOM   9735  H HA     . GLU C 1 81  ? 6.504   -2.521  170.340 1.00 113.97 ? 81  GLU C HA     1 
ATOM   9736  H HB2    . GLU C 1 81  ? 8.695   -2.166  171.312 1.00 119.71 ? 81  GLU C HB2    1 
ATOM   9737  H HB3    . GLU C 1 81  ? 8.284   -0.635  171.422 1.00 119.71 ? 81  GLU C HB3    1 
ATOM   9738  H HG2    . GLU C 1 81  ? 7.925   -1.728  173.441 1.00 125.46 ? 81  GLU C HG2    1 
ATOM   9739  H HG3    . GLU C 1 81  ? 6.547   -1.197  172.847 1.00 125.46 ? 81  GLU C HG3    1 
ATOM   9740  N N      . ILE C 1 82  ? 6.417   0.497   169.389 1.00 90.74  ? 82  ILE C N      1 
ATOM   9741  C CA     . ILE C 1 82  ? 5.518   1.630   169.193 1.00 91.85  ? 82  ILE C CA     1 
ATOM   9742  C C      . ILE C 1 82  ? 4.422   1.261   168.192 1.00 93.01  ? 82  ILE C C      1 
ATOM   9743  O O      . ILE C 1 82  ? 3.261   1.629   168.370 1.00 91.97  ? 82  ILE C O      1 
ATOM   9744  C CB     . ILE C 1 82  ? 6.288   2.893   168.721 1.00 86.56  ? 82  ILE C CB     1 
ATOM   9745  C CG1    . ILE C 1 82  ? 7.135   3.440   169.877 1.00 87.40  ? 82  ILE C CG1    1 
ATOM   9746  C CG2    . ILE C 1 82  ? 5.321   3.982   168.237 1.00 83.95  ? 82  ILE C CG2    1 
ATOM   9747  C CD1    . ILE C 1 82  ? 8.053   4.606   169.511 1.00 85.37  ? 82  ILE C CD1    1 
ATOM   9748  H H      . ILE C 1 82  ? 7.173   0.569   168.985 1.00 109.27 ? 82  ILE C H      1 
ATOM   9749  H HA     . ILE C 1 82  ? 5.091   1.841   170.038 1.00 110.61 ? 82  ILE C HA     1 
ATOM   9750  H HB     . ILE C 1 82  ? 6.876   2.647   167.989 1.00 104.26 ? 82  ILE C HB     1 
ATOM   9751  H HG12   . ILE C 1 82  ? 6.539   3.747   170.578 1.00 105.27 ? 82  ILE C HG12   1 
ATOM   9752  H HG13   . ILE C 1 82  ? 7.694   2.724   170.216 1.00 105.27 ? 82  ILE C HG13   1 
ATOM   9753  H HG21   . ILE C 1 82  ? 5.833   4.754   167.951 1.00 101.13 ? 82  ILE C HG21   1 
ATOM   9754  H HG22   . ILE C 1 82  ? 4.801   3.636   167.496 1.00 101.13 ? 82  ILE C HG22   1 
ATOM   9755  H HG23   . ILE C 1 82  ? 4.732   4.228   168.968 1.00 101.13 ? 82  ILE C HG23   1 
ATOM   9756  H HD11   . ILE C 1 82  ? 8.544   4.881   170.301 1.00 102.84 ? 82  ILE C HD11   1 
ATOM   9757  H HD12   . ILE C 1 82  ? 8.670   4.317   168.822 1.00 102.84 ? 82  ILE C HD12   1 
ATOM   9758  H HD13   . ILE C 1 82  ? 7.512   5.342   169.184 1.00 102.84 ? 82  ILE C HD13   1 
ATOM   9759  N N      . GLY C 1 83  ? 4.793   0.528   167.146 1.00 95.08  ? 83  GLY C N      1 
ATOM   9760  C CA     . GLY C 1 83  ? 3.824   0.056   166.172 1.00 96.85  ? 83  GLY C CA     1 
ATOM   9761  C C      . GLY C 1 83  ? 2.831   -0.875  166.843 1.00 101.76 ? 83  GLY C C      1 
ATOM   9762  O O      . GLY C 1 83  ? 1.624   -0.791  166.612 1.00 102.43 ? 83  GLY C O      1 
ATOM   9763  H H      . GLY C 1 83  ? 5.603   0.292   166.979 1.00 114.48 ? 83  GLY C H      1 
ATOM   9764  H HA2    . GLY C 1 83  ? 3.344   0.808   165.791 1.00 116.61 ? 83  GLY C HA2    1 
ATOM   9765  H HA3    . GLY C 1 83  ? 4.275   -0.423  165.461 1.00 116.61 ? 83  GLY C HA3    1 
ATOM   9766  N N      . LYS C 1 84  ? 3.351   -1.779  167.668 1.00 109.77 ? 84  LYS C N      1 
ATOM   9767  C CA     . LYS C 1 84  ? 2.525   -2.711  168.422 1.00 112.29 ? 84  LYS C CA     1 
ATOM   9768  C C      . LYS C 1 84  ? 1.568   -1.942  169.319 1.00 112.17 ? 84  LYS C C      1 
ATOM   9769  O O      . LYS C 1 84  ? 0.426   -2.347  169.524 1.00 114.23 ? 84  LYS C O      1 
ATOM   9770  C CB     . LYS C 1 84  ? 3.396   -3.647  169.253 1.00 118.08 ? 84  LYS C CB     1 
ATOM   9771  C CG     . LYS C 1 84  ? 2.614   -4.715  169.986 1.00 122.29 ? 84  LYS C CG     1 
ATOM   9772  C CD     . LYS C 1 84  ? 3.544   -5.666  170.708 1.00 127.10 ? 84  LYS C CD     1 
ATOM   9773  C CE     . LYS C 1 84  ? 2.807   -6.898  171.190 1.00 128.15 ? 84  LYS C CE     1 
ATOM   9774  N NZ     . LYS C 1 84  ? 3.733   -7.863  171.834 1.00 130.99 ? 84  LYS C NZ     1 
ATOM   9775  H H      . LYS C 1 84  ? 4.194   -1.872  167.809 1.00 132.11 ? 84  LYS C H      1 
ATOM   9776  H HA     . LYS C 1 84  ? 2.002   -3.248  167.807 1.00 135.13 ? 84  LYS C HA     1 
ATOM   9777  H HB2    . LYS C 1 84  ? 4.026   -4.092  168.665 1.00 142.08 ? 84  LYS C HB2    1 
ATOM   9778  H HB3    . LYS C 1 84  ? 3.875   -3.124  169.914 1.00 142.08 ? 84  LYS C HB3    1 
ATOM   9779  H HG2    . LYS C 1 84  ? 2.035   -4.297  170.642 1.00 147.13 ? 84  LYS C HG2    1 
ATOM   9780  H HG3    . LYS C 1 84  ? 2.090   -5.225  169.348 1.00 147.13 ? 84  LYS C HG3    1 
ATOM   9781  H HD2    . LYS C 1 84  ? 4.246   -5.950  170.102 1.00 152.92 ? 84  LYS C HD2    1 
ATOM   9782  H HD3    . LYS C 1 84  ? 3.926   -5.218  171.479 1.00 152.92 ? 84  LYS C HD3    1 
ATOM   9783  H HE2    . LYS C 1 84  ? 2.139   -6.636  171.842 1.00 154.18 ? 84  LYS C HE2    1 
ATOM   9784  H HE3    . LYS C 1 84  ? 2.387   -7.336  170.434 1.00 154.18 ? 84  LYS C HE3    1 
ATOM   9785  H HZ1    . LYS C 1 84  ? 3.281   -8.579  172.110 1.00 157.58 ? 84  LYS C HZ1    1 
ATOM   9786  H HZ2    . LYS C 1 84  ? 4.356   -8.121  171.253 1.00 157.58 ? 84  LYS C HZ2    1 
ATOM   9787  H HZ3    . LYS C 1 84  ? 4.130   -7.484  172.534 1.00 157.58 ? 84  LYS C HZ3    1 
ATOM   9788  N N      . ALA C 1 85  ? 2.062   -0.833  169.860 1.00 106.81 ? 85  ALA C N      1 
ATOM   9789  C CA     . ALA C 1 85  ? 1.337   -0.046  170.852 1.00 108.31 ? 85  ALA C CA     1 
ATOM   9790  C C      . ALA C 1 85  ? 0.187   0.786   170.275 1.00 105.74 ? 85  ALA C C      1 
ATOM   9791  O O      . ALA C 1 85  ? -0.613  1.347   171.020 1.00 106.72 ? 85  ALA C O      1 
ATOM   9792  C CB     . ALA C 1 85  ? 2.310   0.867   171.576 1.00 110.11 ? 85  ALA C CB     1 
ATOM   9793  H H      . ALA C 1 85  ? 2.834   -0.508  169.663 1.00 128.57 ? 85  ALA C H      1 
ATOM   9794  H HA     . ALA C 1 85  ? 0.959   -0.652  171.509 1.00 130.36 ? 85  ALA C HA     1 
ATOM   9795  H HB1    . ALA C 1 85  ? 1.823   1.388   172.234 1.00 132.52 ? 85  ALA C HB1    1 
ATOM   9796  H HB2    . ALA C 1 85  ? 2.984   0.325   172.015 1.00 132.52 ? 85  ALA C HB2    1 
ATOM   9797  H HB3    . ALA C 1 85  ? 2.729   1.457   170.931 1.00 132.52 ? 85  ALA C HB3    1 
ATOM   9798  N N      . VAL C 1 86  ? 0.110   0.876   168.956 1.00 100.81 ? 86  VAL C N      1 
ATOM   9799  C CA     . VAL C 1 86  ? -0.917  1.680   168.307 1.00 97.61  ? 86  VAL C CA     1 
ATOM   9800  C C      . VAL C 1 86  ? -1.929  0.780   167.597 1.00 96.46  ? 86  VAL C C      1 
ATOM   9801  O O      . VAL C 1 86  ? -3.121  0.811   167.901 1.00 100.91 ? 86  VAL C O      1 
ATOM   9802  C CB     . VAL C 1 86  ? -0.296  2.680   167.319 1.00 92.65  ? 86  VAL C CB     1 
ATOM   9803  C CG1    . VAL C 1 86  ? -1.376  3.484   166.618 1.00 91.73  ? 86  VAL C CG1    1 
ATOM   9804  C CG2    . VAL C 1 86  ? 0.648   3.618   168.056 1.00 92.83  ? 86  VAL C CG2    1 
ATOM   9805  H H      . VAL C 1 86  ? 0.643   0.479   168.410 1.00 121.36 ? 86  VAL C H      1 
ATOM   9806  H HA     . VAL C 1 86  ? -1.393  2.187   168.984 1.00 117.52 ? 86  VAL C HA     1 
ATOM   9807  H HB     . VAL C 1 86  ? 0.212   2.198   166.648 1.00 111.57 ? 86  VAL C HB     1 
ATOM   9808  H HG11   . VAL C 1 86  ? -0.957  4.105   166.002 1.00 110.47 ? 86  VAL C HG11   1 
ATOM   9809  H HG12   . VAL C 1 86  ? -1.956  2.876   166.132 1.00 110.47 ? 86  VAL C HG12   1 
ATOM   9810  H HG13   . VAL C 1 86  ? -1.888  3.970   167.283 1.00 110.47 ? 86  VAL C HG13   1 
ATOM   9811  H HG21   . VAL C 1 86  ? 1.031   4.242   167.421 1.00 111.78 ? 86  VAL C HG21   1 
ATOM   9812  H HG22   . VAL C 1 86  ? 0.148   4.100   168.734 1.00 111.78 ? 86  VAL C HG22   1 
ATOM   9813  H HG23   . VAL C 1 86  ? 1.350   3.095   168.473 1.00 111.78 ? 86  VAL C HG23   1 
ATOM   9814  N N      . LEU C 1 87  ? -1.443  -0.017  166.651 1.00 90.51  ? 87  LEU C N      1 
ATOM   9815  C CA     . LEU C 1 87  ? -2.295  -0.901  165.860 1.00 88.71  ? 87  LEU C CA     1 
ATOM   9816  C C      . LEU C 1 87  ? -3.144  -1.851  166.701 1.00 93.50  ? 87  LEU C C      1 
ATOM   9817  O O      . LEU C 1 87  ? -2.721  -2.321  167.756 1.00 93.89  ? 87  LEU C O      1 
ATOM   9818  C CB     . LEU C 1 87  ? -1.433  -1.718  164.893 1.00 85.57  ? 87  LEU C CB     1 
ATOM   9819  C CG     . LEU C 1 87  ? -0.775  -0.997  163.706 1.00 82.99  ? 87  LEU C CG     1 
ATOM   9820  C CD1    . LEU C 1 87  ? -1.814  -0.693  162.682 1.00 80.79  ? 87  LEU C CD1    1 
ATOM   9821  C CD2    . LEU C 1 87  ? -0.066  0.298   164.053 1.00 81.53  ? 87  LEU C CD2    1 
ATOM   9822  H H      . LEU C 1 87  ? -0.609  -0.065  166.445 1.00 109.01 ? 87  LEU C H      1 
ATOM   9823  H HA     . LEU C 1 87  ? -2.899  -0.357  165.331 1.00 106.84 ? 87  LEU C HA     1 
ATOM   9824  H HB2    . LEU C 1 87  ? -0.717  -2.124  165.406 1.00 103.07 ? 87  LEU C HB2    1 
ATOM   9825  H HB3    . LEU C 1 87  ? -1.990  -2.419  164.520 1.00 103.07 ? 87  LEU C HB3    1 
ATOM   9826  H HG     . LEU C 1 87  ? -0.124  -1.592  163.301 1.00 99.98  ? 87  LEU C HG     1 
ATOM   9827  H HD11   . LEU C 1 87  ? -1.396  -0.238  161.934 1.00 97.34  ? 87  LEU C HD11   1 
ATOM   9828  H HD12   . LEU C 1 87  ? -2.214  -1.525  162.383 1.00 97.34  ? 87  LEU C HD12   1 
ATOM   9829  H HD13   . LEU C 1 87  ? -2.491  -0.124  163.080 1.00 97.34  ? 87  LEU C HD13   1 
ATOM   9830  H HD21   . LEU C 1 87  ? 0.314   0.676   163.244 1.00 98.23  ? 87  LEU C HD21   1 
ATOM   9831  H HD22   . LEU C 1 87  ? -0.708  0.916   164.437 1.00 98.23  ? 87  LEU C HD22   1 
ATOM   9832  H HD23   . LEU C 1 87  ? 0.638   0.110   164.693 1.00 98.23  ? 87  LEU C HD23   1 
ATOM   9833  N N      . ASP C 1 88  ? -4.340  -2.143  166.203 1.00 94.89  ? 88  ASP C N      1 
ATOM   9834  C CA     . ASP C 1 88  ? -5.253  -3.039  166.889 1.00 98.50  ? 88  ASP C CA     1 
ATOM   9835  C C      . ASP C 1 88  ? -4.788  -4.459  166.666 1.00 99.86  ? 88  ASP C C      1 
ATOM   9836  O O      . ASP C 1 88  ? -4.356  -5.137  167.599 1.00 105.76 ? 88  ASP C O      1 
ATOM   9837  C CB     . ASP C 1 88  ? -6.678  -2.852  166.375 1.00 98.24  ? 88  ASP C CB     1 
ATOM   9838  C CG     . ASP C 1 88  ? -7.152  -1.420  166.495 1.00 97.67  ? 88  ASP C CG     1 
ATOM   9839  O OD1    . ASP C 1 88  ? -6.550  -0.666  167.287 1.00 97.50  ? 88  ASP C OD1    1 
ATOM   9840  O OD2    . ASP C 1 88  ? -8.121  -1.042  165.799 1.00 96.73  ? 88  ASP C OD2    1 
ATOM   9841  H H      . ASP C 1 88  ? -4.647  -1.831  165.463 1.00 114.26 ? 88  ASP C H      1 
ATOM   9842  H HA     . ASP C 1 88  ? -5.240  -2.853  167.841 1.00 118.59 ? 88  ASP C HA     1 
ATOM   9843  H HB2    . ASP C 1 88  ? -6.713  -3.103  165.439 1.00 118.28 ? 88  ASP C HB2    1 
ATOM   9844  H HB3    . ASP C 1 88  ? -7.278  -3.412  166.892 1.00 118.28 ? 88  ASP C HB3    1 
ATOM   9845  N N      . SER C 1 89  ? -4.863  -4.901  165.418 1.00 93.35  ? 89  SER C N      1 
ATOM   9846  C CA     . SER C 1 89  ? -4.262  -6.163  165.032 1.00 92.88  ? 89  SER C CA     1 
ATOM   9847  C C      . SER C 1 89  ? -2.968  -5.788  164.353 1.00 94.76  ? 89  SER C C      1 
ATOM   9848  O O      . SER C 1 89  ? -2.962  -5.239  163.252 1.00 91.22  ? 89  SER C O      1 
ATOM   9849  C CB     . SER C 1 89  ? -5.159  -6.975  164.095 1.00 90.04  ? 89  SER C CB     1 
ATOM   9850  O OG     . SER C 1 89  ? -5.338  -6.316  162.850 1.00 84.28  ? 89  SER C OG     1 
ATOM   9851  H H      . SER C 1 89  ? -5.258  -4.486  164.777 1.00 112.41 ? 89  SER C H      1 
ATOM   9852  H HA     . SER C 1 89  ? -4.064  -6.693  165.820 1.00 111.85 ? 89  SER C HA     1 
ATOM   9853  H HB2    . SER C 1 89  ? -4.747  -7.839  163.937 1.00 108.44 ? 89  SER C HB2    1 
ATOM   9854  H HB3    . SER C 1 89  ? -6.025  -7.094  164.515 1.00 108.44 ? 89  SER C HB3    1 
ATOM   9855  H HG     . SER C 1 89  ? -4.595  -6.207  162.473 1.00 101.52 ? 89  SER C HG     1 
ATOM   9856  N N      . TYR C 1 90  ? -1.873  -6.076  165.033 1.00 98.39  ? 90  TYR C N      1 
ATOM   9857  C CA     . TYR C 1 90  ? -0.554  -5.704  164.561 1.00 97.28  ? 90  TYR C CA     1 
ATOM   9858  C C      . TYR C 1 90  ? 0.123   -6.925  163.961 1.00 95.91  ? 90  TYR C C      1 
ATOM   9859  O O      . TYR C 1 90  ? 0.132   -7.999  164.563 1.00 102.95 ? 90  TYR C O      1 
ATOM   9860  C CB     . TYR C 1 90  ? 0.282   -5.125  165.706 1.00 100.04 ? 90  TYR C CB     1 
ATOM   9861  C CG     . TYR C 1 90  ? -0.024  -5.747  167.055 1.00 102.58 ? 90  TYR C CG     1 
ATOM   9862  C CD1    . TYR C 1 90  ? 0.479   -6.997  167.397 1.00 102.23 ? 90  TYR C CD1    1 
ATOM   9863  C CD2    . TYR C 1 90  ? -0.830  -5.089  167.977 1.00 103.49 ? 90  TYR C CD2    1 
ATOM   9864  C CE1    . TYR C 1 90  ? 0.195   -7.570  168.620 1.00 104.90 ? 90  TYR C CE1    1 
ATOM   9865  C CE2    . TYR C 1 90  ? -1.117  -5.653  169.203 1.00 106.14 ? 90  TYR C CE2    1 
ATOM   9866  C CZ     . TYR C 1 90  ? -0.602  -6.893  169.520 1.00 107.52 ? 90  TYR C CZ     1 
ATOM   9867  O OH     . TYR C 1 90  ? -0.888  -7.454  170.743 1.00 111.05 ? 90  TYR C OH     1 
ATOM   9868  H H      . TYR C 1 90  ? -1.868  -6.495  165.785 1.00 118.46 ? 90  TYR C H      1 
ATOM   9869  H HA     . TYR C 1 90  ? -0.637  -5.028  163.870 1.00 117.12 ? 90  TYR C HA     1 
ATOM   9870  H HB2    . TYR C 1 90  ? 1.221   -5.275  165.515 1.00 120.44 ? 90  TYR C HB2    1 
ATOM   9871  H HB3    . TYR C 1 90  ? 0.107   -4.173  165.771 1.00 120.44 ? 90  TYR C HB3    1 
ATOM   9872  H HD1    . TYR C 1 90  ? 1.017   -7.455  166.792 1.00 123.07 ? 90  TYR C HD1    1 
ATOM   9873  H HD2    . TYR C 1 90  ? -1.177  -4.253  167.766 1.00 124.58 ? 90  TYR C HD2    1 
ATOM   9874  H HE1    . TYR C 1 90  ? 0.542   -8.406  168.838 1.00 126.28 ? 90  TYR C HE1    1 
ATOM   9875  H HE2    . TYR C 1 90  ? -1.654  -5.200  169.812 1.00 127.75 ? 90  TYR C HE2    1 
ATOM   9876  H HH     . TYR C 1 90  ? -1.379  -6.938  171.188 1.00 133.65 ? 90  TYR C HH     1 
ATOM   9877  N N      . GLU C 1 91  ? 0.676   -6.761  162.766 1.00 87.00  ? 91  GLU C N      1 
ATOM   9878  C CA     . GLU C 1 91  ? 1.400   -7.836  162.106 1.00 85.56  ? 91  GLU C CA     1 
ATOM   9879  C C      . GLU C 1 91  ? 2.782   -7.340  161.702 1.00 85.28  ? 91  GLU C C      1 
ATOM   9880  O O      . GLU C 1 91  ? 2.908   -6.440  160.873 1.00 84.74  ? 91  GLU C O      1 
ATOM   9881  C CB     . GLU C 1 91  ? 0.629   -8.336  160.885 1.00 84.15  ? 91  GLU C CB     1 
ATOM   9882  C CG     . GLU C 1 91  ? 1.184   -9.611  160.270 1.00 84.35  ? 91  GLU C CG     1 
ATOM   9883  C CD     . GLU C 1 91  ? 0.575   -9.914  158.910 1.00 84.37  ? 91  GLU C CD     1 
ATOM   9884  O OE1    . GLU C 1 91  ? 0.188   -8.958  158.195 1.00 80.29  ? 91  GLU C OE1    1 
ATOM   9885  O OE2    . GLU C 1 91  ? 0.485   -11.112 158.559 1.00 84.75  ? 91  GLU C OE2    1 
ATOM   9886  H H      . GLU C 1 91  ? 0.645   -6.030  162.314 1.00 104.79 ? 91  GLU C H      1 
ATOM   9887  H HA     . GLU C 1 91  ? 1.509   -8.577  162.723 1.00 103.06 ? 91  GLU C HA     1 
ATOM   9888  H HB2    . GLU C 1 91  ? -0.289  -8.510  161.147 1.00 101.37 ? 91  GLU C HB2    1 
ATOM   9889  H HB3    . GLU C 1 91  ? 0.648   -7.647  160.202 1.00 101.37 ? 91  GLU C HB3    1 
ATOM   9890  H HG2    . GLU C 1 91  ? 2.143   -9.517  160.156 1.00 101.61 ? 91  GLU C HG2    1 
ATOM   9891  H HG3    . GLU C 1 91  ? 0.991   -10.357 160.859 1.00 101.61 ? 91  GLU C HG3    1 
ATOM   9892  N N      . ILE C 1 92  ? 3.812   -7.924  162.305 1.00 88.88  ? 92  ILE C N      1 
ATOM   9893  C CA     . ILE C 1 92  ? 5.196   -7.581  161.995 1.00 90.45  ? 92  ILE C CA     1 
ATOM   9894  C C      . ILE C 1 92  ? 5.602   -8.264  160.688 1.00 92.04  ? 92  ILE C C      1 
ATOM   9895  O O      . ILE C 1 92  ? 5.356   -9.463  160.500 1.00 90.81  ? 92  ILE C O      1 
ATOM   9896  C CB     . ILE C 1 92  ? 6.166   -8.007  163.130 1.00 84.71  ? 92  ILE C CB     1 
ATOM   9897  C CG1    . ILE C 1 92  ? 5.680   -7.493  164.491 1.00 84.68  ? 92  ILE C CG1    1 
ATOM   9898  C CG2    . ILE C 1 92  ? 7.576   -7.499  162.852 1.00 84.35  ? 92  ILE C CG2    1 
ATOM   9899  C CD1    . ILE C 1 92  ? 6.334   -8.180  165.675 1.00 85.47  ? 92  ILE C CD1    1 
ATOM   9900  H H      . ILE C 1 92  ? 3.734   -8.533  162.908 1.00 107.05 ? 92  ILE C H      1 
ATOM   9901  H HA     . ILE C 1 92  ? 5.270   -6.621  161.874 1.00 108.93 ? 92  ILE C HA     1 
ATOM   9902  H HB     . ILE C 1 92  ? 6.191   -8.976  163.162 1.00 102.04 ? 92  ILE C HB     1 
ATOM   9903  H HG12   . ILE C 1 92  ? 5.874   -6.544  164.554 1.00 102.00 ? 92  ILE C HG12   1 
ATOM   9904  H HG13   . ILE C 1 92  ? 4.723   -7.637  164.556 1.00 102.00 ? 92  ILE C HG13   1 
ATOM   9905  H HG21   . ILE C 1 92  ? 8.159   -7.778  163.575 1.00 101.61 ? 92  ILE C HG21   1 
ATOM   9906  H HG22   . ILE C 1 92  ? 7.886   -7.873  162.013 1.00 101.61 ? 92  ILE C HG22   1 
ATOM   9907  H HG23   . ILE C 1 92  ? 7.557   -6.531  162.797 1.00 101.61 ? 92  ILE C HG23   1 
ATOM   9908  H HD11   . ILE C 1 92  ? 5.978   -7.803  166.495 1.00 102.96 ? 92  ILE C HD11   1 
ATOM   9909  H HD12   . ILE C 1 92  ? 6.140   -9.129  165.635 1.00 102.96 ? 92  ILE C HD12   1 
ATOM   9910  H HD13   . ILE C 1 92  ? 7.293   -8.035  165.633 1.00 102.96 ? 92  ILE C HD13   1 
ATOM   9911  N N      . ARG C 1 93  ? 6.219   -7.498  159.792 1.00 93.21  ? 93  ARG C N      1 
ATOM   9912  C CA     . ARG C 1 93  ? 6.638   -8.015  158.494 1.00 95.56  ? 93  ARG C CA     1 
ATOM   9913  C C      . ARG C 1 93  ? 8.125   -7.779  158.273 1.00 99.55  ? 93  ARG C C      1 
ATOM   9914  O O      . ARG C 1 93  ? 8.581   -6.636  158.212 1.00 98.51  ? 93  ARG C O      1 
ATOM   9915  C CB     . ARG C 1 93  ? 5.823   -7.368  157.369 1.00 93.57  ? 93  ARG C CB     1 
ATOM   9916  C CG     . ARG C 1 93  ? 4.367   -7.807  157.349 1.00 95.26  ? 93  ARG C CG     1 
ATOM   9917  C CD     . ARG C 1 93  ? 3.570   -7.087  156.282 1.00 93.76  ? 93  ARG C CD     1 
ATOM   9918  N NE     . ARG C 1 93  ? 4.105   -7.330  154.947 1.00 98.52  ? 93  ARG C NE     1 
ATOM   9919  C CZ     . ARG C 1 93  ? 3.608   -6.800  153.832 1.00 103.86 ? 93  ARG C CZ     1 
ATOM   9920  N NH1    . ARG C 1 93  ? 2.556   -5.991  153.887 1.00 104.71 ? 93  ARG C NH1    1 
ATOM   9921  N NH2    . ARG C 1 93  ? 4.164   -7.075  152.656 1.00 104.20 ? 93  ARG C NH2    1 
ATOM   9922  H H      . ARG C 1 93  ? 6.407   -6.668  159.913 1.00 112.24 ? 93  ARG C H      1 
ATOM   9923  H HA     . ARG C 1 93  ? 6.478   -8.971  158.468 1.00 115.07 ? 93  ARG C HA     1 
ATOM   9924  H HB2    . ARG C 1 93  ? 5.843   -6.405  157.482 1.00 112.68 ? 93  ARG C HB2    1 
ATOM   9925  H HB3    . ARG C 1 93  ? 6.219   -7.609  156.517 1.00 112.68 ? 93  ARG C HB3    1 
ATOM   9926  H HG2    . ARG C 1 93  ? 4.324   -8.759  157.168 1.00 114.70 ? 93  ARG C HG2    1 
ATOM   9927  H HG3    . ARG C 1 93  ? 3.964   -7.612  158.210 1.00 114.70 ? 93  ARG C HG3    1 
ATOM   9928  H HD2    . ARG C 1 93  ? 2.653   -7.402  156.303 1.00 112.90 ? 93  ARG C HD2    1 
ATOM   9929  H HD3    . ARG C 1 93  ? 3.600   -6.132  156.451 1.00 112.90 ? 93  ARG C HD3    1 
ATOM   9930  H HE     . ARG C 1 93  ? 4.786   -7.850  154.876 1.00 118.61 ? 93  ARG C HE     1 
ATOM   9931  H HH11   . ARG C 1 93  ? 2.193   -5.808  154.645 1.00 126.04 ? 93  ARG C HH11   1 
ATOM   9932  H HH12   . ARG C 1 93  ? 2.238   -5.650  153.165 1.00 126.04 ? 93  ARG C HH12   1 
ATOM   9933  H HH21   . ARG C 1 93  ? 4.845   -7.598  152.614 1.00 125.43 ? 93  ARG C HH21   1 
ATOM   9934  H HH22   . ARG C 1 93  ? 3.840   -6.732  151.937 1.00 125.43 ? 93  ARG C HH22   1 
ATOM   9935  N N      . TYR C 1 94  ? 8.874   -8.875  158.169 1.00 104.64 ? 94  TYR C N      1 
ATOM   9936  C CA     . TYR C 1 94  ? 10.296  -8.820  157.852 1.00 105.42 ? 94  TYR C CA     1 
ATOM   9937  C C      . TYR C 1 94  ? 10.473  -8.798  156.337 1.00 100.29 ? 94  TYR C C      1 
ATOM   9938  O O      . TYR C 1 94  ? 9.897   -9.619  155.621 1.00 100.97 ? 94  TYR C O      1 
ATOM   9939  C CB     . TYR C 1 94  ? 11.042  -10.013 158.469 1.00 107.65 ? 94  TYR C CB     1 
ATOM   9940  C CG     . TYR C 1 94  ? 10.973  -10.052 159.981 1.00 109.77 ? 94  TYR C CG     1 
ATOM   9941  C CD1    . TYR C 1 94  ? 9.958   -10.743 160.629 1.00 111.40 ? 94  TYR C CD1    1 
ATOM   9942  C CD2    . TYR C 1 94  ? 11.917  -9.391  160.759 1.00 110.12 ? 94  TYR C CD2    1 
ATOM   9943  C CE1    . TYR C 1 94  ? 9.884   -10.779 162.008 1.00 113.29 ? 94  TYR C CE1    1 
ATOM   9944  C CE2    . TYR C 1 94  ? 11.850  -9.421  162.140 1.00 113.26 ? 94  TYR C CE2    1 
ATOM   9945  C CZ     . TYR C 1 94  ? 10.830  -10.117 162.758 1.00 115.39 ? 94  TYR C CZ     1 
ATOM   9946  O OH     . TYR C 1 94  ? 10.753  -10.154 164.131 1.00 120.04 ? 94  TYR C OH     1 
ATOM   9947  H H      . TYR C 1 94  ? 8.575   -9.674  158.280 1.00 125.95 ? 94  TYR C H      1 
ATOM   9948  H HA     . TYR C 1 94  ? 10.675  -8.004  158.215 1.00 126.90 ? 94  TYR C HA     1 
ATOM   9949  H HB2    . TYR C 1 94  ? 10.652  -10.834 158.132 1.00 129.57 ? 94  TYR C HB2    1 
ATOM   9950  H HB3    . TYR C 1 94  ? 11.977  -9.963  158.215 1.00 129.57 ? 94  TYR C HB3    1 
ATOM   9951  H HD1    . TYR C 1 94  ? 9.317   -11.190 160.126 1.00 134.07 ? 94  TYR C HD1    1 
ATOM   9952  H HD2    . TYR C 1 94  ? 12.603  -8.920  160.345 1.00 132.54 ? 94  TYR C HD2    1 
ATOM   9953  H HE1    . TYR C 1 94  ? 9.198   -11.247 162.428 1.00 136.34 ? 94  TYR C HE1    1 
ATOM   9954  H HE2    . TYR C 1 94  ? 12.488  -8.975  162.650 1.00 136.30 ? 94  TYR C HE2    1 
ATOM   9955  H HH     . TYR C 1 94  ? 11.385  -9.714  164.466 1.00 144.44 ? 94  TYR C HH     1 
ATOM   9956  N N      . ALA C 1 95  ? 11.261  -7.849  155.851 1.00 93.25  ? 95  ALA C N      1 
ATOM   9957  C CA     . ALA C 1 95  ? 11.462  -7.700  154.419 1.00 90.57  ? 95  ALA C CA     1 
ATOM   9958  C C      . ALA C 1 95  ? 12.557  -6.673  154.137 1.00 89.61  ? 95  ALA C C      1 
ATOM   9959  O O      . ALA C 1 95  ? 12.287  -5.569  153.661 1.00 86.68  ? 95  ALA C O      1 
ATOM   9960  C CB     . ALA C 1 95  ? 10.149  -7.296  153.736 1.00 86.94  ? 95  ALA C CB     1 
ATOM   9961  H H      . ALA C 1 95  ? 11.692  -7.279  156.329 1.00 112.30 ? 95  ALA C H      1 
ATOM   9962  H HA     . ALA C 1 95  ? 11.745  -8.551  154.048 1.00 109.07 ? 95  ALA C HA     1 
ATOM   9963  H HB1    . ALA C 1 95  ? 10.305  -7.202  152.784 1.00 104.72 ? 95  ALA C HB1    1 
ATOM   9964  H HB2    . ALA C 1 95  ? 9.485   -7.984  153.897 1.00 104.72 ? 95  ALA C HB2    1 
ATOM   9965  H HB3    . ALA C 1 95  ? 9.848   -6.452  154.108 1.00 104.72 ? 95  ALA C HB3    1 
ATOM   9966  N N      . HIS C 1 97  ? 13.703  -4.439  155.738 1.00 116.83 ? 97  HIS C N      1 
ATOM   9967  C CA     . HIS C 1 97  ? 13.855  -4.187  157.166 1.00 116.36 ? 97  HIS C CA     1 
ATOM   9968  C C      . HIS C 1 97  ? 12.472  -4.142  157.826 1.00 114.09 ? 97  HIS C C      1 
ATOM   9969  O O      . HIS C 1 97  ? 11.500  -3.723  157.198 1.00 108.08 ? 97  HIS C O      1 
ATOM   9970  C CB     . HIS C 1 97  ? 14.637  -2.896  157.380 1.00 115.59 ? 97  HIS C CB     1 
ATOM   9971  C CG     . HIS C 1 97  ? 16.055  -2.977  156.898 1.00 117.25 ? 97  HIS C CG     1 
ATOM   9972  N ND1    . HIS C 1 97  ? 17.045  -3.632  157.602 1.00 117.92 ? 97  HIS C ND1    1 
ATOM   9973  C CD2    . HIS C 1 97  ? 16.645  -2.501  155.775 1.00 117.61 ? 97  HIS C CD2    1 
ATOM   9974  C CE1    . HIS C 1 97  ? 18.184  -3.547  156.938 1.00 119.04 ? 97  HIS C CE1    1 
ATOM   9975  N NE2    . HIS C 1 97  ? 17.969  -2.866  155.826 1.00 119.19 ? 97  HIS C NE2    1 
ATOM   9976  H HA     . HIS C 1 97  ? 14.357  -4.914  157.566 1.00 140.02 ? 97  HIS C HA     1 
ATOM   9977  H HB2    . HIS C 1 97  ? 14.199  -2.179  156.896 1.00 139.10 ? 97  HIS C HB2    1 
ATOM   9978  H HB3    . HIS C 1 97  ? 14.655  -2.692  158.328 1.00 139.10 ? 97  HIS C HB3    1 
ATOM   9979  H HD1    . HIS C 1 97  ? 16.938  -4.029  158.358 1.00 141.90 ? 97  HIS C HD1    1 
ATOM   9980  H HD2    . HIS C 1 97  ? 16.232  -2.014  155.099 1.00 141.52 ? 97  HIS C HD2    1 
ATOM   9981  H HE1    . HIS C 1 97  ? 18.999  -3.905  157.207 1.00 143.24 ? 97  HIS C HE1    1 
ATOM   9982  H HE2    . HIS C 1 97  ? 18.562  -2.681  155.231 1.00 143.42 ? 97  HIS C HE2    1 
ATOM   9983  N N      . PRO C 1 98  ? 12.375  -4.577  159.094 1.00 118.94 ? 98  PRO C N      1 
ATOM   9984  C CA     . PRO C 1 98  ? 11.051  -4.815  159.689 1.00 118.09 ? 98  PRO C CA     1 
ATOM   9985  C C      . PRO C 1 98  ? 10.225  -3.571  160.008 1.00 112.18 ? 98  PRO C C      1 
ATOM   9986  O O      . PRO C 1 98  ? 10.744  -2.572  160.513 1.00 113.55 ? 98  PRO C O      1 
ATOM   9987  C CB     . PRO C 1 98  ? 11.393  -5.551  160.987 1.00 123.20 ? 98  PRO C CB     1 
ATOM   9988  C CG     . PRO C 1 98  ? 12.729  -5.021  161.361 1.00 125.74 ? 98  PRO C CG     1 
ATOM   9989  C CD     . PRO C 1 98  ? 13.461  -4.772  160.071 1.00 123.83 ? 98  PRO C CD     1 
ATOM   9990  H HA     . PRO C 1 98  ? 10.532  -5.403  159.119 1.00 142.10 ? 98  PRO C HA     1 
ATOM   9991  H HB2    . PRO C 1 98  ? 10.734  -5.342  161.668 1.00 148.23 ? 98  PRO C HB2    1 
ATOM   9992  H HB3    . PRO C 1 98  ? 11.433  -6.507  160.824 1.00 148.23 ? 98  PRO C HB3    1 
ATOM   9993  H HG2    . PRO C 1 98  ? 12.621  -4.193  161.855 1.00 151.28 ? 98  PRO C HG2    1 
ATOM   9994  H HG3    . PRO C 1 98  ? 13.199  -5.678  161.897 1.00 151.28 ? 98  PRO C HG3    1 
ATOM   9995  H HD2    . PRO C 1 98  ? 14.003  -3.970  160.139 1.00 148.99 ? 98  PRO C HD2    1 
ATOM   9996  H HD3    . PRO C 1 98  ? 13.997  -5.544  159.831 1.00 148.99 ? 98  PRO C HD3    1 
ATOM   9997  N N      . TYR C 1 99  ? 8.928   -3.668  159.726 1.00 102.47 ? 99  TYR C N      1 
ATOM   9998  C CA     . TYR C 1 99  ? 7.962   -2.630  160.068 1.00 93.40  ? 99  TYR C CA     1 
ATOM   9999  C C      . TYR C 1 99  ? 6.686   -3.250  160.642 1.00 88.90  ? 99  TYR C C      1 
ATOM   10000 O O      . TYR C 1 99  ? 6.588   -4.476  160.759 1.00 89.34  ? 99  TYR C O      1 
ATOM   10001 C CB     . TYR C 1 99  ? 7.681   -1.728  158.844 1.00 88.31  ? 99  TYR C CB     1 
ATOM   10002 C CG     . TYR C 1 99  ? 6.987   -2.365  157.650 1.00 85.75  ? 99  TYR C CG     1 
ATOM   10003 C CD1    . TYR C 1 99  ? 5.599   -2.368  157.528 1.00 84.27  ? 99  TYR C CD1    1 
ATOM   10004 C CD2    . TYR C 1 99  ? 7.734   -2.924  156.618 1.00 86.05  ? 99  TYR C CD2    1 
ATOM   10005 C CE1    . TYR C 1 99  ? 4.978   -2.939  156.422 1.00 82.98  ? 99  TYR C CE1    1 
ATOM   10006 C CE2    . TYR C 1 99  ? 7.125   -3.493  155.513 1.00 85.34  ? 99  TYR C CE2    1 
ATOM   10007 C CZ     . TYR C 1 99  ? 5.752   -3.498  155.415 1.00 83.73  ? 99  TYR C CZ     1 
ATOM   10008 O OH     . TYR C 1 99  ? 5.170   -4.072  154.303 1.00 81.83  ? 99  TYR C OH     1 
ATOM   10009 H H      . TYR C 1 99  ? 8.576   -4.344  159.328 1.00 123.36 ? 99  TYR C H      1 
ATOM   10010 H HA     . TYR C 1 99  ? 8.348   -2.068  160.759 1.00 112.47 ? 99  TYR C HA     1 
ATOM   10011 H HB2    . TYR C 1 99  ? 7.123   -0.991  159.137 1.00 106.36 ? 99  TYR C HB2    1 
ATOM   10012 H HB3    . TYR C 1 99  ? 8.529   -1.379  158.528 1.00 106.36 ? 99  TYR C HB3    1 
ATOM   10013 H HD1    . TYR C 1 99  ? 5.080   -1.994  158.203 1.00 101.52 ? 99  TYR C HD1    1 
ATOM   10014 H HD2    . TYR C 1 99  ? 8.662   -2.925  156.677 1.00 103.65 ? 99  TYR C HD2    1 
ATOM   10015 H HE1    . TYR C 1 99  ? 4.050   -2.942  156.356 1.00 99.97  ? 99  TYR C HE1    1 
ATOM   10016 H HE2    . TYR C 1 99  ? 7.643   -3.870  154.838 1.00 102.80 ? 99  TYR C HE2    1 
ATOM   10017 H HH     . TYR C 1 99  ? 5.764   -4.365  153.787 1.00 98.59  ? 99  TYR C HH     1 
ATOM   10018 N N      . VAL C 1 100 ? 5.736   -2.396  161.027 1.00 85.56  ? 100 VAL C N      1 
ATOM   10019 C CA     . VAL C 1 100 ? 4.497   -2.845  161.653 1.00 85.15  ? 100 VAL C CA     1 
ATOM   10020 C C      . VAL C 1 100 ? 3.273   -2.562  160.777 1.00 85.21  ? 100 VAL C C      1 
ATOM   10021 O O      . VAL C 1 100 ? 2.815   -1.424  160.669 1.00 83.24  ? 100 VAL C O      1 
ATOM   10022 C CB     . VAL C 1 100 ? 4.314   -2.151  163.027 1.00 82.05  ? 100 VAL C CB     1 
ATOM   10023 C CG1    . VAL C 1 100 ? 3.059   -2.641  163.739 1.00 83.91  ? 100 VAL C CG1    1 
ATOM   10024 C CG2    . VAL C 1 100 ? 5.553   -2.363  163.881 1.00 84.25  ? 100 VAL C CG2    1 
ATOM   10025 H H      . VAL C 1 100 ? 5.788   -1.542  160.934 1.00 103.06 ? 100 VAL C H      1 
ATOM   10026 H HA     . VAL C 1 100 ? 4.546   -3.802  161.802 1.00 102.57 ? 100 VAL C HA     1 
ATOM   10027 H HB     . VAL C 1 100 ? 4.216   -1.197  162.882 1.00 98.85  ? 100 VAL C HB     1 
ATOM   10028 H HG11   . VAL C 1 100 ? 2.981   -2.185  164.591 1.00 101.08 ? 100 VAL C HG11   1 
ATOM   10029 H HG12   . VAL C 1 100 ? 2.286   -2.446  163.187 1.00 101.08 ? 100 VAL C HG12   1 
ATOM   10030 H HG13   . VAL C 1 100 ? 3.131   -3.598  163.881 1.00 101.08 ? 100 VAL C HG13   1 
ATOM   10031 H HG21   . VAL C 1 100 ? 5.425   -1.924  164.736 1.00 101.49 ? 100 VAL C HG21   1 
ATOM   10032 H HG22   . VAL C 1 100 ? 5.686   -3.314  164.013 1.00 101.49 ? 100 VAL C HG22   1 
ATOM   10033 H HG23   . VAL C 1 100 ? 6.320   -1.981  163.424 1.00 101.49 ? 100 VAL C HG23   1 
ATOM   10034 N N      . HIS C 1 101 ? 2.754   -3.618  160.156 1.00 87.34  ? 101 HIS C N      1 
ATOM   10035 C CA     . HIS C 1 101 ? 1.483   -3.567  159.452 1.00 87.32  ? 101 HIS C CA     1 
ATOM   10036 C C      . HIS C 1 101 ? 0.343   -3.812  160.422 1.00 86.29  ? 101 HIS C C      1 
ATOM   10037 O O      . HIS C 1 101 ? 0.546   -4.411  161.471 1.00 94.88  ? 101 HIS C O      1 
ATOM   10038 C CB     . HIS C 1 101 ? 1.441   -4.591  158.329 1.00 92.96  ? 101 HIS C CB     1 
ATOM   10039 C CG     . HIS C 1 101 ? 0.312   -4.374  157.373 1.00 96.19  ? 101 HIS C CG     1 
ATOM   10040 N ND1    . HIS C 1 101 ? 0.244   -3.274  156.547 1.00 93.87  ? 101 HIS C ND1    1 
ATOM   10041 C CD2    . HIS C 1 101 ? -0.797  -5.107  157.116 1.00 99.44  ? 101 HIS C CD2    1 
ATOM   10042 C CE1    . HIS C 1 101 ? -0.854  -3.340  155.816 1.00 93.80  ? 101 HIS C CE1    1 
ATOM   10043 N NE2    . HIS C 1 101 ? -1.504  -4.442  156.142 1.00 97.29  ? 101 HIS C NE2    1 
ATOM   10044 H H      . HIS C 1 101 ? 3.130   -4.390  160.130 1.00 105.20 ? 101 HIS C H      1 
ATOM   10045 H HA     . HIS C 1 101 ? 1.368   -2.686  159.064 1.00 105.18 ? 101 HIS C HA     1 
ATOM   10046 H HB2    . HIS C 1 101 ? 2.270   -4.541  157.827 1.00 111.94 ? 101 HIS C HB2    1 
ATOM   10047 H HB3    . HIS C 1 101 ? 1.341   -5.476  158.713 1.00 111.94 ? 101 HIS C HB3    1 
ATOM   10048 H HD1    . HIS C 1 101 ? 0.828   -2.644  156.510 1.00 113.03 ? 101 HIS C HD1    1 
ATOM   10049 H HD2    . HIS C 1 101 ? -1.034  -5.911  157.518 1.00 119.72 ? 101 HIS C HD2    1 
ATOM   10050 H HE1    . HIS C 1 101 ? -1.125  -2.715  155.182 1.00 112.95 ? 101 HIS C HE1    1 
ATOM   10051 H HE2    . HIS C 1 101 ? -2.250  -4.702  155.801 1.00 117.14 ? 101 HIS C HE2    1 
ATOM   10052 N N      . GLY C 1 102 ? -0.861  -3.386  160.071 1.00 78.68  ? 102 GLY C N      1 
ATOM   10053 C CA     . GLY C 1 102 ? -2.010  -3.678  160.906 1.00 77.49  ? 102 GLY C CA     1 
ATOM   10054 C C      . GLY C 1 102 ? -3.264  -2.932  160.502 1.00 73.54  ? 102 GLY C C      1 
ATOM   10055 O O      . GLY C 1 102 ? -3.427  -2.550  159.346 1.00 72.44  ? 102 GLY C O      1 
ATOM   10056 H H      . GLY C 1 102 ? -1.037  -2.932  159.362 1.00 94.80  ? 102 GLY C H      1 
ATOM   10057 H HA2    . GLY C 1 102 ? -2.198  -4.629  160.867 1.00 93.38  ? 102 GLY C HA2    1 
ATOM   10058 H HA3    . GLY C 1 102 ? -1.803  -3.447  161.825 1.00 93.38  ? 102 GLY C HA3    1 
ATOM   10059 N N      . VAL C 1 103 ? -4.183  -2.782  161.450 1.00 71.43  ? 103 VAL C N      1 
ATOM   10060 C CA     . VAL C 1 103 ? -5.432  -2.071  161.205 1.00 69.62  ? 103 VAL C CA     1 
ATOM   10061 C C      . VAL C 1 103 ? -5.837  -1.261  162.431 1.00 73.47  ? 103 VAL C C      1 
ATOM   10062 O O      . VAL C 1 103 ? -5.666  -1.693  163.571 1.00 75.20  ? 103 VAL C O      1 
ATOM   10063 C CB     . VAL C 1 103 ? -6.575  -3.037  160.820 1.00 70.04  ? 103 VAL C CB     1 
ATOM   10064 C CG1    . VAL C 1 103 ? -7.885  -2.278  160.588 1.00 68.31  ? 103 VAL C CG1    1 
ATOM   10065 C CG2    . VAL C 1 103 ? -6.191  -3.845  159.583 1.00 69.51  ? 103 VAL C CG2    1 
ATOM   10066 H H      . VAL C 1 103 ? -4.106  -3.086  162.251 1.00 86.10  ? 103 VAL C H      1 
ATOM   10067 H HA     . VAL C 1 103 ? -5.302  -1.454  160.469 1.00 83.94  ? 103 VAL C HA     1 
ATOM   10068 H HB     . VAL C 1 103 ? -6.717  -3.660  161.550 1.00 84.44  ? 103 VAL C HB     1 
ATOM   10069 H HG11   . VAL C 1 103 ? -8.578  -2.913  160.349 1.00 82.25  ? 103 VAL C HG11   1 
ATOM   10070 H HG12   . VAL C 1 103 ? -8.128  -1.813  161.403 1.00 82.25  ? 103 VAL C HG12   1 
ATOM   10071 H HG13   . VAL C 1 103 ? -7.756  -1.641  159.868 1.00 82.25  ? 103 VAL C HG13   1 
ATOM   10072 H HG21   . VAL C 1 103 ? -6.921  -4.443  159.359 1.00 83.80  ? 103 VAL C HG21   1 
ATOM   10073 H HG22   . VAL C 1 103 ? -6.025  -3.235  158.847 1.00 83.80  ? 103 VAL C HG22   1 
ATOM   10074 H HG23   . VAL C 1 103 ? -5.390  -4.356  159.776 1.00 83.80  ? 103 VAL C HG23   1 
ATOM   10075 N N      . VAL C 1 104 ? -6.376  -0.079  162.172 1.00 78.22  ? 104 VAL C N      1 
ATOM   10076 C CA     . VAL C 1 104 ? -6.929  0.771   163.211 1.00 84.43  ? 104 VAL C CA     1 
ATOM   10077 C C      . VAL C 1 104 ? -8.261  1.297   162.709 1.00 86.41  ? 104 VAL C C      1 
ATOM   10078 O O      . VAL C 1 104 ? -8.307  1.996   161.693 1.00 87.04  ? 104 VAL C O      1 
ATOM   10079 C CB     . VAL C 1 104 ? -5.980  1.939   163.551 1.00 84.35  ? 104 VAL C CB     1 
ATOM   10080 C CG1    . VAL C 1 104 ? -6.637  2.928   164.513 1.00 86.31  ? 104 VAL C CG1    1 
ATOM   10081 C CG2    . VAL C 1 104 ? -4.686  1.401   164.124 1.00 86.13  ? 104 VAL C CG2    1 
ATOM   10082 H H      . VAL C 1 104 ? -6.434  0.259   161.384 1.00 94.25  ? 104 VAL C H      1 
ATOM   10083 H HA     . VAL C 1 104 ? -7.082  0.250   164.014 1.00 101.71 ? 104 VAL C HA     1 
ATOM   10084 H HB     . VAL C 1 104 ? -5.767  2.417   162.734 1.00 101.61 ? 104 VAL C HB     1 
ATOM   10085 H HG11   . VAL C 1 104 ? -6.012  3.646   164.702 1.00 103.97 ? 104 VAL C HG11   1 
ATOM   10086 H HG12   . VAL C 1 104 ? -7.437  3.286   164.099 1.00 103.97 ? 104 VAL C HG12   1 
ATOM   10087 H HG13   . VAL C 1 104 ? -6.867  2.464   165.333 1.00 103.97 ? 104 VAL C HG13   1 
ATOM   10088 H HG21   . VAL C 1 104 ? -4.100  2.145   164.333 1.00 103.74 ? 104 VAL C HG21   1 
ATOM   10089 H HG22   . VAL C 1 104 ? -4.883  0.898   164.930 1.00 103.74 ? 104 VAL C HG22   1 
ATOM   10090 H HG23   . VAL C 1 104 ? -4.266  0.823   163.468 1.00 103.74 ? 104 VAL C HG23   1 
ATOM   10091 N N      . LYS C 1 105 ? -9.338  0.959   163.414 1.00 79.61  ? 105 LYS C