data_4X4R
# 
_entry.id   4X4R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X4R         
WWPDB D_1000202146 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4X4N unspecified 
PDB . 4X4O unspecified 
PDB . 4X4P unspecified 
PDB . 4X4Q unspecified 
PDB . 4X4S unspecified 
PDB . 4X4T unspecified 
PDB . 4X4U unspecified 
PDB . 4X4V unspecified 
PDB . 4X4W unspecified 
PDB . 4X4X unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X4R 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuhn, C.-D.'    1 
'Joshua-Tor, L.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            160 
_citation.language                  ? 
_citation.page_first                644 
_citation.page_last                 658 
_citation.title                     'On-Enzyme Refolding Permits Small RNA and tRNA Surveillance by the CCA-Adding Enzyme.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2015.01.005 
_citation.pdbx_database_id_PubMed   25640237 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kuhn, C.D.'     1 ? 
primary 'Wilusz, J.E.'   2 ? 
primary 'Zheng, Y.'      3 ? 
primary 'Beal, P.A.'     4 ? 
primary 'Joshua-Tor, L.' 5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4X4R 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     111.100 
_cell.length_a_esd                 ? 
_cell.length_b                     217.368 
_cell.length_b_esd                 ? 
_cell.length_c                     58.562 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4X4R 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CCA-adding enzyme'                             53672.484 2 2.7.7.72 ? 'A. fulgidus CCA-adding enzyme' ? 
2 polymer     syn 'G70A tRNA minihelix ending in CCACC'           11868.098 2 ?        ? ?                               ? 
3 polymer     syn 
;RNA (5'-D(*CP*G)-3')
;
605.430   1 ?        ? ?                               ? 
4 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 505.208   2 ?        ? ?                               ? 
5 non-polymer syn 'MAGNESIUM ION'                                 24.305    2 ?        ? ?                               ? 
6 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'          195.237   1 ?        ? ?                               ? 
7 non-polymer syn GLYCEROL                                        92.094    3 ?        ? ?                               ? 
8 non-polymer syn 'D(-)-TARTARIC ACID'                            150.087   1 ?        ? ?                               ? 
9 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                         106.120   1 ?        ? ?                               ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CCA tRNA nucleotidyltransferase,tRNA CCA-pyrophosphorylase,tRNA adenylyl-/cytidylyl- transferase,tRNA nucleotidyltransferase,tRNA-NT
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSVDKLAAALEHHHHHH
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSVDKLAAALEHHHHHH
;
A,C ? 
2 polyribonucleotide no no GGCCGCGGCAGGUUCGAGUCCUGCCGCGAUCGCCACC GGCCGCGGCAGGUUCGAGUCCUGCCGCGAUCGCCACC B,D ? 
3 polyribonucleotide no no CG CG H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 SER n 
1 439 ASN n 
1 440 SER n 
1 441 SER n 
1 442 SER n 
1 443 VAL n 
1 444 ASP n 
1 445 LYS n 
1 446 LEU n 
1 447 ALA n 
1 448 ALA n 
1 449 ALA n 
1 450 LEU n 
1 451 GLU n 
1 452 HIS n 
1 453 HIS n 
1 454 HIS n 
1 455 HIS n 
1 456 HIS n 
1 457 HIS n 
2 1   G   n 
2 2   G   n 
2 3   C   n 
2 4   C   n 
2 5   G   n 
2 6   C   n 
2 7   G   n 
2 8   G   n 
2 9   C   n 
2 10  A   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  G   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  U   n 
2 23  G   n 
2 24  C   n 
2 25  C   n 
2 26  G   n 
2 27  C   n 
2 28  G   n 
2 29  A   n 
2 30  U   n 
2 31  C   n 
2 32  G   n 
2 33  C   n 
2 34  C   n 
2 35  A   n 
2 36  C   n 
2 37  C   n 
3 1   C   n 
3 2   G   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   457 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'cca, AF_2156' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     224325 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 37 'Homo sapiens' ? 9606 ? 
3 1 sample 1 2  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CCA_ARCFU O28126 ? 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 
2 PDB 4X4R      4X4R   ? 2 ? 1 
3 PDB 4X4R      4X4R   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4X4R A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 4X4R B 1 ? 37  ? 4X4R   1 ? 37  ? 1 37  
3 1 4X4R C 1 ? 437 ? O28126 1 ? 437 ? 1 437 
4 2 4X4R D 1 ? 37  ? 4X4R   1 ? 37  ? 1 37  
5 3 4X4R H 1 ? 2   ? 4X4R   1 ? 2   ? 1 2   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X4R SER A 438 ? UNP O28126 ? ? 'expression tag' 438 1  
1 4X4R ASN A 439 ? UNP O28126 ? ? 'expression tag' 439 2  
1 4X4R SER A 440 ? UNP O28126 ? ? 'expression tag' 440 3  
1 4X4R SER A 441 ? UNP O28126 ? ? 'expression tag' 441 4  
1 4X4R SER A 442 ? UNP O28126 ? ? 'expression tag' 442 5  
1 4X4R VAL A 443 ? UNP O28126 ? ? 'expression tag' 443 6  
1 4X4R ASP A 444 ? UNP O28126 ? ? 'expression tag' 444 7  
1 4X4R LYS A 445 ? UNP O28126 ? ? 'expression tag' 445 8  
1 4X4R LEU A 446 ? UNP O28126 ? ? 'expression tag' 446 9  
1 4X4R ALA A 447 ? UNP O28126 ? ? 'expression tag' 447 10 
1 4X4R ALA A 448 ? UNP O28126 ? ? 'expression tag' 448 11 
1 4X4R ALA A 449 ? UNP O28126 ? ? 'expression tag' 449 12 
1 4X4R LEU A 450 ? UNP O28126 ? ? 'expression tag' 450 13 
1 4X4R GLU A 451 ? UNP O28126 ? ? 'expression tag' 451 14 
1 4X4R HIS A 452 ? UNP O28126 ? ? 'expression tag' 452 15 
1 4X4R HIS A 453 ? UNP O28126 ? ? 'expression tag' 453 16 
1 4X4R HIS A 454 ? UNP O28126 ? ? 'expression tag' 454 17 
1 4X4R HIS A 455 ? UNP O28126 ? ? 'expression tag' 455 18 
1 4X4R HIS A 456 ? UNP O28126 ? ? 'expression tag' 456 19 
1 4X4R HIS A 457 ? UNP O28126 ? ? 'expression tag' 457 20 
3 4X4R SER C 438 ? UNP O28126 ? ? 'expression tag' 438 21 
3 4X4R ASN C 439 ? UNP O28126 ? ? 'expression tag' 439 22 
3 4X4R SER C 440 ? UNP O28126 ? ? 'expression tag' 440 23 
3 4X4R SER C 441 ? UNP O28126 ? ? 'expression tag' 441 24 
3 4X4R SER C 442 ? UNP O28126 ? ? 'expression tag' 442 25 
3 4X4R VAL C 443 ? UNP O28126 ? ? 'expression tag' 443 26 
3 4X4R ASP C 444 ? UNP O28126 ? ? 'expression tag' 444 27 
3 4X4R LYS C 445 ? UNP O28126 ? ? 'expression tag' 445 28 
3 4X4R LEU C 446 ? UNP O28126 ? ? 'expression tag' 446 29 
3 4X4R ALA C 447 ? UNP O28126 ? ? 'expression tag' 447 30 
3 4X4R ALA C 448 ? UNP O28126 ? ? 'expression tag' 448 31 
3 4X4R ALA C 449 ? UNP O28126 ? ? 'expression tag' 449 32 
3 4X4R LEU C 450 ? UNP O28126 ? ? 'expression tag' 450 33 
3 4X4R GLU C 451 ? UNP O28126 ? ? 'expression tag' 451 34 
3 4X4R HIS C 452 ? UNP O28126 ? ? 'expression tag' 452 35 
3 4X4R HIS C 453 ? UNP O28126 ? ? 'expression tag' 453 36 
3 4X4R HIS C 454 ? UNP O28126 ? ? 'expression tag' 454 37 
3 4X4R HIS C 455 ? UNP O28126 ? ? 'expression tag' 455 38 
3 4X4R HIS C 456 ? UNP O28126 ? ? 'expression tag' 456 39 
3 4X4R HIS C 457 ? UNP O28126 ? ? 'expression tag' 457 40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ?                                               
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                        'GLYCERIN; PROPANE-1,2,3-TRIOL'                 
'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'          ?                                               
'C6 H13 N O4 S'     195.237 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ?                                               'Mg 2' 
24.305  
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                         ?                                               
'C4 H10 O3'         106.120 
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
TAR non-polymer         . 'D(-)-TARTARIC ACID'                            ?                                               
'C4 H6 O6'          150.087 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ?                                               
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X4R 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.75 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.33 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '24% PEG3350, 0.2M NaK tartrate, 0.1M MES 6.8' 
_exptl_crystal_grow.pdbx_pH_range   6.8 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-11-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            52.470 
_reflns.entry_id                         4X4R 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.200 
_reflns.d_resolution_low                 30.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24077 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.500 
_reflns.pdbx_Rmerge_I_obs                0.161 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         7.952 
_reflns.pdbx_netI_over_sigmaI            4.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.081 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         84436 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.200 3.260  ? ? ? ? ? 1197 ? 99.800 ? ? ? ? 0.380 ? ? ? ? ? ? ? ? 3.500 ? 0.539 ? ? ? ? 0 1  1 ? ? 
3.260 3.310  ? ? ? ? ? 1145 ? 99.700 ? ? ? ? 0.351 ? ? ? ? ? ? ? ? 3.400 ? 0.598 ? ? ? ? 0 2  1 ? ? 
3.310 3.380  ? ? ? ? ? 1185 ? 99.700 ? ? ? ? 0.327 ? ? ? ? ? ? ? ? 3.500 ? 0.667 ? ? ? ? 0 3  1 ? ? 
3.380 3.450  ? ? ? ? ? 1203 ? 99.700 ? ? ? ? 0.289 ? ? ? ? ? ? ? ? 3.600 ? 0.735 ? ? ? ? 0 4  1 ? ? 
3.450 3.520  ? ? ? ? ? 1152 ? 99.900 ? ? ? ? 0.256 ? ? ? ? ? ? ? ? 3.600 ? 0.768 ? ? ? ? 0 5  1 ? ? 
3.520 3.600  ? ? ? ? ? 1184 ? 99.900 ? ? ? ? 0.240 ? ? ? ? ? ? ? ? 3.500 ? 0.867 ? ? ? ? 0 6  1 ? ? 
3.600 3.690  ? ? ? ? ? 1209 ? 99.900 ? ? ? ? 0.217 ? ? ? ? ? ? ? ? 3.400 ? 0.923 ? ? ? ? 0 7  1 ? ? 
3.690 3.790  ? ? ? ? ? 1172 ? 99.600 ? ? ? ? 0.201 ? ? ? ? ? ? ? ? 3.700 ? 1.038 ? ? ? ? 0 8  1 ? ? 
3.790 3.900  ? ? ? ? ? 1200 ? 99.700 ? ? ? ? 0.183 ? ? ? ? ? ? ? ? 3.600 ? 1.082 ? ? ? ? 0 9  1 ? ? 
3.900 4.030  ? ? ? ? ? 1169 ? 99.700 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 3.600 ? 1.160 ? ? ? ? 0 10 1 ? ? 
4.030 4.170  ? ? ? ? ? 1222 ? 99.400 ? ? ? ? 0.161 ? ? ? ? ? ? ? ? 3.400 ? 1.353 ? ? ? ? 0 11 1 ? ? 
4.170 4.340  ? ? ? ? ? 1166 ? 99.800 ? ? ? ? 0.157 ? ? ? ? ? ? ? ? 3.600 ? 1.293 ? ? ? ? 0 12 1 ? ? 
4.340 4.540  ? ? ? ? ? 1205 ? 99.900 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 3.500 ? 1.389 ? ? ? ? 0 13 1 ? ? 
4.540 4.780  ? ? ? ? ? 1204 ? 99.900 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 3.400 ? 1.408 ? ? ? ? 0 14 1 ? ? 
4.780 5.070  ? ? ? ? ? 1203 ? 99.900 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 3.600 ? 1.321 ? ? ? ? 0 15 1 ? ? 
5.070 5.460  ? ? ? ? ? 1226 ? 99.400 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 3.600 ? 1.347 ? ? ? ? 0 16 1 ? ? 
5.460 6.010  ? ? ? ? ? 1209 ? 99.300 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 3.500 ? 1.144 ? ? ? ? 0 17 1 ? ? 
6.010 6.870  ? ? ? ? ? 1222 ? 99.900 ? ? ? ? 0.127 ? ? ? ? ? ? ? ? 3.400 ? 1.107 ? ? ? ? 0 18 1 ? ? 
6.870 8.620  ? ? ? ? ? 1267 ? 99.600 ? ? ? ? 0.107 ? ? ? ? ? ? ? ? 3.500 ? 1.272 ? ? ? ? 0 19 1 ? ? 
8.620 30.000 ? ? ? ? ? 1337 ? 99.600 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 3.200 ? 1.556 ? ? ? ? 0 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                255.680 
_refine.B_iso_mean                               52.4500 
_refine.B_iso_min                                6.310 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4X4R 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.2020 
_refine.ls_d_res_low                             29.9060 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24030 
_refine.ls_number_reflns_R_free                  1230 
_refine.ls_number_reflns_R_work                  22800 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.4800 
_refine.ls_percent_reflns_R_free                 5.1200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2116 
_refine.ls_R_factor_R_free                       0.2664 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2087 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.360 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.1400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.7895 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.2020 
_refine_hist.d_res_low                        29.9060 
_refine_hist.pdbx_number_atoms_ligand         254 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8975 
_refine_hist.pdbx_number_residues_total       945 
_refine_hist.pdbx_B_iso_mean_ligand           80.06 
_refine_hist.pdbx_number_atoms_protein        7298 
_refine_hist.pdbx_number_atoms_nucleic_acid   1423 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 9153  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.684  ? 12635 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.028  ? 1387  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1375  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.639 ? 3716  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 3991 6.580 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL C 3991 6.580 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 TORSIONAL B 540  6.580 ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 2 2 TORSIONAL D 540  6.580 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2022 3.3303  2542 . 137 2405 98.0000  . . . 0.3778 . 0.2790 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.3303 3.4816  2658 . 124 2534 100.0000 . . . 0.3594 . 0.2645 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.4816 3.6649  2639 . 138 2501 100.0000 . . . 0.3087 . 0.2397 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.6649 3.8940  2624 . 118 2506 100.0000 . . . 0.3096 . 0.2178 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 3.8940 4.1939  2668 . 126 2542 100.0000 . . . 0.2570 . 0.2157 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 4.1939 4.6146  2647 . 142 2505 100.0000 . . . 0.2539 . 0.1858 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 4.6146 5.2792  2698 . 138 2560 100.0000 . . . 0.2474 . 0.1826 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 5.2792 6.6392  2707 . 168 2539 99.0000  . . . 0.2820 . 0.2029 . . . . . . 9 . . . 
'X-RAY DIFFRACTION' 6.6392 29.9077 2847 . 139 2708 100.0000 . . . 0.1708 . 0.1743 . . . . . . 9 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 'chain A and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' 
1 2 'chain C and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' 
2 1 'chain B and (resseq 1:17 or resseq 20:25 )'                     
2 2 'chain D and (resseq 1:17 or resseq 20:25 )'                     
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 3   A 89  'chain A and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' ? ? ? ? ? ? ? ? 
1 1 2 ? A 100 A 257 'chain A and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' ? ? ? ? ? ? ? ? 
1 1 3 ? A 262 A 437 'chain A and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' ? ? ? ? ? ? ? ? 
1 2 1 ? C 3   C 89  'chain C and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' ? ? ? ? ? ? ? ? 
1 2 2 ? C 100 C 257 'chain C and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' ? ? ? ? ? ? ? ? 
1 2 3 ? C 262 C 437 'chain C and (resseq 3:89 or resseq 100:257 or resseq 262:437 )' ? ? ? ? ? ? ? ? 
2 1 1 ? B 1   B 17  'chain B and (resseq 1:17 or resseq 20:25 )'                     ? ? ? ? ? ? ? ? 
2 1 2 ? B 20  B 25  'chain B and (resseq 1:17 or resseq 20:25 )'                     ? ? ? ? ? ? ? ? 
2 2 1 ? D 1   D 17  'chain D and (resseq 1:17 or resseq 20:25 )'                     ? ? ? ? ? ? ? ? 
2 2 2 ? D 20  D 25  'chain D and (resseq 1:17 or resseq 20:25 )'                     ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                     4X4R 
_struct.title                        
'Crystal structure of the A.fulgidus CCA-adding enzyme in complex with a G70A arginyl-tRNA minihelix ending in CCACC and AMPcPP' 
_struct.pdbx_descriptor              'A.fulgidus CCA-adding enzyme/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X4R 
_struct_keywords.text            
'protein-RNA complex, tRNA, non-coding RNA, CCA-adding enzyme, nucleotidyltransferase, ncRNA, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 4 ? 
L N N 5 ? 
M N N 7 ? 
N N N 8 ? 
O N N 9 ? 
# 
_struct_biol.details                      'One CCA-adding enzyme and one tRNA molecule for the biologically functional unit.' 
_struct_biol.id                           1 
_struct_biol.pdbx_parent_biol_id          ? 
_struct_biol.pdbx_formula_weight          ? 
_struct_biol.pdbx_formula_weight_method   ? 
_struct_biol.pdbx_aggregation_state       ? 
_struct_biol.pdbx_assembly_method         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 2   ? ILE A 15  ? LYS A 2   ILE A 15  1 ? 14 
HELX_P HELX_P2  AA2 ASP A 17  ? LEU A 38  ? ASP A 17  LEU A 38  1 ? 22 
HELX_P HELX_P3  AA3 GLY A 46  ? ARG A 50  ? GLY A 46  ARG A 50  1 ? 5  
HELX_P HELX_P4  AA4 SER A 71  ? LEU A 87  ? SER A 71  LEU A 87  1 ? 17 
HELX_P HELX_P5  AA5 ARG A 129 ? GLU A 138 ? ARG A 129 GLU A 138 1 ? 10 
HELX_P HELX_P6  AA6 LYS A 144 ? ALA A 157 ? LYS A 144 ALA A 157 1 ? 14 
HELX_P HELX_P7  AA7 SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P8  AA8 SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P9  AA9 ALA A 204 ? GLY A 206 ? ALA A 204 GLY A 206 5 ? 3  
HELX_P HELX_P10 AB1 SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P11 AB2 SER A 250 ? PHE A 254 ? SER A 250 PHE A 254 5 ? 5  
HELX_P HELX_P12 AB3 GLU A 263 ? GLY A 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P13 AB4 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P14 AB5 ASP A 351 ? ARG A 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P15 AB6 THR A 384 ? HIS A 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P16 AB7 TRP A 397 ? LEU A 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P17 AB8 GLY A 401 ? TYR A 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P18 AB9 GLY A 417 ? LYS A 422 ? GLY A 417 LYS A 422 1 ? 6  
HELX_P HELX_P19 AC1 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P20 AC2 LYS C 2   ? ILE C 15  ? LYS C 2   ILE C 15  1 ? 14 
HELX_P HELX_P21 AC3 ASP C 17  ? GLY C 39  ? ASP C 17  GLY C 39  1 ? 23 
HELX_P HELX_P22 AC4 GLY C 46  ? ARG C 50  ? GLY C 46  ARG C 50  1 ? 5  
HELX_P HELX_P23 AC5 SER C 71  ? LEU C 87  ? SER C 71  LEU C 87  1 ? 17 
HELX_P HELX_P24 AC6 ASP C 128 ? GLU C 138 ? ASP C 128 GLU C 138 1 ? 11 
HELX_P HELX_P25 AC7 LYS C 144 ? ALA C 157 ? LYS C 144 ALA C 157 1 ? 14 
HELX_P HELX_P26 AC8 SER C 171 ? GLY C 183 ? SER C 171 GLY C 183 1 ? 13 
HELX_P HELX_P27 AC9 SER C 184 ? ARG C 193 ? SER C 184 ARG C 193 1 ? 10 
HELX_P HELX_P28 AD1 ALA C 204 ? GLY C 206 ? ALA C 204 GLY C 206 5 ? 3  
HELX_P HELX_P29 AD2 SER C 231 ? ALA C 248 ? SER C 231 ALA C 248 1 ? 18 
HELX_P HELX_P30 AD3 SER C 250 ? LYS C 255 ? SER C 250 LYS C 255 5 ? 6  
HELX_P HELX_P31 AD4 GLU C 263 ? GLY C 275 ? GLU C 263 GLY C 275 1 ? 13 
HELX_P HELX_P32 AD5 VAL C 289 ? GLU C 311 ? VAL C 289 GLU C 311 1 ? 23 
HELX_P HELX_P33 AD6 ASP C 351 ? ARG C 361 ? ASP C 351 ARG C 361 1 ? 11 
HELX_P HELX_P34 AD7 THR C 384 ? HIS C 396 ? THR C 384 HIS C 396 1 ? 13 
HELX_P HELX_P35 AD8 TRP C 397 ? LEU C 400 ? TRP C 397 LEU C 400 5 ? 4  
HELX_P HELX_P36 AD9 GLY C 401 ? TYR C 411 ? GLY C 401 TYR C 411 1 ? 11 
HELX_P HELX_P37 AE1 GLY C 417 ? LYS C 422 ? GLY C 417 LYS C 422 1 ? 6  
HELX_P HELX_P38 AE2 VAL C 425 ? GLY C 434 ? VAL C 425 GLY C 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 61 OD2 ? ? ? 1_555 G MG .  MG ? ? A ASP 61  A MG 502 1_555 ? ? ? ? ? ? ?                    2.650 ? 
metalc2  metalc ? ? C SER 47 OG  ? ? ? 1_555 L MG .  MG ? ? C SER 47  C MG 502 1_555 ? ? ? ? ? ? ?                    2.923 ? 
metalc3  metalc ? ? C ASP 61 OD2 ? ? ? 1_555 L MG .  MG ? ? C ASP 61  C MG 502 1_555 ? ? ? ? ? ? ?                    2.624 ? 
metalc4  metalc ? ? F APC .  O2G ? ? ? 1_555 G MG .  MG ? ? A APC 501 A MG 502 1_555 ? ? ? ? ? ? ?                    2.914 ? 
metalc5  metalc ? ? F APC .  O1B ? ? ? 1_555 G MG .  MG ? ? A APC 501 A MG 502 1_555 ? ? ? ? ? ? ?                    2.631 ? 
metalc6  metalc ? ? K APC .  O1B ? ? ? 1_555 L MG .  MG ? ? C APC 501 C MG 502 1_555 ? ? ? ? ? ? ?                    2.387 ? 
hydrog1  hydrog ? ? B G   1  N1  ? ? ? 1_555 B C  34 N3 ? ? B G   1   B C  34  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2  hydrog ? ? B G   1  N2  ? ? ? 1_555 B C  34 O2 ? ? B G   1   B C  34  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3  hydrog ? ? B G   1  O6  ? ? ? 1_555 B C  34 N4 ? ? B G   1   B C  34  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4  hydrog ? ? B G   2  N1  ? ? ? 1_555 B C  33 N3 ? ? B G   2   B C  33  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5  hydrog ? ? B G   2  N2  ? ? ? 1_555 B C  33 O2 ? ? B G   2   B C  33  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6  hydrog ? ? B G   2  O6  ? ? ? 1_555 B C  33 N4 ? ? B G   2   B C  33  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7  hydrog ? ? B C   3  N3  ? ? ? 1_555 B G  32 N1 ? ? B C   3   B G  32  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8  hydrog ? ? B C   3  N4  ? ? ? 1_555 B G  32 O6 ? ? B C   3   B G  32  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9  hydrog ? ? B C   3  O2  ? ? ? 1_555 B G  32 N2 ? ? B C   3   B G  32  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10 hydrog ? ? B C   4  O2  ? ? ? 1_555 B G  28 N2 ? ? B C   4   B G  28  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog11 hydrog ? ? B G   5  N1  ? ? ? 1_555 B C  27 N3 ? ? B G   5   B C  27  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog12 hydrog ? ? B C   6  N3  ? ? ? 1_555 B G  26 N1 ? ? B C   6   B G  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13 hydrog ? ? B C   6  N4  ? ? ? 1_555 B G  26 O6 ? ? B C   6   B G  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14 hydrog ? ? B C   6  O2  ? ? ? 1_555 B G  26 N2 ? ? B C   6   B G  26  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15 hydrog ? ? B G   7  N1  ? ? ? 1_555 B C  25 N3 ? ? B G   7   B C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog16 hydrog ? ? B G   7  N2  ? ? ? 1_555 B C  25 O2 ? ? B G   7   B C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog17 hydrog ? ? B G   7  O6  ? ? ? 1_555 B C  25 N4 ? ? B G   7   B C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog18 hydrog ? ? B G   8  N1  ? ? ? 1_555 B C  24 N3 ? ? B G   8   B C  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19 hydrog ? ? B G   8  N2  ? ? ? 1_555 B C  24 O2 ? ? B G   8   B C  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20 hydrog ? ? B G   8  O6  ? ? ? 1_555 B C  24 N4 ? ? B G   8   B C  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21 hydrog ? ? B C   9  N3  ? ? ? 1_555 B G  23 N1 ? ? B C   9   B G  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22 hydrog ? ? B C   9  N4  ? ? ? 1_555 B G  23 O6 ? ? B C   9   B G  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23 hydrog ? ? B C   9  O2  ? ? ? 1_555 B G  23 N2 ? ? B C   9   B G  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog24 hydrog ? ? B A   10 N1  ? ? ? 1_555 B U  22 N3 ? ? B A   10  B U  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25 hydrog ? ? B A   10 N6  ? ? ? 1_555 B U  22 O4 ? ? B A   10  B U  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26 hydrog ? ? B G   11 N1  ? ? ? 1_555 B C  21 N3 ? ? B G   11  B C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27 hydrog ? ? B G   11 N2  ? ? ? 1_555 B C  21 O2 ? ? B G   11  B C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog28 hydrog ? ? B G   11 O6  ? ? ? 1_555 B C  21 N4 ? ? B G   11  B C  21  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29 hydrog ? ? B G   12 N1  ? ? ? 1_555 B C  20 N3 ? ? B G   12  B C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30 hydrog ? ? B G   12 N2  ? ? ? 1_555 B C  20 O2 ? ? B G   12  B C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31 hydrog ? ? B G   12 O6  ? ? ? 1_555 B C  20 N4 ? ? B G   12  B C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog32 hydrog ? ? B U   13 N3  ? ? ? 1_555 B A  17 N7 ? ? B U   13  B A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog33 hydrog ? ? B U   13 O2  ? ? ? 1_555 B A  17 N6 ? ? B U   13  B A  17  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog34 hydrog ? ? D G   1  N1  ? ? ? 1_555 D C  34 N3 ? ? D G   1   D C  34  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog35 hydrog ? ? D G   1  N2  ? ? ? 1_555 D C  34 O2 ? ? D G   1   D C  34  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog36 hydrog ? ? D G   1  O6  ? ? ? 1_555 D C  34 N4 ? ? D G   1   D C  34  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog37 hydrog ? ? D G   2  N1  ? ? ? 1_555 D C  33 N3 ? ? D G   2   D C  33  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog38 hydrog ? ? D G   2  N2  ? ? ? 1_555 D C  33 O2 ? ? D G   2   D C  33  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog39 hydrog ? ? D G   2  O6  ? ? ? 1_555 D C  33 N4 ? ? D G   2   D C  33  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog40 hydrog ? ? D C   3  O2  ? ? ? 1_555 D G  32 N2 ? ? D C   3   D G  32  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog41 hydrog ? ? D G   7  N1  ? ? ? 1_555 D C  25 N3 ? ? D G   7   D C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42 hydrog ? ? D G   7  N2  ? ? ? 1_555 D C  25 O2 ? ? D G   7   D C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog43 hydrog ? ? D G   7  O6  ? ? ? 1_555 D C  25 N4 ? ? D G   7   D C  25  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog44 hydrog ? ? D G   8  N1  ? ? ? 1_555 D C  24 N3 ? ? D G   8   D C  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog45 hydrog ? ? D G   8  N2  ? ? ? 1_555 D C  24 O2 ? ? D G   8   D C  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46 hydrog ? ? D G   8  O6  ? ? ? 1_555 D C  24 N4 ? ? D G   8   D C  24  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47 hydrog ? ? D C   9  N3  ? ? ? 1_555 D G  23 N1 ? ? D C   9   D G  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48 hydrog ? ? D C   9  N4  ? ? ? 1_555 D G  23 O6 ? ? D C   9   D G  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog49 hydrog ? ? D C   9  O2  ? ? ? 1_555 D G  23 N2 ? ? D C   9   D G  23  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog50 hydrog ? ? D A   10 N1  ? ? ? 1_555 D U  22 N3 ? ? D A   10  D U  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog51 hydrog ? ? D A   10 N6  ? ? ? 1_555 D U  22 O4 ? ? D A   10  D U  22  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog52 hydrog ? ? D G   11 N2  ? ? ? 1_555 D C  21 O2 ? ? D G   11  D C  21  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog53 hydrog ? ? D G   12 N1  ? ? ? 1_555 D C  20 N3 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog54 hydrog ? ? D G   12 N2  ? ? ? 1_555 D C  20 O2 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog55 hydrog ? ? D G   12 O6  ? ? ? 1_555 D C  20 N4 ? ? D G   12  D C  20  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog56 hydrog ? ? D C   15 N3  ? ? ? 1_555 E G  2  N1 ? ? D C   15  H G  2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog57 hydrog ? ? D C   15 N4  ? ? ? 1_555 E G  2  O6 ? ? D C   15  H G  2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog58 hydrog ? ? D C   15 O2  ? ? ? 1_555 E G  2  N2 ? ? D C   15  H G  2   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog59 hydrog ? ? D G   16 N1  ? ? ? 1_555 E C  1  N3 ? ? D G   16  H C  1   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog60 hydrog ? ? D G   16 N2  ? ? ? 1_555 E C  1  O2 ? ? D G   16  H C  1   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog61 hydrog ? ? D G   16 O6  ? ? ? 1_555 E C  1  N4 ? ? D G   16  H C  1   1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 5 ? 
AA7 ? 4 ? 
AA8 ? 4 ? 
AA9 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
AA1 2 GLU A 59  ? PHE A 66  ? GLU A 59  PHE A 66  
AA1 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
AA1 4 VAL A 100 ? VAL A 104 ? VAL A 100 VAL A 104 
AA1 5 SER A 89  ? GLU A 91  ? SER A 89  GLU A 91  
AA2 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
AA2 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
AA2 3 PHE A 215 ? ASP A 218 ? PHE A 215 ASP A 218 
AA2 4 ASP A 221 ? ASN A 225 ? ASP A 221 ASN A 225 
AA3 1 HIS A 258 ? PRO A 259 ? HIS A 258 PRO A 259 
AA3 2 ASN A 439 ? SER A 440 ? ASN A 439 SER A 440 
AA4 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
AA4 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
AA4 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
AA4 4 GLU A 413 ? SER A 416 ? GLU A 413 SER A 416 
AA5 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
AA5 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
AA5 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
AA6 1 TYR C 42  ? VAL C 45  ? TYR C 42  VAL C 45  
AA6 2 GLU C 59  ? PHE C 66  ? GLU C 59  PHE C 66  
AA6 3 VAL C 107 ? TYR C 115 ? VAL C 107 TYR C 115 
AA6 4 VAL C 100 ? VAL C 104 ? VAL C 100 VAL C 104 
AA6 5 SER C 89  ? GLU C 91  ? SER C 89  GLU C 91  
AA7 1 GLU C 207 ? LYS C 210 ? GLU C 207 LYS C 210 
AA7 2 THR C 199 ? ASP C 202 ? THR C 199 ASP C 202 
AA7 3 PHE C 215 ? ASP C 218 ? PHE C 215 ASP C 218 
AA7 4 ASP C 221 ? ASN C 225 ? ASP C 221 ASN C 225 
AA8 1 PRO C 315 ? ALA C 322 ? PRO C 315 ALA C 322 
AA8 2 PHE C 326 ? CYS C 333 ? PHE C 326 CYS C 333 
AA8 3 ALA C 277 ? ARG C 284 ? ALA C 277 ARG C 284 
AA8 4 GLU C 413 ? SER C 416 ? GLU C 413 SER C 416 
AA9 1 VAL C 341 ? GLN C 348 ? VAL C 341 GLN C 348 
AA9 2 ARG C 373 ? MET C 379 ? ARG C 373 MET C 379 
AA9 3 PHE C 368 ? GLU C 370 ? PHE C 368 GLU C 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
AA1 2 3 N ILE A 60  ? N ILE A 60  O GLU A 108 ? O GLU A 108 
AA1 3 4 O VAL A 111 ? O VAL A 111 N VAL A 100 ? N VAL A 100 
AA1 4 5 O VAL A 103 ? O VAL A 103 N SER A 89  ? N SER A 89  
AA2 1 2 O ARG A 209 ? O ARG A 209 N VAL A 200 ? N VAL A 200 
AA2 2 3 N ILE A 201 ? N ILE A 201 O PHE A 215 ? O PHE A 215 
AA2 3 4 N ASP A 218 ? N ASP A 218 O ARG A 224 ? O ARG A 224 
AA3 1 2 N HIS A 258 ? N HIS A 258 O SER A 440 ? O SER A 440 
AA4 1 2 N LEU A 316 ? N LEU A 316 O GLU A 332 ? O GLU A 332 
AA4 2 3 O CYS A 333 ? O CYS A 333 N ALA A 277 ? N ALA A 277 
AA4 3 4 N ALA A 280 ? N ALA A 280 O ILE A 415 ? O ILE A 415 
AA5 1 2 N GLY A 346 ? N GLY A 346 O TRP A 374 ? O TRP A 374 
AA5 2 3 O TRP A 375 ? O TRP A 375 N PHE A 368 ? N PHE A 368 
AA6 1 2 N VAL C 43  ? N VAL C 43  O PHE C 63  ? O PHE C 63  
AA6 2 3 N LEU C 64  ? N LEU C 64  O VAL C 112 ? O VAL C 112 
AA6 3 4 O VAL C 109 ? O VAL C 109 N GLY C 102 ? N GLY C 102 
AA6 4 5 O HIS C 101 ? O HIS C 101 N GLU C 91  ? N GLU C 91  
AA7 1 2 O ARG C 209 ? O ARG C 209 N VAL C 200 ? N VAL C 200 
AA7 2 3 N ILE C 201 ? N ILE C 201 O PHE C 215 ? O PHE C 215 
AA7 3 4 N ASP C 218 ? N ASP C 218 O ARG C 224 ? O ARG C 224 
AA8 1 2 N ALA C 319 ? N ALA C 319 O LEU C 330 ? O LEU C 330 
AA8 2 3 O CYS C 333 ? O CYS C 333 N ALA C 277 ? N ALA C 277 
AA8 3 4 N LYS C 282 ? N LYS C 282 O GLU C 413 ? O GLU C 413 
AA9 1 2 N GLY C 346 ? N GLY C 346 O TRP C 374 ? O TRP C 374 
AA9 2 3 O TRP C 375 ? O TRP C 375 N PHE C 368 ? N PHE C 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A APC 501 ? 13 'binding site for residue APC A 501' 
AC2 Software A MG  502 ? 4  'binding site for residue MG A 502'  
AC3 Software A MES 503 ? 2  'binding site for residue MES A 503' 
AC4 Software A GOL 504 ? 3  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 3  'binding site for residue GOL A 505' 
AC6 Software C APC 501 ? 15 'binding site for residue APC C 501' 
AC7 Software C MG  502 ? 4  'binding site for residue MG C 502'  
AC8 Software C GOL 503 ? 2  'binding site for residue GOL C 503' 
AC9 Software C TAR 504 ? 7  'binding site for residue TAR C 504' 
AD1 Software C PEG 505 ? 5  'binding site for residue PEG C 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 SER A 47  ? SER A 47  . ? 1_555 ? 
2  AC1 13 ARG A 50  ? ARG A 50  . ? 1_555 ? 
3  AC1 13 GLU A 59  ? GLU A 59  . ? 1_555 ? 
4  AC1 13 ASP A 61  ? ASP A 61  . ? 1_555 ? 
5  AC1 13 THR A 130 ? THR A 130 . ? 1_555 ? 
6  AC1 13 HIS A 133 ? HIS A 133 . ? 1_555 ? 
7  AC1 13 LYS A 152 ? LYS A 152 . ? 1_555 ? 
8  AC1 13 TYR A 161 ? TYR A 161 . ? 1_555 ? 
9  AC1 13 ARG A 224 ? ARG A 224 . ? 1_555 ? 
10 AC1 13 MG  G .   ? MG  A 502 . ? 1_555 ? 
11 AC1 13 A   B 35  ? A   B 35  . ? 1_555 ? 
12 AC1 13 C   B 36  ? C   B 36  . ? 1_555 ? 
13 AC1 13 C   B 37  ? C   B 37  . ? 1_555 ? 
14 AC2 4  SER A 47  ? SER A 47  . ? 1_555 ? 
15 AC2 4  GLU A 59  ? GLU A 59  . ? 1_555 ? 
16 AC2 4  ASP A 61  ? ASP A 61  . ? 1_555 ? 
17 AC2 4  APC F .   ? APC A 501 . ? 1_555 ? 
18 AC3 2  ILE A 92  ? ILE A 92  . ? 1_555 ? 
19 AC3 2  TYR A 94  ? TYR A 94  . ? 1_555 ? 
20 AC4 3  VAL A 200 ? VAL A 200 . ? 1_555 ? 
21 AC4 3  ARG A 209 ? ARG A 209 . ? 1_555 ? 
22 AC4 3  GLU A 222 ? GLU A 222 . ? 1_555 ? 
23 AC5 3  ARG A 317 ? ARG A 317 . ? 1_555 ? 
24 AC5 3  SER A 318 ? SER A 318 . ? 1_555 ? 
25 AC5 3  GLU C 370 ? GLU C 370 . ? 1_555 ? 
26 AC6 15 GLY C 46  ? GLY C 46  . ? 1_555 ? 
27 AC6 15 SER C 47  ? SER C 47  . ? 1_555 ? 
28 AC6 15 ARG C 50  ? ARG C 50  . ? 1_555 ? 
29 AC6 15 GLU C 59  ? GLU C 59  . ? 1_555 ? 
30 AC6 15 ASP C 61  ? ASP C 61  . ? 1_555 ? 
31 AC6 15 THR C 130 ? THR C 130 . ? 1_555 ? 
32 AC6 15 HIS C 133 ? HIS C 133 . ? 1_555 ? 
33 AC6 15 LYS C 152 ? LYS C 152 . ? 1_555 ? 
34 AC6 15 TYR C 161 ? TYR C 161 . ? 1_555 ? 
35 AC6 15 TYR C 173 ? TYR C 173 . ? 1_555 ? 
36 AC6 15 ARG C 224 ? ARG C 224 . ? 1_555 ? 
37 AC6 15 MG  L .   ? MG  C 502 . ? 1_555 ? 
38 AC6 15 A   D 35  ? A   D 35  . ? 1_555 ? 
39 AC6 15 C   D 36  ? C   D 36  . ? 1_555 ? 
40 AC6 15 C   D 37  ? C   D 37  . ? 1_555 ? 
41 AC7 4  SER C 47  ? SER C 47  . ? 1_555 ? 
42 AC7 4  GLU C 59  ? GLU C 59  . ? 1_555 ? 
43 AC7 4  ASP C 61  ? ASP C 61  . ? 1_555 ? 
44 AC7 4  APC K .   ? APC C 501 . ? 1_555 ? 
45 AC8 2  GLU C 311 ? GLU C 311 . ? 1_555 ? 
46 AC8 2  ARG C 344 ? ARG C 344 . ? 1_555 ? 
47 AC9 7  HIS A 240 ? HIS A 240 . ? 1_555 ? 
48 AC9 7  ARG A 243 ? ARG A 243 . ? 1_555 ? 
49 AC9 7  GLU A 244 ? GLU A 244 . ? 1_555 ? 
50 AC9 7  GLU A 247 ? GLU A 247 . ? 1_555 ? 
51 AC9 7  GLU C 352 ? GLU C 352 . ? 1_555 ? 
52 AC9 7  VAL C 355 ? VAL C 355 . ? 1_555 ? 
53 AC9 7  LYS C 356 ? LYS C 356 . ? 1_555 ? 
54 AD1 5  PHE A 349 ? PHE A 349 . ? 1_555 ? 
55 AD1 5  GLU A 352 ? GLU A 352 . ? 1_555 ? 
56 AD1 5  VAL A 355 ? VAL A 355 . ? 1_555 ? 
57 AD1 5  HIS C 240 ? HIS C 240 . ? 1_555 ? 
58 AD1 5  ARG C 243 ? ARG C 243 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X4R 
_atom_sites.fract_transf_matrix[1][1]   0.009001 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004600 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017076 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . MET A 1 1   ? 38.273  54.511  44.509  1.00 86.66  ? 1   MET A N      1 
ATOM   2     C  CA     . MET A 1 1   ? 37.741  53.359  43.725  1.00 90.33  ? 1   MET A CA     1 
ATOM   3     C  C      . MET A 1 1   ? 37.473  52.148  44.624  1.00 94.27  ? 1   MET A C      1 
ATOM   4     O  O      . MET A 1 1   ? 37.652  51.001  44.208  1.00 75.41  ? 1   MET A O      1 
ATOM   5     C  CB     . MET A 1 1   ? 38.714  52.984  42.601  1.00 61.57  ? 1   MET A CB     1 
ATOM   6     C  CG     . MET A 1 1   ? 38.733  53.968  41.439  1.00 98.01  ? 1   MET A CG     1 
ATOM   7     S  SD     . MET A 1 1   ? 37.207  53.948  40.472  1.00 142.82 ? 1   MET A SD     1 
ATOM   8     C  CE     . MET A 1 1   ? 37.697  54.888  39.026  1.00 94.39  ? 1   MET A CE     1 
ATOM   9     H  H1     . MET A 1 1   ? 38.445  55.189  43.960  1.00 103.99 ? 1   MET A H1     1 
ATOM   10    H  H2     . MET A 1 1   ? 37.669  54.763  45.112  1.00 103.99 ? 1   MET A H2     1 
ATOM   11    H  H3     . MET A 1 1   ? 39.022  54.267  44.923  1.00 103.99 ? 1   MET A H3     1 
ATOM   12    H  HA     . MET A 1 1   ? 36.906  53.627  43.311  1.00 108.40 ? 1   MET A HA     1 
ATOM   13    H  HB2    . MET A 1 1   ? 39.611  52.942  42.968  1.00 73.88  ? 1   MET A HB2    1 
ATOM   14    H  HB3    . MET A 1 1   ? 38.463  52.116  42.249  1.00 73.88  ? 1   MET A HB3    1 
ATOM   15    H  HG2    . MET A 1 1   ? 38.855  54.865  41.788  1.00 117.62 ? 1   MET A HG2    1 
ATOM   16    H  HG3    . MET A 1 1   ? 39.466  53.741  40.846  1.00 117.62 ? 1   MET A HG3    1 
ATOM   17    H  HE1    . MET A 1 1   ? 36.943  54.947  38.419  1.00 113.27 ? 1   MET A HE1    1 
ATOM   18    H  HE2    . MET A 1 1   ? 37.969  55.776  39.305  1.00 113.27 ? 1   MET A HE2    1 
ATOM   19    H  HE3    . MET A 1 1   ? 38.437  54.436  38.593  1.00 113.27 ? 1   MET A HE3    1 
ATOM   20    N  N      . LYS A 1 2   ? 37.047  52.414  45.857  1.00 72.53  ? 2   LYS A N      1 
ATOM   21    C  CA     . LYS A 1 2   ? 36.547  51.366  46.742  1.00 65.08  ? 2   LYS A CA     1 
ATOM   22    C  C      . LYS A 1 2   ? 35.043  51.221  46.515  1.00 68.05  ? 2   LYS A C      1 
ATOM   23    O  O      . LYS A 1 2   ? 34.397  52.156  46.043  1.00 72.16  ? 2   LYS A O      1 
ATOM   24    C  CB     . LYS A 1 2   ? 36.846  51.691  48.208  1.00 71.75  ? 2   LYS A CB     1 
ATOM   25    C  CG     . LYS A 1 2   ? 36.704  50.499  49.150  1.00 75.85  ? 2   LYS A CG     1 
ATOM   26    C  CD     . LYS A 1 2   ? 36.785  50.912  50.614  1.00 78.85  ? 2   LYS A CD     1 
ATOM   27    C  CE     . LYS A 1 2   ? 35.512  51.612  51.086  1.00 86.93  ? 2   LYS A CE     1 
ATOM   28    N  NZ     . LYS A 1 2   ? 34.305  50.733  51.029  1.00 43.76  ? 2   LYS A NZ     1 
ATOM   29    H  H      . LYS A 1 2   ? 37.037  53.199  46.207  1.00 87.03  ? 2   LYS A H      1 
ATOM   30    H  HA     . LYS A 1 2   ? 36.974  50.524  46.520  1.00 78.10  ? 2   LYS A HA     1 
ATOM   31    H  HB2    . LYS A 1 2   ? 37.758  52.015  48.275  1.00 86.10  ? 2   LYS A HB2    1 
ATOM   32    H  HB3    . LYS A 1 2   ? 36.231  52.379  48.506  1.00 86.10  ? 2   LYS A HB3    1 
ATOM   33    H  HG2    . LYS A 1 2   ? 35.843  50.078  49.002  1.00 91.02  ? 2   LYS A HG2    1 
ATOM   34    H  HG3    . LYS A 1 2   ? 37.419  49.868  48.974  1.00 91.02  ? 2   LYS A HG3    1 
ATOM   35    H  HD2    . LYS A 1 2   ? 36.914  50.121  51.161  1.00 94.62  ? 2   LYS A HD2    1 
ATOM   36    H  HD3    . LYS A 1 2   ? 37.528  51.524  50.732  1.00 94.62  ? 2   LYS A HD3    1 
ATOM   37    H  HE2    . LYS A 1 2   ? 35.631  51.897  52.005  1.00 104.32 ? 2   LYS A HE2    1 
ATOM   38    H  HE3    . LYS A 1 2   ? 35.348  52.382  50.519  1.00 104.32 ? 2   LYS A HE3    1 
ATOM   39    H  HZ1    . LYS A 1 2   ? 33.589  51.181  51.311  1.00 52.52  ? 2   LYS A HZ1    1 
ATOM   40    H  HZ2    . LYS A 1 2   ? 34.165  50.462  50.193  1.00 52.52  ? 2   LYS A HZ2    1 
ATOM   41    H  HZ3    . LYS A 1 2   ? 34.423  50.020  51.548  1.00 52.52  ? 2   LYS A HZ3    1 
ATOM   42    N  N      . VAL A 1 3   ? 34.495  50.054  46.846  1.00 91.24  ? 3   VAL A N      1 
ATOM   43    C  CA     . VAL A 1 3   ? 33.083  49.757  46.596  1.00 81.25  ? 3   VAL A CA     1 
ATOM   44    C  C      . VAL A 1 3   ? 32.135  50.854  47.074  1.00 71.98  ? 3   VAL A C      1 
ATOM   45    O  O      . VAL A 1 3   ? 31.100  51.085  46.458  1.00 66.97  ? 3   VAL A O      1 
ATOM   46    C  CB     . VAL A 1 3   ? 32.656  48.427  47.262  1.00 83.08  ? 3   VAL A CB     1 
ATOM   47    C  CG1    . VAL A 1 3   ? 33.335  47.246  46.586  1.00 77.92  ? 3   VAL A CG1    1 
ATOM   48    C  CG2    . VAL A 1 3   ? 32.950  48.448  48.759  1.00 102.49 ? 3   VAL A CG2    1 
ATOM   49    H  H      . VAL A 1 3   ? 34.924  49.410  47.221  1.00 109.49 ? 3   VAL A H      1 
ATOM   50    H  HA     . VAL A 1 3   ? 32.955  49.658  45.640  1.00 97.50  ? 3   VAL A HA     1 
ATOM   51    H  HB     . VAL A 1 3   ? 31.699  48.319  47.152  1.00 99.70  ? 3   VAL A HB     1 
ATOM   52    H  HG11   . VAL A 1 3   ? 33.051  46.427  47.021  1.00 93.50  ? 3   VAL A HG11   1 
ATOM   53    H  HG12   . VAL A 1 3   ? 33.080  47.229  45.650  1.00 93.50  ? 3   VAL A HG12   1 
ATOM   54    H  HG13   . VAL A 1 3   ? 34.296  47.347  46.665  1.00 93.50  ? 3   VAL A HG13   1 
ATOM   55    H  HG21   . VAL A 1 3   ? 32.672  47.603  49.147  1.00 122.99 ? 3   VAL A HG21   1 
ATOM   56    H  HG22   . VAL A 1 3   ? 33.902  48.576  48.892  1.00 122.99 ? 3   VAL A HG22   1 
ATOM   57    H  HG23   . VAL A 1 3   ? 32.458  49.177  49.167  1.00 122.99 ? 3   VAL A HG23   1 
ATOM   58    N  N      . GLU A 1 4   ? 32.483  51.532  48.164  1.00 89.96  ? 4   GLU A N      1 
ATOM   59    C  CA     . GLU A 1 4   ? 31.610  52.563  48.713  1.00 93.37  ? 4   GLU A CA     1 
ATOM   60    C  C      . GLU A 1 4   ? 31.919  53.941  48.131  1.00 85.56  ? 4   GLU A C      1 
ATOM   61    O  O      . GLU A 1 4   ? 31.027  54.777  48.009  1.00 81.70  ? 4   GLU A O      1 
ATOM   62    C  CB     . GLU A 1 4   ? 31.727  52.600  50.237  1.00 102.25 ? 4   GLU A CB     1 
ATOM   63    C  CG     . GLU A 1 4   ? 30.611  53.377  50.920  1.00 112.33 ? 4   GLU A CG     1 
ATOM   64    C  CD     . GLU A 1 4   ? 30.690  53.305  52.432  1.00 138.82 ? 4   GLU A CD     1 
ATOM   65    O  OE1    . GLU A 1 4   ? 31.422  52.437  52.952  1.00 134.37 ? 4   GLU A OE1    1 
ATOM   66    O  OE2    . GLU A 1 4   ? 30.016  54.114  53.103  1.00 143.93 ? 4   GLU A OE2    1 
ATOM   67    H  H      . GLU A 1 4   ? 33.215  51.415  48.601  1.00 107.95 ? 4   GLU A H      1 
ATOM   68    H  HA     . GLU A 1 4   ? 30.691  52.346  48.491  1.00 112.04 ? 4   GLU A HA     1 
ATOM   69    H  HB2    . GLU A 1 4   ? 31.705  51.691  50.574  1.00 122.70 ? 4   GLU A HB2    1 
ATOM   70    H  HB3    . GLU A 1 4   ? 32.569  53.019  50.475  1.00 122.70 ? 4   GLU A HB3    1 
ATOM   71    H  HG2    . GLU A 1 4   ? 30.670  54.310  50.660  1.00 134.79 ? 4   GLU A HG2    1 
ATOM   72    H  HG3    . GLU A 1 4   ? 29.757  53.009  50.646  1.00 134.79 ? 4   GLU A HG3    1 
ATOM   73    N  N      . GLU A 1 5   ? 33.175  54.175  47.764  1.00 89.21  ? 5   GLU A N      1 
ATOM   74    C  CA     . GLU A 1 5   ? 33.559  55.459  47.186  1.00 84.26  ? 5   GLU A CA     1 
ATOM   75    C  C      . GLU A 1 5   ? 32.903  55.645  45.827  1.00 76.82  ? 5   GLU A C      1 
ATOM   76    O  O      . GLU A 1 5   ? 32.658  56.768  45.396  1.00 74.25  ? 5   GLU A O      1 
ATOM   77    C  CB     . GLU A 1 5   ? 35.077  55.572  47.039  1.00 97.08  ? 5   GLU A CB     1 
ATOM   78    C  CG     . GLU A 1 5   ? 35.859  55.375  48.321  1.00 106.05 ? 5   GLU A CG     1 
ATOM   79    C  CD     . GLU A 1 5   ? 37.354  55.445  48.090  1.00 113.06 ? 5   GLU A CD     1 
ATOM   80    O  OE1    . GLU A 1 5   ? 37.765  55.962  47.029  1.00 86.72  ? 5   GLU A OE1    1 
ATOM   81    O  OE2    . GLU A 1 5   ? 38.118  54.980  48.963  1.00 118.44 ? 5   GLU A OE2    1 
ATOM   82    H  H      . GLU A 1 5   ? 33.820  53.612  47.839  1.00 107.05 ? 5   GLU A H      1 
ATOM   83    H  HA     . GLU A 1 5   ? 33.257  56.174  47.768  1.00 101.12 ? 5   GLU A HA     1 
ATOM   84    H  HB2    . GLU A 1 5   ? 35.377  54.900  46.408  1.00 116.49 ? 5   GLU A HB2    1 
ATOM   85    H  HB3    . GLU A 1 5   ? 35.289  56.456  46.700  1.00 116.49 ? 5   GLU A HB3    1 
ATOM   86    H  HG2    . GLU A 1 5   ? 35.617  56.072  48.952  1.00 127.26 ? 5   GLU A HG2    1 
ATOM   87    H  HG3    . GLU A 1 5   ? 35.650  54.503  48.691  1.00 127.26 ? 5   GLU A HG3    1 
ATOM   88    N  N      . ILE A 1 6   ? 32.628  54.533  45.154  1.00 77.23  ? 6   ILE A N      1 
ATOM   89    C  CA     . ILE A 1 6   ? 32.078  54.567  43.806  1.00 62.71  ? 6   ILE A CA     1 
ATOM   90    C  C      . ILE A 1 6   ? 30.572  54.779  43.854  1.00 63.45  ? 6   ILE A C      1 
ATOM   91    O  O      . ILE A 1 6   ? 30.011  55.479  43.014  1.00 53.41  ? 6   ILE A O      1 
ATOM   92    C  CB     . ILE A 1 6   ? 32.400  53.272  43.047  1.00 48.69  ? 6   ILE A CB     1 
ATOM   93    C  CG1    . ILE A 1 6   ? 33.907  53.177  42.814  1.00 63.79  ? 6   ILE A CG1    1 
ATOM   94    C  CG2    . ILE A 1 6   ? 31.658  53.227  41.716  1.00 66.45  ? 6   ILE A CG2    1 
ATOM   95    C  CD1    . ILE A 1 6   ? 34.356  51.873  42.213  1.00 59.54  ? 6   ILE A CD1    1 
ATOM   96    H  H      . ILE A 1 6   ? 32.753  53.739  45.459  1.00 92.68  ? 6   ILE A H      1 
ATOM   97    H  HA     . ILE A 1 6   ? 32.472  55.308  43.320  1.00 75.26  ? 6   ILE A HA     1 
ATOM   98    H  HB     . ILE A 1 6   ? 32.119  52.517  43.587  1.00 58.43  ? 6   ILE A HB     1 
ATOM   99    H  HG12   . ILE A 1 6   ? 34.174  53.888  42.211  1.00 76.55  ? 6   ILE A HG12   1 
ATOM   100   H  HG13   . ILE A 1 6   ? 34.361  53.281  43.665  1.00 76.55  ? 6   ILE A HG13   1 
ATOM   101   H  HG21   . ILE A 1 6   ? 31.879  52.401  41.259  1.00 79.74  ? 6   ILE A HG21   1 
ATOM   102   H  HG22   . ILE A 1 6   ? 30.704  53.267  41.885  1.00 79.74  ? 6   ILE A HG22   1 
ATOM   103   H  HG23   . ILE A 1 6   ? 31.931  53.987  41.177  1.00 79.74  ? 6   ILE A HG23   1 
ATOM   104   H  HD11   . ILE A 1 6   ? 35.319  51.894  42.098  1.00 71.45  ? 6   ILE A HD11   1 
ATOM   105   H  HD12   . ILE A 1 6   ? 34.110  51.149  42.809  1.00 71.45  ? 6   ILE A HD12   1 
ATOM   106   H  HD13   . ILE A 1 6   ? 33.923  51.757  41.353  1.00 71.45  ? 6   ILE A HD13   1 
ATOM   107   N  N      . LEU A 1 7   ? 29.920  54.156  44.828  1.00 63.26  ? 7   LEU A N      1 
ATOM   108   C  CA     . LEU A 1 7   ? 28.490  54.346  45.022  1.00 48.17  ? 7   LEU A CA     1 
ATOM   109   C  C      . LEU A 1 7   ? 28.192  55.780  45.447  1.00 52.49  ? 7   LEU A C      1 
ATOM   110   O  O      . LEU A 1 7   ? 27.074  56.259  45.293  1.00 57.15  ? 7   LEU A O      1 
ATOM   111   C  CB     . LEU A 1 7   ? 27.951  53.365  46.061  1.00 44.11  ? 7   LEU A CB     1 
ATOM   112   C  CG     . LEU A 1 7   ? 27.929  51.890  45.657  1.00 56.20  ? 7   LEU A CG     1 
ATOM   113   C  CD1    . LEU A 1 7   ? 27.282  51.062  46.755  1.00 45.17  ? 7   LEU A CD1    1 
ATOM   114   C  CD2    . LEU A 1 7   ? 27.212  51.667  44.331  1.00 60.98  ? 7   LEU A CD2    1 
ATOM   115   H  H      . LEU A 1 7   ? 30.283  53.617  45.391  1.00 75.91  ? 7   LEU A H      1 
ATOM   116   H  HA     . LEU A 1 7   ? 28.032  54.179  44.184  1.00 57.81  ? 7   LEU A HA     1 
ATOM   117   H  HB2    . LEU A 1 7   ? 28.498  53.437  46.859  1.00 52.94  ? 7   LEU A HB2    1 
ATOM   118   H  HB3    . LEU A 1 7   ? 27.039  53.618  46.273  1.00 52.94  ? 7   LEU A HB3    1 
ATOM   119   H  HG     . LEU A 1 7   ? 28.843  51.581  45.554  1.00 67.45  ? 7   LEU A HG     1 
ATOM   120   H  HD11   . LEU A 1 7   ? 27.276  50.130  46.485  1.00 54.20  ? 7   LEU A HD11   1 
ATOM   121   H  HD12   . LEU A 1 7   ? 27.794  51.166  47.572  1.00 54.20  ? 7   LEU A HD12   1 
ATOM   122   H  HD13   . LEU A 1 7   ? 26.374  51.374  46.891  1.00 54.20  ? 7   LEU A HD13   1 
ATOM   123   H  HD21   . LEU A 1 7   ? 27.225  50.720  44.120  1.00 73.18  ? 7   LEU A HD21   1 
ATOM   124   H  HD22   . LEU A 1 7   ? 26.296  51.975  44.412  1.00 73.18  ? 7   LEU A HD22   1 
ATOM   125   H  HD23   . LEU A 1 7   ? 27.669  52.167  43.637  1.00 73.18  ? 7   LEU A HD23   1 
ATOM   126   N  N      . GLU A 1 8   ? 29.195  56.462  45.986  1.00 64.48  ? 8   GLU A N      1 
ATOM   127   C  CA     . GLU A 1 8   ? 29.054  57.868  46.337  1.00 68.44  ? 8   GLU A CA     1 
ATOM   128   C  C      . GLU A 1 8   ? 29.033  58.719  45.074  1.00 55.31  ? 8   GLU A C      1 
ATOM   129   O  O      . GLU A 1 8   ? 28.132  59.531  44.872  1.00 52.87  ? 8   GLU A O      1 
ATOM   130   C  CB     . GLU A 1 8   ? 30.201  58.303  47.254  1.00 81.98  ? 8   GLU A CB     1 
ATOM   131   C  CG     . GLU A 1 8   ? 30.270  59.800  47.554  1.00 89.73  ? 8   GLU A CG     1 
ATOM   132   C  CD     . GLU A 1 8   ? 31.683  60.259  47.869  1.00 107.30 ? 8   GLU A CD     1 
ATOM   133   O  OE1    . GLU A 1 8   ? 32.029  61.410  47.523  1.00 104.77 ? 8   GLU A OE1    1 
ATOM   134   O  OE2    . GLU A 1 8   ? 32.448  59.466  48.461  1.00 100.13 ? 8   GLU A OE2    1 
ATOM   135   H  H      . GLU A 1 8   ? 29.970  56.132  46.159  1.00 77.37  ? 8   GLU A H      1 
ATOM   136   H  HA     . GLU A 1 8   ? 28.218  58.000  46.809  1.00 82.12  ? 8   GLU A HA     1 
ATOM   137   H  HB2    . GLU A 1 8   ? 30.109  57.841  48.101  1.00 98.37  ? 8   GLU A HB2    1 
ATOM   138   H  HB3    . GLU A 1 8   ? 31.040  58.051  46.837  1.00 98.37  ? 8   GLU A HB3    1 
ATOM   139   H  HG2    . GLU A 1 8   ? 29.958  60.294  46.780  1.00 107.68 ? 8   GLU A HG2    1 
ATOM   140   H  HG3    . GLU A 1 8   ? 29.711  59.996  48.322  1.00 107.68 ? 8   GLU A HG3    1 
ATOM   141   N  N      . LYS A 1 9   ? 30.024  58.509  44.217  1.00 56.82  ? 9   LYS A N      1 
ATOM   142   C  CA     . LYS A 1 9   ? 30.157  59.285  42.994  1.00 62.11  ? 9   LYS A CA     1 
ATOM   143   C  C      . LYS A 1 9   ? 28.995  59.004  42.048  1.00 58.07  ? 9   LYS A C      1 
ATOM   144   O  O      . LYS A 1 9   ? 28.630  59.846  41.229  1.00 55.32  ? 9   LYS A O      1 
ATOM   145   C  CB     . LYS A 1 9   ? 31.485  58.954  42.305  1.00 61.70  ? 9   LYS A CB     1 
ATOM   146   C  CG     . LYS A 1 9   ? 32.722  59.168  43.175  1.00 66.08  ? 9   LYS A CG     1 
ATOM   147   C  CD     . LYS A 1 9   ? 33.924  58.404  42.619  1.00 88.02  ? 9   LYS A CD     1 
ATOM   148   C  CE     . LYS A 1 9   ? 35.089  58.354  43.604  1.00 84.33  ? 9   LYS A CE     1 
ATOM   149   N  NZ     . LYS A 1 9   ? 36.198  57.475  43.120  1.00 54.14  ? 9   LYS A NZ     1 
ATOM   150   H  H      . LYS A 1 9   ? 30.638  57.916  44.323  1.00 68.19  ? 9   LYS A H      1 
ATOM   151   H  HA     . LYS A 1 9   ? 30.153  60.230  43.211  1.00 74.53  ? 9   LYS A HA     1 
ATOM   152   H  HB2    . LYS A 1 9   ? 31.472  58.022  42.038  1.00 74.04  ? 9   LYS A HB2    1 
ATOM   153   H  HB3    . LYS A 1 9   ? 31.577  59.518  41.521  1.00 74.04  ? 9   LYS A HB3    1 
ATOM   154   H  HG2    . LYS A 1 9   ? 32.943  60.112  43.194  1.00 79.29  ? 9   LYS A HG2    1 
ATOM   155   H  HG3    . LYS A 1 9   ? 32.544  58.845  44.072  1.00 79.29  ? 9   LYS A HG3    1 
ATOM   156   H  HD2    . LYS A 1 9   ? 33.657  57.493  42.422  1.00 105.63 ? 9   LYS A HD2    1 
ATOM   157   H  HD3    . LYS A 1 9   ? 34.232  58.843  41.810  1.00 105.63 ? 9   LYS A HD3    1 
ATOM   158   H  HE2    . LYS A 1 9   ? 35.443  59.249  43.724  1.00 101.19 ? 9   LYS A HE2    1 
ATOM   159   H  HE3    . LYS A 1 9   ? 34.774  58.003  44.452  1.00 101.19 ? 9   LYS A HE3    1 
ATOM   160   H  HZ1    . LYS A 1 9   ? 36.861  57.467  43.714  1.00 64.97  ? 9   LYS A HZ1    1 
ATOM   161   H  HZ2    . LYS A 1 9   ? 35.900  56.645  43.007  1.00 64.97  ? 9   LYS A HZ2    1 
ATOM   162   H  HZ3    . LYS A 1 9   ? 36.510  57.779  42.344  1.00 64.97  ? 9   LYS A HZ3    1 
ATOM   163   N  N      . ALA A 1 10  ? 28.403  57.823  42.187  1.00 57.33  ? 10  ALA A N      1 
ATOM   164   C  CA     . ALA A 1 10  ? 27.306  57.402  41.325  1.00 46.21  ? 10  ALA A CA     1 
ATOM   165   C  C      . ALA A 1 10  ? 25.977  58.000  41.762  1.00 45.66  ? 10  ALA A C      1 
ATOM   166   O  O      . ALA A 1 10  ? 25.049  58.105  40.964  1.00 48.62  ? 10  ALA A O      1 
ATOM   167   C  CB     . ALA A 1 10  ? 27.214  55.889  41.302  1.00 51.52  ? 10  ALA A CB     1 
ATOM   168   H  H      . ALA A 1 10  ? 28.622  57.240  42.780  1.00 68.80  ? 10  ALA A H      1 
ATOM   169   H  HA     . ALA A 1 10  ? 27.485  57.703  40.420  1.00 55.46  ? 10  ALA A HA     1 
ATOM   170   H  HB1    . ALA A 1 10  ? 26.480  55.627  40.725  1.00 61.82  ? 10  ALA A HB1    1 
ATOM   171   H  HB2    . ALA A 1 10  ? 28.048  55.528  40.963  1.00 61.82  ? 10  ALA A HB2    1 
ATOM   172   H  HB3    . ALA A 1 10  ? 27.056  55.570  42.204  1.00 61.82  ? 10  ALA A HB3    1 
ATOM   173   N  N      . LEU A 1 11  ? 25.883  58.389  43.028  1.00 55.37  ? 11  LEU A N      1 
ATOM   174   C  CA     . LEU A 1 11  ? 24.668  59.017  43.527  1.00 45.90  ? 11  LEU A CA     1 
ATOM   175   C  C      . LEU A 1 11  ? 24.491  60.389  42.897  1.00 37.65  ? 11  LEU A C      1 
ATOM   176   O  O      . LEU A 1 11  ? 23.379  60.902  42.798  1.00 37.27  ? 11  LEU A O      1 
ATOM   177   C  CB     . LEU A 1 11  ? 24.714  59.142  45.052  1.00 47.98  ? 11  LEU A CB     1 
ATOM   178   C  CG     . LEU A 1 11  ? 24.378  57.890  45.863  1.00 34.23  ? 11  LEU A CG     1 
ATOM   179   C  CD1    . LEU A 1 11  ? 24.768  58.087  47.317  1.00 68.77  ? 11  LEU A CD1    1 
ATOM   180   C  CD2    . LEU A 1 11  ? 22.904  57.547  45.757  1.00 35.45  ? 11  LEU A CD2    1 
ATOM   181   H  H      . LEU A 1 11  ? 26.505  58.300  43.615  1.00 66.44  ? 11  LEU A H      1 
ATOM   182   H  HA     . LEU A 1 11  ? 23.903  58.471  43.289  1.00 55.07  ? 11  LEU A HA     1 
ATOM   183   H  HB2    . LEU A 1 11  ? 25.610  59.415  45.305  1.00 57.58  ? 11  LEU A HB2    1 
ATOM   184   H  HB3    . LEU A 1 11  ? 24.085  59.831  45.317  1.00 57.58  ? 11  LEU A HB3    1 
ATOM   185   H  HG     . LEU A 1 11  ? 24.887  57.141  45.515  1.00 41.08  ? 11  LEU A HG     1 
ATOM   186   H  HD11   . LEU A 1 11  ? 24.548  57.284  47.815  1.00 82.52  ? 11  LEU A HD11   1 
ATOM   187   H  HD12   . LEU A 1 11  ? 25.722  58.257  47.368  1.00 82.52  ? 11  LEU A HD12   1 
ATOM   188   H  HD13   . LEU A 1 11  ? 24.278  58.844  47.676  1.00 82.52  ? 11  LEU A HD13   1 
ATOM   189   H  HD21   . LEU A 1 11  ? 22.726  56.751  46.282  1.00 42.54  ? 11  LEU A HD21   1 
ATOM   190   H  HD22   . LEU A 1 11  ? 22.382  58.291  46.097  1.00 42.54  ? 11  LEU A HD22   1 
ATOM   191   H  HD23   . LEU A 1 11  ? 22.683  57.387  44.826  1.00 42.54  ? 11  LEU A HD23   1 
ATOM   192   N  N      . GLU A 1 12  ? 25.598  60.964  42.445  1.00 39.83  ? 12  GLU A N      1 
ATOM   193   C  CA     . GLU A 1 12  ? 25.589  62.285  41.834  1.00 53.65  ? 12  GLU A CA     1 
ATOM   194   C  C      . GLU A 1 12  ? 24.971  62.252  40.438  1.00 55.71  ? 12  GLU A C      1 
ATOM   195   O  O      . GLU A 1 12  ? 24.685  63.297  39.851  1.00 47.40  ? 12  GLU A O      1 
ATOM   196   C  CB     . GLU A 1 12  ? 27.011  62.838  41.779  1.00 61.19  ? 12  GLU A CB     1 
ATOM   197   C  CG     . GLU A 1 12  ? 27.708  62.815  43.130  1.00 73.39  ? 12  GLU A CG     1 
ATOM   198   C  CD     . GLU A 1 12  ? 29.107  63.387  43.076  1.00 95.13  ? 12  GLU A CD     1 
ATOM   199   O  OE1    . GLU A 1 12  ? 29.551  63.771  41.972  1.00 87.43  ? 12  GLU A OE1    1 
ATOM   200   O  OE2    . GLU A 1 12  ? 29.764  63.450  44.138  1.00 88.75  ? 12  GLU A OE2    1 
ATOM   201   H  H      . GLU A 1 12  ? 26.378  60.603  42.481  1.00 47.79  ? 12  GLU A H      1 
ATOM   202   H  HA     . GLU A 1 12  ? 25.057  62.883  42.382  1.00 64.38  ? 12  GLU A HA     1 
ATOM   203   H  HB2    . GLU A 1 12  ? 27.534  62.302  41.163  1.00 73.43  ? 12  GLU A HB2    1 
ATOM   204   H  HB3    . GLU A 1 12  ? 26.980  63.758  41.473  1.00 73.43  ? 12  GLU A HB3    1 
ATOM   205   H  HG2    . GLU A 1 12  ? 27.193  63.342  43.760  1.00 88.07  ? 12  GLU A HG2    1 
ATOM   206   H  HG3    . GLU A 1 12  ? 27.771  61.898  43.438  1.00 88.07  ? 12  GLU A HG3    1 
ATOM   207   N  N      . LEU A 1 13  ? 24.747  61.044  39.927  1.00 52.86  ? 13  LEU A N      1 
ATOM   208   C  CA     . LEU A 1 13  ? 24.231  60.856  38.580  1.00 31.71  ? 13  LEU A CA     1 
ATOM   209   C  C      . LEU A 1 13  ? 22.764  60.462  38.604  1.00 45.63  ? 13  LEU A C      1 
ATOM   210   O  O      . LEU A 1 13  ? 22.006  60.805  37.699  1.00 61.42  ? 13  LEU A O      1 
ATOM   211   C  CB     . LEU A 1 13  ? 25.028  59.768  37.860  1.00 20.96  ? 13  LEU A CB     1 
ATOM   212   C  CG     . LEU A 1 13  ? 26.534  59.972  37.710  1.00 34.64  ? 13  LEU A CG     1 
ATOM   213   C  CD1    . LEU A 1 13  ? 27.161  58.742  37.075  1.00 29.11  ? 13  LEU A CD1    1 
ATOM   214   C  CD2    . LEU A 1 13  ? 26.844  61.213  36.891  1.00 36.84  ? 13  LEU A CD2    1 
ATOM   215   H  H      . LEU A 1 13  ? 24.889  60.309  40.350  1.00 63.43  ? 13  LEU A H      1 
ATOM   216   H  HA     . LEU A 1 13  ? 24.320  61.683  38.081  1.00 38.05  ? 13  LEU A HA     1 
ATOM   217   H  HB2    . LEU A 1 13  ? 24.902  58.936  38.344  1.00 25.15  ? 13  LEU A HB2    1 
ATOM   218   H  HB3    . LEU A 1 13  ? 24.664  59.673  36.966  1.00 25.15  ? 13  LEU A HB3    1 
ATOM   219   H  HG     . LEU A 1 13  ? 26.926  60.089  38.589  1.00 41.56  ? 13  LEU A HG     1 
ATOM   220   H  HD11   . LEU A 1 13  ? 28.116  58.885  36.986  1.00 34.93  ? 13  LEU A HD11   1 
ATOM   221   H  HD12   . LEU A 1 13  ? 26.993  57.974  37.644  1.00 34.93  ? 13  LEU A HD12   1 
ATOM   222   H  HD13   . LEU A 1 13  ? 26.764  58.600  36.202  1.00 34.93  ? 13  LEU A HD13   1 
ATOM   223   H  HD21   . LEU A 1 13  ? 27.806  61.310  36.817  1.00 44.20  ? 13  LEU A HD21   1 
ATOM   224   H  HD22   . LEU A 1 13  ? 26.452  61.115  36.009  1.00 44.20  ? 13  LEU A HD22   1 
ATOM   225   H  HD23   . LEU A 1 13  ? 26.466  61.987  37.336  1.00 44.20  ? 13  LEU A HD23   1 
ATOM   226   N  N      . VAL A 1 14  ? 22.372  59.737  39.645  1.00 47.28  ? 14  VAL A N      1 
ATOM   227   C  CA     . VAL A 1 14  ? 21.024  59.189  39.738  1.00 39.85  ? 14  VAL A CA     1 
ATOM   228   C  C      . VAL A 1 14  ? 20.067  60.031  40.585  1.00 42.42  ? 14  VAL A C      1 
ATOM   229   O  O      . VAL A 1 14  ? 18.854  59.864  40.488  1.00 56.80  ? 14  VAL A O      1 
ATOM   230   C  CB     . VAL A 1 14  ? 21.056  57.756  40.305  1.00 43.19  ? 14  VAL A CB     1 
ATOM   231   C  CG1    . VAL A 1 14  ? 21.828  56.838  39.373  1.00 42.67  ? 14  VAL A CG1    1 
ATOM   232   C  CG2    . VAL A 1 14  ? 21.669  57.734  41.693  1.00 45.59  ? 14  VAL A CG2    1 
ATOM   233   H  H      . VAL A 1 14  ? 22.873  59.546  40.318  1.00 56.73  ? 14  VAL A H      1 
ATOM   234   H  HA     . VAL A 1 14  ? 20.652  59.140  38.843  1.00 47.82  ? 14  VAL A HA     1 
ATOM   235   H  HB     . VAL A 1 14  ? 20.148  57.422  40.372  1.00 51.82  ? 14  VAL A HB     1 
ATOM   236   H  HG11   . VAL A 1 14  ? 21.836  55.944  39.747  1.00 51.21  ? 14  VAL A HG11   1 
ATOM   237   H  HG12   . VAL A 1 14  ? 21.393  56.831  38.506  1.00 51.21  ? 14  VAL A HG12   1 
ATOM   238   H  HG13   . VAL A 1 14  ? 22.736  57.169  39.285  1.00 51.21  ? 14  VAL A HG13   1 
ATOM   239   H  HG21   . VAL A 1 14  ? 21.674  56.821  42.020  1.00 54.71  ? 14  VAL A HG21   1 
ATOM   240   H  HG22   . VAL A 1 14  ? 22.576  58.073  41.642  1.00 54.71  ? 14  VAL A HG22   1 
ATOM   241   H  HG23   . VAL A 1 14  ? 21.138  58.293  42.281  1.00 54.71  ? 14  VAL A HG23   1 
ATOM   242   N  N      . ILE A 1 15  ? 20.600  60.945  41.390  1.00 43.08  ? 15  ILE A N      1 
ATOM   243   C  CA     . ILE A 1 15  ? 19.761  61.785  42.245  1.00 49.87  ? 15  ILE A CA     1 
ATOM   244   C  C      . ILE A 1 15  ? 19.381  63.092  41.553  1.00 59.62  ? 15  ILE A C      1 
ATOM   245   O  O      . ILE A 1 15  ? 20.257  63.807  41.072  1.00 64.71  ? 15  ILE A O      1 
ATOM   246   C  CB     . ILE A 1 15  ? 20.467  62.114  43.576  1.00 46.57  ? 15  ILE A CB     1 
ATOM   247   C  CG1    . ILE A 1 15  ? 20.553  60.858  44.442  1.00 48.95  ? 15  ILE A CG1    1 
ATOM   248   C  CG2    . ILE A 1 15  ? 19.717  63.213  44.337  1.00 49.67  ? 15  ILE A CG2    1 
ATOM   249   C  CD1    . ILE A 1 15  ? 21.302  61.042  45.746  1.00 34.81  ? 15  ILE A CD1    1 
ATOM   250   H  H      . ILE A 1 15  ? 21.443  61.100  41.461  1.00 51.70  ? 15  ILE A H      1 
ATOM   251   H  HA     . ILE A 1 15  ? 18.942  61.307  42.450  1.00 59.85  ? 15  ILE A HA     1 
ATOM   252   H  HB     . ILE A 1 15  ? 21.365  62.424  43.385  1.00 55.88  ? 15  ILE A HB     1 
ATOM   253   H  HG12   . ILE A 1 15  ? 19.653  60.568  44.658  1.00 58.74  ? 15  ILE A HG12   1 
ATOM   254   H  HG13   . ILE A 1 15  ? 21.007  60.164  43.938  1.00 58.74  ? 15  ILE A HG13   1 
ATOM   255   H  HG21   . ILE A 1 15  ? 20.184  63.396  45.167  1.00 59.60  ? 15  ILE A HG21   1 
ATOM   256   H  HG22   . ILE A 1 15  ? 19.688  64.012  43.788  1.00 59.60  ? 15  ILE A HG22   1 
ATOM   257   H  HG23   . ILE A 1 15  ? 18.815  62.907  44.524  1.00 59.60  ? 15  ILE A HG23   1 
ATOM   258   H  HD11   . ILE A 1 15  ? 21.308  60.200  46.228  1.00 41.77  ? 15  ILE A HD11   1 
ATOM   259   H  HD12   . ILE A 1 15  ? 22.212  61.318  45.552  1.00 41.77  ? 15  ILE A HD12   1 
ATOM   260   H  HD13   . ILE A 1 15  ? 20.855  61.722  46.274  1.00 41.77  ? 15  ILE A HD13   1 
ATOM   261   N  N      . PRO A 1 16  ? 18.073  63.414  41.503  1.00 56.62  ? 16  PRO A N      1 
ATOM   262   C  CA     . PRO A 1 16  ? 17.655  64.667  40.864  1.00 46.29  ? 16  PRO A CA     1 
ATOM   263   C  C      . PRO A 1 16  ? 18.160  65.897  41.598  1.00 46.58  ? 16  PRO A C      1 
ATOM   264   O  O      . PRO A 1 16  ? 18.043  65.969  42.818  1.00 43.12  ? 16  PRO A O      1 
ATOM   265   C  CB     . PRO A 1 16  ? 16.124  64.609  40.929  1.00 50.83  ? 16  PRO A CB     1 
ATOM   266   C  CG     . PRO A 1 16  ? 15.792  63.188  41.138  1.00 60.11  ? 16  PRO A CG     1 
ATOM   267   C  CD     . PRO A 1 16  ? 16.913  62.617  41.938  1.00 52.66  ? 16  PRO A CD     1 
ATOM   268   H  HA     . PRO A 1 16  ? 17.943  64.694  39.938  1.00 55.55  ? 16  PRO A HA     1 
ATOM   269   H  HB2    . PRO A 1 16  ? 15.809  65.147  41.672  1.00 61.00  ? 16  PRO A HB2    1 
ATOM   270   H  HB3    . PRO A 1 16  ? 15.751  64.928  40.092  1.00 61.00  ? 16  PRO A HB3    1 
ATOM   271   H  HG2    . PRO A 1 16  ? 14.956  63.118  41.624  1.00 72.13  ? 16  PRO A HG2    1 
ATOM   272   H  HG3    . PRO A 1 16  ? 15.725  62.741  40.279  1.00 72.13  ? 16  PRO A HG3    1 
ATOM   273   H  HD2    . PRO A 1 16  ? 16.751  62.744  42.886  1.00 63.19  ? 16  PRO A HD2    1 
ATOM   274   H  HD3    . PRO A 1 16  ? 17.042  61.681  41.720  1.00 63.19  ? 16  PRO A HD3    1 
ATOM   275   N  N      . ASP A 1 17  ? 18.706  66.854  40.858  1.00 58.85  ? 17  ASP A N      1 
ATOM   276   C  CA     . ASP A 1 17  ? 19.142  68.116  41.439  1.00 58.01  ? 17  ASP A CA     1 
ATOM   277   C  C      . ASP A 1 17  ? 17.940  68.880  41.980  1.00 56.08  ? 17  ASP A C      1 
ATOM   278   O  O      . ASP A 1 17  ? 16.811  68.641  41.565  1.00 61.62  ? 17  ASP A O      1 
ATOM   279   C  CB     . ASP A 1 17  ? 19.887  68.947  40.395  1.00 63.20  ? 17  ASP A CB     1 
ATOM   280   C  CG     . ASP A 1 17  ? 19.061  69.183  39.143  1.00 74.03  ? 17  ASP A CG     1 
ATOM   281   O  OD1    . ASP A 1 17  ? 18.814  68.212  38.393  1.00 60.97  ? 17  ASP A OD1    1 
ATOM   282   O  OD2    . ASP A 1 17  ? 18.660  70.341  38.905  1.00 81.83  ? 17  ASP A OD2    1 
ATOM   283   H  H      . ASP A 1 17  ? 18.835  66.796  40.009  1.00 70.63  ? 17  ASP A H      1 
ATOM   284   H  HA     . ASP A 1 17  ? 19.748  67.938  42.176  1.00 69.61  ? 17  ASP A HA     1 
ATOM   285   H  HB2    . ASP A 1 17  ? 20.107  69.811  40.777  1.00 75.84  ? 17  ASP A HB2    1 
ATOM   286   H  HB3    . ASP A 1 17  ? 20.697  68.481  40.137  1.00 75.84  ? 17  ASP A HB3    1 
ATOM   287   N  N      . GLU A 1 18  ? 18.183  69.807  42.898  1.00 68.77  ? 18  GLU A N      1 
ATOM   288   C  CA     . GLU A 1 18  ? 17.097  70.495  43.590  1.00 76.36  ? 18  GLU A CA     1 
ATOM   289   C  C      . GLU A 1 18  ? 16.322  71.425  42.664  1.00 57.65  ? 18  GLU A C      1 
ATOM   290   O  O      . GLU A 1 18  ? 15.188  71.800  42.957  1.00 57.22  ? 18  GLU A O      1 
ATOM   291   C  CB     . GLU A 1 18  ? 17.643  71.284  44.781  1.00 81.20  ? 18  GLU A CB     1 
ATOM   292   C  CG     . GLU A 1 18  ? 18.144  70.410  45.920  1.00 81.42  ? 18  GLU A CG     1 
ATOM   293   C  CD     . GLU A 1 18  ? 18.909  71.195  46.969  1.00 104.21 ? 18  GLU A CD     1 
ATOM   294   O  OE1    . GLU A 1 18  ? 19.091  72.418  46.787  1.00 101.57 ? 18  GLU A OE1    1 
ATOM   295   O  OE2    . GLU A 1 18  ? 19.331  70.588  47.977  1.00 92.73  ? 18  GLU A OE2    1 
ATOM   296   H  H      . GLU A 1 18  ? 18.970  70.058  43.140  1.00 82.52  ? 18  GLU A H      1 
ATOM   297   H  HA     . GLU A 1 18  ? 16.476  69.833  43.932  1.00 91.63  ? 18  GLU A HA     1 
ATOM   298   H  HB2    . GLU A 1 18  ? 18.384  71.832  44.479  1.00 97.44  ? 18  GLU A HB2    1 
ATOM   299   H  HB3    . GLU A 1 18  ? 16.937  71.850  45.130  1.00 97.44  ? 18  GLU A HB3    1 
ATOM   300   H  HG2    . GLU A 1 18  ? 17.385  69.991  46.354  1.00 97.71  ? 18  GLU A HG2    1 
ATOM   301   H  HG3    . GLU A 1 18  ? 18.737  69.732  45.561  1.00 97.71  ? 18  GLU A HG3    1 
ATOM   302   N  N      . GLU A 1 19  ? 16.936  71.805  41.551  1.00 58.98  ? 19  GLU A N      1 
ATOM   303   C  CA     . GLU A 1 19  ? 16.276  72.683  40.597  1.00 64.35  ? 19  GLU A CA     1 
ATOM   304   C  C      . GLU A 1 19  ? 15.180  71.922  39.856  1.00 58.43  ? 19  GLU A C      1 
ATOM   305   O  O      . GLU A 1 19  ? 14.154  72.492  39.493  1.00 52.28  ? 19  GLU A O      1 
ATOM   306   C  CB     . GLU A 1 19  ? 17.299  73.260  39.616  1.00 63.16  ? 19  GLU A CB     1 
ATOM   307   C  CG     . GLU A 1 19  ? 16.872  74.557  38.946  1.00 82.99  ? 19  GLU A CG     1 
ATOM   308   C  CD     . GLU A 1 19  ? 15.815  74.353  37.881  1.00 93.66  ? 19  GLU A CD     1 
ATOM   309   O  OE1    . GLU A 1 19  ? 15.915  73.366  37.120  1.00 88.04  ? 19  GLU A OE1    1 
ATOM   310   O  OE2    . GLU A 1 19  ? 14.882  75.181  37.807  1.00 78.03  ? 19  GLU A OE2    1 
ATOM   311   H  H      . GLU A 1 19  ? 17.731  71.569  41.325  1.00 70.77  ? 19  GLU A H      1 
ATOM   312   H  HA     . GLU A 1 19  ? 15.864  73.420  41.074  1.00 77.22  ? 19  GLU A HA     1 
ATOM   313   H  HB2    . GLU A 1 19  ? 18.124  73.434  40.095  1.00 75.79  ? 19  GLU A HB2    1 
ATOM   314   H  HB3    . GLU A 1 19  ? 17.460  72.607  38.917  1.00 75.79  ? 19  GLU A HB3    1 
ATOM   315   H  HG2    . GLU A 1 19  ? 16.508  75.153  39.619  1.00 99.59  ? 19  GLU A HG2    1 
ATOM   316   H  HG3    . GLU A 1 19  ? 17.646  74.964  38.526  1.00 99.59  ? 19  GLU A HG3    1 
ATOM   317   N  N      . GLU A 1 20  ? 15.394  70.626  39.656  1.00 71.03  ? 20  GLU A N      1 
ATOM   318   C  CA     . GLU A 1 20  ? 14.420  69.781  38.975  1.00 56.19  ? 20  GLU A CA     1 
ATOM   319   C  C      . GLU A 1 20  ? 13.293  69.369  39.916  1.00 56.56  ? 20  GLU A C      1 
ATOM   320   O  O      . GLU A 1 20  ? 12.136  69.287  39.511  1.00 65.93  ? 20  GLU A O      1 
ATOM   321   C  CB     . GLU A 1 20  ? 15.100  68.541  38.393  1.00 69.17  ? 20  GLU A CB     1 
ATOM   322   C  CG     . GLU A 1 20  ? 14.195  67.701  37.505  1.00 77.53  ? 20  GLU A CG     1 
ATOM   323   C  CD     . GLU A 1 20  ? 14.891  66.474  36.951  1.00 74.97  ? 20  GLU A CD     1 
ATOM   324   O  OE1    . GLU A 1 20  ? 16.062  66.236  37.318  1.00 75.61  ? 20  GLU A OE1    1 
ATOM   325   O  OE2    . GLU A 1 20  ? 14.268  65.753  36.142  1.00 52.15  ? 20  GLU A OE2    1 
ATOM   326   H  H      . GLU A 1 20  ? 16.103  70.209  39.908  1.00 85.23  ? 20  GLU A H      1 
ATOM   327   H  HA     . GLU A 1 20  ? 14.029  70.280  38.241  1.00 67.43  ? 20  GLU A HA     1 
ATOM   328   H  HB2    . GLU A 1 20  ? 15.860  68.823  37.859  1.00 83.00  ? 20  GLU A HB2    1 
ATOM   329   H  HB3    . GLU A 1 20  ? 15.403  67.979  39.123  1.00 83.00  ? 20  GLU A HB3    1 
ATOM   330   H  HG2    . GLU A 1 20  ? 13.431  67.404  38.023  1.00 93.03  ? 20  GLU A HG2    1 
ATOM   331   H  HG3    . GLU A 1 20  ? 13.898  68.241  36.755  1.00 93.03  ? 20  GLU A HG3    1 
ATOM   332   N  N      . VAL A 1 21  ? 13.634  69.106  41.173  1.00 47.54  ? 21  VAL A N      1 
ATOM   333   C  CA     . VAL A 1 21  ? 12.641  68.694  42.155  1.00 40.80  ? 21  VAL A CA     1 
ATOM   334   C  C      . VAL A 1 21  ? 11.621  69.804  42.357  1.00 51.77  ? 21  VAL A C      1 
ATOM   335   O  O      . VAL A 1 21  ? 10.416  69.556  42.376  1.00 47.26  ? 21  VAL A O      1 
ATOM   336   C  CB     . VAL A 1 21  ? 13.298  68.341  43.504  1.00 32.97  ? 21  VAL A CB     1 
ATOM   337   C  CG1    . VAL A 1 21  ? 12.255  67.914  44.527  1.00 41.82  ? 21  VAL A CG1    1 
ATOM   338   C  CG2    . VAL A 1 21  ? 14.328  67.245  43.317  1.00 46.69  ? 21  VAL A CG2    1 
ATOM   339   H  H      . VAL A 1 21  ? 14.435  69.160  41.482  1.00 57.05  ? 21  VAL A H      1 
ATOM   340   H  HA     . VAL A 1 21  ? 12.176  67.908  41.828  1.00 48.96  ? 21  VAL A HA     1 
ATOM   341   H  HB     . VAL A 1 21  ? 13.753  69.125  43.849  1.00 39.57  ? 21  VAL A HB     1 
ATOM   342   H  HG11   . VAL A 1 21  ? 12.700  67.700  45.362  1.00 50.18  ? 21  VAL A HG11   1 
ATOM   343   H  HG12   . VAL A 1 21  ? 11.630  68.643  44.663  1.00 50.18  ? 21  VAL A HG12   1 
ATOM   344   H  HG13   . VAL A 1 21  ? 11.785  67.134  44.193  1.00 50.18  ? 21  VAL A HG13   1 
ATOM   345   H  HG21   . VAL A 1 21  ? 14.728  67.039  44.176  1.00 56.02  ? 21  VAL A HG21   1 
ATOM   346   H  HG22   . VAL A 1 21  ? 13.889  66.458  42.958  1.00 56.02  ? 21  VAL A HG22   1 
ATOM   347   H  HG23   . VAL A 1 21  ? 15.009  67.555  42.700  1.00 56.02  ? 21  VAL A HG23   1 
ATOM   348   N  N      . ARG A 1 22  ? 12.114  71.031  42.479  1.00 67.75  ? 22  ARG A N      1 
ATOM   349   C  CA     . ARG A 1 22  ? 11.257  72.194  42.657  1.00 67.30  ? 22  ARG A CA     1 
ATOM   350   C  C      . ARG A 1 22  ? 10.273  72.297  41.496  1.00 57.53  ? 22  ARG A C      1 
ATOM   351   O  O      . ARG A 1 22  ? 9.093   72.569  41.695  1.00 68.07  ? 22  ARG A O      1 
ATOM   352   C  CB     . ARG A 1 22  ? 12.101  73.463  42.776  1.00 72.79  ? 22  ARG A CB     1 
ATOM   353   C  CG     . ARG A 1 22  ? 11.301  74.739  42.984  1.00 86.71  ? 22  ARG A CG     1 
ATOM   354   C  CD     . ARG A 1 22  ? 12.192  75.965  42.876  1.00 84.98  ? 22  ARG A CD     1 
ATOM   355   N  NE     . ARG A 1 22  ? 12.860  76.040  41.579  1.00 85.80  ? 22  ARG A NE     1 
ATOM   356   C  CZ     . ARG A 1 22  ? 12.276  76.439  40.452  1.00 92.65  ? 22  ARG A CZ     1 
ATOM   357   N  NH1    . ARG A 1 22  ? 10.998  76.793  40.448  1.00 82.67  ? 22  ARG A NH1    1 
ATOM   358   N  NH2    . ARG A 1 22  ? 12.970  76.473  39.322  1.00 82.82  ? 22  ARG A NH2    1 
ATOM   359   H  H      . ARG A 1 22  ? 12.954  71.218  42.460  1.00 81.31  ? 22  ARG A H      1 
ATOM   360   H  HA     . ARG A 1 22  ? 10.748  72.091  43.477  1.00 80.76  ? 22  ARG A HA     1 
ATOM   361   H  HB2    . ARG A 1 22  ? 12.701  73.367  43.533  1.00 87.34  ? 22  ARG A HB2    1 
ATOM   362   H  HB3    . ARG A 1 22  ? 12.617  73.569  41.962  1.00 87.34  ? 22  ARG A HB3    1 
ATOM   363   H  HG2    . ARG A 1 22  ? 10.613  74.801  42.303  1.00 104.05 ? 22  ARG A HG2    1 
ATOM   364   H  HG3    . ARG A 1 22  ? 10.902  74.728  43.868  1.00 104.05 ? 22  ARG A HG3    1 
ATOM   365   H  HD2    . ARG A 1 22  ? 11.651  76.763  42.985  1.00 101.98 ? 22  ARG A HD2    1 
ATOM   366   H  HD3    . ARG A 1 22  ? 12.873  75.926  43.566  1.00 101.98 ? 22  ARG A HD3    1 
ATOM   367   H  HE     . ARG A 1 22  ? 13.688  75.811  41.541  1.00 102.96 ? 22  ARG A HE     1 
ATOM   368   H  HH11   . ARG A 1 22  ? 10.544  76.773  41.177  1.00 99.21  ? 22  ARG A HH11   1 
ATOM   369   H  HH12   . ARG A 1 22  ? 10.625  77.049  39.716  1.00 99.21  ? 22  ARG A HH12   1 
ATOM   370   H  HH21   . ARG A 1 22  ? 13.799  76.242  39.319  1.00 99.39  ? 22  ARG A HH21   1 
ATOM   371   H  HH22   . ARG A 1 22  ? 12.592  76.728  38.593  1.00 99.39  ? 22  ARG A HH22   1 
ATOM   372   N  N      . LYS A 1 23  ? 10.766  72.068  40.284  1.00 50.99  ? 23  LYS A N      1 
ATOM   373   C  CA     . LYS A 1 23  ? 9.921   72.072  39.097  1.00 48.22  ? 23  LYS A CA     1 
ATOM   374   C  C      . LYS A 1 23  ? 8.851   70.993  39.198  1.00 39.93  ? 23  LYS A C      1 
ATOM   375   O  O      . LYS A 1 23  ? 7.754   71.134  38.660  1.00 27.66  ? 23  LYS A O      1 
ATOM   376   C  CB     . LYS A 1 23  ? 10.767  71.854  37.843  1.00 45.20  ? 23  LYS A CB     1 
ATOM   377   C  CG     . LYS A 1 23  ? 9.989   71.868  36.537  1.00 41.55  ? 23  LYS A CG     1 
ATOM   378   C  CD     . LYS A 1 23  ? 10.904  71.544  35.368  1.00 44.81  ? 23  LYS A CD     1 
ATOM   379   C  CE     . LYS A 1 23  ? 10.165  71.584  34.044  1.00 65.50  ? 23  LYS A CE     1 
ATOM   380   N  NZ     . LYS A 1 23  ? 11.044  71.193  32.908  1.00 59.65  ? 23  LYS A NZ     1 
ATOM   381   H  H      . LYS A 1 23  ? 11.595  71.907  40.122  1.00 61.18  ? 23  LYS A H      1 
ATOM   382   H  HA     . LYS A 1 23  ? 9.479   72.933  39.021  1.00 57.86  ? 23  LYS A HA     1 
ATOM   383   H  HB2    . LYS A 1 23  ? 11.434  72.556  37.794  1.00 54.24  ? 23  LYS A HB2    1 
ATOM   384   H  HB3    . LYS A 1 23  ? 11.206  70.992  37.913  1.00 54.24  ? 23  LYS A HB3    1 
ATOM   385   H  HG2    . LYS A 1 23  ? 9.287   71.199  36.572  1.00 49.86  ? 23  LYS A HG2    1 
ATOM   386   H  HG3    . LYS A 1 23  ? 9.611   72.750  36.396  1.00 49.86  ? 23  LYS A HG3    1 
ATOM   387   H  HD2    . LYS A 1 23  ? 11.621  72.196  35.335  1.00 53.78  ? 23  LYS A HD2    1 
ATOM   388   H  HD3    . LYS A 1 23  ? 11.268  70.652  35.485  1.00 53.78  ? 23  LYS A HD3    1 
ATOM   389   H  HE2    . LYS A 1 23  ? 9.418   70.965  34.077  1.00 78.60  ? 23  LYS A HE2    1 
ATOM   390   H  HE3    . LYS A 1 23  ? 9.846   72.486  33.884  1.00 78.60  ? 23  LYS A HE3    1 
ATOM   391   H  HZ1    . LYS A 1 23  ? 10.587  71.225  32.145  1.00 71.58  ? 23  LYS A HZ1    1 
ATOM   392   H  HZ2    . LYS A 1 23  ? 11.736  71.749  32.854  1.00 71.58  ? 23  LYS A HZ2    1 
ATOM   393   H  HZ3    . LYS A 1 23  ? 11.347  70.365  33.030  1.00 71.58  ? 23  LYS A HZ3    1 
ATOM   394   N  N      . GLY A 1 24  ? 9.180   69.913  39.897  1.00 41.30  ? 24  GLY A N      1 
ATOM   395   C  CA     . GLY A 1 24  ? 8.268   68.799  40.048  1.00 43.42  ? 24  GLY A CA     1 
ATOM   396   C  C      . GLY A 1 24  ? 7.177   69.125  41.043  1.00 49.72  ? 24  GLY A C      1 
ATOM   397   O  O      . GLY A 1 24  ? 6.003   68.850  40.801  1.00 50.18  ? 24  GLY A O      1 
ATOM   398   H  H      . GLY A 1 24  ? 9.935   69.805  40.295  1.00 49.56  ? 24  GLY A H      1 
ATOM   399   H  HA2    . GLY A 1 24  ? 7.859   68.591  39.193  1.00 52.11  ? 24  GLY A HA2    1 
ATOM   400   H  HA3    . GLY A 1 24  ? 8.752   68.018  40.360  1.00 52.11  ? 24  GLY A HA3    1 
ATOM   401   N  N      . ARG A 1 25  ? 7.567   69.725  42.163  1.00 64.66  ? 25  ARG A N      1 
ATOM   402   C  CA     . ARG A 1 25  ? 6.620   70.064  43.220  1.00 63.70  ? 25  ARG A CA     1 
ATOM   403   C  C      . ARG A 1 25  ? 5.662   71.163  42.760  1.00 56.09  ? 25  ARG A C      1 
ATOM   404   O  O      . ARG A 1 25  ? 4.481   71.153  43.108  1.00 57.18  ? 25  ARG A O      1 
ATOM   405   C  CB     . ARG A 1 25  ? 7.367   70.503  44.487  1.00 61.69  ? 25  ARG A CB     1 
ATOM   406   C  CG     . ARG A 1 25  ? 6.684   70.072  45.783  1.00 77.75  ? 25  ARG A CG     1 
ATOM   407   C  CD     . ARG A 1 25  ? 7.419   70.541  47.039  1.00 84.06  ? 25  ARG A CD     1 
ATOM   408   N  NE     . ARG A 1 25  ? 8.800   70.062  47.118  1.00 95.86  ? 25  ARG A NE     1 
ATOM   409   C  CZ     . ARG A 1 25  ? 9.883   70.790  46.844  1.00 90.94  ? 25  ARG A CZ     1 
ATOM   410   N  NH1    . ARG A 1 25  ? 9.782   72.058  46.460  1.00 69.08  ? 25  ARG A NH1    1 
ATOM   411   N  NH2    . ARG A 1 25  ? 11.085  70.240  46.957  1.00 85.17  ? 25  ARG A NH2    1 
ATOM   412   H  H      . ARG A 1 25  ? 8.379   69.947  42.337  1.00 77.59  ? 25  ARG A H      1 
ATOM   413   H  HA     . ARG A 1 25  ? 6.094   69.278  43.437  1.00 76.45  ? 25  ARG A HA     1 
ATOM   414   H  HB2    . ARG A 1 25  ? 8.256   70.116  44.477  1.00 74.02  ? 25  ARG A HB2    1 
ATOM   415   H  HB3    . ARG A 1 25  ? 7.430   71.471  44.493  1.00 74.02  ? 25  ARG A HB3    1 
ATOM   416   H  HG2    . ARG A 1 25  ? 5.789   70.444  45.806  1.00 93.30  ? 25  ARG A HG2    1 
ATOM   417   H  HG3    . ARG A 1 25  ? 6.641   69.104  45.808  1.00 93.30  ? 25  ARG A HG3    1 
ATOM   418   H  HD2    . ARG A 1 25  ? 7.440   71.511  47.046  1.00 100.88 ? 25  ARG A HD2    1 
ATOM   419   H  HD3    . ARG A 1 25  ? 6.946   70.215  47.820  1.00 100.88 ? 25  ARG A HD3    1 
ATOM   420   H  HE     . ARG A 1 25  ? 8.923   69.246  47.360  1.00 115.04 ? 25  ARG A HE     1 
ATOM   421   H  HH11   . ARG A 1 25  ? 9.008   72.424  46.385  1.00 82.89  ? 25  ARG A HH11   1 
ATOM   422   H  HH12   . ARG A 1 25  ? 10.492  72.512  46.287  1.00 82.89  ? 25  ARG A HH12   1 
ATOM   423   H  HH21   . ARG A 1 25  ? 11.161  69.420  47.204  1.00 102.20 ? 25  ARG A HH21   1 
ATOM   424   H  HH22   . ARG A 1 25  ? 11.788  70.704  46.780  1.00 102.20 ? 25  ARG A HH22   1 
ATOM   425   N  N      . GLU A 1 26  ? 6.172   72.101  41.969  1.00 59.11  ? 26  GLU A N      1 
ATOM   426   C  CA     . GLU A 1 26  ? 5.346   73.174  41.429  1.00 52.49  ? 26  GLU A CA     1 
ATOM   427   C  C      . GLU A 1 26  ? 4.310   72.627  40.460  1.00 54.11  ? 26  GLU A C      1 
ATOM   428   O  O      . GLU A 1 26  ? 3.166   73.076  40.443  1.00 62.47  ? 26  GLU A O      1 
ATOM   429   C  CB     . GLU A 1 26  ? 6.213   74.220  40.730  1.00 51.79  ? 26  GLU A CB     1 
ATOM   430   C  CG     . GLU A 1 26  ? 7.016   75.083  41.687  1.00 74.70  ? 26  GLU A CG     1 
ATOM   431   C  CD     . GLU A 1 26  ? 7.973   76.013  40.973  1.00 85.69  ? 26  GLU A CD     1 
ATOM   432   O  OE1    . GLU A 1 26  ? 8.805   76.645  41.657  1.00 79.75  ? 26  GLU A OE1    1 
ATOM   433   O  OE2    . GLU A 1 26  ? 7.894   76.111  39.730  1.00 74.27  ? 26  GLU A OE2    1 
ATOM   434   H  H      . GLU A 1 26  ? 6.997   72.139  41.729  1.00 70.93  ? 26  GLU A H      1 
ATOM   435   H  HA     . GLU A 1 26  ? 4.876   73.610  42.157  1.00 62.98  ? 26  GLU A HA     1 
ATOM   436   H  HB2    . GLU A 1 26  ? 6.839   73.767  40.144  1.00 62.15  ? 26  GLU A HB2    1 
ATOM   437   H  HB3    . GLU A 1 26  ? 5.641   74.806  40.211  1.00 62.15  ? 26  GLU A HB3    1 
ATOM   438   H  HG2    . GLU A 1 26  ? 6.406   75.625  42.212  1.00 89.64  ? 26  GLU A HG2    1 
ATOM   439   H  HG3    . GLU A 1 26  ? 7.535   74.509  42.271  1.00 89.64  ? 26  GLU A HG3    1 
ATOM   440   N  N      . ALA A 1 27  ? 4.711   71.645  39.661  1.00 54.08  ? 27  ALA A N      1 
ATOM   441   C  CA     . ALA A 1 27  ? 3.798   71.037  38.707  1.00 34.28  ? 27  ALA A CA     1 
ATOM   442   C  C      . ALA A 1 27  ? 2.812   70.150  39.438  1.00 37.62  ? 27  ALA A C      1 
ATOM   443   O  O      . ALA A 1 27  ? 1.663   70.029  39.032  1.00 46.54  ? 27  ALA A O      1 
ATOM   444   C  CB     . ALA A 1 27  ? 4.558   70.242  37.675  1.00 48.31  ? 27  ALA A CB     1 
ATOM   445   H  H      . ALA A 1 27  ? 5.504   71.314  39.653  1.00 64.90  ? 27  ALA A H      1 
ATOM   446   H  HA     . ALA A 1 27  ? 3.301   71.733  38.250  1.00 41.14  ? 27  ALA A HA     1 
ATOM   447   H  HB1    . ALA A 1 27  ? 3.926   69.849  37.053  1.00 57.97  ? 27  ALA A HB1    1 
ATOM   448   H  HB2    . ALA A 1 27  ? 5.162   70.836  37.202  1.00 57.97  ? 27  ALA A HB2    1 
ATOM   449   H  HB3    . ALA A 1 27  ? 5.062   69.544  38.122  1.00 57.97  ? 27  ALA A HB3    1 
ATOM   450   N  N      . GLU A 1 28  ? 3.268   69.537  40.525  1.00 54.67  ? 28  GLU A N      1 
ATOM   451   C  CA     . GLU A 1 28  ? 2.397   68.729  41.368  1.00 47.81  ? 28  GLU A CA     1 
ATOM   452   C  C      . GLU A 1 28  ? 1.357   69.598  42.060  1.00 52.52  ? 28  GLU A C      1 
ATOM   453   O  O      . GLU A 1 28  ? 0.199   69.205  42.198  1.00 34.86  ? 28  GLU A O      1 
ATOM   454   C  CB     . GLU A 1 28  ? 3.217   67.968  42.412  1.00 43.19  ? 28  GLU A CB     1 
ATOM   455   C  CG     . GLU A 1 28  ? 2.380   67.144  43.389  1.00 55.32  ? 28  GLU A CG     1 
ATOM   456   C  CD     . GLU A 1 28  ? 3.209   66.517  44.493  1.00 59.14  ? 28  GLU A CD     1 
ATOM   457   O  OE1    . GLU A 1 28  ? 4.400   66.869  44.622  1.00 53.19  ? 28  GLU A OE1    1 
ATOM   458   O  OE2    . GLU A 1 28  ? 2.670   65.666  45.232  1.00 58.44  ? 28  GLU A OE2    1 
ATOM   459   H  H      . GLU A 1 28  ? 4.083   69.573  40.797  1.00 65.60  ? 28  GLU A H      1 
ATOM   460   H  HA     . GLU A 1 28  ? 1.932   68.081  40.817  1.00 57.37  ? 28  GLU A HA     1 
ATOM   461   H  HB2    . GLU A 1 28  ? 3.817   67.360  41.953  1.00 51.82  ? 28  GLU A HB2    1 
ATOM   462   H  HB3    . GLU A 1 28  ? 3.731   68.607  42.930  1.00 51.82  ? 28  GLU A HB3    1 
ATOM   463   H  HG2    . GLU A 1 28  ? 1.718   67.721  43.802  1.00 66.39  ? 28  GLU A HG2    1 
ATOM   464   H  HG3    . GLU A 1 28  ? 1.939   66.430  42.903  1.00 66.39  ? 28  GLU A HG3    1 
ATOM   465   N  N      . GLU A 1 29  ? 1.772   70.785  42.488  1.00 51.02  ? 29  GLU A N      1 
ATOM   466   C  CA     . GLU A 1 29  ? 0.872   71.686  43.188  1.00 45.30  ? 29  GLU A CA     1 
ATOM   467   C  C      . GLU A 1 29  ? -0.240  72.147  42.258  1.00 50.92  ? 29  GLU A C      1 
ATOM   468   O  O      . GLU A 1 29  ? -1.404  72.183  42.646  1.00 60.91  ? 29  GLU A O      1 
ATOM   469   C  CB     . GLU A 1 29  ? 1.633   72.889  43.743  1.00 65.90  ? 29  GLU A CB     1 
ATOM   470   C  CG     . GLU A 1 29  ? 0.801   73.766  44.663  1.00 91.16  ? 29  GLU A CG     1 
ATOM   471   C  CD     . GLU A 1 29  ? 1.591   74.922  45.243  1.00 92.72  ? 29  GLU A CD     1 
ATOM   472   O  OE1    . GLU A 1 29  ? 2.480   75.448  44.540  1.00 93.76  ? 29  GLU A OE1    1 
ATOM   473   O  OE2    . GLU A 1 29  ? 1.324   75.303  46.403  1.00 85.80  ? 29  GLU A OE2    1 
ATOM   474   H  H      . GLU A 1 29  ? 2.570   71.090  42.385  1.00 61.23  ? 29  GLU A H      1 
ATOM   475   H  HA     . GLU A 1 29  ? 0.467   71.215  43.933  1.00 54.36  ? 29  GLU A HA     1 
ATOM   476   H  HB2    . GLU A 1 29  ? 2.398   72.569  44.248  1.00 79.08  ? 29  GLU A HB2    1 
ATOM   477   H  HB3    . GLU A 1 29  ? 1.935   73.437  43.002  1.00 79.08  ? 29  GLU A HB3    1 
ATOM   478   H  HG2    . GLU A 1 29  ? 0.056   74.133  44.162  1.00 109.39 ? 29  GLU A HG2    1 
ATOM   479   H  HG3    . GLU A 1 29  ? 0.471   73.228  45.400  1.00 109.39 ? 29  GLU A HG3    1 
ATOM   480   N  N      . GLU A 1 30  ? 0.122   72.500  41.030  1.00 49.62  ? 30  GLU A N      1 
ATOM   481   C  CA     . GLU A 1 30  ? -0.860  72.949  40.052  1.00 47.20  ? 30  GLU A CA     1 
ATOM   482   C  C      . GLU A 1 30  ? -1.735  71.788  39.596  1.00 44.43  ? 30  GLU A C      1 
ATOM   483   O  O      . GLU A 1 30  ? -2.894  71.980  39.244  1.00 43.16  ? 30  GLU A O      1 
ATOM   484   C  CB     . GLU A 1 30  ? -0.179  73.594  38.845  1.00 45.99  ? 30  GLU A CB     1 
ATOM   485   C  CG     . GLU A 1 30  ? -1.149  74.114  37.787  1.00 39.23  ? 30  GLU A CG     1 
ATOM   486   C  CD     . GLU A 1 30  ? -2.022  75.248  38.294  1.00 46.12  ? 30  GLU A CD     1 
ATOM   487   O  OE1    . GLU A 1 30  ? -1.722  75.795  39.375  1.00 53.94  ? 30  GLU A OE1    1 
ATOM   488   O  OE2    . GLU A 1 30  ? -3.017  75.587  37.620  1.00 51.67  ? 30  GLU A OE2    1 
ATOM   489   H  H      . GLU A 1 30  ? 0.931   72.489  40.738  1.00 59.55  ? 30  GLU A H      1 
ATOM   490   H  HA     . GLU A 1 30  ? -1.434  73.613  40.464  1.00 56.65  ? 30  GLU A HA     1 
ATOM   491   H  HB2    . GLU A 1 30  ? 0.353   74.345  39.153  1.00 55.19  ? 30  GLU A HB2    1 
ATOM   492   H  HB3    . GLU A 1 30  ? 0.395   72.937  38.423  1.00 55.19  ? 30  GLU A HB3    1 
ATOM   493   H  HG2    . GLU A 1 30  ? -0.643  74.443  37.028  1.00 47.07  ? 30  GLU A HG2    1 
ATOM   494   H  HG3    . GLU A 1 30  ? -1.731  73.390  37.509  1.00 47.07  ? 30  GLU A HG3    1 
ATOM   495   N  N      . LEU A 1 31  ? -1.178  70.584  39.597  1.00 45.95  ? 31  LEU A N      1 
ATOM   496   C  CA     . LEU A 1 31  ? -1.923  69.415  39.154  1.00 34.82  ? 31  LEU A CA     1 
ATOM   497   C  C      . LEU A 1 31  ? -3.030  69.123  40.158  1.00 47.79  ? 31  LEU A C      1 
ATOM   498   O  O      . LEU A 1 31  ? -4.169  68.863  39.773  1.00 42.32  ? 31  LEU A O      1 
ATOM   499   C  CB     . LEU A 1 31  ? -0.995  68.212  38.989  1.00 43.06  ? 31  LEU A CB     1 
ATOM   500   C  CG     . LEU A 1 31  ? -1.412  67.080  38.051  1.00 33.37  ? 31  LEU A CG     1 
ATOM   501   C  CD1    . LEU A 1 31  ? -1.735  67.594  36.670  1.00 36.61  ? 31  LEU A CD1    1 
ATOM   502   C  CD2    . LEU A 1 31  ? -0.286  66.070  37.965  1.00 42.35  ? 31  LEU A CD2    1 
ATOM   503   H  H      . LEU A 1 31  ? -0.372  70.417  39.848  1.00 55.14  ? 31  LEU A H      1 
ATOM   504   H  HA     . LEU A 1 31  ? -2.333  69.603  38.295  1.00 41.79  ? 31  LEU A HA     1 
ATOM   505   H  HB2    . LEU A 1 31  ? -0.141  68.540  38.667  1.00 51.67  ? 31  LEU A HB2    1 
ATOM   506   H  HB3    . LEU A 1 31  ? -0.868  67.815  39.865  1.00 51.67  ? 31  LEU A HB3    1 
ATOM   507   H  HG     . LEU A 1 31  ? -2.198  66.636  38.407  1.00 40.04  ? 31  LEU A HG     1 
ATOM   508   H  HD11   . LEU A 1 31  ? -1.994  66.847  36.108  1.00 43.93  ? 31  LEU A HD11   1 
ATOM   509   H  HD12   . LEU A 1 31  ? -2.465  68.230  36.733  1.00 43.93  ? 31  LEU A HD12   1 
ATOM   510   H  HD13   . LEU A 1 31  ? -0.949  68.027  36.303  1.00 43.93  ? 31  LEU A HD13   1 
ATOM   511   H  HD21   . LEU A 1 31  ? -0.551  65.351  37.370  1.00 50.81  ? 31  LEU A HD21   1 
ATOM   512   H  HD22   . LEU A 1 31  ? 0.507   66.510  37.621  1.00 50.81  ? 31  LEU A HD22   1 
ATOM   513   H  HD23   . LEU A 1 31  ? -0.110  65.717  38.852  1.00 50.81  ? 31  LEU A HD23   1 
ATOM   514   N  N      . ARG A 1 32  ? -2.693  69.158  41.444  1.00 53.63  ? 32  ARG A N      1 
ATOM   515   C  CA     . ARG A 1 32  ? -3.689  68.969  42.496  1.00 41.13  ? 32  ARG A CA     1 
ATOM   516   C  C      . ARG A 1 32  ? -4.748  70.071  42.477  1.00 46.41  ? 32  ARG A C      1 
ATOM   517   O  O      . ARG A 1 32  ? -5.918  69.827  42.761  1.00 37.33  ? 32  ARG A O      1 
ATOM   518   C  CB     . ARG A 1 32  ? -3.020  68.935  43.871  1.00 47.76  ? 32  ARG A CB     1 
ATOM   519   C  CG     . ARG A 1 32  ? -2.296  67.645  44.183  1.00 50.14  ? 32  ARG A CG     1 
ATOM   520   C  CD     . ARG A 1 32  ? -2.331  67.348  45.672  1.00 33.63  ? 32  ARG A CD     1 
ATOM   521   N  NE     . ARG A 1 32  ? -1.925  65.976  45.955  1.00 38.18  ? 32  ARG A NE     1 
ATOM   522   C  CZ     . ARG A 1 32  ? -0.664  65.572  46.063  1.00 50.21  ? 32  ARG A CZ     1 
ATOM   523   N  NH1    . ARG A 1 32  ? 0.332   66.437  45.912  1.00 40.74  ? 32  ARG A NH1    1 
ATOM   524   N  NH2    . ARG A 1 32  ? -0.400  64.298  46.321  1.00 45.48  ? 32  ARG A NH2    1 
ATOM   525   H  H      . ARG A 1 32  ? -1.895  69.290  41.735  1.00 64.35  ? 32  ARG A H      1 
ATOM   526   H  HA     . ARG A 1 32  ? -4.136  68.120  42.359  1.00 49.36  ? 32  ARG A HA     1 
ATOM   527   H  HB2    . ARG A 1 32  ? -2.372  69.656  43.919  1.00 57.32  ? 32  ARG A HB2    1 
ATOM   528   H  HB3    . ARG A 1 32  ? -3.701  69.062  44.550  1.00 57.32  ? 32  ARG A HB3    1 
ATOM   529   H  HG2    . ARG A 1 32  ? -2.726  66.913  43.714  1.00 60.16  ? 32  ARG A HG2    1 
ATOM   530   H  HG3    . ARG A 1 32  ? -1.368  67.723  43.908  1.00 60.16  ? 32  ARG A HG3    1 
ATOM   531   H  HD2    . ARG A 1 32  ? -1.722  67.946  46.132  1.00 40.35  ? 32  ARG A HD2    1 
ATOM   532   H  HD3    . ARG A 1 32  ? -3.235  67.471  46.001  1.00 40.35  ? 32  ARG A HD3    1 
ATOM   533   H  HE     . ARG A 1 32  ? -2.544  65.388  46.059  1.00 45.82  ? 32  ARG A HE     1 
ATOM   534   H  HH11   . ARG A 1 32  ? 0.162   67.263  45.744  1.00 48.88  ? 32  ARG A HH11   1 
ATOM   535   H  HH12   . ARG A 1 32  ? 1.146   66.171  45.983  1.00 48.88  ? 32  ARG A HH12   1 
ATOM   536   H  HH21   . ARG A 1 32  ? -1.044  63.737  46.419  1.00 54.57  ? 32  ARG A HH21   1 
ATOM   537   H  HH22   . ARG A 1 32  ? 0.415   64.034  46.392  1.00 54.57  ? 32  ARG A HH22   1 
ATOM   538   N  N      . ARG A 1 33  ? -4.324  71.282  42.138  1.00 50.41  ? 33  ARG A N      1 
ATOM   539   C  CA     . ARG A 1 33  ? -5.223  72.427  42.046  1.00 37.43  ? 33  ARG A CA     1 
ATOM   540   C  C      . ARG A 1 33  ? -6.338  72.204  41.027  1.00 42.19  ? 33  ARG A C      1 
ATOM   541   O  O      . ARG A 1 33  ? -7.502  72.484  41.305  1.00 46.45  ? 33  ARG A O      1 
ATOM   542   C  CB     . ARG A 1 33  ? -4.429  73.685  41.693  1.00 61.26  ? 33  ARG A CB     1 
ATOM   543   C  CG     . ARG A 1 33  ? -5.213  74.982  41.816  1.00 61.20  ? 33  ARG A CG     1 
ATOM   544   C  CD     . ARG A 1 33  ? -4.284  76.187  41.894  1.00 71.26  ? 33  ARG A CD     1 
ATOM   545   N  NE     . ARG A 1 33  ? -3.492  76.195  43.129  1.00 85.17  ? 33  ARG A NE     1 
ATOM   546   C  CZ     . ARG A 1 33  ? -2.160  76.141  43.199  1.00 81.21  ? 33  ARG A CZ     1 
ATOM   547   N  NH1    . ARG A 1 33  ? -1.408  76.082  42.104  1.00 53.43  ? 33  ARG A NH1    1 
ATOM   548   N  NH2    . ARG A 1 33  ? -1.570  76.155  44.385  1.00 81.36  ? 33  ARG A NH2    1 
ATOM   549   H  H      . ARG A 1 33  ? -3.505  71.471  41.954  1.00 60.50  ? 33  ARG A H      1 
ATOM   550   H  HA     . ARG A 1 33  ? -5.637  72.569  42.911  1.00 44.92  ? 33  ARG A HA     1 
ATOM   551   H  HB2    . ARG A 1 33  ? -3.665  73.746  42.288  1.00 73.51  ? 33  ARG A HB2    1 
ATOM   552   H  HB3    . ARG A 1 33  ? -4.124  73.612  40.776  1.00 73.51  ? 33  ARG A HB3    1 
ATOM   553   H  HG2    . ARG A 1 33  ? -5.783  75.087  41.038  1.00 73.44  ? 33  ARG A HG2    1 
ATOM   554   H  HG3    . ARG A 1 33  ? -5.749  74.958  42.624  1.00 73.44  ? 33  ARG A HG3    1 
ATOM   555   H  HD2    . ARG A 1 33  ? -3.671  76.165  41.142  1.00 85.51  ? 33  ARG A HD2    1 
ATOM   556   H  HD3    . ARG A 1 33  ? -4.814  76.999  41.870  1.00 85.51  ? 33  ARG A HD3    1 
ATOM   557   H  HE     . ARG A 1 33  ? -3.923  76.237  43.872  1.00 102.21 ? 33  ARG A HE     1 
ATOM   558   H  HH11   . ARG A 1 33  ? -1.779  76.073  41.328  1.00 64.12  ? 33  ARG A HH11   1 
ATOM   559   H  HH12   . ARG A 1 33  ? -0.552  76.050  42.172  1.00 64.12  ? 33  ARG A HH12   1 
ATOM   560   H  HH21   . ARG A 1 33  ? -2.044  76.194  45.102  1.00 97.64  ? 33  ARG A HH21   1 
ATOM   561   H  HH22   . ARG A 1 33  ? -0.712  76.123  44.439  1.00 97.64  ? 33  ARG A HH22   1 
ATOM   562   N  N      . ARG A 1 34  ? -5.971  71.710  39.846  1.00 47.58  ? 34  ARG A N      1 
ATOM   563   C  CA     . ARG A 1 34  ? -6.923  71.513  38.753  1.00 36.49  ? 34  ARG A CA     1 
ATOM   564   C  C      . ARG A 1 34  ? -7.802  70.287  38.975  1.00 43.28  ? 34  ARG A C      1 
ATOM   565   O  O      . ARG A 1 34  ? -8.972  70.280  38.597  1.00 40.41  ? 34  ARG A O      1 
ATOM   566   C  CB     . ARG A 1 34  ? -6.191  71.381  37.417  1.00 27.48  ? 34  ARG A CB     1 
ATOM   567   C  CG     . ARG A 1 34  ? -5.329  72.575  37.061  1.00 47.30  ? 34  ARG A CG     1 
ATOM   568   C  CD     . ARG A 1 34  ? -4.520  72.325  35.800  1.00 36.10  ? 34  ARG A CD     1 
ATOM   569   N  NE     . ARG A 1 34  ? -3.622  73.435  35.498  1.00 27.86  ? 34  ARG A NE     1 
ATOM   570   C  CZ     . ARG A 1 34  ? -2.821  73.483  34.439  1.00 29.70  ? 34  ARG A CZ     1 
ATOM   571   N  NH1    . ARG A 1 34  ? -2.799  72.479  33.575  1.00 42.33  ? 34  ARG A NH1    1 
ATOM   572   N  NH2    . ARG A 1 34  ? -2.038  74.534  34.245  1.00 45.91  ? 34  ARG A NH2    1 
ATOM   573   H  H      . ARG A 1 34  ? -5.167  71.477  39.650  1.00 57.10  ? 34  ARG A H      1 
ATOM   574   H  HA     . ARG A 1 34  ? -7.503  72.289  38.700  1.00 43.79  ? 34  ARG A HA     1 
ATOM   575   H  HB2    . ARG A 1 34  ? -5.615  70.601  37.454  1.00 32.97  ? 34  ARG A HB2    1 
ATOM   576   H  HB3    . ARG A 1 34  ? -6.848  71.270  36.712  1.00 32.97  ? 34  ARG A HB3    1 
ATOM   577   H  HG2    . ARG A 1 34  ? -5.898  73.346  36.908  1.00 56.76  ? 34  ARG A HG2    1 
ATOM   578   H  HG3    . ARG A 1 34  ? -4.711  72.752  37.788  1.00 56.76  ? 34  ARG A HG3    1 
ATOM   579   H  HD2    . ARG A 1 34  ? -3.984  71.526  35.920  1.00 43.32  ? 34  ARG A HD2    1 
ATOM   580   H  HD3    . ARG A 1 34  ? -5.125  72.213  35.051  1.00 43.32  ? 34  ARG A HD3    1 
ATOM   581   H  HE     . ARG A 1 34  ? -3.611  74.102  36.040  1.00 33.43  ? 34  ARG A HE     1 
ATOM   582   H  HH11   . ARG A 1 34  ? -3.306  71.795  33.698  1.00 50.79  ? 34  ARG A HH11   1 
ATOM   583   H  HH12   . ARG A 1 34  ? -2.279  72.512  32.891  1.00 50.79  ? 34  ARG A HH12   1 
ATOM   584   H  HH21   . ARG A 1 34  ? -2.049  75.188  34.804  1.00 55.10  ? 34  ARG A HH21   1 
ATOM   585   H  HH22   . ARG A 1 34  ? -1.519  74.564  33.560  1.00 55.10  ? 34  ARG A HH22   1 
ATOM   586   N  N      . LEU A 1 35  ? -7.231  69.248  39.575  1.00 36.77  ? 35  LEU A N      1 
ATOM   587   C  CA     . LEU A 1 35  ? -7.964  68.013  39.831  1.00 30.54  ? 35  LEU A CA     1 
ATOM   588   C  C      . LEU A 1 35  ? -9.044  68.215  40.886  1.00 32.52  ? 35  LEU A C      1 
ATOM   589   O  O      . LEU A 1 35  ? -10.153 67.702  40.747  1.00 37.17  ? 35  LEU A O      1 
ATOM   590   C  CB     . LEU A 1 35  ? -7.007  66.901  40.260  1.00 31.22  ? 35  LEU A CB     1 
ATOM   591   C  CG     . LEU A 1 35  ? -6.160  66.302  39.136  1.00 20.29  ? 35  LEU A CG     1 
ATOM   592   C  CD1    . LEU A 1 35  ? -5.018  65.490  39.695  1.00 32.22  ? 35  LEU A CD1    1 
ATOM   593   C  CD2    . LEU A 1 35  ? -7.019  65.433  38.239  1.00 12.99  ? 35  LEU A CD2    1 
ATOM   594   H  H      . LEU A 1 35  ? -6.415  69.233  39.846  1.00 44.13  ? 35  LEU A H      1 
ATOM   595   H  HA     . LEU A 1 35  ? -8.398  67.731  39.011  1.00 36.65  ? 35  LEU A HA     1 
ATOM   596   H  HB2    . LEU A 1 35  ? -6.398  67.258  40.925  1.00 37.46  ? 35  LEU A HB2    1 
ATOM   597   H  HB3    . LEU A 1 35  ? -7.527  66.180  40.649  1.00 37.46  ? 35  LEU A HB3    1 
ATOM   598   H  HG     . LEU A 1 35  ? -5.788  67.019  38.599  1.00 24.35  ? 35  LEU A HG     1 
ATOM   599   H  HD11   . LEU A 1 35  ? -4.501  65.125  38.960  1.00 38.67  ? 35  LEU A HD11   1 
ATOM   600   H  HD12   . LEU A 1 35  ? -4.459  66.066  40.240  1.00 38.67  ? 35  LEU A HD12   1 
ATOM   601   H  HD13   . LEU A 1 35  ? -5.378  64.770  40.237  1.00 38.67  ? 35  LEU A HD13   1 
ATOM   602   H  HD21   . LEU A 1 35  ? -6.465  65.063  37.534  1.00 15.59  ? 35  LEU A HD21   1 
ATOM   603   H  HD22   . LEU A 1 35  ? -7.403  64.716  38.768  1.00 15.59  ? 35  LEU A HD22   1 
ATOM   604   H  HD23   . LEU A 1 35  ? -7.724  65.976  37.855  1.00 15.59  ? 35  LEU A HD23   1 
ATOM   605   N  N      . ASP A 1 36  ? -8.722  68.969  41.932  1.00 44.28  ? 36  ASP A N      1 
ATOM   606   C  CA     . ASP A 1 36  ? -9.670  69.239  43.010  1.00 38.34  ? 36  ASP A CA     1 
ATOM   607   C  C      . ASP A 1 36  ? -10.866 70.050  42.524  1.00 41.81  ? 36  ASP A C      1 
ATOM   608   O  O      . ASP A 1 36  ? -11.978 69.891  43.023  1.00 35.75  ? 36  ASP A O      1 
ATOM   609   C  CB     . ASP A 1 36  ? -8.985  69.988  44.152  1.00 36.43  ? 36  ASP A CB     1 
ATOM   610   C  CG     . ASP A 1 36  ? -7.944  69.149  44.860  1.00 45.41  ? 36  ASP A CG     1 
ATOM   611   O  OD1    . ASP A 1 36  ? -8.092  67.910  44.889  1.00 43.45  ? 36  ASP A OD1    1 
ATOM   612   O  OD2    . ASP A 1 36  ? -6.985  69.735  45.405  1.00 45.87  ? 36  ASP A OD2    1 
ATOM   613   H  H      . ASP A 1 36  ? -7.953  69.340  42.043  1.00 53.13  ? 36  ASP A H      1 
ATOM   614   H  HA     . ASP A 1 36  ? -10.000 68.396  43.359  1.00 46.01  ? 36  ASP A HA     1 
ATOM   615   H  HB2    . ASP A 1 36  ? -8.544  70.774  43.794  1.00 43.71  ? 36  ASP A HB2    1 
ATOM   616   H  HB3    . ASP A 1 36  ? -9.654  70.250  44.804  1.00 43.71  ? 36  ASP A HB3    1 
ATOM   617   N  N      . GLU A 1 37  ? -10.625 70.938  41.569  1.00 41.44  ? 37  GLU A N      1 
ATOM   618   C  CA     . GLU A 1 37  ? -11.686 71.745  40.986  1.00 28.41  ? 37  GLU A CA     1 
ATOM   619   C  C      . GLU A 1 37  ? -12.706 70.881  40.241  1.00 35.51  ? 37  GLU A C      1 
ATOM   620   O  O      . GLU A 1 37  ? -13.878 71.243  40.146  1.00 41.20  ? 37  GLU A O      1 
ATOM   621   C  CB     . GLU A 1 37  ? -11.089 72.789  40.040  1.00 32.54  ? 37  GLU A CB     1 
ATOM   622   C  CG     . GLU A 1 37  ? -12.077 73.850  39.588  1.00 58.01  ? 37  GLU A CG     1 
ATOM   623   C  CD     . GLU A 1 37  ? -11.464 74.851  38.627  1.00 61.19  ? 37  GLU A CD     1 
ATOM   624   O  OE1    . GLU A 1 37  ? -10.262 74.719  38.318  1.00 51.66  ? 37  GLU A OE1    1 
ATOM   625   O  OE2    . GLU A 1 37  ? -12.183 75.775  38.189  1.00 75.21  ? 37  GLU A OE2    1 
ATOM   626   H  H      . GLU A 1 37  ? -9.846  71.094  41.239  1.00 49.73  ? 37  GLU A H      1 
ATOM   627   H  HA     . GLU A 1 37  ? -12.152 72.215  41.695  1.00 34.09  ? 37  GLU A HA     1 
ATOM   628   H  HB2    . GLU A 1 37  ? -10.359 73.239  40.493  1.00 39.05  ? 37  GLU A HB2    1 
ATOM   629   H  HB3    . GLU A 1 37  ? -10.756 72.338  39.249  1.00 39.05  ? 37  GLU A HB3    1 
ATOM   630   H  HG2    . GLU A 1 37  ? -12.820 73.419  39.137  1.00 69.61  ? 37  GLU A HG2    1 
ATOM   631   H  HG3    . GLU A 1 37  ? -12.397 74.336  40.364  1.00 69.61  ? 37  GLU A HG3    1 
ATOM   632   N  N      . LEU A 1 38  ? -12.260 69.738  39.723  1.00 32.32  ? 38  LEU A N      1 
ATOM   633   C  CA     . LEU A 1 38  ? -13.133 68.838  38.965  1.00 39.49  ? 38  LEU A CA     1 
ATOM   634   C  C      . LEU A 1 38  ? -13.874 67.838  39.844  1.00 53.64  ? 38  LEU A C      1 
ATOM   635   O  O      . LEU A 1 38  ? -14.780 67.147  39.375  1.00 58.09  ? 38  LEU A O      1 
ATOM   636   C  CB     . LEU A 1 38  ? -12.329 68.073  37.911  1.00 33.95  ? 38  LEU A CB     1 
ATOM   637   C  CG     . LEU A 1 38  ? -11.947 68.830  36.639  1.00 24.40  ? 38  LEU A CG     1 
ATOM   638   C  CD1    . LEU A 1 38  ? -11.017 67.989  35.789  1.00 30.71  ? 38  LEU A CD1    1 
ATOM   639   C  CD2    . LEU A 1 38  ? -13.184 69.204  35.843  1.00 33.80  ? 38  LEU A CD2    1 
ATOM   640   H  H      . LEU A 1 38  ? -11.450 69.458  39.796  1.00 38.78  ? 38  LEU A H      1 
ATOM   641   H  HA     . LEU A 1 38  ? -13.798 69.370  38.500  1.00 47.39  ? 38  LEU A HA     1 
ATOM   642   H  HB2    . LEU A 1 38  ? -11.503 67.772  38.322  1.00 40.74  ? 38  LEU A HB2    1 
ATOM   643   H  HB3    . LEU A 1 38  ? -12.849 67.301  37.638  1.00 40.74  ? 38  LEU A HB3    1 
ATOM   644   H  HG     . LEU A 1 38  ? -11.483 69.647  36.880  1.00 29.28  ? 38  LEU A HG     1 
ATOM   645   H  HD11   . LEU A 1 38  ? -10.787 68.485  34.988  1.00 36.85  ? 38  LEU A HD11   1 
ATOM   646   H  HD12   . LEU A 1 38  ? -10.216 67.792  36.299  1.00 36.85  ? 38  LEU A HD12   1 
ATOM   647   H  HD13   . LEU A 1 38  ? -11.469 67.164  35.550  1.00 36.85  ? 38  LEU A HD13   1 
ATOM   648   H  HD21   . LEU A 1 38  ? -12.913 69.682  35.044  1.00 40.56  ? 38  LEU A HD21   1 
ATOM   649   H  HD22   . LEU A 1 38  ? -13.659 68.393  35.599  1.00 40.56  ? 38  LEU A HD22   1 
ATOM   650   H  HD23   . LEU A 1 38  ? -13.753 69.768  36.389  1.00 40.56  ? 38  LEU A HD23   1 
ATOM   651   N  N      . GLY A 1 39  ? -13.487 67.757  41.111  1.00 48.84  ? 39  GLY A N      1 
ATOM   652   C  CA     . GLY A 1 39  ? -14.156 66.883  42.057  1.00 41.48  ? 39  GLY A CA     1 
ATOM   653   C  C      . GLY A 1 39  ? -14.135 65.433  41.616  1.00 47.33  ? 39  GLY A C      1 
ATOM   654   O  O      . GLY A 1 39  ? -15.171 64.769  41.582  1.00 32.63  ? 39  GLY A O      1 
ATOM   655   H  H      . GLY A 1 39  ? -12.834 68.203  41.449  1.00 58.61  ? 39  GLY A H      1 
ATOM   656   H  HA2    . GLY A 1 39  ? -13.720 66.948  42.921  1.00 49.78  ? 39  GLY A HA2    1 
ATOM   657   H  HA3    . GLY A 1 39  ? -15.080 67.161  42.157  1.00 49.78  ? 39  GLY A HA3    1 
ATOM   658   N  N      . VAL A 1 40  ? -12.944 64.951  41.273  1.00 53.97  ? 40  VAL A N      1 
ATOM   659   C  CA     . VAL A 1 40  ? -12.740 63.558  40.897  1.00 35.26  ? 40  VAL A CA     1 
ATOM   660   C  C      . VAL A 1 40  ? -11.832 62.909  41.919  1.00 38.86  ? 40  VAL A C      1 
ATOM   661   O  O      . VAL A 1 40  ? -10.904 63.538  42.425  1.00 36.76  ? 40  VAL A O      1 
ATOM   662   C  CB     . VAL A 1 40  ? -12.118 63.408  39.495  1.00 45.64  ? 40  VAL A CB     1 
ATOM   663   C  CG1    . VAL A 1 40  ? -13.140 63.746  38.426  1.00 60.63  ? 40  VAL A CG1    1 
ATOM   664   C  CG2    . VAL A 1 40  ? -10.864 64.274  39.357  1.00 31.52  ? 40  VAL A CG2    1 
ATOM   665   H  H      . VAL A 1 40  ? -12.225 65.422  41.250  1.00 64.76  ? 40  VAL A H      1 
ATOM   666   H  HA     . VAL A 1 40  ? -13.592 63.094  40.905  1.00 42.31  ? 40  VAL A HA     1 
ATOM   667   H  HB     . VAL A 1 40  ? -11.853 62.484  39.369  1.00 54.77  ? 40  VAL A HB     1 
ATOM   668   H  HG11   . VAL A 1 40  ? -12.728 63.645  37.553  1.00 72.76  ? 40  VAL A HG11   1 
ATOM   669   H  HG12   . VAL A 1 40  ? -13.894 63.141  38.508  1.00 72.76  ? 40  VAL A HG12   1 
ATOM   670   H  HG13   . VAL A 1 40  ? -13.435 64.662  38.549  1.00 72.76  ? 40  VAL A HG13   1 
ATOM   671   H  HG21   . VAL A 1 40  ? -10.497 64.158  38.466  1.00 37.83  ? 40  VAL A HG21   1 
ATOM   672   H  HG22   . VAL A 1 40  ? -11.105 65.203  39.497  1.00 37.83  ? 40  VAL A HG22   1 
ATOM   673   H  HG23   . VAL A 1 40  ? -10.214 63.997  40.021  1.00 37.83  ? 40  VAL A HG23   1 
ATOM   674   N  N      . GLU A 1 41  ? -12.102 61.646  42.219  1.00 33.98  ? 41  GLU A N      1 
ATOM   675   C  CA     . GLU A 1 41  ? -11.284 60.896  43.154  1.00 31.24  ? 41  GLU A CA     1 
ATOM   676   C  C      . GLU A 1 41  ? -10.013 60.427  42.465  1.00 31.57  ? 41  GLU A C      1 
ATOM   677   O  O      . GLU A 1 41  ? -10.072 59.671  41.498  1.00 38.09  ? 41  GLU A O      1 
ATOM   678   C  CB     . GLU A 1 41  ? -12.072 59.713  43.710  1.00 30.57  ? 41  GLU A CB     1 
ATOM   679   C  CG     . GLU A 1 41  ? -11.468 59.091  44.949  1.00 38.69  ? 41  GLU A CG     1 
ATOM   680   C  CD     . GLU A 1 41  ? -12.341 57.998  45.530  1.00 64.94  ? 41  GLU A CD     1 
ATOM   681   O  OE1    . GLU A 1 41  ? -13.570 58.022  45.293  1.00 56.98  ? 41  GLU A OE1    1 
ATOM   682   O  OE2    . GLU A 1 41  ? -11.797 57.119  46.230  1.00 74.21  ? 41  GLU A OE2    1 
ATOM   683   H  H      . GLU A 1 41  ? -12.759 61.199  41.890  1.00 40.78  ? 41  GLU A H      1 
ATOM   684   H  HA     . GLU A 1 41  ? -11.035 61.470  43.895  1.00 37.49  ? 41  GLU A HA     1 
ATOM   685   H  HB2    . GLU A 1 41  ? -12.966 60.013  43.936  1.00 36.68  ? 41  GLU A HB2    1 
ATOM   686   H  HB3    . GLU A 1 41  ? -12.121 59.024  43.028  1.00 36.68  ? 41  GLU A HB3    1 
ATOM   687   H  HG2    . GLU A 1 41  ? -10.609 58.702  44.723  1.00 46.43  ? 41  GLU A HG2    1 
ATOM   688   H  HG3    . GLU A 1 41  ? -11.355 59.777  45.625  1.00 46.43  ? 41  GLU A HG3    1 
ATOM   689   N  N      . TYR A 1 42  ? -8.867  60.893  42.951  1.00 33.09  ? 42  TYR A N      1 
ATOM   690   C  CA     . TYR A 1 42  ? -7.589  60.561  42.334  1.00 31.53  ? 42  TYR A CA     1 
ATOM   691   C  C      . TYR A 1 42  ? -6.535  60.191  43.370  1.00 36.33  ? 42  TYR A C      1 
ATOM   692   O  O      . TYR A 1 42  ? -6.744  60.342  44.573  1.00 48.30  ? 42  TYR A O      1 
ATOM   693   C  CB     . TYR A 1 42  ? -7.086  61.734  41.496  1.00 34.33  ? 42  TYR A CB     1 
ATOM   694   C  CG     . TYR A 1 42  ? -6.692  62.938  42.318  1.00 27.03  ? 42  TYR A CG     1 
ATOM   695   C  CD1    . TYR A 1 42  ? -7.612  63.923  42.633  1.00 27.17  ? 42  TYR A CD1    1 
ATOM   696   C  CD2    . TYR A 1 42  ? -5.393  63.086  42.777  1.00 45.21  ? 42  TYR A CD2    1 
ATOM   697   C  CE1    . TYR A 1 42  ? -7.248  65.023  43.386  1.00 39.66  ? 42  TYR A CE1    1 
ATOM   698   C  CE2    . TYR A 1 42  ? -5.020  64.178  43.529  1.00 48.33  ? 42  TYR A CE2    1 
ATOM   699   C  CZ     . TYR A 1 42  ? -5.948  65.143  43.831  1.00 35.87  ? 42  TYR A CZ     1 
ATOM   700   O  OH     . TYR A 1 42  ? -5.563  66.229  44.582  1.00 35.39  ? 42  TYR A OH     1 
ATOM   701   H  H      . TYR A 1 42  ? -8.802  61.405  43.639  1.00 39.71  ? 42  TYR A H      1 
ATOM   702   H  HA     . TYR A 1 42  ? -7.711  59.800  41.744  1.00 37.84  ? 42  TYR A HA     1 
ATOM   703   H  HB2    . TYR A 1 42  ? -6.306  61.449  40.994  1.00 41.19  ? 42  TYR A HB2    1 
ATOM   704   H  HB3    . TYR A 1 42  ? -7.788  62.008  40.886  1.00 41.19  ? 42  TYR A HB3    1 
ATOM   705   H  HD1    . TYR A 1 42  ? -8.490  63.844  42.334  1.00 32.61  ? 42  TYR A HD1    1 
ATOM   706   H  HD2    . TYR A 1 42  ? -4.761  62.434  42.576  1.00 54.25  ? 42  TYR A HD2    1 
ATOM   707   H  HE1    . TYR A 1 42  ? -7.875  65.678  43.592  1.00 47.60  ? 42  TYR A HE1    1 
ATOM   708   H  HE2    . TYR A 1 42  ? -4.144  64.261  43.830  1.00 57.99  ? 42  TYR A HE2    1 
ATOM   709   H  HH     . TYR A 1 42  ? -6.216  66.744  44.698  1.00 42.47  ? 42  TYR A HH     1 
ATOM   710   N  N      . VAL A 1 43  ? -5.390  59.726  42.884  1.00 35.27  ? 43  VAL A N      1 
ATOM   711   C  CA     . VAL A 1 43  ? -4.267  59.385  43.741  1.00 30.83  ? 43  VAL A CA     1 
ATOM   712   C  C      . VAL A 1 43  ? -2.972  59.538  42.957  1.00 27.58  ? 43  VAL A C      1 
ATOM   713   O  O      . VAL A 1 43  ? -2.928  59.263  41.760  1.00 24.56  ? 43  VAL A O      1 
ATOM   714   C  CB     . VAL A 1 43  ? -4.379  57.945  44.290  1.00 29.55  ? 43  VAL A CB     1 
ATOM   715   C  CG1    . VAL A 1 43  ? -4.381  56.928  43.157  1.00 32.58  ? 43  VAL A CG1    1 
ATOM   716   C  CG2    . VAL A 1 43  ? -3.250  57.652  45.262  1.00 36.20  ? 43  VAL A CG2    1 
ATOM   717   H  H      . VAL A 1 43  ? -5.239  59.597  42.047  1.00 42.32  ? 43  VAL A H      1 
ATOM   718   H  HA     . VAL A 1 43  ? -4.241  59.996  44.494  1.00 37.00  ? 43  VAL A HA     1 
ATOM   719   H  HB     . VAL A 1 43  ? -5.217  57.857  44.771  1.00 35.46  ? 43  VAL A HB     1 
ATOM   720   H  HG11   . VAL A 1 43  ? -4.453  56.037  43.533  1.00 39.09  ? 43  VAL A HG11   1 
ATOM   721   H  HG12   . VAL A 1 43  ? -5.138  57.104  42.576  1.00 39.09  ? 43  VAL A HG12   1 
ATOM   722   H  HG13   . VAL A 1 43  ? -3.554  57.011  42.657  1.00 39.09  ? 43  VAL A HG13   1 
ATOM   723   H  HG21   . VAL A 1 43  ? -3.344  56.744  45.591  1.00 43.43  ? 43  VAL A HG21   1 
ATOM   724   H  HG22   . VAL A 1 43  ? -2.403  57.751  44.801  1.00 43.43  ? 43  VAL A HG22   1 
ATOM   725   H  HG23   . VAL A 1 43  ? -3.300  58.278  46.001  1.00 43.43  ? 43  VAL A HG23   1 
ATOM   726   N  N      . PHE A 1 44  ? -1.927  60.000  43.635  1.00 38.88  ? 44  PHE A N      1 
ATOM   727   C  CA     . PHE A 1 44  ? -0.600  60.086  43.041  1.00 32.12  ? 44  PHE A CA     1 
ATOM   728   C  C      . PHE A 1 44  ? 0.162   58.798  43.299  1.00 34.13  ? 44  PHE A C      1 
ATOM   729   O  O      . PHE A 1 44  ? 0.298   58.373  44.445  1.00 39.29  ? 44  PHE A O      1 
ATOM   730   C  CB     . PHE A 1 44  ? 0.175   61.274  43.607  1.00 32.05  ? 44  PHE A CB     1 
ATOM   731   C  CG     . PHE A 1 44  ? -0.154  62.578  42.951  1.00 36.93  ? 44  PHE A CG     1 
ATOM   732   C  CD1    . PHE A 1 44  ? -1.415  63.131  43.076  1.00 40.73  ? 44  PHE A CD1    1 
ATOM   733   C  CD2    . PHE A 1 44  ? 0.800   63.255  42.212  1.00 47.48  ? 44  PHE A CD2    1 
ATOM   734   C  CE1    . PHE A 1 44  ? -1.719  64.335  42.472  1.00 40.21  ? 44  PHE A CE1    1 
ATOM   735   C  CE2    . PHE A 1 44  ? 0.502   64.459  41.605  1.00 35.49  ? 44  PHE A CE2    1 
ATOM   736   C  CZ     . PHE A 1 44  ? -0.759  65.000  41.736  1.00 35.05  ? 44  PHE A CZ     1 
ATOM   737   H  H      . PHE A 1 44  ? -1.962  60.273  44.450  1.00 46.66  ? 44  PHE A H      1 
ATOM   738   H  HA     . PHE A 1 44  ? -0.684  60.205  42.081  1.00 38.54  ? 44  PHE A HA     1 
ATOM   739   H  HB2    . PHE A 1 44  ? -0.028  61.358  44.552  1.00 38.46  ? 44  PHE A HB2    1 
ATOM   740   H  HB3    . PHE A 1 44  ? 1.124   61.113  43.487  1.00 38.46  ? 44  PHE A HB3    1 
ATOM   741   H  HD1    . PHE A 1 44  ? -2.065  62.687  43.571  1.00 48.88  ? 44  PHE A HD1    1 
ATOM   742   H  HD2    . PHE A 1 44  ? 1.652   62.893  42.121  1.00 56.98  ? 44  PHE A HD2    1 
ATOM   743   H  HE1    . PHE A 1 44  ? -2.571  64.698  42.561  1.00 48.25  ? 44  PHE A HE1    1 
ATOM   744   H  HE2    . PHE A 1 44  ? 1.151   64.905  41.110  1.00 42.59  ? 44  PHE A HE2    1 
ATOM   745   H  HZ     . PHE A 1 44  ? -0.963  65.811  41.329  1.00 42.06  ? 44  PHE A HZ     1 
ATOM   746   N  N      . VAL A 1 45  ? 0.653   58.182  42.229  1.00 41.91  ? 45  VAL A N      1 
ATOM   747   C  CA     . VAL A 1 45  ? 1.416   56.945  42.329  1.00 35.38  ? 45  VAL A CA     1 
ATOM   748   C  C      . VAL A 1 45  ? 2.730   57.066  41.562  1.00 33.77  ? 45  VAL A C      1 
ATOM   749   O  O      . VAL A 1 45  ? 3.066   58.137  41.050  1.00 40.59  ? 45  VAL A O      1 
ATOM   750   C  CB     . VAL A 1 45  ? 0.611   55.750  41.783  1.00 25.05  ? 45  VAL A CB     1 
ATOM   751   C  CG1    . VAL A 1 45  ? -0.653  55.550  42.592  1.00 27.59  ? 45  VAL A CG1    1 
ATOM   752   C  CG2    . VAL A 1 45  ? 0.260   55.965  40.325  1.00 34.17  ? 45  VAL A CG2    1 
ATOM   753   H  H      . VAL A 1 45  ? 0.555   58.465  41.422  1.00 50.29  ? 45  VAL A H      1 
ATOM   754   H  HA     . VAL A 1 45  ? 1.622   56.772  43.260  1.00 42.46  ? 45  VAL A HA     1 
ATOM   755   H  HB     . VAL A 1 45  ? 1.147   54.945  41.851  1.00 30.06  ? 45  VAL A HB     1 
ATOM   756   H  HG11   . VAL A 1 45  ? -1.142  54.794  42.231  1.00 33.10  ? 45  VAL A HG11   1 
ATOM   757   H  HG12   . VAL A 1 45  ? -0.412  55.378  43.516  1.00 33.10  ? 45  VAL A HG12   1 
ATOM   758   H  HG13   . VAL A 1 45  ? -1.194  56.352  42.535  1.00 33.10  ? 45  VAL A HG13   1 
ATOM   759   H  HG21   . VAL A 1 45  ? -0.245  55.201  40.006  1.00 41.00  ? 45  VAL A HG21   1 
ATOM   760   H  HG22   . VAL A 1 45  ? -0.273  56.772  40.245  1.00 41.00  ? 45  VAL A HG22   1 
ATOM   761   H  HG23   . VAL A 1 45  ? 1.079   56.058  39.814  1.00 41.00  ? 45  VAL A HG23   1 
ATOM   762   N  N      . GLY A 1 46  ? 3.469   55.966  41.487  1.00 20.95  ? 46  GLY A N      1 
ATOM   763   C  CA     . GLY A 1 46  ? 4.673   55.915  40.681  1.00 45.13  ? 46  GLY A CA     1 
ATOM   764   C  C      . GLY A 1 46  ? 5.924   56.362  41.408  1.00 32.61  ? 46  GLY A C      1 
ATOM   765   O  O      . GLY A 1 46  ? 5.927   56.545  42.621  1.00 33.90  ? 46  GLY A O      1 
ATOM   766   H  H      . GLY A 1 46  ? 3.290   55.232  41.897  1.00 25.14  ? 46  GLY A H      1 
ATOM   767   H  HA2    . GLY A 1 46  ? 4.811   55.006  40.374  1.00 54.16  ? 46  GLY A HA2    1 
ATOM   768   H  HA3    . GLY A 1 46  ? 4.558   56.483  39.902  1.00 54.16  ? 46  GLY A HA3    1 
ATOM   769   N  N      . SER A 1 47  ? 6.995   56.546  40.646  1.00 37.10  ? 47  SER A N      1 
ATOM   770   C  CA     . SER A 1 47  ? 8.293   56.885  41.207  1.00 36.37  ? 47  SER A CA     1 
ATOM   771   C  C      . SER A 1 47  ? 8.316   58.289  41.789  1.00 41.00  ? 47  SER A C      1 
ATOM   772   O  O      . SER A 1 47  ? 9.217   58.631  42.551  1.00 56.54  ? 47  SER A O      1 
ATOM   773   C  CB     . SER A 1 47  ? 9.381   56.754  40.140  1.00 53.64  ? 47  SER A CB     1 
ATOM   774   O  OG     . SER A 1 47  ? 9.146   57.643  39.059  1.00 70.46  ? 47  SER A OG     1 
ATOM   775   H  H      . SER A 1 47  ? 6.994   56.480  39.788  1.00 44.52  ? 47  SER A H      1 
ATOM   776   H  HA     . SER A 1 47  ? 8.499   56.262  41.922  1.00 43.64  ? 47  SER A HA     1 
ATOM   777   H  HB2    . SER A 1 47  ? 10.240  56.963  40.538  1.00 64.36  ? 47  SER A HB2    1 
ATOM   778   H  HB3    . SER A 1 47  ? 9.384   55.844  39.804  1.00 64.36  ? 47  SER A HB3    1 
ATOM   779   H  HG     . SER A 1 47  ? 9.750   57.559  38.482  1.00 84.56  ? 47  SER A HG     1 
ATOM   780   N  N      . TYR A 1 48  ? 7.329   59.105  41.436  1.00 39.02  ? 48  TYR A N      1 
ATOM   781   C  CA     . TYR A 1 48  ? 7.286   60.470  41.934  1.00 38.90  ? 48  TYR A CA     1 
ATOM   782   C  C      . TYR A 1 48  ? 6.602   60.525  43.295  1.00 44.64  ? 48  TYR A C      1 
ATOM   783   O  O      . TYR A 1 48  ? 6.988   61.307  44.164  1.00 52.92  ? 48  TYR A O      1 
ATOM   784   C  CB     . TYR A 1 48  ? 6.570   61.396  40.951  1.00 33.34  ? 48  TYR A CB     1 
ATOM   785   C  CG     . TYR A 1 48  ? 6.540   62.820  41.448  1.00 33.04  ? 48  TYR A CG     1 
ATOM   786   C  CD1    . TYR A 1 48  ? 7.689   63.598  41.448  1.00 35.43  ? 48  TYR A CD1    1 
ATOM   787   C  CD2    . TYR A 1 48  ? 5.372   63.375  41.945  1.00 26.15  ? 48  TYR A CD2    1 
ATOM   788   C  CE1    . TYR A 1 48  ? 7.672   64.891  41.920  1.00 43.65  ? 48  TYR A CE1    1 
ATOM   789   C  CE2    . TYR A 1 48  ? 5.346   64.667  42.419  1.00 37.27  ? 48  TYR A CE2    1 
ATOM   790   C  CZ     . TYR A 1 48  ? 6.499   65.421  42.405  1.00 45.68  ? 48  TYR A CZ     1 
ATOM   791   O  OH     . TYR A 1 48  ? 6.475   66.712  42.875  1.00 49.20  ? 48  TYR A OH     1 
ATOM   792   H  H      . TYR A 1 48  ? 6.679   58.894  40.913  1.00 46.82  ? 48  TYR A H      1 
ATOM   793   H  HA     . TYR A 1 48  ? 8.194   60.794  42.043  1.00 46.68  ? 48  TYR A HA     1 
ATOM   794   H  HB2    . TYR A 1 48  ? 7.037   61.382  40.101  1.00 40.01  ? 48  TYR A HB2    1 
ATOM   795   H  HB3    . TYR A 1 48  ? 5.655   61.095  40.837  1.00 40.01  ? 48  TYR A HB3    1 
ATOM   796   H  HD1    . TYR A 1 48  ? 8.483   63.240  41.125  1.00 42.52  ? 48  TYR A HD1    1 
ATOM   797   H  HD2    . TYR A 1 48  ? 4.593   62.867  41.959  1.00 31.38  ? 48  TYR A HD2    1 
ATOM   798   H  HE1    . TYR A 1 48  ? 8.449   65.403  41.911  1.00 52.38  ? 48  TYR A HE1    1 
ATOM   799   H  HE2    . TYR A 1 48  ? 4.554   65.030  42.746  1.00 44.72  ? 48  TYR A HE2    1 
ATOM   800   H  HH     . TYR A 1 48  ? 5.702   66.908  43.139  1.00 59.04  ? 48  TYR A HH     1 
ATOM   801   N  N      . ALA A 1 49  ? 5.592   59.685  43.482  1.00 29.76  ? 49  ALA A N      1 
ATOM   802   C  CA     . ALA A 1 49  ? 4.851   59.664  44.733  1.00 24.90  ? 49  ALA A CA     1 
ATOM   803   C  C      . ALA A 1 49  ? 5.649   58.977  45.834  1.00 41.20  ? 49  ALA A C      1 
ATOM   804   O  O      . ALA A 1 49  ? 5.260   59.018  47.001  1.00 44.42  ? 49  ALA A O      1 
ATOM   805   C  CB     . ALA A 1 49  ? 3.519   58.970  44.538  1.00 36.19  ? 49  ALA A CB     1 
ATOM   806   H  H      . ALA A 1 49  ? 5.316   59.117  42.898  1.00 35.71  ? 49  ALA A H      1 
ATOM   807   H  HA     . ALA A 1 49  ? 4.677   60.576  45.013  1.00 29.87  ? 49  ALA A HA     1 
ATOM   808   H  HB1    . ALA A 1 49  ? 3.040   58.965  45.381  1.00 43.43  ? 49  ALA A HB1    1 
ATOM   809   H  HB2    . ALA A 1 49  ? 3.008   59.451  43.869  1.00 43.43  ? 49  ALA A HB2    1 
ATOM   810   H  HB3    . ALA A 1 49  ? 3.678   58.060  44.242  1.00 43.43  ? 49  ALA A HB3    1 
ATOM   811   N  N      . ARG A 1 50  ? 6.770   58.361  45.460  1.00 40.10  ? 50  ARG A N      1 
ATOM   812   C  CA     . ARG A 1 50  ? 7.639   57.674  46.413  1.00 40.08  ? 50  ARG A CA     1 
ATOM   813   C  C      . ARG A 1 50  ? 9.041   58.277  46.417  1.00 33.53  ? 50  ARG A C      1 
ATOM   814   O  O      . ARG A 1 50  ? 9.924   57.814  47.140  1.00 40.71  ? 50  ARG A O      1 
ATOM   815   C  CB     . ARG A 1 50  ? 7.724   56.183  46.084  1.00 33.38  ? 50  ARG A CB     1 
ATOM   816   C  CG     . ARG A 1 50  ? 6.379   55.516  45.882  1.00 30.20  ? 50  ARG A CG     1 
ATOM   817   C  CD     . ARG A 1 50  ? 6.527   54.023  45.673  1.00 30.59  ? 50  ARG A CD     1 
ATOM   818   N  NE     . ARG A 1 50  ? 5.400   53.476  44.924  1.00 35.17  ? 50  ARG A NE     1 
ATOM   819   C  CZ     . ARG A 1 50  ? 5.416   53.192  43.624  1.00 38.53  ? 50  ARG A CZ     1 
ATOM   820   N  NH1    . ARG A 1 50  ? 6.515   53.370  42.902  1.00 40.03  ? 50  ARG A NH1    1 
ATOM   821   N  NH2    . ARG A 1 50  ? 4.328   52.707  43.042  1.00 51.70  ? 50  ARG A NH2    1 
ATOM   822   H  H      . ARG A 1 50  ? 7.053   58.328  44.648  1.00 48.12  ? 50  ARG A H      1 
ATOM   823   H  HA     . ARG A 1 50  ? 7.268   57.766  47.305  1.00 48.10  ? 50  ARG A HA     1 
ATOM   824   H  HB2    . ARG A 1 50  ? 8.234   56.073  45.267  1.00 40.05  ? 50  ARG A HB2    1 
ATOM   825   H  HB3    . ARG A 1 50  ? 8.173   55.728  46.814  1.00 40.05  ? 50  ARG A HB3    1 
ATOM   826   H  HG2    . ARG A 1 50  ? 5.829   55.660  46.668  1.00 36.24  ? 50  ARG A HG2    1 
ATOM   827   H  HG3    . ARG A 1 50  ? 5.950   55.892  45.098  1.00 36.24  ? 50  ARG A HG3    1 
ATOM   828   H  HD2    . ARG A 1 50  ? 7.339   53.849  45.172  1.00 36.70  ? 50  ARG A HD2    1 
ATOM   829   H  HD3    . ARG A 1 50  ? 6.563   53.581  46.535  1.00 36.70  ? 50  ARG A HD3    1 
ATOM   830   H  HE     . ARG A 1 50  ? 4.670   53.327  45.355  1.00 42.20  ? 50  ARG A HE     1 
ATOM   831   H  HH11   . ARG A 1 50  ? 7.226   53.685  43.270  1.00 48.04  ? 50  ARG A HH11   1 
ATOM   832   H  HH12   . ARG A 1 50  ? 6.515   53.178  42.063  1.00 48.04  ? 50  ARG A HH12   1 
ATOM   833   H  HH21   . ARG A 1 50  ? 3.612   52.583  43.503  1.00 62.04  ? 50  ARG A HH21   1 
ATOM   834   H  HH22   . ARG A 1 50  ? 4.338   52.514  42.204  1.00 62.04  ? 50  ARG A HH22   1 
ATOM   835   N  N      . ASN A 1 51  ? 9.237   59.309  45.605  1.00 38.39  ? 51  ASN A N      1 
ATOM   836   C  CA     . ASN A 1 51  ? 10.524  59.983  45.496  1.00 46.41  ? 51  ASN A CA     1 
ATOM   837   C  C      . ASN A 1 51  ? 11.649  58.999  45.176  1.00 47.50  ? 51  ASN A C      1 
ATOM   838   O  O      . ASN A 1 51  ? 12.654  58.942  45.881  1.00 47.84  ? 51  ASN A O      1 
ATOM   839   C  CB     . ASN A 1 51  ? 10.828  60.746  46.788  1.00 42.26  ? 51  ASN A CB     1 
ATOM   840   C  CG     . ASN A 1 51  ? 11.786  61.901  46.571  1.00 59.71  ? 51  ASN A CG     1 
ATOM   841   O  OD1    . ASN A 1 51  ? 13.000  61.755  46.710  1.00 42.00  ? 51  ASN A OD1    1 
ATOM   842   N  ND2    . ASN A 1 51  ? 11.238  63.061  46.223  1.00 63.89  ? 51  ASN A ND2    1 
ATOM   843   H  H      . ASN A 1 51  ? 8.628   59.644  45.099  1.00 46.07  ? 51  ASN A H      1 
ATOM   844   H  HA     . ASN A 1 51  ? 10.479  60.628  44.773  1.00 55.69  ? 51  ASN A HA     1 
ATOM   845   H  HB2    . ASN A 1 51  ? 10.001  61.105  47.146  1.00 50.72  ? 51  ASN A HB2    1 
ATOM   846   H  HB3    . ASN A 1 51  ? 11.231  60.138  47.427  1.00 50.72  ? 51  ASN A HB3    1 
ATOM   847   H  HD21   . ASN A 1 51  ? 11.737  63.748  46.088  1.00 76.67  ? 51  ASN A HD21   1 
ATOM   848   H  HD22   . ASN A 1 51  ? 10.386  63.124  46.134  1.00 76.67  ? 51  ASN A HD22   1 
ATOM   849   N  N      . THR A 1 52  ? 11.462  58.224  44.110  1.00 50.03  ? 52  THR A N      1 
ATOM   850   C  CA     . THR A 1 52  ? 12.464  57.267  43.646  1.00 35.81  ? 52  THR A CA     1 
ATOM   851   C  C      . THR A 1 52  ? 12.739  57.413  42.148  1.00 45.25  ? 52  THR A C      1 
ATOM   852   O  O      . THR A 1 52  ? 13.251  56.489  41.515  1.00 45.12  ? 52  THR A O      1 
ATOM   853   C  CB     . THR A 1 52  ? 12.030  55.818  43.933  1.00 29.07  ? 52  THR A CB     1 
ATOM   854   O  OG1    . THR A 1 52  ? 10.773  55.558  43.302  1.00 28.42  ? 52  THR A OG1    1 
ATOM   855   C  CG2    . THR A 1 52  ? 11.892  55.587  45.422  1.00 45.65  ? 52  THR A CG2    1 
ATOM   856   H  H      . THR A 1 52  ? 10.749  58.235  43.629  1.00 60.03  ? 52  THR A H      1 
ATOM   857   H  HA     . THR A 1 52  ? 13.295  57.430  44.120  1.00 42.97  ? 52  THR A HA     1 
ATOM   858   H  HB     . THR A 1 52  ? 12.699  55.206  43.587  1.00 34.88  ? 52  THR A HB     1 
ATOM   859   H  HG1    . THR A 1 52  ? 10.532  54.768  43.456  1.00 34.10  ? 52  THR A HG1    1 
ATOM   860   H  HG21   . THR A 1 52  ? 11.619  54.671  45.591  1.00 54.78  ? 52  THR A HG21   1 
ATOM   861   H  HG22   . THR A 1 52  ? 12.741  55.749  45.863  1.00 54.78  ? 52  THR A HG22   1 
ATOM   862   H  HG23   . THR A 1 52  ? 11.226  56.188  45.790  1.00 54.78  ? 52  THR A HG23   1 
ATOM   863   N  N      . TRP A 1 53  ? 12.407  58.573  41.586  1.00 55.51  ? 53  TRP A N      1 
ATOM   864   C  CA     . TRP A 1 53  ? 12.602  58.819  40.160  1.00 41.92  ? 53  TRP A CA     1 
ATOM   865   C  C      . TRP A 1 53  ? 14.039  59.262  39.894  1.00 45.09  ? 53  TRP A C      1 
ATOM   866   O  O      . TRP A 1 53  ? 14.646  59.948  40.713  1.00 56.07  ? 53  TRP A O      1 
ATOM   867   C  CB     . TRP A 1 53  ? 11.598  59.862  39.642  1.00 41.57  ? 53  TRP A CB     1 
ATOM   868   C  CG     . TRP A 1 53  ? 11.949  61.307  39.905  1.00 42.93  ? 53  TRP A CG     1 
ATOM   869   C  CD1    . TRP A 1 53  ? 12.685  62.131  39.100  1.00 49.84  ? 53  TRP A CD1    1 
ATOM   870   C  CD2    . TRP A 1 53  ? 11.556  62.102  41.030  1.00 43.11  ? 53  TRP A CD2    1 
ATOM   871   N  NE1    . TRP A 1 53  ? 12.781  63.382  39.657  1.00 39.50  ? 53  TRP A NE1    1 
ATOM   872   C  CE2    . TRP A 1 53  ? 12.096  63.391  40.846  1.00 44.24  ? 53  TRP A CE2    1 
ATOM   873   C  CE3    . TRP A 1 53  ? 10.804  61.849  42.181  1.00 42.49  ? 53  TRP A CE3    1 
ATOM   874   C  CZ2    . TRP A 1 53  ? 11.911  64.420  41.764  1.00 49.12  ? 53  TRP A CZ2    1 
ATOM   875   C  CZ3    . TRP A 1 53  ? 10.621  62.874  43.095  1.00 60.95  ? 53  TRP A CZ3    1 
ATOM   876   C  CH2    . TRP A 1 53  ? 11.171  64.142  42.880  1.00 55.11  ? 53  TRP A CH2    1 
ATOM   877   H  H      . TRP A 1 53  ? 12.065  59.237  42.012  1.00 66.61  ? 53  TRP A H      1 
ATOM   878   H  HA     . TRP A 1 53  ? 12.450  57.993  39.675  1.00 50.31  ? 53  TRP A HA     1 
ATOM   879   H  HB2    . TRP A 1 53  ? 11.515  59.754  38.682  1.00 49.89  ? 53  TRP A HB2    1 
ATOM   880   H  HB3    . TRP A 1 53  ? 10.740  59.692  40.061  1.00 49.89  ? 53  TRP A HB3    1 
ATOM   881   H  HD1    . TRP A 1 53  ? 13.067  61.879  38.290  1.00 59.81  ? 53  TRP A HD1    1 
ATOM   882   H  HE1    . TRP A 1 53  ? 13.203  64.050  39.318  1.00 47.41  ? 53  TRP A HE1    1 
ATOM   883   H  HE3    . TRP A 1 53  ? 10.435  61.008  42.331  1.00 50.98  ? 53  TRP A HE3    1 
ATOM   884   H  HZ2    . TRP A 1 53  ? 12.277  65.264  41.624  1.00 58.94  ? 53  TRP A HZ2    1 
ATOM   885   H  HZ3    . TRP A 1 53  ? 10.122  62.716  43.864  1.00 73.14  ? 53  TRP A HZ3    1 
ATOM   886   H  HH2    . TRP A 1 53  ? 11.032  64.810  43.511  1.00 66.13  ? 53  TRP A HH2    1 
ATOM   887   N  N      . LEU A 1 54  ? 14.580  58.849  38.751  1.00 51.45  ? 54  LEU A N      1 
ATOM   888   C  CA     . LEU A 1 54  ? 15.964  59.149  38.397  1.00 34.92  ? 54  LEU A CA     1 
ATOM   889   C  C      . LEU A 1 54  ? 16.142  60.588  37.926  1.00 47.59  ? 54  LEU A C      1 
ATOM   890   O  O      . LEU A 1 54  ? 15.203  61.215  37.441  1.00 47.87  ? 54  LEU A O      1 
ATOM   891   C  CB     . LEU A 1 54  ? 16.441  58.206  37.295  1.00 31.14  ? 54  LEU A CB     1 
ATOM   892   C  CG     . LEU A 1 54  ? 16.841  56.786  37.687  1.00 31.36  ? 54  LEU A CG     1 
ATOM   893   C  CD1    . LEU A 1 54  ? 17.239  56.001  36.444  1.00 32.30  ? 54  LEU A CD1    1 
ATOM   894   C  CD2    . LEU A 1 54  ? 17.969  56.785  38.691  1.00 42.18  ? 54  LEU A CD2    1 
ATOM   895   H  H      . LEU A 1 54  ? 14.162  58.389  38.157  1.00 61.73  ? 54  LEU A H      1 
ATOM   896   H  HA     . LEU A 1 54  ? 16.528  59.015  39.175  1.00 41.90  ? 54  LEU A HA     1 
ATOM   897   H  HB2    . LEU A 1 54  ? 15.728  58.128  36.642  1.00 37.37  ? 54  LEU A HB2    1 
ATOM   898   H  HB3    . LEU A 1 54  ? 17.214  58.610  36.872  1.00 37.37  ? 54  LEU A HB3    1 
ATOM   899   H  HG     . LEU A 1 54  ? 16.078  56.342  38.091  1.00 37.63  ? 54  LEU A HG     1 
ATOM   900   H  HD11   . LEU A 1 54  ? 17.491  55.102  36.706  1.00 38.76  ? 54  LEU A HD11   1 
ATOM   901   H  HD12   . LEU A 1 54  ? 16.485  55.970  35.835  1.00 38.76  ? 54  LEU A HD12   1 
ATOM   902   H  HD13   . LEU A 1 54  ? 17.990  56.444  36.018  1.00 38.76  ? 54  LEU A HD13   1 
ATOM   903   H  HD21   . LEU A 1 54  ? 18.193  55.868  38.913  1.00 50.62  ? 54  LEU A HD21   1 
ATOM   904   H  HD22   . LEU A 1 54  ? 18.738  57.229  38.301  1.00 50.62  ? 54  LEU A HD22   1 
ATOM   905   H  HD23   . LEU A 1 54  ? 17.682  57.259  39.488  1.00 50.62  ? 54  LEU A HD23   1 
ATOM   906   N  N      . LYS A 1 55  ? 17.359  61.102  38.065  1.00 52.07  ? 55  LYS A N      1 
ATOM   907   C  CA     . LYS A 1 55  ? 17.681  62.445  37.604  1.00 38.92  ? 55  LYS A CA     1 
ATOM   908   C  C      . LYS A 1 55  ? 17.456  62.555  36.100  1.00 47.03  ? 55  LYS A C      1 
ATOM   909   O  O      . LYS A 1 55  ? 17.920  61.711  35.331  1.00 57.46  ? 55  LYS A O      1 
ATOM   910   C  CB     . LYS A 1 55  ? 19.130  62.796  37.948  1.00 41.80  ? 55  LYS A CB     1 
ATOM   911   C  CG     . LYS A 1 55  ? 19.547  64.201  37.540  1.00 59.31  ? 55  LYS A CG     1 
ATOM   912   C  CD     . LYS A 1 55  ? 20.984  64.497  37.940  1.00 63.40  ? 55  LYS A CD     1 
ATOM   913   C  CE     . LYS A 1 55  ? 21.412  65.881  37.485  1.00 75.52  ? 55  LYS A CE     1 
ATOM   914   N  NZ     . LYS A 1 55  ? 22.782  66.224  37.955  1.00 83.20  ? 55  LYS A NZ     1 
ATOM   915   H  H      . LYS A 1 55  ? 18.021  60.688  38.426  1.00 62.48  ? 55  LYS A H      1 
ATOM   916   H  HA     . LYS A 1 55  ? 17.100  63.083  38.046  1.00 46.70  ? 55  LYS A HA     1 
ATOM   917   H  HB2    . LYS A 1 55  ? 19.249  62.721  38.908  1.00 50.16  ? 55  LYS A HB2    1 
ATOM   918   H  HB3    . LYS A 1 55  ? 19.718  62.171  37.495  1.00 50.16  ? 55  LYS A HB3    1 
ATOM   919   H  HG2    . LYS A 1 55  ? 19.476  64.289  36.576  1.00 71.17  ? 55  LYS A HG2    1 
ATOM   920   H  HG3    . LYS A 1 55  ? 18.970  64.846  37.979  1.00 71.17  ? 55  LYS A HG3    1 
ATOM   921   H  HD2    . LYS A 1 55  ? 21.063  64.457  38.906  1.00 76.08  ? 55  LYS A HD2    1 
ATOM   922   H  HD3    . LYS A 1 55  ? 21.573  63.846  37.527  1.00 76.08  ? 55  LYS A HD3    1 
ATOM   923   H  HE2    . LYS A 1 55  ? 21.407  65.914  36.516  1.00 90.63  ? 55  LYS A HE2    1 
ATOM   924   H  HE3    . LYS A 1 55  ? 20.796  66.539  37.845  1.00 90.63  ? 55  LYS A HE3    1 
ATOM   925   H  HZ1    . LYS A 1 55  ? 23.005  67.038  37.674  1.00 99.85  ? 55  LYS A HZ1    1 
ATOM   926   H  HZ2    . LYS A 1 55  ? 22.812  66.206  38.844  1.00 99.85  ? 55  LYS A HZ2    1 
ATOM   927   H  HZ3    . LYS A 1 55  ? 23.369  65.637  37.634  1.00 99.85  ? 55  LYS A HZ3    1 
ATOM   928   N  N      . GLY A 1 56  ? 16.736  63.591  35.685  1.00 44.40  ? 56  GLY A N      1 
ATOM   929   C  CA     . GLY A 1 56  ? 16.480  63.824  34.276  1.00 43.89  ? 56  GLY A CA     1 
ATOM   930   C  C      . GLY A 1 56  ? 15.275  63.071  33.747  1.00 48.70  ? 56  GLY A C      1 
ATOM   931   O  O      . GLY A 1 56  ? 14.805  63.349  32.643  1.00 55.88  ? 56  GLY A O      1 
ATOM   932   H  H      . GLY A 1 56  ? 16.382  64.176  36.207  1.00 53.28  ? 56  GLY A H      1 
ATOM   933   H  HA2    . GLY A 1 56  ? 16.333  64.772  34.130  1.00 52.67  ? 56  GLY A HA2    1 
ATOM   934   H  HA3    . GLY A 1 56  ? 17.256  63.554  33.761  1.00 52.67  ? 56  GLY A HA3    1 
ATOM   935   N  N      . SER A 1 57  ? 14.780  62.117  34.531  1.00 44.25  ? 57  SER A N      1 
ATOM   936   C  CA     . SER A 1 57  ? 13.635  61.302  34.135  1.00 37.43  ? 57  SER A CA     1 
ATOM   937   C  C      . SER A 1 57  ? 12.391  61.630  34.954  1.00 35.52  ? 57  SER A C      1 
ATOM   938   O  O      . SER A 1 57  ? 11.731  60.732  35.476  1.00 54.57  ? 57  SER A O      1 
ATOM   939   C  CB     . SER A 1 57  ? 13.975  59.819  34.280  1.00 51.77  ? 57  SER A CB     1 
ATOM   940   O  OG     . SER A 1 57  ? 15.125  59.490  33.522  1.00 70.62  ? 57  SER A OG     1 
ATOM   941   H  H      . SER A 1 57  ? 15.093  61.921  35.307  1.00 53.09  ? 57  SER A H      1 
ATOM   942   H  HA     . SER A 1 57  ? 13.433  61.473  33.201  1.00 44.91  ? 57  SER A HA     1 
ATOM   943   H  HB2    . SER A 1 57  ? 14.146  59.625  35.215  1.00 62.12  ? 57  SER A HB2    1 
ATOM   944   H  HB3    . SER A 1 57  ? 13.225  59.291  33.964  1.00 62.12  ? 57  SER A HB3    1 
ATOM   945   H  HG     . SER A 1 57  ? 15.782  59.942  33.786  1.00 84.74  ? 57  SER A HG     1 
ATOM   946   N  N      . LEU A 1 58  ? 12.066  62.915  35.052  1.00 35.95  ? 58  LEU A N      1 
ATOM   947   C  CA     . LEU A 1 58  ? 10.923  63.353  35.848  1.00 39.84  ? 58  LEU A CA     1 
ATOM   948   C  C      . LEU A 1 58  ? 9.602   63.124  35.124  1.00 32.74  ? 58  LEU A C      1 
ATOM   949   O  O      . LEU A 1 58  ? 9.360   63.689  34.059  1.00 44.38  ? 58  LEU A O      1 
ATOM   950   C  CB     . LEU A 1 58  ? 11.059  64.837  36.205  1.00 38.20  ? 58  LEU A CB     1 
ATOM   951   C  CG     . LEU A 1 58  ? 9.863   65.470  36.928  1.00 39.61  ? 58  LEU A CG     1 
ATOM   952   C  CD1    . LEU A 1 58  ? 9.590   64.767  38.248  1.00 51.99  ? 58  LEU A CD1    1 
ATOM   953   C  CD2    . LEU A 1 58  ? 10.078  66.956  37.149  1.00 25.49  ? 58  LEU A CD2    1 
ATOM   954   H  H      . LEU A 1 58  ? 12.492  63.555  34.667  1.00 43.14  ? 58  LEU A H      1 
ATOM   955   H  HA     . LEU A 1 58  ? 10.903  62.847  36.675  1.00 47.80  ? 58  LEU A HA     1 
ATOM   956   H  HB2    . LEU A 1 58  ? 11.832  64.942  36.780  1.00 45.84  ? 58  LEU A HB2    1 
ATOM   957   H  HB3    . LEU A 1 58  ? 11.197  65.336  35.385  1.00 45.84  ? 58  LEU A HB3    1 
ATOM   958   H  HG     . LEU A 1 58  ? 9.075   65.367  36.372  1.00 47.53  ? 58  LEU A HG     1 
ATOM   959   H  HD11   . LEU A 1 58  ? 8.831   65.190  38.679  1.00 62.39  ? 58  LEU A HD11   1 
ATOM   960   H  HD12   . LEU A 1 58  ? 9.395   63.833  38.074  1.00 62.39  ? 58  LEU A HD12   1 
ATOM   961   H  HD13   . LEU A 1 58  ? 10.376  64.842  38.813  1.00 62.39  ? 58  LEU A HD13   1 
ATOM   962   H  HD21   . LEU A 1 58  ? 9.305   67.322  37.607  1.00 30.58  ? 58  LEU A HD21   1 
ATOM   963   H  HD22   . LEU A 1 58  ? 10.874  67.082  37.689  1.00 30.58  ? 58  LEU A HD22   1 
ATOM   964   H  HD23   . LEU A 1 58  ? 10.190  67.389  36.288  1.00 30.58  ? 58  LEU A HD23   1 
ATOM   965   N  N      . GLU A 1 59  ? 8.753   62.287  35.709  1.00 32.99  ? 59  GLU A N      1 
ATOM   966   C  CA     . GLU A 1 59  ? 7.401   62.085  35.203  1.00 41.25  ? 59  GLU A CA     1 
ATOM   967   C  C      . GLU A 1 59  ? 6.437   61.861  36.367  1.00 38.88  ? 59  GLU A C      1 
ATOM   968   O  O      . GLU A 1 59  ? 6.699   61.060  37.264  1.00 39.71  ? 59  GLU A O      1 
ATOM   969   C  CB     . GLU A 1 59  ? 7.343   60.910  34.224  1.00 55.78  ? 59  GLU A CB     1 
ATOM   970   C  CG     . GLU A 1 59  ? 5.983   60.752  33.548  1.00 59.69  ? 59  GLU A CG     1 
ATOM   971   C  CD     . GLU A 1 59  ? 5.777   59.381  32.936  1.00 75.61  ? 59  GLU A CD     1 
ATOM   972   O  OE1    . GLU A 1 59  ? 5.283   58.477  33.647  1.00 60.64  ? 59  GLU A OE1    1 
ATOM   973   O  OE2    . GLU A 1 59  ? 6.100   59.213  31.739  1.00 81.12  ? 59  GLU A OE2    1 
ATOM   974   H  H      . GLU A 1 59  ? 8.938   61.819  36.407  1.00 39.59  ? 59  GLU A H      1 
ATOM   975   H  HA     . GLU A 1 59  ? 7.119   62.883  34.730  1.00 49.50  ? 59  GLU A HA     1 
ATOM   976   H  HB2    . GLU A 1 59  ? 8.007   61.047  33.530  1.00 66.93  ? 59  GLU A HB2    1 
ATOM   977   H  HB3    . GLU A 1 59  ? 7.534   60.090  34.706  1.00 66.93  ? 59  GLU A HB3    1 
ATOM   978   H  HG2    . GLU A 1 59  ? 5.286   60.893  34.207  1.00 71.63  ? 59  GLU A HG2    1 
ATOM   979   H  HG3    . GLU A 1 59  ? 5.906   61.409  32.839  1.00 71.63  ? 59  GLU A HG3    1 
ATOM   980   N  N      . ILE A 1 60  ? 5.327   62.589  36.342  1.00 25.93  ? 60  ILE A N      1 
ATOM   981   C  CA     . ILE A 1 60  ? 4.280   62.456  37.343  1.00 28.45  ? 60  ILE A CA     1 
ATOM   982   C  C      . ILE A 1 60  ? 3.166   61.551  36.828  1.00 32.68  ? 60  ILE A C      1 
ATOM   983   O  O      . ILE A 1 60  ? 2.715   61.696  35.696  1.00 46.64  ? 60  ILE A O      1 
ATOM   984   C  CB     . ILE A 1 60  ? 3.691   63.826  37.720  1.00 36.57  ? 60  ILE A CB     1 
ATOM   985   C  CG1    . ILE A 1 60  ? 4.810   64.777  38.152  1.00 36.47  ? 60  ILE A CG1    1 
ATOM   986   C  CG2    . ILE A 1 60  ? 2.654   63.676  38.830  1.00 37.09  ? 60  ILE A CG2    1 
ATOM   987   C  CD1    . ILE A 1 60  ? 4.353   66.192  38.400  1.00 41.41  ? 60  ILE A CD1    1 
ATOM   988   H  H      . ILE A 1 60  ? 5.155   63.180  35.741  1.00 31.11  ? 60  ILE A H      1 
ATOM   989   H  HA     . ILE A 1 60  ? 4.652   62.055  38.144  1.00 34.14  ? 60  ILE A HA     1 
ATOM   990   H  HB     . ILE A 1 60  ? 3.254   64.199  36.939  1.00 43.88  ? 60  ILE A HB     1 
ATOM   991   H  HG12   . ILE A 1 60  ? 5.202   64.444  38.974  1.00 43.76  ? 60  ILE A HG12   1 
ATOM   992   H  HG13   . ILE A 1 60  ? 5.484   64.802  37.454  1.00 43.76  ? 60  ILE A HG13   1 
ATOM   993   H  HG21   . ILE A 1 60  ? 2.298   64.551  39.050  1.00 44.51  ? 60  ILE A HG21   1 
ATOM   994   H  HG22   . ILE A 1 60  ? 1.941   63.096  38.519  1.00 44.51  ? 60  ILE A HG22   1 
ATOM   995   H  HG23   . ILE A 1 60  ? 3.081   63.287  39.609  1.00 44.51  ? 60  ILE A HG23   1 
ATOM   996   H  HD11   . ILE A 1 60  ? 5.117   66.728  38.668  1.00 49.69  ? 60  ILE A HD11   1 
ATOM   997   H  HD12   . ILE A 1 60  ? 3.969   66.548  37.584  1.00 49.69  ? 60  ILE A HD12   1 
ATOM   998   H  HD13   . ILE A 1 60  ? 3.687   66.189  39.105  1.00 49.69  ? 60  ILE A HD13   1 
ATOM   999   N  N      . ASP A 1 61  ? 2.734   60.612  37.664  1.00 44.30  ? 61  ASP A N      1 
ATOM   1000  C  CA     . ASP A 1 61  ? 1.643   59.707  37.315  1.00 35.78  ? 61  ASP A CA     1 
ATOM   1001  C  C      . ASP A 1 61  ? 0.453   60.007  38.210  1.00 28.23  ? 61  ASP A C      1 
ATOM   1002  O  O      . ASP A 1 61  ? 0.599   60.119  39.425  1.00 34.40  ? 61  ASP A O      1 
ATOM   1003  C  CB     . ASP A 1 61  ? 2.061   58.237  37.466  1.00 36.29  ? 61  ASP A CB     1 
ATOM   1004  C  CG     . ASP A 1 61  ? 3.220   57.856  36.561  1.00 46.81  ? 61  ASP A CG     1 
ATOM   1005  O  OD1    . ASP A 1 61  ? 2.994   57.654  35.350  1.00 56.32  ? 61  ASP A OD1    1 
ATOM   1006  O  OD2    . ASP A 1 61  ? 4.357   57.741  37.065  1.00 54.23  ? 61  ASP A OD2    1 
ATOM   1007  H  H      . ASP A 1 61  ? 3.060   60.477  38.448  1.00 53.16  ? 61  ASP A H      1 
ATOM   1008  H  HA     . ASP A 1 61  ? 1.381   59.858  36.393  1.00 42.94  ? 61  ASP A HA     1 
ATOM   1009  H  HB2    . ASP A 1 61  ? 2.333   58.080  38.384  1.00 43.55  ? 61  ASP A HB2    1 
ATOM   1010  H  HB3    . ASP A 1 61  ? 1.307   57.670  37.242  1.00 43.55  ? 61  ASP A HB3    1 
ATOM   1011  N  N      . VAL A 1 62  ? -0.718  60.149  37.596  1.00 24.63  ? 62  VAL A N      1 
ATOM   1012  C  CA     . VAL A 1 62  ? -1.952  60.446  38.318  1.00 25.83  ? 62  VAL A CA     1 
ATOM   1013  C  C      . VAL A 1 62  ? -3.050  59.467  37.944  1.00 23.49  ? 62  VAL A C      1 
ATOM   1014  O  O      . VAL A 1 62  ? -3.509  59.448  36.803  1.00 23.75  ? 62  VAL A O      1 
ATOM   1015  C  CB     . VAL A 1 62  ? -2.456  61.872  38.016  1.00 22.60  ? 62  VAL A CB     1 
ATOM   1016  C  CG1    . VAL A 1 62  ? -3.761  62.156  38.755  1.00 29.16  ? 62  VAL A CG1    1 
ATOM   1017  C  CG2    . VAL A 1 62  ? -1.407  62.898  38.382  1.00 28.94  ? 62  VAL A CG2    1 
ATOM   1018  H  H      . VAL A 1 62  ? -0.826  60.077  36.746  1.00 29.55  ? 62  VAL A H      1 
ATOM   1019  H  HA     . VAL A 1 62  ? -1.790  60.375  39.272  1.00 31.00  ? 62  VAL A HA     1 
ATOM   1020  H  HB     . VAL A 1 62  ? -2.630  61.949  37.064  1.00 27.12  ? 62  VAL A HB     1 
ATOM   1021  H  HG11   . VAL A 1 62  ? -4.053  63.057  38.546  1.00 34.99  ? 62  VAL A HG11   1 
ATOM   1022  H  HG12   . VAL A 1 62  ? -4.432  61.516  38.469  1.00 34.99  ? 62  VAL A HG12   1 
ATOM   1023  H  HG13   . VAL A 1 62  ? -3.608  62.070  39.709  1.00 34.99  ? 62  VAL A HG13   1 
ATOM   1024  H  HG21   . VAL A 1 62  ? -1.748  63.784  38.182  1.00 34.73  ? 62  VAL A HG21   1 
ATOM   1025  H  HG22   . VAL A 1 62  ? -1.210  62.824  39.329  1.00 34.73  ? 62  VAL A HG22   1 
ATOM   1026  H  HG23   . VAL A 1 62  ? -0.605  62.728  37.863  1.00 34.73  ? 62  VAL A HG23   1 
ATOM   1027  N  N      . PHE A 1 63  ? -3.495  58.681  38.917  1.00 20.02  ? 63  PHE A N      1 
ATOM   1028  C  CA     . PHE A 1 63  ? -4.574  57.737  38.684  1.00 22.74  ? 63  PHE A CA     1 
ATOM   1029  C  C      . PHE A 1 63  ? -5.910  58.320  39.095  1.00 24.82  ? 63  PHE A C      1 
ATOM   1030  O  O      . PHE A 1 63  ? -6.038  58.918  40.158  1.00 39.68  ? 63  PHE A O      1 
ATOM   1031  C  CB     . PHE A 1 63  ? -4.316  56.435  39.434  1.00 30.43  ? 63  PHE A CB     1 
ATOM   1032  C  CG     . PHE A 1 63  ? -3.530  55.436  38.642  1.00 32.43  ? 63  PHE A CG     1 
ATOM   1033  C  CD1    . PHE A 1 63  ? -2.351  55.804  38.017  1.00 22.62  ? 63  PHE A CD1    1 
ATOM   1034  C  CD2    . PHE A 1 63  ? -3.968  54.132  38.521  1.00 29.63  ? 63  PHE A CD2    1 
ATOM   1035  C  CE1    . PHE A 1 63  ? -1.628  54.889  37.285  1.00 27.31  ? 63  PHE A CE1    1 
ATOM   1036  C  CE2    . PHE A 1 63  ? -3.249  53.213  37.792  1.00 38.52  ? 63  PHE A CE2    1 
ATOM   1037  C  CZ     . PHE A 1 63  ? -2.077  53.591  37.174  1.00 44.78  ? 63  PHE A CZ     1 
ATOM   1038  H  H      . PHE A 1 63  ? -3.188  58.677  39.720  1.00 24.03  ? 63  PHE A H      1 
ATOM   1039  H  HA     . PHE A 1 63  ? -4.615  57.534  37.737  1.00 27.29  ? 63  PHE A HA     1 
ATOM   1040  H  HB2    . PHE A 1 63  ? -3.817  56.632  40.242  1.00 36.52  ? 63  PHE A HB2    1 
ATOM   1041  H  HB3    . PHE A 1 63  ? -5.167  56.030  39.662  1.00 36.52  ? 63  PHE A HB3    1 
ATOM   1042  H  HD1    . PHE A 1 63  ? -2.046  56.679  38.089  1.00 27.14  ? 63  PHE A HD1    1 
ATOM   1043  H  HD2    . PHE A 1 63  ? -4.759  53.872  38.936  1.00 35.55  ? 63  PHE A HD2    1 
ATOM   1044  H  HE1    . PHE A 1 63  ? -0.837  55.146  36.869  1.00 32.77  ? 63  PHE A HE1    1 
ATOM   1045  H  HE2    . PHE A 1 63  ? -3.553  52.337  37.717  1.00 46.22  ? 63  PHE A HE2    1 
ATOM   1046  H  HZ     . PHE A 1 63  ? -1.590  52.971  36.681  1.00 53.74  ? 63  PHE A HZ     1 
ATOM   1047  N  N      . LEU A 1 64  ? -6.899  58.141  38.228  1.00 26.69  ? 64  LEU A N      1 
ATOM   1048  C  CA     . LEU A 1 64  ? -8.273  58.511  38.519  1.00 24.60  ? 64  LEU A CA     1 
ATOM   1049  C  C      . LEU A 1 64  ? -9.045  57.240  38.819  1.00 34.33  ? 64  LEU A C      1 
ATOM   1050  O  O      . LEU A 1 64  ? -9.050  56.312  38.012  1.00 39.87  ? 64  LEU A O      1 
ATOM   1051  C  CB     . LEU A 1 64  ? -8.899  59.259  37.342  1.00 27.31  ? 64  LEU A CB     1 
ATOM   1052  C  CG     . LEU A 1 64  ? -8.066  60.399  36.759  1.00 14.32  ? 64  LEU A CG     1 
ATOM   1053  C  CD1    . LEU A 1 64  ? -8.785  61.025  35.585  1.00 18.36  ? 64  LEU A CD1    1 
ATOM   1054  C  CD2    . LEU A 1 64  ? -7.766  61.436  37.817  1.00 27.22  ? 64  LEU A CD2    1 
ATOM   1055  H  H      . LEU A 1 64  ? -6.794  57.798  37.446  1.00 32.02  ? 64  LEU A H      1 
ATOM   1056  H  HA     . LEU A 1 64  ? -8.299  59.084  39.301  1.00 29.52  ? 64  LEU A HA     1 
ATOM   1057  H  HB2    . LEU A 1 64  ? -9.060  58.623  36.628  1.00 32.77  ? 64  LEU A HB2    1 
ATOM   1058  H  HB3    . LEU A 1 64  ? -9.743  59.637  37.635  1.00 32.77  ? 64  LEU A HB3    1 
ATOM   1059  H  HG     . LEU A 1 64  ? -7.222  60.043  36.439  1.00 17.18  ? 64  LEU A HG     1 
ATOM   1060  H  HD11   . LEU A 1 64  ? -8.241  61.745  35.230  1.00 22.03  ? 64  LEU A HD11   1 
ATOM   1061  H  HD12   . LEU A 1 64  ? -8.925  60.349  34.904  1.00 22.03  ? 64  LEU A HD12   1 
ATOM   1062  H  HD13   . LEU A 1 64  ? -9.639  61.373  35.887  1.00 22.03  ? 64  LEU A HD13   1 
ATOM   1063  H  HD21   . LEU A 1 64  ? -7.238  62.146  37.421  1.00 32.66  ? 64  LEU A HD21   1 
ATOM   1064  H  HD22   . LEU A 1 64  ? -8.602  61.793  38.154  1.00 32.66  ? 64  LEU A HD22   1 
ATOM   1065  H  HD23   . LEU A 1 64  ? -7.270  61.017  38.538  1.00 32.66  ? 64  LEU A HD23   1 
ATOM   1066  N  N      . LEU A 1 65  ? -9.695  57.194  39.976  1.00 33.27  ? 65  LEU A N      1 
ATOM   1067  C  CA     . LEU A 1 65  ? -10.387 55.987  40.404  1.00 36.29  ? 65  LEU A CA     1 
ATOM   1068  C  C      . LEU A 1 65  ? -11.891 56.098  40.172  1.00 32.01  ? 65  LEU A C      1 
ATOM   1069  O  O      . LEU A 1 65  ? -12.578 56.870  40.838  1.00 41.55  ? 65  LEU A O      1 
ATOM   1070  C  CB     . LEU A 1 65  ? -10.093 55.708  41.877  1.00 44.18  ? 65  LEU A CB     1 
ATOM   1071  C  CG     . LEU A 1 65  ? -8.606  55.589  42.215  1.00 37.98  ? 65  LEU A CG     1 
ATOM   1072  C  CD1    . LEU A 1 65  ? -8.132  56.829  42.946  1.00 31.77  ? 65  LEU A CD1    1 
ATOM   1073  C  CD2    . LEU A 1 65  ? -8.330  54.339  43.029  1.00 45.21  ? 65  LEU A CD2    1 
ATOM   1074  H  H      . LEU A 1 65  ? -9.749  57.849  40.531  1.00 39.92  ? 65  LEU A H      1 
ATOM   1075  H  HA     . LEU A 1 65  ? -10.059 55.235  39.886  1.00 43.55  ? 65  LEU A HA     1 
ATOM   1076  H  HB2    . LEU A 1 65  ? -10.459 56.433  42.409  1.00 53.02  ? 65  LEU A HB2    1 
ATOM   1077  H  HB3    . LEU A 1 65  ? -10.519 54.873  42.126  1.00 53.02  ? 65  LEU A HB3    1 
ATOM   1078  H  HG     . LEU A 1 65  ? -8.103  55.522  41.388  1.00 45.58  ? 65  LEU A HG     1 
ATOM   1079  H  HD11   . LEU A 1 65  ? -7.189  56.734  43.150  1.00 38.12  ? 65  LEU A HD11   1 
ATOM   1080  H  HD12   . LEU A 1 65  ? -8.272  57.603  42.378  1.00 38.12  ? 65  LEU A HD12   1 
ATOM   1081  H  HD13   . LEU A 1 65  ? -8.641  56.925  43.767  1.00 38.12  ? 65  LEU A HD13   1 
ATOM   1082  H  HD21   . LEU A 1 65  ? -7.381  54.295  43.225  1.00 54.26  ? 65  LEU A HD21   1 
ATOM   1083  H  HD22   . LEU A 1 65  ? -8.837  54.382  43.855  1.00 54.26  ? 65  LEU A HD22   1 
ATOM   1084  H  HD23   . LEU A 1 65  ? -8.599  53.562  42.515  1.00 54.26  ? 65  LEU A HD23   1 
ATOM   1085  N  N      . PHE A 1 66  ? -12.395 55.283  39.249  1.00 31.90  ? 66  PHE A N      1 
ATOM   1086  C  CA     . PHE A 1 66  ? -13.810 55.275  38.890  1.00 35.41  ? 66  PHE A CA     1 
ATOM   1087  C  C      . PHE A 1 66  ? -14.502 54.029  39.439  1.00 40.42  ? 66  PHE A C      1 
ATOM   1088  O  O      . PHE A 1 66  ? -13.839 53.052  39.787  1.00 34.48  ? 66  PHE A O      1 
ATOM   1089  C  CB     . PHE A 1 66  ? -13.981 55.343  37.367  1.00 39.85  ? 66  PHE A CB     1 
ATOM   1090  C  CG     . PHE A 1 66  ? -13.522 56.639  36.755  1.00 40.66  ? 66  PHE A CG     1 
ATOM   1091  C  CD1    . PHE A 1 66  ? -14.387 57.718  36.661  1.00 48.06  ? 66  PHE A CD1    1 
ATOM   1092  C  CD2    . PHE A 1 66  ? -12.238 56.776  36.261  1.00 38.32  ? 66  PHE A CD2    1 
ATOM   1093  C  CE1    . PHE A 1 66  ? -13.976 58.910  36.097  1.00 33.19  ? 66  PHE A CE1    1 
ATOM   1094  C  CE2    . PHE A 1 66  ? -11.823 57.969  35.695  1.00 37.33  ? 66  PHE A CE2    1 
ATOM   1095  C  CZ     . PHE A 1 66  ? -12.694 59.036  35.615  1.00 32.21  ? 66  PHE A CZ     1 
ATOM   1096  H  H      . PHE A 1 66  ? -11.926 54.714  38.806  1.00 38.29  ? 66  PHE A H      1 
ATOM   1097  H  HA     . PHE A 1 66  ? -14.239 56.054  39.276  1.00 42.49  ? 66  PHE A HA     1 
ATOM   1098  H  HB2    . PHE A 1 66  ? -13.466 54.626  36.964  1.00 47.83  ? 66  PHE A HB2    1 
ATOM   1099  H  HB3    . PHE A 1 66  ? -14.921 55.231  37.154  1.00 47.83  ? 66  PHE A HB3    1 
ATOM   1100  H  HD1    . PHE A 1 66  ? -15.254 57.640  36.987  1.00 57.67  ? 66  PHE A HD1    1 
ATOM   1101  H  HD2    . PHE A 1 66  ? -11.645 56.061  36.314  1.00 45.98  ? 66  PHE A HD2    1 
ATOM   1102  H  HE1    . PHE A 1 66  ? -14.566 59.627  36.043  1.00 39.83  ? 66  PHE A HE1    1 
ATOM   1103  H  HE2    . PHE A 1 66  ? -10.956 58.052  35.369  1.00 44.80  ? 66  PHE A HE2    1 
ATOM   1104  H  HZ     . PHE A 1 66  ? -12.416 59.837  35.234  1.00 38.65  ? 66  PHE A HZ     1 
ATOM   1105  N  N      . PRO A 1 67  ? -15.842 54.069  39.539  1.00 33.66  ? 67  PRO A N      1 
ATOM   1106  C  CA     . PRO A 1 67  ? -16.612 52.925  40.040  1.00 40.07  ? 67  PRO A CA     1 
ATOM   1107  C  C      . PRO A 1 67  ? -16.336 51.632  39.284  1.00 39.07  ? 67  PRO A C      1 
ATOM   1108  O  O      . PRO A 1 67  ? -15.954 51.678  38.120  1.00 49.58  ? 67  PRO A O      1 
ATOM   1109  C  CB     . PRO A 1 67  ? -18.064 53.366  39.831  1.00 46.19  ? 67  PRO A CB     1 
ATOM   1110  C  CG     . PRO A 1 67  ? -18.017 54.843  39.842  1.00 41.40  ? 67  PRO A CG     1 
ATOM   1111  C  CD     . PRO A 1 67  ? -16.713 55.214  39.218  1.00 33.00  ? 67  PRO A CD     1 
ATOM   1112  H  HA     . PRO A 1 67  ? -16.446 52.791  40.986  1.00 48.08  ? 67  PRO A HA     1 
ATOM   1113  H  HB2    . PRO A 1 67  ? -18.386 53.038  38.977  1.00 55.43  ? 67  PRO A HB2    1 
ATOM   1114  H  HB3    . PRO A 1 67  ? -18.615 53.034  40.557  1.00 55.43  ? 67  PRO A HB3    1 
ATOM   1115  H  HG2    . PRO A 1 67  ? -18.756 55.195  39.322  1.00 49.68  ? 67  PRO A HG2    1 
ATOM   1116  H  HG3    . PRO A 1 67  ? -18.061 55.163  40.757  1.00 49.68  ? 67  PRO A HG3    1 
ATOM   1117  H  HD2    . PRO A 1 67  ? -16.811 55.305  38.258  1.00 39.60  ? 67  PRO A HD2    1 
ATOM   1118  H  HD3    . PRO A 1 67  ? -16.365 56.026  39.619  1.00 39.60  ? 67  PRO A HD3    1 
ATOM   1119  N  N      . GLU A 1 68  ? -16.533 50.495  39.945  1.00 55.82  ? 68  GLU A N      1 
ATOM   1120  C  CA     . GLU A 1 68  ? -16.316 49.194  39.320  1.00 42.92  ? 68  GLU A CA     1 
ATOM   1121  C  C      . GLU A 1 68  ? -17.331 48.920  38.221  1.00 44.66  ? 68  GLU A C      1 
ATOM   1122  O  O      . GLU A 1 68  ? -17.024 48.257  37.233  1.00 53.55  ? 68  GLU A O      1 
ATOM   1123  C  CB     . GLU A 1 68  ? -16.404 48.077  40.355  1.00 43.05  ? 68  GLU A CB     1 
ATOM   1124  C  CG     . GLU A 1 68  ? -15.342 48.118  41.424  1.00 62.77  ? 68  GLU A CG     1 
ATOM   1125  C  CD     . GLU A 1 68  ? -15.284 46.829  42.215  1.00 77.04  ? 68  GLU A CD     1 
ATOM   1126  O  OE1    . GLU A 1 68  ? -15.157 46.895  43.457  1.00 90.15  ? 68  GLU A OE1    1 
ATOM   1127  O  OE2    . GLU A 1 68  ? -15.381 45.750  41.593  1.00 47.60  ? 68  GLU A OE2    1 
ATOM   1128  H  H      . GLU A 1 68  ? -16.794 50.450  40.763  1.00 66.99  ? 68  GLU A H      1 
ATOM   1129  H  HA     . GLU A 1 68  ? -15.429 49.173  38.927  1.00 51.51  ? 68  GLU A HA     1 
ATOM   1130  H  HB2    . GLU A 1 68  ? -17.266 48.133  40.797  1.00 51.66  ? 68  GLU A HB2    1 
ATOM   1131  H  HB3    . GLU A 1 68  ? -16.327 47.225  39.898  1.00 51.66  ? 68  GLU A HB3    1 
ATOM   1132  H  HG2    . GLU A 1 68  ? -14.477 48.257  41.008  1.00 75.33  ? 68  GLU A HG2    1 
ATOM   1133  H  HG3    . GLU A 1 68  ? -15.537 48.842  42.039  1.00 75.33  ? 68  GLU A HG3    1 
ATOM   1134  N  N      . GLU A 1 69  ? -18.545 49.432  38.405  1.00 44.01  ? 69  GLU A N      1 
ATOM   1135  C  CA     . GLU A 1 69  ? -19.662 49.113  37.523  1.00 46.61  ? 69  GLU A CA     1 
ATOM   1136  C  C      . GLU A 1 69  ? -19.490 49.722  36.132  1.00 48.39  ? 69  GLU A C      1 
ATOM   1137  O  O      . GLU A 1 69  ? -20.175 49.331  35.187  1.00 52.19  ? 69  GLU A O      1 
ATOM   1138  C  CB     . GLU A 1 69  ? -20.980 49.609  38.131  1.00 69.01  ? 69  GLU A CB     1 
ATOM   1139  C  CG     . GLU A 1 69  ? -21.421 48.888  39.407  1.00 70.09  ? 69  GLU A CG     1 
ATOM   1140  C  CD     . GLU A 1 69  ? -20.585 49.257  40.626  1.00 80.32  ? 69  GLU A CD     1 
ATOM   1141  O  OE1    . GLU A 1 69  ? -20.516 48.446  41.573  1.00 88.76  ? 69  GLU A OE1    1 
ATOM   1142  O  OE2    . GLU A 1 69  ? -20.004 50.362  40.645  1.00 61.03  ? 69  GLU A OE2    1 
ATOM   1143  H  H      . GLU A 1 69  ? -18.748 49.973  39.042  1.00 52.81  ? 69  GLU A H      1 
ATOM   1144  H  HA     . GLU A 1 69  ? -19.720 48.150  37.423  1.00 55.93  ? 69  GLU A HA     1 
ATOM   1145  H  HB2    . GLU A 1 69  ? -20.886 50.550  38.345  1.00 82.81  ? 69  GLU A HB2    1 
ATOM   1146  H  HB3    . GLU A 1 69  ? -21.684 49.494  37.473  1.00 82.81  ? 69  GLU A HB3    1 
ATOM   1147  H  HG2    . GLU A 1 69  ? -22.343 49.120  39.596  1.00 84.11  ? 69  GLU A HG2    1 
ATOM   1148  H  HG3    . GLU A 1 69  ? -21.342 47.931  39.270  1.00 84.11  ? 69  GLU A HG3    1 
ATOM   1149  N  N      . PHE A 1 70  ? -18.571 50.675  36.014  1.00 35.93  ? 70  PHE A N      1 
ATOM   1150  C  CA     . PHE A 1 70  ? -18.306 51.348  34.749  1.00 29.72  ? 70  PHE A CA     1 
ATOM   1151  C  C      . PHE A 1 70  ? -17.857 50.409  33.637  1.00 44.64  ? 70  PHE A C      1 
ATOM   1152  O  O      . PHE A 1 70  ? -16.985 49.564  33.833  1.00 37.74  ? 70  PHE A O      1 
ATOM   1153  C  CB     . PHE A 1 70  ? -17.236 52.424  34.942  1.00 28.42  ? 70  PHE A CB     1 
ATOM   1154  C  CG     . PHE A 1 70  ? -17.782 53.776  35.294  1.00 31.61  ? 70  PHE A CG     1 
ATOM   1155  C  CD1    . PHE A 1 70  ? -18.993 53.909  35.947  1.00 35.40  ? 70  PHE A CD1    1 
ATOM   1156  C  CD2    . PHE A 1 70  ? -17.082 54.919  34.958  1.00 38.16  ? 70  PHE A CD2    1 
ATOM   1157  C  CE1    . PHE A 1 70  ? -19.487 55.155  36.263  1.00 40.69  ? 70  PHE A CE1    1 
ATOM   1158  C  CE2    . PHE A 1 70  ? -17.573 56.166  35.271  1.00 32.94  ? 70  PHE A CE2    1 
ATOM   1159  C  CZ     . PHE A 1 70  ? -18.776 56.284  35.923  1.00 40.22  ? 70  PHE A CZ     1 
ATOM   1160  H  H      . PHE A 1 70  ? -18.080 50.952  36.663  1.00 43.12  ? 70  PHE A H      1 
ATOM   1161  H  HA     . PHE A 1 70  ? -19.118 51.788  34.454  1.00 35.67  ? 70  PHE A HA     1 
ATOM   1162  H  HB2    . PHE A 1 70  ? -16.644 52.148  35.660  1.00 34.10  ? 70  PHE A HB2    1 
ATOM   1163  H  HB3    . PHE A 1 70  ? -16.732 52.514  34.118  1.00 34.10  ? 70  PHE A HB3    1 
ATOM   1164  H  HD1    . PHE A 1 70  ? -19.477 53.149  36.178  1.00 42.49  ? 70  PHE A HD1    1 
ATOM   1165  H  HD2    . PHE A 1 70  ? -16.266 54.845  34.517  1.00 45.79  ? 70  PHE A HD2    1 
ATOM   1166  H  HE1    . PHE A 1 70  ? -20.302 55.233  36.704  1.00 48.83  ? 70  PHE A HE1    1 
ATOM   1167  H  HE2    . PHE A 1 70  ? -17.091 56.927  35.042  1.00 39.53  ? 70  PHE A HE2    1 
ATOM   1168  H  HZ     . PHE A 1 70  ? -19.110 57.126  36.136  1.00 48.26  ? 70  PHE A HZ     1 
ATOM   1169  N  N      . SER A 1 71  ? -18.463 50.569  32.466  1.00 53.51  ? 71  SER A N      1 
ATOM   1170  C  CA     . SER A 1 71  ? -18.051 49.831  31.283  1.00 41.25  ? 71  SER A CA     1 
ATOM   1171  C  C      . SER A 1 71  ? -16.629 50.225  30.930  1.00 41.70  ? 71  SER A C      1 
ATOM   1172  O  O      . SER A 1 71  ? -16.169 51.291  31.328  1.00 53.66  ? 71  SER A O      1 
ATOM   1173  C  CB     . SER A 1 71  ? -18.985 50.117  30.109  1.00 51.56  ? 71  SER A CB     1 
ATOM   1174  O  OG     . SER A 1 71  ? -20.303 49.677  30.386  1.00 81.47  ? 71  SER A OG     1 
ATOM   1175  H  H      . SER A 1 71  ? -19.122 51.105  32.331  1.00 64.21  ? 71  SER A H      1 
ATOM   1176  H  HA     . SER A 1 71  ? -18.071 48.880  31.470  1.00 49.50  ? 71  SER A HA     1 
ATOM   1177  H  HB2    . SER A 1 71  ? -19.001 51.073  29.945  1.00 61.87  ? 71  SER A HB2    1 
ATOM   1178  H  HB3    . SER A 1 71  ? -18.656 49.652  29.324  1.00 61.87  ? 71  SER A HB3    1 
ATOM   1179  H  HG     . SER A 1 71  ? -20.804 49.840  29.732  1.00 97.76  ? 71  SER A HG     1 
ATOM   1180  N  N      . LYS A 1 72  ? -15.935 49.377  30.182  1.00 50.68  ? 72  LYS A N      1 
ATOM   1181  C  CA     . LYS A 1 72  ? -14.596 49.715  29.719  1.00 46.91  ? 72  LYS A CA     1 
ATOM   1182  C  C      . LYS A 1 72  ? -14.664 50.932  28.801  1.00 45.06  ? 72  LYS A C      1 
ATOM   1183  O  O      . LYS A 1 72  ? -13.712 51.708  28.722  1.00 41.69  ? 72  LYS A O      1 
ATOM   1184  C  CB     . LYS A 1 72  ? -13.942 48.531  29.008  1.00 50.87  ? 72  LYS A CB     1 
ATOM   1185  C  CG     . LYS A 1 72  ? -13.399 47.468  29.961  1.00 75.33  ? 72  LYS A CG     1 
ATOM   1186  C  CD     . LYS A 1 72  ? -11.919 47.179  29.722  1.00 74.07  ? 72  LYS A CD     1 
ATOM   1187  C  CE     . LYS A 1 72  ? -11.036 48.362  30.093  1.00 34.21  ? 72  LYS A CE     1 
ATOM   1188  N  NZ     . LYS A 1 72  ? -9.594  48.063  29.872  1.00 28.88  ? 72  LYS A NZ     1 
ATOM   1189  H  H      . LYS A 1 72  ? -16.214 48.603  29.930  1.00 60.82  ? 72  LYS A H      1 
ATOM   1190  H  HA     . LYS A 1 72  ? -14.047 49.947  30.483  1.00 56.29  ? 72  LYS A HA     1 
ATOM   1191  H  HB2    . LYS A 1 72  ? -14.599 48.108  28.434  1.00 61.05  ? 72  LYS A HB2    1 
ATOM   1192  H  HB3    . LYS A 1 72  ? -13.201 48.857  28.474  1.00 61.05  ? 72  LYS A HB3    1 
ATOM   1193  H  HG2    . LYS A 1 72  ? -13.502 47.779  30.874  1.00 90.39  ? 72  LYS A HG2    1 
ATOM   1194  H  HG3    . LYS A 1 72  ? -13.892 46.643  29.831  1.00 90.39  ? 72  LYS A HG3    1 
ATOM   1195  H  HD2    . LYS A 1 72  ? -11.652 46.420  30.265  1.00 88.89  ? 72  LYS A HD2    1 
ATOM   1196  H  HD3    . LYS A 1 72  ? -11.782 46.982  28.782  1.00 88.89  ? 72  LYS A HD3    1 
ATOM   1197  H  HE2    . LYS A 1 72  ? -11.276 49.124  29.543  1.00 41.05  ? 72  LYS A HE2    1 
ATOM   1198  H  HE3    . LYS A 1 72  ? -11.162 48.572  31.032  1.00 41.05  ? 72  LYS A HE3    1 
ATOM   1199  H  HZ1    . LYS A 1 72  ? -9.100  48.769  30.096  1.00 34.65  ? 72  LYS A HZ1    1 
ATOM   1200  H  HZ2    . LYS A 1 72  ? -9.348  47.368  30.370  1.00 34.65  ? 72  LYS A HZ2    1 
ATOM   1201  H  HZ3    . LYS A 1 72  ? -9.452  47.871  29.015  1.00 34.65  ? 72  LYS A HZ3    1 
ATOM   1202  N  N      . GLU A 1 73  ? -15.790 51.098  28.109  1.00 44.84  ? 73  GLU A N      1 
ATOM   1203  C  CA     . GLU A 1 73  ? -15.984 52.267  27.255  1.00 47.70  ? 73  GLU A CA     1 
ATOM   1204  C  C      . GLU A 1 73  ? -16.175 53.502  28.118  1.00 45.80  ? 73  GLU A C      1 
ATOM   1205  O  O      . GLU A 1 73  ? -15.648 54.570  27.812  1.00 51.65  ? 73  GLU A O      1 
ATOM   1206  C  CB     . GLU A 1 73  ? -17.189 52.100  26.324  1.00 59.57  ? 73  GLU A CB     1 
ATOM   1207  C  CG     . GLU A 1 73  ? -17.120 50.887  25.404  1.00 86.10  ? 73  GLU A CG     1 
ATOM   1208  C  CD     . GLU A 1 73  ? -17.682 49.620  26.029  1.00 85.32  ? 73  GLU A CD     1 
ATOM   1209  O  OE1    . GLU A 1 73  ? -17.183 48.524  25.696  1.00 76.87  ? 73  GLU A OE1    1 
ATOM   1210  O  OE2    . GLU A 1 73  ? -18.625 49.716  26.843  1.00 81.40  ? 73  GLU A OE2    1 
ATOM   1211  H  H      . GLU A 1 73  ? -16.453 50.551  28.116  1.00 53.80  ? 73  GLU A H      1 
ATOM   1212  H  HA     . GLU A 1 73  ? -15.194 52.398  26.708  1.00 57.24  ? 73  GLU A HA     1 
ATOM   1213  H  HB2    . GLU A 1 73  ? -17.989 52.012  26.865  1.00 71.49  ? 73  GLU A HB2    1 
ATOM   1214  H  HB3    . GLU A 1 73  ? -17.259 52.889  25.764  1.00 71.49  ? 73  GLU A HB3    1 
ATOM   1215  H  HG2    . GLU A 1 73  ? -17.629 51.073  24.600  1.00 103.32 ? 73  GLU A HG2    1 
ATOM   1216  H  HG3    . GLU A 1 73  ? -16.192 50.719  25.175  1.00 103.32 ? 73  GLU A HG3    1 
ATOM   1217  N  N      . GLU A 1 74  ? -16.942 53.357  29.193  1.00 51.45  ? 74  GLU A N      1 
ATOM   1218  C  CA     . GLU A 1 74  ? -17.211 54.472  30.092  1.00 37.92  ? 74  GLU A CA     1 
ATOM   1219  C  C      . GLU A 1 74  ? -15.945 54.917  30.819  1.00 40.67  ? 74  GLU A C      1 
ATOM   1220  O  O      . GLU A 1 74  ? -15.738 56.107  31.043  1.00 41.08  ? 74  GLU A O      1 
ATOM   1221  C  CB     . GLU A 1 74  ? -18.297 54.093  31.097  1.00 30.95  ? 74  GLU A CB     1 
ATOM   1222  C  CG     . GLU A 1 74  ? -19.671 53.949  30.469  1.00 54.96  ? 74  GLU A CG     1 
ATOM   1223  C  CD     . GLU A 1 74  ? -20.757 53.652  31.482  1.00 52.73  ? 74  GLU A CD     1 
ATOM   1224  O  OE1    . GLU A 1 74  ? -20.431 53.168  32.584  1.00 47.20  ? 74  GLU A OE1    1 
ATOM   1225  O  OE2    . GLU A 1 74  ? -21.940 53.906  31.175  1.00 63.81  ? 74  GLU A OE2    1 
ATOM   1226  H  H      . GLU A 1 74  ? -17.320 52.620  29.425  1.00 61.74  ? 74  GLU A H      1 
ATOM   1227  H  HA     . GLU A 1 74  ? -17.536 55.224  29.571  1.00 45.50  ? 74  GLU A HA     1 
ATOM   1228  H  HB2    . GLU A 1 74  ? -18.066 53.244  31.505  1.00 37.14  ? 74  GLU A HB2    1 
ATOM   1229  H  HB3    . GLU A 1 74  ? -18.351 54.782  31.777  1.00 37.14  ? 74  GLU A HB3    1 
ATOM   1230  H  HG2    . GLU A 1 74  ? -19.900 54.777  30.019  1.00 65.96  ? 74  GLU A HG2    1 
ATOM   1231  H  HG3    . GLU A 1 74  ? -19.651 53.219  29.830  1.00 65.96  ? 74  GLU A HG3    1 
ATOM   1232  N  N      . LEU A 1 75  ? -15.105 53.955  31.190  1.00 50.68  ? 75  LEU A N      1 
ATOM   1233  C  CA     . LEU A 1 75  ? -13.822 54.246  31.826  1.00 37.72  ? 75  LEU A CA     1 
ATOM   1234  C  C      . LEU A 1 75  ? -12.934 55.079  30.903  1.00 36.09  ? 75  LEU A C      1 
ATOM   1235  O  O      . LEU A 1 75  ? -12.264 56.014  31.340  1.00 26.08  ? 75  LEU A O      1 
ATOM   1236  C  CB     . LEU A 1 75  ? -13.107 52.949  32.210  1.00 33.09  ? 75  LEU A CB     1 
ATOM   1237  C  CG     . LEU A 1 75  ? -11.810 53.107  33.007  1.00 37.81  ? 75  LEU A CG     1 
ATOM   1238  C  CD1    . LEU A 1 75  ? -12.109 53.559  34.426  1.00 43.43  ? 75  LEU A CD1    1 
ATOM   1239  C  CD2    . LEU A 1 75  ? -11.016 51.814  33.008  1.00 45.24  ? 75  LEU A CD2    1 
ATOM   1240  H  H      . LEU A 1 75  ? -15.256 53.116  31.082  1.00 60.82  ? 75  LEU A H      1 
ATOM   1241  H  HA     . LEU A 1 75  ? -13.978 54.756  32.637  1.00 45.26  ? 75  LEU A HA     1 
ATOM   1242  H  HB2    . LEU A 1 75  ? -13.713 52.414  32.746  1.00 39.71  ? 75  LEU A HB2    1 
ATOM   1243  H  HB3    . LEU A 1 75  ? -12.889 52.469  31.396  1.00 39.71  ? 75  LEU A HB3    1 
ATOM   1244  H  HG     . LEU A 1 75  ? -11.265 53.790  32.586  1.00 45.37  ? 75  LEU A HG     1 
ATOM   1245  H  HD11   . LEU A 1 75  ? -11.273 53.651  34.910  1.00 52.11  ? 75  LEU A HD11   1 
ATOM   1246  H  HD12   . LEU A 1 75  ? -12.570 54.412  34.395  1.00 52.11  ? 75  LEU A HD12   1 
ATOM   1247  H  HD13   . LEU A 1 75  ? -12.669 52.895  34.858  1.00 52.11  ? 75  LEU A HD13   1 
ATOM   1248  H  HD21   . LEU A 1 75  ? -10.202 51.944  33.519  1.00 54.29  ? 75  LEU A HD21   1 
ATOM   1249  H  HD22   . LEU A 1 75  ? -11.552 51.114  33.412  1.00 54.29  ? 75  LEU A HD22   1 
ATOM   1250  H  HD23   . LEU A 1 75  ? -10.798 51.577  32.093  1.00 54.29  ? 75  LEU A HD23   1 
ATOM   1251  N  N      . ARG A 1 76  ? -12.925 54.716  29.625  1.00 44.11  ? 76  ARG A N      1 
ATOM   1252  C  CA     . ARG A 1 76  ? -12.141 55.423  28.621  1.00 36.83  ? 76  ARG A CA     1 
ATOM   1253  C  C      . ARG A 1 76  ? -12.661 56.839  28.395  1.00 39.51  ? 76  ARG A C      1 
ATOM   1254  O  O      . ARG A 1 76  ? -11.910 57.809  28.494  1.00 33.98  ? 76  ARG A O      1 
ATOM   1255  C  CB     . ARG A 1 76  ? -12.155 54.641  27.305  1.00 34.35  ? 76  ARG A CB     1 
ATOM   1256  C  CG     . ARG A 1 76  ? -11.512 55.362  26.130  1.00 30.01  ? 76  ARG A CG     1 
ATOM   1257  C  CD     . ARG A 1 76  ? -11.533 54.503  24.878  1.00 39.60  ? 76  ARG A CD     1 
ATOM   1258  N  NE     . ARG A 1 76  ? -12.894 54.121  24.508  1.00 74.78  ? 76  ARG A NE     1 
ATOM   1259  C  CZ     . ARG A 1 76  ? -13.746 54.901  23.850  1.00 85.26  ? 76  ARG A CZ     1 
ATOM   1260  N  NH1    . ARG A 1 76  ? -13.393 56.130  23.492  1.00 69.59  ? 76  ARG A NH1    1 
ATOM   1261  N  NH2    . ARG A 1 76  ? -14.963 54.454  23.563  1.00 64.56  ? 76  ARG A NH2    1 
ATOM   1262  H  H      . ARG A 1 76  ? -13.373 54.053  29.311  1.00 52.94  ? 76  ARG A H      1 
ATOM   1263  H  HA     . ARG A 1 76  ? -11.222 55.486  28.923  1.00 44.19  ? 76  ARG A HA     1 
ATOM   1264  H  HB2    . ARG A 1 76  ? -11.677 53.807  27.435  1.00 41.22  ? 76  ARG A HB2    1 
ATOM   1265  H  HB3    . ARG A 1 76  ? -13.076 54.454  27.066  1.00 41.22  ? 76  ARG A HB3    1 
ATOM   1266  H  HG2    . ARG A 1 76  ? -12.002 56.178  25.947  1.00 36.02  ? 76  ARG A HG2    1 
ATOM   1267  H  HG3    . ARG A 1 76  ? -10.588 55.565  26.345  1.00 36.02  ? 76  ARG A HG3    1 
ATOM   1268  H  HD2    . ARG A 1 76  ? -11.147 55.002  24.141  1.00 47.52  ? 76  ARG A HD2    1 
ATOM   1269  H  HD3    . ARG A 1 76  ? -11.023 53.693  25.037  1.00 47.52  ? 76  ARG A HD3    1 
ATOM   1270  H  HE     . ARG A 1 76  ? -13.163 53.335  24.732  1.00 89.73  ? 76  ARG A HE     1 
ATOM   1271  H  HH11   . ARG A 1 76  ? -12.606 56.422  23.678  1.00 83.51  ? 76  ARG A HH11   1 
ATOM   1272  H  HH12   . ARG A 1 76  ? -13.949 56.631  23.069  1.00 83.51  ? 76  ARG A HH12   1 
ATOM   1273  H  HH21   . ARG A 1 76  ? -15.196 53.660  23.796  1.00 77.48  ? 76  ARG A HH21   1 
ATOM   1274  H  HH22   . ARG A 1 76  ? -15.518 54.958  23.140  1.00 77.48  ? 76  ARG A HH22   1 
ATOM   1275  N  N      . GLU A 1 77  ? -13.945 56.949  28.076  1.00 39.29  ? 77  GLU A N      1 
ATOM   1276  C  CA     . GLU A 1 77  ? -14.530 58.228  27.699  1.00 38.39  ? 77  GLU A CA     1 
ATOM   1277  C  C      . GLU A 1 77  ? -14.445 59.252  28.825  1.00 34.61  ? 77  GLU A C      1 
ATOM   1278  O  O      . GLU A 1 77  ? -14.302 60.446  28.570  1.00 43.23  ? 77  GLU A O      1 
ATOM   1279  C  CB     . GLU A 1 77  ? -15.991 58.040  27.281  1.00 60.48  ? 77  GLU A CB     1 
ATOM   1280  C  CG     . GLU A 1 77  ? -16.167 57.334  25.940  1.00 80.94  ? 77  GLU A CG     1 
ATOM   1281  C  CD     . GLU A 1 77  ? -17.602 56.917  25.672  1.00 95.75  ? 77  GLU A CD     1 
ATOM   1282  O  OE1    . GLU A 1 77  ? -17.859 56.331  24.598  1.00 82.95  ? 77  GLU A OE1    1 
ATOM   1283  O  OE2    . GLU A 1 77  ? -18.473 57.174  26.532  1.00 87.06  ? 77  GLU A OE2    1 
ATOM   1284  H  H      . GLU A 1 77  ? -14.501 56.294  28.070  1.00 47.15  ? 77  GLU A H      1 
ATOM   1285  H  HA     . GLU A 1 77  ? -14.045 58.582  26.937  1.00 46.06  ? 77  GLU A HA     1 
ATOM   1286  H  HB2    . GLU A 1 77  ? -16.443 57.510  27.956  1.00 72.57  ? 77  GLU A HB2    1 
ATOM   1287  H  HB3    . GLU A 1 77  ? -16.411 58.912  27.213  1.00 72.57  ? 77  GLU A HB3    1 
ATOM   1288  H  HG2    . GLU A 1 77  ? -15.892 57.935  25.229  1.00 97.13  ? 77  GLU A HG2    1 
ATOM   1289  H  HG3    . GLU A 1 77  ? -15.616 56.536  25.930  1.00 97.13  ? 77  GLU A HG3    1 
ATOM   1290  N  N      . ARG A 1 78  ? -14.500 58.781  30.067  1.00 39.49  ? 78  ARG A N      1 
ATOM   1291  C  CA     . ARG A 1 78  ? -14.442 59.672  31.221  1.00 39.48  ? 78  ARG A CA     1 
ATOM   1292  C  C      . ARG A 1 78  ? -13.000 59.980  31.597  1.00 29.64  ? 78  ARG A C      1 
ATOM   1293  O  O      . ARG A 1 78  ? -12.663 61.114  31.929  1.00 43.06  ? 78  ARG A O      1 
ATOM   1294  C  CB     . ARG A 1 78  ? -15.178 59.052  32.414  1.00 35.59  ? 78  ARG A CB     1 
ATOM   1295  C  CG     . ARG A 1 78  ? -16.673 59.359  32.463  1.00 46.73  ? 78  ARG A CG     1 
ATOM   1296  C  CD     . ARG A 1 78  ? -16.960 60.842  32.672  1.00 43.34  ? 78  ARG A CD     1 
ATOM   1297  N  NE     . ARG A 1 78  ? -16.505 61.312  33.977  1.00 49.47  ? 78  ARG A NE     1 
ATOM   1298  C  CZ     . ARG A 1 78  ? -16.347 62.591  34.304  1.00 50.55  ? 78  ARG A CZ     1 
ATOM   1299  N  NH1    . ARG A 1 78  ? -16.589 63.547  33.417  1.00 61.06  ? 78  ARG A NH1    1 
ATOM   1300  N  NH2    . ARG A 1 78  ? -15.936 62.916  35.521  1.00 44.21  ? 78  ARG A NH2    1 
ATOM   1301  H  H      . ARG A 1 78  ? -14.570 57.948  30.269  1.00 47.38  ? 78  ARG A H      1 
ATOM   1302  H  HA     . ARG A 1 78  ? -14.880 60.508  30.998  1.00 47.37  ? 78  ARG A HA     1 
ATOM   1303  H  HB2    . ARG A 1 78  ? -15.077 58.088  32.375  1.00 42.71  ? 78  ARG A HB2    1 
ATOM   1304  H  HB3    . ARG A 1 78  ? -14.782 59.390  33.233  1.00 42.71  ? 78  ARG A HB3    1 
ATOM   1305  H  HG2    . ARG A 1 78  ? -17.079 59.089  31.624  1.00 56.08  ? 78  ARG A HG2    1 
ATOM   1306  H  HG3    . ARG A 1 78  ? -17.073 58.869  33.199  1.00 56.08  ? 78  ARG A HG3    1 
ATOM   1307  H  HD2    . ARG A 1 78  ? -16.499 61.354  31.989  1.00 52.01  ? 78  ARG A HD2    1 
ATOM   1308  H  HD3    . ARG A 1 78  ? -17.916 60.993  32.613  1.00 52.01  ? 78  ARG A HD3    1 
ATOM   1309  H  HE     . ARG A 1 78  ? -16.327 60.721  34.575  1.00 59.36  ? 78  ARG A HE     1 
ATOM   1310  H  HH11   . ARG A 1 78  ? -16.857 63.342  32.626  1.00 73.27  ? 78  ARG A HH11   1 
ATOM   1311  H  HH12   . ARG A 1 78  ? -16.482 64.372  33.635  1.00 73.27  ? 78  ARG A HH12   1 
ATOM   1312  H  HH21   . ARG A 1 78  ? -15.774 62.300  36.099  1.00 53.05  ? 78  ARG A HH21   1 
ATOM   1313  H  HH22   . ARG A 1 78  ? -15.828 63.743  35.732  1.00 53.05  ? 78  ARG A HH22   1 
ATOM   1314  N  N      . GLY A 1 79  ? -12.151 58.964  31.536  1.00 27.26  ? 79  GLY A N      1 
ATOM   1315  C  CA     . GLY A 1 79  ? -10.743 59.124  31.840  1.00 33.50  ? 79  GLY A CA     1 
ATOM   1316  C  C      . GLY A 1 79  ? -10.059 60.155  30.960  1.00 36.83  ? 79  GLY A C      1 
ATOM   1317  O  O      . GLY A 1 79  ? -9.365  61.044  31.452  1.00 27.52  ? 79  GLY A O      1 
ATOM   1318  H  H      . GLY A 1 79  ? -12.372 58.162  31.318  1.00 32.72  ? 79  GLY A H      1 
ATOM   1319  H  HA2    . GLY A 1 79  ? -10.643 59.398  32.766  1.00 40.19  ? 79  GLY A HA2    1 
ATOM   1320  H  HA3    . GLY A 1 79  ? -10.290 58.274  31.723  1.00 40.19  ? 79  GLY A HA3    1 
ATOM   1321  N  N      . LEU A 1 80  ? -10.254 60.030  29.651  1.00 42.44  ? 80  LEU A N      1 
ATOM   1322  C  CA     . LEU A 1 80  ? -9.675  60.966  28.695  1.00 35.91  ? 80  LEU A CA     1 
ATOM   1323  C  C      . LEU A 1 80  ? -10.252 62.366  28.885  1.00 37.24  ? 80  LEU A C      1 
ATOM   1324  O  O      . LEU A 1 80  ? -9.545  63.360  28.733  1.00 40.03  ? 80  LEU A O      1 
ATOM   1325  C  CB     . LEU A 1 80  ? -9.923  60.491  27.260  1.00 50.41  ? 80  LEU A CB     1 
ATOM   1326  C  CG     . LEU A 1 80  ? -9.347  59.131  26.848  1.00 45.41  ? 80  LEU A CG     1 
ATOM   1327  C  CD1    . LEU A 1 80  ? -9.655  58.859  25.380  1.00 50.61  ? 80  LEU A CD1    1 
ATOM   1328  C  CD2    . LEU A 1 80  ? -7.849  59.046  27.103  1.00 34.76  ? 80  LEU A CD2    1 
ATOM   1329  H  H      . LEU A 1 80  ? -10.722 59.406  29.289  1.00 50.92  ? 80  LEU A H      1 
ATOM   1330  H  HA     . LEU A 1 80  ? -8.717  61.012  28.836  1.00 43.09  ? 80  LEU A HA     1 
ATOM   1331  H  HB2    . LEU A 1 80  ? -10.882 60.446  27.121  1.00 60.49  ? 80  LEU A HB2    1 
ATOM   1332  H  HB3    . LEU A 1 80  ? -9.546  61.152  26.657  1.00 60.49  ? 80  LEU A HB3    1 
ATOM   1333  H  HG     . LEU A 1 80  ? -9.777  58.438  27.373  1.00 54.49  ? 80  LEU A HG     1 
ATOM   1334  H  HD11   . LEU A 1 80  ? -9.285  57.997  25.135  1.00 60.73  ? 80  LEU A HD11   1 
ATOM   1335  H  HD12   . LEU A 1 80  ? -10.617 58.855  25.255  1.00 60.73  ? 80  LEU A HD12   1 
ATOM   1336  H  HD13   . LEU A 1 80  ? -9.254  59.558  24.840  1.00 60.73  ? 80  LEU A HD13   1 
ATOM   1337  H  HD21   . LEU A 1 80  ? -7.531  58.172  26.828  1.00 41.71  ? 80  LEU A HD21   1 
ATOM   1338  H  HD22   . LEU A 1 80  ? -7.402  59.737  26.589  1.00 41.71  ? 80  LEU A HD22   1 
ATOM   1339  H  HD23   . LEU A 1 80  ? -7.682  59.176  28.049  1.00 41.71  ? 80  LEU A HD23   1 
ATOM   1340  N  N      . GLU A 1 81  ? -11.538 62.436  29.219  1.00 38.26  ? 81  GLU A N      1 
ATOM   1341  C  CA     . GLU A 1 81  ? -12.211 63.715  29.413  1.00 34.08  ? 81  GLU A CA     1 
ATOM   1342  C  C      . GLU A 1 81  ? -11.568 64.512  30.544  1.00 36.91  ? 81  GLU A C      1 
ATOM   1343  O  O      . GLU A 1 81  ? -11.303 65.706  30.398  1.00 31.70  ? 81  GLU A O      1 
ATOM   1344  C  CB     . GLU A 1 81  ? -13.697 63.494  29.708  1.00 33.75  ? 81  GLU A CB     1 
ATOM   1345  C  CG     . GLU A 1 81  ? -14.502 64.776  29.863  1.00 54.87  ? 81  GLU A CG     1 
ATOM   1346  C  CD     . GLU A 1 81  ? -15.968 64.516  30.160  1.00 65.99  ? 81  GLU A CD     1 
ATOM   1347  O  OE1    . GLU A 1 81  ? -16.359 63.333  30.237  1.00 58.38  ? 81  GLU A OE1    1 
ATOM   1348  O  OE2    . GLU A 1 81  ? -16.728 65.496  30.317  1.00 61.67  ? 81  GLU A OE2    1 
ATOM   1349  H  H      . GLU A 1 81  ? -12.045 61.752  29.340  1.00 45.91  ? 81  GLU A H      1 
ATOM   1350  H  HA     . GLU A 1 81  ? -12.140 64.237  28.599  1.00 40.89  ? 81  GLU A HA     1 
ATOM   1351  H  HB2    . GLU A 1 81  ? -14.087 62.987  28.978  1.00 40.50  ? 81  GLU A HB2    1 
ATOM   1352  H  HB3    . GLU A 1 81  ? -13.779 62.992  30.534  1.00 40.50  ? 81  GLU A HB3    1 
ATOM   1353  H  HG2    . GLU A 1 81  ? -14.135 65.294  30.597  1.00 65.84  ? 81  GLU A HG2    1 
ATOM   1354  H  HG3    . GLU A 1 81  ? -14.449 65.285  29.039  1.00 65.84  ? 81  GLU A HG3    1 
ATOM   1355  N  N      . ILE A 1 82  ? -11.310 63.843  31.666  1.00 34.17  ? 82  ILE A N      1 
ATOM   1356  C  CA     . ILE A 1 82  ? -10.657 64.480  32.807  1.00 49.66  ? 82  ILE A CA     1 
ATOM   1357  C  C      . ILE A 1 82  ? -9.212  64.821  32.462  1.00 40.01  ? 82  ILE A C      1 
ATOM   1358  O  O      . ILE A 1 82  ? -8.731  65.909  32.775  1.00 32.55  ? 82  ILE A O      1 
ATOM   1359  C  CB     . ILE A 1 82  ? -10.686 63.578  34.069  1.00 36.78  ? 82  ILE A CB     1 
ATOM   1360  C  CG1    . ILE A 1 82  ? -12.126 63.304  34.512  1.00 26.44  ? 82  ILE A CG1    1 
ATOM   1361  C  CG2    . ILE A 1 82  ? -9.906  64.214  35.217  1.00 27.42  ? 82  ILE A CG2    1 
ATOM   1362  C  CD1    . ILE A 1 82  ? -12.917 64.543  34.897  1.00 42.67  ? 82  ILE A CD1    1 
ATOM   1363  H  H      . ILE A 1 82  ? -11.505 63.015  31.792  1.00 41.01  ? 82  ILE A H      1 
ATOM   1364  H  HA     . ILE A 1 82  ? -11.119 65.307  33.016  1.00 59.59  ? 82  ILE A HA     1 
ATOM   1365  H  HB     . ILE A 1 82  ? -10.268 62.731  33.849  1.00 44.13  ? 82  ILE A HB     1 
ATOM   1366  H  HG12   . ILE A 1 82  ? -12.597 62.870  33.783  1.00 31.72  ? 82  ILE A HG12   1 
ATOM   1367  H  HG13   . ILE A 1 82  ? -12.106 62.716  35.283  1.00 31.72  ? 82  ILE A HG13   1 
ATOM   1368  H  HG21   . ILE A 1 82  ? -9.945  63.627  35.988  1.00 32.91  ? 82  ILE A HG21   1 
ATOM   1369  H  HG22   . ILE A 1 82  ? -8.985  64.339  34.941  1.00 32.91  ? 82  ILE A HG22   1 
ATOM   1370  H  HG23   . ILE A 1 82  ? -10.306 65.071  35.433  1.00 32.91  ? 82  ILE A HG23   1 
ATOM   1371  H  HD11   . ILE A 1 82  ? -13.812 64.276  35.162  1.00 51.20  ? 82  ILE A HD11   1 
ATOM   1372  H  HD12   . ILE A 1 82  ? -12.471 64.985  35.637  1.00 51.20  ? 82  ILE A HD12   1 
ATOM   1373  H  HD13   . ILE A 1 82  ? -12.962 65.139  34.133  1.00 51.20  ? 82  ILE A HD13   1 
ATOM   1374  N  N      . GLY A 1 83  ? -8.525  63.879  31.823  1.00 33.57  ? 83  GLY A N      1 
ATOM   1375  C  CA     . GLY A 1 83  ? -7.133  64.058  31.453  1.00 34.98  ? 83  GLY A CA     1 
ATOM   1376  C  C      . GLY A 1 83  ? -6.908  65.315  30.639  1.00 31.98  ? 83  GLY A C      1 
ATOM   1377  O  O      . GLY A 1 83  ? -6.076  66.153  30.984  1.00 35.52  ? 83  GLY A O      1 
ATOM   1378  H  H      . GLY A 1 83  ? -8.851  63.117  31.592  1.00 40.28  ? 83  GLY A H      1 
ATOM   1379  H  HA2    . GLY A 1 83  ? -6.590  64.110  32.254  1.00 41.97  ? 83  GLY A HA2    1 
ATOM   1380  H  HA3    . GLY A 1 83  ? -6.838  63.297  30.929  1.00 41.97  ? 83  GLY A HA3    1 
ATOM   1381  N  N      . LYS A 1 84  ? -7.657  65.444  29.552  1.00 28.40  ? 84  LYS A N      1 
ATOM   1382  C  CA     . LYS A 1 84  ? -7.528  66.589  28.663  1.00 37.03  ? 84  LYS A CA     1 
ATOM   1383  C  C      . LYS A 1 84  ? -7.822  67.905  29.388  1.00 36.70  ? 84  LYS A C      1 
ATOM   1384  O  O      . LYS A 1 84  ? -7.261  68.947  29.046  1.00 35.93  ? 84  LYS A O      1 
ATOM   1385  C  CB     . LYS A 1 84  ? -8.452  66.413  27.454  1.00 41.43  ? 84  LYS A CB     1 
ATOM   1386  C  CG     . LYS A 1 84  ? -8.024  65.267  26.539  1.00 39.95  ? 84  LYS A CG     1 
ATOM   1387  C  CD     . LYS A 1 84  ? -8.956  65.079  25.350  1.00 34.62  ? 84  LYS A CD     1 
ATOM   1388  C  CE     . LYS A 1 84  ? -10.261 64.419  25.760  1.00 46.61  ? 84  LYS A CE     1 
ATOM   1389  N  NZ     . LYS A 1 84  ? -11.033 63.917  24.591  1.00 41.00  ? 84  LYS A NZ     1 
ATOM   1390  H  H      . LYS A 1 84  ? -8.253  64.875  29.304  1.00 34.09  ? 84  LYS A H      1 
ATOM   1391  H  HA     . LYS A 1 84  ? -6.616  66.629  28.336  1.00 44.43  ? 84  LYS A HA     1 
ATOM   1392  H  HB2    . LYS A 1 84  ? -9.350  66.227  27.768  1.00 49.72  ? 84  LYS A HB2    1 
ATOM   1393  H  HB3    . LYS A 1 84  ? -8.446  67.231  26.931  1.00 49.72  ? 84  LYS A HB3    1 
ATOM   1394  H  HG2    . LYS A 1 84  ? -7.135  65.450  26.198  1.00 47.94  ? 84  LYS A HG2    1 
ATOM   1395  H  HG3    . LYS A 1 84  ? -8.019  64.441  27.049  1.00 47.94  ? 84  LYS A HG3    1 
ATOM   1396  H  HD2    . LYS A 1 84  ? -9.161  65.946  24.965  1.00 41.55  ? 84  LYS A HD2    1 
ATOM   1397  H  HD3    . LYS A 1 84  ? -8.523  64.514  24.691  1.00 41.55  ? 84  LYS A HD3    1 
ATOM   1398  H  HE2    . LYS A 1 84  ? -10.067 63.665  26.339  1.00 55.93  ? 84  LYS A HE2    1 
ATOM   1399  H  HE3    . LYS A 1 84  ? -10.811 65.066  26.228  1.00 55.93  ? 84  LYS A HE3    1 
ATOM   1400  H  HZ1    . LYS A 1 84  ? -11.789 63.537  24.866  1.00 49.21  ? 84  LYS A HZ1    1 
ATOM   1401  H  HZ2    . LYS A 1 84  ? -11.230 64.591  24.045  1.00 49.21  ? 84  LYS A HZ2    1 
ATOM   1402  H  HZ3    . LYS A 1 84  ? -10.552 63.314  24.145  1.00 49.21  ? 84  LYS A HZ3    1 
ATOM   1403  N  N      . ALA A 1 85  ? -8.688  67.851  30.396  1.00 38.35  ? 85  ALA A N      1 
ATOM   1404  C  CA     . ALA A 1 85  ? -9.085  69.048  31.135  1.00 27.24  ? 85  ALA A CA     1 
ATOM   1405  C  C      . ALA A 1 85  ? -7.996  69.543  32.080  1.00 28.20  ? 85  ALA A C      1 
ATOM   1406  O  O      . ALA A 1 85  ? -7.968  70.717  32.439  1.00 43.25  ? 85  ALA A O      1 
ATOM   1407  C  CB     . ALA A 1 85  ? -10.353 68.780  31.916  1.00 26.18  ? 85  ALA A CB     1 
ATOM   1408  H  H      . ALA A 1 85  ? -9.064  67.128  30.673  1.00 46.02  ? 85  ALA A H      1 
ATOM   1409  H  HA     . ALA A 1 85  ? -9.272  69.758  30.501  1.00 32.69  ? 85  ALA A HA     1 
ATOM   1410  H  HB1    . ALA A 1 85  ? -10.601 69.583  32.400  1.00 31.41  ? 85  ALA A HB1    1 
ATOM   1411  H  HB2    . ALA A 1 85  ? -11.059 68.534  31.297  1.00 31.41  ? 85  ALA A HB2    1 
ATOM   1412  H  HB3    . ALA A 1 85  ? -10.192 68.054  32.539  1.00 31.41  ? 85  ALA A HB3    1 
ATOM   1413  N  N      . VAL A 1 86  ? -7.104  68.644  32.478  1.00 36.55  ? 86  VAL A N      1 
ATOM   1414  C  CA     . VAL A 1 86  ? -6.107  68.945  33.500  1.00 27.53  ? 86  VAL A CA     1 
ATOM   1415  C  C      . VAL A 1 86  ? -4.738  69.292  32.910  1.00 37.70  ? 86  VAL A C      1 
ATOM   1416  O  O      . VAL A 1 86  ? -3.967  70.033  33.518  1.00 40.20  ? 86  VAL A O      1 
ATOM   1417  C  CB     . VAL A 1 86  ? -5.961  67.751  34.465  1.00 19.24  ? 86  VAL A CB     1 
ATOM   1418  C  CG1    . VAL A 1 86  ? -4.828  67.970  35.454  1.00 42.10  ? 86  VAL A CG1    1 
ATOM   1419  C  CG2    . VAL A 1 86  ? -7.262  67.524  35.211  1.00 19.13  ? 86  VAL A CG2    1 
ATOM   1420  H  H      . VAL A 1 86  ? -7.054  67.843  32.169  1.00 43.86  ? 86  VAL A H      1 
ATOM   1421  H  HA     . VAL A 1 86  ? -6.409  69.709  34.016  1.00 33.04  ? 86  VAL A HA     1 
ATOM   1422  H  HB     . VAL A 1 86  ? -5.763  66.951  33.953  1.00 23.09  ? 86  VAL A HB     1 
ATOM   1423  H  HG11   . VAL A 1 86  ? -4.769  67.200  36.041  1.00 50.52  ? 86  VAL A HG11   1 
ATOM   1424  H  HG12   . VAL A 1 86  ? -3.998  68.078  34.964  1.00 50.52  ? 86  VAL A HG12   1 
ATOM   1425  H  HG13   . VAL A 1 86  ? -5.013  68.769  35.972  1.00 50.52  ? 86  VAL A HG13   1 
ATOM   1426  H  HG21   . VAL A 1 86  ? -7.153  66.770  35.812  1.00 22.95  ? 86  VAL A HG21   1 
ATOM   1427  H  HG22   . VAL A 1 86  ? -7.479  68.323  35.716  1.00 22.95  ? 86  VAL A HG22   1 
ATOM   1428  H  HG23   . VAL A 1 86  ? -7.964  67.336  34.569  1.00 22.95  ? 86  VAL A HG23   1 
ATOM   1429  N  N      . LEU A 1 87  ? -4.441  68.770  31.724  1.00 42.78  ? 87  LEU A N      1 
ATOM   1430  C  CA     . LEU A 1 87  ? -3.126  68.960  31.120  1.00 42.99  ? 87  LEU A CA     1 
ATOM   1431  C  C      . LEU A 1 87  ? -3.089  70.175  30.197  1.00 41.86  ? 87  LEU A C      1 
ATOM   1432  O  O      . LEU A 1 87  ? -4.063  70.463  29.501  1.00 51.15  ? 87  LEU A O      1 
ATOM   1433  C  CB     . LEU A 1 87  ? -2.724  67.703  30.348  1.00 36.80  ? 87  LEU A CB     1 
ATOM   1434  C  CG     . LEU A 1 87  ? -2.769  66.413  31.171  1.00 28.90  ? 87  LEU A CG     1 
ATOM   1435  C  CD1    . LEU A 1 87  ? -2.475  65.214  30.297  1.00 35.48  ? 87  LEU A CD1    1 
ATOM   1436  C  CD2    . LEU A 1 87  ? -1.801  66.465  32.342  1.00 29.80  ? 87  LEU A CD2    1 
ATOM   1437  H  H      . LEU A 1 87  ? -4.984  68.302  31.249  1.00 51.34  ? 87  LEU A H      1 
ATOM   1438  H  HA     . LEU A 1 87  ? -2.473  69.100  31.823  1.00 51.59  ? 87  LEU A HA     1 
ATOM   1439  H  HB2    . LEU A 1 87  ? -3.327  67.594  29.596  1.00 44.17  ? 87  LEU A HB2    1 
ATOM   1440  H  HB3    . LEU A 1 87  ? -1.816  67.814  30.025  1.00 44.17  ? 87  LEU A HB3    1 
ATOM   1441  H  HG     . LEU A 1 87  ? -3.664  66.304  31.531  1.00 34.68  ? 87  LEU A HG     1 
ATOM   1442  H  HD11   . LEU A 1 87  ? -2.510  64.412  30.841  1.00 42.57  ? 87  LEU A HD11   1 
ATOM   1443  H  HD12   . LEU A 1 87  ? -3.140  65.166  29.593  1.00 42.57  ? 87  LEU A HD12   1 
ATOM   1444  H  HD13   . LEU A 1 87  ? -1.590  65.315  29.912  1.00 42.57  ? 87  LEU A HD13   1 
ATOM   1445  H  HD21   . LEU A 1 87  ? -1.860  65.632  32.837  1.00 35.77  ? 87  LEU A HD21   1 
ATOM   1446  H  HD22   . LEU A 1 87  ? -0.901  66.585  32.002  1.00 35.77  ? 87  LEU A HD22   1 
ATOM   1447  H  HD23   . LEU A 1 87  ? -2.041  67.209  32.917  1.00 35.77  ? 87  LEU A HD23   1 
ATOM   1448  N  N      . ASP A 1 88  ? -1.960  70.881  30.198  1.00 40.35  ? 88  ASP A N      1 
ATOM   1449  C  CA     . ASP A 1 88  ? -1.762  72.037  29.321  1.00 45.10  ? 88  ASP A CA     1 
ATOM   1450  C  C      . ASP A 1 88  ? -1.827  71.607  27.862  1.00 44.72  ? 88  ASP A C      1 
ATOM   1451  O  O      . ASP A 1 88  ? -2.673  72.069  27.098  1.00 52.47  ? 88  ASP A O      1 
ATOM   1452  C  CB     . ASP A 1 88  ? -0.417  72.714  29.598  1.00 47.15  ? 88  ASP A CB     1 
ATOM   1453  C  CG     . ASP A 1 88  ? -0.281  73.194  31.028  1.00 49.15  ? 88  ASP A CG     1 
ATOM   1454  O  OD1    . ASP A 1 88  ? -1.315  73.382  31.699  1.00 53.21  ? 88  ASP A OD1    1 
ATOM   1455  O  OD2    . ASP A 1 88  ? 0.868   73.387  31.481  1.00 44.38  ? 88  ASP A OD2    1 
ATOM   1456  H  H      . ASP A 1 88  ? -1.285  70.710  30.702  1.00 48.42  ? 88  ASP A H      1 
ATOM   1457  H  HA     . ASP A 1 88  ? -2.467  72.684  29.480  1.00 54.12  ? 88  ASP A HA     1 
ATOM   1458  H  HB2    . ASP A 1 88  ? 0.296   72.080  29.426  1.00 56.59  ? 88  ASP A HB2    1 
ATOM   1459  H  HB3    . ASP A 1 88  ? -0.325  73.483  29.014  1.00 56.59  ? 88  ASP A HB3    1 
ATOM   1460  N  N      . SER A 1 89  ? -0.900  70.733  27.486  1.00 51.30  ? 89  SER A N      1 
ATOM   1461  C  CA     . SER A 1 89  ? -0.914  70.081  26.187  1.00 46.24  ? 89  SER A CA     1 
ATOM   1462  C  C      . SER A 1 89  ? -0.938  68.582  26.414  1.00 30.79  ? 89  SER A C      1 
ATOM   1463  O  O      . SER A 1 89  ? -0.218  68.073  27.271  1.00 40.89  ? 89  SER A O      1 
ATOM   1464  C  CB     . SER A 1 89  ? 0.310   70.469  25.361  1.00 55.40  ? 89  SER A CB     1 
ATOM   1465  O  OG     . SER A 1 89  ? 1.497   69.991  25.970  1.00 38.85  ? 89  SER A OG     1 
ATOM   1466  H  H      . SER A 1 89  ? -0.237  70.497  27.981  1.00 61.56  ? 89  SER A H      1 
ATOM   1467  H  HA     . SER A 1 89  ? -1.713  70.336  25.700  1.00 55.48  ? 89  SER A HA     1 
ATOM   1468  H  HB2    . SER A 1 89  ? 0.230   70.081  24.476  1.00 66.48  ? 89  SER A HB2    1 
ATOM   1469  H  HB3    . SER A 1 89  ? 0.354   71.436  25.297  1.00 66.48  ? 89  SER A HB3    1 
ATOM   1470  H  HG     . SER A 1 89  ? 2.164   70.209  25.509  1.00 46.62  ? 89  SER A HG     1 
ATOM   1471  N  N      . TYR A 1 90  ? -1.766  67.876  25.654  1.00 18.64  ? 90  TYR A N      1 
ATOM   1472  C  CA     . TYR A 1 90  ? -1.877  66.433  25.808  1.00 27.68  ? 90  TYR A CA     1 
ATOM   1473  C  C      . TYR A 1 90  ? -1.635  65.698  24.495  1.00 33.44  ? 90  TYR A C      1 
ATOM   1474  O  O      . TYR A 1 90  ? -1.471  66.304  23.436  1.00 38.67  ? 90  TYR A O      1 
ATOM   1475  C  CB     . TYR A 1 90  ? -3.251  66.059  26.370  1.00 33.34  ? 90  TYR A CB     1 
ATOM   1476  C  CG     . TYR A 1 90  ? -4.403  66.318  25.429  1.00 21.93  ? 90  TYR A CG     1 
ATOM   1477  C  CD1    . TYR A 1 90  ? -4.778  65.371  24.487  1.00 25.36  ? 90  TYR A CD1    1 
ATOM   1478  C  CD2    . TYR A 1 90  ? -5.124  67.502  25.491  1.00 19.01  ? 90  TYR A CD2    1 
ATOM   1479  C  CE1    . TYR A 1 90  ? -5.831  65.598  23.626  1.00 33.60  ? 90  TYR A CE1    1 
ATOM   1480  C  CE2    . TYR A 1 90  ? -6.181  67.739  24.634  1.00 21.57  ? 90  TYR A CE2    1 
ATOM   1481  C  CZ     . TYR A 1 90  ? -6.530  66.782  23.703  1.00 45.68  ? 90  TYR A CZ     1 
ATOM   1482  O  OH     . TYR A 1 90  ? -7.580  67.006  22.842  1.00 68.09  ? 90  TYR A OH     1 
ATOM   1483  H  H      . TYR A 1 90  ? -2.273  68.208  25.044  1.00 22.36  ? 90  TYR A H      1 
ATOM   1484  H  HA     . TYR A 1 90  ? -1.206  66.135  26.442  1.00 33.22  ? 90  TYR A HA     1 
ATOM   1485  H  HB2    . TYR A 1 90  ? -3.252  65.113  26.583  1.00 40.00  ? 90  TYR A HB2    1 
ATOM   1486  H  HB3    . TYR A 1 90  ? -3.407  66.576  27.176  1.00 40.00  ? 90  TYR A HB3    1 
ATOM   1487  H  HD1    . TYR A 1 90  ? -4.308  64.571  24.431  1.00 30.43  ? 90  TYR A HD1    1 
ATOM   1488  H  HD2    . TYR A 1 90  ? -4.889  68.148  26.117  1.00 22.81  ? 90  TYR A HD2    1 
ATOM   1489  H  HE1    . TYR A 1 90  ? -6.068  64.955  22.998  1.00 40.32  ? 90  TYR A HE1    1 
ATOM   1490  H  HE2    . TYR A 1 90  ? -6.654  68.538  24.684  1.00 25.89  ? 90  TYR A HE2    1 
ATOM   1491  H  HH     . TYR A 1 90  ? -7.919  67.760  22.992  1.00 81.71  ? 90  TYR A HH     1 
ATOM   1492  N  N      . GLU A 1 91  ? -1.616  64.377  24.599  1.00 39.66  ? 91  GLU A N      1 
ATOM   1493  C  CA     . GLU A 1 91  ? -1.375  63.491  23.475  1.00 15.38  ? 91  GLU A CA     1 
ATOM   1494  C  C      . GLU A 1 91  ? -1.930  62.130  23.853  1.00 22.60  ? 91  GLU A C      1 
ATOM   1495  O  O      . GLU A 1 91  ? -1.649  61.624  24.939  1.00 49.21  ? 91  GLU A O      1 
ATOM   1496  C  CB     . GLU A 1 91  ? 0.117   63.404  23.158  1.00 27.25  ? 91  GLU A CB     1 
ATOM   1497  C  CG     . GLU A 1 91  ? 0.476   62.384  22.083  1.00 43.33  ? 91  GLU A CG     1 
ATOM   1498  C  CD     . GLU A 1 91  ? 1.954   62.039  22.070  1.00 63.99  ? 91  GLU A CD     1 
ATOM   1499  O  OE1    . GLU A 1 91  ? 2.436   61.535  21.033  1.00 88.36  ? 91  GLU A OE1    1 
ATOM   1500  O  OE2    . GLU A 1 91  ? 2.635   62.263  23.094  1.00 68.38  ? 91  GLU A OE2    1 
ATOM   1501  H  H      . GLU A 1 91  ? -1.745  63.957  25.338  1.00 47.59  ? 91  GLU A H      1 
ATOM   1502  H  HA     . GLU A 1 91  ? -1.845  63.816  22.691  1.00 18.45  ? 91  GLU A HA     1 
ATOM   1503  H  HB2    . GLU A 1 91  ? 0.420   64.273  22.852  1.00 32.70  ? 91  GLU A HB2    1 
ATOM   1504  H  HB3    . GLU A 1 91  ? 0.592   63.158  23.967  1.00 32.70  ? 91  GLU A HB3    1 
ATOM   1505  H  HG2    . GLU A 1 91  ? -0.021  61.567  22.244  1.00 52.00  ? 91  GLU A HG2    1 
ATOM   1506  H  HG3    . GLU A 1 91  ? 0.245   62.748  21.214  1.00 52.00  ? 91  GLU A HG3    1 
ATOM   1507  N  N      . ILE A 1 92  ? -2.719  61.542  22.965  1.00 25.63  ? 92  ILE A N      1 
ATOM   1508  C  CA     . ILE A 1 92  ? -3.335  60.254  23.244  1.00 30.28  ? 92  ILE A CA     1 
ATOM   1509  C  C      . ILE A 1 92  ? -2.818  59.214  22.261  1.00 34.93  ? 92  ILE A C      1 
ATOM   1510  O  O      . ILE A 1 92  ? -3.200  59.197  21.091  1.00 51.37  ? 92  ILE A O      1 
ATOM   1511  C  CB     . ILE A 1 92  ? -4.871  60.346  23.184  1.00 17.30  ? 92  ILE A CB     1 
ATOM   1512  C  CG1    . ILE A 1 92  ? -5.362  61.350  24.234  1.00 18.77  ? 92  ILE A CG1    1 
ATOM   1513  C  CG2    . ILE A 1 92  ? -5.500  58.976  23.422  1.00 25.86  ? 92  ILE A CG2    1 
ATOM   1514  C  CD1    . ILE A 1 92  ? -6.852  61.627  24.196  1.00 37.96  ? 92  ILE A CD1    1 
ATOM   1515  H  H      . ILE A 1 92  ? -2.914  61.867  22.194  1.00 30.75  ? 92  ILE A H      1 
ATOM   1516  H  HA     . ILE A 1 92  ? -3.086  59.971  24.138  1.00 36.34  ? 92  ILE A HA     1 
ATOM   1517  H  HB     . ILE A 1 92  ? -5.131  60.661  22.304  1.00 20.76  ? 92  ILE A HB     1 
ATOM   1518  H  HG12   . ILE A 1 92  ? -5.151  61.004  25.116  1.00 22.52  ? 92  ILE A HG12   1 
ATOM   1519  H  HG13   . ILE A 1 92  ? -4.903  62.193  24.095  1.00 22.52  ? 92  ILE A HG13   1 
ATOM   1520  H  HG21   . ILE A 1 92  ? -6.466  59.061  23.379  1.00 31.04  ? 92  ILE A HG21   1 
ATOM   1521  H  HG22   . ILE A 1 92  ? -5.191  58.363  22.736  1.00 31.04  ? 92  ILE A HG22   1 
ATOM   1522  H  HG23   . ILE A 1 92  ? -5.234  58.654  24.297  1.00 31.04  ? 92  ILE A HG23   1 
ATOM   1523  H  HD11   . ILE A 1 92  ? -7.071  62.269  24.890  1.00 45.55  ? 92  ILE A HD11   1 
ATOM   1524  H  HD12   . ILE A 1 92  ? -7.084  61.988  23.326  1.00 45.55  ? 92  ILE A HD12   1 
ATOM   1525  H  HD13   . ILE A 1 92  ? -7.332  60.798  24.349  1.00 45.55  ? 92  ILE A HD13   1 
ATOM   1526  N  N      . ARG A 1 93  ? -1.927  58.361  22.755  1.00 30.32  ? 93  ARG A N      1 
ATOM   1527  C  CA     . ARG A 1 93  ? -1.392  57.252  21.980  1.00 40.09  ? 93  ARG A CA     1 
ATOM   1528  C  C      . ARG A 1 93  ? -1.066  56.111  22.935  1.00 45.25  ? 93  ARG A C      1 
ATOM   1529  O  O      . ARG A 1 93  ? -0.108  56.183  23.706  1.00 28.45  ? 93  ARG A O      1 
ATOM   1530  C  CB     . ARG A 1 93  ? -0.150  57.680  21.192  1.00 55.98  ? 93  ARG A CB     1 
ATOM   1531  C  CG     . ARG A 1 93  ? -0.230  57.386  19.697  1.00 68.47  ? 93  ARG A CG     1 
ATOM   1532  C  CD     . ARG A 1 93  ? 0.960   57.975  18.950  1.00 67.04  ? 93  ARG A CD     1 
ATOM   1533  N  NE     . ARG A 1 93  ? 2.208   57.263  19.236  1.00 65.69  ? 93  ARG A NE     1 
ATOM   1534  C  CZ     . ARG A 1 93  ? 2.743   56.320  18.462  1.00 55.27  ? 93  ARG A CZ     1 
ATOM   1535  N  NH1    . ARG A 1 93  ? 2.152   55.953  17.330  1.00 56.25  ? 93  ARG A NH1    1 
ATOM   1536  N  NH2    . ARG A 1 93  ? 3.882   55.740  18.821  1.00 49.26  ? 93  ARG A NH2    1 
ATOM   1537  H  H      . ARG A 1 93  ? -1.612  58.407  23.553  1.00 36.39  ? 93  ARG A H      1 
ATOM   1538  H  HA     . ARG A 1 93  ? -2.063  56.944  21.351  1.00 48.11  ? 93  ARG A HA     1 
ATOM   1539  H  HB2    . ARG A 1 93  ? -0.027  58.636  21.299  1.00 67.17  ? 93  ARG A HB2    1 
ATOM   1540  H  HB3    . ARG A 1 93  ? 0.621   57.208  21.545  1.00 67.17  ? 93  ARG A HB3    1 
ATOM   1541  H  HG2    . ARG A 1 93  ? -0.232  56.426  19.559  1.00 82.17  ? 93  ARG A HG2    1 
ATOM   1542  H  HG3    . ARG A 1 93  ? -1.041  57.779  19.337  1.00 82.17  ? 93  ARG A HG3    1 
ATOM   1543  H  HD2    . ARG A 1 93  ? 0.794   57.919  17.996  1.00 80.45  ? 93  ARG A HD2    1 
ATOM   1544  H  HD3    . ARG A 1 93  ? 1.074   58.901  19.215  1.00 80.45  ? 93  ARG A HD3    1 
ATOM   1545  H  HE     . ARG A 1 93  ? 2.626   57.470  19.958  1.00 78.83  ? 93  ARG A HE     1 
ATOM   1546  H  HH11   . ARG A 1 93  ? 1.414   56.324  17.090  1.00 67.50  ? 93  ARG A HH11   1 
ATOM   1547  H  HH12   . ARG A 1 93  ? 2.506   55.343  16.838  1.00 67.50  ? 93  ARG A HH12   1 
ATOM   1548  H  HH21   . ARG A 1 93  ? 4.271   55.973  19.552  1.00 59.11  ? 93  ARG A HH21   1 
ATOM   1549  H  HH22   . ARG A 1 93  ? 4.230   55.132  18.323  1.00 59.11  ? 93  ARG A HH22   1 
ATOM   1550  N  N      . TYR A 1 94  ? -1.890  55.069  22.888  1.00 55.42  ? 94  TYR A N      1 
ATOM   1551  C  CA     . TYR A 1 94  ? -1.746  53.921  23.776  1.00 30.94  ? 94  TYR A CA     1 
ATOM   1552  C  C      . TYR A 1 94  ? -2.047  52.634  23.023  1.00 22.65  ? 94  TYR A C      1 
ATOM   1553  O  O      . TYR A 1 94  ? -2.612  52.668  21.932  1.00 42.29  ? 94  TYR A O      1 
ATOM   1554  C  CB     . TYR A 1 94  ? -2.672  54.060  24.978  1.00 21.99  ? 94  TYR A CB     1 
ATOM   1555  C  CG     . TYR A 1 94  ? -4.138  54.090  24.617  1.00 21.04  ? 94  TYR A CG     1 
ATOM   1556  C  CD1    . TYR A 1 94  ? -4.865  52.914  24.487  1.00 29.34  ? 94  TYR A CD1    1 
ATOM   1557  C  CD2    . TYR A 1 94  ? -4.799  55.294  24.411  1.00 17.93  ? 94  TYR A CD2    1 
ATOM   1558  C  CE1    . TYR A 1 94  ? -6.209  52.933  24.164  1.00 29.57  ? 94  TYR A CE1    1 
ATOM   1559  C  CE2    . TYR A 1 94  ? -6.145  55.323  24.085  1.00 24.66  ? 94  TYR A CE2    1 
ATOM   1560  C  CZ     . TYR A 1 94  ? -6.845  54.138  23.963  1.00 26.93  ? 94  TYR A CZ     1 
ATOM   1561  O  OH     . TYR A 1 94  ? -8.184  54.151  23.641  1.00 24.07  ? 94  TYR A OH     1 
ATOM   1562  H  H      . TYR A 1 94  ? -2.551  55.002  22.342  1.00 66.50  ? 94  TYR A H      1 
ATOM   1563  H  HA     . TYR A 1 94  ? -0.832  53.879  24.098  1.00 37.12  ? 94  TYR A HA     1 
ATOM   1564  H  HB2    . TYR A 1 94  ? -2.529  53.306  25.572  1.00 26.39  ? 94  TYR A HB2    1 
ATOM   1565  H  HB3    . TYR A 1 94  ? -2.463  54.886  25.440  1.00 26.39  ? 94  TYR A HB3    1 
ATOM   1566  H  HD1    . TYR A 1 94  ? -4.440  52.098  24.623  1.00 35.21  ? 94  TYR A HD1    1 
ATOM   1567  H  HD2    . TYR A 1 94  ? -4.330  56.093  24.494  1.00 21.51  ? 94  TYR A HD2    1 
ATOM   1568  H  HE1    . TYR A 1 94  ? -6.681  52.136  24.080  1.00 35.49  ? 94  TYR A HE1    1 
ATOM   1569  H  HE2    . TYR A 1 94  ? -6.576  56.136  23.950  1.00 29.59  ? 94  TYR A HE2    1 
ATOM   1570  H  HH     . TYR A 1 94  ? -8.449  54.942  23.545  1.00 28.88  ? 94  TYR A HH     1 
ATOM   1571  N  N      . ALA A 1 95  ? -1.680  51.501  23.613  1.00 14.51  ? 95  ALA A N      1 
ATOM   1572  C  CA     . ALA A 1 95  ? -1.764  50.222  22.918  1.00 19.72  ? 95  ALA A CA     1 
ATOM   1573  C  C      . ALA A 1 95  ? -3.065  49.490  23.229  1.00 26.94  ? 95  ALA A C      1 
ATOM   1574  O  O      . ALA A 1 95  ? -3.735  48.987  22.322  1.00 31.06  ? 95  ALA A O      1 
ATOM   1575  C  CB     . ALA A 1 95  ? -0.572  49.353  23.279  1.00 21.99  ? 95  ALA A CB     1 
ATOM   1576  H  H      . ALA A 1 95  ? -1.378  51.446  24.417  1.00 17.41  ? 95  ALA A H      1 
ATOM   1577  H  HA     . ALA A 1 95  ? -1.736  50.384  21.962  1.00 23.66  ? 95  ALA A HA     1 
ATOM   1578  H  HB1    . ALA A 1 95  ? -0.645  48.508  22.808  1.00 26.39  ? 95  ALA A HB1    1 
ATOM   1579  H  HB2    . ALA A 1 95  ? 0.242   49.810  23.016  1.00 26.39  ? 95  ALA A HB2    1 
ATOM   1580  H  HB3    . ALA A 1 95  ? -0.572  49.200  24.236  1.00 26.39  ? 95  ALA A HB3    1 
ATOM   1581  N  N      . GLU A 1 96  ? -3.411  49.428  24.513  1.00 21.73  ? 96  GLU A N      1 
ATOM   1582  C  CA     . GLU A 1 96  ? -4.618  48.739  24.962  1.00 17.00  ? 96  GLU A CA     1 
ATOM   1583  C  C      . GLU A 1 96  ? -5.356  49.565  26.002  1.00 18.59  ? 96  GLU A C      1 
ATOM   1584  O  O      . GLU A 1 96  ? -6.487  49.999  25.776  1.00 21.67  ? 96  GLU A O      1 
ATOM   1585  C  CB     . GLU A 1 96  ? -4.273  47.365  25.541  1.00 15.05  ? 96  GLU A CB     1 
ATOM   1586  C  CG     . GLU A 1 96  ? -5.491  46.525  25.923  1.00 33.79  ? 96  GLU A CG     1 
ATOM   1587  C  CD     . GLU A 1 96  ? -6.013  46.826  27.319  1.00 31.16  ? 96  GLU A CD     1 
ATOM   1588  O  OE1    . GLU A 1 96  ? -5.263  46.608  28.293  1.00 38.87  ? 96  GLU A OE1    1 
ATOM   1589  O  OE2    . GLU A 1 96  ? -7.174  47.277  27.442  1.00 35.21  ? 96  GLU A OE2    1 
ATOM   1590  H  H      . GLU A 1 96  ? -2.957  49.782  25.151  1.00 26.08  ? 96  GLU A H      1 
ATOM   1591  H  HA     . GLU A 1 96  ? -5.210  48.608  24.204  1.00 20.40  ? 96  GLU A HA     1 
ATOM   1592  H  HB2    . GLU A 1 96  ? -3.767  46.867  24.880  1.00 18.06  ? 96  GLU A HB2    1 
ATOM   1593  H  HB3    . GLU A 1 96  ? -3.737  47.489  26.339  1.00 18.06  ? 96  GLU A HB3    1 
ATOM   1594  H  HG2    . GLU A 1 96  ? -6.206  46.702  25.292  1.00 40.55  ? 96  GLU A HG2    1 
ATOM   1595  H  HG3    . GLU A 1 96  ? -5.247  45.587  25.892  1.00 40.55  ? 96  GLU A HG3    1 
ATOM   1596  N  N      . HIS A 1 97  ? -4.711  49.772  27.146  1.00 15.81  ? 97  HIS A N      1 
ATOM   1597  C  CA     . HIS A 1 97  ? -5.316  50.522  28.236  1.00 18.25  ? 97  HIS A CA     1 
ATOM   1598  C  C      . HIS A 1 97  ? -5.209  52.027  27.992  1.00 15.84  ? 97  HIS A C      1 
ATOM   1599  O  O      . HIS A 1 97  ? -4.102  52.558  27.883  1.00 21.86  ? 97  HIS A O      1 
ATOM   1600  C  CB     . HIS A 1 97  ? -4.658  50.167  29.568  1.00 21.76  ? 97  HIS A CB     1 
ATOM   1601  C  CG     . HIS A 1 97  ? -5.342  50.778  30.752  1.00 31.54  ? 97  HIS A CG     1 
ATOM   1602  N  ND1    . HIS A 1 97  ? -6.537  50.303  31.245  1.00 35.90  ? 97  HIS A ND1    1 
ATOM   1603  C  CD2    . HIS A 1 97  ? -5.009  51.838  31.526  1.00 25.53  ? 97  HIS A CD2    1 
ATOM   1604  C  CE1    . HIS A 1 97  ? -6.907  51.037  32.280  1.00 41.80  ? 97  HIS A CE1    1 
ATOM   1605  N  NE2    . HIS A 1 97  ? -5.997  51.976  32.471  1.00 31.18  ? 97  HIS A NE2    1 
ATOM   1606  H  H      . HIS A 1 97  ? -3.917  49.486  27.315  1.00 18.97  ? 97  HIS A H      1 
ATOM   1607  H  HA     . HIS A 1 97  ? -6.257  50.293  28.294  1.00 21.90  ? 97  HIS A HA     1 
ATOM   1608  H  HB2    . HIS A 1 97  ? -4.675  49.203  29.680  1.00 26.11  ? 97  HIS A HB2    1 
ATOM   1609  H  HB3    . HIS A 1 97  ? -3.741  50.482  29.559  1.00 26.11  ? 97  HIS A HB3    1 
ATOM   1610  H  HD1    . HIS A 1 97  ? -6.972  49.631  30.932  1.00 43.07  ? 97  HIS A HD1    1 
ATOM   1611  H  HD2    . HIS A 1 97  ? -4.251  52.370  31.438  1.00 30.63  ? 97  HIS A HD2    1 
ATOM   1612  H  HE1    . HIS A 1 97  ? -7.677  50.914  32.787  1.00 50.16  ? 97  HIS A HE1    1 
ATOM   1613  H  HE2    . HIS A 1 97  ? -6.019  52.575  33.087  1.00 37.42  ? 97  HIS A HE2    1 
ATOM   1614  N  N      . PRO A 1 98  ? -6.356  52.726  27.931  1.00 12.92  ? 98  PRO A N      1 
ATOM   1615  C  CA     . PRO A 1 98  ? -6.355  54.148  27.574  1.00 15.83  ? 98  PRO A CA     1 
ATOM   1616  C  C      . PRO A 1 98  ? -5.779  55.047  28.659  1.00 26.17  ? 98  PRO A C      1 
ATOM   1617  O  O      . PRO A 1 98  ? -5.964  54.770  29.840  1.00 30.03  ? 98  PRO A O      1 
ATOM   1618  C  CB     . PRO A 1 98  ? -7.837  54.449  27.371  1.00 13.22  ? 98  PRO A CB     1 
ATOM   1619  C  CG     . PRO A 1 98  ? -8.516  53.529  28.316  1.00 21.43  ? 98  PRO A CG     1 
ATOM   1620  C  CD     . PRO A 1 98  ? -7.705  52.266  28.309  1.00 19.00  ? 98  PRO A CD     1 
ATOM   1621  H  HA     . PRO A 1 98  ? -5.877  54.292  26.743  1.00 18.99  ? 98  PRO A HA     1 
ATOM   1622  H  HB2    . PRO A 1 98  ? -8.020  55.375  27.596  1.00 15.86  ? 98  PRO A HB2    1 
ATOM   1623  H  HB3    . PRO A 1 98  ? -8.092  54.256  26.455  1.00 15.86  ? 98  PRO A HB3    1 
ATOM   1624  H  HG2    . PRO A 1 98  ? -8.526  53.923  29.203  1.00 25.71  ? 98  PRO A HG2    1 
ATOM   1625  H  HG3    . PRO A 1 98  ? -9.420  53.357  28.009  1.00 25.71  ? 98  PRO A HG3    1 
ATOM   1626  H  HD2    . PRO A 1 98  ? -7.691  51.868  29.193  1.00 22.80  ? 98  PRO A HD2    1 
ATOM   1627  H  HD3    . PRO A 1 98  ? -8.050  51.647  27.646  1.00 22.80  ? 98  PRO A HD3    1 
ATOM   1628  N  N      . TYR A 1 99  ? -5.095  56.111  28.255  1.00 14.93  ? 99  TYR A N      1 
ATOM   1629  C  CA     . TYR A 1 99  ? -4.607  57.106  29.197  1.00 15.67  ? 99  TYR A CA     1 
ATOM   1630  C  C      . TYR A 1 99  ? -4.196  58.350  28.437  1.00 18.78  ? 99  TYR A C      1 
ATOM   1631  O  O      . TYR A 1 99  ? -4.202  58.357  27.208  1.00 30.32  ? 99  TYR A O      1 
ATOM   1632  C  CB     . TYR A 1 99  ? -3.437  56.562  30.018  1.00 23.83  ? 99  TYR A CB     1 
ATOM   1633  C  CG     . TYR A 1 99  ? -2.166  56.316  29.239  1.00 15.11  ? 99  TYR A CG     1 
ATOM   1634  C  CD1    . TYR A 1 99  ? -1.971  55.134  28.539  1.00 19.49  ? 99  TYR A CD1    1 
ATOM   1635  C  CD2    . TYR A 1 99  ? -1.150  57.258  29.226  1.00 29.10  ? 99  TYR A CD2    1 
ATOM   1636  C  CE1    . TYR A 1 99  ? -0.802  54.906  27.836  1.00 26.75  ? 99  TYR A CE1    1 
ATOM   1637  C  CE2    . TYR A 1 99  ? 0.020   57.039  28.530  1.00 41.32  ? 99  TYR A CE2    1 
ATOM   1638  C  CZ     . TYR A 1 99  ? 0.191   55.864  27.836  1.00 29.78  ? 99  TYR A CZ     1 
ATOM   1639  O  OH     . TYR A 1 99  ? 1.363   55.656  27.143  1.00 29.53  ? 99  TYR A OH     1 
ATOM   1640  H  H      . TYR A 1 99  ? -4.901  56.280  27.435  1.00 17.92  ? 99  TYR A H      1 
ATOM   1641  H  HA     . TYR A 1 99  ? -5.321  57.345  29.808  1.00 18.81  ? 99  TYR A HA     1 
ATOM   1642  H  HB2    . TYR A 1 99  ? -3.231  57.198  30.720  1.00 28.59  ? 99  TYR A HB2    1 
ATOM   1643  H  HB3    . TYR A 1 99  ? -3.705  55.717  30.414  1.00 28.59  ? 99  TYR A HB3    1 
ATOM   1644  H  HD1    . TYR A 1 99  ? -2.639  54.487  28.538  1.00 23.39  ? 99  TYR A HD1    1 
ATOM   1645  H  HD2    . TYR A 1 99  ? -1.260  58.054  29.694  1.00 34.92  ? 99  TYR A HD2    1 
ATOM   1646  H  HE1    . TYR A 1 99  ? -0.685  54.111  27.367  1.00 32.10  ? 99  TYR A HE1    1 
ATOM   1647  H  HE2    . TYR A 1 99  ? 0.690   57.684  28.528  1.00 49.59  ? 99  TYR A HE2    1 
ATOM   1648  H  HH     . TYR A 1 99  ? 1.343   54.907  26.764  1.00 35.43  ? 99  TYR A HH     1 
ATOM   1649  N  N      . VAL A 1 100 ? -3.848  59.403  29.168  1.00 20.20  ? 100 VAL A N      1 
ATOM   1650  C  CA     . VAL A 1 100 ? -3.486  60.667  28.547  1.00 26.57  ? 100 VAL A CA     1 
ATOM   1651  C  C      . VAL A 1 100 ? -2.077  61.072  28.936  1.00 35.80  ? 100 VAL A C      1 
ATOM   1652  O  O      . VAL A 1 100 ? -1.795  61.329  30.102  1.00 40.75  ? 100 VAL A O      1 
ATOM   1653  C  CB     . VAL A 1 100 ? -4.455  61.792  28.935  1.00 25.44  ? 100 VAL A CB     1 
ATOM   1654  C  CG1    . VAL A 1 100 ? -4.154  63.045  28.127  1.00 32.64  ? 100 VAL A CG1    1 
ATOM   1655  C  CG2    . VAL A 1 100 ? -5.892  61.355  28.709  1.00 33.13  ? 100 VAL A CG2    1 
ATOM   1656  H  H      . VAL A 1 100 ? -3.814  59.409  30.028  1.00 24.23  ? 100 VAL A H      1 
ATOM   1657  H  HA     . VAL A 1 100 ? -3.514  60.565  27.583  1.00 31.88  ? 100 VAL A HA     1 
ATOM   1658  H  HB     . VAL A 1 100 ? -4.343  62.001  29.876  1.00 30.53  ? 100 VAL A HB     1 
ATOM   1659  H  HG11   . VAL A 1 100 ? -4.775  63.744  28.385  1.00 39.16  ? 100 VAL A HG11   1 
ATOM   1660  H  HG12   . VAL A 1 100 ? -3.244  63.327  28.309  1.00 39.16  ? 100 VAL A HG12   1 
ATOM   1661  H  HG13   . VAL A 1 100 ? -4.256  62.844  27.183  1.00 39.16  ? 100 VAL A HG13   1 
ATOM   1662  H  HG21   . VAL A 1 100 ? -6.485  62.080  28.961  1.00 39.76  ? 100 VAL A HG21   1 
ATOM   1663  H  HG22   . VAL A 1 100 ? -6.013  61.139  27.771  1.00 39.76  ? 100 VAL A HG22   1 
ATOM   1664  H  HG23   . VAL A 1 100 ? -6.074  60.574  29.255  1.00 39.76  ? 100 VAL A HG23   1 
ATOM   1665  N  N      . HIS A 1 101 ? -1.196  61.111  27.943  1.00 43.62  ? 101 HIS A N      1 
ATOM   1666  C  CA     . HIS A 1 101 ? 0.155   61.615  28.125  1.00 33.24  ? 101 HIS A CA     1 
ATOM   1667  C  C      . HIS A 1 101 ? 0.168   63.096  27.774  1.00 30.79  ? 101 HIS A C      1 
ATOM   1668  O  O      . HIS A 1 101 ? -0.320  63.488  26.720  1.00 38.93  ? 101 HIS A O      1 
ATOM   1669  C  CB     . HIS A 1 101 ? 1.137   60.840  27.246  1.00 35.42  ? 101 HIS A CB     1 
ATOM   1670  C  CG     . HIS A 1 101 ? 2.569   61.206  27.469  1.00 43.18  ? 101 HIS A CG     1 
ATOM   1671  N  ND1    . HIS A 1 101 ? 3.340   60.630  28.454  1.00 66.33  ? 101 HIS A ND1    1 
ATOM   1672  C  CD2    . HIS A 1 101 ? 3.371   62.092  26.833  1.00 42.91  ? 101 HIS A CD2    1 
ATOM   1673  C  CE1    . HIS A 1 101 ? 4.556   61.144  28.416  1.00 64.77  ? 101 HIS A CE1    1 
ATOM   1674  N  NE2    . HIS A 1 101 ? 4.601   62.034  27.440  1.00 44.45  ? 101 HIS A NE2    1 
ATOM   1675  H  H      . HIS A 1 101 ? -1.362  60.846  27.142  1.00 52.35  ? 101 HIS A H      1 
ATOM   1676  H  HA     . HIS A 1 101 ? 0.420   61.512  29.052  1.00 39.89  ? 101 HIS A HA     1 
ATOM   1677  H  HB2    . HIS A 1 101 ? 1.041   59.892  27.431  1.00 42.51  ? 101 HIS A HB2    1 
ATOM   1678  H  HB3    . HIS A 1 101 ? 0.928   61.015  26.315  1.00 42.51  ? 101 HIS A HB3    1 
ATOM   1679  H  HD1    . HIS A 1 101 ? 3.072   60.029  29.008  1.00 79.60  ? 101 HIS A HD1    1 
ATOM   1680  H  HD2    . HIS A 1 101 ? 3.134   62.637  26.118  1.00 51.49  ? 101 HIS A HD2    1 
ATOM   1681  H  HE1    . HIS A 1 101 ? 5.261   60.918  28.979  1.00 77.73  ? 101 HIS A HE1    1 
ATOM   1682  H  HE2    . HIS A 1 101 ? 5.289   62.501  27.221  1.00 53.34  ? 101 HIS A HE2    1 
ATOM   1683  N  N      . GLY A 1 102 ? 0.707   63.925  28.659  1.00 22.80  ? 102 GLY A N      1 
ATOM   1684  C  CA     . GLY A 1 102 ? 0.753   65.347  28.396  1.00 27.30  ? 102 GLY A CA     1 
ATOM   1685  C  C      . GLY A 1 102 ? 1.751   66.082  29.259  1.00 35.20  ? 102 GLY A C      1 
ATOM   1686  O  O      . GLY A 1 102 ? 2.686   65.490  29.792  1.00 42.27  ? 102 GLY A O      1 
ATOM   1687  H  H      . GLY A 1 102 ? 1.048   63.688  29.412  1.00 27.36  ? 102 GLY A H      1 
ATOM   1688  H  HA2    . GLY A 1 102 ? 0.989   65.494  27.467  1.00 32.76  ? 102 GLY A HA2    1 
ATOM   1689  H  HA3    . GLY A 1 102 ? -0.124  65.731  28.552  1.00 32.76  ? 102 GLY A HA3    1 
ATOM   1690  N  N      . VAL A 1 103 ? 1.544   67.387  29.385  1.00 44.14  ? 103 VAL A N      1 
ATOM   1691  C  CA     . VAL A 1 103 ? 2.470   68.257  30.091  1.00 48.65  ? 103 VAL A CA     1 
ATOM   1692  C  C      . VAL A 1 103 ? 1.704   69.191  31.020  1.00 43.23  ? 103 VAL A C      1 
ATOM   1693  O  O      . VAL A 1 103 ? 0.578   69.588  30.721  1.00 34.72  ? 103 VAL A O      1 
ATOM   1694  C  CB     . VAL A 1 103 ? 3.325   69.086  29.106  1.00 30.17  ? 103 VAL A CB     1 
ATOM   1695  C  CG1    . VAL A 1 103 ? 4.440   69.816  29.840  1.00 39.13  ? 103 VAL A CG1    1 
ATOM   1696  C  CG2    . VAL A 1 103 ? 3.912   68.191  28.030  1.00 35.11  ? 103 VAL A CG2    1 
ATOM   1697  H  H      . VAL A 1 103 ? 0.860   67.798  29.064  1.00 52.97  ? 103 VAL A H      1 
ATOM   1698  H  HA     . VAL A 1 103 ? 3.068   67.716  30.630  1.00 58.37  ? 103 VAL A HA     1 
ATOM   1699  H  HB     . VAL A 1 103 ? 2.762   69.748  28.675  1.00 36.21  ? 103 VAL A HB     1 
ATOM   1700  H  HG11   . VAL A 1 103 ? 4.958   70.326  29.198  1.00 46.96  ? 103 VAL A HG11   1 
ATOM   1701  H  HG12   . VAL A 1 103 ? 4.048   70.411  30.497  1.00 46.96  ? 103 VAL A HG12   1 
ATOM   1702  H  HG13   . VAL A 1 103 ? 5.007   69.163  30.280  1.00 46.96  ? 103 VAL A HG13   1 
ATOM   1703  H  HG21   . VAL A 1 103 ? 4.443   68.731  27.425  1.00 42.13  ? 103 VAL A HG21   1 
ATOM   1704  H  HG22   . VAL A 1 103 ? 4.471   67.518  28.450  1.00 42.13  ? 103 VAL A HG22   1 
ATOM   1705  H  HG23   . VAL A 1 103 ? 3.188   67.764  27.545  1.00 42.13  ? 103 VAL A HG23   1 
ATOM   1706  N  N      . VAL A 1 104 ? 2.309   69.513  32.158  1.00 37.64  ? 104 VAL A N      1 
ATOM   1707  C  CA     . VAL A 1 104 ? 1.752   70.500  33.075  1.00 39.97  ? 104 VAL A CA     1 
ATOM   1708  C  C      . VAL A 1 104 ? 2.870   71.349  33.668  1.00 51.43  ? 104 VAL A C      1 
ATOM   1709  O  O      . VAL A 1 104 ? 3.678   70.864  34.456  1.00 53.25  ? 104 VAL A O      1 
ATOM   1710  C  CB     . VAL A 1 104 ? 0.949   69.832  34.197  1.00 36.01  ? 104 VAL A CB     1 
ATOM   1711  C  CG1    . VAL A 1 104 ? 0.589   70.841  35.289  1.00 34.45  ? 104 VAL A CG1    1 
ATOM   1712  C  CG2    . VAL A 1 104 ? -0.308  69.211  33.622  1.00 47.83  ? 104 VAL A CG2    1 
ATOM   1713  H  H      . VAL A 1 104 ? 3.052   69.171  32.424  1.00 45.17  ? 104 VAL A H      1 
ATOM   1714  H  HA     . VAL A 1 104 ? 1.155   71.087  32.586  1.00 47.96  ? 104 VAL A HA     1 
ATOM   1715  H  HB     . VAL A 1 104 ? 1.482   69.127  34.597  1.00 43.22  ? 104 VAL A HB     1 
ATOM   1716  H  HG11   . VAL A 1 104 ? 0.083   70.389  35.982  1.00 41.34  ? 104 VAL A HG11   1 
ATOM   1717  H  HG12   . VAL A 1 104 ? 1.406   71.208  35.662  1.00 41.34  ? 104 VAL A HG12   1 
ATOM   1718  H  HG13   . VAL A 1 104 ? 0.056   71.551  34.899  1.00 41.34  ? 104 VAL A HG13   1 
ATOM   1719  H  HG21   . VAL A 1 104 ? -0.809  68.791  34.338  1.00 57.39  ? 104 VAL A HG21   1 
ATOM   1720  H  HG22   . VAL A 1 104 ? -0.843  69.906  33.207  1.00 57.39  ? 104 VAL A HG22   1 
ATOM   1721  H  HG23   . VAL A 1 104 ? -0.058  68.547  32.960  1.00 57.39  ? 104 VAL A HG23   1 
ATOM   1722  N  N      . LYS A 1 105 ? 2.907   72.618  33.274  1.00 52.70  ? 105 LYS A N      1 
ATOM   1723  C  CA     . LYS A 1 105 ? 3.957   73.540  33.698  1.00 50.64  ? 105 LYS A CA     1 
ATOM   1724  C  C      . LYS A 1 105 ? 5.337   72.993  33.346  1.00 48.19  ? 105 LYS A C      1 
ATOM   1725  O  O      . LYS A 1 105 ? 6.321   73.258  34.037  1.00 41.03  ? 105 LYS A O      1 
ATOM   1726  C  CB     . LYS A 1 105 ? 3.860   73.830  35.199  1.00 35.65  ? 105 LYS A CB     1 
ATOM   1727  C  CG     . LYS A 1 105 ? 2.563   74.520  35.602  1.00 43.82  ? 105 LYS A CG     1 
ATOM   1728  C  CD     . LYS A 1 105 ? 2.551   74.902  37.074  1.00 57.59  ? 105 LYS A CD     1 
ATOM   1729  C  CE     . LYS A 1 105 ? 3.383   76.140  37.355  1.00 58.35  ? 105 LYS A CE     1 
ATOM   1730  N  NZ     . LYS A 1 105 ? 2.796   77.359  36.737  1.00 63.11  ? 105 LYS A NZ     1 
ATOM   1731  H  H      . LYS A 1 105 ? 2.324   72.976  32.753  1.00 63.24  ? 105 LYS A H      1 
ATOM   1732  H  HA     . LYS A 1 105 ? 3.844   74.380  33.226  1.00 60.77  ? 105 LYS A HA     1 
ATOM   1733  H  HB2    . LYS A 1 105 ? 3.914   72.992  35.684  1.00 42.78  ? 105 LYS A HB2    1 
ATOM   1734  H  HB3    . LYS A 1 105 ? 4.596   74.408  35.455  1.00 42.78  ? 105 LYS A HB3    1 
ATOM   1735  H  HG2    . LYS A 1 105 ? 2.458   75.330  35.079  1.00 52.58  ? 105 LYS A HG2    1 
ATOM   1736  H  HG3    . LYS A 1 105 ? 1.819   73.919  35.439  1.00 52.58  ? 105 LYS A HG3    1 
ATOM   1737  H  HD2    . LYS A 1 105 ? 1.638   75.083  37.348  1.00 69.11  ? 105 LYS A HD2    1 
ATOM   1738  H  HD3    . LYS A 1 105 ? 2.916   74.169  37.595  1.00 69.11  ? 105 LYS A HD3    1 
ATOM   1739  H  HE2    . LYS A 1 105 ? 3.432   76.281  38.313  1.00 70.02  ? 105 LYS A HE2    1 
ATOM   1740  H  HE3    . LYS A 1 105 ? 4.273   76.015  36.990  1.00 70.02  ? 105 LYS A HE3    1 
ATOM   1741  H  HZ1    . LYS A 1 105 ? 3.305   78.067  36.918  1.00 75.74  ? 105 LYS A HZ1    1 
ATOM   1742  H  HZ2    . LYS A 1 105 ? 2.745   77.258  35.854  1.00 75.74  ? 105 LYS A HZ2    1 
ATOM   1743  H  HZ3    . LYS A 1 105 ? 1.979   77.500  37.059  1.00 75.74  ? 105 LYS A HZ3    1 
ATOM   1744  N  N      . GLY A 1 106 ? 5.386   72.204  32.277  1.00 41.19  ? 106 GLY A N      1 
ATOM   1745  C  CA     . GLY A 1 106 ? 6.639   71.751  31.709  1.00 32.36  ? 106 GLY A CA     1 
ATOM   1746  C  C      . GLY A 1 106 ? 7.134   70.399  32.183  1.00 41.51  ? 106 GLY A C      1 
ATOM   1747  O  O      . GLY A 1 106 ? 8.247   70.006  31.834  1.00 48.73  ? 106 GLY A O      1 
ATOM   1748  H  H      . GLY A 1 106 ? 4.692   71.916  31.859  1.00 49.43  ? 106 GLY A H      1 
ATOM   1749  H  HA2    . GLY A 1 106 ? 6.546   71.709  30.745  1.00 38.84  ? 106 GLY A HA2    1 
ATOM   1750  H  HA3    . GLY A 1 106 ? 7.327   72.404  31.913  1.00 38.84  ? 106 GLY A HA3    1 
ATOM   1751  N  N      . VAL A 1 107 ? 6.327   69.687  32.967  1.00 39.16  ? 107 VAL A N      1 
ATOM   1752  C  CA     . VAL A 1 107 ? 6.713   68.357  33.440  1.00 42.02  ? 107 VAL A CA     1 
ATOM   1753  C  C      . VAL A 1 107 ? 5.838   67.295  32.794  1.00 43.40  ? 107 VAL A C      1 
ATOM   1754  O  O      . VAL A 1 107 ? 4.679   67.547  32.471  1.00 47.60  ? 107 VAL A O      1 
ATOM   1755  C  CB     . VAL A 1 107 ? 6.618   68.230  34.980  1.00 41.19  ? 107 VAL A CB     1 
ATOM   1756  C  CG1    . VAL A 1 107 ? 7.203   69.462  35.658  1.00 49.06  ? 107 VAL A CG1    1 
ATOM   1757  C  CG2    . VAL A 1 107 ? 5.183   68.007  35.433  1.00 52.48  ? 107 VAL A CG2    1 
ATOM   1758  H  H      . VAL A 1 107 ? 5.555   69.949  33.240  1.00 47.00  ? 107 VAL A H      1 
ATOM   1759  H  HA     . VAL A 1 107 ? 7.632   68.186  33.182  1.00 50.43  ? 107 VAL A HA     1 
ATOM   1760  H  HB     . VAL A 1 107 ? 7.140   67.462  35.261  1.00 49.42  ? 107 VAL A HB     1 
ATOM   1761  H  HG11   . VAL A 1 107 ? 7.131   69.357  36.619  1.00 58.87  ? 107 VAL A HG11   1 
ATOM   1762  H  HG12   . VAL A 1 107 ? 8.135   69.550  35.403  1.00 58.87  ? 107 VAL A HG12   1 
ATOM   1763  H  HG13   . VAL A 1 107 ? 6.707   70.245  35.372  1.00 58.87  ? 107 VAL A HG13   1 
ATOM   1764  H  HG21   . VAL A 1 107 ? 5.166   67.932  36.400  1.00 62.97  ? 107 VAL A HG21   1 
ATOM   1765  H  HG22   . VAL A 1 107 ? 4.642   68.760  35.149  1.00 62.97  ? 107 VAL A HG22   1 
ATOM   1766  H  HG23   . VAL A 1 107 ? 4.850   67.189  35.032  1.00 62.97  ? 107 VAL A HG23   1 
ATOM   1767  N  N      . GLU A 1 108 ? 6.396   66.104  32.616  1.00 42.71  ? 108 GLU A N      1 
ATOM   1768  C  CA     . GLU A 1 108 ? 5.648   64.995  32.039  1.00 48.78  ? 108 GLU A CA     1 
ATOM   1769  C  C      . GLU A 1 108 ? 4.606   64.498  33.027  1.00 49.15  ? 108 GLU A C      1 
ATOM   1770  O  O      . GLU A 1 108 ? 4.920   64.213  34.181  1.00 50.48  ? 108 GLU A O      1 
ATOM   1771  C  CB     . GLU A 1 108 ? 6.583   63.849  31.645  1.00 60.87  ? 108 GLU A CB     1 
ATOM   1772  C  CG     . GLU A 1 108 ? 7.607   64.214  30.586  1.00 76.35  ? 108 GLU A CG     1 
ATOM   1773  C  CD     . GLU A 1 108 ? 7.074   64.026  29.179  1.00 77.66  ? 108 GLU A CD     1 
ATOM   1774  O  OE1    . GLU A 1 108 ? 7.765   63.379  28.364  1.00 82.99  ? 108 GLU A OE1    1 
ATOM   1775  O  OE2    . GLU A 1 108 ? 5.972   64.538  28.885  1.00 53.75  ? 108 GLU A OE2    1 
ATOM   1776  H  H      . GLU A 1 108 ? 7.208   65.911  32.822  1.00 51.25  ? 108 GLU A H      1 
ATOM   1777  H  HA     . GLU A 1 108 ? 5.189   65.301  31.241  1.00 58.53  ? 108 GLU A HA     1 
ATOM   1778  H  HB2    . GLU A 1 108 ? 7.066   63.556  32.434  1.00 73.04  ? 108 GLU A HB2    1 
ATOM   1779  H  HB3    . GLU A 1 108 ? 6.049   63.117  31.299  1.00 73.04  ? 108 GLU A HB3    1 
ATOM   1780  H  HG2    . GLU A 1 108 ? 7.855   65.146  30.692  1.00 91.62  ? 108 GLU A HG2    1 
ATOM   1781  H  HG3    . GLU A 1 108 ? 8.388   63.648  30.691  1.00 91.62  ? 108 GLU A HG3    1 
ATOM   1782  N  N      . VAL A 1 109 ? 3.367   64.400  32.561  1.00 46.88  ? 109 VAL A N      1 
ATOM   1783  C  CA     . VAL A 1 109 ? 2.270   63.911  33.383  1.00 36.16  ? 109 VAL A CA     1 
ATOM   1784  C  C      . VAL A 1 109 ? 1.485   62.856  32.618  1.00 38.61  ? 109 VAL A C      1 
ATOM   1785  O  O      . VAL A 1 109 ? 1.170   63.034  31.442  1.00 52.21  ? 109 VAL A O      1 
ATOM   1786  C  CB     . VAL A 1 109 ? 1.323   65.053  33.806  1.00 43.72  ? 109 VAL A CB     1 
ATOM   1787  C  CG1    . VAL A 1 109 ? 0.141   64.513  34.606  1.00 39.71  ? 109 VAL A CG1    1 
ATOM   1788  C  CG2    . VAL A 1 109 ? 2.078   66.095  34.614  1.00 40.38  ? 109 VAL A CG2    1 
ATOM   1789  H  H      . VAL A 1 109 ? 3.133   64.613  31.761  1.00 56.26  ? 109 VAL A H      1 
ATOM   1790  H  HA     . VAL A 1 109 ? 2.630   63.501  34.186  1.00 43.40  ? 109 VAL A HA     1 
ATOM   1791  H  HB     . VAL A 1 109 ? 0.975   65.485  33.011  1.00 52.46  ? 109 VAL A HB     1 
ATOM   1792  H  HG11   . VAL A 1 109 ? -0.434  65.253  34.857  1.00 47.66  ? 109 VAL A HG11   1 
ATOM   1793  H  HG12   . VAL A 1 109 ? -0.350  63.883  34.056  1.00 47.66  ? 109 VAL A HG12   1 
ATOM   1794  H  HG13   . VAL A 1 109 ? 0.475   64.069  35.401  1.00 47.66  ? 109 VAL A HG13   1 
ATOM   1795  H  HG21   . VAL A 1 109 ? 1.464   66.801  34.868  1.00 48.46  ? 109 VAL A HG21   1 
ATOM   1796  H  HG22   . VAL A 1 109 ? 2.446   65.674  35.406  1.00 48.46  ? 109 VAL A HG22   1 
ATOM   1797  H  HG23   . VAL A 1 109 ? 2.794   66.458  34.069  1.00 48.46  ? 109 VAL A HG23   1 
ATOM   1798  N  N      . ASP A 1 110 ? 1.166   61.761  33.302  1.00 37.21  ? 110 ASP A N      1 
ATOM   1799  C  CA     . ASP A 1 110 ? 0.322   60.714  32.742  1.00 43.59  ? 110 ASP A CA     1 
ATOM   1800  C  C      . ASP A 1 110 ? -0.928  60.588  33.596  1.00 33.49  ? 110 ASP A C      1 
ATOM   1801  O  O      . ASP A 1 110 ? -0.847  60.310  34.789  1.00 44.60  ? 110 ASP A O      1 
ATOM   1802  C  CB     . ASP A 1 110 ? 1.064   59.371  32.684  1.00 39.70  ? 110 ASP A CB     1 
ATOM   1803  C  CG     . ASP A 1 110 ? 2.106   59.322  31.581  1.00 54.70  ? 110 ASP A CG     1 
ATOM   1804  O  OD1    . ASP A 1 110 ? 2.576   60.396  31.153  1.00 76.09  ? 110 ASP A OD1    1 
ATOM   1805  O  OD2    . ASP A 1 110 ? 2.455   58.207  31.139  1.00 52.96  ? 110 ASP A OD2    1 
ATOM   1806  H  H      . ASP A 1 110 ? 1.430   61.601  34.104  1.00 44.66  ? 110 ASP A H      1 
ATOM   1807  H  HA     . ASP A 1 110 ? 0.057   60.958  31.842  1.00 52.31  ? 110 ASP A HA     1 
ATOM   1808  H  HB2    . ASP A 1 110 ? 1.515   59.223  33.529  1.00 47.64  ? 110 ASP A HB2    1 
ATOM   1809  H  HB3    . ASP A 1 110 ? 0.422   58.663  32.521  1.00 47.64  ? 110 ASP A HB3    1 
ATOM   1810  N  N      . VAL A 1 111 ? -2.083  60.796  32.974  1.00 31.03  ? 111 VAL A N      1 
ATOM   1811  C  CA     . VAL A 1 111 ? -3.359  60.703  33.667  1.00 27.11  ? 111 VAL A CA     1 
ATOM   1812  C  C      . VAL A 1 111 ? -4.040  59.397  33.279  1.00 23.83  ? 111 VAL A C      1 
ATOM   1813  O  O      . VAL A 1 111 ? -4.626  59.284  32.202  1.00 21.01  ? 111 VAL A O      1 
ATOM   1814  C  CB     . VAL A 1 111 ? -4.269  61.893  33.331  1.00 23.28  ? 111 VAL A CB     1 
ATOM   1815  C  CG1    . VAL A 1 111 ? -5.475  61.913  34.249  1.00 27.10  ? 111 VAL A CG1    1 
ATOM   1816  C  CG2    . VAL A 1 111 ? -3.496  63.192  33.444  1.00 14.85  ? 111 VAL A CG2    1 
ATOM   1817  H  H      . VAL A 1 111 ? -2.154  60.996  32.141  1.00 37.24  ? 111 VAL A H      1 
ATOM   1818  H  HA     . VAL A 1 111 ? -3.206  60.696  34.625  1.00 32.53  ? 111 VAL A HA     1 
ATOM   1819  H  HB     . VAL A 1 111 ? -4.585  61.806  32.418  1.00 27.94  ? 111 VAL A HB     1 
ATOM   1820  H  HG11   . VAL A 1 111 ? -6.034  62.672  34.019  1.00 32.52  ? 111 VAL A HG11   1 
ATOM   1821  H  HG12   . VAL A 1 111 ? -5.972  61.088  34.135  1.00 32.52  ? 111 VAL A HG12   1 
ATOM   1822  H  HG13   . VAL A 1 111 ? -5.171  61.992  35.167  1.00 32.52  ? 111 VAL A HG13   1 
ATOM   1823  H  HG21   . VAL A 1 111 ? -4.087  63.931  33.229  1.00 17.83  ? 111 VAL A HG21   1 
ATOM   1824  H  HG22   . VAL A 1 111 ? -3.167  63.285  34.352  1.00 17.83  ? 111 VAL A HG22   1 
ATOM   1825  H  HG23   . VAL A 1 111 ? -2.751  63.171  32.823  1.00 17.83  ? 111 VAL A HG23   1 
ATOM   1826  N  N      . VAL A 1 112 ? -3.970  58.418  34.175  1.00 15.09  ? 112 VAL A N      1 
ATOM   1827  C  CA     . VAL A 1 112 ? -4.431  57.071  33.875  1.00 19.24  ? 112 VAL A CA     1 
ATOM   1828  C  C      . VAL A 1 112 ? -5.764  56.787  34.559  1.00 18.54  ? 112 VAL A C      1 
ATOM   1829  O  O      . VAL A 1 112 ? -5.896  56.999  35.758  1.00 29.27  ? 112 VAL A O      1 
ATOM   1830  C  CB     . VAL A 1 112 ? -3.405  56.019  34.324  1.00 21.77  ? 112 VAL A CB     1 
ATOM   1831  C  CG1    . VAL A 1 112 ? -3.804  54.635  33.826  1.00 25.58  ? 112 VAL A CG1    1 
ATOM   1832  C  CG2    . VAL A 1 112 ? -2.025  56.379  33.812  1.00 28.60  ? 112 VAL A CG2    1 
ATOM   1833  H  H      . VAL A 1 112 ? -3.657  58.511  34.970  1.00 18.11  ? 112 VAL A H      1 
ATOM   1834  H  HA     . VAL A 1 112 ? -4.557  56.983  32.917  1.00 23.09  ? 112 VAL A HA     1 
ATOM   1835  H  HB     . VAL A 1 112 ? -3.374  55.996  35.293  1.00 26.13  ? 112 VAL A HB     1 
ATOM   1836  H  HG11   . VAL A 1 112 ? -3.142  53.991  34.122  1.00 30.69  ? 112 VAL A HG11   1 
ATOM   1837  H  HG12   . VAL A 1 112 ? -4.673  54.407  34.191  1.00 30.69  ? 112 VAL A HG12   1 
ATOM   1838  H  HG13   . VAL A 1 112 ? -3.844  54.648  32.857  1.00 30.69  ? 112 VAL A HG13   1 
ATOM   1839  H  HG21   . VAL A 1 112 ? -1.394  55.704  34.106  1.00 34.32  ? 112 VAL A HG21   1 
ATOM   1840  H  HG22   . VAL A 1 112 ? -2.047  56.413  32.843  1.00 34.32  ? 112 VAL A HG22   1 
ATOM   1841  H  HG23   . VAL A 1 112 ? -1.773  57.245  34.168  1.00 34.32  ? 112 VAL A HG23   1 
ATOM   1842  N  N      . PRO A 1 113 ? -6.765  56.319  33.798  1.00 23.69  ? 113 PRO A N      1 
ATOM   1843  C  CA     . PRO A 1 113 ? -8.017  55.883  34.418  1.00 26.96  ? 113 PRO A CA     1 
ATOM   1844  C  C      . PRO A 1 113 ? -7.901  54.461  34.938  1.00 33.70  ? 113 PRO A C      1 
ATOM   1845  O  O      . PRO A 1 113 ? -7.194  53.662  34.328  1.00 39.70  ? 113 PRO A O      1 
ATOM   1846  C  CB     . PRO A 1 113 ? -9.031  55.953  33.268  1.00 28.93  ? 113 PRO A CB     1 
ATOM   1847  C  CG     . PRO A 1 113 ? -8.311  56.611  32.134  1.00 31.26  ? 113 PRO A CG     1 
ATOM   1848  C  CD     . PRO A 1 113 ? -6.881  56.301  32.334  1.00 44.44  ? 113 PRO A CD     1 
ATOM   1849  H  HA     . PRO A 1 113 ? -8.281  56.482  35.134  1.00 32.36  ? 113 PRO A HA     1 
ATOM   1850  H  HB2    . PRO A 1 113 ? -9.306  55.056  33.022  1.00 34.71  ? 113 PRO A HB2    1 
ATOM   1851  H  HB3    . PRO A 1 113 ? -9.796  56.483  33.540  1.00 34.71  ? 113 PRO A HB3    1 
ATOM   1852  H  HG2    . PRO A 1 113 ? -8.625  56.245  31.293  1.00 37.51  ? 113 PRO A HG2    1 
ATOM   1853  H  HG3    . PRO A 1 113 ? -8.460  57.569  32.167  1.00 37.51  ? 113 PRO A HG3    1 
ATOM   1854  H  HD2    . PRO A 1 113 ? -6.670  55.421  31.985  1.00 53.33  ? 113 PRO A HD2    1 
ATOM   1855  H  HD3    . PRO A 1 113 ? -6.324  56.989  31.938  1.00 53.33  ? 113 PRO A HD3    1 
ATOM   1856  N  N      . CYS A 1 114 ? -8.580  54.148  36.035  1.00 44.02  ? 114 CYS A N      1 
ATOM   1857  C  CA     . CYS A 1 114 ? -8.596  52.786  36.553  1.00 45.98  ? 114 CYS A CA     1 
ATOM   1858  C  C      . CYS A 1 114 ? -9.803  52.601  37.459  1.00 39.86  ? 114 CYS A C      1 
ATOM   1859  O  O      . CYS A 1 114 ? -10.509 53.558  37.768  1.00 46.40  ? 114 CYS A O      1 
ATOM   1860  C  CB     . CYS A 1 114 ? -7.313  52.466  37.314  1.00 32.59  ? 114 CYS A CB     1 
ATOM   1861  S  SG     . CYS A 1 114 ? -7.246  53.177  38.951  1.00 40.92  ? 114 CYS A SG     1 
ATOM   1862  H  H      . CYS A 1 114 ? -9.041  54.707  36.499  1.00 52.82  ? 114 CYS A H      1 
ATOM   1863  H  HA     . CYS A 1 114 ? -8.674  52.164  35.813  1.00 55.18  ? 114 CYS A HA     1 
ATOM   1864  H  HB2    . CYS A 1 114 ? -7.237  51.503  37.406  1.00 39.11  ? 114 CYS A HB2    1 
ATOM   1865  H  HB3    . CYS A 1 114 ? -6.558  52.809  36.811  1.00 39.11  ? 114 CYS A HB3    1 
ATOM   1866  H  HG     . CYS A 1 114 ? -7.324  54.371  38.861  1.00 49.11  ? 114 CYS A HG     1 
ATOM   1867  N  N      . TYR A 1 115 ? -10.027 51.365  37.889  1.00 44.23  ? 115 TYR A N      1 
ATOM   1868  C  CA     . TYR A 1 115 ? -11.161 51.041  38.743  1.00 44.43  ? 115 TYR A CA     1 
ATOM   1869  C  C      . TYR A 1 115 ? -10.810 51.126  40.225  1.00 48.94  ? 115 TYR A C      1 
ATOM   1870  O  O      . TYR A 1 115 ? -9.778  50.613  40.660  1.00 37.62  ? 115 TYR A O      1 
ATOM   1871  C  CB     . TYR A 1 115 ? -11.668 49.641  38.411  1.00 35.75  ? 115 TYR A CB     1 
ATOM   1872  C  CG     . TYR A 1 115 ? -12.313 49.537  37.051  1.00 40.35  ? 115 TYR A CG     1 
ATOM   1873  C  CD1    . TYR A 1 115 ? -13.550 50.111  36.804  1.00 51.42  ? 115 TYR A CD1    1 
ATOM   1874  C  CD2    . TYR A 1 115 ? -11.685 48.866  36.013  1.00 46.93  ? 115 TYR A CD2    1 
ATOM   1875  C  CE1    . TYR A 1 115 ? -14.147 50.017  35.564  1.00 48.92  ? 115 TYR A CE1    1 
ATOM   1876  C  CE2    . TYR A 1 115 ? -12.274 48.765  34.769  1.00 45.43  ? 115 TYR A CE2    1 
ATOM   1877  C  CZ     . TYR A 1 115 ? -13.504 49.343  34.549  1.00 40.40  ? 115 TYR A CZ     1 
ATOM   1878  O  OH     . TYR A 1 115 ? -14.095 49.248  33.310  1.00 46.17  ? 115 TYR A OH     1 
ATOM   1879  H  H      . TYR A 1 115 ? -9.531  50.689  37.697  1.00 53.07  ? 115 TYR A H      1 
ATOM   1880  H  HA     . TYR A 1 115 ? -11.878 51.669  38.568  1.00 53.31  ? 115 TYR A HA     1 
ATOM   1881  H  HB2    . TYR A 1 115 ? -10.920 49.023  38.433  1.00 42.90  ? 115 TYR A HB2    1 
ATOM   1882  H  HB3    . TYR A 1 115 ? -12.328 49.382  39.074  1.00 42.90  ? 115 TYR A HB3    1 
ATOM   1883  H  HD1    . TYR A 1 115 ? -13.988 50.565  37.488  1.00 61.70  ? 115 TYR A HD1    1 
ATOM   1884  H  HD2    . TYR A 1 115 ? -10.855 48.473  36.159  1.00 56.31  ? 115 TYR A HD2    1 
ATOM   1885  H  HE1    . TYR A 1 115 ? -14.977 50.407  35.413  1.00 58.70  ? 115 TYR A HE1    1 
ATOM   1886  H  HE2    . TYR A 1 115 ? -11.841 48.311  34.082  1.00 54.52  ? 115 TYR A HE2    1 
ATOM   1887  H  HH     . TYR A 1 115 ? -14.837 49.642  33.315  1.00 55.40  ? 115 TYR A HH     1 
ATOM   1888  N  N      . LYS A 1 116 ? -11.680 51.768  41.000  1.00 44.67  ? 116 LYS A N      1 
ATOM   1889  C  CA     . LYS A 1 116 ? -11.499 51.818  42.443  1.00 48.35  ? 116 LYS A CA     1 
ATOM   1890  C  C      . LYS A 1 116 ? -11.889 50.482  43.039  1.00 49.42  ? 116 LYS A C      1 
ATOM   1891  O  O      . LYS A 1 116 ? -13.043 50.269  43.410  1.00 44.33  ? 116 LYS A O      1 
ATOM   1892  C  CB     . LYS A 1 116 ? -12.333 52.929  43.079  1.00 32.82  ? 116 LYS A CB     1 
ATOM   1893  C  CG     . LYS A 1 116 ? -11.986 53.153  44.538  1.00 34.92  ? 116 LYS A CG     1 
ATOM   1894  C  CD     . LYS A 1 116 ? -12.843 54.220  45.180  1.00 51.34  ? 116 LYS A CD     1 
ATOM   1895  C  CE     . LYS A 1 116 ? -12.558 54.305  46.670  1.00 53.30  ? 116 LYS A CE     1 
ATOM   1896  N  NZ     . LYS A 1 116 ? -13.416 55.304  47.358  1.00 48.74  ? 116 LYS A NZ     1 
ATOM   1897  H  H      . LYS A 1 116 ? -12.379 52.179  40.714  1.00 53.60  ? 116 LYS A H      1 
ATOM   1898  H  HA     . LYS A 1 116 ? -10.565 51.982  42.645  1.00 58.02  ? 116 LYS A HA     1 
ATOM   1899  H  HB2    . LYS A 1 116 ? -12.173 53.758  42.601  1.00 39.39  ? 116 LYS A HB2    1 
ATOM   1900  H  HB3    . LYS A 1 116 ? -13.271 52.690  43.026  1.00 39.39  ? 116 LYS A HB3    1 
ATOM   1901  H  HG2    . LYS A 1 116 ? -12.119 52.326  45.026  1.00 41.90  ? 116 LYS A HG2    1 
ATOM   1902  H  HG3    . LYS A 1 116 ? -11.059 53.433  44.603  1.00 41.90  ? 116 LYS A HG3    1 
ATOM   1903  H  HD2    . LYS A 1 116 ? -12.644 55.080  44.779  1.00 61.61  ? 116 LYS A HD2    1 
ATOM   1904  H  HD3    . LYS A 1 116 ? -13.780 53.998  45.059  1.00 61.61  ? 116 LYS A HD3    1 
ATOM   1905  H  HE2    . LYS A 1 116 ? -12.722 53.438  47.074  1.00 63.95  ? 116 LYS A HE2    1 
ATOM   1906  H  HE3    . LYS A 1 116 ? -11.632 54.563  46.800  1.00 63.95  ? 116 LYS A HE3    1 
ATOM   1907  H  HZ1    . LYS A 1 116 ? -13.221 55.326  48.226  1.00 58.49  ? 116 LYS A HZ1    1 
ATOM   1908  H  HZ2    . LYS A 1 116 ? -13.280 56.112  47.010  1.00 58.49  ? 116 LYS A HZ2    1 
ATOM   1909  H  HZ3    . LYS A 1 116 ? -14.273 55.087  47.259  1.00 58.49  ? 116 LYS A HZ3    1 
ATOM   1910  N  N      . LEU A 1 117 ? -10.918 49.583  43.131  1.00 50.22  ? 117 LEU A N      1 
ATOM   1911  C  CA     . LEU A 1 117 ? -11.167 48.260  43.670  1.00 51.24  ? 117 LEU A CA     1 
ATOM   1912  C  C      . LEU A 1 117 ? -10.891 48.218  45.161  1.00 61.85  ? 117 LEU A C      1 
ATOM   1913  O  O      . LEU A 1 117 ? -10.115 49.013  45.691  1.00 49.66  ? 117 LEU A O      1 
ATOM   1914  C  CB     . LEU A 1 117 ? -10.300 47.216  42.964  1.00 60.20  ? 117 LEU A CB     1 
ATOM   1915  C  CG     . LEU A 1 117 ? -10.392 47.169  41.440  1.00 48.92  ? 117 LEU A CG     1 
ATOM   1916  C  CD1    . LEU A 1 117 ? -9.407  46.153  40.895  1.00 39.38  ? 117 LEU A CD1    1 
ATOM   1917  C  CD2    . LEU A 1 117 ? -11.803 46.850  40.983  1.00 48.89  ? 117 LEU A CD2    1 
ATOM   1918  H  H      . LEU A 1 117 ? -10.105 49.718  42.887  1.00 60.27  ? 117 LEU A H      1 
ATOM   1919  H  HA     . LEU A 1 117 ? -12.098 48.027  43.527  1.00 61.48  ? 117 LEU A HA     1 
ATOM   1920  H  HB2    . LEU A 1 117 ? -9.373  47.388  43.190  1.00 72.24  ? 117 LEU A HB2    1 
ATOM   1921  H  HB3    . LEU A 1 117 ? -10.553 46.339  43.294  1.00 72.24  ? 117 LEU A HB3    1 
ATOM   1922  H  HG     . LEU A 1 117 ? -10.152 48.038  41.083  1.00 58.71  ? 117 LEU A HG     1 
ATOM   1923  H  HD11   . LEU A 1 117 ? -9.476  46.134  39.928  1.00 47.25  ? 117 LEU A HD11   1 
ATOM   1924  H  HD12   . LEU A 1 117 ? -8.510  46.412  41.158  1.00 47.25  ? 117 LEU A HD12   1 
ATOM   1925  H  HD13   . LEU A 1 117 ? -9.620  45.280  41.260  1.00 47.25  ? 117 LEU A HD13   1 
ATOM   1926  H  HD21   . LEU A 1 117 ? -11.824 46.828  40.013  1.00 58.67  ? 117 LEU A HD21   1 
ATOM   1927  H  HD22   . LEU A 1 117 ? -12.062 45.985  41.339  1.00 58.67  ? 117 LEU A HD22   1 
ATOM   1928  H  HD23   . LEU A 1 117 ? -12.404 47.537  41.312  1.00 58.67  ? 117 LEU A HD23   1 
ATOM   1929  N  N      . LYS A 1 118 ? -11.567 47.291  45.827  1.00 71.44  ? 118 LYS A N      1 
ATOM   1930  C  CA     . LYS A 1 118 ? -11.209 46.868  47.170  1.00 60.34  ? 118 LYS A CA     1 
ATOM   1931  C  C      . LYS A 1 118 ? -10.672 45.450  47.022  1.00 76.57  ? 118 LYS A C      1 
ATOM   1932  O  O      . LYS A 1 118 ? -11.373 44.575  46.513  1.00 93.70  ? 118 LYS A O      1 
ATOM   1933  C  CB     . LYS A 1 118 ? -12.407 46.942  48.126  1.00 56.44  ? 118 LYS A CB     1 
ATOM   1934  C  CG     . LYS A 1 118 ? -13.747 46.531  47.517  1.00 79.66  ? 118 LYS A CG     1 
ATOM   1935  C  CD     . LYS A 1 118 ? -14.916 46.905  48.423  1.00 87.47  ? 118 LYS A CD     1 
ATOM   1936  C  CE     . LYS A 1 118 ? -16.257 46.561  47.780  1.00 80.53  ? 118 LYS A CE     1 
ATOM   1937  N  NZ     . LYS A 1 118 ? -16.451 47.229  46.456  1.00 57.67  ? 118 LYS A NZ     1 
ATOM   1938  H  H      . LYS A 1 118 ? -12.255 46.884  45.513  1.00 85.73  ? 118 LYS A H      1 
ATOM   1939  H  HA     . LYS A 1 118 ? -10.500 47.434  47.515  1.00 72.40  ? 118 LYS A HA     1 
ATOM   1940  H  HB2    . LYS A 1 118 ? -12.237 46.357  48.880  1.00 67.73  ? 118 LYS A HB2    1 
ATOM   1941  H  HB3    . LYS A 1 118 ? -12.496 47.856  48.438  1.00 67.73  ? 118 LYS A HB3    1 
ATOM   1942  H  HG2    . LYS A 1 118 ? -13.865 46.985  46.667  1.00 95.59  ? 118 LYS A HG2    1 
ATOM   1943  H  HG3    . LYS A 1 118 ? -13.758 45.570  47.388  1.00 95.59  ? 118 LYS A HG3    1 
ATOM   1944  H  HD2    . LYS A 1 118 ? -14.844 46.414  49.256  1.00 104.96 ? 118 LYS A HD2    1 
ATOM   1945  H  HD3    . LYS A 1 118 ? -14.897 47.859  48.593  1.00 104.96 ? 118 LYS A HD3    1 
ATOM   1946  H  HE2    . LYS A 1 118 ? -16.305 45.602  47.642  1.00 96.63  ? 118 LYS A HE2    1 
ATOM   1947  H  HE3    . LYS A 1 118 ? -16.972 46.848  48.368  1.00 96.63  ? 118 LYS A HE3    1 
ATOM   1948  H  HZ1    . LYS A 1 118 ? -17.242 47.004  46.115  1.00 69.21  ? 118 LYS A HZ1    1 
ATOM   1949  H  HZ2    . LYS A 1 118 ? -16.420 48.113  46.554  1.00 69.21  ? 118 LYS A HZ2    1 
ATOM   1950  H  HZ3    . LYS A 1 118 ? -15.811 46.978  45.892  1.00 69.21  ? 118 LYS A HZ3    1 
ATOM   1951  N  N      . GLU A 1 119 ? -9.429  45.242  47.451  1.00 69.14  ? 119 GLU A N      1 
ATOM   1952  C  CA     . GLU A 1 119 ? -8.674  44.014  47.173  1.00 81.86  ? 119 GLU A CA     1 
ATOM   1953  C  C      . GLU A 1 119 ? -8.472  43.818  45.666  1.00 62.59  ? 119 GLU A C      1 
ATOM   1954  O  O      . GLU A 1 119 ? -9.437  43.644  44.922  1.00 53.27  ? 119 GLU A O      1 
ATOM   1955  C  CB     . GLU A 1 119 ? -9.355  42.777  47.768  1.00 89.97  ? 119 GLU A CB     1 
ATOM   1956  C  CG     . GLU A 1 119 ? -9.058  42.567  49.244  1.00 98.35  ? 119 GLU A CG     1 
ATOM   1957  C  CD     . GLU A 1 119 ? -9.292  41.138  49.694  1.00 117.96 ? 119 GLU A CD     1 
ATOM   1958  O  OE1    . GLU A 1 119 ? -9.670  40.295  48.852  1.00 104.71 ? 119 GLU A OE1    1 
ATOM   1959  O  OE2    . GLU A 1 119 ? -9.090  40.856  50.895  1.00 114.09 ? 119 GLU A OE2    1 
ATOM   1960  H  H      . GLU A 1 119 ? -8.987  45.813  47.918  1.00 82.96  ? 119 GLU A H      1 
ATOM   1961  H  HA     . GLU A 1 119 ? -7.797  44.091  47.580  1.00 98.24  ? 119 GLU A HA     1 
ATOM   1962  H  HB2    . GLU A 1 119 ? -10.315 42.870  47.668  1.00 107.97 ? 119 GLU A HB2    1 
ATOM   1963  H  HB3    . GLU A 1 119 ? -9.049  41.991  47.289  1.00 107.97 ? 119 GLU A HB3    1 
ATOM   1964  H  HG2    . GLU A 1 119 ? -8.129  42.787  49.414  1.00 118.02 ? 119 GLU A HG2    1 
ATOM   1965  H  HG3    . GLU A 1 119 ? -9.636  43.144  49.768  1.00 118.02 ? 119 GLU A HG3    1 
ATOM   1966  N  N      . PRO A 1 120 ? -7.208  43.834  45.211  1.00 60.00  ? 120 PRO A N      1 
ATOM   1967  C  CA     . PRO A 1 120 ? -6.898  43.664  43.792  1.00 59.71  ? 120 PRO A CA     1 
ATOM   1968  C  C      . PRO A 1 120 ? -6.586  42.221  43.418  1.00 73.18  ? 120 PRO A C      1 
ATOM   1969  O  O      . PRO A 1 120 ? -5.470  41.922  42.994  1.00 74.77  ? 120 PRO A O      1 
ATOM   1970  C  CB     . PRO A 1 120 ? -5.664  44.541  43.624  1.00 56.94  ? 120 PRO A CB     1 
ATOM   1971  C  CG     . PRO A 1 120 ? -4.938  44.334  44.904  1.00 45.56  ? 120 PRO A CG     1 
ATOM   1972  C  CD     . PRO A 1 120 ? -5.982  44.121  45.978  1.00 62.23  ? 120 PRO A CD     1 
ATOM   1973  H  HA     . PRO A 1 120 ? -7.619  44.001  43.238  1.00 71.65  ? 120 PRO A HA     1 
ATOM   1974  H  HB2    . PRO A 1 120 ? -5.138  44.234  42.869  1.00 68.33  ? 120 PRO A HB2    1 
ATOM   1975  H  HB3    . PRO A 1 120 ? -5.926  45.468  43.516  1.00 68.33  ? 120 PRO A HB3    1 
ATOM   1976  H  HG2    . PRO A 1 120 ? -4.369  43.552  44.828  1.00 54.67  ? 120 PRO A HG2    1 
ATOM   1977  H  HG3    . PRO A 1 120 ? -4.407  45.120  45.103  1.00 54.67  ? 120 PRO A HG3    1 
ATOM   1978  H  HD2    . PRO A 1 120 ? -5.745  43.362  46.533  1.00 74.68  ? 120 PRO A HD2    1 
ATOM   1979  H  HD3    . PRO A 1 120 ? -6.094  44.927  46.505  1.00 74.68  ? 120 PRO A HD3    1 
ATOM   1980  N  N      . LYS A 1 121 ? -7.556  41.332  43.587  1.00 82.37  ? 121 LYS A N      1 
ATOM   1981  C  CA     . LYS A 1 121 ? -7.352  39.929  43.261  1.00 86.44  ? 121 LYS A CA     1 
ATOM   1982  C  C      . LYS A 1 121 ? -7.627  39.675  41.783  1.00 93.83  ? 121 LYS A C      1 
ATOM   1983  O  O      . LYS A 1 121 ? -6.717  39.319  41.031  1.00 89.45  ? 121 LYS A O      1 
ATOM   1984  C  CB     . LYS A 1 121 ? -8.229  39.040  44.144  1.00 90.80  ? 121 LYS A CB     1 
ATOM   1985  C  CG     . LYS A 1 121 ? -7.773  38.987  45.600  1.00 94.58  ? 121 LYS A CG     1 
ATOM   1986  C  CD     . LYS A 1 121 ? -6.362  38.412  45.708  1.00 84.18  ? 121 LYS A CD     1 
ATOM   1987  C  CE     . LYS A 1 121 ? -5.971  38.109  47.141  1.00 87.93  ? 121 LYS A CE     1 
ATOM   1988  N  NZ     . LYS A 1 121 ? -4.630  37.462  47.202  1.00 84.57  ? 121 LYS A NZ     1 
ATOM   1989  H  H      . LYS A 1 121 ? -8.341  41.516  43.888  1.00 98.85  ? 121 LYS A H      1 
ATOM   1990  H  HA     . LYS A 1 121 ? -6.426  39.699  43.435  1.00 103.73 ? 121 LYS A HA     1 
ATOM   1991  H  HB2    . LYS A 1 121 ? -9.137  39.382  44.129  1.00 108.96 ? 121 LYS A HB2    1 
ATOM   1992  H  HB3    . LYS A 1 121 ? -8.212  38.136  43.794  1.00 108.96 ? 121 LYS A HB3    1 
ATOM   1993  H  HG2    . LYS A 1 121 ? -7.766  39.885  45.968  1.00 113.50 ? 121 LYS A HG2    1 
ATOM   1994  H  HG3    . LYS A 1 121 ? -8.375  38.419  46.105  1.00 113.50 ? 121 LYS A HG3    1 
ATOM   1995  H  HD2    . LYS A 1 121 ? -6.317  37.585  45.202  1.00 101.01 ? 121 LYS A HD2    1 
ATOM   1996  H  HD3    . LYS A 1 121 ? -5.729  39.055  45.352  1.00 101.01 ? 121 LYS A HD3    1 
ATOM   1997  H  HE2    . LYS A 1 121 ? -5.934  38.936  47.646  1.00 105.52 ? 121 LYS A HE2    1 
ATOM   1998  H  HE3    . LYS A 1 121 ? -6.620  37.503  47.530  1.00 105.52 ? 121 LYS A HE3    1 
ATOM   1999  H  HZ1    . LYS A 1 121 ? -4.414  37.290  48.048  1.00 101.48 ? 121 LYS A HZ1    1 
ATOM   2000  H  HZ2    . LYS A 1 121 ? -4.640  36.698  46.745  1.00 101.48 ? 121 LYS A HZ2    1 
ATOM   2001  H  HZ3    . LYS A 1 121 ? -4.016  38.001  46.850  1.00 101.48 ? 121 LYS A HZ3    1 
ATOM   2002  N  N      . ASN A 1 122 ? -8.878  39.852  41.373  1.00 82.98  ? 122 ASN A N      1 
ATOM   2003  C  CA     . ASN A 1 122 ? -9.253  39.702  39.972  1.00 74.25  ? 122 ASN A CA     1 
ATOM   2004  C  C      . ASN A 1 122 ? -9.477  41.058  39.315  1.00 69.82  ? 122 ASN A C      1 
ATOM   2005  O  O      . ASN A 1 122 ? -10.609 41.443  39.023  1.00 72.91  ? 122 ASN A O      1 
ATOM   2006  C  CB     . ASN A 1 122 ? -10.505 38.833  39.853  1.00 92.81  ? 122 ASN A CB     1 
ATOM   2007  C  CG     . ASN A 1 122 ? -10.238 37.382  40.210  1.00 101.54 ? 122 ASN A CG     1 
ATOM   2008  O  OD1    . ASN A 1 122 ? -9.149  36.862  39.965  1.00 101.92 ? 122 ASN A OD1    1 
ATOM   2009  N  ND2    . ASN A 1 122 ? -11.229 36.724  40.801  1.00 88.02  ? 122 ASN A ND2    1 
ATOM   2010  H  H      . ASN A 1 122 ? -9.532  40.062  41.890  1.00 99.57  ? 122 ASN A H      1 
ATOM   2011  H  HA     . ASN A 1 122 ? -8.533  39.256  39.499  1.00 89.10  ? 122 ASN A HA     1 
ATOM   2012  H  HB2    . ASN A 1 122 ? -11.185 39.171  40.457  1.00 111.37 ? 122 ASN A HB2    1 
ATOM   2013  H  HB3    . ASN A 1 122 ? -10.827 38.864  38.938  1.00 111.37 ? 122 ASN A HB3    1 
ATOM   2014  H  HD21   . ASN A 1 122 ? -11.125 35.899  41.023  1.00 105.62 ? 122 ASN A HD21   1 
ATOM   2015  H  HD22   . ASN A 1 122 ? -11.974 37.122  40.963  1.00 105.62 ? 122 ASN A HD22   1 
ATOM   2016  N  N      . ILE A 1 123 ? -8.378  41.778  39.106  1.00 77.35  ? 123 ILE A N      1 
ATOM   2017  C  CA     . ILE A 1 123 ? -8.394  43.101  38.483  1.00 62.69  ? 123 ILE A CA     1 
ATOM   2018  C  C      . ILE A 1 123 ? -9.224  43.144  37.203  1.00 41.12  ? 123 ILE A C      1 
ATOM   2019  O  O      . ILE A 1 123 ? -9.357  42.142  36.506  1.00 50.93  ? 123 ILE A O      1 
ATOM   2020  C  CB     . ILE A 1 123 ? -6.955  43.589  38.166  1.00 48.70  ? 123 ILE A CB     1 
ATOM   2021  C  CG1    . ILE A 1 123 ? -6.110  42.499  37.488  1.00 49.23  ? 123 ILE A CG1    1 
ATOM   2022  C  CG2    . ILE A 1 123 ? -6.263  44.033  39.444  1.00 45.84  ? 123 ILE A CG2    1 
ATOM   2023  C  CD1    . ILE A 1 123 ? -6.182  42.485  35.985  1.00 56.16  ? 123 ILE A CD1    1 
ATOM   2024  H  H      . ILE A 1 123 ? -7.589  41.514  39.323  1.00 92.82  ? 123 ILE A H      1 
ATOM   2025  H  HA     . ILE A 1 123 ? -8.787  43.731  39.107  1.00 75.23  ? 123 ILE A HA     1 
ATOM   2026  H  HB     . ILE A 1 123 ? -7.013  44.350  37.567  1.00 58.44  ? 123 ILE A HB     1 
ATOM   2027  H  HG12   . ILE A 1 123 ? -5.181  42.630  37.735  1.00 59.08  ? 123 ILE A HG12   1 
ATOM   2028  H  HG13   . ILE A 1 123 ? -6.412  41.633  37.804  1.00 59.08  ? 123 ILE A HG13   1 
ATOM   2029  H  HG21   . ILE A 1 123 ? -5.367  44.335  39.229  1.00 55.01  ? 123 ILE A HG21   1 
ATOM   2030  H  HG22   . ILE A 1 123 ? -6.770  44.759  39.841  1.00 55.01  ? 123 ILE A HG22   1 
ATOM   2031  H  HG23   . ILE A 1 123 ? -6.222  43.283  40.057  1.00 55.01  ? 123 ILE A HG23   1 
ATOM   2032  H  HD11   . ILE A 1 123 ? -5.621  41.768  35.650  1.00 67.40  ? 123 ILE A HD11   1 
ATOM   2033  H  HD12   . ILE A 1 123 ? -7.102  42.339  35.715  1.00 67.40  ? 123 ILE A HD12   1 
ATOM   2034  H  HD13   . ILE A 1 123 ? -5.868  43.338  35.646  1.00 67.40  ? 123 ILE A HD13   1 
ATOM   2035  N  N      . LYS A 1 124 ? -9.793  44.314  36.921  1.00 41.90  ? 124 LYS A N      1 
ATOM   2036  C  CA     . LYS A 1 124 ? -10.684 44.507  35.777  1.00 42.20  ? 124 LYS A CA     1 
ATOM   2037  C  C      . LYS A 1 124 ? -9.958  45.202  34.624  1.00 41.79  ? 124 LYS A C      1 
ATOM   2038  O  O      . LYS A 1 124 ? -10.187 44.889  33.454  1.00 52.03  ? 124 LYS A O      1 
ATOM   2039  C  CB     . LYS A 1 124 ? -11.911 45.313  36.202  1.00 39.39  ? 124 LYS A CB     1 
ATOM   2040  C  CG     . LYS A 1 124 ? -12.998 45.401  35.147  1.00 45.40  ? 124 LYS A CG     1 
ATOM   2041  C  CD     . LYS A 1 124 ? -14.250 46.071  35.697  1.00 39.78  ? 124 LYS A CD     1 
ATOM   2042  C  CE     . LYS A 1 124 ? -15.370 46.099  34.669  1.00 40.36  ? 124 LYS A CE     1 
ATOM   2043  N  NZ     . LYS A 1 124 ? -16.598 46.763  35.184  1.00 40.61  ? 124 LYS A NZ     1 
ATOM   2044  H  H      . LYS A 1 124 ? -9.676  45.027  37.387  1.00 50.28  ? 124 LYS A H      1 
ATOM   2045  H  HA     . LYS A 1 124 ? -10.988 43.641  35.463  1.00 50.64  ? 124 LYS A HA     1 
ATOM   2046  H  HB2    . LYS A 1 124 ? -12.297 44.900  36.989  1.00 47.27  ? 124 LYS A HB2    1 
ATOM   2047  H  HB3    . LYS A 1 124 ? -11.631 46.218  36.411  1.00 47.27  ? 124 LYS A HB3    1 
ATOM   2048  H  HG2    . LYS A 1 124 ? -12.676 45.925  34.397  1.00 54.48  ? 124 LYS A HG2    1 
ATOM   2049  H  HG3    . LYS A 1 124 ? -13.234 44.507  34.855  1.00 54.48  ? 124 LYS A HG3    1 
ATOM   2050  H  HD2    . LYS A 1 124 ? -14.561 45.579  36.472  1.00 47.74  ? 124 LYS A HD2    1 
ATOM   2051  H  HD3    . LYS A 1 124 ? -14.041 46.986  35.942  1.00 47.74  ? 124 LYS A HD3    1 
ATOM   2052  H  HE2    . LYS A 1 124 ? -15.070 46.586  33.886  1.00 48.43  ? 124 LYS A HE2    1 
ATOM   2053  H  HE3    . LYS A 1 124 ? -15.600 45.188  34.426  1.00 48.43  ? 124 LYS A HE3    1 
ATOM   2054  H  HZ1    . LYS A 1 124 ? -16.900 46.331  35.901  1.00 48.73  ? 124 LYS A HZ1    1 
ATOM   2055  H  HZ2    . LYS A 1 124 ? -16.417 47.605  35.408  1.00 48.73  ? 124 LYS A HZ2    1 
ATOM   2056  H  HZ3    . LYS A 1 124 ? -17.230 46.761  34.557  1.00 48.73  ? 124 LYS A HZ3    1 
ATOM   2057  N  N      . SER A 1 125 ? -9.106  46.164  34.971  1.00 46.68  ? 125 SER A N      1 
ATOM   2058  C  CA     . SER A 1 125 ? -8.191  46.794  34.020  1.00 45.91  ? 125 SER A CA     1 
ATOM   2059  C  C      . SER A 1 125 ? -6.787  46.271  34.275  1.00 47.62  ? 125 SER A C      1 
ATOM   2060  O  O      . SER A 1 125 ? -6.545  45.588  35.267  1.00 56.45  ? 125 SER A O      1 
ATOM   2061  C  CB     . SER A 1 125 ? -8.215  48.319  34.147  1.00 46.83  ? 125 SER A CB     1 
ATOM   2062  O  OG     . SER A 1 125 ? -9.207  48.888  33.315  1.00 67.60  ? 125 SER A OG     1 
ATOM   2063  H  H      . SER A 1 125 ? -9.037  46.476  35.769  1.00 56.01  ? 125 SER A H      1 
ATOM   2064  H  HA     . SER A 1 125 ? -8.450  46.556  33.116  1.00 55.09  ? 125 SER A HA     1 
ATOM   2065  H  HB2    . SER A 1 125 ? -8.405  48.555  35.069  1.00 56.20  ? 125 SER A HB2    1 
ATOM   2066  H  HB3    . SER A 1 125 ? -7.348  48.669  33.888  1.00 56.20  ? 125 SER A HB3    1 
ATOM   2067  H  HG     . SER A 1 125 ? -9.965  48.594  33.528  1.00 81.12  ? 125 SER A HG     1 
ATOM   2068  N  N      . ALA A 1 126 ? -5.856  46.608  33.391  1.00 49.11  ? 126 ALA A N      1 
ATOM   2069  C  CA     . ALA A 1 126 ? -4.487  46.122  33.508  1.00 42.19  ? 126 ALA A CA     1 
ATOM   2070  C  C      . ALA A 1 126 ? -3.712  46.867  34.589  1.00 46.09  ? 126 ALA A C      1 
ATOM   2071  O  O      . ALA A 1 126 ? -2.746  46.342  35.143  1.00 60.59  ? 126 ALA A O      1 
ATOM   2072  C  CB     . ALA A 1 126 ? -3.774  46.248  32.177  1.00 49.79  ? 126 ALA A CB     1 
ATOM   2073  H  H      . ALA A 1 126 ? -5.992  47.119  32.713  1.00 58.94  ? 126 ALA A H      1 
ATOM   2074  H  HA     . ALA A 1 126 ? -4.507  45.182  33.749  1.00 50.63  ? 126 ALA A HA     1 
ATOM   2075  H  HB1    . ALA A 1 126 ? -2.867  45.920  32.273  1.00 59.74  ? 126 ALA A HB1    1 
ATOM   2076  H  HB2    . ALA A 1 126 ? -4.248  45.721  31.515  1.00 59.74  ? 126 ALA A HB2    1 
ATOM   2077  H  HB3    . ALA A 1 126 ? -3.764  47.181  31.913  1.00 59.74  ? 126 ALA A HB3    1 
ATOM   2078  N  N      . VAL A 1 127 ? -4.151  48.083  34.895  1.00 37.57  ? 127 VAL A N      1 
ATOM   2079  C  CA     . VAL A 1 127 ? -3.394  48.978  35.759  1.00 30.61  ? 127 VAL A CA     1 
ATOM   2080  C  C      . VAL A 1 127 ? -3.986  49.098  37.159  1.00 37.07  ? 127 VAL A C      1 
ATOM   2081  O  O      . VAL A 1 127 ? -3.572  49.948  37.943  1.00 45.10  ? 127 VAL A O      1 
ATOM   2082  C  CB     . VAL A 1 127 ? -3.319  50.380  35.137  1.00 30.82  ? 127 VAL A CB     1 
ATOM   2083  C  CG1    . VAL A 1 127 ? -2.745  50.298  33.740  1.00 42.96  ? 127 VAL A CG1    1 
ATOM   2084  C  CG2    . VAL A 1 127 ? -4.697  51.017  35.079  1.00 36.37  ? 127 VAL A CG2    1 
ATOM   2085  H  H      . VAL A 1 127 ? -4.892  48.416  34.611  1.00 45.08  ? 127 VAL A H      1 
ATOM   2086  H  HA     . VAL A 1 127 ? -2.489  48.640  35.845  1.00 36.73  ? 127 VAL A HA     1 
ATOM   2087  H  HB     . VAL A 1 127 ? -2.741  50.943  35.675  1.00 36.99  ? 127 VAL A HB     1 
ATOM   2088  H  HG11   . VAL A 1 127 ? -2.705  51.190  33.362  1.00 51.56  ? 127 VAL A HG11   1 
ATOM   2089  H  HG12   . VAL A 1 127 ? -1.854  49.918  33.787  1.00 51.56  ? 127 VAL A HG12   1 
ATOM   2090  H  HG13   . VAL A 1 127 ? -3.318  49.734  33.196  1.00 51.56  ? 127 VAL A HG13   1 
ATOM   2091  H  HG21   . VAL A 1 127 ? -4.621  51.899  34.683  1.00 43.64  ? 127 VAL A HG21   1 
ATOM   2092  H  HG22   . VAL A 1 127 ? -5.279  50.460  34.538  1.00 43.64  ? 127 VAL A HG22   1 
ATOM   2093  H  HG23   . VAL A 1 127 ? -5.050  51.087  35.980  1.00 43.64  ? 127 VAL A HG23   1 
ATOM   2094  N  N      . ASP A 1 128 ? -4.945  48.241  37.479  1.00 34.66  ? 128 ASP A N      1 
ATOM   2095  C  CA     . ASP A 1 128 ? -5.643  48.341  38.754  1.00 35.93  ? 128 ASP A CA     1 
ATOM   2096  C  C      . ASP A 1 128 ? -4.779  47.951  39.944  1.00 40.10  ? 128 ASP A C      1 
ATOM   2097  O  O      . ASP A 1 128 ? -5.194  48.114  41.090  1.00 42.79  ? 128 ASP A O      1 
ATOM   2098  C  CB     . ASP A 1 128 ? -6.893  47.468  38.741  1.00 34.24  ? 128 ASP A CB     1 
ATOM   2099  C  CG     . ASP A 1 128 ? -7.969  48.013  37.837  1.00 37.08  ? 128 ASP A CG     1 
ATOM   2100  O  OD1    . ASP A 1 128 ? -7.840  49.169  37.388  1.00 44.59  ? 128 ASP A OD1    1 
ATOM   2101  O  OD2    . ASP A 1 128 ? -8.956  47.293  37.590  1.00 48.28  ? 128 ASP A OD2    1 
ATOM   2102  H  H      . ASP A 1 128 ? -5.211  47.594  36.979  1.00 41.59  ? 128 ASP A H      1 
ATOM   2103  H  HA     . ASP A 1 128 ? -5.925  49.260  38.883  1.00 43.12  ? 128 ASP A HA     1 
ATOM   2104  H  HB2    . ASP A 1 128 ? -6.657  46.581  38.428  1.00 41.09  ? 128 ASP A HB2    1 
ATOM   2105  H  HB3    . ASP A 1 128 ? -7.253  47.418  39.641  1.00 41.09  ? 128 ASP A HB3    1 
ATOM   2106  N  N      . ARG A 1 129 ? -3.595  47.416  39.679  1.00 42.90  ? 129 ARG A N      1 
ATOM   2107  C  CA     . ARG A 1 129 ? -2.684  47.044  40.752  1.00 36.24  ? 129 ARG A CA     1 
ATOM   2108  C  C      . ARG A 1 129 ? -1.841  48.221  41.224  1.00 29.84  ? 129 ARG A C      1 
ATOM   2109  O  O      . ARG A 1 129 ? -1.272  48.185  42.311  1.00 43.42  ? 129 ARG A O      1 
ATOM   2110  C  CB     . ARG A 1 129 ? -1.758  45.914  40.303  1.00 39.56  ? 129 ARG A CB     1 
ATOM   2111  C  CG     . ARG A 1 129 ? -2.458  44.616  39.959  1.00 42.24  ? 129 ARG A CG     1 
ATOM   2112  C  CD     . ARG A 1 129 ? -1.464  43.470  39.935  1.00 39.85  ? 129 ARG A CD     1 
ATOM   2113  N  NE     . ARG A 1 129 ? -1.994  42.275  39.284  1.00 48.23  ? 129 ARG A NE     1 
ATOM   2114  C  CZ     . ARG A 1 129 ? -1.921  42.033  37.978  1.00 32.26  ? 129 ARG A CZ     1 
ATOM   2115  N  NH1    . ARG A 1 129 ? -1.342  42.904  37.163  1.00 28.45  ? 129 ARG A NH1    1 
ATOM   2116  N  NH2    . ARG A 1 129 ? -2.430  40.914  37.484  1.00 34.07  ? 129 ARG A NH2    1 
ATOM   2117  H  H      . ARG A 1 129 ? -3.295  47.258  38.889  1.00 51.48  ? 129 ARG A H      1 
ATOM   2118  H  HA     . ARG A 1 129 ? -3.201  46.724  41.507  1.00 43.49  ? 129 ARG A HA     1 
ATOM   2119  H  HB2    . ARG A 1 129 ? -1.275  46.205  39.514  1.00 47.48  ? 129 ARG A HB2    1 
ATOM   2120  H  HB3    . ARG A 1 129 ? -1.130  45.727  41.018  1.00 47.48  ? 129 ARG A HB3    1 
ATOM   2121  H  HG2    . ARG A 1 129 ? -3.133  44.425  40.629  1.00 50.69  ? 129 ARG A HG2    1 
ATOM   2122  H  HG3    . ARG A 1 129 ? -2.863  44.690  39.080  1.00 50.69  ? 129 ARG A HG3    1 
ATOM   2123  H  HD2    . ARG A 1 129 ? -0.671  43.750  39.450  1.00 47.82  ? 129 ARG A HD2    1 
ATOM   2124  H  HD3    . ARG A 1 129 ? -1.230  43.236  40.847  1.00 47.82  ? 129 ARG A HD3    1 
ATOM   2125  H  HE     . ARG A 1 129 ? -2.380  41.688  39.779  1.00 57.87  ? 129 ARG A HE     1 
ATOM   2126  H  HH11   . ARG A 1 129 ? -1.009  43.632  37.477  1.00 34.14  ? 129 ARG A HH11   1 
ATOM   2127  H  HH12   . ARG A 1 129 ? -1.299  42.741  36.319  1.00 34.14  ? 129 ARG A HH12   1 
ATOM   2128  H  HH21   . ARG A 1 129 ? -2.807  40.346  38.007  1.00 40.88  ? 129 ARG A HH21   1 
ATOM   2129  H  HH22   . ARG A 1 129 ? -2.385  40.758  36.639  1.00 40.88  ? 129 ARG A HH22   1 
ATOM   2130  N  N      . THR A 1 130 ? -1.774  49.272  40.416  1.00 29.62  ? 130 THR A N      1 
ATOM   2131  C  CA     . THR A 1 130 ? -0.800  50.335  40.640  1.00 38.34  ? 130 THR A CA     1 
ATOM   2132  C  C      . THR A 1 130 ? -1.064  51.170  41.896  1.00 41.61  ? 130 THR A C      1 
ATOM   2133  O  O      . THR A 1 130 ? -0.116  51.586  42.564  1.00 41.17  ? 130 THR A O      1 
ATOM   2134  C  CB     . THR A 1 130 ? -0.737  51.267  39.424  1.00 37.56  ? 130 THR A CB     1 
ATOM   2135  O  OG1    . THR A 1 130 ? -0.471  50.492  38.248  1.00 38.05  ? 130 THR A OG1    1 
ATOM   2136  C  CG2    . THR A 1 130 ? 0.359   52.307  39.596  1.00 53.74  ? 130 THR A CG2    1 
ATOM   2137  H  H      . THR A 1 130 ? -2.280  49.394  39.732  1.00 35.54  ? 130 THR A H      1 
ATOM   2138  H  HA     . THR A 1 130 ? 0.076   49.930  40.741  1.00 46.00  ? 130 THR A HA     1 
ATOM   2139  H  HB     . THR A 1 130 ? -1.585  51.727  39.323  1.00 45.07  ? 130 THR A HB     1 
ATOM   2140  H  HG1    . THR A 1 130 ? -0.434  50.993  37.576  1.00 45.66  ? 130 THR A HG1    1 
ATOM   2141  H  HG21   . THR A 1 130 ? 0.388   52.889  38.821  1.00 64.49  ? 130 THR A HG21   1 
ATOM   2142  H  HG22   . THR A 1 130 ? 0.186   52.842  40.386  1.00 64.49  ? 130 THR A HG22   1 
ATOM   2143  H  HG23   . THR A 1 130 ? 1.219   51.869  39.694  1.00 64.49  ? 130 THR A HG23   1 
ATOM   2144  N  N      . PRO A 1 131 ? -2.340  51.440  42.215  1.00 38.78  ? 131 PRO A N      1 
ATOM   2145  C  CA     . PRO A 1 131 ? -2.612  52.110  43.490  1.00 36.11  ? 131 PRO A CA     1 
ATOM   2146  C  C      . PRO A 1 131 ? -2.245  51.243  44.691  1.00 36.79  ? 131 PRO A C      1 
ATOM   2147  O  O      . PRO A 1 131 ? -1.711  51.744  45.680  1.00 33.88  ? 131 PRO A O      1 
ATOM   2148  C  CB     . PRO A 1 131 ? -4.121  52.362  43.440  1.00 30.11  ? 131 PRO A CB     1 
ATOM   2149  C  CG     . PRO A 1 131 ? -4.455  52.375  42.006  1.00 33.58  ? 131 PRO A CG     1 
ATOM   2150  C  CD     . PRO A 1 131 ? -3.548  51.364  41.378  1.00 51.90  ? 131 PRO A CD     1 
ATOM   2151  H  HA     . PRO A 1 131 ? -2.141  52.956  43.541  1.00 43.33  ? 131 PRO A HA     1 
ATOM   2152  H  HB2    . PRO A 1 131 ? -4.589  51.645  43.895  1.00 36.13  ? 131 PRO A HB2    1 
ATOM   2153  H  HB3    . PRO A 1 131 ? -4.324  53.219  43.847  1.00 36.13  ? 131 PRO A HB3    1 
ATOM   2154  H  HG2    . PRO A 1 131 ? -5.384  52.123  41.885  1.00 40.30  ? 131 PRO A HG2    1 
ATOM   2155  H  HG3    . PRO A 1 131 ? -4.289  53.258  41.640  1.00 40.30  ? 131 PRO A HG3    1 
ATOM   2156  H  HD2    . PRO A 1 131 ? -3.940  50.478  41.428  1.00 62.28  ? 131 PRO A HD2    1 
ATOM   2157  H  HD3    . PRO A 1 131 ? -3.344  51.613  40.463  1.00 62.28  ? 131 PRO A HD3    1 
ATOM   2158  N  N      . PHE A 1 132 ? -2.546  49.953  44.604  1.00 33.58  ? 132 PHE A N      1 
ATOM   2159  C  CA     . PHE A 1 132 ? -2.208  49.015  45.665  1.00 29.03  ? 132 PHE A CA     1 
ATOM   2160  C  C      . PHE A 1 132 ? -0.697  48.819  45.776  1.00 34.93  ? 132 PHE A C      1 
ATOM   2161  O  O      . PHE A 1 132 ? -0.185  48.497  46.844  1.00 53.94  ? 132 PHE A O      1 
ATOM   2162  C  CB     . PHE A 1 132 ? -2.896  47.674  45.425  1.00 35.79  ? 132 PHE A CB     1 
ATOM   2163  C  CG     . PHE A 1 132 ? -4.387  47.727  45.571  1.00 27.48  ? 132 PHE A CG     1 
ATOM   2164  C  CD1    . PHE A 1 132 ? -4.979  47.589  46.810  1.00 48.82  ? 132 PHE A CD1    1 
ATOM   2165  C  CD2    . PHE A 1 132 ? -5.195  47.905  44.467  1.00 37.62  ? 132 PHE A CD2    1 
ATOM   2166  C  CE1    . PHE A 1 132 ? -6.350  47.636  46.945  1.00 51.20  ? 132 PHE A CE1    1 
ATOM   2167  C  CE2    . PHE A 1 132 ? -6.566  47.951  44.596  1.00 48.45  ? 132 PHE A CE2    1 
ATOM   2168  C  CZ     . PHE A 1 132 ? -7.144  47.816  45.837  1.00 45.86  ? 132 PHE A CZ     1 
ATOM   2169  H  H      . PHE A 1 132 ? -2.948  49.593  43.934  1.00 40.29  ? 132 PHE A H      1 
ATOM   2170  H  HA     . PHE A 1 132 ? -2.526  49.368  46.511  1.00 34.83  ? 132 PHE A HA     1 
ATOM   2171  H  HB2    . PHE A 1 132 ? -2.696  47.377  44.524  1.00 42.94  ? 132 PHE A HB2    1 
ATOM   2172  H  HB3    . PHE A 1 132 ? -2.557  47.030  46.066  1.00 42.94  ? 132 PHE A HB3    1 
ATOM   2173  H  HD1    . PHE A 1 132 ? -4.447  47.468  47.564  1.00 58.58  ? 132 PHE A HD1    1 
ATOM   2174  H  HD2    . PHE A 1 132 ? -4.810  47.997  43.626  1.00 45.14  ? 132 PHE A HD2    1 
ATOM   2175  H  HE1    . PHE A 1 132 ? -6.739  47.543  47.785  1.00 61.44  ? 132 PHE A HE1    1 
ATOM   2176  H  HE2    . PHE A 1 132 ? -7.101  48.073  43.845  1.00 58.14  ? 132 PHE A HE2    1 
ATOM   2177  H  HZ     . PHE A 1 132 ? -8.069  47.847  45.926  1.00 55.03  ? 132 PHE A HZ     1 
ATOM   2178  N  N      . HIS A 1 133 ? 0.010   48.995  44.665  1.00 36.84  ? 133 HIS A N      1 
ATOM   2179  C  CA     . HIS A 1 133 ? 1.467   48.945  44.677  1.00 31.09  ? 133 HIS A CA     1 
ATOM   2180  C  C      . HIS A 1 133 ? 2.008   50.081  45.529  1.00 38.41  ? 133 HIS A C      1 
ATOM   2181  O  O      . HIS A 1 133 ? 2.930   49.898  46.315  1.00 45.30  ? 133 HIS A O      1 
ATOM   2182  C  CB     . HIS A 1 133 ? 2.038   49.040  43.259  1.00 42.05  ? 133 HIS A CB     1 
ATOM   2183  C  CG     . HIS A 1 133 ? 1.923   47.776  42.469  1.00 33.25  ? 133 HIS A CG     1 
ATOM   2184  N  ND1    . HIS A 1 133 ? 2.120   47.730  41.104  1.00 22.82  ? 133 HIS A ND1    1 
ATOM   2185  C  CD2    . HIS A 1 133 ? 1.639   46.506  42.845  1.00 47.18  ? 133 HIS A CD2    1 
ATOM   2186  C  CE1    . HIS A 1 133 ? 1.958   46.494  40.678  1.00 40.50  ? 133 HIS A CE1    1 
ATOM   2187  N  NE2    . HIS A 1 133 ? 1.664   45.729  41.714  1.00 33.08  ? 133 HIS A NE2    1 
ATOM   2188  H  H      . HIS A 1 133 ? -0.330  49.145  43.890  1.00 44.21  ? 133 HIS A H      1 
ATOM   2189  H  HA     . HIS A 1 133 ? 1.757   48.105  45.067  1.00 37.31  ? 133 HIS A HA     1 
ATOM   2190  H  HB2    . HIS A 1 133 ? 1.562   49.734  42.777  1.00 50.46  ? 133 HIS A HB2    1 
ATOM   2191  H  HB3    . HIS A 1 133 ? 2.979   49.267  43.316  1.00 50.46  ? 133 HIS A HB3    1 
ATOM   2192  H  HD1    . HIS A 1 133 ? 2.316   48.404  40.608  1.00 27.38  ? 133 HIS A HD1    1 
ATOM   2193  H  HD2    . HIS A 1 133 ? 1.457   46.215  43.710  1.00 56.61  ? 133 HIS A HD2    1 
ATOM   2194  H  HE1    . HIS A 1 133 ? 2.037   46.209  39.796  1.00 48.60  ? 133 HIS A HE1    1 
ATOM   2195  H  HE2    . HIS A 1 133 ? 1.515   44.882  41.685  1.00 39.69  ? 133 HIS A HE2    1 
ATOM   2196  N  N      . HIS A 1 134 ? 1.428   51.262  45.362  1.00 38.60  ? 134 HIS A N      1 
ATOM   2197  C  CA     . HIS A 1 134 ? 1.888   52.441  46.076  1.00 27.87  ? 134 HIS A CA     1 
ATOM   2198  C  C      . HIS A 1 134 ? 1.538   52.371  47.553  1.00 46.16  ? 134 HIS A C      1 
ATOM   2199  O  O      . HIS A 1 134 ? 2.296   52.838  48.399  1.00 63.82  ? 134 HIS A O      1 
ATOM   2200  C  CB     . HIS A 1 134 ? 1.282   53.701  45.463  1.00 30.93  ? 134 HIS A CB     1 
ATOM   2201  C  CG     . HIS A 1 134 ? 1.693   54.963  46.153  1.00 27.53  ? 134 HIS A CG     1 
ATOM   2202  N  ND1    . HIS A 1 134 ? 2.986   55.437  46.131  1.00 32.95  ? 134 HIS A ND1    1 
ATOM   2203  C  CD2    . HIS A 1 134 ? 0.982   55.845  46.894  1.00 32.03  ? 134 HIS A CD2    1 
ATOM   2204  C  CE1    . HIS A 1 134 ? 3.053   56.560  46.825  1.00 47.15  ? 134 HIS A CE1    1 
ATOM   2205  N  NE2    . HIS A 1 134 ? 1.850   56.829  47.298  1.00 52.90  ? 134 HIS A NE2    1 
ATOM   2206  H  H      . HIS A 1 134 ? 0.762   51.407  44.838  1.00 46.32  ? 134 HIS A H      1 
ATOM   2207  H  HA     . HIS A 1 134 ? 2.853   52.502  45.998  1.00 33.44  ? 134 HIS A HA     1 
ATOM   2208  H  HB2    . HIS A 1 134 ? 1.563   53.765  44.537  1.00 37.11  ? 134 HIS A HB2    1 
ATOM   2209  H  HB3    . HIS A 1 134 ? 0.315   53.639  45.510  1.00 37.11  ? 134 HIS A HB3    1 
ATOM   2210  H  HD1    . HIS A 1 134 ? 3.646   55.062  45.727  1.00 39.54  ? 134 HIS A HD1    1 
ATOM   2211  H  HD2    . HIS A 1 134 ? 0.074   55.795  47.091  1.00 38.44  ? 134 HIS A HD2    1 
ATOM   2212  H  HE1    . HIS A 1 134 ? 3.817   57.073  46.957  1.00 56.58  ? 134 HIS A HE1    1 
ATOM   2213  H  HE2    . HIS A 1 134 ? 1.644   57.510  47.781  1.00 63.48  ? 134 HIS A HE2    1 
ATOM   2214  N  N      . LYS A 1 135 ? 0.397   51.767  47.861  1.00 56.74  ? 135 LYS A N      1 
ATOM   2215  C  CA     . LYS A 1 135 ? -0.065  51.679  49.242  1.00 64.67  ? 135 LYS A CA     1 
ATOM   2216  C  C      . LYS A 1 135 ? 0.833   50.733  50.030  1.00 52.82  ? 135 LYS A C      1 
ATOM   2217  O  O      . LYS A 1 135 ? 1.078   50.933  51.221  1.00 45.41  ? 135 LYS A O      1 
ATOM   2218  C  CB     . LYS A 1 135 ? -1.521  51.204  49.289  1.00 59.02  ? 135 LYS A CB     1 
ATOM   2219  C  CG     . LYS A 1 135 ? -2.409  51.984  50.248  1.00 76.27  ? 135 LYS A CG     1 
ATOM   2220  C  CD     . LYS A 1 135 ? -3.867  51.558  50.120  1.00 81.92  ? 135 LYS A CD     1 
ATOM   2221  C  CE     . LYS A 1 135 ? -4.771  52.320  51.080  1.00 82.80  ? 135 LYS A CE     1 
ATOM   2222  N  NZ     . LYS A 1 135 ? -4.805  53.781  50.793  1.00 51.62  ? 135 LYS A NZ     1 
ATOM   2223  H  H      . LYS A 1 135 ? -0.130  51.400  47.289  1.00 68.09  ? 135 LYS A H      1 
ATOM   2224  H  HA     . LYS A 1 135 ? -0.018  52.556  49.652  1.00 77.61  ? 135 LYS A HA     1 
ATOM   2225  H  HB2    . LYS A 1 135 ? -1.903  51.287  48.401  1.00 70.82  ? 135 LYS A HB2    1 
ATOM   2226  H  HB3    . LYS A 1 135 ? -1.536  50.275  49.565  1.00 70.82  ? 135 LYS A HB3    1 
ATOM   2227  H  HG2    . LYS A 1 135 ? -2.121  51.818  51.159  1.00 91.52  ? 135 LYS A HG2    1 
ATOM   2228  H  HG3    . LYS A 1 135 ? -2.349  52.931  50.043  1.00 91.52  ? 135 LYS A HG3    1 
ATOM   2229  H  HD2    . LYS A 1 135 ? -4.171  51.731  49.215  1.00 98.31  ? 135 LYS A HD2    1 
ATOM   2230  H  HD3    . LYS A 1 135 ? -3.940  50.612  50.321  1.00 98.31  ? 135 LYS A HD3    1 
ATOM   2231  H  HE2    . LYS A 1 135 ? -5.675  51.977  51.003  1.00 99.36  ? 135 LYS A HE2    1 
ATOM   2232  H  HE3    . LYS A 1 135 ? -4.445  52.199  51.985  1.00 99.36  ? 135 LYS A HE3    1 
ATOM   2233  H  HZ1    . LYS A 1 135 ? -5.342  54.192  51.372  1.00 61.94  ? 135 LYS A HZ1    1 
ATOM   2234  H  HZ2    . LYS A 1 135 ? -3.987  54.124  50.863  1.00 61.94  ? 135 LYS A HZ2    1 
ATOM   2235  H  HZ3    . LYS A 1 135 ? -5.108  53.922  49.968  1.00 61.94  ? 135 LYS A HZ3    1 
ATOM   2236  N  N      . TRP A 1 136 ? 1.336   49.714  49.341  1.00 41.39  ? 136 TRP A N      1 
ATOM   2237  C  CA     . TRP A 1 136 ? 2.172   48.688  49.948  1.00 38.17  ? 136 TRP A CA     1 
ATOM   2238  C  C      . TRP A 1 136 ? 3.612   49.147  50.105  1.00 40.15  ? 136 TRP A C      1 
ATOM   2239  O  O      . TRP A 1 136 ? 4.324   48.683  50.992  1.00 57.38  ? 136 TRP A O      1 
ATOM   2240  C  CB     . TRP A 1 136 ? 2.135   47.415  49.097  1.00 30.33  ? 136 TRP A CB     1 
ATOM   2241  C  CG     . TRP A 1 136 ? 2.854   46.240  49.696  1.00 25.24  ? 136 TRP A CG     1 
ATOM   2242  C  CD1    . TRP A 1 136 ? 2.307   45.243  50.444  1.00 36.53  ? 136 TRP A CD1    1 
ATOM   2243  C  CD2    . TRP A 1 136 ? 4.250   45.935  49.583  1.00 29.65  ? 136 TRP A CD2    1 
ATOM   2244  N  NE1    . TRP A 1 136 ? 3.271   44.338  50.808  1.00 24.39  ? 136 TRP A NE1    1 
ATOM   2245  C  CE2    . TRP A 1 136 ? 4.473   44.740  50.294  1.00 23.96  ? 136 TRP A CE2    1 
ATOM   2246  C  CE3    . TRP A 1 136 ? 5.332   46.556  48.954  1.00 42.21  ? 136 TRP A CE3    1 
ATOM   2247  C  CZ2    . TRP A 1 136 ? 5.733   44.156  50.395  1.00 19.67  ? 136 TRP A CZ2    1 
ATOM   2248  C  CZ3    . TRP A 1 136 ? 6.582   45.973  49.055  1.00 38.96  ? 136 TRP A CZ3    1 
ATOM   2249  C  CH2    . TRP A 1 136 ? 6.771   44.786  49.771  1.00 32.96  ? 136 TRP A CH2    1 
ATOM   2250  H  H      . TRP A 1 136 ? 1.203   49.594  48.499  1.00 49.67  ? 136 TRP A H      1 
ATOM   2251  H  HA     . TRP A 1 136 ? 1.825   48.474  50.828  1.00 45.81  ? 136 TRP A HA     1 
ATOM   2252  H  HB2    . TRP A 1 136 ? 1.210   47.157  48.966  1.00 36.39  ? 136 TRP A HB2    1 
ATOM   2253  H  HB3    . TRP A 1 136 ? 2.546   47.604  48.239  1.00 36.39  ? 136 TRP A HB3    1 
ATOM   2254  H  HD1    . TRP A 1 136 ? 1.407   45.184  50.674  1.00 43.84  ? 136 TRP A HD1    1 
ATOM   2255  H  HE1    . TRP A 1 136 ? 3.141   43.634  51.285  1.00 29.27  ? 136 TRP A HE1    1 
ATOM   2256  H  HE3    . TRP A 1 136 ? 5.215   47.346  48.478  1.00 50.65  ? 136 TRP A HE3    1 
ATOM   2257  H  HZ2    . TRP A 1 136 ? 5.862   43.366  50.868  1.00 23.61  ? 136 TRP A HZ2    1 
ATOM   2258  H  HZ3    . TRP A 1 136 ? 7.310   46.378  48.641  1.00 46.75  ? 136 TRP A HZ3    1 
ATOM   2259  H  HH2    . TRP A 1 136 ? 7.623   44.416  49.821  1.00 39.55  ? 136 TRP A HH2    1 
ATOM   2260  N  N      . LEU A 1 137 ? 4.033   50.063  49.241  1.00 40.51  ? 137 LEU A N      1 
ATOM   2261  C  CA     . LEU A 1 137 ? 5.442   50.412  49.124  1.00 37.79  ? 137 LEU A CA     1 
ATOM   2262  C  C      . LEU A 1 137 ? 5.828   51.687  49.878  1.00 43.13  ? 137 LEU A C      1 
ATOM   2263  O  O      . LEU A 1 137 ? 6.976   51.834  50.297  1.00 45.99  ? 137 LEU A O      1 
ATOM   2264  C  CB     . LEU A 1 137 ? 5.790   50.553  47.642  1.00 46.39  ? 137 LEU A CB     1 
ATOM   2265  C  CG     . LEU A 1 137 ? 7.182   50.160  47.150  1.00 51.33  ? 137 LEU A CG     1 
ATOM   2266  C  CD1    . LEU A 1 137 ? 7.544   48.731  47.522  1.00 43.36  ? 137 LEU A CD1    1 
ATOM   2267  C  CD2    . LEU A 1 137 ? 7.216   50.334  45.647  1.00 47.23  ? 137 LEU A CD2    1 
ATOM   2268  H  H      . LEU A 1 137 ? 3.518   50.500  48.709  1.00 48.61  ? 137 LEU A H      1 
ATOM   2269  H  HA     . LEU A 1 137 ? 5.973   49.684  49.484  1.00 45.35  ? 137 LEU A HA     1 
ATOM   2270  H  HB2    . LEU A 1 137 ? 5.159   50.013  47.141  1.00 55.67  ? 137 LEU A HB2    1 
ATOM   2271  H  HB3    . LEU A 1 137 ? 5.665   51.484  47.400  1.00 55.67  ? 137 LEU A HB3    1 
ATOM   2272  H  HG     . LEU A 1 137 ? 7.841   50.754  47.542  1.00 61.60  ? 137 LEU A HG     1 
ATOM   2273  H  HD11   . LEU A 1 137 ? 8.433   48.533  47.187  1.00 52.03  ? 137 LEU A HD11   1 
ATOM   2274  H  HD12   . LEU A 1 137 ? 7.526   48.642  48.488  1.00 52.03  ? 137 LEU A HD12   1 
ATOM   2275  H  HD13   . LEU A 1 137 ? 6.898   48.128  47.122  1.00 52.03  ? 137 LEU A HD13   1 
ATOM   2276  H  HD21   . LEU A 1 137 ? 8.096   50.087  45.321  1.00 56.68  ? 137 LEU A HD21   1 
ATOM   2277  H  HD22   . LEU A 1 137 ? 6.543   49.761  45.248  1.00 56.68  ? 137 LEU A HD22   1 
ATOM   2278  H  HD23   . LEU A 1 137 ? 7.032   51.261  45.432  1.00 56.68  ? 137 LEU A HD23   1 
ATOM   2279  N  N      . GLU A 1 138 ? 4.878   52.601  50.049  1.00 39.99  ? 138 GLU A N      1 
ATOM   2280  C  CA     . GLU A 1 138 ? 5.172   53.907  50.638  1.00 52.44  ? 138 GLU A CA     1 
ATOM   2281  C  C      . GLU A 1 138 ? 5.764   53.810  52.043  1.00 55.89  ? 138 GLU A C      1 
ATOM   2282  O  O      . GLU A 1 138 ? 6.628   54.602  52.414  1.00 39.81  ? 138 GLU A O      1 
ATOM   2283  C  CB     . GLU A 1 138 ? 3.910   54.774  50.668  1.00 50.37  ? 138 GLU A CB     1 
ATOM   2284  C  CG     . GLU A 1 138 ? 2.761   54.203  51.482  1.00 58.16  ? 138 GLU A CG     1 
ATOM   2285  C  CD     . GLU A 1 138 ? 1.535   55.098  51.452  1.00 65.58  ? 138 GLU A CD     1 
ATOM   2286  O  OE1    . GLU A 1 138 ? 1.681   56.297  51.130  1.00 63.82  ? 138 GLU A OE1    1 
ATOM   2287  O  OE2    . GLU A 1 138 ? 0.424   54.604  51.741  1.00 53.32  ? 138 GLU A OE2    1 
ATOM   2288  H  H      . GLU A 1 138 ? 4.053   52.491  49.833  1.00 47.99  ? 138 GLU A H      1 
ATOM   2289  H  HA     . GLU A 1 138 ? 5.823   54.358  50.078  1.00 62.93  ? 138 GLU A HA     1 
ATOM   2290  H  HB2    . GLU A 1 138 ? 4.137   55.637  51.048  1.00 60.45  ? 138 GLU A HB2    1 
ATOM   2291  H  HB3    . GLU A 1 138 ? 3.595   54.891  49.759  1.00 60.45  ? 138 GLU A HB3    1 
ATOM   2292  H  HG2    . GLU A 1 138 ? 2.512   53.339  51.118  1.00 69.79  ? 138 GLU A HG2    1 
ATOM   2293  H  HG3    . GLU A 1 138 ? 3.042   54.107  52.405  1.00 69.79  ? 138 GLU A HG3    1 
ATOM   2294  N  N      . GLY A 1 139 ? 5.304   52.834  52.817  1.00 52.82  ? 139 GLY A N      1 
ATOM   2295  C  CA     . GLY A 1 139 ? 5.728   52.704  54.198  1.00 57.53  ? 139 GLY A CA     1 
ATOM   2296  C  C      . GLY A 1 139 ? 7.016   51.922  54.370  1.00 55.68  ? 139 GLY A C      1 
ATOM   2297  O  O      . GLY A 1 139 ? 7.733   52.104  55.354  1.00 63.32  ? 139 GLY A O      1 
ATOM   2298  H  H      . GLY A 1 139 ? 4.744   52.234  52.562  1.00 63.39  ? 139 GLY A H      1 
ATOM   2299  H  HA2    . GLY A 1 139 ? 5.857   53.587  54.577  1.00 69.03  ? 139 GLY A HA2    1 
ATOM   2300  H  HA3    . GLY A 1 139 ? 5.032   52.255  54.704  1.00 69.03  ? 139 GLY A HA3    1 
ATOM   2301  N  N      . ARG A 1 140 ? 7.315   51.061  53.403  1.00 43.08  ? 140 ARG A N      1 
ATOM   2302  C  CA     . ARG A 1 140 ? 8.467   50.169  53.488  1.00 39.62  ? 140 ARG A CA     1 
ATOM   2303  C  C      . ARG A 1 140 ? 9.685   50.713  52.756  1.00 41.08  ? 140 ARG A C      1 
ATOM   2304  O  O      . ARG A 1 140 ? 10.818  50.361  53.081  1.00 35.96  ? 140 ARG A O      1 
ATOM   2305  C  CB     . ARG A 1 140 ? 8.108   48.795  52.926  1.00 30.90  ? 140 ARG A CB     1 
ATOM   2306  C  CG     . ARG A 1 140 ? 6.895   48.163  53.583  1.00 32.70  ? 140 ARG A CG     1 
ATOM   2307  C  CD     . ARG A 1 140 ? 6.413   46.957  52.808  1.00 30.74  ? 140 ARG A CD     1 
ATOM   2308  N  NE     . ARG A 1 140 ? 5.024   46.620  53.125  1.00 27.98  ? 140 ARG A NE     1 
ATOM   2309  C  CZ     . ARG A 1 140 ? 4.644   45.690  53.998  1.00 32.87  ? 140 ARG A CZ     1 
ATOM   2310  N  NH1    . ARG A 1 140 ? 5.542   44.973  54.664  1.00 44.16  ? 140 ARG A NH1    1 
ATOM   2311  N  NH2    . ARG A 1 140 ? 3.351   45.469  54.199  1.00 27.41  ? 140 ARG A NH2    1 
ATOM   2312  H  H      . ARG A 1 140 ? 6.861   50.973  52.678  1.00 51.70  ? 140 ARG A H      1 
ATOM   2313  H  HA     . ARG A 1 140 ? 8.707   50.055  54.421  1.00 47.54  ? 140 ARG A HA     1 
ATOM   2314  H  HB2    . ARG A 1 140 ? 7.920   48.884  51.979  1.00 37.08  ? 140 ARG A HB2    1 
ATOM   2315  H  HB3    . ARG A 1 140 ? 8.861   48.197  53.057  1.00 37.08  ? 140 ARG A HB3    1 
ATOM   2316  H  HG2    . ARG A 1 140 ? 7.130   47.876  54.479  1.00 39.24  ? 140 ARG A HG2    1 
ATOM   2317  H  HG3    . ARG A 1 140 ? 6.175   48.812  53.615  1.00 39.24  ? 140 ARG A HG3    1 
ATOM   2318  H  HD2    . ARG A 1 140 ? 6.468   47.146  51.858  1.00 36.89  ? 140 ARG A HD2    1 
ATOM   2319  H  HD3    . ARG A 1 140 ? 6.968   46.193  53.030  1.00 36.89  ? 140 ARG A HD3    1 
ATOM   2320  H  HE     . ARG A 1 140 ? 4.407   47.056  52.715  1.00 33.58  ? 140 ARG A HE     1 
ATOM   2321  H  HH11   . ARG A 1 140 ? 6.381   45.109  54.537  1.00 52.99  ? 140 ARG A HH11   1 
ATOM   2322  H  HH12   . ARG A 1 140 ? 5.284   44.374  55.225  1.00 52.99  ? 140 ARG A HH12   1 
ATOM   2323  H  HH21   . ARG A 1 140 ? 2.765   45.930  53.771  1.00 32.89  ? 140 ARG A HH21   1 
ATOM   2324  H  HH22   . ARG A 1 140 ? 3.100   44.870  54.762  1.00 32.89  ? 140 ARG A HH22   1 
ATOM   2325  N  N      . ILE A 1 141 ? 9.454   51.565  51.767  1.00 44.11  ? 141 ILE A N      1 
ATOM   2326  C  CA     . ILE A 1 141 ? 10.541  52.069  50.941  1.00 42.25  ? 141 ILE A CA     1 
ATOM   2327  C  C      . ILE A 1 141 ? 11.184  53.300  51.566  1.00 37.30  ? 141 ILE A C      1 
ATOM   2328  O  O      . ILE A 1 141 ? 12.224  53.763  51.105  1.00 44.68  ? 141 ILE A O      1 
ATOM   2329  C  CB     . ILE A 1 141 ? 10.049  52.409  49.511  1.00 44.48  ? 141 ILE A CB     1 
ATOM   2330  C  CG1    . ILE A 1 141 ? 11.212  52.415  48.515  1.00 43.03  ? 141 ILE A CG1    1 
ATOM   2331  C  CG2    . ILE A 1 141 ? 9.316   53.750  49.475  1.00 54.41  ? 141 ILE A CG2    1 
ATOM   2332  C  CD1    . ILE A 1 141 ? 11.872  51.063  48.311  1.00 40.83  ? 141 ILE A CD1    1 
ATOM   2333  H  H      . ILE A 1 141 ? 8.677   51.866  51.553  1.00 52.94  ? 141 ILE A H      1 
ATOM   2334  H  HA     . ILE A 1 141 ? 11.222  51.383  50.866  1.00 50.70  ? 141 ILE A HA     1 
ATOM   2335  H  HB     . ILE A 1 141 ? 9.424   51.719  49.238  1.00 53.38  ? 141 ILE A HB     1 
ATOM   2336  H  HG12   . ILE A 1 141 ? 10.881  52.714  47.654  1.00 51.63  ? 141 ILE A HG12   1 
ATOM   2337  H  HG13   . ILE A 1 141 ? 11.891  53.029  48.835  1.00 51.63  ? 141 ILE A HG13   1 
ATOM   2338  H  HG21   . ILE A 1 141 ? 9.025   53.926  48.567  1.00 65.29  ? 141 ILE A HG21   1 
ATOM   2339  H  HG22   . ILE A 1 141 ? 8.549   53.706  50.066  1.00 65.29  ? 141 ILE A HG22   1 
ATOM   2340  H  HG23   . ILE A 1 141 ? 9.922   54.448  49.770  1.00 65.29  ? 141 ILE A HG23   1 
ATOM   2341  H  HD11   . ILE A 1 141 ? 12.593  51.158  47.669  1.00 49.00  ? 141 ILE A HD11   1 
ATOM   2342  H  HD12   . ILE A 1 141 ? 12.223  50.753  49.160  1.00 49.00  ? 141 ILE A HD12   1 
ATOM   2343  H  HD13   . ILE A 1 141 ? 11.211  50.437  47.977  1.00 49.00  ? 141 ILE A HD13   1 
ATOM   2344  N  N      . LYS A 1 142 ? 10.568  53.831  52.617  1.00 41.49  ? 142 LYS A N      1 
ATOM   2345  C  CA     . LYS A 1 142 ? 11.021  55.090  53.196  1.00 48.45  ? 142 LYS A CA     1 
ATOM   2346  C  C      . LYS A 1 142 ? 12.450  54.973  53.713  1.00 51.46  ? 142 LYS A C      1 
ATOM   2347  O  O      . LYS A 1 142 ? 12.778  54.060  54.470  1.00 57.67  ? 142 LYS A O      1 
ATOM   2348  C  CB     . LYS A 1 142 ? 10.084  55.539  54.318  1.00 40.80  ? 142 LYS A CB     1 
ATOM   2349  C  CG     . LYS A 1 142 ? 9.351   56.829  53.996  1.00 62.30  ? 142 LYS A CG     1 
ATOM   2350  C  CD     . LYS A 1 142 ? 8.370   57.225  55.085  1.00 83.27  ? 142 LYS A CD     1 
ATOM   2351  C  CE     . LYS A 1 142 ? 7.603   58.485  54.701  1.00 81.68  ? 142 LYS A CE     1 
ATOM   2352  N  NZ     . LYS A 1 142 ? 8.506   59.638  54.407  1.00 51.01  ? 142 LYS A NZ     1 
ATOM   2353  H  H      . LYS A 1 142 ? 9.888   53.483  53.012  1.00 49.78  ? 142 LYS A H      1 
ATOM   2354  H  HA     . LYS A 1 142 ? 11.010  55.773  52.507  1.00 58.14  ? 142 LYS A HA     1 
ATOM   2355  H  HB2    . LYS A 1 142 ? 9.421   54.848  54.470  1.00 48.96  ? 142 LYS A HB2    1 
ATOM   2356  H  HB3    . LYS A 1 142 ? 10.604  55.683  55.124  1.00 48.96  ? 142 LYS A HB3    1 
ATOM   2357  H  HG2    . LYS A 1 142 ? 9.998   57.545  53.899  1.00 74.76  ? 142 LYS A HG2    1 
ATOM   2358  H  HG3    . LYS A 1 142 ? 8.855   56.714  53.171  1.00 74.76  ? 142 LYS A HG3    1 
ATOM   2359  H  HD2    . LYS A 1 142 ? 7.732   56.507  55.219  1.00 99.92  ? 142 LYS A HD2    1 
ATOM   2360  H  HD3    . LYS A 1 142 ? 8.855   57.401  55.906  1.00 99.92  ? 142 LYS A HD3    1 
ATOM   2361  H  HE2    . LYS A 1 142 ? 7.077   58.305  53.906  1.00 98.02  ? 142 LYS A HE2    1 
ATOM   2362  H  HE3    . LYS A 1 142 ? 7.021   58.737  55.435  1.00 98.02  ? 142 LYS A HE3    1 
ATOM   2363  H  HZ1    . LYS A 1 142 ? 8.024   60.353  54.188  1.00 61.21  ? 142 LYS A HZ1    1 
ATOM   2364  H  HZ2    . LYS A 1 142 ? 8.997   59.829  55.124  1.00 61.21  ? 142 LYS A HZ2    1 
ATOM   2365  H  HZ3    . LYS A 1 142 ? 9.048   59.435  53.731  1.00 61.21  ? 142 LYS A HZ3    1 
ATOM   2366  N  N      . GLY A 1 143 ? 13.296  55.904  53.282  1.00 39.50  ? 143 GLY A N      1 
ATOM   2367  C  CA     . GLY A 1 143 ? 14.693  55.920  53.673  1.00 39.65  ? 143 GLY A CA     1 
ATOM   2368  C  C      . GLY A 1 143 ? 15.581  55.272  52.631  1.00 43.58  ? 143 GLY A C      1 
ATOM   2369  O  O      . GLY A 1 143 ? 16.765  55.586  52.534  1.00 61.39  ? 143 GLY A O      1 
ATOM   2370  H  H      . GLY A 1 143 ? 13.077  56.546  52.753  1.00 47.40  ? 143 GLY A H      1 
ATOM   2371  H  HA2    . GLY A 1 143 ? 14.984  56.837  53.800  1.00 47.58  ? 143 GLY A HA2    1 
ATOM   2372  H  HA3    . GLY A 1 143 ? 14.801  55.443  54.511  1.00 47.58  ? 143 GLY A HA3    1 
ATOM   2373  N  N      . LYS A 1 144 ? 15.003  54.367  51.847  1.00 57.91  ? 144 LYS A N      1 
ATOM   2374  C  CA     . LYS A 1 144 ? 15.746  53.618  50.838  1.00 49.54  ? 144 LYS A CA     1 
ATOM   2375  C  C      . LYS A 1 144 ? 15.576  54.184  49.431  1.00 45.96  ? 144 LYS A C      1 
ATOM   2376  O  O      . LYS A 1 144 ? 15.799  53.479  48.450  1.00 45.91  ? 144 LYS A O      1 
ATOM   2377  C  CB     . LYS A 1 144 ? 15.304  52.154  50.853  1.00 37.12  ? 144 LYS A CB     1 
ATOM   2378  C  CG     . LYS A 1 144 ? 15.454  51.494  52.209  1.00 57.12  ? 144 LYS A CG     1 
ATOM   2379  C  CD     . LYS A 1 144 ? 14.985  50.053  52.186  1.00 55.45  ? 144 LYS A CD     1 
ATOM   2380  C  CE     . LYS A 1 144 ? 15.139  49.405  53.552  1.00 56.05  ? 144 LYS A CE     1 
ATOM   2381  N  NZ     . LYS A 1 144 ? 16.547  49.451  54.035  1.00 67.01  ? 144 LYS A NZ     1 
ATOM   2382  H  H      . LYS A 1 144 ? 14.167  54.165  51.882  1.00 69.49  ? 144 LYS A H      1 
ATOM   2383  H  HA     . LYS A 1 144 ? 16.691  53.647  51.058  1.00 59.45  ? 144 LYS A HA     1 
ATOM   2384  H  HB2    . LYS A 1 144 ? 14.369  52.106  50.600  1.00 44.54  ? 144 LYS A HB2    1 
ATOM   2385  H  HB3    . LYS A 1 144 ? 15.843  51.657  50.218  1.00 44.54  ? 144 LYS A HB3    1 
ATOM   2386  H  HG2    . LYS A 1 144 ? 16.388  51.505  52.467  1.00 68.55  ? 144 LYS A HG2    1 
ATOM   2387  H  HG3    . LYS A 1 144 ? 14.920  51.976  52.859  1.00 68.55  ? 144 LYS A HG3    1 
ATOM   2388  H  HD2    . LYS A 1 144 ? 14.048  50.024  51.938  1.00 66.54  ? 144 LYS A HD2    1 
ATOM   2389  H  HD3    . LYS A 1 144 ? 15.518  49.552  51.549  1.00 66.54  ? 144 LYS A HD3    1 
ATOM   2390  H  HE2    . LYS A 1 144 ? 14.583  49.876  54.193  1.00 67.27  ? 144 LYS A HE2    1 
ATOM   2391  H  HE3    . LYS A 1 144 ? 14.869  48.475  53.496  1.00 67.27  ? 144 LYS A HE3    1 
ATOM   2392  H  HZ1    . LYS A 1 144 ? 16.607  49.066  54.835  1.00 80.41  ? 144 LYS A HZ1    1 
ATOM   2393  H  HZ2    . LYS A 1 144 ? 17.078  49.020  53.465  1.00 80.41  ? 144 LYS A HZ2    1 
ATOM   2394  H  HZ3    . LYS A 1 144 ? 16.818  50.297  54.100  1.00 80.41  ? 144 LYS A HZ3    1 
ATOM   2395  N  N      . GLU A 1 145 ? 15.186  55.449  49.326  1.00 49.26  ? 145 GLU A N      1 
ATOM   2396  C  CA     . GLU A 1 145 ? 14.889  56.031  48.023  1.00 34.84  ? 145 GLU A CA     1 
ATOM   2397  C  C      . GLU A 1 145 ? 16.089  56.053  47.086  1.00 39.18  ? 145 GLU A C      1 
ATOM   2398  O  O      . GLU A 1 145 ? 15.952  55.796  45.894  1.00 48.47  ? 145 GLU A O      1 
ATOM   2399  C  CB     . GLU A 1 145 ? 14.364  57.455  48.184  1.00 39.12  ? 145 GLU A CB     1 
ATOM   2400  C  CG     . GLU A 1 145 ? 12.900  57.542  48.583  1.00 51.38  ? 145 GLU A CG     1 
ATOM   2401  C  CD     . GLU A 1 145 ? 12.667  57.316  50.061  1.00 52.09  ? 145 GLU A CD     1 
ATOM   2402  O  OE1    . GLU A 1 145 ? 13.649  57.100  50.803  1.00 54.52  ? 145 GLU A OE1    1 
ATOM   2403  O  OE2    . GLU A 1 145 ? 11.491  57.361  50.479  1.00 44.00  ? 145 GLU A OE2    1 
ATOM   2404  H  H      . GLU A 1 145 ? 15.087  55.988  49.989  1.00 59.12  ? 145 GLU A H      1 
ATOM   2405  H  HA     . GLU A 1 145 ? 14.193  55.505  47.600  1.00 41.81  ? 145 GLU A HA     1 
ATOM   2406  H  HB2    . GLU A 1 145 ? 14.883  57.902  48.871  1.00 46.94  ? 145 GLU A HB2    1 
ATOM   2407  H  HB3    . GLU A 1 145 ? 14.467  57.922  47.340  1.00 46.94  ? 145 GLU A HB3    1 
ATOM   2408  H  HG2    . GLU A 1 145 ? 12.566  58.425  48.360  1.00 61.66  ? 145 GLU A HG2    1 
ATOM   2409  H  HG3    . GLU A 1 145 ? 12.401  56.867  48.096  1.00 61.66  ? 145 GLU A HG3    1 
ATOM   2410  N  N      . ASN A 1 146 ? 17.266  56.352  47.616  1.00 36.17  ? 146 ASN A N      1 
ATOM   2411  C  CA     . ASN A 1 146 ? 18.451  56.446  46.776  1.00 33.56  ? 146 ASN A CA     1 
ATOM   2412  C  C      . ASN A 1 146 ? 19.020  55.078  46.416  1.00 39.11  ? 146 ASN A C      1 
ATOM   2413  O  O      . ASN A 1 146 ? 19.737  54.945  45.427  1.00 47.33  ? 146 ASN A O      1 
ATOM   2414  C  CB     . ASN A 1 146 ? 19.518  57.297  47.461  1.00 46.31  ? 146 ASN A CB     1 
ATOM   2415  C  CG     . ASN A 1 146 ? 19.141  58.766  47.518  1.00 43.10  ? 146 ASN A CG     1 
ATOM   2416  O  OD1    . ASN A 1 146 ? 18.369  59.256  46.694  1.00 29.66  ? 146 ASN A OD1    1 
ATOM   2417  N  ND2    . ASN A 1 146 ? 19.687  59.477  48.495  1.00 50.85  ? 146 ASN A ND2    1 
ATOM   2418  H  H      . ASN A 1 146 ? 17.406  56.505  48.451  1.00 43.41  ? 146 ASN A H      1 
ATOM   2419  H  HA     . ASN A 1 146 ? 18.208  56.889  45.948  1.00 40.27  ? 146 ASN A HA     1 
ATOM   2420  H  HB2    . ASN A 1 146 ? 19.639  56.982  48.370  1.00 55.57  ? 146 ASN A HB2    1 
ATOM   2421  H  HB3    . ASN A 1 146 ? 20.350  57.219  46.968  1.00 55.57  ? 146 ASN A HB3    1 
ATOM   2422  H  HD21   . ASN A 1 146 ? 19.505  60.315  48.571  1.00 61.02  ? 146 ASN A HD21   1 
ATOM   2423  H  HD22   . ASN A 1 146 ? 20.222  59.101  49.054  1.00 61.02  ? 146 ASN A HD22   1 
ATOM   2424  N  N      . GLU A 1 147 ? 18.701  54.063  47.212  1.00 51.40  ? 147 GLU A N      1 
ATOM   2425  C  CA     . GLU A 1 147 ? 19.132  52.702  46.909  1.00 40.97  ? 147 GLU A CA     1 
ATOM   2426  C  C      . GLU A 1 147 ? 18.406  52.208  45.666  1.00 38.41  ? 147 GLU A C      1 
ATOM   2427  O  O      . GLU A 1 147 ? 18.940  51.411  44.900  1.00 52.53  ? 147 GLU A O      1 
ATOM   2428  C  CB     . GLU A 1 147 ? 18.869  51.761  48.089  1.00 47.10  ? 147 GLU A CB     1 
ATOM   2429  C  CG     . GLU A 1 147 ? 19.605  52.128  49.380  1.00 55.86  ? 147 GLU A CG     1 
ATOM   2430  C  CD     . GLU A 1 147 ? 21.113  51.971  49.289  1.00 53.89  ? 147 GLU A CD     1 
ATOM   2431  O  OE1    . GLU A 1 147 ? 21.590  51.201  48.428  1.00 43.97  ? 147 GLU A OE1    1 
ATOM   2432  O  OE2    . GLU A 1 147 ? 21.823  52.621  50.088  1.00 44.03  ? 147 GLU A OE2    1 
ATOM   2433  H  H      . GLU A 1 147 ? 18.237  54.134  47.933  1.00 61.69  ? 147 GLU A H      1 
ATOM   2434  H  HA     . GLU A 1 147 ? 20.085  52.701  46.726  1.00 49.17  ? 147 GLU A HA     1 
ATOM   2435  H  HB2    . GLU A 1 147 ? 17.918  51.767  48.282  1.00 56.52  ? 147 GLU A HB2    1 
ATOM   2436  H  HB3    . GLU A 1 147 ? 19.145  50.866  47.839  1.00 56.52  ? 147 GLU A HB3    1 
ATOM   2437  H  HG2    . GLU A 1 147 ? 19.415  53.054  49.597  1.00 67.03  ? 147 GLU A HG2    1 
ATOM   2438  H  HG3    . GLU A 1 147 ? 19.290  51.552  50.094  1.00 67.03  ? 147 GLU A HG3    1 
ATOM   2439  N  N      . VAL A 1 148 ? 17.188  52.697  45.468  1.00 38.55  ? 148 VAL A N      1 
ATOM   2440  C  CA     . VAL A 1 148 ? 16.423  52.387  44.268  1.00 39.06  ? 148 VAL A CA     1 
ATOM   2441  C  C      . VAL A 1 148 ? 17.024  53.110  43.071  1.00 34.88  ? 148 VAL A C      1 
ATOM   2442  O  O      . VAL A 1 148 ? 17.158  52.542  41.990  1.00 39.01  ? 148 VAL A O      1 
ATOM   2443  C  CB     . VAL A 1 148 ? 14.943  52.797  44.417  1.00 47.28  ? 148 VAL A CB     1 
ATOM   2444  C  CG1    . VAL A 1 148 ? 14.157  52.438  43.168  1.00 47.58  ? 148 VAL A CG1    1 
ATOM   2445  C  CG2    . VAL A 1 148 ? 14.322  52.144  45.642  1.00 35.53  ? 148 VAL A CG2    1 
ATOM   2446  H  H      . VAL A 1 148 ? 16.779  53.216  46.018  1.00 46.27  ? 148 VAL A H      1 
ATOM   2447  H  HA     . VAL A 1 148 ? 16.460  51.432  44.100  1.00 46.87  ? 148 VAL A HA     1 
ATOM   2448  H  HB     . VAL A 1 148 ? 14.893  53.759  44.535  1.00 56.74  ? 148 VAL A HB     1 
ATOM   2449  H  HG11   . VAL A 1 148 ? 13.233  52.707  43.289  1.00 57.09  ? 148 VAL A HG11   1 
ATOM   2450  H  HG12   . VAL A 1 148 ? 14.541  52.905  42.410  1.00 57.09  ? 148 VAL A HG12   1 
ATOM   2451  H  HG13   . VAL A 1 148 ? 14.208  51.480  43.028  1.00 57.09  ? 148 VAL A HG13   1 
ATOM   2452  H  HG21   . VAL A 1 148 ? 13.395  52.419  45.710  1.00 42.64  ? 148 VAL A HG21   1 
ATOM   2453  H  HG22   . VAL A 1 148 ? 14.376  51.180  45.546  1.00 42.64  ? 148 VAL A HG22   1 
ATOM   2454  H  HG23   . VAL A 1 148 ? 14.810  52.426  46.431  1.00 42.64  ? 148 VAL A HG23   1 
ATOM   2455  N  N      . ARG A 1 149 ? 17.381  54.372  43.278  1.00 37.25  ? 149 ARG A N      1 
ATOM   2456  C  CA     . ARG A 1 149 ? 17.933  55.199  42.218  1.00 28.57  ? 149 ARG A CA     1 
ATOM   2457  C  C      . ARG A 1 149 ? 19.271  54.668  41.725  1.00 32.12  ? 149 ARG A C      1 
ATOM   2458  O  O      . ARG A 1 149 ? 19.615  54.838  40.561  1.00 43.00  ? 149 ARG A O      1 
ATOM   2459  C  CB     . ARG A 1 149 ? 18.101  56.637  42.704  1.00 34.43  ? 149 ARG A CB     1 
ATOM   2460  C  CG     . ARG A 1 149 ? 16.808  57.427  42.784  1.00 44.53  ? 149 ARG A CG     1 
ATOM   2461  C  CD     . ARG A 1 149 ? 17.072  58.835  43.291  1.00 63.28  ? 149 ARG A CD     1 
ATOM   2462  N  NE     . ARG A 1 149 ? 15.934  59.731  43.072  1.00 49.94  ? 149 ARG A NE     1 
ATOM   2463  C  CZ     . ARG A 1 149 ? 15.273  60.384  44.027  1.00 41.40  ? 149 ARG A CZ     1 
ATOM   2464  N  NH1    . ARG A 1 149 ? 15.611  60.266  45.307  1.00 44.25  ? 149 ARG A NH1    1 
ATOM   2465  N  NH2    . ARG A 1 149 ? 14.259  61.168  43.693  1.00 29.78  ? 149 ARG A NH2    1 
ATOM   2466  H  H      . ARG A 1 149 ? 17.311  54.776  44.034  1.00 44.70  ? 149 ARG A H      1 
ATOM   2467  H  HA     . ARG A 1 149 ? 17.317  55.204  41.468  1.00 34.28  ? 149 ARG A HA     1 
ATOM   2468  H  HB2    . ARG A 1 149 ? 18.492  56.621  43.591  1.00 41.31  ? 149 ARG A HB2    1 
ATOM   2469  H  HB3    . ARG A 1 149 ? 18.693  57.103  42.094  1.00 41.31  ? 149 ARG A HB3    1 
ATOM   2470  H  HG2    . ARG A 1 149 ? 16.411  57.487  41.901  1.00 53.44  ? 149 ARG A HG2    1 
ATOM   2471  H  HG3    . ARG A 1 149 ? 16.199  56.988  43.400  1.00 53.44  ? 149 ARG A HG3    1 
ATOM   2472  H  HD2    . ARG A 1 149 ? 17.249  58.801  44.244  1.00 75.94  ? 149 ARG A HD2    1 
ATOM   2473  H  HD3    . ARG A 1 149 ? 17.838  59.202  42.822  1.00 75.94  ? 149 ARG A HD3    1 
ATOM   2474  H  HE     . ARG A 1 149 ? 15.672  59.846  42.261  1.00 59.93  ? 149 ARG A HE     1 
ATOM   2475  H  HH11   . ARG A 1 149 ? 16.269  59.760  45.534  1.00 53.10  ? 149 ARG A HH11   1 
ATOM   2476  H  HH12   . ARG A 1 149 ? 15.172  60.696  45.909  1.00 53.10  ? 149 ARG A HH12   1 
ATOM   2477  H  HH21   . ARG A 1 149 ? 14.033  61.251  42.868  1.00 35.74  ? 149 ARG A HH21   1 
ATOM   2478  H  HH22   . ARG A 1 149 ? 13.826  61.593  44.302  1.00 35.74  ? 149 ARG A HH22   1 
ATOM   2479  N  N      . LEU A 1 150 ? 20.024  54.017  42.605  1.00 38.59  ? 150 LEU A N      1 
ATOM   2480  C  CA     . LEU A 1 150 ? 21.296  53.430  42.205  1.00 43.52  ? 150 LEU A CA     1 
ATOM   2481  C  C      . LEU A 1 150 ? 21.047  52.225  41.319  1.00 37.14  ? 150 LEU A C      1 
ATOM   2482  O  O      . LEU A 1 150 ? 21.747  52.014  40.331  1.00 29.59  ? 150 LEU A O      1 
ATOM   2483  C  CB     . LEU A 1 150 ? 22.128  53.020  43.420  1.00 48.31  ? 150 LEU A CB     1 
ATOM   2484  C  CG     . LEU A 1 150 ? 22.952  54.098  44.125  1.00 36.71  ? 150 LEU A CG     1 
ATOM   2485  C  CD1    . LEU A 1 150 ? 23.682  53.479  45.298  1.00 31.45  ? 150 LEU A CD1    1 
ATOM   2486  C  CD2    . LEU A 1 150 ? 23.947  54.759  43.183  1.00 35.39  ? 150 LEU A CD2    1 
ATOM   2487  H  H      . LEU A 1 150 ? 19.823  53.902  43.433  1.00 46.31  ? 150 LEU A H      1 
ATOM   2488  H  HA     . LEU A 1 150 ? 21.802  54.082  41.695  1.00 52.22  ? 150 LEU A HA     1 
ATOM   2489  H  HB2    . LEU A 1 150 ? 21.524  52.649  44.082  1.00 57.97  ? 150 LEU A HB2    1 
ATOM   2490  H  HB3    . LEU A 1 150 ? 22.748  52.331  43.137  1.00 57.97  ? 150 LEU A HB3    1 
ATOM   2491  H  HG     . LEU A 1 150 ? 22.356  54.783  44.466  1.00 44.05  ? 150 LEU A HG     1 
ATOM   2492  H  HD11   . LEU A 1 150 ? 24.204  54.165  45.743  1.00 37.74  ? 150 LEU A HD11   1 
ATOM   2493  H  HD12   . LEU A 1 150 ? 23.032  53.107  45.914  1.00 37.74  ? 150 LEU A HD12   1 
ATOM   2494  H  HD13   . LEU A 1 150 ? 24.268  52.778  44.971  1.00 37.74  ? 150 LEU A HD13   1 
ATOM   2495  H  HD21   . LEU A 1 150 ? 24.445  55.432  43.672  1.00 42.47  ? 150 LEU A HD21   1 
ATOM   2496  H  HD22   . LEU A 1 150 ? 24.553  54.083  42.839  1.00 42.47  ? 150 LEU A HD22   1 
ATOM   2497  H  HD23   . LEU A 1 150 ? 23.462  55.172  42.451  1.00 42.47  ? 150 LEU A HD23   1 
ATOM   2498  N  N      . LEU A 1 151 ? 20.040  51.439  41.683  1.00 38.70  ? 151 LEU A N      1 
ATOM   2499  C  CA     . LEU A 1 151 ? 19.684  50.243  40.934  1.00 35.78  ? 151 LEU A CA     1 
ATOM   2500  C  C      . LEU A 1 151 ? 19.042  50.604  39.598  1.00 43.52  ? 151 LEU A C      1 
ATOM   2501  O  O      . LEU A 1 151 ? 19.346  49.994  38.572  1.00 42.61  ? 151 LEU A O      1 
ATOM   2502  C  CB     . LEU A 1 151 ? 18.743  49.366  41.758  1.00 36.26  ? 151 LEU A CB     1 
ATOM   2503  C  CG     . LEU A 1 151 ? 18.256  48.075  41.100  1.00 46.51  ? 151 LEU A CG     1 
ATOM   2504  C  CD1    . LEU A 1 151 ? 19.422  47.220  40.641  1.00 41.44  ? 151 LEU A CD1    1 
ATOM   2505  C  CD2    . LEU A 1 151 ? 17.383  47.299  42.071  1.00 46.29  ? 151 LEU A CD2    1 
ATOM   2506  H  H      . LEU A 1 151 ? 19.542  51.581  42.369  1.00 46.43  ? 151 LEU A H      1 
ATOM   2507  H  HA     . LEU A 1 151 ? 20.488  49.733  40.753  1.00 42.94  ? 151 LEU A HA     1 
ATOM   2508  H  HB2    . LEU A 1 151 ? 19.202  49.116  42.576  1.00 43.51  ? 151 LEU A HB2    1 
ATOM   2509  H  HB3    . LEU A 1 151 ? 17.957  49.889  41.979  1.00 43.51  ? 151 LEU A HB3    1 
ATOM   2510  H  HG     . LEU A 1 151 ? 17.720  48.297  40.323  1.00 55.81  ? 151 LEU A HG     1 
ATOM   2511  H  HD11   . LEU A 1 151 ? 19.077  46.412  40.229  1.00 49.72  ? 151 LEU A HD11   1 
ATOM   2512  H  HD12   . LEU A 1 151 ? 19.947  47.721  39.997  1.00 49.72  ? 151 LEU A HD12   1 
ATOM   2513  H  HD13   . LEU A 1 151 ? 19.969  46.993  41.409  1.00 49.72  ? 151 LEU A HD13   1 
ATOM   2514  H  HD21   . LEU A 1 151 ? 17.082  46.484  41.641  1.00 55.54  ? 151 LEU A HD21   1 
ATOM   2515  H  HD22   . LEU A 1 151 ? 17.904  47.084  42.860  1.00 55.54  ? 151 LEU A HD22   1 
ATOM   2516  H  HD23   . LEU A 1 151 ? 16.621  47.846  42.316  1.00 55.54  ? 151 LEU A HD23   1 
ATOM   2517  N  N      . LYS A 1 152 ? 18.145  51.585  39.613  1.00 44.36  ? 152 LYS A N      1 
ATOM   2518  C  CA     . LYS A 1 152 ? 17.505  52.039  38.384  1.00 34.32  ? 152 LYS A CA     1 
ATOM   2519  C  C      . LYS A 1 152 ? 18.543  52.639  37.444  1.00 32.61  ? 152 LYS A C      1 
ATOM   2520  O  O      . LYS A 1 152 ? 18.472  52.460  36.232  1.00 38.15  ? 152 LYS A O      1 
ATOM   2521  C  CB     . LYS A 1 152 ? 16.411  53.067  38.684  1.00 37.23  ? 152 LYS A CB     1 
ATOM   2522  C  CG     . LYS A 1 152 ? 15.141  52.484  39.280  1.00 36.60  ? 152 LYS A CG     1 
ATOM   2523  C  CD     . LYS A 1 152 ? 14.060  53.547  39.436  1.00 33.88  ? 152 LYS A CD     1 
ATOM   2524  C  CE     . LYS A 1 152 ? 12.750  52.943  39.923  1.00 35.62  ? 152 LYS A CE     1 
ATOM   2525  N  NZ     . LYS A 1 152 ? 11.660  53.952  40.035  1.00 31.03  ? 152 LYS A NZ     1 
ATOM   2526  H  H      . LYS A 1 152 ? 17.891  52.004  40.320  1.00 53.23  ? 152 LYS A H      1 
ATOM   2527  H  HA     . LYS A 1 152 ? 17.095  51.280  37.939  1.00 41.19  ? 152 LYS A HA     1 
ATOM   2528  H  HB2    . LYS A 1 152 ? 16.760  53.717  39.314  1.00 44.67  ? 152 LYS A HB2    1 
ATOM   2529  H  HB3    . LYS A 1 152 ? 16.170  53.513  37.856  1.00 44.67  ? 152 LYS A HB3    1 
ATOM   2530  H  HG2    . LYS A 1 152 ? 14.802  51.789  38.694  1.00 43.92  ? 152 LYS A HG2    1 
ATOM   2531  H  HG3    . LYS A 1 152 ? 15.337  52.119  40.157  1.00 43.92  ? 152 LYS A HG3    1 
ATOM   2532  H  HD2    . LYS A 1 152 ? 14.350  54.206  40.086  1.00 40.66  ? 152 LYS A HD2    1 
ATOM   2533  H  HD3    . LYS A 1 152 ? 13.899  53.969  38.578  1.00 40.66  ? 152 LYS A HD3    1 
ATOM   2534  H  HE2    . LYS A 1 152 ? 12.463  52.261  39.295  1.00 42.74  ? 152 LYS A HE2    1 
ATOM   2535  H  HE3    . LYS A 1 152 ? 12.888  52.552  40.799  1.00 42.74  ? 152 LYS A HE3    1 
ATOM   2536  H  HZ1    . LYS A 1 152 ? 10.913  53.563  40.321  1.00 37.23  ? 152 LYS A HZ1    1 
ATOM   2537  H  HZ2    . LYS A 1 152 ? 11.894  54.589  40.612  1.00 37.23  ? 152 LYS A HZ2    1 
ATOM   2538  H  HZ3    . LYS A 1 152 ? 11.507  54.324  39.241  1.00 37.23  ? 152 LYS A HZ3    1 
ATOM   2539  N  N      . GLY A 1 153 ? 19.514  53.344  38.014  1.00 30.77  ? 153 GLY A N      1 
ATOM   2540  C  CA     . GLY A 1 153 ? 20.569  53.954  37.229  1.00 32.01  ? 153 GLY A CA     1 
ATOM   2541  C  C      . GLY A 1 153 ? 21.552  52.929  36.711  1.00 30.61  ? 153 GLY A C      1 
ATOM   2542  O  O      . GLY A 1 153 ? 22.079  53.057  35.608  1.00 27.03  ? 153 GLY A O      1 
ATOM   2543  H  H      . GLY A 1 153 ? 19.582  53.481  38.860  1.00 36.92  ? 153 GLY A H      1 
ATOM   2544  H  HA2    . GLY A 1 153 ? 20.182  54.421  36.472  1.00 38.42  ? 153 GLY A HA2    1 
ATOM   2545  H  HA3    . GLY A 1 153 ? 21.050  54.596  37.775  1.00 38.42  ? 153 GLY A HA3    1 
ATOM   2546  N  N      . PHE A 1 154 ? 21.793  51.901  37.514  1.00 34.65  ? 154 PHE A N      1 
ATOM   2547  C  CA     . PHE A 1 154 ? 22.712  50.833  37.146  1.00 29.94  ? 154 PHE A CA     1 
ATOM   2548  C  C      . PHE A 1 154 ? 22.177  50.081  35.942  1.00 39.53  ? 154 PHE A C      1 
ATOM   2549  O  O      . PHE A 1 154 ? 22.927  49.704  35.044  1.00 42.47  ? 154 PHE A O      1 
ATOM   2550  C  CB     . PHE A 1 154 ? 22.909  49.878  38.324  1.00 38.05  ? 154 PHE A CB     1 
ATOM   2551  C  CG     . PHE A 1 154 ? 23.843  48.737  38.041  1.00 41.95  ? 154 PHE A CG     1 
ATOM   2552  C  CD1    . PHE A 1 154 ? 25.212  48.930  38.026  1.00 45.53  ? 154 PHE A CD1    1 
ATOM   2553  C  CD2    . PHE A 1 154 ? 23.351  47.465  37.807  1.00 44.57  ? 154 PHE A CD2    1 
ATOM   2554  C  CE1    . PHE A 1 154 ? 26.072  47.877  37.777  1.00 43.16  ? 154 PHE A CE1    1 
ATOM   2555  C  CE2    . PHE A 1 154 ? 24.206  46.411  37.554  1.00 38.53  ? 154 PHE A CE2    1 
ATOM   2556  C  CZ     . PHE A 1 154 ? 25.567  46.618  37.540  1.00 43.22  ? 154 PHE A CZ     1 
ATOM   2557  H  H      . PHE A 1 154 ? 21.432  51.797  38.288  1.00 41.58  ? 154 PHE A H      1 
ATOM   2558  H  HA     . PHE A 1 154 ? 23.573  51.214  36.912  1.00 35.93  ? 154 PHE A HA     1 
ATOM   2559  H  HB2    . PHE A 1 154 ? 23.272  50.378  39.072  1.00 45.65  ? 154 PHE A HB2    1 
ATOM   2560  H  HB3    . PHE A 1 154 ? 22.049  49.502  38.567  1.00 45.65  ? 154 PHE A HB3    1 
ATOM   2561  H  HD1    . PHE A 1 154 ? 25.559  49.778  38.186  1.00 54.64  ? 154 PHE A HD1    1 
ATOM   2562  H  HD2    . PHE A 1 154 ? 22.433  47.320  37.815  1.00 53.48  ? 154 PHE A HD2    1 
ATOM   2563  H  HE1    . PHE A 1 154 ? 26.991  48.019  37.766  1.00 51.80  ? 154 PHE A HE1    1 
ATOM   2564  H  HE2    . PHE A 1 154 ? 23.863  45.561  37.396  1.00 46.24  ? 154 PHE A HE2    1 
ATOM   2565  H  HZ     . PHE A 1 154 ? 26.145  45.909  37.370  1.00 51.86  ? 154 PHE A HZ     1 
ATOM   2566  N  N      . LEU A 1 155 ? 20.865  49.879  35.928  1.00 46.05  ? 155 LEU A N      1 
ATOM   2567  C  CA     . LEU A 1 155 ? 20.218  49.148  34.851  1.00 29.87  ? 155 LEU A CA     1 
ATOM   2568  C  C      . LEU A 1 155 ? 20.063  50.004  33.606  1.00 28.94  ? 155 LEU A C      1 
ATOM   2569  O  O      . LEU A 1 155 ? 20.375  49.569  32.501  1.00 46.71  ? 155 LEU A O      1 
ATOM   2570  C  CB     . LEU A 1 155 ? 18.845  48.654  35.310  1.00 33.31  ? 155 LEU A CB     1 
ATOM   2571  C  CG     . LEU A 1 155 ? 18.854  47.603  36.420  1.00 35.97  ? 155 LEU A CG     1 
ATOM   2572  C  CD1    . LEU A 1 155 ? 17.493  47.525  37.083  1.00 32.67  ? 155 LEU A CD1    1 
ATOM   2573  C  CD2    . LEU A 1 155 ? 19.259  46.242  35.873  1.00 32.41  ? 155 LEU A CD2    1 
ATOM   2574  H  H      . LEU A 1 155 ? 20.324  50.157  36.536  1.00 55.26  ? 155 LEU A H      1 
ATOM   2575  H  HA     . LEU A 1 155 ? 20.757  48.376  34.621  1.00 35.84  ? 155 LEU A HA     1 
ATOM   2576  H  HB2    . LEU A 1 155 ? 18.339  49.415  35.635  1.00 39.97  ? 155 LEU A HB2    1 
ATOM   2577  H  HB3    . LEU A 1 155 ? 18.390  48.265  34.546  1.00 39.97  ? 155 LEU A HB3    1 
ATOM   2578  H  HG     . LEU A 1 155 ? 19.502  47.860  37.095  1.00 43.17  ? 155 LEU A HG     1 
ATOM   2579  H  HD11   . LEU A 1 155 ? 17.521  46.853  37.782  1.00 39.21  ? 155 LEU A HD11   1 
ATOM   2580  H  HD12   . LEU A 1 155 ? 17.277  48.391  37.463  1.00 39.21  ? 155 LEU A HD12   1 
ATOM   2581  H  HD13   . LEU A 1 155 ? 16.831  47.281  36.416  1.00 39.21  ? 155 LEU A HD13   1 
ATOM   2582  H  HD21   . LEU A 1 155 ? 19.256  45.597  36.597  1.00 38.89  ? 155 LEU A HD21   1 
ATOM   2583  H  HD22   . LEU A 1 155 ? 18.625  45.975  35.189  1.00 38.89  ? 155 LEU A HD22   1 
ATOM   2584  H  HD23   . LEU A 1 155 ? 20.149  46.308  35.492  1.00 38.89  ? 155 LEU A HD23   1 
ATOM   2585  N  N      . LYS A 1 156 ? 19.601  51.234  33.798  1.00 40.59  ? 156 LYS A N      1 
ATOM   2586  C  CA     . LYS A 1 156 ? 19.361  52.145  32.688  1.00 41.73  ? 156 LYS A CA     1 
ATOM   2587  C  C      . LYS A 1 156 ? 20.642  52.404  31.908  1.00 32.59  ? 156 LYS A C      1 
ATOM   2588  O  O      . LYS A 1 156 ? 20.610  52.609  30.697  1.00 39.79  ? 156 LYS A O      1 
ATOM   2589  C  CB     . LYS A 1 156 ? 18.774  53.458  33.202  1.00 42.49  ? 156 LYS A CB     1 
ATOM   2590  C  CG     . LYS A 1 156 ? 18.246  54.380  32.120  1.00 31.45  ? 156 LYS A CG     1 
ATOM   2591  C  CD     . LYS A 1 156 ? 17.558  55.584  32.743  1.00 51.93  ? 156 LYS A CD     1 
ATOM   2592  C  CE     . LYS A 1 156 ? 16.799  56.401  31.718  1.00 49.57  ? 156 LYS A CE     1 
ATOM   2593  N  NZ     . LYS A 1 156 ? 16.177  57.599  32.347  1.00 67.98  ? 156 LYS A NZ     1 
ATOM   2594  H  H      . LYS A 1 156 ? 19.417  51.567  34.570  1.00 48.70  ? 156 LYS A H      1 
ATOM   2595  H  HA     . LYS A 1 156 ? 18.717  51.744  32.083  1.00 50.08  ? 156 LYS A HA     1 
ATOM   2596  H  HB2    . LYS A 1 156 ? 18.037  53.255  33.800  1.00 50.98  ? 156 LYS A HB2    1 
ATOM   2597  H  HB3    . LYS A 1 156 ? 19.464  53.937  33.687  1.00 50.98  ? 156 LYS A HB3    1 
ATOM   2598  H  HG2    . LYS A 1 156 ? 18.984  54.695  31.575  1.00 37.74  ? 156 LYS A HG2    1 
ATOM   2599  H  HG3    . LYS A 1 156 ? 17.600  53.904  31.575  1.00 37.74  ? 156 LYS A HG3    1 
ATOM   2600  H  HD2    . LYS A 1 156 ? 16.927  55.278  33.413  1.00 62.32  ? 156 LYS A HD2    1 
ATOM   2601  H  HD3    . LYS A 1 156 ? 18.226  56.156  33.151  1.00 62.32  ? 156 LYS A HD3    1 
ATOM   2602  H  HE2    . LYS A 1 156 ? 17.411  56.701  31.028  1.00 59.49  ? 156 LYS A HE2    1 
ATOM   2603  H  HE3    . LYS A 1 156 ? 16.094  55.858  31.332  1.00 59.49  ? 156 LYS A HE3    1 
ATOM   2604  H  HZ1    . LYS A 1 156 ? 15.734  58.069  31.734  1.00 81.57  ? 156 LYS A HZ1    1 
ATOM   2605  H  HZ2    . LYS A 1 156 ? 15.608  57.348  32.984  1.00 81.57  ? 156 LYS A HZ2    1 
ATOM   2606  H  HZ3    . LYS A 1 156 ? 16.806  58.115  32.708  1.00 81.57  ? 156 LYS A HZ3    1 
ATOM   2607  N  N      . ALA A 1 157 ? 21.769  52.367  32.610  1.00 30.56  ? 157 ALA A N      1 
ATOM   2608  C  CA     . ALA A 1 157 ? 23.061  52.642  31.999  1.00 31.48  ? 157 ALA A CA     1 
ATOM   2609  C  C      . ALA A 1 157 ? 23.498  51.491  31.111  1.00 30.44  ? 157 ALA A C      1 
ATOM   2610  O  O      . ALA A 1 157 ? 24.311  51.672  30.205  1.00 39.77  ? 157 ALA A O      1 
ATOM   2611  C  CB     . ALA A 1 157 ? 24.101  52.902  33.069  1.00 44.59  ? 157 ALA A CB     1 
ATOM   2612  H  H      . ALA A 1 157 ? 21.811  52.183  33.449  1.00 36.67  ? 157 ALA A H      1 
ATOM   2613  H  HA     . ALA A 1 157 ? 22.989  53.437  31.448  1.00 37.77  ? 157 ALA A HA     1 
ATOM   2614  H  HB1    . ALA A 1 157 ? 24.953  53.083  32.642  1.00 53.51  ? 157 ALA A HB1    1 
ATOM   2615  H  HB2    . ALA A 1 157 ? 23.825  53.667  33.597  1.00 53.51  ? 157 ALA A HB2    1 
ATOM   2616  H  HB3    . ALA A 1 157 ? 24.173  52.118  33.635  1.00 53.51  ? 157 ALA A HB3    1 
ATOM   2617  N  N      . ASN A 1 158 ? 22.951  50.309  31.373  1.00 35.69  ? 158 ASN A N      1 
ATOM   2618  C  CA     . ASN A 1 158 ? 23.284  49.118  30.603  1.00 33.56  ? 158 ASN A CA     1 
ATOM   2619  C  C      . ASN A 1 158 ? 22.101  48.660  29.763  1.00 29.57  ? 158 ASN A C      1 
ATOM   2620  O  O      . ASN A 1 158 ? 22.025  47.504  29.349  1.00 30.79  ? 158 ASN A O      1 
ATOM   2621  C  CB     . ASN A 1 158 ? 23.748  48.002  31.533  1.00 24.72  ? 158 ASN A CB     1 
ATOM   2622  C  CG     . ASN A 1 158 ? 25.041  48.344  32.240  1.00 39.80  ? 158 ASN A CG     1 
ATOM   2623  O  OD1    . ASN A 1 158 ? 26.127  48.048  31.744  1.00 47.03  ? 158 ASN A OD1    1 
ATOM   2624  N  ND2    . ASN A 1 158 ? 24.932  48.978  33.401  1.00 32.76  ? 158 ASN A ND2    1 
ATOM   2625  H  H      . ASN A 1 158 ? 22.378  50.170  32.000  1.00 42.83  ? 158 ASN A H      1 
ATOM   2626  H  HA     . ASN A 1 158 ? 24.014  49.328  30.001  1.00 40.28  ? 158 ASN A HA     1 
ATOM   2627  H  HB2    . ASN A 1 158 ? 23.068  47.847  32.207  1.00 29.67  ? 158 ASN A HB2    1 
ATOM   2628  H  HB3    . ASN A 1 158 ? 23.893  47.196  31.013  1.00 29.67  ? 158 ASN A HB3    1 
ATOM   2629  H  HD21   . ASN A 1 158 ? 25.639  49.194  33.841  1.00 39.32  ? 158 ASN A HD21   1 
ATOM   2630  H  HD22   . ASN A 1 158 ? 24.155  49.173  33.714  1.00 39.32  ? 158 ASN A HD22   1 
ATOM   2631  N  N      . GLY A 1 159 ? 21.182  49.587  29.514  1.00 28.34  ? 159 GLY A N      1 
ATOM   2632  C  CA     . GLY A 1 159 ? 20.093  49.373  28.580  1.00 34.59  ? 159 GLY A CA     1 
ATOM   2633  C  C      . GLY A 1 159 ? 19.182  48.193  28.854  1.00 29.92  ? 159 GLY A C      1 
ATOM   2634  O  O      . GLY A 1 159 ? 18.727  47.534  27.918  1.00 33.83  ? 159 GLY A O      1 
ATOM   2635  H  H      . GLY A 1 159 ? 21.172  50.363  29.883  1.00 34.01  ? 159 GLY A H      1 
ATOM   2636  H  HA2    . GLY A 1 159 ? 19.541  50.170  28.562  1.00 41.51  ? 159 GLY A HA2    1 
ATOM   2637  H  HA3    . GLY A 1 159 ? 20.467  49.253  27.693  1.00 41.51  ? 159 GLY A HA3    1 
ATOM   2638  N  N      . ILE A 1 160 ? 18.921  47.918  30.129  1.00 30.76  ? 160 ILE A N      1 
ATOM   2639  C  CA     . ILE A 1 160 ? 17.979  46.868  30.501  1.00 33.31  ? 160 ILE A CA     1 
ATOM   2640  C  C      . ILE A 1 160 ? 17.034  47.365  31.591  1.00 24.87  ? 160 ILE A C      1 
ATOM   2641  O  O      . ILE A 1 160 ? 16.570  46.589  32.423  1.00 18.59  ? 160 ILE A O      1 
ATOM   2642  C  CB     . ILE A 1 160 ? 18.705  45.588  30.974  1.00 32.07  ? 160 ILE A CB     1 
ATOM   2643  C  CG1    . ILE A 1 160 ? 19.680  45.906  32.108  1.00 24.20  ? 160 ILE A CG1    1 
ATOM   2644  C  CG2    . ILE A 1 160 ? 19.441  44.948  29.808  1.00 33.96  ? 160 ILE A CG2    1 
ATOM   2645  C  CD1    . ILE A 1 160 ? 20.268  44.677  32.773  1.00 25.22  ? 160 ILE A CD1    1 
ATOM   2646  H  H      . ILE A 1 160 ? 19.277  48.325  30.797  1.00 36.91  ? 160 ILE A H      1 
ATOM   2647  H  HA     . ILE A 1 160 ? 17.444  46.637  29.726  1.00 39.98  ? 160 ILE A HA     1 
ATOM   2648  H  HB     . ILE A 1 160 ? 18.042  44.961  31.304  1.00 38.49  ? 160 ILE A HB     1 
ATOM   2649  H  HG12   . ILE A 1 160 ? 20.415  46.429  31.751  1.00 29.04  ? 160 ILE A HG12   1 
ATOM   2650  H  HG13   . ILE A 1 160 ? 19.214  46.416  32.788  1.00 29.04  ? 160 ILE A HG13   1 
ATOM   2651  H  HG21   . ILE A 1 160 ? 19.891  44.147  30.120  1.00 40.75  ? 160 ILE A HG21   1 
ATOM   2652  H  HG22   . ILE A 1 160 ? 18.799  44.719  29.117  1.00 40.75  ? 160 ILE A HG22   1 
ATOM   2653  H  HG23   . ILE A 1 160 ? 20.091  45.578  29.460  1.00 40.75  ? 160 ILE A HG23   1 
ATOM   2654  H  HD11   . ILE A 1 160 ? 20.873  44.959  33.477  1.00 30.26  ? 160 ILE A HD11   1 
ATOM   2655  H  HD12   . ILE A 1 160 ? 19.548  44.147  33.148  1.00 30.26  ? 160 ILE A HD12   1 
ATOM   2656  H  HD13   . ILE A 1 160 ? 20.750  44.160  32.110  1.00 30.26  ? 160 ILE A HD13   1 
ATOM   2657  N  N      . TYR A 1 161 ? 16.772  48.669  31.586  1.00 27.79  ? 161 TYR A N      1 
ATOM   2658  C  CA     . TYR A 1 161 ? 15.767  49.258  32.463  1.00 32.88  ? 161 TYR A CA     1 
ATOM   2659  C  C      . TYR A 1 161 ? 14.486  49.485  31.664  1.00 30.02  ? 161 TYR A C      1 
ATOM   2660  O  O      . TYR A 1 161 ? 14.505  50.180  30.646  1.00 22.35  ? 161 TYR A O      1 
ATOM   2661  C  CB     . TYR A 1 161 ? 16.251  50.573  33.069  1.00 27.16  ? 161 TYR A CB     1 
ATOM   2662  C  CG     . TYR A 1 161 ? 15.238  51.195  33.996  1.00 27.15  ? 161 TYR A CG     1 
ATOM   2663  C  CD1    . TYR A 1 161 ? 14.822  50.526  35.139  1.00 35.69  ? 161 TYR A CD1    1 
ATOM   2664  C  CD2    . TYR A 1 161 ? 14.681  52.433  33.724  1.00 20.56  ? 161 TYR A CD2    1 
ATOM   2665  C  CE1    . TYR A 1 161 ? 13.893  51.076  35.992  1.00 30.01  ? 161 TYR A CE1    1 
ATOM   2666  C  CE2    . TYR A 1 161 ? 13.747  52.993  34.573  1.00 34.49  ? 161 TYR A CE2    1 
ATOM   2667  C  CZ     . TYR A 1 161 ? 13.357  52.308  35.707  1.00 36.94  ? 161 TYR A CZ     1 
ATOM   2668  O  OH     . TYR A 1 161 ? 12.428  52.852  36.561  1.00 40.91  ? 161 TYR A OH     1 
ATOM   2669  H  H      . TYR A 1 161 ? 17.167  49.240  31.078  1.00 33.35  ? 161 TYR A H      1 
ATOM   2670  H  HA     . TYR A 1 161 ? 15.571  48.642  33.187  1.00 39.45  ? 161 TYR A HA     1 
ATOM   2671  H  HB2    . TYR A 1 161 ? 17.061  50.408  33.577  1.00 32.59  ? 161 TYR A HB2    1 
ATOM   2672  H  HB3    . TYR A 1 161 ? 16.431  51.203  32.354  1.00 32.59  ? 161 TYR A HB3    1 
ATOM   2673  H  HD1    . TYR A 1 161 ? 15.183  49.692  35.336  1.00 42.83  ? 161 TYR A HD1    1 
ATOM   2674  H  HD2    . TYR A 1 161 ? 14.943  52.897  32.962  1.00 24.67  ? 161 TYR A HD2    1 
ATOM   2675  H  HE1    . TYR A 1 161 ? 13.628  50.616  36.756  1.00 36.01  ? 161 TYR A HE1    1 
ATOM   2676  H  HE2    . TYR A 1 161 ? 13.383  53.828  34.382  1.00 41.39  ? 161 TYR A HE2    1 
ATOM   2677  H  HH     . TYR A 1 161 ? 12.180  53.603  36.276  1.00 49.09  ? 161 TYR A HH     1 
ATOM   2678  N  N      . GLY A 1 162 ? 13.383  48.905  32.130  1.00 29.64  ? 162 GLY A N      1 
ATOM   2679  C  CA     . GLY A 1 162 ? 12.094  49.030  31.468  1.00 29.19  ? 162 GLY A CA     1 
ATOM   2680  C  C      . GLY A 1 162 ? 11.538  47.660  31.134  1.00 25.04  ? 162 GLY A C      1 
ATOM   2681  O  O      . GLY A 1 162 ? 12.254  46.806  30.615  1.00 31.12  ? 162 GLY A O      1 
ATOM   2682  H  H      . GLY A 1 162 ? 13.358  48.426  32.844  1.00 35.57  ? 162 GLY A H      1 
ATOM   2683  H  HA2    . GLY A 1 162 ? 11.467  49.490  32.049  1.00 35.03  ? 162 GLY A HA2    1 
ATOM   2684  H  HA3    . GLY A 1 162 ? 12.192  49.538  30.647  1.00 35.03  ? 162 GLY A HA3    1 
ATOM   2685  N  N      . ALA A 1 163 ? 10.258  47.453  31.418  1.00 22.03  ? 163 ALA A N      1 
ATOM   2686  C  CA     . ALA A 1 163 ? 9.591   46.191  31.105  1.00 25.48  ? 163 ALA A CA     1 
ATOM   2687  C  C      . ALA A 1 163 ? 8.932   46.214  29.733  1.00 31.49  ? 163 ALA A C      1 
ATOM   2688  O  O      . ALA A 1 163 ? 8.361   45.216  29.298  1.00 18.08  ? 163 ALA A O      1 
ATOM   2689  C  CB     . ALA A 1 163 ? 8.564   45.866  32.167  1.00 30.26  ? 163 ALA A CB     1 
ATOM   2690  H  H      . ALA A 1 163 ? 9.747   48.033  31.796  1.00 26.44  ? 163 ALA A H      1 
ATOM   2691  H  HA     . ALA A 1 163 ? 10.252  45.481  31.104  1.00 30.57  ? 163 ALA A HA     1 
ATOM   2692  H  HB1    . ALA A 1 163 ? 8.133   45.026  31.943  1.00 36.31  ? 163 ALA A HB1    1 
ATOM   2693  H  HB2    . ALA A 1 163 ? 9.010   45.789  33.025  1.00 36.31  ? 163 ALA A HB2    1 
ATOM   2694  H  HB3    . ALA A 1 163 ? 7.906   46.578  32.198  1.00 36.31  ? 163 ALA A HB3    1 
ATOM   2695  N  N      . GLU A 1 164 ? 8.999   47.359  29.061  1.00 35.06  ? 164 GLU A N      1 
ATOM   2696  C  CA     . GLU A 1 164 ? 8.428   47.499  27.728  1.00 26.30  ? 164 GLU A CA     1 
ATOM   2697  C  C      . GLU A 1 164 ? 9.050   46.517  26.737  1.00 31.95  ? 164 GLU A C      1 
ATOM   2698  O  O      . GLU A 1 164 ? 10.202  46.112  26.893  1.00 29.23  ? 164 GLU A O      1 
ATOM   2699  C  CB     . GLU A 1 164 ? 8.634   48.926  27.228  1.00 26.71  ? 164 GLU A CB     1 
ATOM   2700  C  CG     . GLU A 1 164 ? 10.099  49.342  27.171  1.00 28.01  ? 164 GLU A CG     1 
ATOM   2701  C  CD     . GLU A 1 164 ? 10.392  50.596  27.969  1.00 46.18  ? 164 GLU A CD     1 
ATOM   2702  O  OE1    . GLU A 1 164 ? 10.829  51.595  27.358  1.00 54.81  ? 164 GLU A OE1    1 
ATOM   2703  O  OE2    . GLU A 1 164 ? 10.196  50.582  29.205  1.00 44.60  ? 164 GLU A OE2    1 
ATOM   2704  H  H      . GLU A 1 164 ? 9.371   48.075  29.359  1.00 42.07  ? 164 GLU A H      1 
ATOM   2705  H  HA     . GLU A 1 164 ? 7.475   47.326  27.768  1.00 31.56  ? 164 GLU A HA     1 
ATOM   2706  H  HB2    . GLU A 1 164 ? 8.268   49.001  26.333  1.00 32.05  ? 164 GLU A HB2    1 
ATOM   2707  H  HB3    . GLU A 1 164 ? 8.174   49.537  27.825  1.00 32.05  ? 164 GLU A HB3    1 
ATOM   2708  H  HG2    . GLU A 1 164 ? 10.644  48.625  27.530  1.00 33.62  ? 164 GLU A HG2    1 
ATOM   2709  H  HG3    . GLU A 1 164 ? 10.342  49.512  26.247  1.00 33.62  ? 164 GLU A HG3    1 
ATOM   2710  N  N      . TYR A 1 165 ? 8.288   46.153  25.708  1.00 35.06  ? 165 TYR A N      1 
ATOM   2711  C  CA     . TYR A 1 165 ? 8.743   45.173  24.724  1.00 20.58  ? 165 TYR A CA     1 
ATOM   2712  C  C      . TYR A 1 165 ? 9.950   45.663  23.935  1.00 25.85  ? 165 TYR A C      1 
ATOM   2713  O  O      . TYR A 1 165 ? 10.612  44.875  23.259  1.00 29.15  ? 165 TYR A O      1 
ATOM   2714  C  CB     . TYR A 1 165 ? 7.617   44.812  23.755  1.00 17.15  ? 165 TYR A CB     1 
ATOM   2715  C  CG     . TYR A 1 165 ? 6.781   43.629  24.183  1.00 22.28  ? 165 TYR A CG     1 
ATOM   2716  C  CD1    . TYR A 1 165 ? 7.360   42.384  24.387  1.00 32.42  ? 165 TYR A CD1    1 
ATOM   2717  C  CD2    . TYR A 1 165 ? 5.410   43.746  24.351  1.00 18.14  ? 165 TYR A CD2    1 
ATOM   2718  C  CE1    . TYR A 1 165 ? 6.602   41.296  24.770  1.00 35.96  ? 165 TYR A CE1    1 
ATOM   2719  C  CE2    . TYR A 1 165 ? 4.641   42.663  24.733  1.00 20.66  ? 165 TYR A CE2    1 
ATOM   2720  C  CZ     . TYR A 1 165 ? 5.244   41.438  24.939  1.00 31.99  ? 165 TYR A CZ     1 
ATOM   2721  O  OH     . TYR A 1 165 ? 4.496   40.346  25.317  1.00 45.21  ? 165 TYR A OH     1 
ATOM   2722  H  H      . TYR A 1 165 ? 7.500   46.461  25.557  1.00 42.08  ? 165 TYR A H      1 
ATOM   2723  H  HA     . TYR A 1 165 ? 9.003   44.363  25.190  1.00 24.69  ? 165 TYR A HA     1 
ATOM   2724  H  HB2    . TYR A 1 165 ? 7.025   45.576  23.668  1.00 20.58  ? 165 TYR A HB2    1 
ATOM   2725  H  HB3    . TYR A 1 165 ? 8.007   44.601  22.892  1.00 20.58  ? 165 TYR A HB3    1 
ATOM   2726  H  HD1    . TYR A 1 165 ? 8.278   42.284  24.275  1.00 38.90  ? 165 TYR A HD1    1 
ATOM   2727  H  HD2    . TYR A 1 165 ? 5.002   44.570  24.214  1.00 21.77  ? 165 TYR A HD2    1 
ATOM   2728  H  HE1    . TYR A 1 165 ? 7.007   40.470  24.908  1.00 43.15  ? 165 TYR A HE1    1 
ATOM   2729  H  HE2    . TYR A 1 165 ? 3.723   42.758  24.847  1.00 24.79  ? 165 TYR A HE2    1 
ATOM   2730  H  HH     . TYR A 1 165 ? 3.687   40.562  25.386  1.00 54.25  ? 165 TYR A HH     1 
ATOM   2731  N  N      . LYS A 1 166 ? 10.219  46.963  23.991  1.00 19.25  ? 166 LYS A N      1 
ATOM   2732  C  CA     . LYS A 1 166 ? 11.408  47.511  23.349  1.00 12.69  ? 166 LYS A CA     1 
ATOM   2733  C  C      . LYS A 1 166 ? 12.659  47.131  24.135  1.00 22.74  ? 166 LYS A C      1 
ATOM   2734  O  O      . LYS A 1 166 ? 13.771  47.177  23.603  1.00 14.25  ? 166 LYS A O      1 
ATOM   2735  C  CB     . LYS A 1 166 ? 11.309  49.032  23.223  1.00 15.55  ? 166 LYS A CB     1 
ATOM   2736  C  CG     . LYS A 1 166 ? 12.372  49.648  22.319  1.00 12.00  ? 166 LYS A CG     1 
ATOM   2737  C  CD     . LYS A 1 166 ? 12.258  51.162  22.273  1.00 22.62  ? 166 LYS A CD     1 
ATOM   2738  C  CE     . LYS A 1 166 ? 13.235  51.772  21.280  1.00 22.50  ? 166 LYS A CE     1 
ATOM   2739  N  NZ     . LYS A 1 166 ? 14.613  51.226  21.420  1.00 36.35  ? 166 LYS A NZ     1 
ATOM   2740  H  H      . LYS A 1 166 ? 9.732   47.547  24.393  1.00 23.10  ? 166 LYS A H      1 
ATOM   2741  H  HA     . LYS A 1 166 ? 11.487  47.138  22.456  1.00 15.22  ? 166 LYS A HA     1 
ATOM   2742  H  HB2    . LYS A 1 166 ? 10.441  49.260  22.856  1.00 18.66  ? 166 LYS A HB2    1 
ATOM   2743  H  HB3    . LYS A 1 166 ? 11.407  49.425  24.104  1.00 18.66  ? 166 LYS A HB3    1 
ATOM   2744  H  HG2    . LYS A 1 166 ? 13.251  49.419  22.658  1.00 14.40  ? 166 LYS A HG2    1 
ATOM   2745  H  HG3    . LYS A 1 166 ? 12.261  49.307  21.418  1.00 14.40  ? 166 LYS A HG3    1 
ATOM   2746  H  HD2    . LYS A 1 166 ? 11.359  51.406  22.003  1.00 27.14  ? 166 LYS A HD2    1 
ATOM   2747  H  HD3    . LYS A 1 166 ? 12.453  51.523  23.152  1.00 27.14  ? 166 LYS A HD3    1 
ATOM   2748  H  HE2    . LYS A 1 166 ? 12.928  51.584  20.379  1.00 27.00  ? 166 LYS A HE2    1 
ATOM   2749  H  HE3    . LYS A 1 166 ? 13.275  52.730  21.425  1.00 27.00  ? 166 LYS A HE3    1 
ATOM   2750  H  HZ1    . LYS A 1 166 ? 15.153  51.607  20.824  1.00 43.62  ? 166 LYS A HZ1    1 
ATOM   2751  H  HZ2    . LYS A 1 166 ? 14.924  51.391  22.238  1.00 43.62  ? 166 LYS A HZ2    1 
ATOM   2752  H  HZ3    . LYS A 1 166 ? 14.608  50.347  21.285  1.00 43.62  ? 166 LYS A HZ3    1 
ATOM   2753  N  N      . VAL A 1 167 ? 12.467  46.737  25.394  1.00 28.68  ? 167 VAL A N      1 
ATOM   2754  C  CA     . VAL A 1 167 ? 13.580  46.498  26.307  1.00 23.03  ? 167 VAL A CA     1 
ATOM   2755  C  C      . VAL A 1 167 ? 13.560  45.088  26.891  1.00 15.17  ? 167 VAL A C      1 
ATOM   2756  O  O      . VAL A 1 167 ? 14.590  44.419  26.937  1.00 22.93  ? 167 VAL A O      1 
ATOM   2757  C  CB     . VAL A 1 167 ? 13.564  47.516  27.467  1.00 13.51  ? 167 VAL A CB     1 
ATOM   2758  C  CG1    . VAL A 1 167 ? 14.784  47.341  28.355  1.00 19.79  ? 167 VAL A CG1    1 
ATOM   2759  C  CG2    . VAL A 1 167 ? 13.523  48.930  26.924  1.00 14.64  ? 167 VAL A CG2    1 
ATOM   2760  H  H      . VAL A 1 167 ? 11.694  46.600  25.745  1.00 34.41  ? 167 VAL A H      1 
ATOM   2761  H  HA     . VAL A 1 167 ? 14.413  46.609  25.823  1.00 27.64  ? 167 VAL A HA     1 
ATOM   2762  H  HB     . VAL A 1 167 ? 12.771  47.374  28.007  1.00 16.21  ? 167 VAL A HB     1 
ATOM   2763  H  HG11   . VAL A 1 167 ? 14.747  47.992  29.073  1.00 23.74  ? 167 VAL A HG11   1 
ATOM   2764  H  HG12   . VAL A 1 167 ? 14.781  46.443  28.722  1.00 23.74  ? 167 VAL A HG12   1 
ATOM   2765  H  HG13   . VAL A 1 167 ? 15.584  47.479  27.823  1.00 23.74  ? 167 VAL A HG13   1 
ATOM   2766  H  HG21   . VAL A 1 167 ? 13.513  49.553  27.667  1.00 17.56  ? 167 VAL A HG21   1 
ATOM   2767  H  HG22   . VAL A 1 167 ? 14.309  49.080  26.376  1.00 17.56  ? 167 VAL A HG22   1 
ATOM   2768  H  HG23   . VAL A 1 167 ? 12.721  49.039  26.389  1.00 17.56  ? 167 VAL A HG23   1 
ATOM   2769  N  N      . ARG A 1 168 ? 12.388  44.645  27.332  1.00 20.99  ? 168 ARG A N      1 
ATOM   2770  C  CA     . ARG A 1 168 ? 12.253  43.375  28.046  1.00 26.45  ? 168 ARG A CA     1 
ATOM   2771  C  C      . ARG A 1 168 ? 13.198  43.334  29.246  1.00 28.04  ? 168 ARG A C      1 
ATOM   2772  O  O      . ARG A 1 168 ? 13.940  42.370  29.424  1.00 22.52  ? 168 ARG A O      1 
ATOM   2773  C  CB     . ARG A 1 168 ? 12.522  42.185  27.121  1.00 18.40  ? 168 ARG A CB     1 
ATOM   2774  C  CG     . ARG A 1 168 ? 11.527  42.035  25.991  1.00 26.68  ? 168 ARG A CG     1 
ATOM   2775  C  CD     . ARG A 1 168 ? 11.900  40.879  25.075  1.00 33.74  ? 168 ARG A CD     1 
ATOM   2776  N  NE     . ARG A 1 168 ? 10.823  40.552  24.144  1.00 28.54  ? 168 ARG A NE     1 
ATOM   2777  C  CZ     . ARG A 1 168 ? 9.794   39.759  24.433  1.00 36.21  ? 168 ARG A CZ     1 
ATOM   2778  N  NH1    . ARG A 1 168 ? 9.692   39.199  25.632  1.00 49.40  ? 168 ARG A NH1    1 
ATOM   2779  N  NH2    . ARG A 1 168 ? 8.862   39.522  23.521  1.00 21.24  ? 168 ARG A NH2    1 
ATOM   2780  H  H      . ARG A 1 168 ? 11.645  45.065  27.229  1.00 25.19  ? 168 ARG A H      1 
ATOM   2781  H  HA     . ARG A 1 168 ? 11.345  43.296  28.377  1.00 31.74  ? 168 ARG A HA     1 
ATOM   2782  H  HB2    . ARG A 1 168 ? 13.402  42.291  26.727  1.00 22.07  ? 168 ARG A HB2    1 
ATOM   2783  H  HB3    . ARG A 1 168 ? 12.496  41.371  27.647  1.00 22.07  ? 168 ARG A HB3    1 
ATOM   2784  H  HG2    . ARG A 1 168 ? 10.647  41.861  26.359  1.00 32.01  ? 168 ARG A HG2    1 
ATOM   2785  H  HG3    . ARG A 1 168 ? 11.516  42.850  25.464  1.00 32.01  ? 168 ARG A HG3    1 
ATOM   2786  H  HD2    . ARG A 1 168 ? 12.684  41.122  24.558  1.00 40.49  ? 168 ARG A HD2    1 
ATOM   2787  H  HD3    . ARG A 1 168 ? 12.084  40.093  25.612  1.00 40.49  ? 168 ARG A HD3    1 
ATOM   2788  H  HE     . ARG A 1 168 ? 10.855  40.896  23.356  1.00 34.24  ? 168 ARG A HE     1 
ATOM   2789  H  HH11   . ARG A 1 168 ? 10.293  39.349  26.229  1.00 59.28  ? 168 ARG A HH11   1 
ATOM   2790  H  HH12   . ARG A 1 168 ? 9.025   38.687  25.813  1.00 59.28  ? 168 ARG A HH12   1 
ATOM   2791  H  HH21   . ARG A 1 168 ? 8.922   39.881  22.741  1.00 25.49  ? 168 ARG A HH21   1 
ATOM   2792  H  HH22   . ARG A 1 168 ? 8.198   39.008  23.708  1.00 25.49  ? 168 ARG A HH22   1 
ATOM   2793  N  N      . GLY A 1 169 ? 13.171  44.394  30.053  1.00 35.27  ? 169 GLY A N      1 
ATOM   2794  C  CA     . GLY A 1 169 ? 14.040  44.515  31.213  1.00 34.99  ? 169 GLY A CA     1 
ATOM   2795  C  C      . GLY A 1 169 ? 13.300  44.598  32.539  1.00 42.26  ? 169 GLY A C      1 
ATOM   2796  O  O      . GLY A 1 169 ? 12.225  44.021  32.708  1.00 41.91  ? 169 GLY A O      1 
ATOM   2797  H  H      . GLY A 1 169 ? 12.646  45.067  29.943  1.00 42.33  ? 169 GLY A H      1 
ATOM   2798  H  HA2    . GLY A 1 169 ? 14.633  43.748  31.247  1.00 41.99  ? 169 GLY A HA2    1 
ATOM   2799  H  HA3    . GLY A 1 169 ? 14.583  45.313  31.121  1.00 41.99  ? 169 GLY A HA3    1 
ATOM   2800  N  N      . PHE A 1 170 ? 13.882  45.339  33.478  1.00 35.30  ? 170 PHE A N      1 
ATOM   2801  C  CA     . PHE A 1 170 ? 13.338  45.462  34.826  1.00 32.20  ? 170 PHE A CA     1 
ATOM   2802  C  C      . PHE A 1 170 ? 12.441  46.683  34.972  1.00 32.60  ? 170 PHE A C      1 
ATOM   2803  O  O      . PHE A 1 170 ? 12.895  47.813  34.806  1.00 35.82  ? 170 PHE A O      1 
ATOM   2804  C  CB     . PHE A 1 170 ? 14.468  45.557  35.851  1.00 44.11  ? 170 PHE A CB     1 
ATOM   2805  C  CG     . PHE A 1 170 ? 15.365  44.354  35.893  1.00 37.69  ? 170 PHE A CG     1 
ATOM   2806  C  CD1    . PHE A 1 170 ? 16.385  44.197  34.974  1.00 35.29  ? 170 PHE A CD1    1 
ATOM   2807  C  CD2    . PHE A 1 170 ? 15.211  43.399  36.881  1.00 29.88  ? 170 PHE A CD2    1 
ATOM   2808  C  CE1    . PHE A 1 170 ? 17.213  43.099  35.024  1.00 36.16  ? 170 PHE A CE1    1 
ATOM   2809  C  CE2    . PHE A 1 170 ? 16.040  42.301  36.937  1.00 29.10  ? 170 PHE A CE2    1 
ATOM   2810  C  CZ     . PHE A 1 170 ? 17.041  42.151  36.009  1.00 36.56  ? 170 PHE A CZ     1 
ATOM   2811  H  H      . PHE A 1 170 ? 14.606  45.787  33.356  1.00 42.36  ? 170 PHE A H      1 
ATOM   2812  H  HA     . PHE A 1 170 ? 12.811  44.674  35.030  1.00 38.64  ? 170 PHE A HA     1 
ATOM   2813  H  HB2    . PHE A 1 170 ? 15.018  46.327  35.637  1.00 52.93  ? 170 PHE A HB2    1 
ATOM   2814  H  HB3    . PHE A 1 170 ? 14.080  45.667  36.733  1.00 52.93  ? 170 PHE A HB3    1 
ATOM   2815  H  HD1    . PHE A 1 170 ? 16.505  44.833  34.306  1.00 42.35  ? 170 PHE A HD1    1 
ATOM   2816  H  HD2    . PHE A 1 170 ? 14.534  43.495  37.511  1.00 35.86  ? 170 PHE A HD2    1 
ATOM   2817  H  HE1    . PHE A 1 170 ? 17.892  42.999  34.396  1.00 43.39  ? 170 PHE A HE1    1 
ATOM   2818  H  HE2    . PHE A 1 170 ? 15.921  41.661  37.602  1.00 34.92  ? 170 PHE A HE2    1 
ATOM   2819  H  HZ     . PHE A 1 170 ? 17.601  41.409  36.044  1.00 43.87  ? 170 PHE A HZ     1 
ATOM   2820  N  N      . SER A 1 171 ? 11.171  46.455  35.290  1.00 28.76  ? 171 SER A N      1 
ATOM   2821  C  CA     . SER A 1 171 ? 10.244  47.553  35.534  1.00 30.79  ? 171 SER A CA     1 
ATOM   2822  C  C      . SER A 1 171 ? 10.691  48.358  36.747  1.00 25.86  ? 171 SER A C      1 
ATOM   2823  O  O      . SER A 1 171 ? 11.356  47.836  37.635  1.00 25.79  ? 171 SER A O      1 
ATOM   2824  C  CB     . SER A 1 171 ? 8.821   47.032  35.744  1.00 31.17  ? 171 SER A CB     1 
ATOM   2825  O  OG     . SER A 1 171 ? 8.767   46.082  36.792  1.00 29.12  ? 171 SER A OG     1 
ATOM   2826  H  H      . SER A 1 171 ? 10.822  45.674  35.371  1.00 34.51  ? 171 SER A H      1 
ATOM   2827  H  HA     . SER A 1 171 ? 10.240  48.143  34.765  1.00 36.95  ? 171 SER A HA     1 
ATOM   2828  H  HB2    . SER A 1 171 ? 8.243   47.778  35.967  1.00 37.41  ? 171 SER A HB2    1 
ATOM   2829  H  HB3    . SER A 1 171 ? 8.517   46.612  34.924  1.00 37.41  ? 171 SER A HB3    1 
ATOM   2830  H  HG     . SER A 1 171 ? 7.980   45.808  36.891  1.00 34.95  ? 171 SER A HG     1 
ATOM   2831  N  N      . GLY A 1 172 ? 10.332  49.635  36.773  1.00 31.01  ? 172 GLY A N      1 
ATOM   2832  C  CA     . GLY A 1 172 ? 10.691  50.499  37.881  1.00 48.78  ? 172 GLY A CA     1 
ATOM   2833  C  C      . GLY A 1 172 ? 10.130  50.023  39.210  1.00 45.02  ? 172 GLY A C      1 
ATOM   2834  O  O      . GLY A 1 172 ? 10.683  50.323  40.266  1.00 40.40  ? 172 GLY A O      1 
ATOM   2835  H  H      . GLY A 1 172 ? 9.878   50.025  36.156  1.00 37.21  ? 172 GLY A H      1 
ATOM   2836  H  HA2    . GLY A 1 172 ? 11.657  50.541  37.956  1.00 58.53  ? 172 GLY A HA2    1 
ATOM   2837  H  HA3    . GLY A 1 172 ? 10.357  51.393  37.712  1.00 58.53  ? 172 GLY A HA3    1 
ATOM   2838  N  N      . TYR A 1 173 ? 9.029   49.279  39.157  1.00 47.71  ? 173 TYR A N      1 
ATOM   2839  C  CA     . TYR A 1 173 ? 8.411   48.741  40.364  1.00 37.09  ? 173 TYR A CA     1 
ATOM   2840  C  C      . TYR A 1 173 ? 9.160   47.502  40.836  1.00 35.88  ? 173 TYR A C      1 
ATOM   2841  O  O      . TYR A 1 173 ? 9.292   47.265  42.034  1.00 38.12  ? 173 TYR A O      1 
ATOM   2842  C  CB     . TYR A 1 173 ? 6.937   48.417  40.107  1.00 41.67  ? 173 TYR A CB     1 
ATOM   2843  C  CG     . TYR A 1 173 ? 6.257   47.654  41.222  1.00 43.94  ? 173 TYR A CG     1 
ATOM   2844  C  CD1    . TYR A 1 173 ? 6.099   48.219  42.481  1.00 34.90  ? 173 TYR A CD1    1 
ATOM   2845  C  CD2    . TYR A 1 173 ? 5.754   46.376  41.010  1.00 38.78  ? 173 TYR A CD2    1 
ATOM   2846  C  CE1    . TYR A 1 173 ? 5.473   47.528  43.502  1.00 30.30  ? 173 TYR A CE1    1 
ATOM   2847  C  CE2    . TYR A 1 173 ? 5.125   45.678  42.023  1.00 40.24  ? 173 TYR A CE2    1 
ATOM   2848  C  CZ     . TYR A 1 173 ? 4.987   46.259  43.268  1.00 39.98  ? 173 TYR A CZ     1 
ATOM   2849  O  OH     . TYR A 1 173 ? 4.360   45.571  44.284  1.00 31.77  ? 173 TYR A OH     1 
ATOM   2850  H  H      . TYR A 1 173 ? 8.618   49.071  38.431  1.00 57.26  ? 173 TYR A H      1 
ATOM   2851  H  HA     . TYR A 1 173 ? 8.455   49.407  41.068  1.00 44.51  ? 173 TYR A HA     1 
ATOM   2852  H  HB2    . TYR A 1 173 ? 6.454   49.248  39.983  1.00 50.01  ? 173 TYR A HB2    1 
ATOM   2853  H  HB3    . TYR A 1 173 ? 6.874   47.879  39.302  1.00 50.01  ? 173 TYR A HB3    1 
ATOM   2854  H  HD1    . TYR A 1 173 ? 6.427   49.074  42.642  1.00 41.88  ? 173 TYR A HD1    1 
ATOM   2855  H  HD2    . TYR A 1 173 ? 5.846   45.982  40.173  1.00 46.53  ? 173 TYR A HD2    1 
ATOM   2856  H  HE1    . TYR A 1 173 ? 5.378   47.918  44.341  1.00 36.36  ? 173 TYR A HE1    1 
ATOM   2857  H  HE2    . TYR A 1 173 ? 4.797   44.822  41.867  1.00 48.29  ? 173 TYR A HE2    1 
ATOM   2858  H  HH     . TYR A 1 173 ? 4.114   44.816  44.010  1.00 38.13  ? 173 TYR A HH     1 
ATOM   2859  N  N      . LEU A 1 174 ? 9.664   46.722  39.887  1.00 41.40  ? 174 LEU A N      1 
ATOM   2860  C  CA     . LEU A 1 174 ? 10.459  45.545  40.209  1.00 39.88  ? 174 LEU A CA     1 
ATOM   2861  C  C      . LEU A 1 174 ? 11.726  45.946  40.948  1.00 39.61  ? 174 LEU A C      1 
ATOM   2862  O  O      . LEU A 1 174 ? 12.198  45.227  41.823  1.00 36.31  ? 174 LEU A O      1 
ATOM   2863  C  CB     . LEU A 1 174 ? 10.817  44.770  38.939  1.00 45.00  ? 174 LEU A CB     1 
ATOM   2864  C  CG     . LEU A 1 174 ? 11.757  43.571  39.102  1.00 31.42  ? 174 LEU A CG     1 
ATOM   2865  C  CD1    . LEU A 1 174 ? 11.239  42.590  40.135  1.00 37.27  ? 174 LEU A CD1    1 
ATOM   2866  C  CD2    . LEU A 1 174 ? 11.954  42.878  37.769  1.00 23.03  ? 174 LEU A CD2    1 
ATOM   2867  H  H      . LEU A 1 174 ? 9.559   46.854  39.043  1.00 49.68  ? 174 LEU A H      1 
ATOM   2868  H  HA     . LEU A 1 174 ? 9.944   44.960  40.786  1.00 47.86  ? 174 LEU A HA     1 
ATOM   2869  H  HB2    . LEU A 1 174 ? 9.995   44.437  38.546  1.00 54.00  ? 174 LEU A HB2    1 
ATOM   2870  H  HB3    . LEU A 1 174 ? 11.241  45.384  38.320  1.00 54.00  ? 174 LEU A HB3    1 
ATOM   2871  H  HG     . LEU A 1 174 ? 12.622  43.890  39.402  1.00 37.70  ? 174 LEU A HG     1 
ATOM   2872  H  HD11   . LEU A 1 174 ? 11.862  41.850  40.206  1.00 44.72  ? 174 LEU A HD11   1 
ATOM   2873  H  HD12   . LEU A 1 174 ? 11.164  43.043  40.990  1.00 44.72  ? 174 LEU A HD12   1 
ATOM   2874  H  HD13   . LEU A 1 174 ? 10.370  42.266  39.854  1.00 44.72  ? 174 LEU A HD13   1 
ATOM   2875  H  HD21   . LEU A 1 174 ? 12.550  42.123  37.892  1.00 27.64  ? 174 LEU A HD21   1 
ATOM   2876  H  HD22   . LEU A 1 174 ? 11.093  42.571  37.444  1.00 27.64  ? 174 LEU A HD22   1 
ATOM   2877  H  HD23   . LEU A 1 174 ? 12.340  43.507  37.141  1.00 27.64  ? 174 LEU A HD23   1 
ATOM   2878  N  N      . CYS A 1 175 ? 12.276  47.101  40.594  1.00 38.05  ? 175 CYS A N      1 
ATOM   2879  C  CA     . CYS A 1 175 ? 13.485  47.580  41.240  1.00 27.74  ? 175 CYS A CA     1 
ATOM   2880  C  C      . CYS A 1 175 ? 13.233  47.909  42.695  1.00 41.66  ? 175 CYS A C      1 
ATOM   2881  O  O      . CYS A 1 175 ? 14.026  47.554  43.563  1.00 47.81  ? 175 CYS A O      1 
ATOM   2882  C  CB     . CYS A 1 175 ? 14.018  48.812  40.522  1.00 27.41  ? 175 CYS A CB     1 
ATOM   2883  S  SG     . CYS A 1 175 ? 14.735  48.428  38.930  1.00 22.85  ? 175 CYS A SG     1 
ATOM   2884  H  H      . CYS A 1 175 ? 11.968  47.624  39.985  1.00 45.66  ? 175 CYS A H      1 
ATOM   2885  H  HA     . CYS A 1 175 ? 14.164  46.888  41.199  1.00 33.29  ? 175 CYS A HA     1 
ATOM   2886  H  HB2    . CYS A 1 175 ? 13.289  49.435  40.379  1.00 32.89  ? 175 CYS A HB2    1 
ATOM   2887  H  HB3    . CYS A 1 175 ? 14.705  49.224  41.069  1.00 32.89  ? 175 CYS A HB3    1 
ATOM   2888  H  HG     . CYS A 1 175 ? 15.132  49.442  38.426  1.00 27.42  ? 175 CYS A HG     1 
ATOM   2889  N  N      . GLU A 1 176 ? 12.110  48.565  42.959  1.00 43.32  ? 176 GLU A N      1 
ATOM   2890  C  CA     . GLU A 1 176 ? 11.768  48.958  44.316  1.00 29.48  ? 176 GLU A CA     1 
ATOM   2891  C  C      . GLU A 1 176 ? 11.553  47.732  45.191  1.00 21.49  ? 176 GLU A C      1 
ATOM   2892  O  O      . GLU A 1 176 ? 12.007  47.698  46.328  1.00 31.57  ? 176 GLU A O      1 
ATOM   2893  C  CB     . GLU A 1 176 ? 10.530  49.854  44.318  1.00 32.17  ? 176 GLU A CB     1 
ATOM   2894  C  CG     . GLU A 1 176 ? 10.773  51.221  43.684  1.00 44.27  ? 176 GLU A CG     1 
ATOM   2895  C  CD     . GLU A 1 176 ? 9.533   52.097  43.639  1.00 50.27  ? 176 GLU A CD     1 
ATOM   2896  O  OE1    . GLU A 1 176 ? 9.520   53.130  44.339  1.00 50.13  ? 176 GLU A OE1    1 
ATOM   2897  O  OE2    . GLU A 1 176 ? 8.576   51.761  42.909  1.00 50.43  ? 176 GLU A OE2    1 
ATOM   2898  H  H      . GLU A 1 176 ? 11.529  48.795  42.368  1.00 51.99  ? 176 GLU A H      1 
ATOM   2899  H  HA     . GLU A 1 176 ? 12.504  49.467  44.691  1.00 35.37  ? 176 GLU A HA     1 
ATOM   2900  H  HB2    . GLU A 1 176 ? 9.824   49.414  43.817  1.00 38.60  ? 176 GLU A HB2    1 
ATOM   2901  H  HB3    . GLU A 1 176 ? 10.246  49.996  45.234  1.00 38.60  ? 176 GLU A HB3    1 
ATOM   2902  H  HG2    . GLU A 1 176 ? 11.450  51.689  44.198  1.00 53.12  ? 176 GLU A HG2    1 
ATOM   2903  H  HG3    . GLU A 1 176 ? 11.081  51.094  42.773  1.00 53.12  ? 176 GLU A HG3    1 
ATOM   2904  N  N      . LEU A 1 177 ? 10.883  46.720  44.650  1.00 32.28  ? 177 LEU A N      1 
ATOM   2905  C  CA     . LEU A 1 177 ? 10.652  45.474  45.376  1.00 30.41  ? 177 LEU A CA     1 
ATOM   2906  C  C      . LEU A 1 177 ? 11.962  44.775  45.727  1.00 34.41  ? 177 LEU A C      1 
ATOM   2907  O  O      . LEU A 1 177 ? 12.077  44.151  46.782  1.00 42.72  ? 177 LEU A O      1 
ATOM   2908  C  CB     . LEU A 1 177 ? 9.775   44.528  44.551  1.00 24.49  ? 177 LEU A CB     1 
ATOM   2909  C  CG     . LEU A 1 177 ? 8.284   44.841  44.427  1.00 27.96  ? 177 LEU A CG     1 
ATOM   2910  C  CD1    . LEU A 1 177 ? 7.597   43.728  43.662  1.00 34.22  ? 177 LEU A CD1    1 
ATOM   2911  C  CD2    . LEU A 1 177 ? 7.626   45.022  45.784  1.00 41.97  ? 177 LEU A CD2    1 
ATOM   2912  H  H      . LEU A 1 177 ? 10.548  46.730  43.857  1.00 38.73  ? 177 LEU A H      1 
ATOM   2913  H  HA     . LEU A 1 177 ? 10.185  45.672  46.203  1.00 36.49  ? 177 LEU A HA     1 
ATOM   2914  H  HB2    . LEU A 1 177 ? 10.133  44.504  43.649  1.00 29.39  ? 177 LEU A HB2    1 
ATOM   2915  H  HB3    . LEU A 1 177 ? 9.845   43.643  44.941  1.00 29.39  ? 177 LEU A HB3    1 
ATOM   2916  H  HG     . LEU A 1 177 ? 8.172   45.664  43.926  1.00 33.55  ? 177 LEU A HG     1 
ATOM   2917  H  HD11   . LEU A 1 177 ? 6.652   43.933  43.587  1.00 41.06  ? 177 LEU A HD11   1 
ATOM   2918  H  HD12   . LEU A 1 177 ? 7.992   43.662  42.778  1.00 41.06  ? 177 LEU A HD12   1 
ATOM   2919  H  HD13   . LEU A 1 177 ? 7.718   42.894  44.142  1.00 41.06  ? 177 LEU A HD13   1 
ATOM   2920  H  HD21   . LEU A 1 177 ? 6.685   45.217  45.654  1.00 50.36  ? 177 LEU A HD21   1 
ATOM   2921  H  HD22   . LEU A 1 177 ? 7.727   44.204  46.295  1.00 50.36  ? 177 LEU A HD22   1 
ATOM   2922  H  HD23   . LEU A 1 177 ? 8.056   45.757  46.247  1.00 50.36  ? 177 LEU A HD23   1 
ATOM   2923  N  N      . LEU A 1 178 ? 12.949  44.879  44.844  1.00 38.46  ? 178 LEU A N      1 
ATOM   2924  C  CA     . LEU A 1 178 ? 14.234  44.231  45.067  1.00 30.07  ? 178 LEU A CA     1 
ATOM   2925  C  C      . LEU A 1 178 ? 14.998  44.916  46.190  1.00 29.44  ? 178 LEU A C      1 
ATOM   2926  O  O      . LEU A 1 178 ? 15.751  44.271  46.911  1.00 36.37  ? 178 LEU A O      1 
ATOM   2927  C  CB     . LEU A 1 178 ? 15.071  44.224  43.787  1.00 34.36  ? 178 LEU A CB     1 
ATOM   2928  C  CG     . LEU A 1 178 ? 14.656  43.247  42.685  1.00 20.77  ? 178 LEU A CG     1 
ATOM   2929  C  CD1    . LEU A 1 178 ? 15.652  43.301  41.553  1.00 26.13  ? 178 LEU A CD1    1 
ATOM   2930  C  CD2    . LEU A 1 178 ? 14.546  41.823  43.198  1.00 31.88  ? 178 LEU A CD2    1 
ATOM   2931  H  H      . LEU A 1 178 ? 12.899  45.320  44.107  1.00 46.15  ? 178 LEU A H      1 
ATOM   2932  H  HA     . LEU A 1 178 ? 14.080  43.310  45.329  1.00 36.09  ? 178 LEU A HA     1 
ATOM   2933  H  HB2    . LEU A 1 178 ? 15.042  45.114  43.404  1.00 41.23  ? 178 LEU A HB2    1 
ATOM   2934  H  HB3    . LEU A 1 178 ? 15.986  44.010  44.028  1.00 41.23  ? 178 LEU A HB3    1 
ATOM   2935  H  HG     . LEU A 1 178 ? 13.790  43.510  42.336  1.00 24.92  ? 178 LEU A HG     1 
ATOM   2936  H  HD11   . LEU A 1 178 ? 15.379  42.679  40.861  1.00 31.36  ? 178 LEU A HD11   1 
ATOM   2937  H  HD12   . LEU A 1 178 ? 15.675  44.203  41.196  1.00 31.36  ? 178 LEU A HD12   1 
ATOM   2938  H  HD13   . LEU A 1 178 ? 16.528  43.057  41.891  1.00 31.36  ? 178 LEU A HD13   1 
ATOM   2939  H  HD21   . LEU A 1 178 ? 14.283  41.244  42.466  1.00 38.26  ? 178 LEU A HD21   1 
ATOM   2940  H  HD22   . LEU A 1 178 ? 15.409  41.546  43.546  1.00 38.26  ? 178 LEU A HD22   1 
ATOM   2941  H  HD23   . LEU A 1 178 ? 13.880  41.792  43.902  1.00 38.26  ? 178 LEU A HD23   1 
ATOM   2942  N  N      . ILE A 1 179 ? 14.812  46.225  46.327  1.00 35.19  ? 179 ILE A N      1 
ATOM   2943  C  CA     . ILE A 1 179 ? 15.447  46.982  47.402  1.00 31.72  ? 179 ILE A CA     1 
ATOM   2944  C  C      . ILE A 1 179 ? 14.793  46.674  48.750  1.00 29.66  ? 179 ILE A C      1 
ATOM   2945  O  O      . ILE A 1 179 ? 15.473  46.578  49.769  1.00 47.42  ? 179 ILE A O      1 
ATOM   2946  C  CB     . ILE A 1 179 ? 15.382  48.500  47.132  1.00 30.88  ? 179 ILE A CB     1 
ATOM   2947  C  CG1    . ILE A 1 179 ? 16.141  48.854  45.850  1.00 24.12  ? 179 ILE A CG1    1 
ATOM   2948  C  CG2    . ILE A 1 179 ? 15.962  49.291  48.299  1.00 49.39  ? 179 ILE A CG2    1 
ATOM   2949  C  CD1    . ILE A 1 179 ? 17.605  48.465  45.845  1.00 27.10  ? 179 ILE A CD1    1 
ATOM   2950  H  H      . ILE A 1 179 ? 14.318  46.702  45.808  1.00 42.22  ? 179 ILE A H      1 
ATOM   2951  H  HA     . ILE A 1 179 ? 16.381  46.728  47.457  1.00 38.07  ? 179 ILE A HA     1 
ATOM   2952  H  HB     . ILE A 1 179 ? 14.453  48.753  47.019  1.00 37.06  ? 179 ILE A HB     1 
ATOM   2953  H  HG12   . ILE A 1 179 ? 15.716  48.402  45.105  1.00 28.94  ? 179 ILE A HG12   1 
ATOM   2954  H  HG13   . ILE A 1 179 ? 16.093  49.814  45.719  1.00 28.94  ? 179 ILE A HG13   1 
ATOM   2955  H  HG21   . ILE A 1 179 ? 15.905  50.238  48.097  1.00 59.27  ? 179 ILE A HG21   1 
ATOM   2956  H  HG22   . ILE A 1 179 ? 15.451  49.092  49.099  1.00 59.27  ? 179 ILE A HG22   1 
ATOM   2957  H  HG23   . ILE A 1 179 ? 16.888  49.034  48.425  1.00 59.27  ? 179 ILE A HG23   1 
ATOM   2958  H  HD11   . ILE A 1 179 ? 17.998  48.728  44.999  1.00 32.52  ? 179 ILE A HD11   1 
ATOM   2959  H  HD12   . ILE A 1 179 ? 18.054  48.919  46.575  1.00 32.52  ? 179 ILE A HD12   1 
ATOM   2960  H  HD13   . ILE A 1 179 ? 17.676  47.504  45.959  1.00 32.52  ? 179 ILE A HD13   1 
ATOM   2961  N  N      . VAL A 1 180 ? 13.475  46.516  48.754  1.00 26.81  ? 180 VAL A N      1 
ATOM   2962  C  CA     . VAL A 1 180 ? 12.761  46.160  49.971  1.00 28.76  ? 180 VAL A CA     1 
ATOM   2963  C  C      . VAL A 1 180 ? 13.165  44.764  50.434  1.00 32.41  ? 180 VAL A C      1 
ATOM   2964  O  O      . VAL A 1 180 ? 13.198  44.488  51.631  1.00 51.54  ? 180 VAL A O      1 
ATOM   2965  C  CB     . VAL A 1 180 ? 11.232  46.226  49.765  1.00 30.70  ? 180 VAL A CB     1 
ATOM   2966  C  CG1    . VAL A 1 180 ? 10.487  45.737  51.001  1.00 35.49  ? 180 VAL A CG1    1 
ATOM   2967  C  CG2    . VAL A 1 180 ? 10.806  47.644  49.430  1.00 27.42  ? 180 VAL A CG2    1 
ATOM   2968  H  H      . VAL A 1 180 ? 12.971  46.610  48.064  1.00 32.18  ? 180 VAL A H      1 
ATOM   2969  H  HA     . VAL A 1 180 ? 12.996  46.789  50.671  1.00 34.51  ? 180 VAL A HA     1 
ATOM   2970  H  HB     . VAL A 1 180 ? 10.988  45.654  49.021  1.00 36.84  ? 180 VAL A HB     1 
ATOM   2971  H  HG11   . VAL A 1 180 ? 9.533   45.791  50.837  1.00 42.59  ? 180 VAL A HG11   1 
ATOM   2972  H  HG12   . VAL A 1 180 ? 10.741  44.817  51.179  1.00 42.59  ? 180 VAL A HG12   1 
ATOM   2973  H  HG13   . VAL A 1 180 ? 10.726  46.298  51.756  1.00 42.59  ? 180 VAL A HG13   1 
ATOM   2974  H  HG21   . VAL A 1 180 ? 9.845   47.663  49.304  1.00 32.91  ? 180 VAL A HG21   1 
ATOM   2975  H  HG22   . VAL A 1 180 ? 11.057  48.229  50.161  1.00 32.91  ? 180 VAL A HG22   1 
ATOM   2976  H  HG23   . VAL A 1 180 ? 11.252  47.922  48.614  1.00 32.91  ? 180 VAL A HG23   1 
ATOM   2977  N  N      . PHE A 1 181 ? 13.485  43.891  49.486  1.00 25.20  ? 181 PHE A N      1 
ATOM   2978  C  CA     . PHE A 1 181 ? 13.796  42.501  49.803  1.00 35.42  ? 181 PHE A CA     1 
ATOM   2979  C  C      . PHE A 1 181 ? 15.243  42.282  50.248  1.00 39.67  ? 181 PHE A C      1 
ATOM   2980  O  O      . PHE A 1 181 ? 15.527  41.340  50.989  1.00 33.57  ? 181 PHE A O      1 
ATOM   2981  C  CB     . PHE A 1 181 ? 13.502  41.614  48.594  1.00 31.35  ? 181 PHE A CB     1 
ATOM   2982  C  CG     . PHE A 1 181 ? 13.654  40.148  48.872  1.00 24.47  ? 181 PHE A CG     1 
ATOM   2983  C  CD1    . PHE A 1 181 ? 12.596  39.413  49.368  1.00 27.36  ? 181 PHE A CD1    1 
ATOM   2984  C  CD2    . PHE A 1 181 ? 14.856  39.505  48.635  1.00 34.80  ? 181 PHE A CD2    1 
ATOM   2985  C  CE1    . PHE A 1 181 ? 12.734  38.068  49.626  1.00 34.73  ? 181 PHE A CE1    1 
ATOM   2986  C  CE2    . PHE A 1 181 ? 14.998  38.159  48.891  1.00 37.95  ? 181 PHE A CE2    1 
ATOM   2987  C  CZ     . PHE A 1 181 ? 13.935  37.442  49.387  1.00 32.50  ? 181 PHE A CZ     1 
ATOM   2988  H  H      . PHE A 1 181 ? 13.530  44.079  48.647  1.00 30.24  ? 181 PHE A H      1 
ATOM   2989  H  HA     . PHE A 1 181 ? 13.219  42.213  50.528  1.00 42.51  ? 181 PHE A HA     1 
ATOM   2990  H  HB2    . PHE A 1 181 ? 12.588  41.768  48.307  1.00 37.62  ? 181 PHE A HB2    1 
ATOM   2991  H  HB3    . PHE A 1 181 ? 14.115  41.846  47.879  1.00 37.62  ? 181 PHE A HB3    1 
ATOM   2992  H  HD1    . PHE A 1 181 ? 11.783  39.832  49.532  1.00 32.83  ? 181 PHE A HD1    1 
ATOM   2993  H  HD2    . PHE A 1 181 ? 15.578  39.987  48.301  1.00 41.76  ? 181 PHE A HD2    1 
ATOM   2994  H  HE1    . PHE A 1 181 ? 12.015  37.583  49.960  1.00 41.68  ? 181 PHE A HE1    1 
ATOM   2995  H  HE2    . PHE A 1 181 ? 15.810  37.737  48.729  1.00 45.54  ? 181 PHE A HE2    1 
ATOM   2996  H  HZ     . PHE A 1 181 ? 14.027  36.533  49.560  1.00 39.00  ? 181 PHE A HZ     1 
ATOM   2997  N  N      . TYR A 1 182 ? 16.147  43.150  49.801  1.00 38.51  ? 182 TYR A N      1 
ATOM   2998  C  CA     . TYR A 1 182 ? 17.575  42.999  50.086  1.00 39.08  ? 182 TYR A CA     1 
ATOM   2999  C  C      . TYR A 1 182 ? 18.111  44.138  50.946  1.00 33.55  ? 182 TYR A C      1 
ATOM   3000  O  O      . TYR A 1 182 ? 19.130  43.987  51.617  1.00 45.83  ? 182 TYR A O      1 
ATOM   3001  C  CB     . TYR A 1 182 ? 18.377  42.913  48.783  1.00 49.45  ? 182 TYR A CB     1 
ATOM   3002  C  CG     . TYR A 1 182 ? 18.219  41.602  48.039  1.00 42.28  ? 182 TYR A CG     1 
ATOM   3003  C  CD1    . TYR A 1 182 ? 18.739  40.423  48.556  1.00 42.91  ? 182 TYR A CD1    1 
ATOM   3004  C  CD2    . TYR A 1 182 ? 17.563  41.546  46.816  1.00 33.70  ? 182 TYR A CD2    1 
ATOM   3005  C  CE1    . TYR A 1 182 ? 18.605  39.228  47.882  1.00 48.96  ? 182 TYR A CE1    1 
ATOM   3006  C  CE2    . TYR A 1 182 ? 17.425  40.354  46.136  1.00 37.29  ? 182 TYR A CE2    1 
ATOM   3007  C  CZ     . TYR A 1 182 ? 17.948  39.198  46.673  1.00 47.77  ? 182 TYR A CZ     1 
ATOM   3008  O  OH     . TYR A 1 182 ? 17.816  38.006  46.001  1.00 36.42  ? 182 TYR A OH     1 
ATOM   3009  H  H      . TYR A 1 182 ? 15.959  43.841  49.326  1.00 46.21  ? 182 TYR A H      1 
ATOM   3010  H  HA     . TYR A 1 182 ? 17.711  42.171  50.573  1.00 46.89  ? 182 TYR A HA     1 
ATOM   3011  H  HB2    . TYR A 1 182 ? 18.086  43.625  48.192  1.00 59.34  ? 182 TYR A HB2    1 
ATOM   3012  H  HB3    . TYR A 1 182 ? 19.318  43.024  48.989  1.00 59.34  ? 182 TYR A HB3    1 
ATOM   3013  H  HD1    . TYR A 1 182 ? 19.184  40.440  49.372  1.00 51.49  ? 182 TYR A HD1    1 
ATOM   3014  H  HD2    . TYR A 1 182 ? 17.209  42.325  46.451  1.00 40.43  ? 182 TYR A HD2    1 
ATOM   3015  H  HE1    . TYR A 1 182 ? 18.958  38.446  48.242  1.00 58.75  ? 182 TYR A HE1    1 
ATOM   3016  H  HE2    . TYR A 1 182 ? 16.981  40.330  45.318  1.00 44.75  ? 182 TYR A HE2    1 
ATOM   3017  H  HH     . TYR A 1 182 ? 17.398  38.127  45.282  1.00 43.71  ? 182 TYR A HH     1 
ATOM   3018  N  N      . GLY A 1 183 ? 17.425  45.275  50.922  1.00 30.47  ? 183 GLY A N      1 
ATOM   3019  C  CA     . GLY A 1 183 ? 17.747  46.378  51.810  1.00 40.13  ? 183 GLY A CA     1 
ATOM   3020  C  C      . GLY A 1 183 ? 18.564  47.480  51.166  1.00 27.10  ? 183 GLY A C      1 
ATOM   3021  O  O      . GLY A 1 183 ? 18.354  48.655  51.457  1.00 35.86  ? 183 GLY A O      1 
ATOM   3022  H  H      . GLY A 1 183 ? 16.763  45.432  50.396  1.00 36.57  ? 183 GLY A H      1 
ATOM   3023  H  HA2    . GLY A 1 183 ? 16.923  46.769  52.141  1.00 48.16  ? 183 GLY A HA2    1 
ATOM   3024  H  HA3    . GLY A 1 183 ? 18.246  46.038  52.569  1.00 48.16  ? 183 GLY A HA3    1 
ATOM   3025  N  N      . SER A 1 184 ? 19.503  47.108  50.304  1.00 24.74  ? 184 SER A N      1 
ATOM   3026  C  CA     . SER A 1 184 ? 20.363  48.090  49.650  1.00 37.33  ? 184 SER A CA     1 
ATOM   3027  C  C      . SER A 1 184 ? 20.696  47.677  48.224  1.00 49.02  ? 184 SER A C      1 
ATOM   3028  O  O      . SER A 1 184 ? 20.514  46.523  47.839  1.00 40.58  ? 184 SER A O      1 
ATOM   3029  C  CB     . SER A 1 184 ? 21.654  48.287  50.446  1.00 41.96  ? 184 SER A CB     1 
ATOM   3030  O  OG     . SER A 1 184 ? 22.438  47.108  50.450  1.00 23.41  ? 184 SER A OG     1 
ATOM   3031  H  H      . SER A 1 184 ? 19.665  46.294  50.081  1.00 29.69  ? 184 SER A H      1 
ATOM   3032  H  HA     . SER A 1 184 ? 19.899  48.941  49.615  1.00 44.80  ? 184 SER A HA     1 
ATOM   3033  H  HB2    . SER A 1 184 ? 22.167  49.004  50.041  1.00 50.36  ? 184 SER A HB2    1 
ATOM   3034  H  HB3    . SER A 1 184 ? 21.428  48.518  51.360  1.00 50.36  ? 184 SER A HB3    1 
ATOM   3035  H  HG     . SER A 1 184 ? 23.142  47.232  50.890  1.00 28.09  ? 184 SER A HG     1 
ATOM   3036  N  N      . PHE A 1 185 ? 21.186  48.632  47.442  1.00 52.45  ? 185 PHE A N      1 
ATOM   3037  C  CA     . PHE A 1 185 ? 21.653  48.347  46.096  1.00 44.30  ? 185 PHE A CA     1 
ATOM   3038  C  C      . PHE A 1 185 ? 22.751  47.296  46.134  1.00 42.54  ? 185 PHE A C      1 
ATOM   3039  O  O      . PHE A 1 185 ? 22.753  46.358  45.343  1.00 46.81  ? 185 PHE A O      1 
ATOM   3040  C  CB     . PHE A 1 185 ? 22.172  49.609  45.416  1.00 43.16  ? 185 PHE A CB     1 
ATOM   3041  C  CG     . PHE A 1 185 ? 22.969  49.332  44.182  1.00 44.08  ? 185 PHE A CG     1 
ATOM   3042  C  CD1    . PHE A 1 185 ? 22.335  49.045  42.987  1.00 42.20  ? 185 PHE A CD1    1 
ATOM   3043  C  CD2    . PHE A 1 185 ? 24.349  49.343  44.214  1.00 48.02  ? 185 PHE A CD2    1 
ATOM   3044  C  CE1    . PHE A 1 185 ? 23.063  48.784  41.849  1.00 36.01  ? 185 PHE A CE1    1 
ATOM   3045  C  CE2    . PHE A 1 185 ? 25.082  49.083  43.076  1.00 46.19  ? 185 PHE A CE2    1 
ATOM   3046  C  CZ     . PHE A 1 185 ? 24.437  48.802  41.893  1.00 31.07  ? 185 PHE A CZ     1 
ATOM   3047  H  H      . PHE A 1 185 ? 21.258  49.458  47.672  1.00 62.94  ? 185 PHE A H      1 
ATOM   3048  H  HA     . PHE A 1 185 ? 20.916  47.999  45.569  1.00 53.16  ? 185 PHE A HA     1 
ATOM   3049  H  HB2    . PHE A 1 185 ? 21.417  50.164  45.166  1.00 51.79  ? 185 PHE A HB2    1 
ATOM   3050  H  HB3    . PHE A 1 185 ? 22.742  50.088  46.038  1.00 51.79  ? 185 PHE A HB3    1 
ATOM   3051  H  HD1    . PHE A 1 185 ? 21.406  49.032  42.952  1.00 50.64  ? 185 PHE A HD1    1 
ATOM   3052  H  HD2    . PHE A 1 185 ? 24.789  49.533  45.012  1.00 57.62  ? 185 PHE A HD2    1 
ATOM   3053  H  HE1    . PHE A 1 185 ? 22.625  48.595  41.050  1.00 43.22  ? 185 PHE A HE1    1 
ATOM   3054  H  HE2    . PHE A 1 185 ? 26.011  49.095  43.108  1.00 55.42  ? 185 PHE A HE2    1 
ATOM   3055  H  HZ     . PHE A 1 185 ? 24.930  48.626  41.124  1.00 37.28  ? 185 PHE A HZ     1 
ATOM   3056  N  N      . LEU A 1 186 ? 23.690  47.474  47.056  1.00 59.66  ? 186 LEU A N      1 
ATOM   3057  C  CA     . LEU A 1 186 ? 24.834  46.581  47.181  1.00 46.95  ? 186 LEU A CA     1 
ATOM   3058  C  C      . LEU A 1 186 ? 24.401  45.149  47.491  1.00 37.83  ? 186 LEU A C      1 
ATOM   3059  O  O      . LEU A 1 186 ? 25.005  44.196  47.005  1.00 40.65  ? 186 LEU A O      1 
ATOM   3060  C  CB     . LEU A 1 186 ? 25.782  47.082  48.274  1.00 49.72  ? 186 LEU A CB     1 
ATOM   3061  C  CG     . LEU A 1 186 ? 27.207  46.526  48.220  1.00 47.80  ? 186 LEU A CG     1 
ATOM   3062  C  CD1    . LEU A 1 186 ? 27.983  47.181  47.094  1.00 42.91  ? 186 LEU A CD1    1 
ATOM   3063  C  CD2    . LEU A 1 186 ? 27.927  46.712  49.547  1.00 60.80  ? 186 LEU A CD2    1 
ATOM   3064  H  H      . LEU A 1 186 ? 23.687  48.115  47.629  1.00 71.59  ? 186 LEU A H      1 
ATOM   3065  H  HA     . LEU A 1 186 ? 25.321  46.572  46.342  1.00 56.34  ? 186 LEU A HA     1 
ATOM   3066  H  HB2    . LEU A 1 186 ? 25.844  48.048  48.206  1.00 59.67  ? 186 LEU A HB2    1 
ATOM   3067  H  HB3    . LEU A 1 186 ? 25.409  46.842  49.136  1.00 59.67  ? 186 LEU A HB3    1 
ATOM   3068  H  HG     . LEU A 1 186 ? 27.164  45.575  48.037  1.00 57.36  ? 186 LEU A HG     1 
ATOM   3069  H  HD11   . LEU A 1 186 ? 28.881  46.816  47.077  1.00 51.49  ? 186 LEU A HD11   1 
ATOM   3070  H  HD12   . LEU A 1 186 ? 27.535  46.998  46.254  1.00 51.49  ? 186 LEU A HD12   1 
ATOM   3071  H  HD13   . LEU A 1 186 ? 28.017  48.138  47.250  1.00 51.49  ? 186 LEU A HD13   1 
ATOM   3072  H  HD21   . LEU A 1 186 ? 28.823  46.349  49.473  1.00 72.96  ? 186 LEU A HD21   1 
ATOM   3073  H  HD22   . LEU A 1 186 ? 27.970  47.659  49.752  1.00 72.96  ? 186 LEU A HD22   1 
ATOM   3074  H  HD23   . LEU A 1 186 ? 27.436  46.244  50.240  1.00 72.96  ? 186 LEU A HD23   1 
ATOM   3075  N  N      . GLU A 1 187 ? 23.368  44.996  48.312  1.00 28.78  ? 187 GLU A N      1 
ATOM   3076  C  CA     . GLU A 1 187 ? 22.892  43.668  48.687  1.00 39.65  ? 187 GLU A CA     1 
ATOM   3077  C  C      . GLU A 1 187 ? 22.134  42.983  47.558  1.00 43.88  ? 187 GLU A C      1 
ATOM   3078  O  O      . GLU A 1 187 ? 22.043  41.757  47.522  1.00 48.73  ? 187 GLU A O      1 
ATOM   3079  C  CB     . GLU A 1 187 ? 22.010  43.745  49.933  1.00 60.38  ? 187 GLU A CB     1 
ATOM   3080  C  CG     . GLU A 1 187 ? 22.792  43.745  51.236  1.00 56.39  ? 187 GLU A CG     1 
ATOM   3081  C  CD     . GLU A 1 187 ? 23.621  42.486  51.415  1.00 58.12  ? 187 GLU A CD     1 
ATOM   3082  O  OE1    . GLU A 1 187 ? 23.037  41.381  51.382  1.00 38.47  ? 187 GLU A OE1    1 
ATOM   3083  O  OE2    . GLU A 1 187 ? 24.856  42.601  51.572  1.00 42.25  ? 187 GLU A OE2    1 
ATOM   3084  H  H      . GLU A 1 187 ? 22.925  45.643  48.666  1.00 34.54  ? 187 GLU A H      1 
ATOM   3085  H  HA     . GLU A 1 187 ? 23.659  43.114  48.904  1.00 47.58  ? 187 GLU A HA     1 
ATOM   3086  H  HB2    . GLU A 1 187 ? 21.491  44.564  49.898  1.00 72.46  ? 187 GLU A HB2    1 
ATOM   3087  H  HB3    . GLU A 1 187 ? 21.415  42.979  49.944  1.00 72.46  ? 187 GLU A HB3    1 
ATOM   3088  H  HG2    . GLU A 1 187 ? 23.395  44.506  51.244  1.00 67.67  ? 187 GLU A HG2    1 
ATOM   3089  H  HG3    . GLU A 1 187 ? 22.171  43.805  51.979  1.00 67.67  ? 187 GLU A HG3    1 
ATOM   3090  N  N      . THR A 1 188 ? 21.590  43.767  46.635  1.00 47.57  ? 188 THR A N      1 
ATOM   3091  C  CA     . THR A 1 188 ? 20.926  43.190  45.475  1.00 39.20  ? 188 THR A CA     1 
ATOM   3092  C  C      . THR A 1 188 ? 21.980  42.648  44.518  1.00 39.11  ? 188 THR A C      1 
ATOM   3093  O  O      . THR A 1 188 ? 21.855  41.535  44.014  1.00 51.14  ? 188 THR A O      1 
ATOM   3094  C  CB     . THR A 1 188 ? 20.043  44.218  44.752  1.00 40.94  ? 188 THR A CB     1 
ATOM   3095  O  OG1    . THR A 1 188 ? 19.098  44.768  45.675  1.00 39.25  ? 188 THR A OG1    1 
ATOM   3096  C  CG2    . THR A 1 188 ? 19.292  43.571  43.602  1.00 40.91  ? 188 THR A CG2    1 
ATOM   3097  H  H      . THR A 1 188 ? 21.592  44.627  46.656  1.00 57.08  ? 188 THR A H      1 
ATOM   3098  H  HA     . THR A 1 188 ? 20.364  42.453  45.761  1.00 47.04  ? 188 THR A HA     1 
ATOM   3099  H  HB     . THR A 1 188 ? 20.599  44.929  44.396  1.00 49.13  ? 188 THR A HB     1 
ATOM   3100  H  HG1    . THR A 1 188 ? 19.500  45.146  46.308  1.00 47.10  ? 188 THR A HG1    1 
ATOM   3101  H  HG21   . THR A 1 188 ? 18.739  44.231  43.154  1.00 49.09  ? 188 THR A HG21   1 
ATOM   3102  H  HG22   . THR A 1 188 ? 19.920  43.201  42.962  1.00 49.09  ? 188 THR A HG22   1 
ATOM   3103  H  HG23   . THR A 1 188 ? 18.725  42.859  43.936  1.00 49.09  ? 188 THR A HG23   1 
ATOM   3104  N  N      . VAL A 1 189 ? 23.031  43.429  44.296  1.00 38.70  ? 189 VAL A N      1 
ATOM   3105  C  CA     . VAL A 1 189 ? 24.127  43.021  43.424  1.00 36.71  ? 189 VAL A CA     1 
ATOM   3106  C  C      . VAL A 1 189 ? 24.813  41.758  43.944  1.00 40.10  ? 189 VAL A C      1 
ATOM   3107  O  O      . VAL A 1 189 ? 25.055  40.826  43.181  1.00 37.67  ? 189 VAL A O      1 
ATOM   3108  C  CB     . VAL A 1 189 ? 25.169  44.151  43.279  1.00 30.51  ? 189 VAL A CB     1 
ATOM   3109  C  CG1    . VAL A 1 189 ? 26.412  43.668  42.539  1.00 47.20  ? 189 VAL A CG1    1 
ATOM   3110  C  CG2    . VAL A 1 189 ? 24.556  45.336  42.554  1.00 33.66  ? 189 VAL A CG2    1 
ATOM   3111  H  H      . VAL A 1 189 ? 23.134  44.210  44.642  1.00 46.44  ? 189 VAL A H      1 
ATOM   3112  H  HA     . VAL A 1 189 ? 23.772  42.827  42.542  1.00 44.05  ? 189 VAL A HA     1 
ATOM   3113  H  HB     . VAL A 1 189 ? 25.440  44.447  44.162  1.00 36.61  ? 189 VAL A HB     1 
ATOM   3114  H  HG11   . VAL A 1 189 ? 27.041  44.403  42.468  1.00 56.64  ? 189 VAL A HG11   1 
ATOM   3115  H  HG12   . VAL A 1 189 ? 26.811  42.937  43.037  1.00 56.64  ? 189 VAL A HG12   1 
ATOM   3116  H  HG13   . VAL A 1 189 ? 26.155  43.365  41.655  1.00 56.64  ? 189 VAL A HG13   1 
ATOM   3117  H  HG21   . VAL A 1 189 ? 25.224  46.035  42.473  1.00 40.39  ? 189 VAL A HG21   1 
ATOM   3118  H  HG22   . VAL A 1 189 ? 24.266  45.051  41.674  1.00 40.39  ? 189 VAL A HG22   1 
ATOM   3119  H  HG23   . VAL A 1 189 ? 23.798  45.661  43.065  1.00 40.39  ? 189 VAL A HG23   1 
ATOM   3120  N  N      . LYS A 1 190 ? 25.128  41.732  45.237  1.00 47.73  ? 190 LYS A N      1 
ATOM   3121  C  CA     . LYS A 1 190 ? 25.800  40.583  45.836  1.00 43.45  ? 190 LYS A CA     1 
ATOM   3122  C  C      . LYS A 1 190 ? 25.005  39.297  45.648  1.00 50.01  ? 190 LYS A C      1 
ATOM   3123  O  O      . LYS A 1 190 ? 25.566  38.263  45.284  1.00 59.08  ? 190 LYS A O      1 
ATOM   3124  C  CB     . LYS A 1 190 ? 26.041  40.814  47.330  1.00 36.16  ? 190 LYS A CB     1 
ATOM   3125  C  CG     . LYS A 1 190 ? 27.185  41.764  47.649  1.00 42.32  ? 190 LYS A CG     1 
ATOM   3126  C  CD     . LYS A 1 190 ? 27.299  41.998  49.150  1.00 59.32  ? 190 LYS A CD     1 
ATOM   3127  C  CE     . LYS A 1 190 ? 28.374  43.019  49.489  1.00 56.28  ? 190 LYS A CE     1 
ATOM   3128  N  NZ     . LYS A 1 190 ? 28.310  43.445  50.915  1.00 53.46  ? 190 LYS A NZ     1 
ATOM   3129  H  H      . LYS A 1 190 ? 24.962  42.369  45.790  1.00 57.28  ? 190 LYS A H      1 
ATOM   3130  H  HA     . LYS A 1 190 ? 26.663  40.466  45.409  1.00 52.14  ? 190 LYS A HA     1 
ATOM   3131  H  HB2    . LYS A 1 190 ? 25.234  41.185  47.720  1.00 43.39  ? 190 LYS A HB2    1 
ATOM   3132  H  HB3    . LYS A 1 190 ? 26.243  39.962  47.747  1.00 43.39  ? 190 LYS A HB3    1 
ATOM   3133  H  HG2    . LYS A 1 190 ? 28.019  41.381  47.335  1.00 50.78  ? 190 LYS A HG2    1 
ATOM   3134  H  HG3    . LYS A 1 190 ? 27.023  42.618  47.218  1.00 50.78  ? 190 LYS A HG3    1 
ATOM   3135  H  HD2    . LYS A 1 190 ? 26.451  42.329  49.486  1.00 71.18  ? 190 LYS A HD2    1 
ATOM   3136  H  HD3    . LYS A 1 190 ? 27.527  41.162  49.586  1.00 71.18  ? 190 LYS A HD3    1 
ATOM   3137  H  HE2    . LYS A 1 190 ? 29.247  42.628  49.328  1.00 67.53  ? 190 LYS A HE2    1 
ATOM   3138  H  HE3    . LYS A 1 190 ? 28.253  43.805  48.933  1.00 67.53  ? 190 LYS A HE3    1 
ATOM   3139  H  HZ1    . LYS A 1 190 ? 28.950  44.041  51.084  1.00 64.15  ? 190 LYS A HZ1    1 
ATOM   3140  H  HZ2    . LYS A 1 190 ? 27.519  43.813  51.088  1.00 64.15  ? 190 LYS A HZ2    1 
ATOM   3141  H  HZ3    . LYS A 1 190 ? 28.424  42.740  51.448  1.00 64.15  ? 190 LYS A HZ3    1 
ATOM   3142  N  N      . ASN A 1 191 ? 23.700  39.364  45.887  1.00 39.03  ? 191 ASN A N      1 
ATOM   3143  C  CA     . ASN A 1 191 ? 22.858  38.176  45.817  1.00 48.48  ? 191 ASN A CA     1 
ATOM   3144  C  C      . ASN A 1 191 ? 22.460  37.804  44.397  1.00 41.84  ? 191 ASN A C      1 
ATOM   3145  O  O      . ASN A 1 191 ? 22.323  36.625  44.077  1.00 47.42  ? 191 ASN A O      1 
ATOM   3146  C  CB     . ASN A 1 191 ? 21.605  38.370  46.664  1.00 49.68  ? 191 ASN A CB     1 
ATOM   3147  C  CG     . ASN A 1 191 ? 21.887  38.242  48.140  1.00 41.93  ? 191 ASN A CG     1 
ATOM   3148  O  OD1    . ASN A 1 191 ? 21.704  37.178  48.728  1.00 38.32  ? 191 ASN A OD1    1 
ATOM   3149  N  ND2    . ASN A 1 191 ? 22.338  39.329  48.751  1.00 57.21  ? 191 ASN A ND2    1 
ATOM   3150  H  H      . ASN A 1 191 ? 23.278  40.085  46.092  1.00 46.83  ? 191 ASN A H      1 
ATOM   3151  H  HA     . ASN A 1 191 ? 23.350  37.428  46.188  1.00 58.18  ? 191 ASN A HA     1 
ATOM   3152  H  HB2    . ASN A 1 191 ? 21.245  39.255  46.501  1.00 59.62  ? 191 ASN A HB2    1 
ATOM   3153  H  HB3    . ASN A 1 191 ? 20.951  37.695  46.423  1.00 59.62  ? 191 ASN A HB3    1 
ATOM   3154  H  HD21   . ASN A 1 191 ? 22.514  39.307  49.593  1.00 68.65  ? 191 ASN A HD21   1 
ATOM   3155  H  HD22   . ASN A 1 191 ? 22.455  40.055  48.306  1.00 68.65  ? 191 ASN A HD22   1 
ATOM   3156  N  N      . ALA A 1 192 ? 22.279  38.809  43.549  1.00 37.30  ? 192 ALA A N      1 
ATOM   3157  C  CA     . ALA A 1 192 ? 21.854  38.581  42.175  1.00 36.03  ? 192 ALA A CA     1 
ATOM   3158  C  C      . ALA A 1 192 ? 22.838  37.685  41.432  1.00 42.59  ? 192 ALA A C      1 
ATOM   3159  O  O      . ALA A 1 192 ? 22.463  36.983  40.494  1.00 37.18  ? 192 ALA A O      1 
ATOM   3160  C  CB     . ALA A 1 192 ? 21.696  39.899  41.450  1.00 37.19  ? 192 ALA A CB     1 
ATOM   3161  H  H      . ALA A 1 192 ? 22.397  39.638  43.747  1.00 44.76  ? 192 ALA A H      1 
ATOM   3162  H  HA     . ALA A 1 192 ? 20.991  38.137  42.181  1.00 43.23  ? 192 ALA A HA     1 
ATOM   3163  H  HB1    . ALA A 1 192 ? 21.413  39.725  40.539  1.00 44.63  ? 192 ALA A HB1    1 
ATOM   3164  H  HB2    . ALA A 1 192 ? 21.028  40.433  41.908  1.00 44.63  ? 192 ALA A HB2    1 
ATOM   3165  H  HB3    . ALA A 1 192 ? 22.548  40.363  41.450  1.00 44.63  ? 192 ALA A HB3    1 
ATOM   3166  N  N      . ARG A 1 193 ? 24.096  37.717  41.855  1.00 45.69  ? 193 ARG A N      1 
ATOM   3167  C  CA     . ARG A 1 193 ? 25.143  36.932  41.214  1.00 35.33  ? 193 ARG A CA     1 
ATOM   3168  C  C      . ARG A 1 193 ? 24.798  35.445  41.165  1.00 34.89  ? 193 ARG A C      1 
ATOM   3169  O  O      . ARG A 1 193 ? 25.205  34.737  40.245  1.00 40.86  ? 193 ARG A O      1 
ATOM   3170  C  CB     . ARG A 1 193 ? 26.466  37.130  41.955  1.00 35.32  ? 193 ARG A CB     1 
ATOM   3171  C  CG     . ARG A 1 193 ? 27.063  38.519  41.800  1.00 44.21  ? 193 ARG A CG     1 
ATOM   3172  C  CD     . ARG A 1 193 ? 28.362  38.661  42.573  1.00 53.07  ? 193 ARG A CD     1 
ATOM   3173  N  NE     . ARG A 1 193 ? 28.180  38.406  43.999  1.00 48.71  ? 193 ARG A NE     1 
ATOM   3174  C  CZ     . ARG A 1 193 ? 29.119  38.599  44.918  1.00 42.91  ? 193 ARG A CZ     1 
ATOM   3175  N  NH1    . ARG A 1 193 ? 30.311  39.055  44.564  1.00 52.48  ? 193 ARG A NH1    1 
ATOM   3176  N  NH2    . ARG A 1 193 ? 28.866  38.342  46.193  1.00 43.62  ? 193 ARG A NH2    1 
ATOM   3177  H  H      . ARG A 1 193 ? 24.372  38.191  42.518  1.00 54.82  ? 193 ARG A H      1 
ATOM   3178  H  HA     . ARG A 1 193 ? 25.259  37.243  40.303  1.00 42.40  ? 193 ARG A HA     1 
ATOM   3179  H  HB2    . ARG A 1 193 ? 26.319  36.976  42.901  1.00 42.38  ? 193 ARG A HB2    1 
ATOM   3180  H  HB3    . ARG A 1 193 ? 27.112  36.491  41.615  1.00 42.38  ? 193 ARG A HB3    1 
ATOM   3181  H  HG2    . ARG A 1 193 ? 27.249  38.684  40.862  1.00 53.05  ? 193 ARG A HG2    1 
ATOM   3182  H  HG3    . ARG A 1 193 ? 26.435  39.177  42.138  1.00 53.05  ? 193 ARG A HG3    1 
ATOM   3183  H  HD2    . ARG A 1 193 ? 29.007  38.022  42.232  1.00 63.69  ? 193 ARG A HD2    1 
ATOM   3184  H  HD3    . ARG A 1 193 ? 28.698  39.564  42.468  1.00 63.69  ? 193 ARG A HD3    1 
ATOM   3185  H  HE     . ARG A 1 193 ? 27.415  38.113  44.261  1.00 58.45  ? 193 ARG A HE     1 
ATOM   3186  H  HH11   . ARG A 1 193 ? 30.479  39.224  43.737  1.00 62.97  ? 193 ARG A HH11   1 
ATOM   3187  H  HH12   . ARG A 1 193 ? 30.918  39.181  45.160  1.00 62.97  ? 193 ARG A HH12   1 
ATOM   3188  H  HH21   . ARG A 1 193 ? 28.093  38.046  46.427  1.00 52.35  ? 193 ARG A HH21   1 
ATOM   3189  H  HH22   . ARG A 1 193 ? 29.476  38.469  46.786  1.00 52.35  ? 193 ARG A HH22   1 
ATOM   3190  N  N      . ARG A 1 194 ? 24.032  34.984  42.149  1.00 37.50  ? 194 ARG A N      1 
ATOM   3191  C  CA     . ARG A 1 194 ? 23.687  33.571  42.265  1.00 41.21  ? 194 ARG A CA     1 
ATOM   3192  C  C      . ARG A 1 194 ? 22.203  33.318  42.007  1.00 37.62  ? 194 ARG A C      1 
ATOM   3193  O  O      . ARG A 1 194 ? 21.633  32.334  42.476  1.00 40.62  ? 194 ARG A O      1 
ATOM   3194  C  CB     . ARG A 1 194 ? 24.122  33.050  43.636  1.00 38.58  ? 194 ARG A CB     1 
ATOM   3195  C  CG     . ARG A 1 194 ? 25.542  32.498  43.610  1.00 49.29  ? 194 ARG A CG     1 
ATOM   3196  C  CD     . ARG A 1 194 ? 26.118  32.309  44.995  1.00 79.27  ? 194 ARG A CD     1 
ATOM   3197  N  NE     . ARG A 1 194 ? 26.309  33.588  45.673  1.00 104.65 ? 194 ARG A NE     1 
ATOM   3198  C  CZ     . ARG A 1 194 ? 27.365  34.381  45.499  1.00 98.15  ? 194 ARG A CZ     1 
ATOM   3199  N  NH1    . ARG A 1 194 ? 28.337  34.037  44.661  1.00 78.96  ? 194 ARG A NH1    1 
ATOM   3200  N  NH2    . ARG A 1 194 ? 27.446  35.526  46.162  1.00 81.89  ? 194 ARG A NH2    1 
ATOM   3201  H  H      . ARG A 1 194 ? 23.696  35.476  42.770  1.00 45.01  ? 194 ARG A H      1 
ATOM   3202  H  HA     . ARG A 1 194 ? 24.186  33.078  41.595  1.00 49.45  ? 194 ARG A HA     1 
ATOM   3203  H  HB2    . ARG A 1 194 ? 24.091  33.776  44.278  1.00 46.30  ? 194 ARG A HB2    1 
ATOM   3204  H  HB3    . ARG A 1 194 ? 23.525  32.336  43.910  1.00 46.30  ? 194 ARG A HB3    1 
ATOM   3205  H  HG2    . ARG A 1 194 ? 25.538  31.635  43.166  1.00 59.15  ? 194 ARG A HG2    1 
ATOM   3206  H  HG3    . ARG A 1 194 ? 26.113  33.117  43.129  1.00 59.15  ? 194 ARG A HG3    1 
ATOM   3207  H  HD2    . ARG A 1 194 ? 25.509  31.772  45.525  1.00 95.12  ? 194 ARG A HD2    1 
ATOM   3208  H  HD3    . ARG A 1 194 ? 26.980  31.869  44.926  1.00 95.12  ? 194 ARG A HD3    1 
ATOM   3209  H  HE     . ARG A 1 194 ? 25.700  33.846  46.221  1.00 125.58 ? 194 ARG A HE     1 
ATOM   3210  H  HH11   . ARG A 1 194 ? 28.290  33.296  44.227  1.00 94.76  ? 194 ARG A HH11   1 
ATOM   3211  H  HH12   . ARG A 1 194 ? 29.015  34.555  44.553  1.00 94.76  ? 194 ARG A HH12   1 
ATOM   3212  H  HH21   . ARG A 1 194 ? 26.819  35.754  46.705  1.00 98.27  ? 194 ARG A HH21   1 
ATOM   3213  H  HH22   . ARG A 1 194 ? 28.126  36.040  46.050  1.00 98.27  ? 194 ARG A HH22   1 
ATOM   3214  N  N      . TRP A 1 195 ? 21.580  34.215  41.252  1.00 41.53  ? 195 TRP A N      1 
ATOM   3215  C  CA     . TRP A 1 195 ? 20.251  33.956  40.724  1.00 31.16  ? 195 TRP A CA     1 
ATOM   3216  C  C      . TRP A 1 195 ? 20.387  32.895  39.642  1.00 27.43  ? 195 TRP A C      1 
ATOM   3217  O  O      . TRP A 1 195 ? 21.465  32.704  39.084  1.00 43.17  ? 195 TRP A O      1 
ATOM   3218  C  CB     . TRP A 1 195 ? 19.608  35.217  40.140  1.00 41.71  ? 195 TRP A CB     1 
ATOM   3219  C  CG     . TRP A 1 195 ? 19.127  36.213  41.152  1.00 34.42  ? 195 TRP A CG     1 
ATOM   3220  C  CD1    . TRP A 1 195 ? 19.072  36.052  42.502  1.00 43.52  ? 195 TRP A CD1    1 
ATOM   3221  C  CD2    . TRP A 1 195 ? 18.614  37.523  40.884  1.00 34.39  ? 195 TRP A CD2    1 
ATOM   3222  N  NE1    . TRP A 1 195 ? 18.569  37.185  43.095  1.00 38.24  ? 195 TRP A NE1    1 
ATOM   3223  C  CE2    . TRP A 1 195 ? 18.278  38.101  42.123  1.00 36.71  ? 195 TRP A CE2    1 
ATOM   3224  C  CE3    . TRP A 1 195 ? 18.410  38.263  39.717  1.00 31.01  ? 195 TRP A CE3    1 
ATOM   3225  C  CZ2    . TRP A 1 195 ? 17.751  39.384  42.228  1.00 39.36  ? 195 TRP A CZ2    1 
ATOM   3226  C  CZ3    . TRP A 1 195 ? 17.887  39.536  39.824  1.00 41.88  ? 195 TRP A CZ3    1 
ATOM   3227  C  CH2    . TRP A 1 195 ? 17.563  40.085  41.072  1.00 30.33  ? 195 TRP A CH2    1 
ATOM   3228  H  H      . TRP A 1 195 ? 21.906  34.979  41.032  1.00 49.84  ? 195 TRP A H      1 
ATOM   3229  H  HA     . TRP A 1 195 ? 19.679  33.612  41.428  1.00 37.39  ? 195 TRP A HA     1 
ATOM   3230  H  HB2    . TRP A 1 195 ? 20.261  35.664  39.579  1.00 50.05  ? 195 TRP A HB2    1 
ATOM   3231  H  HB3    . TRP A 1 195 ? 18.845  34.954  39.603  1.00 50.05  ? 195 TRP A HB3    1 
ATOM   3232  H  HD1    . TRP A 1 195 ? 19.345  35.289  42.958  1.00 52.23  ? 195 TRP A HD1    1 
ATOM   3233  H  HE1    . TRP A 1 195 ? 18.452  37.297  43.940  1.00 45.89  ? 195 TRP A HE1    1 
ATOM   3234  H  HE3    . TRP A 1 195 ? 18.624  37.906  38.886  1.00 37.21  ? 195 TRP A HE3    1 
ATOM   3235  H  HZ2    . TRP A 1 195 ? 17.534  39.751  43.055  1.00 47.24  ? 195 TRP A HZ2    1 
ATOM   3236  H  HZ3    . TRP A 1 195 ? 17.748  40.039  39.055  1.00 50.25  ? 195 TRP A HZ3    1 
ATOM   3237  H  HH2    . TRP A 1 195 ? 17.212  40.945  41.113  1.00 36.40  ? 195 TRP A HH2    1 
ATOM   3238  N  N      . THR A 1 196 ? 19.298  32.195  39.361  1.00 21.21  ? 196 THR A N      1 
ATOM   3239  C  CA     . THR A 1 196 ? 19.251  31.274  38.239  1.00 27.75  ? 196 THR A CA     1 
ATOM   3240  C  C      . THR A 1 196 ? 17.956  31.517  37.492  1.00 31.18  ? 196 THR A C      1 
ATOM   3241  O  O      . THR A 1 196 ? 17.132  32.318  37.925  1.00 32.54  ? 196 THR A O      1 
ATOM   3242  C  CB     . THR A 1 196 ? 19.323  29.811  38.691  1.00 31.47  ? 196 THR A CB     1 
ATOM   3243  O  OG1    . THR A 1 196 ? 18.116  29.464  39.379  1.00 30.56  ? 196 THR A OG1    1 
ATOM   3244  C  CG2    . THR A 1 196 ? 20.515  29.591  39.610  1.00 34.43  ? 196 THR A CG2    1 
ATOM   3245  H  H      . THR A 1 196 ? 18.566  32.237  39.811  1.00 25.46  ? 196 THR A H      1 
ATOM   3246  H  HA     . THR A 1 196 ? 19.993  31.450  37.640  1.00 33.30  ? 196 THR A HA     1 
ATOM   3247  H  HB     . THR A 1 196 ? 19.426  29.239  37.915  1.00 37.76  ? 196 THR A HB     1 
ATOM   3248  H  HG1    . THR A 1 196 ? 18.148  28.663  39.630  1.00 36.67  ? 196 THR A HG1    1 
ATOM   3249  H  HG21   . THR A 1 196 ? 20.550  28.663  39.890  1.00 41.31  ? 196 THR A HG21   1 
ATOM   3250  H  HG22   . THR A 1 196 ? 21.337  29.812  39.145  1.00 41.31  ? 196 THR A HG22   1 
ATOM   3251  H  HG23   . THR A 1 196 ? 20.436  30.154  40.396  1.00 41.31  ? 196 THR A HG23   1 
ATOM   3252  N  N      . ARG A 1 197 ? 17.753  30.808  36.390  1.00 31.48  ? 197 ARG A N      1 
ATOM   3253  C  CA     . ARG A 1 197 ? 16.528  30.975  35.626  1.00 34.24  ? 197 ARG A CA     1 
ATOM   3254  C  C      . ARG A 1 197 ? 15.346  30.325  36.341  1.00 38.54  ? 197 ARG A C      1 
ATOM   3255  O  O      . ARG A 1 197 ? 14.218  30.365  35.850  1.00 48.67  ? 197 ARG A O      1 
ATOM   3256  C  CB     . ARG A 1 197 ? 16.689  30.388  34.228  1.00 33.43  ? 197 ARG A CB     1 
ATOM   3257  C  CG     . ARG A 1 197 ? 16.881  28.889  34.200  1.00 34.14  ? 197 ARG A CG     1 
ATOM   3258  C  CD     . ARG A 1 197 ? 17.466  28.449  32.875  1.00 36.02  ? 197 ARG A CD     1 
ATOM   3259  N  NE     . ARG A 1 197 ? 18.842  28.905  32.715  1.00 37.76  ? 197 ARG A NE     1 
ATOM   3260  C  CZ     . ARG A 1 197 ? 19.530  28.829  31.581  1.00 35.68  ? 197 ARG A CZ     1 
ATOM   3261  N  NH1    . ARG A 1 197 ? 18.967  28.331  30.489  1.00 45.65  ? 197 ARG A NH1    1 
ATOM   3262  N  NH2    . ARG A 1 197 ? 20.781  29.264  31.538  1.00 29.81  ? 197 ARG A NH2    1 
ATOM   3263  H  H      . ARG A 1 197 ? 18.302  30.231  36.067  1.00 37.78  ? 197 ARG A H      1 
ATOM   3264  H  HA     . ARG A 1 197 ? 16.339  31.922  35.534  1.00 41.09  ? 197 ARG A HA     1 
ATOM   3265  H  HB2    . ARG A 1 197 ? 15.894  30.592  33.712  1.00 40.12  ? 197 ARG A HB2    1 
ATOM   3266  H  HB3    . ARG A 1 197 ? 17.464  30.792  33.809  1.00 40.12  ? 197 ARG A HB3    1 
ATOM   3267  H  HG2    . ARG A 1 197 ? 17.493  28.629  34.907  1.00 40.97  ? 197 ARG A HG2    1 
ATOM   3268  H  HG3    . ARG A 1 197 ? 16.024  28.451  34.318  1.00 40.97  ? 197 ARG A HG3    1 
ATOM   3269  H  HD2    . ARG A 1 197 ? 17.459  27.480  32.829  1.00 43.23  ? 197 ARG A HD2    1 
ATOM   3270  H  HD3    . ARG A 1 197 ? 16.936  28.822  32.153  1.00 43.23  ? 197 ARG A HD3    1 
ATOM   3271  H  HE     . ARG A 1 197 ? 19.235  29.245  33.400  1.00 45.31  ? 197 ARG A HE     1 
ATOM   3272  H  HH11   . ARG A 1 197 ? 18.155  28.048  30.514  1.00 54.77  ? 197 ARG A HH11   1 
ATOM   3273  H  HH12   . ARG A 1 197 ? 19.415  28.287  29.756  1.00 54.77  ? 197 ARG A HH12   1 
ATOM   3274  H  HH21   . ARG A 1 197 ? 21.148  29.591  32.244  1.00 35.77  ? 197 ARG A HH21   1 
ATOM   3275  H  HH22   . ARG A 1 197 ? 21.226  29.221  30.803  1.00 35.77  ? 197 ARG A HH22   1 
ATOM   3276  N  N      . ARG A 1 198 ? 15.615  29.740  37.505  1.00 33.04  ? 198 ARG A N      1 
ATOM   3277  C  CA     . ARG A 1 198 ? 14.596  29.088  38.318  1.00 42.64  ? 198 ARG A CA     1 
ATOM   3278  C  C      . ARG A 1 198 ? 14.286  29.897  39.577  1.00 38.98  ? 198 ARG A C      1 
ATOM   3279  O  O      . ARG A 1 198 ? 13.401  29.535  40.351  1.00 36.22  ? 198 ARG A O      1 
ATOM   3280  C  CB     . ARG A 1 198 ? 15.058  27.688  38.721  1.00 53.37  ? 198 ARG A CB     1 
ATOM   3281  C  CG     . ARG A 1 198 ? 15.430  26.763  37.573  1.00 53.49  ? 198 ARG A CG     1 
ATOM   3282  C  CD     . ARG A 1 198 ? 14.234  25.981  37.063  1.00 58.05  ? 198 ARG A CD     1 
ATOM   3283  N  NE     . ARG A 1 198 ? 14.604  25.071  35.980  1.00 88.80  ? 198 ARG A NE     1 
ATOM   3284  C  CZ     . ARG A 1 198 ? 14.600  25.382  34.685  1.00 83.56  ? 198 ARG A CZ     1 
ATOM   3285  N  NH1    . ARG A 1 198 ? 14.238  26.592  34.276  1.00 65.03  ? 198 ARG A NH1    1 
ATOM   3286  N  NH2    . ARG A 1 198 ? 14.959  24.471  33.791  1.00 68.89  ? 198 ARG A NH2    1 
ATOM   3287  H  H      . ARG A 1 198 ? 16.401  29.709  37.853  1.00 39.65  ? 198 ARG A H      1 
ATOM   3288  H  HA     . ARG A 1 198 ? 13.780  29.003  37.801  1.00 51.17  ? 198 ARG A HA     1 
ATOM   3289  H  HB2    . ARG A 1 198 ? 15.840  27.775  39.289  1.00 64.04  ? 198 ARG A HB2    1 
ATOM   3290  H  HB3    . ARG A 1 198 ? 14.343  27.261  39.218  1.00 64.04  ? 198 ARG A HB3    1 
ATOM   3291  H  HG2    . ARG A 1 198 ? 15.781  27.291  36.839  1.00 64.19  ? 198 ARG A HG2    1 
ATOM   3292  H  HG3    . ARG A 1 198 ? 16.098  26.129  37.878  1.00 64.19  ? 198 ARG A HG3    1 
ATOM   3293  H  HD2    . ARG A 1 198 ? 13.864  25.454  37.789  1.00 69.66  ? 198 ARG A HD2    1 
ATOM   3294  H  HD3    . ARG A 1 198 ? 13.568  26.600  36.725  1.00 69.66  ? 198 ARG A HD3    1 
ATOM   3295  H  HE     . ARG A 1 198 ? 14.842  24.273  36.195  1.00 106.56 ? 198 ARG A HE     1 
ATOM   3296  H  HH11   . ARG A 1 198 ? 14.004  27.188  34.850  1.00 78.04  ? 198 ARG A HH11   1 
ATOM   3297  H  HH12   . ARG A 1 198 ? 14.238  26.780  33.437  1.00 78.04  ? 198 ARG A HH12   1 
ATOM   3298  H  HH21   . ARG A 1 198 ? 15.193  23.684  34.049  1.00 82.67  ? 198 ARG A HH21   1 
ATOM   3299  H  HH22   . ARG A 1 198 ? 14.956  24.666  32.954  1.00 82.67  ? 198 ARG A HH22   1 
ATOM   3300  N  N      . THR A 1 199 ? 15.024  30.983  39.784  1.00 29.14  ? 199 THR A N      1 
ATOM   3301  C  CA     . THR A 1 199 ? 14.887  31.787  40.992  1.00 17.96  ? 199 THR A CA     1 
ATOM   3302  C  C      . THR A 1 199 ? 13.490  32.358  41.161  1.00 26.32  ? 199 THR A C      1 
ATOM   3303  O  O      . THR A 1 199 ? 12.960  33.000  40.262  1.00 35.39  ? 199 THR A O      1 
ATOM   3304  C  CB     . THR A 1 199 ? 15.883  32.953  40.995  1.00 17.60  ? 199 THR A CB     1 
ATOM   3305  O  OG1    . THR A 1 199 ? 17.216  32.439  40.926  1.00 37.10  ? 199 THR A OG1    1 
ATOM   3306  C  CG2    . THR A 1 199 ? 15.742  33.787  42.258  1.00 24.49  ? 199 THR A CG2    1 
ATOM   3307  H  H      . THR A 1 199 ? 15.616  31.277  39.234  1.00 34.97  ? 199 THR A H      1 
ATOM   3308  H  HA     . THR A 1 199 ? 15.077  31.230  41.763  1.00 21.55  ? 199 THR A HA     1 
ATOM   3309  H  HB     . THR A 1 199 ? 15.716  33.524  40.229  1.00 21.12  ? 199 THR A HB     1 
ATOM   3310  H  HG1    . THR A 1 199 ? 17.368  31.943  41.587  1.00 44.52  ? 199 THR A HG1    1 
ATOM   3311  H  HG21   . THR A 1 199 ? 16.378  34.519  42.245  1.00 29.39  ? 199 THR A HG21   1 
ATOM   3312  H  HG22   . THR A 1 199 ? 14.845  34.151  42.316  1.00 29.39  ? 199 THR A HG22   1 
ATOM   3313  H  HG23   . THR A 1 199 ? 15.911  33.237  43.039  1.00 29.39  ? 199 THR A HG23   1 
ATOM   3314  N  N      . VAL A 1 200 ? 12.907  32.124  42.332  1.00 48.08  ? 200 VAL A N      1 
ATOM   3315  C  CA     . VAL A 1 200 ? 11.650  32.754  42.707  1.00 40.02  ? 200 VAL A CA     1 
ATOM   3316  C  C      . VAL A 1 200 ? 11.885  33.638  43.927  1.00 42.19  ? 200 VAL A C      1 
ATOM   3317  O  O      . VAL A 1 200 ? 12.471  33.194  44.914  1.00 42.00  ? 200 VAL A O      1 
ATOM   3318  C  CB     . VAL A 1 200 ? 10.555  31.712  43.020  1.00 31.50  ? 200 VAL A CB     1 
ATOM   3319  C  CG1    . VAL A 1 200 ? 9.243   32.393  43.374  1.00 32.44  ? 200 VAL A CG1    1 
ATOM   3320  C  CG2    . VAL A 1 200 ? 10.353  30.780  41.841  1.00 41.13  ? 200 VAL A CG2    1 
ATOM   3321  H  H      . VAL A 1 200 ? 13.226  31.598  42.933  1.00 57.70  ? 200 VAL A H      1 
ATOM   3322  H  HA     . VAL A 1 200 ? 11.340  33.314  41.979  1.00 48.03  ? 200 VAL A HA     1 
ATOM   3323  H  HB     . VAL A 1 200 ? 10.833  31.179  43.781  1.00 37.80  ? 200 VAL A HB     1 
ATOM   3324  H  HG11   . VAL A 1 200 ? 8.577   31.714  43.565  1.00 38.93  ? 200 VAL A HG11   1 
ATOM   3325  H  HG12   . VAL A 1 200 ? 9.379   32.952  44.155  1.00 38.93  ? 200 VAL A HG12   1 
ATOM   3326  H  HG13   . VAL A 1 200 ? 8.957   32.936  42.624  1.00 38.93  ? 200 VAL A HG13   1 
ATOM   3327  H  HG21   . VAL A 1 200 ? 9.662   30.136  42.062  1.00 49.35  ? 200 VAL A HG21   1 
ATOM   3328  H  HG22   . VAL A 1 200 ? 10.085  31.302  41.068  1.00 49.35  ? 200 VAL A HG22   1 
ATOM   3329  H  HG23   . VAL A 1 200 ? 11.187  30.320  41.656  1.00 49.35  ? 200 VAL A HG23   1 
ATOM   3330  N  N      . ILE A 1 201 ? 11.413  34.879  43.856  1.00 34.69  ? 201 ILE A N      1 
ATOM   3331  C  CA     . ILE A 1 201 ? 11.572  35.834  44.945  1.00 29.48  ? 201 ILE A CA     1 
ATOM   3332  C  C      . ILE A 1 201 ? 10.205  36.314  45.402  1.00 42.01  ? 201 ILE A C      1 
ATOM   3333  O  O      . ILE A 1 201 ? 9.641   37.244  44.828  1.00 47.74  ? 201 ILE A O      1 
ATOM   3334  C  CB     . ILE A 1 201 ? 12.425  37.043  44.521  1.00 20.44  ? 201 ILE A CB     1 
ATOM   3335  C  CG1    . ILE A 1 201 ? 13.835  36.586  44.148  1.00 22.27  ? 201 ILE A CG1    1 
ATOM   3336  C  CG2    . ILE A 1 201 ? 12.499  38.069  45.643  1.00 23.45  ? 201 ILE A CG2    1 
ATOM   3337  C  CD1    . ILE A 1 201 ? 14.733  37.690  43.623  1.00 22.70  ? 201 ILE A CD1    1 
ATOM   3338  H  H      . ILE A 1 201 ? 10.991  35.196  43.177  1.00 41.63  ? 201 ILE A H      1 
ATOM   3339  H  HA     . ILE A 1 201 ? 12.009  35.398  45.694  1.00 35.37  ? 201 ILE A HA     1 
ATOM   3340  H  HB     . ILE A 1 201 ? 12.016  37.457  43.745  1.00 24.53  ? 201 ILE A HB     1 
ATOM   3341  H  HG12   . ILE A 1 201 ? 14.259  36.212  44.937  1.00 26.72  ? 201 ILE A HG12   1 
ATOM   3342  H  HG13   . ILE A 1 201 ? 13.769  35.906  43.459  1.00 26.72  ? 201 ILE A HG13   1 
ATOM   3343  H  HG21   . ILE A 1 201 ? 13.041  38.818  45.350  1.00 28.14  ? 201 ILE A HG21   1 
ATOM   3344  H  HG22   . ILE A 1 201 ? 11.601  38.371  45.853  1.00 28.14  ? 201 ILE A HG22   1 
ATOM   3345  H  HG23   . ILE A 1 201 ? 12.900  37.655  46.423  1.00 28.14  ? 201 ILE A HG23   1 
ATOM   3346  H  HD11   . ILE A 1 201 ? 15.603  37.315  43.412  1.00 27.24  ? 201 ILE A HD11   1 
ATOM   3347  H  HD12   . ILE A 1 201 ? 14.333  38.068  42.824  1.00 27.24  ? 201 ILE A HD12   1 
ATOM   3348  H  HD13   . ILE A 1 201 ? 14.823  38.374  44.304  1.00 27.24  ? 201 ILE A HD13   1 
ATOM   3349  N  N      . ASP A 1 202 ? 9.683   35.681  46.447  1.00 45.19  ? 202 ASP A N      1 
ATOM   3350  C  CA     . ASP A 1 202 ? 8.405   36.078  47.017  1.00 49.56  ? 202 ASP A CA     1 
ATOM   3351  C  C      . ASP A 1 202 ? 8.656   37.127  48.091  1.00 40.76  ? 202 ASP A C      1 
ATOM   3352  O  O      . ASP A 1 202 ? 9.034   36.800  49.213  1.00 52.67  ? 202 ASP A O      1 
ATOM   3353  C  CB     . ASP A 1 202 ? 7.669   34.867  47.596  1.00 36.82  ? 202 ASP A CB     1 
ATOM   3354  C  CG     . ASP A 1 202 ? 6.192   35.129  47.812  1.00 45.39  ? 202 ASP A CG     1 
ATOM   3355  O  OD1    . ASP A 1 202 ? 5.810   36.305  48.009  1.00 34.15  ? 202 ASP A OD1    1 
ATOM   3356  O  OD2    . ASP A 1 202 ? 5.412   34.153  47.788  1.00 46.23  ? 202 ASP A OD2    1 
ATOM   3357  H  H      . ASP A 1 202 ? 10.054  35.016  46.846  1.00 54.23  ? 202 ASP A H      1 
ATOM   3358  H  HA     . ASP A 1 202 ? 7.851   36.473  46.326  1.00 59.48  ? 202 ASP A HA     1 
ATOM   3359  H  HB2    . ASP A 1 202 ? 7.754   34.122  46.981  1.00 44.19  ? 202 ASP A HB2    1 
ATOM   3360  H  HB3    . ASP A 1 202 ? 8.062   34.638  48.452  1.00 44.19  ? 202 ASP A HB3    1 
ATOM   3361  N  N      . VAL A 1 203 ? 8.451   38.391  47.741  1.00 45.01  ? 203 VAL A N      1 
ATOM   3362  C  CA     . VAL A 1 203 ? 8.752   39.482  48.657  1.00 38.82  ? 203 VAL A CA     1 
ATOM   3363  C  C      . VAL A 1 203 ? 7.805   39.464  49.843  1.00 35.72  ? 203 VAL A C      1 
ATOM   3364  O  O      . VAL A 1 203 ? 8.203   39.743  50.970  1.00 34.15  ? 203 VAL A O      1 
ATOM   3365  C  CB     . VAL A 1 203 ? 8.649   40.852  47.965  1.00 48.20  ? 203 VAL A CB     1 
ATOM   3366  C  CG1    . VAL A 1 203 ? 9.176   41.949  48.880  1.00 27.47  ? 203 VAL A CG1    1 
ATOM   3367  C  CG2    . VAL A 1 203 ? 9.413   40.850  46.648  1.00 56.30  ? 203 VAL A CG2    1 
ATOM   3368  H  H      . VAL A 1 203 ? 8.139   38.643  46.981  1.00 54.01  ? 203 VAL A H      1 
ATOM   3369  H  HA     . VAL A 1 203 ? 9.657   39.378  48.991  1.00 46.59  ? 203 VAL A HA     1 
ATOM   3370  H  HB     . VAL A 1 203 ? 7.718   41.042  47.773  1.00 57.85  ? 203 VAL A HB     1 
ATOM   3371  H  HG11   . VAL A 1 203 ? 9.102   42.802  48.424  1.00 32.97  ? 203 VAL A HG11   1 
ATOM   3372  H  HG12   . VAL A 1 203 ? 8.649   41.961  49.694  1.00 32.97  ? 203 VAL A HG12   1 
ATOM   3373  H  HG13   . VAL A 1 203 ? 10.105  41.765  49.090  1.00 32.97  ? 203 VAL A HG13   1 
ATOM   3374  H  HG21   . VAL A 1 203 ? 9.332   41.724  46.235  1.00 67.56  ? 203 VAL A HG21   1 
ATOM   3375  H  HG22   . VAL A 1 203 ? 10.346  40.653  46.825  1.00 67.56  ? 203 VAL A HG22   1 
ATOM   3376  H  HG23   . VAL A 1 203 ? 9.036   40.172  46.066  1.00 67.56  ? 203 VAL A HG23   1 
ATOM   3377  N  N      . ALA A 1 204 ? 6.551   39.115  49.579  1.00 41.36  ? 204 ALA A N      1 
ATOM   3378  C  CA     . ALA A 1 204 ? 5.514   39.129  50.603  1.00 34.46  ? 204 ALA A CA     1 
ATOM   3379  C  C      . ALA A 1 204 ? 5.804   38.150  51.740  1.00 44.96  ? 204 ALA A C      1 
ATOM   3380  O  O      . ALA A 1 204 ? 5.332   38.339  52.860  1.00 38.20  ? 204 ALA A O      1 
ATOM   3381  C  CB     . ALA A 1 204 ? 4.171   38.816  49.980  1.00 44.53  ? 204 ALA A CB     1 
ATOM   3382  H  H      . ALA A 1 204 ? 6.272   38.864  48.805  1.00 49.63  ? 204 ALA A H      1 
ATOM   3383  H  HA     . ALA A 1 204 ? 5.464   40.019  50.984  1.00 41.35  ? 204 ALA A HA     1 
ATOM   3384  H  HB1    . ALA A 1 204 ? 3.492   38.828  50.673  1.00 53.44  ? 204 ALA A HB1    1 
ATOM   3385  H  HB2    . ALA A 1 204 ? 3.971   39.486  49.308  1.00 53.44  ? 204 ALA A HB2    1 
ATOM   3386  H  HB3    . ALA A 1 204 ? 4.211   37.937  49.571  1.00 53.44  ? 204 ALA A HB3    1 
ATOM   3387  N  N      . LYS A 1 205 ? 6.573   37.106  51.444  1.00 37.44  ? 205 LYS A N      1 
ATOM   3388  C  CA     . LYS A 1 205 ? 6.887   36.072  52.425  1.00 27.75  ? 205 LYS A CA     1 
ATOM   3389  C  C      . LYS A 1 205 ? 8.346   36.128  52.885  1.00 42.79  ? 205 LYS A C      1 
ATOM   3390  O  O      . LYS A 1 205 ? 8.773   35.315  53.707  1.00 44.57  ? 205 LYS A O      1 
ATOM   3391  C  CB     . LYS A 1 205 ? 6.586   34.692  51.842  1.00 32.90  ? 205 LYS A CB     1 
ATOM   3392  C  CG     . LYS A 1 205 ? 5.113   34.411  51.621  1.00 37.33  ? 205 LYS A CG     1 
ATOM   3393  C  CD     . LYS A 1 205 ? 4.910   33.009  51.069  1.00 51.29  ? 205 LYS A CD     1 
ATOM   3394  C  CE     . LYS A 1 205 ? 3.448   32.717  50.779  1.00 52.15  ? 205 LYS A CE     1 
ATOM   3395  N  NZ     . LYS A 1 205 ? 3.289   31.473  49.974  1.00 57.38  ? 205 LYS A NZ     1 
ATOM   3396  H  H      . LYS A 1 205 ? 6.930   36.973  50.673  1.00 44.93  ? 205 LYS A H      1 
ATOM   3397  H  HA     . LYS A 1 205 ? 6.323   36.197  53.204  1.00 33.30  ? 205 LYS A HA     1 
ATOM   3398  H  HB2    . LYS A 1 205 ? 7.033   34.613  50.985  1.00 39.48  ? 205 LYS A HB2    1 
ATOM   3399  H  HB3    . LYS A 1 205 ? 6.926   34.018  52.451  1.00 39.48  ? 205 LYS A HB3    1 
ATOM   3400  H  HG2    . LYS A 1 205 ? 4.641   34.479  52.466  1.00 44.80  ? 205 LYS A HG2    1 
ATOM   3401  H  HG3    . LYS A 1 205 ? 4.756   35.047  50.982  1.00 44.80  ? 205 LYS A HG3    1 
ATOM   3402  H  HD2    . LYS A 1 205 ? 5.407   32.918  50.241  1.00 61.55  ? 205 LYS A HD2    1 
ATOM   3403  H  HD3    . LYS A 1 205 ? 5.224   32.362  51.720  1.00 61.55  ? 205 LYS A HD3    1 
ATOM   3404  H  HE2    . LYS A 1 205 ? 2.973   32.600  51.617  1.00 62.58  ? 205 LYS A HE2    1 
ATOM   3405  H  HE3    . LYS A 1 205 ? 3.068   33.455  50.277  1.00 62.58  ? 205 LYS A HE3    1 
ATOM   3406  H  HZ1    . LYS A 1 205 ? 2.426   31.322  49.816  1.00 68.86  ? 205 LYS A HZ1    1 
ATOM   3407  H  HZ2    . LYS A 1 205 ? 3.714   31.557  49.197  1.00 68.86  ? 205 LYS A HZ2    1 
ATOM   3408  H  HZ3    . LYS A 1 205 ? 3.628   30.779  50.416  1.00 68.86  ? 205 LYS A HZ3    1 
ATOM   3409  N  N      . GLY A 1 206 ? 9.109   37.080  52.354  1.00 39.13  ? 206 GLY A N      1 
ATOM   3410  C  CA     . GLY A 1 206 ? 10.517  37.200  52.694  1.00 33.71  ? 206 GLY A CA     1 
ATOM   3411  C  C      . GLY A 1 206 ? 11.289  35.930  52.393  1.00 36.19  ? 206 GLY A C      1 
ATOM   3412  O  O      . GLY A 1 206 ? 12.226  35.578  53.111  1.00 40.34  ? 206 GLY A O      1 
ATOM   3413  H  H      . GLY A 1 206 ? 8.831   37.670  51.793  1.00 46.96  ? 206 GLY A H      1 
ATOM   3414  H  HA2    . GLY A 1 206 ? 10.911  37.927  52.188  1.00 40.45  ? 206 GLY A HA2    1 
ATOM   3415  H  HA3    . GLY A 1 206 ? 10.606  37.399  53.639  1.00 40.45  ? 206 GLY A HA3    1 
ATOM   3416  N  N      . GLU A 1 207 ? 10.877  35.242  51.332  1.00 42.72  ? 207 GLU A N      1 
ATOM   3417  C  CA     . GLU A 1 207 ? 11.400  33.923  50.995  1.00 42.82  ? 207 GLU A CA     1 
ATOM   3418  C  C      . GLU A 1 207 ? 11.976  33.885  49.582  1.00 43.25  ? 207 GLU A C      1 
ATOM   3419  O  O      . GLU A 1 207 ? 11.465  34.546  48.678  1.00 43.57  ? 207 GLU A O      1 
ATOM   3420  C  CB     . GLU A 1 207 ? 10.285  32.889  51.135  1.00 36.79  ? 207 GLU A CB     1 
ATOM   3421  C  CG     . GLU A 1 207 ? 10.678  31.458  50.830  1.00 46.24  ? 207 GLU A CG     1 
ATOM   3422  C  CD     . GLU A 1 207 ? 9.478   30.536  50.808  1.00 65.13  ? 207 GLU A CD     1 
ATOM   3423  O  OE1    . GLU A 1 207 ? 8.399   30.971  50.358  1.00 62.25  ? 207 GLU A OE1    1 
ATOM   3424  O  OE2    . GLU A 1 207 ? 9.601   29.383  51.265  1.00 83.31  ? 207 GLU A OE2    1 
ATOM   3425  H  H      . GLU A 1 207 ? 10.281  35.525  50.780  1.00 51.26  ? 207 GLU A H      1 
ATOM   3426  H  HA     . GLU A 1 207 ? 12.108  33.693  51.617  1.00 51.39  ? 207 GLU A HA     1 
ATOM   3427  H  HB2    . GLU A 1 207 ? 9.958   32.911  52.048  1.00 44.15  ? 207 GLU A HB2    1 
ATOM   3428  H  HB3    . GLU A 1 207 ? 9.567   33.128  50.529  1.00 44.15  ? 207 GLU A HB3    1 
ATOM   3429  H  HG2    . GLU A 1 207 ? 11.102  31.423  49.958  1.00 55.49  ? 207 GLU A HG2    1 
ATOM   3430  H  HG3    . GLU A 1 207 ? 11.290  31.143  51.513  1.00 55.49  ? 207 GLU A HG3    1 
ATOM   3431  N  N      . VAL A 1 208 ? 13.047  33.115  49.406  1.00 45.83  ? 208 VAL A N      1 
ATOM   3432  C  CA     . VAL A 1 208 ? 13.587  32.812  48.083  1.00 39.89  ? 208 VAL A CA     1 
ATOM   3433  C  C      . VAL A 1 208 ? 13.449  31.314  47.841  1.00 34.09  ? 208 VAL A C      1 
ATOM   3434  O  O      . VAL A 1 208 ? 14.004  30.512  48.590  1.00 42.89  ? 208 VAL A O      1 
ATOM   3435  C  CB     . VAL A 1 208 ? 15.066  33.222  47.949  1.00 33.18  ? 208 VAL A CB     1 
ATOM   3436  C  CG1    . VAL A 1 208 ? 15.559  32.974  46.533  1.00 31.88  ? 208 VAL A CG1    1 
ATOM   3437  C  CG2    . VAL A 1 208 ? 15.253  34.680  48.319  1.00 34.81  ? 208 VAL A CG2    1 
ATOM   3438  H  H      . VAL A 1 208 ? 13.487  32.750  50.050  1.00 54.99  ? 208 VAL A H      1 
ATOM   3439  H  HA     . VAL A 1 208 ? 13.073  33.283  47.408  1.00 47.87  ? 208 VAL A HA     1 
ATOM   3440  H  HB     . VAL A 1 208 ? 15.601  32.685  48.554  1.00 39.81  ? 208 VAL A HB     1 
ATOM   3441  H  HG11   . VAL A 1 208 ? 16.491  33.239  46.473  1.00 38.26  ? 208 VAL A HG11   1 
ATOM   3442  H  HG12   . VAL A 1 208 ? 15.470  32.030  46.328  1.00 38.26  ? 208 VAL A HG12   1 
ATOM   3443  H  HG13   . VAL A 1 208 ? 15.025  33.499  45.916  1.00 38.26  ? 208 VAL A HG13   1 
ATOM   3444  H  HG21   . VAL A 1 208 ? 16.190  34.911  48.225  1.00 41.78  ? 208 VAL A HG21   1 
ATOM   3445  H  HG22   . VAL A 1 208 ? 14.716  35.227  47.724  1.00 41.78  ? 208 VAL A HG22   1 
ATOM   3446  H  HG23   . VAL A 1 208 ? 14.969  34.811  49.237  1.00 41.78  ? 208 VAL A HG23   1 
ATOM   3447  N  N      . ARG A 1 209 ? 12.714  30.934  46.801  1.00 30.01  ? 209 ARG A N      1 
ATOM   3448  C  CA     . ARG A 1 209 ? 12.515  29.521  46.507  1.00 40.13  ? 209 ARG A CA     1 
ATOM   3449  C  C      . ARG A 1 209 ? 12.798  29.203  45.045  1.00 43.65  ? 209 ARG A C      1 
ATOM   3450  O  O      . ARG A 1 209 ? 13.101  30.091  44.249  1.00 35.21  ? 209 ARG A O      1 
ATOM   3451  C  CB     . ARG A 1 209 ? 11.089  29.100  46.882  1.00 38.49  ? 209 ARG A CB     1 
ATOM   3452  C  CG     . ARG A 1 209 ? 9.974   29.869  46.191  1.00 38.62  ? 209 ARG A CG     1 
ATOM   3453  C  CD     . ARG A 1 209 ? 8.611   29.350  46.634  1.00 39.15  ? 209 ARG A CD     1 
ATOM   3454  N  NE     . ARG A 1 209 ? 7.491   30.017  45.965  1.00 32.73  ? 209 ARG A NE     1 
ATOM   3455  C  CZ     . ARG A 1 209 ? 6.776   31.019  46.473  1.00 34.89  ? 209 ARG A CZ     1 
ATOM   3456  N  NH1    . ARG A 1 209 ? 7.043   31.511  47.675  1.00 51.63  ? 209 ARG A NH1    1 
ATOM   3457  N  NH2    . ARG A 1 209 ? 5.778   31.534  45.769  1.00 47.20  ? 209 ARG A NH2    1 
ATOM   3458  H  H      . ARG A 1 209 ? 12.323  31.470  46.254  1.00 36.02  ? 209 ARG A H      1 
ATOM   3459  H  HA     . ARG A 1 209 ? 13.129  29.001  47.047  1.00 48.16  ? 209 ARG A HA     1 
ATOM   3460  H  HB2    . ARG A 1 209 ? 10.978  28.162  46.658  1.00 46.18  ? 209 ARG A HB2    1 
ATOM   3461  H  HB3    . ARG A 1 209 ? 10.976  29.219  47.838  1.00 46.18  ? 209 ARG A HB3    1 
ATOM   3462  H  HG2    . ARG A 1 209 ? 10.035  30.809  46.425  1.00 46.34  ? 209 ARG A HG2    1 
ATOM   3463  H  HG3    . ARG A 1 209 ? 10.048  29.754  45.230  1.00 46.34  ? 209 ARG A HG3    1 
ATOM   3464  H  HD2    . ARG A 1 209 ? 8.556   28.403  46.435  1.00 46.98  ? 209 ARG A HD2    1 
ATOM   3465  H  HD3    . ARG A 1 209 ? 8.516   29.493  47.588  1.00 46.98  ? 209 ARG A HD3    1 
ATOM   3466  H  HE     . ARG A 1 209 ? 7.278   29.738  45.180  1.00 39.27  ? 209 ARG A HE     1 
ATOM   3467  H  HH11   . ARG A 1 209 ? 7.687   31.182  48.141  1.00 61.96  ? 209 ARG A HH11   1 
ATOM   3468  H  HH12   . ARG A 1 209 ? 6.572   32.159  47.989  1.00 61.96  ? 209 ARG A HH12   1 
ATOM   3469  H  HH21   . ARG A 1 209 ? 5.598   31.223  44.988  1.00 56.64  ? 209 ARG A HH21   1 
ATOM   3470  H  HH22   . ARG A 1 209 ? 5.315   32.183  46.091  1.00 56.64  ? 209 ARG A HH22   1 
ATOM   3471  N  N      . LYS A 1 210 ? 12.706  27.919  44.715  1.00 48.00  ? 210 LYS A N      1 
ATOM   3472  C  CA     . LYS A 1 210 ? 13.007  27.418  43.381  1.00 40.00  ? 210 LYS A CA     1 
ATOM   3473  C  C      . LYS A 1 210 ? 11.701  27.195  42.634  1.00 42.70  ? 210 LYS A C      1 
ATOM   3474  O  O      . LYS A 1 210 ? 10.695  26.837  43.242  1.00 61.55  ? 210 LYS A O      1 
ATOM   3475  C  CB     . LYS A 1 210 ? 13.809  26.120  43.482  1.00 48.10  ? 210 LYS A CB     1 
ATOM   3476  C  CG     . LYS A 1 210 ? 14.979  26.000  42.520  1.00 61.47  ? 210 LYS A CG     1 
ATOM   3477  C  CD     . LYS A 1 210 ? 14.733  24.933  41.468  1.00 76.70  ? 210 LYS A CD     1 
ATOM   3478  C  CE     . LYS A 1 210 ? 15.978  24.689  40.632  1.00 76.42  ? 210 LYS A CE     1 
ATOM   3479  N  NZ     . LYS A 1 210 ? 15.735  23.698  39.553  1.00 64.64  ? 210 LYS A NZ     1 
ATOM   3480  H  H      . LYS A 1 210 ? 12.465  27.302  45.264  1.00 57.60  ? 210 LYS A H      1 
ATOM   3481  H  HA     . LYS A 1 210 ? 13.534  28.072  42.897  1.00 47.99  ? 210 LYS A HA     1 
ATOM   3482  H  HB2    . LYS A 1 210 ? 14.164  26.048  44.382  1.00 57.72  ? 210 LYS A HB2    1 
ATOM   3483  H  HB3    . LYS A 1 210 ? 13.212  25.376  43.309  1.00 57.72  ? 210 LYS A HB3    1 
ATOM   3484  H  HG2    . LYS A 1 210 ? 15.108  26.848  42.067  1.00 73.76  ? 210 LYS A HG2    1 
ATOM   3485  H  HG3    . LYS A 1 210 ? 15.777  25.760  43.016  1.00 73.76  ? 210 LYS A HG3    1 
ATOM   3486  H  HD2    . LYS A 1 210 ? 14.492  24.101  41.905  1.00 92.04  ? 210 LYS A HD2    1 
ATOM   3487  H  HD3    . LYS A 1 210 ? 14.020  25.222  40.877  1.00 92.04  ? 210 LYS A HD3    1 
ATOM   3488  H  HE2    . LYS A 1 210 ? 16.253  25.523  40.220  1.00 91.70  ? 210 LYS A HE2    1 
ATOM   3489  H  HE3    . LYS A 1 210 ? 16.684  24.349  41.203  1.00 91.70  ? 210 LYS A HE3    1 
ATOM   3490  H  HZ1    . LYS A 1 210 ? 16.479  23.575  39.080  1.00 77.57  ? 210 LYS A HZ1    1 
ATOM   3491  H  HZ2    . LYS A 1 210 ? 15.485  22.920  39.906  1.00 77.57  ? 210 LYS A HZ2    1 
ATOM   3492  H  HZ3    . LYS A 1 210 ? 15.092  23.990  39.011  1.00 77.57  ? 210 LYS A HZ3    1 
ATOM   3493  N  N      . GLY A 1 211 ? 11.708  27.398  41.322  1.00 37.87  ? 211 GLY A N      1 
ATOM   3494  C  CA     . GLY A 1 211 ? 10.479  27.301  40.556  1.00 57.91  ? 211 GLY A CA     1 
ATOM   3495  C  C      . GLY A 1 211 ? 10.650  26.890  39.110  1.00 57.91  ? 211 GLY A C      1 
ATOM   3496  O  O      . GLY A 1 211 ? 11.698  26.391  38.701  1.00 56.86  ? 211 GLY A O      1 
ATOM   3497  H  H      . GLY A 1 211 ? 12.406  27.591  40.857  1.00 45.44  ? 211 GLY A H      1 
ATOM   3498  H  HA2    . GLY A 1 211 ? 9.895   26.654  40.982  1.00 69.49  ? 211 GLY A HA2    1 
ATOM   3499  H  HA3    . GLY A 1 211 ? 10.033  28.162  40.571  1.00 69.49  ? 211 GLY A HA3    1 
ATOM   3500  N  N      . GLU A 1 212 ? 9.595   27.111  38.334  1.00 48.68  ? 212 GLU A N      1 
ATOM   3501  C  CA     . GLU A 1 212 ? 9.565   26.716  36.935  1.00 68.50  ? 212 GLU A CA     1 
ATOM   3502  C  C      . GLU A 1 212 ? 10.325  27.715  36.074  1.00 52.38  ? 212 GLU A C      1 
ATOM   3503  O  O      . GLU A 1 212 ? 10.992  27.343  35.109  1.00 36.80  ? 212 GLU A O      1 
ATOM   3504  C  CB     . GLU A 1 212 ? 8.117   26.603  36.453  1.00 75.69  ? 212 GLU A CB     1 
ATOM   3505  C  CG     . GLU A 1 212 ? 7.928   25.742  35.212  1.00 96.74  ? 212 GLU A CG     1 
ATOM   3506  C  CD     . GLU A 1 212 ? 8.043   24.254  35.493  1.00 97.95  ? 212 GLU A CD     1 
ATOM   3507  O  OE1    . GLU A 1 212 ? 8.345   23.879  36.646  1.00 72.66  ? 212 GLU A OE1    1 
ATOM   3508  O  OE2    . GLU A 1 212 ? 7.825   23.457  34.554  1.00 85.94  ? 212 GLU A OE2    1 
ATOM   3509  H  H      . GLU A 1 212 ? 8.873   27.495  38.601  1.00 58.41  ? 212 GLU A H      1 
ATOM   3510  H  HA     . GLU A 1 212 ? 9.987   25.848  36.838  1.00 82.21  ? 212 GLU A HA     1 
ATOM   3511  H  HB2    . GLU A 1 212 ? 7.584   26.214  37.164  1.00 90.83  ? 212 GLU A HB2    1 
ATOM   3512  H  HB3    . GLU A 1 212 ? 7.788   27.492  36.247  1.00 90.83  ? 212 GLU A HB3    1 
ATOM   3513  H  HG2    . GLU A 1 212 ? 7.046   25.909  34.845  1.00 116.09 ? 212 GLU A HG2    1 
ATOM   3514  H  HG3    . GLU A 1 212 ? 8.607   25.977  34.560  1.00 116.09 ? 212 GLU A HG3    1 
ATOM   3515  N  N      . GLU A 1 213 ? 10.221  28.985  36.445  1.00 49.40  ? 213 GLU A N      1 
ATOM   3516  C  CA     . GLU A 1 213 ? 10.876  30.068  35.727  1.00 44.73  ? 213 GLU A CA     1 
ATOM   3517  C  C      . GLU A 1 213 ? 11.306  31.156  36.699  1.00 48.59  ? 213 GLU A C      1 
ATOM   3518  O  O      . GLU A 1 213 ? 11.029  31.062  37.893  1.00 58.75  ? 213 GLU A O      1 
ATOM   3519  C  CB     . GLU A 1 213 ? 9.924   30.642  34.687  1.00 44.43  ? 213 GLU A CB     1 
ATOM   3520  C  CG     . GLU A 1 213 ? 8.796   31.437  35.316  1.00 51.56  ? 213 GLU A CG     1 
ATOM   3521  C  CD     . GLU A 1 213 ? 7.516   31.366  34.517  1.00 76.64  ? 213 GLU A CD     1 
ATOM   3522  O  OE1    . GLU A 1 213 ? 7.594   31.318  33.271  1.00 104.58 ? 213 GLU A OE1    1 
ATOM   3523  O  OE2    . GLU A 1 213 ? 6.431   31.346  35.137  1.00 57.76  ? 213 GLU A OE2    1 
ATOM   3524  H  H      . GLU A 1 213 ? 9.766   29.249  37.125  1.00 59.28  ? 213 GLU A H      1 
ATOM   3525  H  HA     . GLU A 1 213 ? 11.663  29.729  35.273  1.00 53.68  ? 213 GLU A HA     1 
ATOM   3526  H  HB2    . GLU A 1 213 ? 10.417  31.232  34.097  1.00 53.32  ? 213 GLU A HB2    1 
ATOM   3527  H  HB3    . GLU A 1 213 ? 9.532   29.914  34.180  1.00 53.32  ? 213 GLU A HB3    1 
ATOM   3528  H  HG2    . GLU A 1 213 ? 8.617   31.086  36.202  1.00 61.87  ? 213 GLU A HG2    1 
ATOM   3529  H  HG3    . GLU A 1 213 ? 9.061   32.369  35.375  1.00 61.87  ? 213 GLU A HG3    1 
ATOM   3530  N  N      . PHE A 1 214 ? 11.983  32.185  36.195  1.00 41.63  ? 214 PHE A N      1 
ATOM   3531  C  CA     . PHE A 1 214 ? 12.298  33.345  37.023  1.00 25.08  ? 214 PHE A CA     1 
ATOM   3532  C  C      . PHE A 1 214 ? 10.995  34.053  37.347  1.00 33.75  ? 214 PHE A C      1 
ATOM   3533  O  O      . PHE A 1 214 ? 10.225  34.387  36.447  1.00 39.80  ? 214 PHE A O      1 
ATOM   3534  C  CB     . PHE A 1 214 ? 13.276  34.289  36.329  1.00 27.15  ? 214 PHE A CB     1 
ATOM   3535  C  CG     . PHE A 1 214 ? 13.773  35.403  37.213  1.00 23.59  ? 214 PHE A CG     1 
ATOM   3536  C  CD1    . PHE A 1 214 ? 14.893  35.225  38.009  1.00 32.77  ? 214 PHE A CD1    1 
ATOM   3537  C  CD2    . PHE A 1 214 ? 13.128  36.628  37.242  1.00 27.17  ? 214 PHE A CD2    1 
ATOM   3538  C  CE1    . PHE A 1 214 ? 15.355  36.244  38.824  1.00 24.95  ? 214 PHE A CE1    1 
ATOM   3539  C  CE2    . PHE A 1 214 ? 13.589  37.652  38.053  1.00 23.72  ? 214 PHE A CE2    1 
ATOM   3540  C  CZ     . PHE A 1 214 ? 14.704  37.458  38.844  1.00 24.73  ? 214 PHE A CZ     1 
ATOM   3541  H  H      . PHE A 1 214 ? 12.268  32.237  35.386  1.00 49.95  ? 214 PHE A H      1 
ATOM   3542  H  HA     . PHE A 1 214 ? 12.699  33.047  37.854  1.00 30.09  ? 214 PHE A HA     1 
ATOM   3543  H  HB2    . PHE A 1 214 ? 14.046  33.780  36.032  1.00 32.58  ? 214 PHE A HB2    1 
ATOM   3544  H  HB3    . PHE A 1 214 ? 12.834  34.692  35.565  1.00 32.58  ? 214 PHE A HB3    1 
ATOM   3545  H  HD1    . PHE A 1 214 ? 15.337  34.408  38.001  1.00 39.33  ? 214 PHE A HD1    1 
ATOM   3546  H  HD2    . PHE A 1 214 ? 12.376  36.765  36.712  1.00 32.60  ? 214 PHE A HD2    1 
ATOM   3547  H  HE1    . PHE A 1 214 ? 16.107  36.111  39.355  1.00 29.95  ? 214 PHE A HE1    1 
ATOM   3548  H  HE2    . PHE A 1 214 ? 13.147  38.470  38.066  1.00 28.46  ? 214 PHE A HE2    1 
ATOM   3549  H  HZ     . PHE A 1 214 ? 15.014  38.144  39.389  1.00 29.67  ? 214 PHE A HZ     1 
ATOM   3550  N  N      . PHE A 1 215 ? 10.761  34.293  38.632  1.00 39.90  ? 215 PHE A N      1 
ATOM   3551  C  CA     . PHE A 1 215 ? 9.449   34.705  39.104  1.00 31.74  ? 215 PHE A CA     1 
ATOM   3552  C  C      . PHE A 1 215 ? 9.563   35.545  40.369  1.00 29.74  ? 215 PHE A C      1 
ATOM   3553  O  O      . PHE A 1 215 ? 9.871   35.026  41.435  1.00 40.55  ? 215 PHE A O      1 
ATOM   3554  C  CB     . PHE A 1 215 ? 8.586   33.465  39.365  1.00 35.91  ? 215 PHE A CB     1 
ATOM   3555  C  CG     . PHE A 1 215 ? 7.106   33.729  39.368  1.00 33.26  ? 215 PHE A CG     1 
ATOM   3556  C  CD1    . PHE A 1 215 ? 6.535   34.577  40.299  1.00 30.23  ? 215 PHE A CD1    1 
ATOM   3557  C  CD2    . PHE A 1 215 ? 6.278   33.096  38.454  1.00 36.37  ? 215 PHE A CD2    1 
ATOM   3558  C  CE1    . PHE A 1 215 ? 5.175   34.807  40.303  1.00 33.90  ? 215 PHE A CE1    1 
ATOM   3559  C  CE2    . PHE A 1 215 ? 4.915   33.322  38.457  1.00 21.52  ? 215 PHE A CE2    1 
ATOM   3560  C  CZ     . PHE A 1 215 ? 4.365   34.178  39.382  1.00 24.88  ? 215 PHE A CZ     1 
ATOM   3561  H  H      . PHE A 1 215 ? 11.351  34.223  39.253  1.00 47.88  ? 215 PHE A H      1 
ATOM   3562  H  HA     . PHE A 1 215 ? 9.015   35.240  38.421  1.00 38.09  ? 215 PHE A HA     1 
ATOM   3563  H  HB2    . PHE A 1 215 ? 8.767   32.809  38.673  1.00 43.09  ? 215 PHE A HB2    1 
ATOM   3564  H  HB3    . PHE A 1 215 ? 8.822   33.099  40.231  1.00 43.09  ? 215 PHE A HB3    1 
ATOM   3565  H  HD1    . PHE A 1 215 ? 7.076   35.006  40.922  1.00 36.27  ? 215 PHE A HD1    1 
ATOM   3566  H  HD2    . PHE A 1 215 ? 6.646   32.518  37.825  1.00 43.64  ? 215 PHE A HD2    1 
ATOM   3567  H  HE1    . PHE A 1 215 ? 4.803   35.385  40.930  1.00 40.67  ? 215 PHE A HE1    1 
ATOM   3568  H  HE2    . PHE A 1 215 ? 4.371   32.897  37.834  1.00 25.83  ? 215 PHE A HE2    1 
ATOM   3569  H  HZ     . PHE A 1 215 ? 3.448   34.332  39.386  1.00 29.86  ? 215 PHE A HZ     1 
ATOM   3570  N  N      . VAL A 1 216 ? 9.350   36.850  40.238  1.00 32.93  ? 216 VAL A N      1 
ATOM   3571  C  CA     . VAL A 1 216 ? 9.250   37.736  41.396  1.00 36.32  ? 216 VAL A CA     1 
ATOM   3572  C  C      . VAL A 1 216 ? 7.781   37.934  41.764  1.00 34.66  ? 216 VAL A C      1 
ATOM   3573  O  O      . VAL A 1 216 ? 7.057   38.649  41.076  1.00 33.55  ? 216 VAL A O      1 
ATOM   3574  C  CB     . VAL A 1 216 ? 9.909   39.096  41.123  1.00 32.27  ? 216 VAL A CB     1 
ATOM   3575  C  CG1    . VAL A 1 216 ? 9.741   40.031  42.317  1.00 35.94  ? 216 VAL A CG1    1 
ATOM   3576  C  CG2    . VAL A 1 216 ? 11.379  38.901  40.804  1.00 30.31  ? 216 VAL A CG2    1 
ATOM   3577  H  H      . VAL A 1 216 ? 9.258   37.252  39.483  1.00 39.51  ? 216 VAL A H      1 
ATOM   3578  H  HA     . VAL A 1 216 ? 9.700   37.327  42.152  1.00 43.59  ? 216 VAL A HA     1 
ATOM   3579  H  HB     . VAL A 1 216 ? 9.485   39.507  40.354  1.00 38.72  ? 216 VAL A HB     1 
ATOM   3580  H  HG11   . VAL A 1 216 ? 10.167  40.879  42.115  1.00 43.13  ? 216 VAL A HG11   1 
ATOM   3581  H  HG12   . VAL A 1 216 ? 8.795   40.166  42.481  1.00 43.13  ? 216 VAL A HG12   1 
ATOM   3582  H  HG13   . VAL A 1 216 ? 10.158  39.628  43.094  1.00 43.13  ? 216 VAL A HG13   1 
ATOM   3583  H  HG21   . VAL A 1 216 ? 11.783  39.766  40.634  1.00 36.37  ? 216 VAL A HG21   1 
ATOM   3584  H  HG22   . VAL A 1 216 ? 11.812  38.476  41.561  1.00 36.37  ? 216 VAL A HG22   1 
ATOM   3585  H  HG23   . VAL A 1 216 ? 11.459  38.338  40.019  1.00 36.37  ? 216 VAL A HG23   1 
ATOM   3586  N  N      . VAL A 1 217 ? 7.349   37.308  42.854  1.00 34.88  ? 217 VAL A N      1 
ATOM   3587  C  CA     . VAL A 1 217 ? 5.938   37.309  43.215  1.00 25.98  ? 217 VAL A CA     1 
ATOM   3588  C  C      . VAL A 1 217 ? 5.521   38.687  43.702  1.00 38.77  ? 217 VAL A C      1 
ATOM   3589  O  O      . VAL A 1 217 ? 6.172   39.273  44.566  1.00 39.65  ? 217 VAL A O      1 
ATOM   3590  C  CB     . VAL A 1 217 ? 5.634   36.271  44.307  1.00 29.45  ? 217 VAL A CB     1 
ATOM   3591  C  CG1    . VAL A 1 217 ? 4.137   36.157  44.531  1.00 41.56  ? 217 VAL A CG1    1 
ATOM   3592  C  CG2    . VAL A 1 217 ? 6.208   34.918  43.932  1.00 37.20  ? 217 VAL A CG2    1 
ATOM   3593  H  H      . VAL A 1 217 ? 7.853   36.876  43.400  1.00 41.86  ? 217 VAL A H      1 
ATOM   3594  H  HA     . VAL A 1 217 ? 5.408   37.090  42.432  1.00 31.18  ? 217 VAL A HA     1 
ATOM   3595  H  HB     . VAL A 1 217 ? 6.043   36.554  45.140  1.00 35.34  ? 217 VAL A HB     1 
ATOM   3596  H  HG11   . VAL A 1 217 ? 3.971   35.497  45.222  1.00 49.88  ? 217 VAL A HG11   1 
ATOM   3597  H  HG12   . VAL A 1 217 ? 3.793   37.020  44.806  1.00 49.88  ? 217 VAL A HG12   1 
ATOM   3598  H  HG13   . VAL A 1 217 ? 3.715   35.881  43.702  1.00 49.88  ? 217 VAL A HG13   1 
ATOM   3599  H  HG21   . VAL A 1 217 ? 6.003   34.282  44.635  1.00 44.64  ? 217 VAL A HG21   1 
ATOM   3600  H  HG22   . VAL A 1 217 ? 5.811   34.627  43.096  1.00 44.64  ? 217 VAL A HG22   1 
ATOM   3601  H  HG23   . VAL A 1 217 ? 7.169   35.001  43.830  1.00 44.64  ? 217 VAL A HG23   1 
ATOM   3602  N  N      . ASP A 1 218 ? 4.412   39.182  43.160  1.00 36.14  ? 218 ASP A N      1 
ATOM   3603  C  CA     . ASP A 1 218 ? 3.900   40.501  43.509  1.00 34.91  ? 218 ASP A CA     1 
ATOM   3604  C  C      . ASP A 1 218 ? 3.234   40.468  44.877  1.00 50.65  ? 218 ASP A C      1 
ATOM   3605  O  O      . ASP A 1 218 ? 2.328   39.665  45.096  1.00 44.25  ? 218 ASP A O      1 
ATOM   3606  C  CB     . ASP A 1 218 ? 2.904   40.985  42.453  1.00 34.01  ? 218 ASP A CB     1 
ATOM   3607  C  CG     . ASP A 1 218 ? 2.634   42.480  42.539  1.00 39.30  ? 218 ASP A CG     1 
ATOM   3608  O  OD1    . ASP A 1 218 ? 2.833   43.071  43.619  1.00 34.26  ? 218 ASP A OD1    1 
ATOM   3609  O  OD2    . ASP A 1 218 ? 2.218   43.069  41.520  1.00 49.93  ? 218 ASP A OD2    1 
ATOM   3610  H  H      . ASP A 1 218 ? 3.933   38.766  42.579  1.00 43.37  ? 218 ASP A H      1 
ATOM   3611  H  HA     . ASP A 1 218 ? 4.636   41.131  43.544  1.00 41.89  ? 218 ASP A HA     1 
ATOM   3612  H  HB2    . ASP A 1 218 ? 3.262   40.796  41.572  1.00 40.81  ? 218 ASP A HB2    1 
ATOM   3613  H  HB3    . ASP A 1 218 ? 2.062   40.521  42.577  1.00 40.81  ? 218 ASP A HB3    1 
ATOM   3614  N  N      . PRO A 1 219 ? 3.684   41.328  45.808  1.00 52.25  ? 219 PRO A N      1 
ATOM   3615  C  CA     . PRO A 1 219 ? 3.037   41.378  47.122  1.00 35.30  ? 219 PRO A CA     1 
ATOM   3616  C  C      . PRO A 1 219 ? 1.531   41.582  47.035  1.00 37.07  ? 219 PRO A C      1 
ATOM   3617  O  O      . PRO A 1 219 ? 0.790   41.088  47.881  1.00 45.67  ? 219 PRO A O      1 
ATOM   3618  C  CB     . PRO A 1 219 ? 3.704   42.579  47.792  1.00 35.13  ? 219 PRO A CB     1 
ATOM   3619  C  CG     . PRO A 1 219 ? 5.025   42.680  47.153  1.00 32.85  ? 219 PRO A CG     1 
ATOM   3620  C  CD     . PRO A 1 219 ? 4.850   42.229  45.742  1.00 39.55  ? 219 PRO A CD     1 
ATOM   3621  H  HA     . PRO A 1 219 ? 3.230   40.574  47.628  1.00 42.36  ? 219 PRO A HA     1 
ATOM   3622  H  HB2    . PRO A 1 219 ? 3.180   43.379  47.628  1.00 42.16  ? 219 PRO A HB2    1 
ATOM   3623  H  HB3    . PRO A 1 219 ? 3.794   42.415  48.744  1.00 42.16  ? 219 PRO A HB3    1 
ATOM   3624  H  HG2    . PRO A 1 219 ? 5.327   43.602  47.179  1.00 39.43  ? 219 PRO A HG2    1 
ATOM   3625  H  HG3    . PRO A 1 219 ? 5.654   42.105  47.617  1.00 39.43  ? 219 PRO A HG3    1 
ATOM   3626  H  HD2    . PRO A 1 219 ? 4.660   42.987  45.167  1.00 47.46  ? 219 PRO A HD2    1 
ATOM   3627  H  HD3    . PRO A 1 219 ? 5.635   41.744  45.443  1.00 47.46  ? 219 PRO A HD3    1 
ATOM   3628  N  N      . VAL A 1 220 ? 1.095   42.310  46.015  1.00 48.19  ? 220 VAL A N      1 
ATOM   3629  C  CA     . VAL A 1 220 ? -0.308  42.675  45.860  1.00 35.58  ? 220 VAL A CA     1 
ATOM   3630  C  C      . VAL A 1 220 ? -1.133  41.548  45.225  1.00 28.95  ? 220 VAL A C      1 
ATOM   3631  O  O      . VAL A 1 220 ? -2.335  41.442  45.462  1.00 28.89  ? 220 VAL A O      1 
ATOM   3632  C  CB     . VAL A 1 220 ? -0.424  43.970  45.018  1.00 33.18  ? 220 VAL A CB     1 
ATOM   3633  C  CG1    . VAL A 1 220 ? -1.856  44.284  44.672  1.00 47.59  ? 220 VAL A CG1    1 
ATOM   3634  C  CG2    . VAL A 1 220 ? 0.187   45.138  45.776  1.00 24.01  ? 220 VAL A CG2    1 
ATOM   3635  H  H      . VAL A 1 220 ? 1.601   42.610  45.387  1.00 57.83  ? 220 VAL A H      1 
ATOM   3636  H  HA     . VAL A 1 220 ? -0.681  42.857  46.737  1.00 42.70  ? 220 VAL A HA     1 
ATOM   3637  H  HB     . VAL A 1 220 ? 0.069   43.856  44.191  1.00 39.81  ? 220 VAL A HB     1 
ATOM   3638  H  HG11   . VAL A 1 220 ? -1.882  45.099  44.146  1.00 57.10  ? 220 VAL A HG11   1 
ATOM   3639  H  HG12   . VAL A 1 220 ? -2.225  43.548  44.159  1.00 57.10  ? 220 VAL A HG12   1 
ATOM   3640  H  HG13   . VAL A 1 220 ? -2.360  44.403  45.492  1.00 57.10  ? 220 VAL A HG13   1 
ATOM   3641  H  HG21   . VAL A 1 220 ? 0.107   45.940  45.237  1.00 28.81  ? 220 VAL A HG21   1 
ATOM   3642  H  HG22   . VAL A 1 220 ? -0.288  45.254  46.614  1.00 28.81  ? 220 VAL A HG22   1 
ATOM   3643  H  HG23   . VAL A 1 220 ? 1.122   44.948  45.949  1.00 28.81  ? 220 VAL A HG23   1 
ATOM   3644  N  N      . ASP A 1 221 ? -0.481  40.697  44.439  1.00 45.62  ? 221 ASP A N      1 
ATOM   3645  C  CA     . ASP A 1 221 ? -1.151  39.565  43.802  1.00 39.96  ? 221 ASP A CA     1 
ATOM   3646  C  C      . ASP A 1 221 ? -0.172  38.408  43.643  1.00 40.87  ? 221 ASP A C      1 
ATOM   3647  O  O      . ASP A 1 221 ? 0.749   38.472  42.836  1.00 35.86  ? 221 ASP A O      1 
ATOM   3648  C  CB     . ASP A 1 221 ? -1.723  39.973  42.445  1.00 31.42  ? 221 ASP A CB     1 
ATOM   3649  C  CG     . ASP A 1 221 ? -2.715  38.966  41.898  1.00 50.74  ? 221 ASP A CG     1 
ATOM   3650  O  OD1    . ASP A 1 221 ? -2.798  37.843  42.438  1.00 56.42  ? 221 ASP A OD1    1 
ATOM   3651  O  OD2    . ASP A 1 221 ? -3.413  39.301  40.918  1.00 64.99  ? 221 ASP A OD2    1 
ATOM   3652  H  H      . ASP A 1 221 ? 0.357   40.754  44.255  1.00 54.74  ? 221 ASP A H      1 
ATOM   3653  H  HA     . ASP A 1 221 ? -1.884  39.268  44.365  1.00 47.95  ? 221 ASP A HA     1 
ATOM   3654  H  HB2    . ASP A 1 221 ? -2.180  40.824  42.537  1.00 37.71  ? 221 ASP A HB2    1 
ATOM   3655  H  HB3    . ASP A 1 221 ? -0.997  40.054  41.807  1.00 37.71  ? 221 ASP A HB3    1 
ATOM   3656  N  N      . GLU A 1 222 ? -0.379  37.350  44.418  1.00 52.22  ? 222 GLU A N      1 
ATOM   3657  C  CA     . GLU A 1 222 ? 0.553   36.230  44.447  1.00 49.07  ? 222 GLU A CA     1 
ATOM   3658  C  C      . GLU A 1 222 ? 0.567   35.418  43.152  1.00 54.38  ? 222 GLU A C      1 
ATOM   3659  O  O      . GLU A 1 222 ? 1.403   34.529  42.978  1.00 48.88  ? 222 GLU A O      1 
ATOM   3660  C  CB     . GLU A 1 222 ? 0.210   35.308  45.614  1.00 50.38  ? 222 GLU A CB     1 
ATOM   3661  C  CG     . GLU A 1 222 ? -1.235  34.839  45.616  1.00 53.91  ? 222 GLU A CG     1 
ATOM   3662  C  CD     . GLU A 1 222 ? -1.449  33.618  46.481  1.00 70.10  ? 222 GLU A CD     1 
ATOM   3663  O  OE1    . GLU A 1 222 ? -0.602  32.700  46.440  1.00 51.20  ? 222 GLU A OE1    1 
ATOM   3664  O  OE2    . GLU A 1 222 ? -2.465  33.575  47.204  1.00 85.40  ? 222 GLU A OE2    1 
ATOM   3665  H  H      . GLU A 1 222 ? -1.056  37.256  44.940  1.00 62.66  ? 222 GLU A H      1 
ATOM   3666  H  HA     . GLU A 1 222 ? 1.449   36.573  44.592  1.00 58.88  ? 222 GLU A HA     1 
ATOM   3667  H  HB2    . GLU A 1 222 ? 0.777   34.523  45.570  1.00 60.45  ? 222 GLU A HB2    1 
ATOM   3668  H  HB3    . GLU A 1 222 ? 0.369   35.783  46.445  1.00 60.45  ? 222 GLU A HB3    1 
ATOM   3669  H  HG2    . GLU A 1 222 ? -1.798  35.551  45.956  1.00 64.70  ? 222 GLU A HG2    1 
ATOM   3670  H  HG3    . GLU A 1 222 ? -1.495  34.614  44.709  1.00 64.70  ? 222 GLU A HG3    1 
ATOM   3671  N  N      . LYS A 1 223 ? -0.351  35.730  42.245  1.00 49.18  ? 223 LYS A N      1 
ATOM   3672  C  CA     . LYS A 1 223 ? -0.401  35.071  40.947  1.00 42.92  ? 223 LYS A CA     1 
ATOM   3673  C  C      . LYS A 1 223 ? 0.398   35.854  39.908  1.00 41.87  ? 223 LYS A C      1 
ATOM   3674  O  O      . LYS A 1 223 ? 0.840   35.298  38.904  1.00 45.53  ? 223 LYS A O      1 
ATOM   3675  C  CB     . LYS A 1 223 ? -1.850  34.897  40.491  1.00 42.78  ? 223 LYS A CB     1 
ATOM   3676  C  CG     . LYS A 1 223 ? -2.673  33.992  41.402  1.00 58.18  ? 223 LYS A CG     1 
ATOM   3677  C  CD     . LYS A 1 223 ? -2.312  32.517  41.239  1.00 72.60  ? 223 LYS A CD     1 
ATOM   3678  C  CE     . LYS A 1 223 ? -1.337  32.056  42.325  1.00 75.58  ? 223 LYS A CE     1 
ATOM   3679  N  NZ     . LYS A 1 223 ? -0.980  30.616  42.212  1.00 42.38  ? 223 LYS A NZ     1 
ATOM   3680  H  H      . LYS A 1 223 ? -0.962  36.325  42.359  1.00 59.01  ? 223 LYS A H      1 
ATOM   3681  H  HA     . LYS A 1 223 ? -0.004  34.189  41.026  1.00 51.50  ? 223 LYS A HA     1 
ATOM   3682  H  HB2    . LYS A 1 223 ? -2.278  35.767  40.471  1.00 51.34  ? 223 LYS A HB2    1 
ATOM   3683  H  HB3    . LYS A 1 223 ? -1.854  34.508  39.603  1.00 51.34  ? 223 LYS A HB3    1 
ATOM   3684  H  HG2    . LYS A 1 223 ? -2.512  34.241  42.326  1.00 69.82  ? 223 LYS A HG2    1 
ATOM   3685  H  HG3    . LYS A 1 223 ? -3.613  34.098  41.188  1.00 69.82  ? 223 LYS A HG3    1 
ATOM   3686  H  HD2    . LYS A 1 223 ? -3.118  31.982  41.306  1.00 87.12  ? 223 LYS A HD2    1 
ATOM   3687  H  HD3    . LYS A 1 223 ? -1.891  32.384  40.375  1.00 87.12  ? 223 LYS A HD3    1 
ATOM   3688  H  HE2    . LYS A 1 223 ? -0.519  32.573  42.254  1.00 90.70  ? 223 LYS A HE2    1 
ATOM   3689  H  HE3    . LYS A 1 223 ? -1.743  32.196  43.194  1.00 90.70  ? 223 LYS A HE3    1 
ATOM   3690  H  HZ1    . LYS A 1 223 ? -0.413  30.391  42.860  1.00 50.86  ? 223 LYS A HZ1    1 
ATOM   3691  H  HZ2    . LYS A 1 223 ? -1.713  30.115  42.281  1.00 50.86  ? 223 LYS A HZ2    1 
ATOM   3692  H  HZ3    . LYS A 1 223 ? -0.596  30.459  41.424  1.00 50.86  ? 223 LYS A HZ3    1 
ATOM   3693  N  N      . ARG A 1 224 ? 0.572   37.148  40.158  1.00 40.90  ? 224 ARG A N      1 
ATOM   3694  C  CA     . ARG A 1 224 ? 1.251   38.043  39.225  1.00 39.28  ? 224 ARG A CA     1 
ATOM   3695  C  C      . ARG A 1 224 ? 2.771   37.933  39.323  1.00 40.19  ? 224 ARG A C      1 
ATOM   3696  O  O      . ARG A 1 224 ? 3.340   37.992  40.410  1.00 44.82  ? 224 ARG A O      1 
ATOM   3697  C  CB     . ARG A 1 224 ? 0.805   39.486  39.495  1.00 34.25  ? 224 ARG A CB     1 
ATOM   3698  C  CG     . ARG A 1 224 ? 1.716   40.595  38.971  1.00 31.60  ? 224 ARG A CG     1 
ATOM   3699  C  CD     . ARG A 1 224 ? 1.804   40.632  37.463  1.00 36.37  ? 224 ARG A CD     1 
ATOM   3700  N  NE     . ARG A 1 224 ? 2.358   41.904  37.007  1.00 51.28  ? 224 ARG A NE     1 
ATOM   3701  C  CZ     . ARG A 1 224 ? 2.669   42.179  35.744  1.00 47.79  ? 224 ARG A CZ     1 
ATOM   3702  N  NH1    . ARG A 1 224 ? 2.490   41.266  34.799  1.00 30.38  ? 224 ARG A NH1    1 
ATOM   3703  N  NH2    . ARG A 1 224 ? 3.163   43.367  35.427  1.00 33.89  ? 224 ARG A NH2    1 
ATOM   3704  H  H      . ARG A 1 224 ? 0.300   37.539  40.875  1.00 49.08  ? 224 ARG A H      1 
ATOM   3705  H  HA     . ARG A 1 224 ? 0.991   37.813  38.320  1.00 47.14  ? 224 ARG A HA     1 
ATOM   3706  H  HB2    . ARG A 1 224 ? -0.066  39.614  39.088  1.00 41.10  ? 224 ARG A HB2    1 
ATOM   3707  H  HB3    . ARG A 1 224 ? 0.730   39.605  40.455  1.00 41.10  ? 224 ARG A HB3    1 
ATOM   3708  H  HG2    . ARG A 1 224 ? 1.374   41.451  39.271  1.00 37.92  ? 224 ARG A HG2    1 
ATOM   3709  H  HG3    . ARG A 1 224 ? 2.611   40.457  39.319  1.00 37.92  ? 224 ARG A HG3    1 
ATOM   3710  H  HD2    . ARG A 1 224 ? 2.384   39.918  37.156  1.00 43.64  ? 224 ARG A HD2    1 
ATOM   3711  H  HD3    . ARG A 1 224 ? 0.916   40.532  37.086  1.00 43.64  ? 224 ARG A HD3    1 
ATOM   3712  H  HE     . ARG A 1 224 ? 2.493   42.516  37.595  1.00 61.54  ? 224 ARG A HE     1 
ATOM   3713  H  HH11   . ARG A 1 224 ? 2.169   40.495  35.001  1.00 36.46  ? 224 ARG A HH11   1 
ATOM   3714  H  HH12   . ARG A 1 224 ? 2.694   41.447  33.983  1.00 36.46  ? 224 ARG A HH12   1 
ATOM   3715  H  HH21   . ARG A 1 224 ? 3.282   43.961  36.038  1.00 40.66  ? 224 ARG A HH21   1 
ATOM   3716  H  HH22   . ARG A 1 224 ? 3.367   43.544  34.610  1.00 40.66  ? 224 ARG A HH22   1 
ATOM   3717  N  N      . ASN A 1 225 ? 3.417   37.784  38.171  1.00 41.65  ? 225 ASN A N      1 
ATOM   3718  C  CA     . ASN A 1 225 ? 4.872   37.811  38.079  1.00 30.09  ? 225 ASN A CA     1 
ATOM   3719  C  C      . ASN A 1 225 ? 5.350   39.200  37.676  1.00 28.48  ? 225 ASN A C      1 
ATOM   3720  O  O      . ASN A 1 225 ? 5.168   39.619  36.536  1.00 41.35  ? 225 ASN A O      1 
ATOM   3721  C  CB     . ASN A 1 225 ? 5.354   36.767  37.072  1.00 37.66  ? 225 ASN A CB     1 
ATOM   3722  C  CG     . ASN A 1 225 ? 6.862   36.688  36.985  1.00 26.80  ? 225 ASN A CG     1 
ATOM   3723  O  OD1    . ASN A 1 225 ? 7.578   37.330  37.749  1.00 31.05  ? 225 ASN A OD1    1 
ATOM   3724  N  ND2    . ASN A 1 225 ? 7.353   35.886  36.051  1.00 34.08  ? 225 ASN A ND2    1 
ATOM   3725  H  H      . ASN A 1 225 ? 3.026   37.662  37.414  1.00 49.98  ? 225 ASN A H      1 
ATOM   3726  H  HA     . ASN A 1 225 ? 5.252   37.598  38.945  1.00 36.11  ? 225 ASN A HA     1 
ATOM   3727  H  HB2    . ASN A 1 225 ? 5.023   35.895  37.338  1.00 45.19  ? 225 ASN A HB2    1 
ATOM   3728  H  HB3    . ASN A 1 225 ? 5.015   36.996  36.193  1.00 45.19  ? 225 ASN A HB3    1 
ATOM   3729  H  HD21   . ASN A 1 225 ? 8.204   35.804  35.959  1.00 40.89  ? 225 ASN A HD21   1 
ATOM   3730  H  HD22   . ASN A 1 225 ? 6.820   35.447  35.538  1.00 40.89  ? 225 ASN A HD22   1 
ATOM   3731  N  N      . VAL A 1 226 ? 5.966   39.915  38.608  1.00 28.18  ? 226 VAL A N      1 
ATOM   3732  C  CA     . VAL A 1 226 ? 6.390   41.283  38.341  1.00 41.59  ? 226 VAL A CA     1 
ATOM   3733  C  C      . VAL A 1 226 ? 7.461   41.298  37.250  1.00 39.63  ? 226 VAL A C      1 
ATOM   3734  O  O      . VAL A 1 226 ? 7.550   42.246  36.464  1.00 33.73  ? 226 VAL A O      1 
ATOM   3735  C  CB     . VAL A 1 226 ? 6.931   41.969  39.626  1.00 29.95  ? 226 VAL A CB     1 
ATOM   3736  C  CG1    . VAL A 1 226 ? 7.263   43.431  39.368  1.00 34.12  ? 226 VAL A CG1    1 
ATOM   3737  C  CG2    . VAL A 1 226 ? 5.919   41.866  40.752  1.00 31.48  ? 226 VAL A CG2    1 
ATOM   3738  H  H      . VAL A 1 226 ? 6.151   39.633  39.399  1.00 33.82  ? 226 VAL A H      1 
ATOM   3739  H  HA     . VAL A 1 226 ? 5.629   41.795  38.024  1.00 49.90  ? 226 VAL A HA     1 
ATOM   3740  H  HB     . VAL A 1 226 ? 7.743   41.519  39.908  1.00 35.94  ? 226 VAL A HB     1 
ATOM   3741  H  HG11   . VAL A 1 226 ? 7.597   43.828  40.187  1.00 40.94  ? 226 VAL A HG11   1 
ATOM   3742  H  HG12   . VAL A 1 226 ? 7.940   43.483  38.675  1.00 40.94  ? 226 VAL A HG12   1 
ATOM   3743  H  HG13   . VAL A 1 226 ? 6.459   43.891  39.081  1.00 40.94  ? 226 VAL A HG13   1 
ATOM   3744  H  HG21   . VAL A 1 226 ? 6.280   42.301  41.541  1.00 37.77  ? 226 VAL A HG21   1 
ATOM   3745  H  HG22   . VAL A 1 226 ? 5.098   42.305  40.479  1.00 37.77  ? 226 VAL A HG22   1 
ATOM   3746  H  HG23   . VAL A 1 226 ? 5.748   40.930  40.938  1.00 37.77  ? 226 VAL A HG23   1 
ATOM   3747  N  N      . ALA A 1 227 ? 8.233   40.215  37.179  1.00 27.10  ? 227 ALA A N      1 
ATOM   3748  C  CA     . ALA A 1 227 ? 9.319   40.089  36.214  1.00 26.91  ? 227 ALA A CA     1 
ATOM   3749  C  C      . ALA A 1 227 ? 8.912   39.209  35.042  1.00 34.30  ? 227 ALA A C      1 
ATOM   3750  O  O      . ALA A 1 227 ? 9.728   38.468  34.494  1.00 41.05  ? 227 ALA A O      1 
ATOM   3751  C  CB     . ALA A 1 227 ? 10.553  39.523  36.892  1.00 28.35  ? 227 ALA A CB     1 
ATOM   3752  H  H      . ALA A 1 227 ? 8.144   39.529  37.690  1.00 32.53  ? 227 ALA A H      1 
ATOM   3753  H  HA     . ALA A 1 227 ? 9.541   40.968  35.869  1.00 32.30  ? 227 ALA A HA     1 
ATOM   3754  H  HB1    . ALA A 1 227 ? 11.264  39.445  36.238  1.00 34.02  ? 227 ALA A HB1    1 
ATOM   3755  H  HB2    . ALA A 1 227 ? 10.823  40.121  37.606  1.00 34.02  ? 227 ALA A HB2    1 
ATOM   3756  H  HB3    . ALA A 1 227 ? 10.340  38.649  37.255  1.00 34.02  ? 227 ALA A HB3    1 
ATOM   3757  N  N      . ALA A 1 228 ? 7.646   39.308  34.654  1.00 35.23  ? 228 ALA A N      1 
ATOM   3758  C  CA     . ALA A 1 228 ? 7.090   38.445  33.621  1.00 26.41  ? 228 ALA A CA     1 
ATOM   3759  C  C      . ALA A 1 228 ? 7.750   38.664  32.269  1.00 25.07  ? 228 ALA A C      1 
ATOM   3760  O  O      . ALA A 1 228 ? 8.005   37.704  31.543  1.00 32.88  ? 228 ALA A O      1 
ATOM   3761  C  CB     . ALA A 1 228 ? 5.592   38.668  33.507  1.00 20.85  ? 228 ALA A CB     1 
ATOM   3762  H  H      . ALA A 1 228 ? 7.084   39.874  34.976  1.00 42.28  ? 228 ALA A H      1 
ATOM   3763  H  HA     . ALA A 1 228 ? 7.234   37.520  33.876  1.00 31.70  ? 228 ALA A HA     1 
ATOM   3764  H  HB1    . ALA A 1 228 ? 5.239   38.086  32.816  1.00 25.02  ? 228 ALA A HB1    1 
ATOM   3765  H  HB2    . ALA A 1 228 ? 5.177   38.461  34.359  1.00 25.02  ? 228 ALA A HB2    1 
ATOM   3766  H  HB3    . ALA A 1 228 ? 5.428   39.595  33.275  1.00 25.02  ? 228 ALA A HB3    1 
ATOM   3767  N  N      . ASN A 1 229 ? 8.028   39.921  31.936  1.00 22.39  ? 229 ASN A N      1 
ATOM   3768  C  CA     . ASN A 1 229 ? 8.519   40.263  30.605  1.00 27.30  ? 229 ASN A CA     1 
ATOM   3769  C  C      . ASN A 1 229 ? 10.038  40.448  30.548  1.00 37.33  ? 229 ASN A C      1 
ATOM   3770  O  O      . ASN A 1 229 ? 10.582  40.837  29.512  1.00 44.27  ? 229 ASN A O      1 
ATOM   3771  C  CB     . ASN A 1 229 ? 7.826   41.532  30.102  1.00 29.95  ? 229 ASN A CB     1 
ATOM   3772  C  CG     . ASN A 1 229 ? 7.848   41.650  28.587  1.00 25.99  ? 229 ASN A CG     1 
ATOM   3773  O  OD1    . ASN A 1 229 ? 7.967   40.653  27.877  1.00 40.15  ? 229 ASN A OD1    1 
ATOM   3774  N  ND2    . ASN A 1 229 ? 7.735   42.873  28.086  1.00 27.07  ? 229 ASN A ND2    1 
ATOM   3775  H  H      . ASN A 1 229 ? 7.941   40.595  32.464  1.00 26.87  ? 229 ASN A H      1 
ATOM   3776  H  HA     . ASN A 1 229 ? 8.289   39.543  29.998  1.00 32.76  ? 229 ASN A HA     1 
ATOM   3777  H  HB2    . ASN A 1 229 ? 6.899   41.522  30.389  1.00 35.94  ? 229 ASN A HB2    1 
ATOM   3778  H  HB3    . ASN A 1 229 ? 8.279   42.307  30.470  1.00 35.94  ? 229 ASN A HB3    1 
ATOM   3779  H  HD21   . ASN A 1 229 ? 7.742   42.991  27.234  1.00 32.48  ? 229 ASN A HD21   1 
ATOM   3780  H  HD22   . ASN A 1 229 ? 7.654   43.547  28.613  1.00 32.48  ? 229 ASN A HD22   1 
ATOM   3781  N  N      . LEU A 1 230 ? 10.720  40.173  31.657  1.00 32.76  ? 230 LEU A N      1 
ATOM   3782  C  CA     . LEU A 1 230 ? 12.181  40.171  31.668  1.00 38.55  ? 230 LEU A CA     1 
ATOM   3783  C  C      . LEU A 1 230 ? 12.691  38.948  30.919  1.00 30.41  ? 230 LEU A C      1 
ATOM   3784  O  O      . LEU A 1 230 ? 12.571  37.823  31.404  1.00 28.12  ? 230 LEU A O      1 
ATOM   3785  C  CB     . LEU A 1 230 ? 12.723  40.175  33.099  1.00 28.60  ? 230 LEU A CB     1 
ATOM   3786  C  CG     . LEU A 1 230 ? 14.248  40.099  33.232  1.00 24.87  ? 230 LEU A CG     1 
ATOM   3787  C  CD1    . LEU A 1 230 ? 14.911  41.334  32.657  1.00 16.82  ? 230 LEU A CD1    1 
ATOM   3788  C  CD2    . LEU A 1 230 ? 14.650  39.902  34.680  1.00 32.74  ? 230 LEU A CD2    1 
ATOM   3789  H  H      . LEU A 1 230 ? 10.362  39.985  32.416  1.00 39.32  ? 230 LEU A H      1 
ATOM   3790  H  HA     . LEU A 1 230 ? 12.507  40.965  31.216  1.00 46.26  ? 230 LEU A HA     1 
ATOM   3791  H  HB2    . LEU A 1 230 ? 12.434  40.992  33.534  1.00 34.32  ? 230 LEU A HB2    1 
ATOM   3792  H  HB3    . LEU A 1 230 ? 12.352  39.411  33.569  1.00 34.32  ? 230 LEU A HB3    1 
ATOM   3793  H  HG     . LEU A 1 230 ? 14.566  39.332  32.731  1.00 29.84  ? 230 LEU A HG     1 
ATOM   3794  H  HD11   . LEU A 1 230 ? 15.872  41.251  32.758  1.00 20.18  ? 230 LEU A HD11   1 
ATOM   3795  H  HD12   . LEU A 1 230 ? 14.682  41.406  31.717  1.00 20.18  ? 230 LEU A HD12   1 
ATOM   3796  H  HD13   . LEU A 1 230 ? 14.593  42.115  33.136  1.00 20.18  ? 230 LEU A HD13   1 
ATOM   3797  H  HD21   . LEU A 1 230 ? 15.617  39.858  34.735  1.00 39.29  ? 230 LEU A HD21   1 
ATOM   3798  H  HD22   . LEU A 1 230 ? 14.322  40.651  35.202  1.00 39.29  ? 230 LEU A HD22   1 
ATOM   3799  H  HD23   . LEU A 1 230 ? 14.261  39.075  35.005  1.00 39.29  ? 230 LEU A HD23   1 
ATOM   3800  N  N      . SER A 1 231 ? 13.277  39.171  29.748  1.00 23.65  ? 231 SER A N      1 
ATOM   3801  C  CA     . SER A 1 231 ? 13.784  38.077  28.930  1.00 33.06  ? 231 SER A CA     1 
ATOM   3802  C  C      . SER A 1 231 ? 14.882  37.318  29.664  1.00 30.46  ? 231 SER A C      1 
ATOM   3803  O  O      . SER A 1 231 ? 15.537  37.864  30.549  1.00 39.14  ? 231 SER A O      1 
ATOM   3804  C  CB     . SER A 1 231 ? 14.309  38.606  27.595  1.00 38.46  ? 231 SER A CB     1 
ATOM   3805  O  OG     . SER A 1 231 ? 15.450  39.420  27.788  1.00 29.35  ? 231 SER A OG     1 
ATOM   3806  H  H      . SER A 1 231 ? 13.393  39.950  29.403  1.00 28.38  ? 231 SER A H      1 
ATOM   3807  H  HA     . SER A 1 231 ? 13.061  37.457  28.746  1.00 39.67  ? 231 SER A HA     1 
ATOM   3808  H  HB2    . SER A 1 231 ? 14.549  37.854  27.031  1.00 46.16  ? 231 SER A HB2    1 
ATOM   3809  H  HB3    . SER A 1 231 ? 13.614  39.132  27.169  1.00 46.16  ? 231 SER A HB3    1 
ATOM   3810  H  HG     . SER A 1 231 ? 15.728  39.704  27.048  1.00 35.22  ? 231 SER A HG     1 
ATOM   3811  N  N      . LEU A 1 232 ? 15.062  36.050  29.309  1.00 24.33  ? 232 LEU A N      1 
ATOM   3812  C  CA     . LEU A 1 232 ? 16.088  35.228  29.932  1.00 17.44  ? 232 LEU A CA     1 
ATOM   3813  C  C      . LEU A 1 232 ? 17.464  35.818  29.669  1.00 21.60  ? 232 LEU A C      1 
ATOM   3814  O  O      . LEU A 1 232 ? 18.340  35.786  30.528  1.00 20.57  ? 232 LEU A O      1 
ATOM   3815  C  CB     . LEU A 1 232 ? 16.021  33.795  29.406  1.00 18.85  ? 232 LEU A CB     1 
ATOM   3816  C  CG     . LEU A 1 232 ? 17.055  32.810  29.956  1.00 16.76  ? 232 LEU A CG     1 
ATOM   3817  C  CD1    . LEU A 1 232 ? 16.906  32.643  31.457  1.00 37.78  ? 232 LEU A CD1    1 
ATOM   3818  C  CD2    . LEU A 1 232 ? 16.934  31.472  29.257  1.00 26.61  ? 232 LEU A CD2    1 
ATOM   3819  H  H      . LEU A 1 232 ? 14.601  35.643  28.708  1.00 29.19  ? 232 LEU A H      1 
ATOM   3820  H  HA     . LEU A 1 232 ? 15.944  35.208  30.891  1.00 20.93  ? 232 LEU A HA     1 
ATOM   3821  H  HB2    . LEU A 1 232 ? 15.144  33.436  29.616  1.00 22.63  ? 232 LEU A HB2    1 
ATOM   3822  H  HB3    . LEU A 1 232 ? 16.134  33.820  28.443  1.00 22.63  ? 232 LEU A HB3    1 
ATOM   3823  H  HG     . LEU A 1 232 ? 17.944  33.158  29.782  1.00 20.11  ? 232 LEU A HG     1 
ATOM   3824  H  HD11   . LEU A 1 232 ? 17.575  32.015  31.772  1.00 45.33  ? 232 LEU A HD11   1 
ATOM   3825  H  HD12   . LEU A 1 232 ? 17.033  33.505  31.884  1.00 45.33  ? 232 LEU A HD12   1 
ATOM   3826  H  HD13   . LEU A 1 232 ? 16.017  32.306  31.650  1.00 45.33  ? 232 LEU A HD13   1 
ATOM   3827  H  HD21   . LEU A 1 232 ? 17.598  30.865  29.621  1.00 31.93  ? 232 LEU A HD21   1 
ATOM   3828  H  HD22   . LEU A 1 232 ? 16.044  31.118  29.407  1.00 31.93  ? 232 LEU A HD22   1 
ATOM   3829  H  HD23   . LEU A 1 232 ? 17.086  31.598  28.307  1.00 31.93  ? 232 LEU A HD23   1 
ATOM   3830  N  N      . ASP A 1 233 ? 17.640  36.377  28.478  1.00 30.81  ? 233 ASP A N      1 
ATOM   3831  C  CA     . ASP A 1 233 ? 18.924  36.938  28.090  1.00 29.21  ? 233 ASP A CA     1 
ATOM   3832  C  C      . ASP A 1 233 ? 19.241  38.200  28.889  1.00 25.74  ? 233 ASP A C      1 
ATOM   3833  O  O      . ASP A 1 233 ? 20.377  38.392  29.313  1.00 26.83  ? 233 ASP A O      1 
ATOM   3834  C  CB     . ASP A 1 233 ? 18.939  37.237  26.591  1.00 42.16  ? 233 ASP A CB     1 
ATOM   3835  C  CG     . ASP A 1 233 ? 18.637  36.012  25.753  1.00 40.18  ? 233 ASP A CG     1 
ATOM   3836  O  OD1    . ASP A 1 233 ? 19.048  34.905  26.156  1.00 38.75  ? 233 ASP A OD1    1 
ATOM   3837  O  OD2    . ASP A 1 233 ? 17.986  36.153  24.696  1.00 59.17  ? 233 ASP A OD2    1 
ATOM   3838  H  H      . ASP A 1 233 ? 17.030  36.443  27.876  1.00 36.97  ? 233 ASP A H      1 
ATOM   3839  H  HA     . ASP A 1 233 ? 19.620  36.287  28.272  1.00 35.05  ? 233 ASP A HA     1 
ATOM   3840  H  HB2    . ASP A 1 233 ? 18.266  37.909  26.396  1.00 50.60  ? 233 ASP A HB2    1 
ATOM   3841  H  HB3    . ASP A 1 233 ? 19.817  37.564  26.342  1.00 50.60  ? 233 ASP A HB3    1 
ATOM   3842  N  N      . ASN A 1 234 ? 18.241  39.049  29.109  1.00 17.89  ? 234 ASN A N      1 
ATOM   3843  C  CA     . ASN A 1 234 ? 18.447  40.263  29.894  1.00 23.51  ? 234 ASN A CA     1 
ATOM   3844  C  C      . ASN A 1 234 ? 18.645  39.935  31.368  1.00 31.67  ? 234 ASN A C      1 
ATOM   3845  O  O      . ASN A 1 234 ? 19.377  40.632  32.072  1.00 40.44  ? 234 ASN A O      1 
ATOM   3846  C  CB     . ASN A 1 234 ? 17.276  41.235  29.734  1.00 25.16  ? 234 ASN A CB     1 
ATOM   3847  C  CG     . ASN A 1 234 ? 17.400  42.111  28.497  1.00 27.73  ? 234 ASN A CG     1 
ATOM   3848  O  OD1    . ASN A 1 234 ? 18.502  42.409  28.033  1.00 16.52  ? 234 ASN A OD1    1 
ATOM   3849  N  ND2    . ASN A 1 234 ? 16.263  42.548  27.973  1.00 36.48  ? 234 ASN A ND2    1 
ATOM   3850  H  H      . ASN A 1 234 ? 17.438  38.947  28.817  1.00 21.47  ? 234 ASN A H      1 
ATOM   3851  H  HA     . ASN A 1 234 ? 19.249  40.708  29.578  1.00 28.21  ? 234 ASN A HA     1 
ATOM   3852  H  HB2    . ASN A 1 234 ? 16.452  40.727  29.660  1.00 30.19  ? 234 ASN A HB2    1 
ATOM   3853  H  HB3    . ASN A 1 234 ? 17.238  41.815  30.510  1.00 30.19  ? 234 ASN A HB3    1 
ATOM   3854  H  HD21   . ASN A 1 234 ? 16.276  43.047  27.273  1.00 43.78  ? 234 ASN A HD21   1 
ATOM   3855  H  HD22   . ASN A 1 234 ? 15.512  42.332  28.333  1.00 43.78  ? 234 ASN A HD22   1 
ATOM   3856  N  N      . LEU A 1 235 ? 17.979  38.885  31.838  1.00 30.41  ? 235 LEU A N      1 
ATOM   3857  C  CA     . LEU A 1 235 ? 18.224  38.376  33.180  1.00 29.33  ? 235 LEU A CA     1 
ATOM   3858  C  C      . LEU A 1 235 ? 19.692  38.000  33.307  1.00 32.70  ? 235 LEU A C      1 
ATOM   3859  O  O      . LEU A 1 235 ? 20.359  38.367  34.273  1.00 34.94  ? 235 LEU A O      1 
ATOM   3860  C  CB     . LEU A 1 235 ? 17.336  37.168  33.482  1.00 32.93  ? 235 LEU A CB     1 
ATOM   3861  C  CG     . LEU A 1 235 ? 17.677  36.388  34.756  1.00 25.72  ? 235 LEU A CG     1 
ATOM   3862  C  CD1    . LEU A 1 235 ? 17.623  37.294  35.976  1.00 30.33  ? 235 LEU A CD1    1 
ATOM   3863  C  CD2    . LEU A 1 235 ? 16.745  35.204  34.930  1.00 19.36  ? 235 LEU A CD2    1 
ATOM   3864  H  H      . LEU A 1 235 ? 17.382  38.449  31.399  1.00 36.49  ? 235 LEU A H      1 
ATOM   3865  H  HA     . LEU A 1 235 ? 18.028  39.071  33.829  1.00 35.20  ? 235 LEU A HA     1 
ATOM   3866  H  HB2    . LEU A 1 235 ? 16.420  37.476  33.568  1.00 39.52  ? 235 LEU A HB2    1 
ATOM   3867  H  HB3    . LEU A 1 235 ? 17.399  36.549  32.738  1.00 39.52  ? 235 LEU A HB3    1 
ATOM   3868  H  HG     . LEU A 1 235 ? 18.581  36.046  34.681  1.00 30.86  ? 235 LEU A HG     1 
ATOM   3869  H  HD11   . LEU A 1 235 ? 17.843  36.774  36.765  1.00 36.40  ? 235 LEU A HD11   1 
ATOM   3870  H  HD12   . LEU A 1 235 ? 18.265  38.012  35.863  1.00 36.40  ? 235 LEU A HD12   1 
ATOM   3871  H  HD13   . LEU A 1 235 ? 16.728  37.659  36.059  1.00 36.40  ? 235 LEU A HD13   1 
ATOM   3872  H  HD21   . LEU A 1 235 ? 16.984  34.731  35.743  1.00 23.24  ? 235 LEU A HD21   1 
ATOM   3873  H  HD22   . LEU A 1 235 ? 15.833  35.527  34.992  1.00 23.24  ? 235 LEU A HD22   1 
ATOM   3874  H  HD23   . LEU A 1 235 ? 16.837  34.615  34.165  1.00 23.24  ? 235 LEU A HD23   1 
ATOM   3875  N  N      . ALA A 1 236 ? 20.188  37.271  32.314  1.00 36.54  ? 236 ALA A N      1 
ATOM   3876  C  CA     . ALA A 1 236 ? 21.583  36.854  32.282  1.00 30.49  ? 236 ALA A CA     1 
ATOM   3877  C  C      . ALA A 1 236 ? 22.522  38.057  32.200  1.00 27.71  ? 236 ALA A C      1 
ATOM   3878  O  O      . ALA A 1 236 ? 23.518  38.122  32.916  1.00 21.10  ? 236 ALA A O      1 
ATOM   3879  C  CB     . ALA A 1 236 ? 21.821  35.917  31.113  1.00 20.39  ? 236 ALA A CB     1 
ATOM   3880  H  H      . ALA A 1 236 ? 19.730  37.002  31.638  1.00 43.85  ? 236 ALA A H      1 
ATOM   3881  H  HA     . ALA A 1 236 ? 21.787  36.372  33.099  1.00 36.59  ? 236 ALA A HA     1 
ATOM   3882  H  HB1    . ALA A 1 236 ? 22.754  35.650  31.108  1.00 24.47  ? 236 ALA A HB1    1 
ATOM   3883  H  HB2    . ALA A 1 236 ? 21.254  35.136  31.214  1.00 24.47  ? 236 ALA A HB2    1 
ATOM   3884  H  HB3    . ALA A 1 236 ? 21.604  36.379  30.289  1.00 24.47  ? 236 ALA A HB3    1 
ATOM   3885  N  N      . ARG A 1 237 ? 22.203  39.001  31.321  1.00 34.71  ? 237 ARG A N      1 
ATOM   3886  C  CA     . ARG A 1 237 ? 23.026  40.192  31.143  1.00 27.92  ? 237 ARG A CA     1 
ATOM   3887  C  C      . ARG A 1 237 ? 23.175  40.960  32.454  1.00 34.15  ? 237 ARG A C      1 
ATOM   3888  O  O      . ARG A 1 237 ? 24.209  41.573  32.705  1.00 35.51  ? 237 ARG A O      1 
ATOM   3889  C  CB     . ARG A 1 237 ? 22.429  41.099  30.066  1.00 24.86  ? 237 ARG A CB     1 
ATOM   3890  C  CG     . ARG A 1 237 ? 22.666  40.612  28.643  1.00 39.53  ? 237 ARG A CG     1 
ATOM   3891  C  CD     . ARG A 1 237 ? 22.112  41.587  27.608  1.00 62.87  ? 237 ARG A CD     1 
ATOM   3892  N  NE     . ARG A 1 237 ? 22.288  41.099  26.239  1.00 69.63  ? 237 ARG A NE     1 
ATOM   3893  C  CZ     . ARG A 1 237 ? 21.402  40.363  25.571  1.00 63.89  ? 237 ARG A CZ     1 
ATOM   3894  N  NH1    . ARG A 1 237 ? 20.244  40.028  26.123  1.00 51.26  ? 237 ARG A NH1    1 
ATOM   3895  N  NH2    . ARG A 1 237 ? 21.670  39.970  24.333  1.00 73.06  ? 237 ARG A NH2    1 
ATOM   3896  H  H      . ARG A 1 237 ? 21.510  38.976  30.812  1.00 41.65  ? 237 ARG A H      1 
ATOM   3897  H  HA     . ARG A 1 237 ? 23.911  39.923  30.851  1.00 33.50  ? 237 ARG A HA     1 
ATOM   3898  H  HB2    . ARG A 1 237 ? 21.470  41.155  30.203  1.00 29.83  ? 237 ARG A HB2    1 
ATOM   3899  H  HB3    . ARG A 1 237 ? 22.824  41.981  30.147  1.00 29.83  ? 237 ARG A HB3    1 
ATOM   3900  H  HG2    . ARG A 1 237 ? 23.620  40.521  28.492  1.00 47.44  ? 237 ARG A HG2    1 
ATOM   3901  H  HG3    . ARG A 1 237 ? 22.225  39.757  28.520  1.00 47.44  ? 237 ARG A HG3    1 
ATOM   3902  H  HD2    . ARG A 1 237 ? 21.162  41.711  27.765  1.00 75.45  ? 237 ARG A HD2    1 
ATOM   3903  H  HD3    . ARG A 1 237 ? 22.576  42.435  27.689  1.00 75.45  ? 237 ARG A HD3    1 
ATOM   3904  H  HE     . ARG A 1 237 ? 23.019  41.304  25.835  1.00 83.56  ? 237 ARG A HE     1 
ATOM   3905  H  HH11   . ARG A 1 237 ? 20.062  40.278  26.925  1.00 61.51  ? 237 ARG A HH11   1 
ATOM   3906  H  HH12   . ARG A 1 237 ? 19.678  39.555  25.681  1.00 61.51  ? 237 ARG A HH12   1 
ATOM   3907  H  HH21   . ARG A 1 237 ? 22.417  40.186  23.966  1.00 87.67  ? 237 ARG A HH21   1 
ATOM   3908  H  HH22   . ARG A 1 237 ? 21.096  39.499  23.898  1.00 87.67  ? 237 ARG A HH22   1 
ATOM   3909  N  N      . PHE A 1 238 ? 22.146  40.908  33.294  1.00 37.41  ? 238 PHE A N      1 
ATOM   3910  C  CA     . PHE A 1 238 ? 22.176  41.591  34.585  1.00 37.01  ? 238 PHE A CA     1 
ATOM   3911  C  C      . PHE A 1 238 ? 23.071  40.854  35.577  1.00 31.93  ? 238 PHE A C      1 
ATOM   3912  O  O      . PHE A 1 238 ? 23.924  41.462  36.220  1.00 36.62  ? 238 PHE A O      1 
ATOM   3913  C  CB     . PHE A 1 238 ? 20.761  41.726  35.151  1.00 45.19  ? 238 PHE A CB     1 
ATOM   3914  C  CG     . PHE A 1 238 ? 20.717  42.258  36.558  1.00 50.84  ? 238 PHE A CG     1 
ATOM   3915  C  CD1    . PHE A 1 238 ? 21.135  43.547  36.841  1.00 36.10  ? 238 PHE A CD1    1 
ATOM   3916  C  CD2    . PHE A 1 238 ? 20.250  41.471  37.596  1.00 39.55  ? 238 PHE A CD2    1 
ATOM   3917  C  CE1    . PHE A 1 238 ? 21.093  44.033  38.133  1.00 33.80  ? 238 PHE A CE1    1 
ATOM   3918  C  CE2    . PHE A 1 238 ? 20.207  41.956  38.888  1.00 25.42  ? 238 PHE A CE2    1 
ATOM   3919  C  CZ     . PHE A 1 238 ? 20.629  43.236  39.156  1.00 20.72  ? 238 PHE A CZ     1 
ATOM   3920  H  H      . PHE A 1 238 ? 21.415  40.482  33.140  1.00 44.89  ? 238 PHE A H      1 
ATOM   3921  H  HA     . PHE A 1 238 ? 22.536  42.483  34.461  1.00 44.41  ? 238 PHE A HA     1 
ATOM   3922  H  HB2    . PHE A 1 238 ? 20.256  42.334  34.588  1.00 54.23  ? 238 PHE A HB2    1 
ATOM   3923  H  HB3    . PHE A 1 238 ? 20.340  40.852  35.151  1.00 54.23  ? 238 PHE A HB3    1 
ATOM   3924  H  HD1    . PHE A 1 238 ? 21.451  44.089  36.155  1.00 43.32  ? 238 PHE A HD1    1 
ATOM   3925  H  HD2    . PHE A 1 238 ? 19.965  40.603  37.421  1.00 47.45  ? 238 PHE A HD2    1 
ATOM   3926  H  HE1    . PHE A 1 238 ? 21.378  44.900  38.312  1.00 40.57  ? 238 PHE A HE1    1 
ATOM   3927  H  HE2    . PHE A 1 238 ? 19.893  41.416  39.577  1.00 30.50  ? 238 PHE A HE2    1 
ATOM   3928  H  HZ     . PHE A 1 238 ? 20.599  43.564  40.026  1.00 24.86  ? 238 PHE A HZ     1 
ATOM   3929  N  N      . VAL A 1 239 ? 22.860  39.548  35.704  1.00 27.87  ? 239 VAL A N      1 
ATOM   3930  C  CA     . VAL A 1 239 ? 23.666  38.705  36.585  1.00 27.65  ? 239 VAL A CA     1 
ATOM   3931  C  C      . VAL A 1 239 ? 25.154  38.834  36.260  1.00 38.84  ? 239 VAL A C      1 
ATOM   3932  O  O      . VAL A 1 239 ? 25.994  38.891  37.157  1.00 36.16  ? 239 VAL A O      1 
ATOM   3933  C  CB     . VAL A 1 239 ? 23.239  37.227  36.477  1.00 25.45  ? 239 VAL A CB     1 
ATOM   3934  C  CG1    . VAL A 1 239 ? 24.224  36.310  37.190  1.00 28.10  ? 239 VAL A CG1    1 
ATOM   3935  C  CG2    . VAL A 1 239 ? 21.843  37.043  37.047  1.00 37.53  ? 239 VAL A CG2    1 
ATOM   3936  H  H      . VAL A 1 239 ? 22.245  39.118  35.284  1.00 33.44  ? 239 VAL A H      1 
ATOM   3937  H  HA     . VAL A 1 239 ? 23.534  38.990  37.502  1.00 33.18  ? 239 VAL A HA     1 
ATOM   3938  H  HB     . VAL A 1 239 ? 23.217  36.972  35.542  1.00 30.54  ? 239 VAL A HB     1 
ATOM   3939  H  HG11   . VAL A 1 239 ? 23.922  35.392  37.101  1.00 33.72  ? 239 VAL A HG11   1 
ATOM   3940  H  HG12   . VAL A 1 239 ? 25.099  36.411  36.785  1.00 33.72  ? 239 VAL A HG12   1 
ATOM   3941  H  HG13   . VAL A 1 239 ? 24.261  36.556  38.128  1.00 33.72  ? 239 VAL A HG13   1 
ATOM   3942  H  HG21   . VAL A 1 239 ? 21.592  36.109  36.971  1.00 45.04  ? 239 VAL A HG21   1 
ATOM   3943  H  HG22   . VAL A 1 239 ? 21.845  37.311  37.979  1.00 45.04  ? 239 VAL A HG22   1 
ATOM   3944  H  HG23   . VAL A 1 239 ? 21.223  37.595  36.545  1.00 45.04  ? 239 VAL A HG23   1 
ATOM   3945  N  N      . HIS A 1 240 ? 25.471  38.859  34.971  1.00 35.39  ? 240 HIS A N      1 
ATOM   3946  C  CA     . HIS A 1 240 ? 26.852  38.971  34.525  1.00 27.58  ? 240 HIS A CA     1 
ATOM   3947  C  C      . HIS A 1 240 ? 27.464  40.299  34.956  1.00 35.55  ? 240 HIS A C      1 
ATOM   3948  O  O      . HIS A 1 240 ? 28.631  40.357  35.338  1.00 46.65  ? 240 HIS A O      1 
ATOM   3949  C  CB     . HIS A 1 240 ? 26.924  38.824  33.003  1.00 42.54  ? 240 HIS A CB     1 
ATOM   3950  C  CG     . HIS A 1 240 ? 28.305  38.993  32.441  1.00 37.28  ? 240 HIS A CG     1 
ATOM   3951  N  ND1    . HIS A 1 240 ? 29.372  38.237  32.854  1.00 36.78  ? 240 HIS A ND1    1 
ATOM   3952  C  CD2    . HIS A 1 240 ? 28.778  39.838  31.492  1.00 42.09  ? 240 HIS A CD2    1 
ATOM   3953  C  CE1    . HIS A 1 240 ? 30.458  38.606  32.185  1.00 42.98  ? 240 HIS A CE1    1 
ATOM   3954  N  NE2    . HIS A 1 240 ? 30.120  39.573  31.357  1.00 45.86  ? 240 HIS A NE2    1 
ATOM   3955  H  H      . HIS A 1 240 ? 24.900  38.812  34.330  1.00 42.47  ? 240 HIS A H      1 
ATOM   3956  H  HA     . HIS A 1 240 ? 27.374  38.255  34.922  1.00 33.10  ? 240 HIS A HA     1 
ATOM   3957  H  HB2    . HIS A 1 240 ? 26.612  37.938  32.760  1.00 51.05  ? 240 HIS A HB2    1 
ATOM   3958  H  HB3    . HIS A 1 240 ? 26.354  39.495  32.597  1.00 51.05  ? 240 HIS A HB3    1 
ATOM   3959  H  HD1    . HIS A 1 240 ? 29.343  37.621  33.454  1.00 44.14  ? 240 HIS A HD1    1 
ATOM   3960  H  HD2    . HIS A 1 240 ? 28.289  40.476  31.023  1.00 50.51  ? 240 HIS A HD2    1 
ATOM   3961  H  HE1    . HIS A 1 240 ? 31.309  38.245  32.285  1.00 51.58  ? 240 HIS A HE1    1 
ATOM   3962  H  HE2    . HIS A 1 240 ? 30.655  39.975  30.816  1.00 55.04  ? 240 HIS A HE2    1 
ATOM   3963  N  N      . LEU A 1 241 ? 26.674  41.366  34.898  1.00 37.31  ? 241 LEU A N      1 
ATOM   3964  C  CA     . LEU A 1 241 ? 27.151  42.687  35.293  1.00 32.37  ? 241 LEU A CA     1 
ATOM   3965  C  C      . LEU A 1 241 ? 27.479  42.738  36.780  1.00 48.75  ? 241 LEU A C      1 
ATOM   3966  O  O      . LEU A 1 241 ? 28.446  43.378  37.191  1.00 68.72  ? 241 LEU A O      1 
ATOM   3967  C  CB     . LEU A 1 241 ? 26.109  43.754  34.963  1.00 33.11  ? 241 LEU A CB     1 
ATOM   3968  C  CG     . LEU A 1 241 ? 26.032  44.213  33.509  1.00 36.18  ? 241 LEU A CG     1 
ATOM   3969  C  CD1    . LEU A 1 241 ? 24.830  45.123  33.320  1.00 27.45  ? 241 LEU A CD1    1 
ATOM   3970  C  CD2    . LEU A 1 241 ? 27.307  44.916  33.085  1.00 58.51  ? 241 LEU A CD2    1 
ATOM   3971  H  H      . LEU A 1 241 ? 25.856  41.352  34.633  1.00 44.77  ? 241 LEU A H      1 
ATOM   3972  H  HA     . LEU A 1 241 ? 27.960  42.893  34.799  1.00 38.84  ? 241 LEU A HA     1 
ATOM   3973  H  HB2    . LEU A 1 241 ? 25.235  43.407  35.200  1.00 39.74  ? 241 LEU A HB2    1 
ATOM   3974  H  HB3    . LEU A 1 241 ? 26.299  44.538  35.501  1.00 39.74  ? 241 LEU A HB3    1 
ATOM   3975  H  HG     . LEU A 1 241 ? 25.914  43.438  32.938  1.00 43.42  ? 241 LEU A HG     1 
ATOM   3976  H  HD11   . LEU A 1 241 ? 24.793  45.407  32.394  1.00 32.93  ? 241 LEU A HD11   1 
ATOM   3977  H  HD12   . LEU A 1 241 ? 24.025  44.633  33.550  1.00 32.93  ? 241 LEU A HD12   1 
ATOM   3978  H  HD13   . LEU A 1 241 ? 24.925  45.894  33.900  1.00 32.93  ? 241 LEU A HD13   1 
ATOM   3979  H  HD21   . LEU A 1 241 ? 27.221  45.193  32.159  1.00 70.21  ? 241 LEU A HD21   1 
ATOM   3980  H  HD22   . LEU A 1 241 ? 27.442  45.692  33.651  1.00 70.21  ? 241 LEU A HD22   1 
ATOM   3981  H  HD23   . LEU A 1 241 ? 28.052  44.303  33.180  1.00 70.21  ? 241 LEU A HD23   1 
ATOM   3982  N  N      . CYS A 1 242 ? 26.660  42.068  37.584  1.00 39.23  ? 242 CYS A N      1 
ATOM   3983  C  CA     . CYS A 1 242 ? 26.835  42.060  39.032  1.00 29.90  ? 242 CYS A CA     1 
ATOM   3984  C  C      . CYS A 1 242 ? 28.107  41.328  39.447  1.00 37.98  ? 242 CYS A C      1 
ATOM   3985  O  O      . CYS A 1 242 ? 28.810  41.762  40.358  1.00 53.69  ? 242 CYS A O      1 
ATOM   3986  C  CB     . CYS A 1 242 ? 25.616  41.427  39.704  1.00 41.21  ? 242 CYS A CB     1 
ATOM   3987  S  SG     . CYS A 1 242 ? 24.102  42.418  39.551  1.00 31.13  ? 242 CYS A SG     1 
ATOM   3988  H  H      . CYS A 1 242 ? 25.988  41.605  37.312  1.00 47.07  ? 242 CYS A H      1 
ATOM   3989  H  HA     . CYS A 1 242 ? 26.904  42.976  39.343  1.00 35.88  ? 242 CYS A HA     1 
ATOM   3990  H  HB2    . CYS A 1 242 ? 25.448  40.563  39.297  1.00 49.45  ? 242 CYS A HB2    1 
ATOM   3991  H  HB3    . CYS A 1 242 ? 25.803  41.316  40.649  1.00 49.45  ? 242 CYS A HB3    1 
ATOM   3992  H  HG     . CYS A 1 242 ? 23.204  41.847  40.105  1.00 37.36  ? 242 CYS A HG     1 
ATOM   3993  N  N      . ARG A 1 243 ? 28.400  40.219  38.779  1.00 43.07  ? 243 ARG A N      1 
ATOM   3994  C  CA     . ARG A 1 243 ? 29.624  39.470  39.037  1.00 35.77  ? 243 ARG A CA     1 
ATOM   3995  C  C      . ARG A 1 243 ? 30.850  40.276  38.629  1.00 40.76  ? 243 ARG A C      1 
ATOM   3996  O  O      . ARG A 1 243 ? 31.872  40.260  39.312  1.00 50.53  ? 243 ARG A O      1 
ATOM   3997  C  CB     . ARG A 1 243 ? 29.596  38.140  38.292  1.00 27.01  ? 243 ARG A CB     1 
ATOM   3998  C  CG     . ARG A 1 243 ? 28.491  37.217  38.759  1.00 35.36  ? 243 ARG A CG     1 
ATOM   3999  C  CD     . ARG A 1 243 ? 28.393  35.964  37.909  1.00 33.76  ? 243 ARG A CD     1 
ATOM   4000  N  NE     . ARG A 1 243 ? 27.341  35.074  38.394  1.00 26.56  ? 243 ARG A NE     1 
ATOM   4001  C  CZ     . ARG A 1 243 ? 26.910  33.996  37.750  1.00 29.70  ? 243 ARG A CZ     1 
ATOM   4002  N  NH1    . ARG A 1 243 ? 27.435  33.661  36.579  1.00 42.41  ? 243 ARG A NH1    1 
ATOM   4003  N  NH2    . ARG A 1 243 ? 25.948  33.252  38.277  1.00 35.08  ? 243 ARG A NH2    1 
ATOM   4004  H  H      . ARG A 1 243 ? 27.902  39.877  38.166  1.00 51.69  ? 243 ARG A H      1 
ATOM   4005  H  HA     . ARG A 1 243 ? 29.688  39.284  39.986  1.00 42.92  ? 243 ARG A HA     1 
ATOM   4006  H  HB2    . ARG A 1 243 ? 29.462  38.311  37.346  1.00 32.41  ? 243 ARG A HB2    1 
ATOM   4007  H  HB3    . ARG A 1 243 ? 30.442  37.685  38.428  1.00 32.41  ? 243 ARG A HB3    1 
ATOM   4008  H  HG2    . ARG A 1 243 ? 28.667  36.948  39.674  1.00 42.43  ? 243 ARG A HG2    1 
ATOM   4009  H  HG3    . ARG A 1 243 ? 27.643  37.685  38.706  1.00 42.43  ? 243 ARG A HG3    1 
ATOM   4010  H  HD2    . ARG A 1 243 ? 28.184  36.212  36.995  1.00 40.51  ? 243 ARG A HD2    1 
ATOM   4011  H  HD3    . ARG A 1 243 ? 29.236  35.486  37.944  1.00 40.51  ? 243 ARG A HD3    1 
ATOM   4012  H  HE     . ARG A 1 243 ? 26.976  35.262  39.149  1.00 31.87  ? 243 ARG A HE     1 
ATOM   4013  H  HH11   . ARG A 1 243 ? 28.059  34.141  36.234  1.00 50.89  ? 243 ARG A HH11   1 
ATOM   4014  H  HH12   . ARG A 1 243 ? 27.152  32.962  36.166  1.00 50.89  ? 243 ARG A HH12   1 
ATOM   4015  H  HH21   . ARG A 1 243 ? 25.605  33.467  39.036  1.00 42.09  ? 243 ARG A HH21   1 
ATOM   4016  H  HH22   . ARG A 1 243 ? 25.667  32.554  37.861  1.00 42.09  ? 243 ARG A HH22   1 
ATOM   4017  N  N      . GLU A 1 244 ? 30.747  40.966  37.499  1.00 44.00  ? 244 GLU A N      1 
ATOM   4018  C  CA     . GLU A 1 244 ? 31.818  41.838  37.037  1.00 46.69  ? 244 GLU A CA     1 
ATOM   4019  C  C      . GLU A 1 244 ? 32.026  43.011  37.980  1.00 35.11  ? 244 GLU A C      1 
ATOM   4020  O  O      . GLU A 1 244 ? 33.158  43.408  38.248  1.00 53.26  ? 244 GLU A O      1 
ATOM   4021  C  CB     . GLU A 1 244 ? 31.523  42.367  35.631  1.00 51.14  ? 244 GLU A CB     1 
ATOM   4022  C  CG     . GLU A 1 244 ? 31.853  41.399  34.509  1.00 48.10  ? 244 GLU A CG     1 
ATOM   4023  C  CD     . GLU A 1 244 ? 31.646  42.012  33.140  1.00 46.17  ? 244 GLU A CD     1 
ATOM   4024  O  OE1    . GLU A 1 244 ? 30.768  42.889  33.010  1.00 44.04  ? 244 GLU A OE1    1 
ATOM   4025  O  OE2    . GLU A 1 244 ? 32.372  41.631  32.198  1.00 57.17  ? 244 GLU A OE2    1 
ATOM   4026  H  H      . GLU A 1 244 ? 30.063  40.946  36.979  1.00 52.80  ? 244 GLU A H      1 
ATOM   4027  H  HA     . GLU A 1 244 ? 32.644  41.332  37.000  1.00 56.03  ? 244 GLU A HA     1 
ATOM   4028  H  HB2    . GLU A 1 244 ? 30.578  42.575  35.570  1.00 61.37  ? 244 GLU A HB2    1 
ATOM   4029  H  HB3    . GLU A 1 244 ? 32.044  43.172  35.487  1.00 61.37  ? 244 GLU A HB3    1 
ATOM   4030  H  HG2    . GLU A 1 244 ? 32.783  41.134  34.583  1.00 57.72  ? 244 GLU A HG2    1 
ATOM   4031  H  HG3    . GLU A 1 244 ? 31.278  40.622  34.582  1.00 57.72  ? 244 GLU A HG3    1 
ATOM   4032  N  N      . PHE A 1 245 ? 30.929  43.554  38.493  1.00 33.47  ? 245 PHE A N      1 
ATOM   4033  C  CA     . PHE A 1 245 ? 30.990  44.763  39.299  1.00 42.94  ? 245 PHE A CA     1 
ATOM   4034  C  C      . PHE A 1 245 ? 31.646  44.498  40.642  1.00 50.28  ? 245 PHE A C      1 
ATOM   4035  O  O      . PHE A 1 245 ? 32.502  45.260  41.080  1.00 64.33  ? 245 PHE A O      1 
ATOM   4036  C  CB     . PHE A 1 245 ? 29.589  45.335  39.509  1.00 50.44  ? 245 PHE A CB     1 
ATOM   4037  C  CG     . PHE A 1 245 ? 29.572  46.607  40.302  1.00 51.17  ? 245 PHE A CG     1 
ATOM   4038  C  CD1    . PHE A 1 245 ? 29.989  47.797  39.736  1.00 47.33  ? 245 PHE A CD1    1 
ATOM   4039  C  CD2    . PHE A 1 245 ? 29.145  46.612  41.614  1.00 41.13  ? 245 PHE A CD2    1 
ATOM   4040  C  CE1    . PHE A 1 245 ? 29.975  48.966  40.465  1.00 35.26  ? 245 PHE A CE1    1 
ATOM   4041  C  CE2    . PHE A 1 245 ? 29.131  47.778  42.345  1.00 33.31  ? 245 PHE A CE2    1 
ATOM   4042  C  CZ     . PHE A 1 245 ? 29.546  48.955  41.770  1.00 27.87  ? 245 PHE A CZ     1 
ATOM   4043  H  H      . PHE A 1 245 ? 30.135  43.240  38.389  1.00 40.16  ? 245 PHE A H      1 
ATOM   4044  H  HA     . PHE A 1 245 ? 31.520  45.428  38.832  1.00 51.53  ? 245 PHE A HA     1 
ATOM   4045  H  HB2    . PHE A 1 245 ? 29.193  45.520  38.643  1.00 60.53  ? 245 PHE A HB2    1 
ATOM   4046  H  HB3    . PHE A 1 245 ? 29.052  44.682  39.984  1.00 60.53  ? 245 PHE A HB3    1 
ATOM   4047  H  HD1    . PHE A 1 245 ? 30.280  47.809  38.853  1.00 56.80  ? 245 PHE A HD1    1 
ATOM   4048  H  HD2    . PHE A 1 245 ? 28.862  45.819  42.009  1.00 49.36  ? 245 PHE A HD2    1 
ATOM   4049  H  HE1    . PHE A 1 245 ? 30.257  49.761  40.074  1.00 42.31  ? 245 PHE A HE1    1 
ATOM   4050  H  HE2    . PHE A 1 245 ? 28.840  47.770  43.228  1.00 39.98  ? 245 PHE A HE2    1 
ATOM   4051  H  HZ     . PHE A 1 245 ? 29.536  49.744  42.263  1.00 33.44  ? 245 PHE A HZ     1 
ATOM   4052  N  N      . MET A 1 246 ? 31.242  43.417  41.293  1.00 41.52  ? 246 MET A N      1 
ATOM   4053  C  CA     . MET A 1 246 ? 31.796  43.068  42.590  1.00 35.63  ? 246 MET A CA     1 
ATOM   4054  C  C      . MET A 1 246 ? 33.255  42.656  42.446  1.00 48.52  ? 246 MET A C      1 
ATOM   4055  O  O      . MET A 1 246 ? 34.074  42.916  43.327  1.00 62.99  ? 246 MET A O      1 
ATOM   4056  C  CB     . MET A 1 246 ? 30.980  41.949  43.228  1.00 44.26  ? 246 MET A CB     1 
ATOM   4057  C  CG     . MET A 1 246 ? 29.562  42.355  43.594  1.00 48.71  ? 246 MET A CG     1 
ATOM   4058  S  SD     . MET A 1 246 ? 29.460  43.234  45.165  1.00 58.40  ? 246 MET A SD     1 
ATOM   4059  C  CE     . MET A 1 246 ? 29.639  44.943  44.657  1.00 55.88  ? 246 MET A CE     1 
ATOM   4060  H  H      . MET A 1 246 ? 30.648  42.867  41.003  1.00 49.83  ? 246 MET A H      1 
ATOM   4061  H  HA     . MET A 1 246 ? 31.744  43.842  43.171  1.00 42.76  ? 246 MET A HA     1 
ATOM   4062  H  HB2    . MET A 1 246 ? 30.925  41.208  42.604  1.00 53.11  ? 246 MET A HB2    1 
ATOM   4063  H  HB3    . MET A 1 246 ? 31.425  41.662  44.040  1.00 53.11  ? 246 MET A HB3    1 
ATOM   4064  H  HG2    . MET A 1 246 ? 29.212  42.938  42.902  1.00 58.45  ? 246 MET A HG2    1 
ATOM   4065  H  HG3    . MET A 1 246 ? 29.014  41.557  43.662  1.00 58.45  ? 246 MET A HG3    1 
ATOM   4066  H  HE1    . MET A 1 246 ? 29.598  45.512  45.442  1.00 67.05  ? 246 MET A HE1    1 
ATOM   4067  H  HE2    . MET A 1 246 ? 30.495  45.052  44.213  1.00 67.05  ? 246 MET A HE2    1 
ATOM   4068  H  HE3    . MET A 1 246 ? 28.919  45.168  44.047  1.00 67.05  ? 246 MET A HE3    1 
ATOM   4069  N  N      . GLU A 1 247 ? 33.571  42.017  41.324  1.00 55.33  ? 247 GLU A N      1 
ATOM   4070  C  CA     . GLU A 1 247 ? 34.931  41.575  41.037  1.00 54.08  ? 247 GLU A CA     1 
ATOM   4071  C  C      . GLU A 1 247 ? 35.850  42.766  40.772  1.00 45.18  ? 247 GLU A C      1 
ATOM   4072  O  O      . GLU A 1 247 ? 37.048  42.707  41.038  1.00 52.24  ? 247 GLU A O      1 
ATOM   4073  C  CB     . GLU A 1 247 ? 34.928  40.629  39.829  1.00 60.39  ? 247 GLU A CB     1 
ATOM   4074  C  CG     . GLU A 1 247 ? 36.304  40.145  39.367  1.00 89.06  ? 247 GLU A CG     1 
ATOM   4075  C  CD     . GLU A 1 247 ? 36.963  39.192  40.347  1.00 99.58  ? 247 GLU A CD     1 
ATOM   4076  O  OE1    . GLU A 1 247 ? 36.237  38.459  41.053  1.00 89.81  ? 247 GLU A OE1    1 
ATOM   4077  O  OE2    . GLU A 1 247 ? 38.211  39.172  40.406  1.00 95.78  ? 247 GLU A OE2    1 
ATOM   4078  H  H      . GLU A 1 247 ? 33.006  41.824  40.705  1.00 66.39  ? 247 GLU A H      1 
ATOM   4079  H  HA     . GLU A 1 247 ? 35.277  41.090  41.802  1.00 64.89  ? 247 GLU A HA     1 
ATOM   4080  H  HB2    . GLU A 1 247 ? 34.405  39.844  40.056  1.00 72.47  ? 247 GLU A HB2    1 
ATOM   4081  H  HB3    . GLU A 1 247 ? 34.514  41.087  39.081  1.00 72.47  ? 247 GLU A HB3    1 
ATOM   4082  H  HG2    . GLU A 1 247 ? 36.207  39.682  38.520  1.00 106.87 ? 247 GLU A HG2    1 
ATOM   4083  H  HG3    . GLU A 1 247 ? 36.887  40.912  39.259  1.00 106.87 ? 247 GLU A HG3    1 
ATOM   4084  N  N      . ALA A 1 248 ? 35.276  43.851  40.266  1.00 40.50  ? 248 ALA A N      1 
ATOM   4085  C  CA     . ALA A 1 248 ? 36.049  45.031  39.907  1.00 40.28  ? 248 ALA A CA     1 
ATOM   4086  C  C      . ALA A 1 248 ? 35.135  46.241  39.757  1.00 48.78  ? 248 ALA A C      1 
ATOM   4087  O  O      . ALA A 1 248 ? 34.774  46.613  38.639  1.00 50.19  ? 248 ALA A O      1 
ATOM   4088  C  CB     . ALA A 1 248 ? 36.812  44.785  38.624  1.00 45.12  ? 248 ALA A CB     1 
ATOM   4089  H  H      . ALA A 1 248 ? 34.432  43.929  40.120  1.00 48.60  ? 248 ALA A H      1 
ATOM   4090  H  HA     . ALA A 1 248 ? 36.690  45.220  40.610  1.00 48.34  ? 248 ALA A HA     1 
ATOM   4091  H  HB1    . ALA A 1 248 ? 37.320  45.581  38.402  1.00 54.15  ? 248 ALA A HB1    1 
ATOM   4092  H  HB2    . ALA A 1 248 ? 37.412  44.035  38.753  1.00 54.15  ? 248 ALA A HB2    1 
ATOM   4093  H  HB3    . ALA A 1 248 ? 36.181  44.586  37.915  1.00 54.15  ? 248 ALA A HB3    1 
ATOM   4094  N  N      . PRO A 1 249 ? 34.759  46.861  40.886  1.00 38.46  ? 249 PRO A N      1 
ATOM   4095  C  CA     . PRO A 1 249 ? 33.851  48.011  40.886  1.00 36.25  ? 249 PRO A CA     1 
ATOM   4096  C  C      . PRO A 1 249 ? 34.372  49.182  40.069  1.00 44.84  ? 249 PRO A C      1 
ATOM   4097  O  O      . PRO A 1 249 ? 35.580  49.376  39.966  1.00 70.60  ? 249 PRO A O      1 
ATOM   4098  C  CB     . PRO A 1 249 ? 33.770  48.388  42.367  1.00 50.98  ? 249 PRO A CB     1 
ATOM   4099  C  CG     . PRO A 1 249 ? 34.106  47.149  43.097  1.00 56.43  ? 249 PRO A CG     1 
ATOM   4100  C  CD     . PRO A 1 249 ? 35.121  46.453  42.253  1.00 52.64  ? 249 PRO A CD     1 
ATOM   4101  H  HA     . PRO A 1 249 ? 32.972  47.753  40.566  1.00 43.50  ? 249 PRO A HA     1 
ATOM   4102  H  HB2    . PRO A 1 249 ? 34.413  49.087  42.562  1.00 61.18  ? 249 PRO A HB2    1 
ATOM   4103  H  HB3    . PRO A 1 249 ? 32.869  48.679  42.581  1.00 61.18  ? 249 PRO A HB3    1 
ATOM   4104  H  HG2    . PRO A 1 249 ? 34.478  47.373  43.964  1.00 67.72  ? 249 PRO A HG2    1 
ATOM   4105  H  HG3    . PRO A 1 249 ? 33.311  46.603  43.195  1.00 67.72  ? 249 PRO A HG3    1 
ATOM   4106  H  HD2    . PRO A 1 249 ? 36.014  46.762  42.474  1.00 63.17  ? 249 PRO A HD2    1 
ATOM   4107  H  HD3    . PRO A 1 249 ? 35.042  45.492  42.353  1.00 63.17  ? 249 PRO A HD3    1 
ATOM   4108  N  N      . SER A 1 250 ? 33.460  49.958  39.498  1.00 42.77  ? 250 SER A N      1 
ATOM   4109  C  CA     . SER A 1 250 ? 33.835  51.130  38.725  1.00 49.27  ? 250 SER A CA     1 
ATOM   4110  C  C      . SER A 1 250 ? 32.644  52.058  38.569  1.00 56.50  ? 250 SER A C      1 
ATOM   4111  O  O      . SER A 1 250 ? 31.504  51.651  38.784  1.00 45.89  ? 250 SER A O      1 
ATOM   4112  C  CB     . SER A 1 250 ? 34.361  50.718  37.353  1.00 37.60  ? 250 SER A CB     1 
ATOM   4113  O  OG     . SER A 1 250 ? 34.702  51.857  36.585  1.00 52.23  ? 250 SER A OG     1 
ATOM   4114  H  H      . SER A 1 250 ? 32.612  49.825  39.544  1.00 51.32  ? 250 SER A H      1 
ATOM   4115  H  HA     . SER A 1 250 ? 34.538  51.610  39.190  1.00 59.12  ? 250 SER A HA     1 
ATOM   4116  H  HB2    . SER A 1 250 ? 35.152  50.168  37.469  1.00 45.13  ? 250 SER A HB2    1 
ATOM   4117  H  HB3    . SER A 1 250 ? 33.673  50.218  36.887  1.00 45.13  ? 250 SER A HB3    1 
ATOM   4118  H  HG     . SER A 1 250 ? 34.990  51.621  35.833  1.00 62.68  ? 250 SER A HG     1 
ATOM   4119  N  N      . LEU A 1 251 ? 32.908  53.305  38.198  1.00 58.80  ? 251 LEU A N      1 
ATOM   4120  C  CA     . LEU A 1 251 ? 31.841  54.271  37.966  1.00 44.26  ? 251 LEU A CA     1 
ATOM   4121  C  C      . LEU A 1 251 ? 31.263  54.099  36.564  1.00 50.68  ? 251 LEU A C      1 
ATOM   4122  O  O      . LEU A 1 251 ? 30.187  54.610  36.266  1.00 64.30  ? 251 LEU A O      1 
ATOM   4123  C  CB     . LEU A 1 251 ? 32.351  55.701  38.164  1.00 56.69  ? 251 LEU A CB     1 
ATOM   4124  C  CG     . LEU A 1 251 ? 31.294  56.809  38.244  1.00 41.88  ? 251 LEU A CG     1 
ATOM   4125  C  CD1    . LEU A 1 251 ? 30.404  56.637  39.461  1.00 38.32  ? 251 LEU A CD1    1 
ATOM   4126  C  CD2    . LEU A 1 251 ? 31.955  58.174  38.270  1.00 39.57  ? 251 LEU A CD2    1 
ATOM   4127  H  H      . LEU A 1 251 ? 33.700  53.618  38.072  1.00 70.56  ? 251 LEU A H      1 
ATOM   4128  H  HA     . LEU A 1 251 ? 31.129  54.115  38.606  1.00 53.12  ? 251 LEU A HA     1 
ATOM   4129  H  HB2    . LEU A 1 251 ? 32.859  55.730  38.990  1.00 68.02  ? 251 LEU A HB2    1 
ATOM   4130  H  HB3    . LEU A 1 251 ? 32.936  55.918  37.421  1.00 68.02  ? 251 LEU A HB3    1 
ATOM   4131  H  HG     . LEU A 1 251 ? 30.731  56.765  37.455  1.00 50.25  ? 251 LEU A HG     1 
ATOM   4132  H  HD11   . LEU A 1 251 ? 29.751  57.354  39.477  1.00 45.98  ? 251 LEU A HD11   1 
ATOM   4133  H  HD12   . LEU A 1 251 ? 29.954  55.780  39.404  1.00 45.98  ? 251 LEU A HD12   1 
ATOM   4134  H  HD13   . LEU A 1 251 ? 30.953  56.671  40.260  1.00 45.98  ? 251 LEU A HD13   1 
ATOM   4135  H  HD21   . LEU A 1 251 ? 31.268  58.857  38.321  1.00 47.49  ? 251 LEU A HD21   1 
ATOM   4136  H  HD22   . LEU A 1 251 ? 32.535  58.229  39.046  1.00 47.49  ? 251 LEU A HD22   1 
ATOM   4137  H  HD23   . LEU A 1 251 ? 32.475  58.287  37.459  1.00 47.49  ? 251 LEU A HD23   1 
ATOM   4138  N  N      . GLY A 1 252 ? 31.977  53.373  35.709  1.00 53.74  ? 252 GLY A N      1 
ATOM   4139  C  CA     . GLY A 1 252 ? 31.568  53.196  34.326  1.00 40.84  ? 252 GLY A CA     1 
ATOM   4140  C  C      . GLY A 1 252 ? 30.302  52.377  34.186  1.00 37.84  ? 252 GLY A C      1 
ATOM   4141  O  O      . GLY A 1 252 ? 29.639  52.417  33.149  1.00 50.30  ? 252 GLY A O      1 
ATOM   4142  H  H      . GLY A 1 252 ? 32.710  52.970  35.910  1.00 64.49  ? 252 GLY A H      1 
ATOM   4143  H  HA2    . GLY A 1 252 ? 31.417  54.065  33.922  1.00 49.01  ? 252 GLY A HA2    1 
ATOM   4144  H  HA3    . GLY A 1 252 ? 32.277  52.750  33.836  1.00 49.01  ? 252 GLY A HA3    1 
ATOM   4145  N  N      . PHE A 1 253 ? 29.967  51.627  35.230  1.00 32.04  ? 253 PHE A N      1 
ATOM   4146  C  CA     . PHE A 1 253 ? 28.757  50.814  35.239  1.00 31.76  ? 253 PHE A CA     1 
ATOM   4147  C  C      . PHE A 1 253 ? 27.498  51.673  35.315  1.00 38.29  ? 253 PHE A C      1 
ATOM   4148  O  O      . PHE A 1 253 ? 26.389  51.175  35.126  1.00 36.59  ? 253 PHE A O      1 
ATOM   4149  C  CB     . PHE A 1 253 ? 28.772  49.852  36.423  1.00 35.14  ? 253 PHE A CB     1 
ATOM   4150  C  CG     . PHE A 1 253 ? 29.740  48.720  36.280  1.00 36.42  ? 253 PHE A CG     1 
ATOM   4151  C  CD1    . PHE A 1 253 ? 31.091  48.916  36.490  1.00 43.69  ? 253 PHE A CD1    1 
ATOM   4152  C  CD2    . PHE A 1 253 ? 29.294  47.451  35.966  1.00 43.84  ? 253 PHE A CD2    1 
ATOM   4153  C  CE1    . PHE A 1 253 ? 31.981  47.869  36.372  1.00 49.78  ? 253 PHE A CE1    1 
ATOM   4154  C  CE2    . PHE A 1 253 ? 30.178  46.401  35.848  1.00 38.68  ? 253 PHE A CE2    1 
ATOM   4155  C  CZ     . PHE A 1 253 ? 31.522  46.610  36.051  1.00 40.45  ? 253 PHE A CZ     1 
ATOM   4156  H  H      . PHE A 1 253 ? 30.429  51.572  35.953  1.00 38.45  ? 253 PHE A H      1 
ATOM   4157  H  HA     . PHE A 1 253 ? 28.719  50.290  34.423  1.00 38.11  ? 253 PHE A HA     1 
ATOM   4158  H  HB2    . PHE A 1 253 ? 29.012  50.346  37.222  1.00 42.17  ? 253 PHE A HB2    1 
ATOM   4159  H  HB3    . PHE A 1 253 ? 27.886  49.472  36.526  1.00 42.17  ? 253 PHE A HB3    1 
ATOM   4160  H  HD1    . PHE A 1 253 ? 31.405  49.764  36.708  1.00 52.42  ? 253 PHE A HD1    1 
ATOM   4161  H  HD2    . PHE A 1 253 ? 28.386  47.304  35.828  1.00 52.61  ? 253 PHE A HD2    1 
ATOM   4162  H  HE1    . PHE A 1 253 ? 32.889  48.013  36.510  1.00 59.74  ? 253 PHE A HE1    1 
ATOM   4163  H  HE2    . PHE A 1 253 ? 29.866  45.552  35.629  1.00 46.41  ? 253 PHE A HE2    1 
ATOM   4164  H  HZ     . PHE A 1 253 ? 32.121  45.903  35.969  1.00 48.54  ? 253 PHE A HZ     1 
ATOM   4165  N  N      . PHE A 1 254 ? 27.678  52.960  35.599  1.00 39.39  ? 254 PHE A N      1 
ATOM   4166  C  CA     . PHE A 1 254 ? 26.568  53.903  35.715  1.00 32.45  ? 254 PHE A CA     1 
ATOM   4167  C  C      . PHE A 1 254 ? 26.601  54.956  34.613  1.00 41.24  ? 254 PHE A C      1 
ATOM   4168  O  O      . PHE A 1 254 ? 25.686  55.770  34.503  1.00 43.79  ? 254 PHE A O      1 
ATOM   4169  C  CB     . PHE A 1 254 ? 26.592  54.601  37.078  1.00 39.26  ? 254 PHE A CB     1 
ATOM   4170  C  CG     . PHE A 1 254 ? 26.504  53.665  38.246  1.00 29.61  ? 254 PHE A CG     1 
ATOM   4171  C  CD1    . PHE A 1 254 ? 27.638  53.048  38.740  1.00 30.97  ? 254 PHE A CD1    1 
ATOM   4172  C  CD2    . PHE A 1 254 ? 25.292  53.414  38.860  1.00 30.11  ? 254 PHE A CD2    1 
ATOM   4173  C  CE1    . PHE A 1 254 ? 27.564  52.192  39.816  1.00 25.55  ? 254 PHE A CE1    1 
ATOM   4174  C  CE2    . PHE A 1 254 ? 25.213  52.557  39.938  1.00 25.53  ? 254 PHE A CE2    1 
ATOM   4175  C  CZ     . PHE A 1 254 ? 26.350  51.947  40.416  1.00 24.15  ? 254 PHE A CZ     1 
ATOM   4176  H  H      . PHE A 1 254 ? 28.449  53.318  35.731  1.00 47.27  ? 254 PHE A H      1 
ATOM   4177  H  HA     . PHE A 1 254 ? 25.732  53.417  35.641  1.00 38.94  ? 254 PHE A HA     1 
ATOM   4178  H  HB2    . PHE A 1 254 ? 27.421  55.098  37.159  1.00 47.11  ? 254 PHE A HB2    1 
ATOM   4179  H  HB3    . PHE A 1 254 ? 25.838  55.210  37.129  1.00 47.11  ? 254 PHE A HB3    1 
ATOM   4180  H  HD1    . PHE A 1 254 ? 28.461  53.210  38.338  1.00 37.17  ? 254 PHE A HD1    1 
ATOM   4181  H  HD2    . PHE A 1 254 ? 24.521  53.823  38.540  1.00 36.14  ? 254 PHE A HD2    1 
ATOM   4182  H  HE1    . PHE A 1 254 ? 28.333  51.781  40.138  1.00 30.66  ? 254 PHE A HE1    1 
ATOM   4183  H  HE2    . PHE A 1 254 ? 24.391  52.392  40.342  1.00 30.64  ? 254 PHE A HE2    1 
ATOM   4184  H  HZ     . PHE A 1 254 ? 26.298  51.369  41.143  1.00 28.98  ? 254 PHE A HZ     1 
ATOM   4185  N  N      . LYS A 1 255 ? 27.670  54.969  33.822  1.00 44.63  ? 255 LYS A N      1 
ATOM   4186  C  CA     . LYS A 1 255 ? 27.775  55.915  32.718  1.00 54.27  ? 255 LYS A CA     1 
ATOM   4187  C  C      . LYS A 1 255 ? 27.066  55.322  31.501  1.00 45.85  ? 255 LYS A C      1 
ATOM   4188  O  O      . LYS A 1 255 ? 27.401  54.216  31.073  1.00 42.02  ? 255 LYS A O      1 
ATOM   4189  C  CB     . LYS A 1 255 ? 29.243  56.211  32.408  1.00 65.29  ? 255 LYS A CB     1 
ATOM   4190  C  CG     . LYS A 1 255 ? 29.955  56.997  33.505  1.00 59.31  ? 255 LYS A CG     1 
ATOM   4191  C  CD     . LYS A 1 255 ? 31.418  57.236  33.170  1.00 70.33  ? 255 LYS A CD     1 
ATOM   4192  C  CE     . LYS A 1 255 ? 32.125  58.008  34.272  1.00 60.60  ? 255 LYS A CE     1 
ATOM   4193  N  NZ     . LYS A 1 255 ? 33.596  58.106  34.035  1.00 57.50  ? 255 LYS A NZ     1 
ATOM   4194  H  H      . LYS A 1 255 ? 28.345  54.443  33.904  1.00 53.55  ? 255 LYS A H      1 
ATOM   4195  H  HA     . LYS A 1 255 ? 27.335  56.745  32.958  1.00 65.12  ? 255 LYS A HA     1 
ATOM   4196  H  HB2    . LYS A 1 255 ? 29.714  55.371  32.291  1.00 78.34  ? 255 LYS A HB2    1 
ATOM   4197  H  HB3    . LYS A 1 255 ? 29.291  56.732  31.591  1.00 78.34  ? 255 LYS A HB3    1 
ATOM   4198  H  HG2    . LYS A 1 255 ? 29.524  57.859  33.612  1.00 71.17  ? 255 LYS A HG2    1 
ATOM   4199  H  HG3    . LYS A 1 255 ? 29.913  56.496  34.335  1.00 71.17  ? 255 LYS A HG3    1 
ATOM   4200  H  HD2    . LYS A 1 255 ? 31.865  56.383  33.061  1.00 84.39  ? 255 LYS A HD2    1 
ATOM   4201  H  HD3    . LYS A 1 255 ? 31.477  57.753  32.351  1.00 84.39  ? 255 LYS A HD3    1 
ATOM   4202  H  HE2    . LYS A 1 255 ? 31.765  58.908  34.312  1.00 72.72  ? 255 LYS A HE2    1 
ATOM   4203  H  HE3    . LYS A 1 255 ? 31.986  57.555  35.118  1.00 72.72  ? 255 LYS A HE3    1 
ATOM   4204  H  HZ1    . LYS A 1 255 ? 33.980  58.562  34.695  1.00 69.00  ? 255 LYS A HZ1    1 
ATOM   4205  H  HZ2    . LYS A 1 255 ? 33.953  57.292  33.999  1.00 69.00  ? 255 LYS A HZ2    1 
ATOM   4206  H  HZ3    . LYS A 1 255 ? 33.752  58.524  33.265  1.00 69.00  ? 255 LYS A HZ3    1 
ATOM   4207  N  N      . PRO A 1 256 ? 26.076  56.042  30.943  1.00 34.29  ? 256 PRO A N      1 
ATOM   4208  C  CA     . PRO A 1 256 ? 25.421  55.538  29.733  1.00 34.30  ? 256 PRO A CA     1 
ATOM   4209  C  C      . PRO A 1 256 ? 26.326  55.474  28.512  1.00 57.03  ? 256 PRO A C      1 
ATOM   4210  O  O      . PRO A 1 256 ? 26.879  56.495  28.104  1.00 57.05  ? 256 PRO A O      1 
ATOM   4211  C  CB     . PRO A 1 256 ? 24.295  56.549  29.500  1.00 43.23  ? 256 PRO A CB     1 
ATOM   4212  C  CG     . PRO A 1 256 ? 24.044  57.156  30.816  1.00 52.82  ? 256 PRO A CG     1 
ATOM   4213  C  CD     . PRO A 1 256 ? 25.377  57.220  31.484  1.00 62.49  ? 256 PRO A CD     1 
ATOM   4214  H  HA     . PRO A 1 256 ? 25.038  54.662  29.896  1.00 41.16  ? 256 PRO A HA     1 
ATOM   4215  H  HB2    . PRO A 1 256 ? 24.584  57.219  28.862  1.00 51.88  ? 256 PRO A HB2    1 
ATOM   4216  H  HB3    . PRO A 1 256 ? 23.504  56.088  29.179  1.00 51.88  ? 256 PRO A HB3    1 
ATOM   4217  H  HG2    . PRO A 1 256 ? 23.677  58.046  30.699  1.00 63.38  ? 256 PRO A HG2    1 
ATOM   4218  H  HG3    . PRO A 1 256 ? 23.434  56.597  31.322  1.00 63.38  ? 256 PRO A HG3    1 
ATOM   4219  H  HD2    . PRO A 1 256 ? 25.843  58.034  31.236  1.00 74.99  ? 256 PRO A HD2    1 
ATOM   4220  H  HD3    . PRO A 1 256 ? 25.279  57.143  32.446  1.00 74.99  ? 256 PRO A HD3    1 
ATOM   4221  N  N      . LYS A 1 257 ? 26.468  54.286  27.937  1.00 63.70  ? 257 LYS A N      1 
ATOM   4222  C  CA     . LYS A 1 257 ? 27.309  54.105  26.764  1.00 58.34  ? 257 LYS A CA     1 
ATOM   4223  C  C      . LYS A 1 257 ? 26.500  54.465  25.523  1.00 52.32  ? 257 LYS A C      1 
ATOM   4224  O  O      . LYS A 1 257 ? 25.295  54.219  25.475  1.00 47.67  ? 257 LYS A O      1 
ATOM   4225  C  CB     . LYS A 1 257 ? 27.848  52.677  26.692  1.00 55.56  ? 257 LYS A CB     1 
ATOM   4226  C  CG     . LYS A 1 257 ? 28.475  52.210  27.998  1.00 57.67  ? 257 LYS A CG     1 
ATOM   4227  C  CD     . LYS A 1 257 ? 29.255  50.920  27.825  1.00 65.94  ? 257 LYS A CD     1 
ATOM   4228  C  CE     . LYS A 1 257 ? 29.987  50.538  29.105  1.00 73.23  ? 257 LYS A CE     1 
ATOM   4229  N  NZ     . LYS A 1 257 ? 31.044  51.525  29.468  1.00 71.92  ? 257 LYS A NZ     1 
ATOM   4230  H  H      . LYS A 1 257 ? 26.086  53.565  28.210  1.00 76.44  ? 257 LYS A H      1 
ATOM   4231  H  HA     . LYS A 1 257 ? 28.065  54.710  26.818  1.00 70.01  ? 257 LYS A HA     1 
ATOM   4232  H  HB2    . LYS A 1 257 ? 27.117  52.075  26.480  1.00 66.68  ? 257 LYS A HB2    1 
ATOM   4233  H  HB3    . LYS A 1 257 ? 28.526  52.630  26.001  1.00 66.68  ? 257 LYS A HB3    1 
ATOM   4234  H  HG2    . LYS A 1 257 ? 29.086  52.892  28.319  1.00 69.20  ? 257 LYS A HG2    1 
ATOM   4235  H  HG3    . LYS A 1 257 ? 27.775  52.055  28.650  1.00 69.20  ? 257 LYS A HG3    1 
ATOM   4236  H  HD2    . LYS A 1 257 ? 28.643  50.203  27.599  1.00 79.13  ? 257 LYS A HD2    1 
ATOM   4237  H  HD3    . LYS A 1 257 ? 29.913  51.035  27.121  1.00 79.13  ? 257 LYS A HD3    1 
ATOM   4238  H  HE2    . LYS A 1 257 ? 29.349  50.497  29.835  1.00 87.88  ? 257 LYS A HE2    1 
ATOM   4239  H  HE3    . LYS A 1 257 ? 30.410  49.674  28.982  1.00 87.88  ? 257 LYS A HE3    1 
ATOM   4240  H  HZ1    . LYS A 1 257 ? 31.450  51.272  30.218  1.00 86.31  ? 257 LYS A HZ1    1 
ATOM   4241  H  HZ2    . LYS A 1 257 ? 31.647  51.578  28.816  1.00 86.31  ? 257 LYS A HZ2    1 
ATOM   4242  H  HZ3    . LYS A 1 257 ? 30.680  52.328  29.592  1.00 86.31  ? 257 LYS A HZ3    1 
ATOM   4243  N  N      . HIS A 1 258 ? 27.162  55.055  24.532  1.00 25.53  ? 258 HIS A N      1 
ATOM   4244  C  CA     . HIS A 1 258 ? 26.510  55.443  23.285  1.00 19.56  ? 258 HIS A CA     1 
ATOM   4245  C  C      . HIS A 1 258 ? 27.320  54.956  22.079  1.00 28.26  ? 258 HIS A C      1 
ATOM   4246  O  O      . HIS A 1 258 ? 28.540  54.837  22.167  1.00 33.63  ? 258 HIS A O      1 
ATOM   4247  C  CB     . HIS A 1 258 ? 26.334  56.961  23.233  1.00 23.96  ? 258 HIS A CB     1 
ATOM   4248  C  CG     . HIS A 1 258 ? 27.608  57.723  23.419  1.00 31.75  ? 258 HIS A CG     1 
ATOM   4249  N  ND1    . HIS A 1 258 ? 28.525  57.899  22.405  1.00 27.11  ? 258 HIS A ND1    1 
ATOM   4250  C  CD2    . HIS A 1 258 ? 28.118  58.357  24.502  1.00 41.32  ? 258 HIS A CD2    1 
ATOM   4251  C  CE1    . HIS A 1 258 ? 29.545  58.608  22.854  1.00 31.32  ? 258 HIS A CE1    1 
ATOM   4252  N  NE2    . HIS A 1 258 ? 29.323  58.898  24.124  1.00 47.98  ? 258 HIS A NE2    1 
ATOM   4253  H  H      . HIS A 1 258 ? 28.001  55.243  24.558  1.00 30.64  ? 258 HIS A H      1 
ATOM   4254  H  HA     . HIS A 1 258 ? 25.631  55.035  23.245  1.00 23.48  ? 258 HIS A HA     1 
ATOM   4255  H  HB2    . HIS A 1 258 ? 25.967  57.203  22.369  1.00 28.75  ? 258 HIS A HB2    1 
ATOM   4256  H  HB3    . HIS A 1 258 ? 25.723  57.229  23.937  1.00 28.75  ? 258 HIS A HB3    1 
ATOM   4257  H  HD1    . HIS A 1 258 ? 28.446  57.595  21.605  1.00 32.54  ? 258 HIS A HD1    1 
ATOM   4258  H  HD2    . HIS A 1 258 ? 27.726  58.415  25.343  1.00 49.59  ? 258 HIS A HD2    1 
ATOM   4259  H  HE1    . HIS A 1 258 ? 30.293  58.860  22.361  1.00 37.58  ? 258 HIS A HE1    1 
ATOM   4260  H  HE2    . HIS A 1 258 ? 29.847  59.353  24.632  1.00 57.57  ? 258 HIS A HE2    1 
ATOM   4261  N  N      . PRO A 1 259 ? 26.646  54.665  20.949  1.00 19.51  ? 259 PRO A N      1 
ATOM   4262  C  CA     . PRO A 1 259 ? 27.369  54.163  19.773  1.00 18.07  ? 259 PRO A CA     1 
ATOM   4263  C  C      . PRO A 1 259 ? 28.339  55.175  19.174  1.00 37.20  ? 259 PRO A C      1 
ATOM   4264  O  O      . PRO A 1 259 ? 28.183  56.377  19.392  1.00 30.67  ? 259 PRO A O      1 
ATOM   4265  C  CB     . PRO A 1 259 ? 26.249  53.852  18.773  1.00 10.06  ? 259 PRO A CB     1 
ATOM   4266  C  CG     . PRO A 1 259 ? 25.024  53.730  19.583  1.00 29.48  ? 259 PRO A CG     1 
ATOM   4267  C  CD     . PRO A 1 259 ? 25.192  54.679  20.722  1.00 31.19  ? 259 PRO A CD     1 
ATOM   4268  H  HA     . PRO A 1 259 ? 27.845  53.346  19.990  1.00 21.68  ? 259 PRO A HA     1 
ATOM   4269  H  HB2    . PRO A 1 259 ? 26.168  54.581  18.138  1.00 12.08  ? 259 PRO A HB2    1 
ATOM   4270  H  HB3    . PRO A 1 259 ? 26.442  53.019  18.316  1.00 12.08  ? 259 PRO A HB3    1 
ATOM   4271  H  HG2    . PRO A 1 259 ? 24.254  53.975  19.046  1.00 35.38  ? 259 PRO A HG2    1 
ATOM   4272  H  HG3    . PRO A 1 259 ? 24.939  52.820  19.908  1.00 35.38  ? 259 PRO A HG3    1 
ATOM   4273  H  HD2    . PRO A 1 259 ? 24.896  55.567  20.470  1.00 37.43  ? 259 PRO A HD2    1 
ATOM   4274  H  HD3    . PRO A 1 259 ? 24.723  54.354  21.506  1.00 37.43  ? 259 PRO A HD3    1 
ATOM   4275  N  N      . LEU A 1 260 ? 29.323  54.676  18.427  1.00 41.19  ? 260 LEU A N      1 
ATOM   4276  C  CA     . LEU A 1 260 ? 30.286  55.520  17.721  1.00 27.38  ? 260 LEU A CA     1 
ATOM   4277  C  C      . LEU A 1 260 ? 30.090  55.400  16.216  1.00 35.48  ? 260 LEU A C      1 
ATOM   4278  O  O      . LEU A 1 260 ? 29.757  54.327  15.712  1.00 56.77  ? 260 LEU A O      1 
ATOM   4279  C  CB     . LEU A 1 260 ? 31.722  55.133  18.085  1.00 17.68  ? 260 LEU A CB     1 
ATOM   4280  C  CG     . LEU A 1 260 ? 32.174  55.315  19.536  1.00 20.41  ? 260 LEU A CG     1 
ATOM   4281  C  CD1    . LEU A 1 260 ? 33.620  54.877  19.683  1.00 11.93  ? 260 LEU A CD1    1 
ATOM   4282  C  CD2    . LEU A 1 260 ? 32.004  56.754  19.998  1.00 43.02  ? 260 LEU A CD2    1 
ATOM   4283  H  H      . LEU A 1 260 ? 29.457  53.835  18.312  1.00 49.43  ? 260 LEU A H      1 
ATOM   4284  H  HA     . LEU A 1 260 ? 30.146  56.446  17.974  1.00 32.86  ? 260 LEU A HA     1 
ATOM   4285  H  HB2    . LEU A 1 260 ? 31.841  54.195  17.868  1.00 21.22  ? 260 LEU A HB2    1 
ATOM   4286  H  HB3    . LEU A 1 260 ? 32.320  55.662  17.535  1.00 21.22  ? 260 LEU A HB3    1 
ATOM   4287  H  HG     . LEU A 1 260 ? 31.631  54.751  20.108  1.00 24.49  ? 260 LEU A HG     1 
ATOM   4288  H  HD11   . LEU A 1 260 ? 33.894  54.997  20.606  1.00 14.31  ? 260 LEU A HD11   1 
ATOM   4289  H  HD12   . LEU A 1 260 ? 33.694  53.942  19.435  1.00 14.31  ? 260 LEU A HD12   1 
ATOM   4290  H  HD13   . LEU A 1 260 ? 34.175  55.418  19.100  1.00 14.31  ? 260 LEU A HD13   1 
ATOM   4291  H  HD21   . LEU A 1 260 ? 32.301  56.827  20.919  1.00 51.63  ? 260 LEU A HD21   1 
ATOM   4292  H  HD22   . LEU A 1 260 ? 32.539  57.333  19.431  1.00 51.63  ? 260 LEU A HD22   1 
ATOM   4293  H  HD23   . LEU A 1 260 ? 31.068  56.999  19.932  1.00 51.63  ? 260 LEU A HD23   1 
ATOM   4294  N  N      . GLU A 1 261 ? 30.299  56.501  15.500  1.00 37.55  ? 261 GLU A N      1 
ATOM   4295  C  CA     . GLU A 1 261 ? 30.207  56.480  14.047  1.00 40.78  ? 261 GLU A CA     1 
ATOM   4296  C  C      . GLU A 1 261 ? 31.333  55.634  13.480  1.00 34.85  ? 261 GLU A C      1 
ATOM   4297  O  O      . GLU A 1 261 ? 32.505  55.988  13.588  1.00 30.82  ? 261 GLU A O      1 
ATOM   4298  C  CB     . GLU A 1 261 ? 30.262  57.893  13.461  1.00 61.94  ? 261 GLU A CB     1 
ATOM   4299  C  CG     . GLU A 1 261 ? 28.956  58.669  13.582  1.00 102.71 ? 261 GLU A CG     1 
ATOM   4300  C  CD     . GLU A 1 261 ? 28.932  59.918  12.715  1.00 99.31  ? 261 GLU A CD     1 
ATOM   4301  O  OE1    . GLU A 1 261 ? 27.842  60.508  12.548  1.00 84.55  ? 261 GLU A OE1    1 
ATOM   4302  O  OE2    . GLU A 1 261 ? 30.002  60.308  12.200  1.00 80.44  ? 261 GLU A OE2    1 
ATOM   4303  H  H      . GLU A 1 261 ? 30.494  57.270  15.831  1.00 45.06  ? 261 GLU A H      1 
ATOM   4304  H  HA     . GLU A 1 261 ? 29.364  56.076  13.786  1.00 48.93  ? 261 GLU A HA     1 
ATOM   4305  H  HB2    . GLU A 1 261 ? 30.948  58.396  13.925  1.00 74.33  ? 261 GLU A HB2    1 
ATOM   4306  H  HB3    . GLU A 1 261 ? 30.482  57.831  12.518  1.00 74.33  ? 261 GLU A HB3    1 
ATOM   4307  H  HG2    . GLU A 1 261 ? 28.222  58.098  13.306  1.00 123.25 ? 261 GLU A HG2    1 
ATOM   4308  H  HG3    . GLU A 1 261 ? 28.835  58.943  14.505  1.00 123.25 ? 261 GLU A HG3    1 
ATOM   4309  N  N      . ILE A 1 262 ? 30.964  54.506  12.887  1.00 59.19  ? 262 ILE A N      1 
ATOM   4310  C  CA     . ILE A 1 262 ? 31.926  53.596  12.288  1.00 52.88  ? 262 ILE A CA     1 
ATOM   4311  C  C      . ILE A 1 262 ? 32.028  53.931  10.805  1.00 45.88  ? 262 ILE A C      1 
ATOM   4312  O  O      . ILE A 1 262 ? 31.012  54.169  10.153  1.00 39.80  ? 262 ILE A O      1 
ATOM   4313  C  CB     . ILE A 1 262 ? 31.501  52.117  12.485  1.00 51.13  ? 262 ILE A CB     1 
ATOM   4314  C  CG1    . ILE A 1 262 ? 31.438  51.764  13.974  1.00 46.66  ? 262 ILE A CG1    1 
ATOM   4315  C  CG2    . ILE A 1 262 ? 32.428  51.167  11.731  1.00 43.93  ? 262 ILE A CG2    1 
ATOM   4316  C  CD1    . ILE A 1 262 ? 32.758  51.868  14.703  1.00 70.78  ? 262 ILE A CD1    1 
ATOM   4317  H  H      . ILE A 1 262 ? 30.148  54.242  12.818  1.00 71.02  ? 262 ILE A H      1 
ATOM   4318  H  HA     . ILE A 1 262 ? 32.796  53.726  12.697  1.00 63.45  ? 262 ILE A HA     1 
ATOM   4319  H  HB     . ILE A 1 262 ? 30.609  52.014  12.118  1.00 61.36  ? 262 ILE A HB     1 
ATOM   4320  H  HG12   . ILE A 1 262 ? 30.814  52.366  14.409  1.00 55.99  ? 262 ILE A HG12   1 
ATOM   4321  H  HG13   . ILE A 1 262 ? 31.124  50.850  14.063  1.00 55.99  ? 262 ILE A HG13   1 
ATOM   4322  H  HG21   . ILE A 1 262 ? 32.132  50.255  11.877  1.00 52.72  ? 262 ILE A HG21   1 
ATOM   4323  H  HG22   . ILE A 1 262 ? 32.394  51.378  10.785  1.00 52.72  ? 262 ILE A HG22   1 
ATOM   4324  H  HG23   . ILE A 1 262 ? 33.332  51.278  12.063  1.00 52.72  ? 262 ILE A HG23   1 
ATOM   4325  H  HD11   . ILE A 1 262 ? 32.625  51.628  15.633  1.00 84.94  ? 262 ILE A HD11   1 
ATOM   4326  H  HD12   . ILE A 1 262 ? 33.393  51.260  14.292  1.00 84.94  ? 262 ILE A HD12   1 
ATOM   4327  H  HD13   . ILE A 1 262 ? 33.082  52.779  14.639  1.00 84.94  ? 262 ILE A HD13   1 
ATOM   4328  N  N      . GLU A 1 263 ? 33.246  53.964  10.272  1.00 56.13  ? 263 GLU A N      1 
ATOM   4329  C  CA     . GLU A 1 263 ? 33.428  54.252  8.856   1.00 59.13  ? 263 GLU A CA     1 
ATOM   4330  C  C      . GLU A 1 263 ? 32.801  53.137  8.030   1.00 60.62  ? 263 GLU A C      1 
ATOM   4331  O  O      . GLU A 1 263 ? 32.902  51.963  8.392   1.00 52.48  ? 263 GLU A O      1 
ATOM   4332  C  CB     . GLU A 1 263 ? 34.913  54.383  8.500   1.00 70.17  ? 263 GLU A CB     1 
ATOM   4333  C  CG     . GLU A 1 263 ? 35.679  55.439  9.277   1.00 87.32  ? 263 GLU A CG     1 
ATOM   4334  C  CD     . GLU A 1 263 ? 35.090  56.826  9.107   1.00 114.18 ? 263 GLU A CD     1 
ATOM   4335  O  OE1    . GLU A 1 263 ? 34.592  57.128  8.001   1.00 112.05 ? 263 GLU A OE1    1 
ATOM   4336  O  OE2    . GLU A 1 263 ? 35.130  57.614  10.074  1.00 113.14 ? 263 GLU A OE2    1 
ATOM   4337  H  H      . GLU A 1 263 ? 33.976  53.825  10.706  1.00 67.36  ? 263 GLU A H      1 
ATOM   4338  H  HA     . GLU A 1 263 ? 32.984  55.086  8.635   1.00 70.96  ? 263 GLU A HA     1 
ATOM   4339  H  HB2    . GLU A 1 263 ? 35.345  53.530  8.666   1.00 84.21  ? 263 GLU A HB2    1 
ATOM   4340  H  HB3    . GLU A 1 263 ? 34.985  54.604  7.559   1.00 84.21  ? 263 GLU A HB3    1 
ATOM   4341  H  HG2    . GLU A 1 263 ? 35.657  55.217  10.220  1.00 104.79 ? 263 GLU A HG2    1 
ATOM   4342  H  HG3    . GLU A 1 263 ? 36.596  55.462  8.961   1.00 104.79 ? 263 GLU A HG3    1 
ATOM   4343  N  N      . PRO A 1 264 ? 32.164  53.492  6.903   1.00 55.48  ? 264 PRO A N      1 
ATOM   4344  C  CA     . PRO A 1 264 ? 31.616  52.448  6.034   1.00 48.17  ? 264 PRO A CA     1 
ATOM   4345  C  C      . PRO A 1 264 ? 32.731  51.584  5.458   1.00 49.54  ? 264 PRO A C      1 
ATOM   4346  O  O      . PRO A 1 264 ? 32.485  50.474  4.986   1.00 44.23  ? 264 PRO A O      1 
ATOM   4347  C  CB     . PRO A 1 264 ? 30.889  53.239  4.944   1.00 30.04  ? 264 PRO A CB     1 
ATOM   4348  C  CG     . PRO A 1 264 ? 31.573  54.554  4.916   1.00 56.90  ? 264 PRO A CG     1 
ATOM   4349  C  CD     . PRO A 1 264 ? 31.968  54.837  6.334   1.00 62.72  ? 264 PRO A CD     1 
ATOM   4350  H  HA     . PRO A 1 264 ? 30.983  51.894  6.517   1.00 57.81  ? 264 PRO A HA     1 
ATOM   4351  H  HB2    . PRO A 1 264 ? 30.981  52.784  4.092   1.00 36.05  ? 264 PRO A HB2    1 
ATOM   4352  H  HB3    . PRO A 1 264 ? 29.954  53.342  5.181   1.00 36.05  ? 264 PRO A HB3    1 
ATOM   4353  H  HG2    . PRO A 1 264 ? 32.358  54.501  4.348   1.00 68.28  ? 264 PRO A HG2    1 
ATOM   4354  H  HG3    . PRO A 1 264 ? 30.961  55.233  4.591   1.00 68.28  ? 264 PRO A HG3    1 
ATOM   4355  H  HD2    . PRO A 1 264 ? 32.797  55.340  6.361   1.00 75.27  ? 264 PRO A HD2    1 
ATOM   4356  H  HD3    . PRO A 1 264 ? 31.254  55.301  6.799   1.00 75.27  ? 264 PRO A HD3    1 
ATOM   4357  N  N      . GLU A 1 265 ? 33.954  52.101  5.509   1.00 65.57  ? 265 GLU A N      1 
ATOM   4358  C  CA     . GLU A 1 265 ? 35.113  51.364  5.036   1.00 61.34  ? 265 GLU A CA     1 
ATOM   4359  C  C      . GLU A 1 265 ? 35.564  50.346  6.078   1.00 51.53  ? 265 GLU A C      1 
ATOM   4360  O  O      . GLU A 1 265 ? 35.791  49.184  5.742   1.00 50.75  ? 265 GLU A O      1 
ATOM   4361  C  CB     . GLU A 1 265 ? 36.258  52.323  4.702   1.00 75.23  ? 265 GLU A CB     1 
ATOM   4362  C  CG     . GLU A 1 265 ? 37.538  51.631  4.262   1.00 70.55  ? 265 GLU A CG     1 
ATOM   4363  C  CD     . GLU A 1 265 ? 37.314  50.690  3.091   1.00 77.41  ? 265 GLU A CD     1 
ATOM   4364  O  OE1    . GLU A 1 265 ? 36.404  50.958  2.276   1.00 65.02  ? 265 GLU A OE1    1 
ATOM   4365  O  OE2    . GLU A 1 265 ? 38.046  49.684  2.983   1.00 67.41  ? 265 GLU A OE2    1 
ATOM   4366  H  H      . GLU A 1 265 ? 34.138  52.883  5.817   1.00 78.69  ? 265 GLU A H      1 
ATOM   4367  H  HA     . GLU A 1 265 ? 34.875  50.884  4.227   1.00 73.61  ? 265 GLU A HA     1 
ATOM   4368  H  HB2    . GLU A 1 265 ? 35.975  52.907  3.982   1.00 90.27  ? 265 GLU A HB2    1 
ATOM   4369  H  HB3    . GLU A 1 265 ? 36.462  52.849  5.491   1.00 90.27  ? 265 GLU A HB3    1 
ATOM   4370  H  HG2    . GLU A 1 265 ? 38.183  52.303  3.989   1.00 84.66  ? 265 GLU A HG2    1 
ATOM   4371  H  HG3    . GLU A 1 265 ? 37.890  51.113  5.002   1.00 84.66  ? 265 GLU A HG3    1 
ATOM   4372  N  N      . ARG A 1 266 ? 35.693  50.776  7.333   1.00 43.26  ? 266 ARG A N      1 
ATOM   4373  C  CA     . ARG A 1 266 ? 36.100  49.864  8.400   1.00 44.28  ? 266 ARG A CA     1 
ATOM   4374  C  C      . ARG A 1 266 ? 35.098  48.727  8.494   1.00 48.30  ? 266 ARG A C      1 
ATOM   4375  O  O      . ARG A 1 266 ? 35.465  47.574  8.705   1.00 37.14  ? 266 ARG A O      1 
ATOM   4376  C  CB     . ARG A 1 266 ? 36.209  50.584  9.750   1.00 48.69  ? 266 ARG A CB     1 
ATOM   4377  C  CG     . ARG A 1 266 ? 36.611  49.662  10.916  1.00 42.81  ? 266 ARG A CG     1 
ATOM   4378  C  CD     . ARG A 1 266 ? 36.478  50.344  12.277  1.00 66.70  ? 266 ARG A CD     1 
ATOM   4379  N  NE     . ARG A 1 266 ? 36.546  49.383  13.381  1.00 83.35  ? 266 ARG A NE     1 
ATOM   4380  C  CZ     . ARG A 1 266 ? 36.241  49.660  14.648  1.00 70.78  ? 266 ARG A CZ     1 
ATOM   4381  N  NH1    . ARG A 1 266 ? 35.849  50.878  14.997  1.00 59.11  ? 266 ARG A NH1    1 
ATOM   4382  N  NH2    . ARG A 1 266 ? 36.332  48.716  15.576  1.00 35.03  ? 266 ARG A NH2    1 
ATOM   4383  H  H      . ARG A 1 266 ? 35.552  51.584  7.591   1.00 51.91  ? 266 ARG A H      1 
ATOM   4384  H  HA     . ARG A 1 266 ? 36.968  49.488  8.185   1.00 53.14  ? 266 ARG A HA     1 
ATOM   4385  H  HB2    . ARG A 1 266 ? 36.878  51.282  9.679   1.00 58.43  ? 266 ARG A HB2    1 
ATOM   4386  H  HB3    . ARG A 1 266 ? 35.348  50.975  9.966   1.00 58.43  ? 266 ARG A HB3    1 
ATOM   4387  H  HG2    . ARG A 1 266 ? 36.037  48.881  10.914  1.00 51.37  ? 266 ARG A HG2    1 
ATOM   4388  H  HG3    . ARG A 1 266 ? 37.536  49.395  10.803  1.00 51.37  ? 266 ARG A HG3    1 
ATOM   4389  H  HD2    . ARG A 1 266 ? 37.201  50.982  12.386  1.00 80.03  ? 266 ARG A HD2    1 
ATOM   4390  H  HD3    . ARG A 1 266 ? 35.622  50.798  12.324  1.00 80.03  ? 266 ARG A HD3    1 
ATOM   4391  H  HE     . ARG A 1 266 ? 36.801  48.583  13.198  1.00 100.02 ? 266 ARG A HE     1 
ATOM   4392  H  HH11   . ARG A 1 266 ? 35.787  51.496  14.402  1.00 70.93  ? 266 ARG A HH11   1 
ATOM   4393  H  HH12   . ARG A 1 266 ? 35.656  51.050  15.817  1.00 70.93  ? 266 ARG A HH12   1 
ATOM   4394  H  HH21   . ARG A 1 266 ? 36.587  47.924  15.359  1.00 42.04  ? 266 ARG A HH21   1 
ATOM   4395  H  HH22   . ARG A 1 266 ? 36.138  48.897  16.394  1.00 42.04  ? 266 ARG A HH22   1 
ATOM   4396  N  N      . LEU A 1 267 ? 33.826  49.059  8.323   1.00 49.15  ? 267 LEU A N      1 
ATOM   4397  C  CA     . LEU A 1 267 ? 32.770  48.066  8.409   1.00 39.33  ? 267 LEU A CA     1 
ATOM   4398  C  C      . LEU A 1 267 ? 32.862  47.082  7.244   1.00 32.19  ? 267 LEU A C      1 
ATOM   4399  O  O      . LEU A 1 267 ? 32.621  45.888  7.410   1.00 32.09  ? 267 LEU A O      1 
ATOM   4400  C  CB     . LEU A 1 267 ? 31.405  48.756  8.432   1.00 41.47  ? 267 LEU A CB     1 
ATOM   4401  C  CG     . LEU A 1 267 ? 30.221  48.008  9.049   1.00 38.52  ? 267 LEU A CG     1 
ATOM   4402  C  CD1    . LEU A 1 267 ? 30.522  47.510  10.457  1.00 28.83  ? 267 LEU A CD1    1 
ATOM   4403  C  CD2    . LEU A 1 267 ? 29.003  48.916  9.067   1.00 38.77  ? 267 LEU A CD2    1 
ATOM   4404  H  H      . LEU A 1 267 ? 33.548  49.856  8.156   1.00 58.98  ? 267 LEU A H      1 
ATOM   4405  H  HA     . LEU A 1 267 ? 32.870  47.567  9.234   1.00 47.20  ? 267 LEU A HA     1 
ATOM   4406  H  HB2    . LEU A 1 267 ? 31.501  49.585  8.926   1.00 49.77  ? 267 LEU A HB2    1 
ATOM   4407  H  HB3    . LEU A 1 267 ? 31.161  48.961  7.516   1.00 49.77  ? 267 LEU A HB3    1 
ATOM   4408  H  HG     . LEU A 1 267 ? 30.012  47.238  8.497   1.00 46.22  ? 267 LEU A HG     1 
ATOM   4409  H  HD11   . LEU A 1 267 ? 29.742  47.045  10.800  1.00 34.60  ? 267 LEU A HD11   1 
ATOM   4410  H  HD12   . LEU A 1 267 ? 31.279  46.905  10.422  1.00 34.60  ? 267 LEU A HD12   1 
ATOM   4411  H  HD13   . LEU A 1 267 ? 30.730  48.270  11.022  1.00 34.60  ? 267 LEU A HD13   1 
ATOM   4412  H  HD21   . LEU A 1 267 ? 28.257  48.436  9.459   1.00 46.52  ? 267 LEU A HD21   1 
ATOM   4413  H  HD22   . LEU A 1 267 ? 29.205  49.704  9.597   1.00 46.52  ? 267 LEU A HD22   1 
ATOM   4414  H  HD23   . LEU A 1 267 ? 28.789  49.175  8.157   1.00 46.52  ? 267 LEU A HD23   1 
ATOM   4415  N  N      . ARG A 1 268 ? 33.218  47.588  6.066   1.00 41.50  ? 268 ARG A N      1 
ATOM   4416  C  CA     . ARG A 1 268 ? 33.363  46.750  4.879   1.00 35.08  ? 268 ARG A CA     1 
ATOM   4417  C  C      . ARG A 1 268 ? 34.507  45.749  5.053   1.00 35.36  ? 268 ARG A C      1 
ATOM   4418  O  O      . ARG A 1 268 ? 34.423  44.613  4.588   1.00 24.05  ? 268 ARG A O      1 
ATOM   4419  C  CB     . ARG A 1 268 ? 33.592  47.618  3.638   1.00 44.94  ? 268 ARG A CB     1 
ATOM   4420  C  CG     . ARG A 1 268 ? 33.525  46.858  2.314   1.00 61.46  ? 268 ARG A CG     1 
ATOM   4421  C  CD     . ARG A 1 268 ? 34.404  47.482  1.239   1.00 59.36  ? 268 ARG A CD     1 
ATOM   4422  N  NE     . ARG A 1 268 ? 35.811  47.528  1.623   1.00 66.62  ? 268 ARG A NE     1 
ATOM   4423  C  CZ     . ARG A 1 268 ? 36.658  46.510  1.498   1.00 71.78  ? 268 ARG A CZ     1 
ATOM   4424  N  NH1    . ARG A 1 268 ? 36.249  45.352  0.991   1.00 52.55  ? 268 ARG A NH1    1 
ATOM   4425  N  NH2    . ARG A 1 268 ? 37.922  46.651  1.877   1.00 70.03  ? 268 ARG A NH2    1 
ATOM   4426  H  H      . ARG A 1 268 ? 33.381  48.421  5.927   1.00 49.80  ? 268 ARG A H      1 
ATOM   4427  H  HA     . ARG A 1 268 ? 32.545  46.247  4.745   1.00 42.10  ? 268 ARG A HA     1 
ATOM   4428  H  HB2    . ARG A 1 268 ? 32.913  48.311  3.615   1.00 53.92  ? 268 ARG A HB2    1 
ATOM   4429  H  HB3    . ARG A 1 268 ? 34.471  48.024  3.701   1.00 53.92  ? 268 ARG A HB3    1 
ATOM   4430  H  HG2    . ARG A 1 268 ? 33.824  45.947  2.456   1.00 73.75  ? 268 ARG A HG2    1 
ATOM   4431  H  HG3    . ARG A 1 268 ? 32.609  46.862  1.993   1.00 73.75  ? 268 ARG A HG3    1 
ATOM   4432  H  HD2    . ARG A 1 268 ? 34.332  46.956  0.427   1.00 71.23  ? 268 ARG A HD2    1 
ATOM   4433  H  HD3    . ARG A 1 268 ? 34.107  48.390  1.074   1.00 71.23  ? 268 ARG A HD3    1 
ATOM   4434  H  HE     . ARG A 1 268 ? 36.113  48.263  1.953   1.00 79.94  ? 268 ARG A HE     1 
ATOM   4435  H  HH11   . ARG A 1 268 ? 35.431  45.256  0.743   1.00 63.06  ? 268 ARG A HH11   1 
ATOM   4436  H  HH12   . ARG A 1 268 ? 36.802  44.698  0.912   1.00 63.06  ? 268 ARG A HH12   1 
ATOM   4437  H  HH21   . ARG A 1 268 ? 38.192  47.399  2.205   1.00 84.03  ? 268 ARG A HH21   1 
ATOM   4438  H  HH22   . ARG A 1 268 ? 38.471  45.994  1.796   1.00 84.03  ? 268 ARG A HH22   1 
ATOM   4439  N  N      . LYS A 1 269 ? 35.578  46.180  5.717   1.00 49.35  ? 269 LYS A N      1 
ATOM   4440  C  CA     . LYS A 1 269 ? 36.719  45.307  5.989   1.00 41.08  ? 269 LYS A CA     1 
ATOM   4441  C  C      . LYS A 1 269 ? 36.358  44.217  6.993   1.00 35.31  ? 269 LYS A C      1 
ATOM   4442  O  O      . LYS A 1 269 ? 36.792  43.077  6.858   1.00 33.77  ? 269 LYS A O      1 
ATOM   4443  C  CB     . LYS A 1 269 ? 37.908  46.108  6.531   1.00 39.69  ? 269 LYS A CB     1 
ATOM   4444  C  CG     . LYS A 1 269 ? 38.542  47.076  5.551   1.00 61.24  ? 269 LYS A CG     1 
ATOM   4445  C  CD     . LYS A 1 269 ? 39.608  47.921  6.244   1.00 67.89  ? 269 LYS A CD     1 
ATOM   4446  C  CE     . LYS A 1 269 ? 40.193  48.978  5.317   1.00 90.63  ? 269 LYS A CE     1 
ATOM   4447  N  NZ     . LYS A 1 269 ? 41.153  49.876  6.018   1.00 74.15  ? 269 LYS A NZ     1 
ATOM   4448  H  H      . LYS A 1 269 ? 35.668  46.979  6.023   1.00 59.21  ? 269 LYS A H      1 
ATOM   4449  H  HA     . LYS A 1 269 ? 36.995  44.879  5.164   1.00 49.29  ? 269 LYS A HA     1 
ATOM   4450  H  HB2    . LYS A 1 269 ? 37.607  46.623  7.296   1.00 47.63  ? 269 LYS A HB2    1 
ATOM   4451  H  HB3    . LYS A 1 269 ? 38.596  45.484  6.811   1.00 47.63  ? 269 LYS A HB3    1 
ATOM   4452  H  HG2    . LYS A 1 269 ? 38.964  46.578  4.833   1.00 73.49  ? 269 LYS A HG2    1 
ATOM   4453  H  HG3    . LYS A 1 269 ? 37.861  47.670  5.197   1.00 73.49  ? 269 LYS A HG3    1 
ATOM   4454  H  HD2    . LYS A 1 269 ? 39.211  48.373  7.005   1.00 81.47  ? 269 LYS A HD2    1 
ATOM   4455  H  HD3    . LYS A 1 269 ? 40.330  47.344  6.538   1.00 81.47  ? 269 LYS A HD3    1 
ATOM   4456  H  HE2    . LYS A 1 269 ? 40.666  48.538  4.593   1.00 108.76 ? 269 LYS A HE2    1 
ATOM   4457  H  HE3    . LYS A 1 269 ? 39.474  49.523  4.962   1.00 108.76 ? 269 LYS A HE3    1 
ATOM   4458  H  HZ1    . LYS A 1 269 ? 41.475  50.480  5.449   1.00 88.99  ? 269 LYS A HZ1    1 
ATOM   4459  H  HZ2    . LYS A 1 269 ? 40.742  50.298  6.686   1.00 88.99  ? 269 LYS A HZ2    1 
ATOM   4460  H  HZ3    . LYS A 1 269 ? 41.828  49.401  6.349   1.00 88.99  ? 269 LYS A HZ3    1 
ATOM   4461  N  N      . ILE A 1 270 ? 35.572  44.574  8.006   1.00 33.39  ? 270 ILE A N      1 
ATOM   4462  C  CA     . ILE A 1 270 ? 35.176  43.612  9.029   1.00 28.42  ? 270 ILE A CA     1 
ATOM   4463  C  C      . ILE A 1 270 ? 34.330  42.498  8.434   1.00 32.28  ? 270 ILE A C      1 
ATOM   4464  O  O      . ILE A 1 270 ? 34.518  41.334  8.773   1.00 46.23  ? 270 ILE A O      1 
ATOM   4465  C  CB     . ILE A 1 270 ? 34.387  44.284  10.179  1.00 36.18  ? 270 ILE A CB     1 
ATOM   4466  C  CG1    . ILE A 1 270 ? 35.310  45.191  10.991  1.00 30.54  ? 270 ILE A CG1    1 
ATOM   4467  C  CG2    . ILE A 1 270 ? 33.782  43.234  11.117  1.00 31.00  ? 270 ILE A CG2    1 
ATOM   4468  C  CD1    . ILE A 1 270 ? 34.596  46.038  12.021  1.00 37.66  ? 270 ILE A CD1    1 
ATOM   4469  H  H      . ILE A 1 270 ? 35.256  45.365  8.123   1.00 40.07  ? 270 ILE A H      1 
ATOM   4470  H  HA     . ILE A 1 270 ? 35.973  43.212  9.408   1.00 34.11  ? 270 ILE A HA     1 
ATOM   4471  H  HB     . ILE A 1 270 ? 33.672  44.820  9.801   1.00 43.42  ? 270 ILE A HB     1 
ATOM   4472  H  HG12   . ILE A 1 270 ? 35.955  44.639  11.460  1.00 36.64  ? 270 ILE A HG12   1 
ATOM   4473  H  HG13   . ILE A 1 270 ? 35.771  45.790  10.384  1.00 36.64  ? 270 ILE A HG13   1 
ATOM   4474  H  HG21   . ILE A 1 270 ? 33.296  43.685  11.825  1.00 37.20  ? 270 ILE A HG21   1 
ATOM   4475  H  HG22   . ILE A 1 270 ? 33.179  42.669  10.610  1.00 37.20  ? 270 ILE A HG22   1 
ATOM   4476  H  HG23   . ILE A 1 270 ? 34.498  42.699  11.495  1.00 37.20  ? 270 ILE A HG23   1 
ATOM   4477  H  HD11   . ILE A 1 270 ? 35.249  46.581  12.490  1.00 45.19  ? 270 ILE A HD11   1 
ATOM   4478  H  HD12   . ILE A 1 270 ? 33.954  46.609  11.570  1.00 45.19  ? 270 ILE A HD12   1 
ATOM   4479  H  HD13   . ILE A 1 270 ? 34.139  45.455  12.647  1.00 45.19  ? 270 ILE A HD13   1 
ATOM   4480  N  N      . VAL A 1 271 ? 33.402  42.845  7.551   1.00 17.05  ? 271 VAL A N      1 
ATOM   4481  C  CA     . VAL A 1 271 ? 32.513  41.842  6.980   1.00 24.92  ? 271 VAL A CA     1 
ATOM   4482  C  C      . VAL A 1 271 ? 33.287  40.957  6.003   1.00 28.22  ? 271 VAL A C      1 
ATOM   4483  O  O      . VAL A 1 271 ? 33.048  39.751  5.920   1.00 30.44  ? 271 VAL A O      1 
ATOM   4484  C  CB     . VAL A 1 271 ? 31.314  42.493  6.277   1.00 26.61  ? 271 VAL A CB     1 
ATOM   4485  C  CG1    . VAL A 1 271 ? 30.454  41.441  5.588   1.00 29.21  ? 271 VAL A CG1    1 
ATOM   4486  C  CG2    . VAL A 1 271 ? 30.480  43.252  7.286   1.00 29.31  ? 271 VAL A CG2    1 
ATOM   4487  H  H      . VAL A 1 271 ? 33.266  43.646  7.269   1.00 20.46  ? 271 VAL A H      1 
ATOM   4488  H  HA     . VAL A 1 271 ? 32.174  41.278  7.692   1.00 29.90  ? 271 VAL A HA     1 
ATOM   4489  H  HB     . VAL A 1 271 ? 31.631  43.118  5.606   1.00 31.93  ? 271 VAL A HB     1 
ATOM   4490  H  HG11   . VAL A 1 271 ? 29.706  41.880  5.154   1.00 35.06  ? 271 VAL A HG11   1 
ATOM   4491  H  HG12   . VAL A 1 271 ? 30.993  40.975  4.930   1.00 35.06  ? 271 VAL A HG12   1 
ATOM   4492  H  HG13   . VAL A 1 271 ? 30.129  40.814  6.254   1.00 35.06  ? 271 VAL A HG13   1 
ATOM   4493  H  HG21   . VAL A 1 271 ? 29.726  43.658  6.830   1.00 35.17  ? 271 VAL A HG21   1 
ATOM   4494  H  HG22   . VAL A 1 271 ? 30.164  42.634  7.963   1.00 35.17  ? 271 VAL A HG22   1 
ATOM   4495  H  HG23   . VAL A 1 271 ? 31.028  43.940  7.695   1.00 35.17  ? 271 VAL A HG23   1 
ATOM   4496  N  N      . GLU A 1 272 ? 34.220  41.565  5.276   1.00 31.59  ? 272 GLU A N      1 
ATOM   4497  C  CA     . GLU A 1 272 ? 35.083  40.842  4.348   1.00 18.72  ? 272 GLU A CA     1 
ATOM   4498  C  C      . GLU A 1 272 ? 35.988  39.892  5.121   1.00 19.81  ? 272 GLU A C      1 
ATOM   4499  O  O      . GLU A 1 272 ? 36.210  38.754  4.710   1.00 24.83  ? 272 GLU A O      1 
ATOM   4500  C  CB     . GLU A 1 272 ? 35.912  41.833  3.525   1.00 36.44  ? 272 GLU A CB     1 
ATOM   4501  C  CG     . GLU A 1 272 ? 37.088  41.240  2.753   1.00 57.40  ? 272 GLU A CG     1 
ATOM   4502  C  CD     . GLU A 1 272 ? 38.016  42.312  2.203   1.00 74.75  ? 272 GLU A CD     1 
ATOM   4503  O  OE1    . GLU A 1 272 ? 38.067  42.483  0.965   1.00 81.22  ? 272 GLU A OE1    1 
ATOM   4504  O  OE2    . GLU A 1 272 ? 38.697  42.986  3.010   1.00 59.17  ? 272 GLU A OE2    1 
ATOM   4505  H  H      . GLU A 1 272 ? 34.374  42.411  5.303   1.00 37.90  ? 272 GLU A H      1 
ATOM   4506  H  HA     . GLU A 1 272 ? 34.537  40.319  3.740   1.00 22.46  ? 272 GLU A HA     1 
ATOM   4507  H  HB2    . GLU A 1 272 ? 35.327  42.259  2.879   1.00 43.73  ? 272 GLU A HB2    1 
ATOM   4508  H  HB3    . GLU A 1 272 ? 36.271  42.505  4.127   1.00 43.73  ? 272 GLU A HB3    1 
ATOM   4509  H  HG2    . GLU A 1 272 ? 37.603  40.671  3.347   1.00 68.88  ? 272 GLU A HG2    1 
ATOM   4510  H  HG3    . GLU A 1 272 ? 36.749  40.722  2.006   1.00 68.88  ? 272 GLU A HG3    1 
ATOM   4511  N  N      . GLU A 1 273 ? 36.495  40.374  6.251   1.00 29.76  ? 273 GLU A N      1 
ATOM   4512  C  CA     . GLU A 1 273 ? 37.355  39.588  7.130   1.00 37.42  ? 273 GLU A CA     1 
ATOM   4513  C  C      . GLU A 1 273 ? 36.626  38.354  7.648   1.00 33.12  ? 273 GLU A C      1 
ATOM   4514  O  O      . GLU A 1 273 ? 37.244  37.330  7.944   1.00 40.39  ? 273 GLU A O      1 
ATOM   4515  C  CB     . GLU A 1 273 ? 37.824  40.449  8.310   1.00 40.14  ? 273 GLU A CB     1 
ATOM   4516  C  CG     . GLU A 1 273 ? 38.788  39.768  9.280   1.00 44.07  ? 273 GLU A CG     1 
ATOM   4517  C  CD     . GLU A 1 273 ? 40.227  39.806  8.808   1.00 82.85  ? 273 GLU A CD     1 
ATOM   4518  O  OE1    . GLU A 1 273 ? 40.933  38.787  8.973   1.00 86.70  ? 273 GLU A OE1    1 
ATOM   4519  O  OE2    . GLU A 1 273 ? 40.657  40.858  8.286   1.00 61.47  ? 273 GLU A OE2    1 
ATOM   4520  H  H      . GLU A 1 273 ? 36.353  41.173  6.536   1.00 35.72  ? 273 GLU A H      1 
ATOM   4521  H  HA     . GLU A 1 273 ? 38.137  39.295  6.636   1.00 44.90  ? 273 GLU A HA     1 
ATOM   4522  H  HB2    . GLU A 1 273 ? 38.273  41.234  7.957   1.00 48.17  ? 273 GLU A HB2    1 
ATOM   4523  H  HB3    . GLU A 1 273 ? 37.045  40.724  8.818   1.00 48.17  ? 273 GLU A HB3    1 
ATOM   4524  H  HG2    . GLU A 1 273 ? 38.742  40.218  10.138  1.00 52.89  ? 273 GLU A HG2    1 
ATOM   4525  H  HG3    . GLU A 1 273 ? 38.530  38.838  9.380   1.00 52.89  ? 273 GLU A HG3    1 
ATOM   4526  N  N      . ARG A 1 274 ? 35.305  38.466  7.752   1.00 21.13  ? 274 ARG A N      1 
ATOM   4527  C  CA     . ARG A 1 274 ? 34.466  37.383  8.246   1.00 21.87  ? 274 ARG A CA     1 
ATOM   4528  C  C      . ARG A 1 274 ? 34.011  36.469  7.123   1.00 28.97  ? 274 ARG A C      1 
ATOM   4529  O  O      . ARG A 1 274 ? 33.804  35.273  7.329   1.00 31.31  ? 274 ARG A O      1 
ATOM   4530  C  CB     . ARG A 1 274 ? 33.255  37.951  8.979   1.00 21.63  ? 274 ARG A CB     1 
ATOM   4531  C  CG     . ARG A 1 274 ? 33.614  38.680  10.256  1.00 21.09  ? 274 ARG A CG     1 
ATOM   4532  C  CD     . ARG A 1 274 ? 32.394  39.275  10.913  1.00 16.85  ? 274 ARG A CD     1 
ATOM   4533  N  NE     . ARG A 1 274 ? 32.158  38.649  12.209  1.00 17.23  ? 274 ARG A NE     1 
ATOM   4534  C  CZ     . ARG A 1 274 ? 30.971  38.549  12.795  1.00 19.42  ? 274 ARG A CZ     1 
ATOM   4535  N  NH1    . ARG A 1 274 ? 29.893  39.034  12.205  1.00 30.13  ? 274 ARG A NH1    1 
ATOM   4536  N  NH2    . ARG A 1 274 ? 30.862  37.958  13.975  1.00 30.36  ? 274 ARG A NH2    1 
ATOM   4537  H  H      . ARG A 1 274 ? 34.865  39.174  7.538   1.00 25.36  ? 274 ARG A H      1 
ATOM   4538  H  HA     . ARG A 1 274 ? 34.977  36.852  8.877   1.00 26.24  ? 274 ARG A HA     1 
ATOM   4539  H  HB2    . ARG A 1 274 ? 32.801  38.579  8.395   1.00 25.95  ? 274 ARG A HB2    1 
ATOM   4540  H  HB3    . ARG A 1 274 ? 32.657  37.223  9.209   1.00 25.95  ? 274 ARG A HB3    1 
ATOM   4541  H  HG2    . ARG A 1 274 ? 34.020  38.056  10.878  1.00 25.30  ? 274 ARG A HG2    1 
ATOM   4542  H  HG3    . ARG A 1 274 ? 34.231  39.400  10.052  1.00 25.30  ? 274 ARG A HG3    1 
ATOM   4543  H  HD2    . ARG A 1 274 ? 32.531  40.226  11.051  1.00 20.22  ? 274 ARG A HD2    1 
ATOM   4544  H  HD3    . ARG A 1 274 ? 31.617  39.123  10.352  1.00 20.22  ? 274 ARG A HD3    1 
ATOM   4545  H  HE     . ARG A 1 274 ? 32.837  38.321  12.623  1.00 20.68  ? 274 ARG A HE     1 
ATOM   4546  H  HH11   . ARG A 1 274 ? 29.958  39.418  11.438  1.00 36.16  ? 274 ARG A HH11   1 
ATOM   4547  H  HH12   . ARG A 1 274 ? 29.126  38.967  12.588  1.00 36.16  ? 274 ARG A HH12   1 
ATOM   4548  H  HH21   . ARG A 1 274 ? 31.560  37.640  14.364  1.00 36.44  ? 274 ARG A HH21   1 
ATOM   4549  H  HH22   . ARG A 1 274 ? 30.092  37.894  14.354  1.00 36.44  ? 274 ARG A HH22   1 
ATOM   4550  N  N      . GLY A 1 275 ? 33.837  37.042  5.938   1.00 28.05  ? 275 GLY A N      1 
ATOM   4551  C  CA     . GLY A 1 275 ? 33.423  36.274  4.780   1.00 32.01  ? 275 GLY A CA     1 
ATOM   4552  C  C      . GLY A 1 275 ? 31.994  35.793  4.905   1.00 23.81  ? 275 GLY A C      1 
ATOM   4553  O  O      . GLY A 1 275 ? 31.633  34.744  4.371   1.00 33.82  ? 275 GLY A O      1 
ATOM   4554  H  H      . GLY A 1 275 ? 33.953  37.879  5.781   1.00 33.66  ? 275 GLY A H      1 
ATOM   4555  H  HA2    . GLY A 1 275 ? 33.497  36.822  3.984   1.00 38.41  ? 275 GLY A HA2    1 
ATOM   4556  H  HA3    . GLY A 1 275 ? 34.002  35.502  4.679   1.00 38.41  ? 275 GLY A HA3    1 
ATOM   4557  N  N      . THR A 1 276 ? 31.183  36.558  5.625   1.00 23.36  ? 276 THR A N      1 
ATOM   4558  C  CA     . THR A 1 276 ? 29.788  36.204  5.839   1.00 23.52  ? 276 THR A CA     1 
ATOM   4559  C  C      . THR A 1 276 ? 28.891  37.011  4.913   1.00 22.05  ? 276 THR A C      1 
ATOM   4560  O  O      . THR A 1 276 ? 29.291  38.059  4.405   1.00 24.77  ? 276 THR A O      1 
ATOM   4561  C  CB     . THR A 1 276 ? 29.361  36.444  7.299   1.00 18.45  ? 276 THR A CB     1 
ATOM   4562  O  OG1    . THR A 1 276 ? 29.750  37.760  7.706   1.00 19.22  ? 276 THR A OG1    1 
ATOM   4563  C  CG2    . THR A 1 276 ? 30.009  35.424  8.218   1.00 20.30  ? 276 THR A CG2    1 
ATOM   4564  H  H      . THR A 1 276 ? 31.419  37.294  6.002   1.00 28.03  ? 276 THR A H      1 
ATOM   4565  H  HA     . THR A 1 276 ? 29.664  35.263  5.638   1.00 28.23  ? 276 THR A HA     1 
ATOM   4566  H  HB     . THR A 1 276 ? 28.398  36.354  7.372   1.00 22.15  ? 276 THR A HB     1 
ATOM   4567  H  HG1    . THR A 1 276 ? 29.519  37.894  8.502   1.00 23.07  ? 276 THR A HG1    1 
ATOM   4568  H  HG21   . THR A 1 276 ? 29.735  35.583  9.134   1.00 24.37  ? 276 THR A HG21   1 
ATOM   4569  H  HG22   . THR A 1 276 ? 29.743  34.528  7.959   1.00 24.37  ? 276 THR A HG22   1 
ATOM   4570  H  HG23   . THR A 1 276 ? 30.975  35.495  8.161   1.00 24.37  ? 276 THR A HG23   1 
ATOM   4571  N  N      . ALA A 1 277 ? 27.677  36.512  4.703   1.00 20.62  ? 277 ALA A N      1 
ATOM   4572  C  CA     . ALA A 1 277 ? 26.663  37.220  3.935   1.00 13.61  ? 277 ALA A CA     1 
ATOM   4573  C  C      . ALA A 1 277 ? 25.866  38.118  4.861   1.00 24.01  ? 277 ALA A C      1 
ATOM   4574  O  O      . ALA A 1 277 ? 25.066  37.636  5.661   1.00 28.03  ? 277 ALA A O      1 
ATOM   4575  C  CB     . ALA A 1 277 ? 25.741  36.240  3.229   1.00 23.26  ? 277 ALA A CB     1 
ATOM   4576  H  H      . ALA A 1 277 ? 27.413  35.749  5.001   1.00 24.74  ? 277 ALA A H      1 
ATOM   4577  H  HA     . ALA A 1 277 ? 27.093  37.774  3.265   1.00 16.34  ? 277 ALA A HA     1 
ATOM   4578  H  HB1    . ALA A 1 277 ? 25.077  36.738  2.727   1.00 27.92  ? 277 ALA A HB1    1 
ATOM   4579  H  HB2    . ALA A 1 277 ? 26.267  35.689  2.628   1.00 27.92  ? 277 ALA A HB2    1 
ATOM   4580  H  HB3    . ALA A 1 277 ? 25.305  35.683  3.893   1.00 27.92  ? 277 ALA A HB3    1 
ATOM   4581  N  N      . VAL A 1 278 ? 26.090  39.422  4.751   1.00 31.77  ? 278 VAL A N      1 
ATOM   4582  C  CA     . VAL A 1 278 ? 25.386  40.398  5.573   1.00 17.11  ? 278 VAL A CA     1 
ATOM   4583  C  C      . VAL A 1 278 ? 24.411  41.183  4.701   1.00 17.92  ? 278 VAL A C      1 
ATOM   4584  O  O      . VAL A 1 278 ? 24.817  41.887  3.779   1.00 26.98  ? 278 VAL A O      1 
ATOM   4585  C  CB     . VAL A 1 278 ? 26.357  41.370  6.263   1.00 9.96   ? 278 VAL A CB     1 
ATOM   4586  C  CG1    . VAL A 1 278 ? 25.611  42.253  7.254   1.00 17.01  ? 278 VAL A CG1    1 
ATOM   4587  C  CG2    . VAL A 1 278 ? 27.447  40.606  6.975   1.00 18.18  ? 278 VAL A CG2    1 
ATOM   4588  H  H      . VAL A 1 278 ? 26.651  39.771  4.202   1.00 38.12  ? 278 VAL A H      1 
ATOM   4589  H  HA     . VAL A 1 278 ? 24.879  39.935  6.258   1.00 20.54  ? 278 VAL A HA     1 
ATOM   4590  H  HB     . VAL A 1 278 ? 26.769  41.941  5.596   1.00 11.96  ? 278 VAL A HB     1 
ATOM   4591  H  HG11   . VAL A 1 278 ? 26.242  42.856  7.676   1.00 20.41  ? 278 VAL A HG11   1 
ATOM   4592  H  HG12   . VAL A 1 278 ? 24.935  42.760  6.777   1.00 20.41  ? 278 VAL A HG12   1 
ATOM   4593  H  HG13   . VAL A 1 278 ? 25.192  41.690  7.924   1.00 20.41  ? 278 VAL A HG13   1 
ATOM   4594  H  HG21   . VAL A 1 278 ? 28.047  41.237  7.402   1.00 21.81  ? 278 VAL A HG21   1 
ATOM   4595  H  HG22   . VAL A 1 278 ? 27.043  40.029  7.641   1.00 21.81  ? 278 VAL A HG22   1 
ATOM   4596  H  HG23   . VAL A 1 278 ? 27.933  40.074  6.326   1.00 21.81  ? 278 VAL A HG23   1 
ATOM   4597  N  N      . PHE A 1 279 ? 23.124  41.048  4.997   1.00 17.18  ? 279 PHE A N      1 
ATOM   4598  C  CA     . PHE A 1 279 ? 22.083  41.715  4.233   1.00 16.77  ? 279 PHE A CA     1 
ATOM   4599  C  C      . PHE A 1 279 ? 20.912  42.111  5.132   1.00 16.11  ? 279 PHE A C      1 
ATOM   4600  O  O      . PHE A 1 279 ? 20.774  41.608  6.245   1.00 14.65  ? 279 PHE A O      1 
ATOM   4601  C  CB     . PHE A 1 279 ? 21.606  40.810  3.103   1.00 23.12  ? 279 PHE A CB     1 
ATOM   4602  C  CG     . PHE A 1 279 ? 20.978  39.535  3.577   1.00 14.02  ? 279 PHE A CG     1 
ATOM   4603  C  CD1    . PHE A 1 279 ? 21.756  38.424  3.842   1.00 11.64  ? 279 PHE A CD1    1 
ATOM   4604  C  CD2    . PHE A 1 279 ? 19.611  39.449  3.755   1.00 13.71  ? 279 PHE A CD2    1 
ATOM   4605  C  CE1    . PHE A 1 279 ? 21.182  37.251  4.275   1.00 16.17  ? 279 PHE A CE1    1 
ATOM   4606  C  CE2    . PHE A 1 279 ? 19.031  38.281  4.187   1.00 13.07  ? 279 PHE A CE2    1 
ATOM   4607  C  CZ     . PHE A 1 279 ? 19.816  37.178  4.448   1.00 20.94  ? 279 PHE A CZ     1 
ATOM   4608  H  H      . PHE A 1 279 ? 22.826  40.569  5.646   1.00 20.62  ? 279 PHE A H      1 
ATOM   4609  H  HA     . PHE A 1 279 ? 22.447  42.523  3.838   1.00 20.13  ? 279 PHE A HA     1 
ATOM   4610  H  HB2    . PHE A 1 279 ? 20.946  41.287  2.576   1.00 27.74  ? 279 PHE A HB2    1 
ATOM   4611  H  HB3    . PHE A 1 279 ? 22.365  40.577  2.546   1.00 27.74  ? 279 PHE A HB3    1 
ATOM   4612  H  HD1    . PHE A 1 279 ? 22.678  38.469  3.725   1.00 13.97  ? 279 PHE A HD1    1 
ATOM   4613  H  HD2    . PHE A 1 279 ? 19.076  40.189  3.579   1.00 16.45  ? 279 PHE A HD2    1 
ATOM   4614  H  HE1    . PHE A 1 279 ? 21.714  36.508  4.451   1.00 19.40  ? 279 PHE A HE1    1 
ATOM   4615  H  HE2    . PHE A 1 279 ? 18.110  38.234  4.303   1.00 15.68  ? 279 PHE A HE2    1 
ATOM   4616  H  HZ     . PHE A 1 279 ? 19.425  36.387  4.742   1.00 25.12  ? 279 PHE A HZ     1 
ATOM   4617  N  N      . ALA A 1 280 ? 20.064  43.007  4.637   1.00 20.25  ? 280 ALA A N      1 
ATOM   4618  C  CA     . ALA A 1 280 ? 18.961  43.534  5.428   1.00 18.86  ? 280 ALA A CA     1 
ATOM   4619  C  C      . ALA A 1 280 ? 17.667  43.562  4.627   1.00 22.57  ? 280 ALA A C      1 
ATOM   4620  O  O      . ALA A 1 280 ? 17.689  43.635  3.404   1.00 15.43  ? 280 ALA A O      1 
ATOM   4621  C  CB     . ALA A 1 280 ? 19.300  44.928  5.931   1.00 17.24  ? 280 ALA A CB     1 
ATOM   4622  H  H      . ALA A 1 280 ? 20.107  43.327  3.840   1.00 24.30  ? 280 ALA A H      1 
ATOM   4623  H  HA     . ALA A 1 280 ? 18.824  42.962  6.200   1.00 22.63  ? 280 ALA A HA     1 
ATOM   4624  H  HB1    . ALA A 1 280 ? 18.556  45.263  6.456   1.00 20.69  ? 280 ALA A HB1    1 
ATOM   4625  H  HB2    . ALA A 1 280 ? 20.098  44.880  6.481   1.00 20.69  ? 280 ALA A HB2    1 
ATOM   4626  H  HB3    . ALA A 1 280 ? 19.457  45.508  5.170   1.00 20.69  ? 280 ALA A HB3    1 
ATOM   4627  N  N      . VAL A 1 281 ? 16.543  43.471  5.332   1.00 21.72  ? 281 VAL A N      1 
ATOM   4628  C  CA     . VAL A 1 281 ? 15.228  43.628  4.727   1.00 15.24  ? 281 VAL A CA     1 
ATOM   4629  C  C      . VAL A 1 281 ? 14.667  44.985  5.130   1.00 15.68  ? 281 VAL A C      1 
ATOM   4630  O  O      . VAL A 1 281 ? 14.441  45.241  6.310   1.00 25.70  ? 281 VAL A O      1 
ATOM   4631  C  CB     . VAL A 1 281 ? 14.263  42.508  5.156   1.00 16.16  ? 281 VAL A CB     1 
ATOM   4632  C  CG1    . VAL A 1 281 ? 12.901  42.681  4.491   1.00 18.74  ? 281 VAL A CG1    1 
ATOM   4633  C  CG2    . VAL A 1 281 ? 14.855  41.145  4.823   1.00 10.72  ? 281 VAL A CG2    1 
ATOM   4634  H  H      . VAL A 1 281 ? 16.518  43.315  6.177   1.00 26.07  ? 281 VAL A H      1 
ATOM   4635  H  HA     . VAL A 1 281 ? 15.312  43.606  3.761   1.00 18.29  ? 281 VAL A HA     1 
ATOM   4636  H  HB     . VAL A 1 281 ? 14.135  42.552  6.117   1.00 19.40  ? 281 VAL A HB     1 
ATOM   4637  H  HG11   . VAL A 1 281 ? 12.316  41.963  4.779   1.00 22.49  ? 281 VAL A HG11   1 
ATOM   4638  H  HG12   . VAL A 1 281 ? 12.529  43.537  4.753   1.00 22.49  ? 281 VAL A HG12   1 
ATOM   4639  H  HG13   . VAL A 1 281 ? 13.014  42.649  3.528   1.00 22.49  ? 281 VAL A HG13   1 
ATOM   4640  H  HG21   . VAL A 1 281 ? 14.233  40.455  5.101   1.00 12.87  ? 281 VAL A HG21   1 
ATOM   4641  H  HG22   . VAL A 1 281 ? 15.003  41.091  3.866   1.00 12.87  ? 281 VAL A HG22   1 
ATOM   4642  H  HG23   . VAL A 1 281 ? 15.696  41.043  5.295   1.00 12.87  ? 281 VAL A HG23   1 
ATOM   4643  N  N      . LYS A 1 282 ? 14.444  45.844  4.142   1.00 14.44  ? 282 LYS A N      1 
ATOM   4644  C  CA     . LYS A 1 282 ? 14.004  47.218  4.371   1.00 22.08  ? 282 LYS A CA     1 
ATOM   4645  C  C      . LYS A 1 282 ? 12.552  47.410  3.930   1.00 23.08  ? 282 LYS A C      1 
ATOM   4646  O  O      . LYS A 1 282 ? 12.178  46.996  2.838   1.00 32.51  ? 282 LYS A O      1 
ATOM   4647  C  CB     . LYS A 1 282 ? 14.926  48.184  3.620   1.00 18.02  ? 282 LYS A CB     1 
ATOM   4648  C  CG     . LYS A 1 282 ? 14.581  49.650  3.775   1.00 23.67  ? 282 LYS A CG     1 
ATOM   4649  C  CD     . LYS A 1 282 ? 15.612  50.522  3.077   1.00 28.85  ? 282 LYS A CD     1 
ATOM   4650  C  CE     . LYS A 1 282 ? 15.345  52.001  3.302   1.00 37.51  ? 282 LYS A CE     1 
ATOM   4651  N  NZ     . LYS A 1 282 ? 16.471  52.850  2.819   1.00 35.99  ? 282 LYS A NZ     1 
ATOM   4652  H  H      . LYS A 1 282 ? 14.542  45.650  3.310   1.00 17.32  ? 282 LYS A H      1 
ATOM   4653  H  HA     . LYS A 1 282 ? 14.062  47.418  5.318   1.00 26.49  ? 282 LYS A HA     1 
ATOM   4654  H  HB2    . LYS A 1 282 ? 15.832  48.061  3.945   1.00 21.63  ? 282 LYS A HB2    1 
ATOM   4655  H  HB3    . LYS A 1 282 ? 14.889  47.973  2.674   1.00 21.63  ? 282 LYS A HB3    1 
ATOM   4656  H  HG2    . LYS A 1 282 ? 13.714  49.822  3.375   1.00 28.40  ? 282 LYS A HG2    1 
ATOM   4657  H  HG3    . LYS A 1 282 ? 14.571  49.882  4.717   1.00 28.40  ? 282 LYS A HG3    1 
ATOM   4658  H  HD2    . LYS A 1 282 ? 16.493  50.316  3.426   1.00 34.63  ? 282 LYS A HD2    1 
ATOM   4659  H  HD3    . LYS A 1 282 ? 15.581  50.350  2.122   1.00 34.63  ? 282 LYS A HD3    1 
ATOM   4660  H  HE2    . LYS A 1 282 ? 14.544  52.258  2.818   1.00 45.02  ? 282 LYS A HE2    1 
ATOM   4661  H  HE3    . LYS A 1 282 ? 15.229  52.163  4.251   1.00 45.02  ? 282 LYS A HE3    1 
ATOM   4662  H  HZ1    . LYS A 1 282 ? 16.287  53.709  2.963   1.00 43.19  ? 282 LYS A HZ1    1 
ATOM   4663  H  HZ2    . LYS A 1 282 ? 17.219  52.637  3.252   1.00 43.19  ? 282 LYS A HZ2    1 
ATOM   4664  H  HZ3    . LYS A 1 282 ? 16.595  52.723  1.947   1.00 43.19  ? 282 LYS A HZ3    1 
ATOM   4665  N  N      . PHE A 1 283 ? 11.732  48.018  4.784   1.00 19.08  ? 283 PHE A N      1 
ATOM   4666  C  CA     . PHE A 1 283 ? 10.342  48.305  4.432   1.00 23.67  ? 283 PHE A CA     1 
ATOM   4667  C  C      . PHE A 1 283 ? 9.819   49.519  5.196   1.00 28.68  ? 283 PHE A C      1 
ATOM   4668  O  O      . PHE A 1 283 ? 10.448  49.983  6.145   1.00 24.44  ? 283 PHE A O      1 
ATOM   4669  C  CB     . PHE A 1 283 ? 9.455   47.090  4.706   1.00 22.00  ? 283 PHE A CB     1 
ATOM   4670  C  CG     . PHE A 1 283 ? 9.522   46.593  6.119   1.00 30.46  ? 283 PHE A CG     1 
ATOM   4671  C  CD1    . PHE A 1 283 ? 10.529  45.734  6.519   1.00 30.11  ? 283 PHE A CD1    1 
ATOM   4672  C  CD2    . PHE A 1 283 ? 8.571   46.981  7.046   1.00 26.30  ? 283 PHE A CD2    1 
ATOM   4673  C  CE1    . PHE A 1 283 ? 10.590  45.276  7.817   1.00 22.49  ? 283 PHE A CE1    1 
ATOM   4674  C  CE2    . PHE A 1 283 ? 8.628   46.526  8.342   1.00 22.74  ? 283 PHE A CE2    1 
ATOM   4675  C  CZ     . PHE A 1 283 ? 9.639   45.674  8.730   1.00 25.26  ? 283 PHE A CZ     1 
ATOM   4676  H  H      . PHE A 1 283 ? 11.955  48.274  5.574   1.00 22.90  ? 283 PHE A H      1 
ATOM   4677  H  HA     . PHE A 1 283 ? 10.292  48.504  3.484   1.00 28.41  ? 283 PHE A HA     1 
ATOM   4678  H  HB2    . PHE A 1 283 ? 8.533   47.328  4.519   1.00 26.40  ? 283 PHE A HB2    1 
ATOM   4679  H  HB3    . PHE A 1 283 ? 9.730   46.364  4.124   1.00 26.40  ? 283 PHE A HB3    1 
ATOM   4680  H  HD1    . PHE A 1 283 ? 11.174  45.465  5.906   1.00 36.13  ? 283 PHE A HD1    1 
ATOM   4681  H  HD2    . PHE A 1 283 ? 7.888   47.557  6.790   1.00 31.56  ? 283 PHE A HD2    1 
ATOM   4682  H  HE1    . PHE A 1 283 ? 11.273  44.700  8.076   1.00 26.99  ? 283 PHE A HE1    1 
ATOM   4683  H  HE2    . PHE A 1 283 ? 7.984   46.795  8.958   1.00 27.29  ? 283 PHE A HE2    1 
ATOM   4684  H  HZ     . PHE A 1 283 ? 9.677   45.365  9.606   1.00 30.31  ? 283 PHE A HZ     1 
ATOM   4685  N  N      . ARG A 1 284 ? 8.673   50.041  4.767   1.00 29.94  ? 284 ARG A N      1 
ATOM   4686  C  CA     . ARG A 1 284 ? 8.071   51.197  5.423   1.00 22.53  ? 284 ARG A CA     1 
ATOM   4687  C  C      . ARG A 1 284 ? 7.652   50.823  6.841   1.00 25.79  ? 284 ARG A C      1 
ATOM   4688  O  O      . ARG A 1 284 ? 7.009   49.796  7.046   1.00 30.72  ? 284 ARG A O      1 
ATOM   4689  C  CB     . ARG A 1 284 ? 6.856   51.695  4.633   1.00 31.90  ? 284 ARG A CB     1 
ATOM   4690  C  CG     . ARG A 1 284 ? 7.167   52.206  3.237   1.00 40.54  ? 284 ARG A CG     1 
ATOM   4691  C  CD     . ARG A 1 284 ? 7.760   53.600  3.258   1.00 49.02  ? 284 ARG A CD     1 
ATOM   4692  N  NE     . ARG A 1 284 ? 6.824   54.592  3.785   1.00 78.53  ? 284 ARG A NE     1 
ATOM   4693  C  CZ     . ARG A 1 284 ? 7.006   55.907  3.709   1.00 77.87  ? 284 ARG A CZ     1 
ATOM   4694  N  NH1    . ARG A 1 284 ? 8.089   56.397  3.120   1.00 52.97  ? 284 ARG A NH1    1 
ATOM   4695  N  NH2    . ARG A 1 284 ? 6.103   56.737  4.215   1.00 66.19  ? 284 ARG A NH2    1 
ATOM   4696  H  H      . ARG A 1 284 ? 8.224   49.743  4.097   1.00 35.92  ? 284 ARG A H      1 
ATOM   4697  H  HA     . ARG A 1 284 ? 8.720   51.915  5.473   1.00 27.04  ? 284 ARG A HA     1 
ATOM   4698  H  HB2    . ARG A 1 284 ? 6.225   50.964  4.543   1.00 38.28  ? 284 ARG A HB2    1 
ATOM   4699  H  HB3    . ARG A 1 284 ? 6.444   52.421  5.126   1.00 38.28  ? 284 ARG A HB3    1 
ATOM   4700  H  HG2    . ARG A 1 284 ? 7.807   51.612  2.816   1.00 48.65  ? 284 ARG A HG2    1 
ATOM   4701  H  HG3    . ARG A 1 284 ? 6.347   52.234  2.719   1.00 48.65  ? 284 ARG A HG3    1 
ATOM   4702  H  HD2    . ARG A 1 284 ? 8.549   53.601  3.822   1.00 58.82  ? 284 ARG A HD2    1 
ATOM   4703  H  HD3    . ARG A 1 284 ? 7.995   53.859  2.354   1.00 58.82  ? 284 ARG A HD3    1 
ATOM   4704  H  HE     . ARG A 1 284 ? 6.110   54.306  4.170   1.00 94.24  ? 284 ARG A HE     1 
ATOM   4705  H  HH11   . ARG A 1 284 ? 8.677   55.863  2.790   1.00 63.57  ? 284 ARG A HH11   1 
ATOM   4706  H  HH12   . ARG A 1 284 ? 8.204   57.247  3.071   1.00 63.57  ? 284 ARG A HH12   1 
ATOM   4707  H  HH21   . ARG A 1 284 ? 5.399   56.425  4.597   1.00 79.43  ? 284 ARG A HH21   1 
ATOM   4708  H  HH22   . ARG A 1 284 ? 6.223   57.587  4.163   1.00 79.43  ? 284 ARG A HH22   1 
ATOM   4709  N  N      . LYS A 1 285 ? 8.032   51.639  7.820   1.00 29.26  ? 285 LYS A N      1 
ATOM   4710  C  CA     . LYS A 1 285 ? 7.583   51.433  9.195   1.00 16.97  ? 285 LYS A CA     1 
ATOM   4711  C  C      . LYS A 1 285 ? 6.073   51.563  9.262   1.00 17.28  ? 285 LYS A C      1 
ATOM   4712  O  O      . LYS A 1 285 ? 5.527   52.584  8.843   1.00 30.23  ? 285 LYS A O      1 
ATOM   4713  C  CB     . LYS A 1 285 ? 8.239   52.445  10.142  1.00 28.64  ? 285 LYS A CB     1 
ATOM   4714  C  CG     . LYS A 1 285 ? 7.577   52.573  11.525  1.00 16.11  ? 285 LYS A CG     1 
ATOM   4715  C  CD     . LYS A 1 285 ? 8.328   53.583  12.386  1.00 30.33  ? 285 LYS A CD     1 
ATOM   4716  C  CE     . LYS A 1 285 ? 7.513   54.051  13.584  1.00 35.76  ? 285 LYS A CE     1 
ATOM   4717  N  NZ     . LYS A 1 285 ? 7.324   53.004  14.619  1.00 54.64  ? 285 LYS A NZ     1 
ATOM   4718  H  H      . LYS A 1 285 ? 8.548   52.319  7.715   1.00 35.11  ? 285 LYS A H      1 
ATOM   4719  H  HA     . LYS A 1 285 ? 7.827   50.540  9.483   1.00 20.36  ? 285 LYS A HA     1 
ATOM   4720  H  HB2    . LYS A 1 285 ? 9.161   52.181  10.283  1.00 34.37  ? 285 LYS A HB2    1 
ATOM   4721  H  HB3    . LYS A 1 285 ? 8.212   53.320  9.724   1.00 34.37  ? 285 LYS A HB3    1 
ATOM   4722  H  HG2    . LYS A 1 285 ? 6.663   52.880  11.419  1.00 19.33  ? 285 LYS A HG2    1 
ATOM   4723  H  HG3    . LYS A 1 285 ? 7.596   51.713  11.973  1.00 19.33  ? 285 LYS A HG3    1 
ATOM   4724  H  HD2    . LYS A 1 285 ? 9.142   53.172  12.717  1.00 36.40  ? 285 LYS A HD2    1 
ATOM   4725  H  HD3    . LYS A 1 285 ? 8.544   54.360  11.847  1.00 36.40  ? 285 LYS A HD3    1 
ATOM   4726  H  HE2    . LYS A 1 285 ? 7.968   54.800  13.999  1.00 42.92  ? 285 LYS A HE2    1 
ATOM   4727  H  HE3    . LYS A 1 285 ? 6.635   54.327  13.277  1.00 42.92  ? 285 LYS A HE3    1 
ATOM   4728  H  HZ1    . LYS A 1 285 ? 6.843   53.328  15.294  1.00 65.57  ? 285 LYS A HZ1    1 
ATOM   4729  H  HZ2    . LYS A 1 285 ? 6.898   52.305  14.270  1.00 65.57  ? 285 LYS A HZ2    1 
ATOM   4730  H  HZ3    . LYS A 1 285 ? 8.114   52.737  14.929  1.00 65.57  ? 285 LYS A HZ3    1 
ATOM   4731  N  N      . PRO A 1 286 ? 5.384   50.530  9.769   1.00 12.15  ? 286 PRO A N      1 
ATOM   4732  C  CA     . PRO A 1 286 ? 3.943   50.708  9.976   1.00 17.09  ? 286 PRO A CA     1 
ATOM   4733  C  C      . PRO A 1 286 ? 3.689   51.760  11.052  1.00 28.98  ? 286 PRO A C      1 
ATOM   4734  O  O      . PRO A 1 286 ? 4.451   51.833  12.017  1.00 34.77  ? 286 PRO A O      1 
ATOM   4735  C  CB     . PRO A 1 286 ? 3.466   49.321  10.419  1.00 12.87  ? 286 PRO A CB     1 
ATOM   4736  C  CG     . PRO A 1 286 ? 4.544   48.379  9.996   1.00 10.48  ? 286 PRO A CG     1 
ATOM   4737  C  CD     . PRO A 1 286 ? 5.817   49.157  10.074  1.00 10.48  ? 286 PRO A CD     1 
ATOM   4738  H  HA     . PRO A 1 286 ? 3.502   50.963  9.150   1.00 20.51  ? 286 PRO A HA     1 
ATOM   4739  H  HB2    . PRO A 1 286 ? 3.357   49.306  11.382  1.00 15.45  ? 286 PRO A HB2    1 
ATOM   4740  H  HB3    . PRO A 1 286 ? 2.631   49.106  9.975   1.00 15.45  ? 286 PRO A HB3    1 
ATOM   4741  H  HG2    . PRO A 1 286 ? 4.569   47.622  10.602  1.00 12.57  ? 286 PRO A HG2    1 
ATOM   4742  H  HG3    . PRO A 1 286 ? 4.379   48.085  9.087   1.00 12.57  ? 286 PRO A HG3    1 
ATOM   4743  H  HD2    . PRO A 1 286 ? 6.189   49.109  10.968  1.00 12.58  ? 286 PRO A HD2    1 
ATOM   4744  H  HD3    . PRO A 1 286 ? 6.447   48.844  9.407   1.00 12.58  ? 286 PRO A HD3    1 
ATOM   4745  N  N      . ASP A 1 287 ? 2.658   52.580  10.880  1.00 28.56  ? 287 ASP A N      1 
ATOM   4746  C  CA     . ASP A 1 287 ? 2.370   53.642  11.838  1.00 25.14  ? 287 ASP A CA     1 
ATOM   4747  C  C      . ASP A 1 287 ? 1.643   53.093  13.066  1.00 25.47  ? 287 ASP A C      1 
ATOM   4748  O  O      . ASP A 1 287 ? 0.428   53.242  13.190  1.00 30.99  ? 287 ASP A O      1 
ATOM   4749  C  CB     . ASP A 1 287 ? 1.543   54.752  11.184  1.00 27.87  ? 287 ASP A CB     1 
ATOM   4750  C  CG     . ASP A 1 287 ? 1.405   55.974  12.073  1.00 32.59  ? 287 ASP A CG     1 
ATOM   4751  O  OD1    . ASP A 1 287 ? 2.228   56.133  13.002  1.00 28.80  ? 287 ASP A OD1    1 
ATOM   4752  O  OD2    . ASP A 1 287 ? 0.477   56.777  11.840  1.00 35.86  ? 287 ASP A OD2    1 
ATOM   4753  H  H      . ASP A 1 287 ? 2.110   52.542  10.218  1.00 34.27  ? 287 ASP A H      1 
ATOM   4754  H  HA     . ASP A 1 287 ? 3.207   54.031  12.137  1.00 30.16  ? 287 ASP A HA     1 
ATOM   4755  H  HB2    . ASP A 1 287 ? 1.976   55.026  10.361  1.00 33.45  ? 287 ASP A HB2    1 
ATOM   4756  H  HB3    . ASP A 1 287 ? 0.653   54.415  10.996  1.00 33.45  ? 287 ASP A HB3    1 
ATOM   4757  N  N      . ILE A 1 288 ? 2.391   52.442  13.956  1.00 28.92  ? 288 ILE A N      1 
ATOM   4758  C  CA     . ILE A 1 288 ? 1.823   51.847  15.165  1.00 25.64  ? 288 ILE A CA     1 
ATOM   4759  C  C      . ILE A 1 288 ? 2.697   52.097  16.394  1.00 26.89  ? 288 ILE A C      1 
ATOM   4760  O  O      . ILE A 1 288 ? 3.871   52.459  16.279  1.00 20.93  ? 288 ILE A O      1 
ATOM   4761  C  CB     . ILE A 1 288 ? 1.621   50.336  14.996  1.00 17.23  ? 288 ILE A CB     1 
ATOM   4762  C  CG1    . ILE A 1 288 ? 2.922   49.679  14.533  1.00 14.31  ? 288 ILE A CG1    1 
ATOM   4763  C  CG2    . ILE A 1 288 ? 0.511   50.075  13.994  1.00 25.59  ? 288 ILE A CG2    1 
ATOM   4764  C  CD1    . ILE A 1 288 ? 2.866   48.169  14.485  1.00 16.37  ? 288 ILE A CD1    1 
ATOM   4765  H  H      . ILE A 1 288 ? 3.240   52.331  13.881  1.00 34.70  ? 288 ILE A H      1 
ATOM   4766  H  HA     . ILE A 1 288 ? 0.954   52.247  15.332  1.00 30.77  ? 288 ILE A HA     1 
ATOM   4767  H  HB     . ILE A 1 288 ? 1.365   49.957  15.851  1.00 20.68  ? 288 ILE A HB     1 
ATOM   4768  H  HG12   . ILE A 1 288 ? 3.132   49.996  13.641  1.00 17.18  ? 288 ILE A HG12   1 
ATOM   4769  H  HG13   . ILE A 1 288 ? 3.632   49.930  15.145  1.00 17.18  ? 288 ILE A HG13   1 
ATOM   4770  H  HG21   . ILE A 1 288 ? 0.394   49.117  13.896  1.00 30.71  ? 288 ILE A HG21   1 
ATOM   4771  H  HG22   . ILE A 1 288 ? -0.309  50.477  14.319  1.00 30.71  ? 288 ILE A HG22   1 
ATOM   4772  H  HG23   . ILE A 1 288 ? 0.757   50.467  13.141  1.00 30.71  ? 288 ILE A HG23   1 
ATOM   4773  H  HD11   . ILE A 1 288 ? 3.724   47.830  14.185  1.00 19.65  ? 288 ILE A HD11   1 
ATOM   4774  H  HD12   . ILE A 1 288 ? 2.670   47.832  15.374  1.00 19.65  ? 288 ILE A HD12   1 
ATOM   4775  H  HD13   . ILE A 1 288 ? 2.169   47.899  13.867  1.00 19.65  ? 288 ILE A HD13   1 
ATOM   4776  N  N      . VAL A 1 289 ? 2.112   51.895  17.571  1.00 31.77  ? 289 VAL A N      1 
ATOM   4777  C  CA     . VAL A 1 289 ? 2.812   52.134  18.827  1.00 24.58  ? 289 VAL A CA     1 
ATOM   4778  C  C      . VAL A 1 289 ? 3.930   51.116  18.994  1.00 28.74  ? 289 VAL A C      1 
ATOM   4779  O  O      . VAL A 1 289 ? 3.798   49.965  18.581  1.00 22.30  ? 289 VAL A O      1 
ATOM   4780  C  CB     . VAL A 1 289 ? 1.860   52.060  20.027  1.00 23.41  ? 289 VAL A CB     1 
ATOM   4781  C  CG1    . VAL A 1 289 ? 2.578   52.472  21.304  1.00 59.77  ? 289 VAL A CG1    1 
ATOM   4782  C  CG2    . VAL A 1 289 ? 0.651   52.950  19.797  1.00 36.97  ? 289 VAL A CG2    1 
ATOM   4783  H  H      . VAL A 1 289 ? 1.304   51.617  17.668  1.00 38.13  ? 289 VAL A H      1 
ATOM   4784  H  HA     . VAL A 1 289 ? 3.207   53.020  18.808  1.00 29.50  ? 289 VAL A HA     1 
ATOM   4785  H  HB     . VAL A 1 289 ? 1.550   51.147  20.133  1.00 28.09  ? 289 VAL A HB     1 
ATOM   4786  H  HG11   . VAL A 1 289 ? 1.957   52.416  22.047  1.00 71.72  ? 289 VAL A HG11   1 
ATOM   4787  H  HG12   . VAL A 1 289 ? 3.326   51.872  21.452  1.00 71.72  ? 289 VAL A HG12   1 
ATOM   4788  H  HG13   . VAL A 1 289 ? 2.897   53.382  21.206  1.00 71.72  ? 289 VAL A HG13   1 
ATOM   4789  H  HG21   . VAL A 1 289 ? 0.063   52.888  20.567  1.00 44.36  ? 289 VAL A HG21   1 
ATOM   4790  H  HG22   . VAL A 1 289 ? 0.950   53.865  19.682  1.00 44.36  ? 289 VAL A HG22   1 
ATOM   4791  H  HG23   . VAL A 1 289 ? 0.186   52.651  19.000  1.00 44.36  ? 289 VAL A HG23   1 
ATOM   4792  N  N      . ASP A 1 290 ? 5.025   51.547  19.610  1.00 22.55  ? 290 ASP A N      1 
ATOM   4793  C  CA     . ASP A 1 290 ? 6.220   50.723  19.735  1.00 14.85  ? 290 ASP A CA     1 
ATOM   4794  C  C      . ASP A 1 290 ? 5.933   49.341  20.305  1.00 14.57  ? 290 ASP A C      1 
ATOM   4795  O  O      . ASP A 1 290 ? 6.586   48.367  19.943  1.00 20.41  ? 290 ASP A O      1 
ATOM   4796  C  CB     . ASP A 1 290 ? 7.247   51.434  20.611  1.00 15.12  ? 290 ASP A CB     1 
ATOM   4797  C  CG     . ASP A 1 290 ? 8.038   52.468  19.847  1.00 34.13  ? 290 ASP A CG     1 
ATOM   4798  O  OD1    . ASP A 1 290 ? 7.525   52.965  18.821  1.00 51.53  ? 290 ASP A OD1    1 
ATOM   4799  O  OD2    . ASP A 1 290 ? 9.169   52.786  20.268  1.00 26.94  ? 290 ASP A OD2    1 
ATOM   4800  H  H      . ASP A 1 290 ? 5.101   52.325  19.969  1.00 27.05  ? 290 ASP A H      1 
ATOM   4801  H  HA     . ASP A 1 290 ? 6.611   50.605  18.856  1.00 17.82  ? 290 ASP A HA     1 
ATOM   4802  H  HB2    . ASP A 1 290 ? 6.787   51.883  21.338  1.00 18.14  ? 290 ASP A HB2    1 
ATOM   4803  H  HB3    . ASP A 1 290 ? 7.869   50.780  20.965  1.00 18.14  ? 290 ASP A HB3    1 
ATOM   4804  N  N      . ASP A 1 291 ? 4.941   49.252  21.180  1.00 16.67  ? 291 ASP A N      1 
ATOM   4805  C  CA     . ASP A 1 291 ? 4.677   48.012  21.896  1.00 18.80  ? 291 ASP A CA     1 
ATOM   4806  C  C      . ASP A 1 291 ? 3.961   46.964  21.040  1.00 21.03  ? 291 ASP A C      1 
ATOM   4807  O  O      . ASP A 1 291 ? 3.841   45.806  21.436  1.00 20.33  ? 291 ASP A O      1 
ATOM   4808  C  CB     . ASP A 1 291 ? 3.869   48.322  23.153  1.00 15.57  ? 291 ASP A CB     1 
ATOM   4809  C  CG     . ASP A 1 291 ? 4.503   49.424  23.985  1.00 27.29  ? 291 ASP A CG     1 
ATOM   4810  O  OD1    . ASP A 1 291 ? 5.519   49.148  24.659  1.00 19.28  ? 291 ASP A OD1    1 
ATOM   4811  O  OD2    . ASP A 1 291 ? 3.993   50.566  23.962  1.00 34.21  ? 291 ASP A OD2    1 
ATOM   4812  H  H      . ASP A 1 291 ? 4.406   49.896  21.377  1.00 20.01  ? 291 ASP A H      1 
ATOM   4813  H  HA     . ASP A 1 291 ? 5.523   47.631  22.178  1.00 22.56  ? 291 ASP A HA     1 
ATOM   4814  H  HB2    . ASP A 1 291 ? 2.980   48.612  22.896  1.00 18.69  ? 291 ASP A HB2    1 
ATOM   4815  H  HB3    . ASP A 1 291 ? 3.814   47.524  23.701  1.00 18.69  ? 291 ASP A HB3    1 
ATOM   4816  N  N      . ASN A 1 292 ? 3.510   47.370  19.858  1.00 24.90  ? 292 ASN A N      1 
ATOM   4817  C  CA     . ASN A 1 292 ? 2.947   46.444  18.882  1.00 18.53  ? 292 ASN A CA     1 
ATOM   4818  C  C      . ASN A 1 292 ? 3.990   46.131  17.824  1.00 27.95  ? 292 ASN A C      1 
ATOM   4819  O  O      . ASN A 1 292 ? 4.022   45.039  17.260  1.00 26.90  ? 292 ASN A O      1 
ATOM   4820  C  CB     . ASN A 1 292 ? 1.701   47.030  18.225  1.00 24.01  ? 292 ASN A CB     1 
ATOM   4821  C  CG     . ASN A 1 292 ? 0.629   47.389  19.224  1.00 20.87  ? 292 ASN A CG     1 
ATOM   4822  O  OD1    . ASN A 1 292 ? 0.322   46.615  20.128  1.00 31.02  ? 292 ASN A OD1    1 
ATOM   4823  N  ND2    . ASN A 1 292 ? 0.056   48.575  19.072  1.00 37.34  ? 292 ASN A ND2    1 
ATOM   4824  H  H      . ASN A 1 292 ? 3.518   48.188  19.595  1.00 29.88  ? 292 ASN A H      1 
ATOM   4825  H  HA     . ASN A 1 292 ? 2.701   45.616  19.325  1.00 22.24  ? 292 ASN A HA     1 
ATOM   4826  H  HB2    . ASN A 1 292 ? 1.946   47.836  17.745  1.00 28.82  ? 292 ASN A HB2    1 
ATOM   4827  H  HB3    . ASN A 1 292 ? 1.331   46.377  17.610  1.00 28.82  ? 292 ASN A HB3    1 
ATOM   4828  H  HD21   . ASN A 1 292 ? -0.560  48.828  19.616  1.00 44.81  ? 292 ASN A HD21   1 
ATOM   4829  H  HD22   . ASN A 1 292 ? 0.302   49.092  18.430  1.00 44.81  ? 292 ASN A HD22   1 
ATOM   4830  N  N      . LEU A 1 293 ? 4.836   47.119  17.557  1.00 23.83  ? 293 LEU A N      1 
ATOM   4831  C  CA     . LEU A 1 293 ? 5.838   47.025  16.509  1.00 19.30  ? 293 LEU A CA     1 
ATOM   4832  C  C      . LEU A 1 293 ? 6.915   46.003  16.846  1.00 20.10  ? 293 LEU A C      1 
ATOM   4833  O  O      . LEU A 1 293 ? 7.193   45.099  16.061  1.00 35.31  ? 293 LEU A O      1 
ATOM   4834  C  CB     . LEU A 1 293 ? 6.481   48.395  16.284  1.00 17.17  ? 293 LEU A CB     1 
ATOM   4835  C  CG     . LEU A 1 293 ? 7.565   48.500  15.212  1.00 17.56  ? 293 LEU A CG     1 
ATOM   4836  C  CD1    . LEU A 1 293 ? 6.998   48.182  13.840  1.00 15.12  ? 293 LEU A CD1    1 
ATOM   4837  C  CD2    . LEU A 1 293 ? 8.186   49.880  15.230  1.00 29.41  ? 293 LEU A CD2    1 
ATOM   4838  H  H      . LEU A 1 293 ? 4.848   47.868  17.979  1.00 28.59  ? 293 LEU A H      1 
ATOM   4839  H  HA     . LEU A 1 293 ? 5.410   46.751  15.682  1.00 23.16  ? 293 LEU A HA     1 
ATOM   4840  H  HB2    . LEU A 1 293 ? 5.779   49.019  16.039  1.00 20.60  ? 293 LEU A HB2    1 
ATOM   4841  H  HB3    . LEU A 1 293 ? 6.881   48.680  17.121  1.00 20.60  ? 293 LEU A HB3    1 
ATOM   4842  H  HG     . LEU A 1 293 ? 8.263   47.855  15.405  1.00 21.08  ? 293 LEU A HG     1 
ATOM   4843  H  HD11   . LEU A 1 293 ? 7.706   48.256  13.182  1.00 18.14  ? 293 LEU A HD11   1 
ATOM   4844  H  HD12   . LEU A 1 293 ? 6.645   47.279  13.847  1.00 18.14  ? 293 LEU A HD12   1 
ATOM   4845  H  HD13   . LEU A 1 293 ? 6.289   48.813  13.638  1.00 18.14  ? 293 LEU A HD13   1 
ATOM   4846  H  HD21   . LEU A 1 293 ? 8.870   49.927  14.544  1.00 35.29  ? 293 LEU A HD21   1 
ATOM   4847  H  HD22   . LEU A 1 293 ? 7.495   50.539  15.054  1.00 35.29  ? 293 LEU A HD22   1 
ATOM   4848  H  HD23   . LEU A 1 293 ? 8.580   50.038  16.102  1.00 35.29  ? 293 LEU A HD23   1 
ATOM   4849  N  N      . TYR A 1 294 ? 7.512   46.142  18.023  1.00 18.34  ? 294 TYR A N      1 
ATOM   4850  C  CA     . TYR A 1 294 ? 8.699   45.368  18.355  1.00 21.39  ? 294 TYR A CA     1 
ATOM   4851  C  C      . TYR A 1 294 ? 8.429   43.875  18.521  1.00 16.26  ? 294 TYR A C      1 
ATOM   4852  O  O      . TYR A 1 294 ? 9.239   43.059  18.090  1.00 21.47  ? 294 TYR A O      1 
ATOM   4853  C  CB     . TYR A 1 294 ? 9.355   45.949  19.610  1.00 10.21  ? 294 TYR A CB     1 
ATOM   4854  C  CG     . TYR A 1 294 ? 10.205  47.152  19.271  1.00 7.43   ? 294 TYR A CG     1 
ATOM   4855  C  CD1    . TYR A 1 294 ? 9.648   48.415  19.160  1.00 9.70   ? 294 TYR A CD1    1 
ATOM   4856  C  CD2    . TYR A 1 294 ? 11.557  47.012  19.008  1.00 16.30  ? 294 TYR A CD2    1 
ATOM   4857  C  CE1    . TYR A 1 294 ? 10.420  49.509  18.825  1.00 21.19  ? 294 TYR A CE1    1 
ATOM   4858  C  CE2    . TYR A 1 294 ? 12.337  48.099  18.674  1.00 22.76  ? 294 TYR A CE2    1 
ATOM   4859  C  CZ     . TYR A 1 294 ? 11.765  49.344  18.581  1.00 22.84  ? 294 TYR A CZ     1 
ATOM   4860  O  OH     . TYR A 1 294 ? 12.546  50.425  18.243  1.00 30.57  ? 294 TYR A OH     1 
ATOM   4861  H  H      . TYR A 1 294 ? 7.251   46.676  18.644  1.00 22.01  ? 294 TYR A H      1 
ATOM   4862  H  HA     . TYR A 1 294 ? 9.334   45.464  17.628  1.00 25.67  ? 294 TYR A HA     1 
ATOM   4863  H  HB2    . TYR A 1 294 ? 8.666   46.228  20.233  1.00 12.26  ? 294 TYR A HB2    1 
ATOM   4864  H  HB3    . TYR A 1 294 ? 9.925   45.277  20.015  1.00 12.26  ? 294 TYR A HB3    1 
ATOM   4865  H  HD1    . TYR A 1 294 ? 8.740   48.530  19.323  1.00 11.65  ? 294 TYR A HD1    1 
ATOM   4866  H  HD2    . TYR A 1 294 ? 11.949  46.171  19.068  1.00 19.56  ? 294 TYR A HD2    1 
ATOM   4867  H  HE1    . TYR A 1 294 ? 10.033  50.352  18.763  1.00 25.42  ? 294 TYR A HE1    1 
ATOM   4868  H  HE2    . TYR A 1 294 ? 13.245  47.989  18.508  1.00 27.32  ? 294 TYR A HE2    1 
ATOM   4869  H  HH     . TYR A 1 294 ? 13.341  50.179  18.123  1.00 36.68  ? 294 TYR A HH     1 
ATOM   4870  N  N      . PRO A 1 295 ? 7.291   43.504  19.122  1.00 13.00  ? 295 PRO A N      1 
ATOM   4871  C  CA     . PRO A 1 295 ? 6.969   42.074  19.125  1.00 21.68  ? 295 PRO A CA     1 
ATOM   4872  C  C      . PRO A 1 295 ? 6.850   41.499  17.711  1.00 27.65  ? 295 PRO A C      1 
ATOM   4873  O  O      . PRO A 1 295 ? 7.118   40.315  17.498  1.00 22.94  ? 295 PRO A O      1 
ATOM   4874  C  CB     . PRO A 1 295 ? 5.625   42.023  19.854  1.00 17.11  ? 295 PRO A CB     1 
ATOM   4875  C  CG     . PRO A 1 295 ? 5.631   43.206  20.726  1.00 17.78  ? 295 PRO A CG     1 
ATOM   4876  C  CD     . PRO A 1 295 ? 6.368   44.273  19.970  1.00 22.21  ? 295 PRO A CD     1 
ATOM   4877  H  HA     . PRO A 1 295 ? 7.631   41.575  19.628  1.00 26.02  ? 295 PRO A HA     1 
ATOM   4878  H  HB2    . PRO A 1 295 ? 4.901   42.073  19.211  1.00 20.53  ? 295 PRO A HB2    1 
ATOM   4879  H  HB3    . PRO A 1 295 ? 5.566   41.209  20.378  1.00 20.53  ? 295 PRO A HB3    1 
ATOM   4880  H  HG2    . PRO A 1 295 ? 4.718   43.483  20.903  1.00 21.33  ? 295 PRO A HG2    1 
ATOM   4881  H  HG3    . PRO A 1 295 ? 6.090   42.997  21.554  1.00 21.33  ? 295 PRO A HG3    1 
ATOM   4882  H  HD2    . PRO A 1 295 ? 5.753   44.787  19.423  1.00 26.65  ? 295 PRO A HD2    1 
ATOM   4883  H  HD3    . PRO A 1 295 ? 6.862   44.841  20.581  1.00 26.65  ? 295 PRO A HD3    1 
ATOM   4884  N  N      . GLN A 1 296 ? 6.457   42.338  16.758  1.00 22.01  ? 296 GLN A N      1 
ATOM   4885  C  CA     . GLN A 1 296 ? 6.297   41.905  15.376  1.00 16.66  ? 296 GLN A CA     1 
ATOM   4886  C  C      . GLN A 1 296 ? 7.619   41.874  14.620  1.00 21.69  ? 296 GLN A C      1 
ATOM   4887  O  O      . GLN A 1 296 ? 7.823   41.018  13.759  1.00 30.95  ? 296 GLN A O      1 
ATOM   4888  C  CB     . GLN A 1 296 ? 5.307   42.810  14.656  1.00 19.22  ? 296 GLN A CB     1 
ATOM   4889  C  CG     . GLN A 1 296 ? 3.884   42.639  15.144  1.00 25.11  ? 296 GLN A CG     1 
ATOM   4890  C  CD     . GLN A 1 296 ? 2.920   43.554  14.433  1.00 23.71  ? 296 GLN A CD     1 
ATOM   4891  O  OE1    . GLN A 1 296 ? 3.077   43.835  13.245  1.00 18.63  ? 296 GLN A OE1    1 
ATOM   4892  N  NE2    . GLN A 1 296 ? 1.916   44.030  15.155  1.00 29.20  ? 296 GLN A NE2    1 
ATOM   4893  H  H      . GLN A 1 296 ? 6.276   43.168  16.888  1.00 26.41  ? 296 GLN A H      1 
ATOM   4894  H  HA     . GLN A 1 296 ? 5.933   41.006  15.372  1.00 19.99  ? 296 GLN A HA     1 
ATOM   4895  H  HB2    . GLN A 1 296 ? 5.563   43.735  14.800  1.00 23.07  ? 296 GLN A HB2    1 
ATOM   4896  H  HB3    . GLN A 1 296 ? 5.324   42.606  13.708  1.00 23.07  ? 296 GLN A HB3    1 
ATOM   4897  H  HG2    . GLN A 1 296 ? 3.603   41.724  14.987  1.00 30.14  ? 296 GLN A HG2    1 
ATOM   4898  H  HG3    . GLN A 1 296 ? 3.847   42.841  16.092  1.00 30.14  ? 296 GLN A HG3    1 
ATOM   4899  H  HE21   . GLN A 1 296 ? 1.841   43.812  15.984  1.00 35.04  ? 296 GLN A HE21   1 
ATOM   4900  H  HE22   . GLN A 1 296 ? 1.339   44.556  14.795  1.00 35.04  ? 296 GLN A HE22   1 
ATOM   4901  N  N      . LEU A 1 297 ? 8.510   42.811  14.926  1.00 15.72  ? 297 LEU A N      1 
ATOM   4902  C  CA     . LEU A 1 297 ? 9.843   42.789  14.341  1.00 17.26  ? 297 LEU A CA     1 
ATOM   4903  C  C      . LEU A 1 297 ? 10.572  41.553  14.846  1.00 23.93  ? 297 LEU A C      1 
ATOM   4904  O  O      . LEU A 1 297 ? 11.329  40.921  14.112  1.00 22.70  ? 297 LEU A O      1 
ATOM   4905  C  CB     . LEU A 1 297 ? 10.630  44.053  14.691  1.00 14.49  ? 297 LEU A CB     1 
ATOM   4906  C  CG     . LEU A 1 297 ? 10.157  45.380  14.091  1.00 20.11  ? 297 LEU A CG     1 
ATOM   4907  C  CD1    . LEU A 1 297 ? 11.088  46.500  14.518  1.00 21.24  ? 297 LEU A CD1    1 
ATOM   4908  C  CD2    . LEU A 1 297 ? 10.065  45.323  12.572  1.00 18.24  ? 297 LEU A CD2    1 
ATOM   4909  H  H      . LEU A 1 297 ? 8.368   43.465  15.466  1.00 18.87  ? 297 LEU A H      1 
ATOM   4910  H  HA     . LEU A 1 297 ? 9.771   42.729  13.375  1.00 20.72  ? 297 LEU A HA     1 
ATOM   4911  H  HB2    . LEU A 1 297 ? 10.614  44.157  15.655  1.00 17.39  ? 297 LEU A HB2    1 
ATOM   4912  H  HB3    . LEU A 1 297 ? 11.547  43.923  14.401  1.00 17.39  ? 297 LEU A HB3    1 
ATOM   4913  H  HG     . LEU A 1 297 ? 9.272   45.582  14.434  1.00 24.14  ? 297 LEU A HG     1 
ATOM   4914  H  HD11   . LEU A 1 297 ? 10.778  47.334  14.132  1.00 25.48  ? 297 LEU A HD11   1 
ATOM   4915  H  HD12   . LEU A 1 297 ? 11.084  46.561  15.486  1.00 25.48  ? 297 LEU A HD12   1 
ATOM   4916  H  HD13   . LEU A 1 297 ? 11.984  46.302  14.202  1.00 25.48  ? 297 LEU A HD13   1 
ATOM   4917  H  HD21   . LEU A 1 297 ? 9.763   46.184  12.242  1.00 21.89  ? 297 LEU A HD21   1 
ATOM   4918  H  HD22   . LEU A 1 297 ? 10.942  45.120  12.211  1.00 21.89  ? 297 LEU A HD22   1 
ATOM   4919  H  HD23   . LEU A 1 297 ? 9.435   44.631  12.320  1.00 21.89  ? 297 LEU A HD23   1 
ATOM   4920  N  N      . GLU A 1 298 ? 10.333  41.211  16.108  1.00 20.56  ? 298 GLU A N      1 
ATOM   4921  C  CA     . GLU A 1 298 ? 10.896  40.001  16.682  1.00 12.36  ? 298 GLU A CA     1 
ATOM   4922  C  C      . GLU A 1 298 ? 10.402  38.786  15.918  1.00 11.95  ? 298 GLU A C      1 
ATOM   4923  O  O      . GLU A 1 298 ? 11.187  37.904  15.583  1.00 25.31  ? 298 GLU A O      1 
ATOM   4924  C  CB     . GLU A 1 298 ? 10.532  39.879  18.162  1.00 20.90  ? 298 GLU A CB     1 
ATOM   4925  C  CG     . GLU A 1 298 ? 11.333  40.783  19.087  1.00 24.84  ? 298 GLU A CG     1 
ATOM   4926  C  CD     . GLU A 1 298 ? 10.831  40.745  20.525  1.00 44.39  ? 298 GLU A CD     1 
ATOM   4927  O  OE1    . GLU A 1 298 ? 11.490  41.339  21.405  1.00 42.25  ? 298 GLU A OE1    1 
ATOM   4928  O  OE2    . GLU A 1 298 ? 9.784   40.112  20.778  1.00 44.73  ? 298 GLU A OE2    1 
ATOM   4929  H  H      . GLU A 1 298 ? 9.847   41.666  16.652  1.00 24.67  ? 298 GLU A H      1 
ATOM   4930  H  HA     . GLU A 1 298 ? 11.862  40.033  16.609  1.00 14.83  ? 298 GLU A HA     1 
ATOM   4931  H  HB2    . GLU A 1 298 ? 9.595   40.104  18.270  1.00 25.08  ? 298 GLU A HB2    1 
ATOM   4932  H  HB3    . GLU A 1 298 ? 10.683  38.963  18.443  1.00 25.08  ? 298 GLU A HB3    1 
ATOM   4933  H  HG2    . GLU A 1 298 ? 12.260  40.496  19.085  1.00 29.80  ? 298 GLU A HG2    1 
ATOM   4934  H  HG3    . GLU A 1 298 ? 11.268  41.698  18.770  1.00 29.80  ? 298 GLU A HG3    1 
ATOM   4935  N  N      . ARG A 1 299 ? 9.105   38.750  15.629  1.00 15.35  ? 299 ARG A N      1 
ATOM   4936  C  CA     . ARG A 1 299 ? 8.513   37.607  14.938  1.00 23.80  ? 299 ARG A CA     1 
ATOM   4937  C  C      . ARG A 1 299 ? 9.037   37.508  13.517  1.00 24.61  ? 299 ARG A C      1 
ATOM   4938  O  O      . ARG A 1 299 ? 9.511   36.454  13.090  1.00 20.35  ? 299 ARG A O      1 
ATOM   4939  C  CB     . ARG A 1 299 ? 6.989   37.706  14.907  1.00 19.24  ? 299 ARG A CB     1 
ATOM   4940  C  CG     . ARG A 1 299 ? 6.337   36.611  14.071  1.00 18.44  ? 299 ARG A CG     1 
ATOM   4941  C  CD     . ARG A 1 299 ? 4.828   36.733  14.027  1.00 23.55  ? 299 ARG A CD     1 
ATOM   4942  N  NE     . ARG A 1 299 ? 4.253   35.749  13.114  1.00 14.50  ? 299 ARG A NE     1 
ATOM   4943  C  CZ     . ARG A 1 299 ? 4.018   34.478  13.428  1.00 20.33  ? 299 ARG A CZ     1 
ATOM   4944  N  NH1    . ARG A 1 299 ? 4.294   34.022  14.643  1.00 36.58  ? 299 ARG A NH1    1 
ATOM   4945  N  NH2    . ARG A 1 299 ? 3.497   33.658  12.528  1.00 34.18  ? 299 ARG A NH2    1 
ATOM   4946  H  H      . ARG A 1 299 ? 8.545   39.374  15.822  1.00 18.42  ? 299 ARG A H      1 
ATOM   4947  H  HA     . ARG A 1 299 ? 8.754   36.793  15.406  1.00 28.56  ? 299 ARG A HA     1 
ATOM   4948  H  HB2    . ARG A 1 299 ? 6.650   37.633  15.812  1.00 23.08  ? 299 ARG A HB2    1 
ATOM   4949  H  HB3    . ARG A 1 299 ? 6.736   38.562  14.527  1.00 23.08  ? 299 ARG A HB3    1 
ATOM   4950  H  HG2    . ARG A 1 299 ? 6.670   36.667  13.162  1.00 22.13  ? 299 ARG A HG2    1 
ATOM   4951  H  HG3    . ARG A 1 299 ? 6.558   35.747  14.454  1.00 22.13  ? 299 ARG A HG3    1 
ATOM   4952  H  HD2    . ARG A 1 299 ? 4.467   36.576  14.914  1.00 28.26  ? 299 ARG A HD2    1 
ATOM   4953  H  HD3    . ARG A 1 299 ? 4.586   37.619  13.715  1.00 28.26  ? 299 ARG A HD3    1 
ATOM   4954  H  HE     . ARG A 1 299 ? 4.052   36.009  12.319  1.00 17.40  ? 299 ARG A HE     1 
ATOM   4955  H  HH11   . ARG A 1 299 ? 4.634   34.548  15.233  1.00 43.89  ? 299 ARG A HH11   1 
ATOM   4956  H  HH12   . ARG A 1 299 ? 4.138   33.199  14.839  1.00 43.89  ? 299 ARG A HH12   1 
ATOM   4957  H  HH21   . ARG A 1 299 ? 3.313   33.947  11.739  1.00 41.01  ? 299 ARG A HH21   1 
ATOM   4958  H  HH22   . ARG A 1 299 ? 3.342   32.837  12.732  1.00 41.01  ? 299 ARG A HH22   1 
ATOM   4959  N  N      . ALA A 1 300 ? 8.926   38.611  12.785  1.00 24.93  ? 300 ALA A N      1 
ATOM   4960  C  CA     . ALA A 1 300 ? 9.373   38.659  11.403  1.00 26.94  ? 300 ALA A CA     1 
ATOM   4961  C  C      . ALA A 1 300 ? 10.834  38.234  11.298  1.00 23.63  ? 300 ALA A C      1 
ATOM   4962  O  O      . ALA A 1 300 ? 11.192  37.404  10.464  1.00 21.42  ? 300 ALA A O      1 
ATOM   4963  C  CB     . ALA A 1 300 ? 9.183   40.055  10.838  1.00 23.55  ? 300 ALA A CB     1 
ATOM   4964  H  H      . ALA A 1 300 ? 8.591   39.350  13.070  1.00 29.92  ? 300 ALA A H      1 
ATOM   4965  H  HA     . ALA A 1 300 ? 8.840   38.044  10.874  1.00 32.33  ? 300 ALA A HA     1 
ATOM   4966  H  HB1    . ALA A 1 300 ? 9.486   40.067  9.917   1.00 28.26  ? 300 ALA A HB1    1 
ATOM   4967  H  HB2    . ALA A 1 300 ? 8.242   40.287  10.880  1.00 28.26  ? 300 ALA A HB2    1 
ATOM   4968  H  HB3    . ALA A 1 300 ? 9.702   40.682  11.366  1.00 28.26  ? 300 ALA A HB3    1 
ATOM   4969  N  N      . SER A 1 301 ? 11.667  38.789  12.170  1.00 17.73  ? 301 SER A N      1 
ATOM   4970  C  CA     . SER A 1 301 ? 13.086  38.472  12.171  1.00 14.40  ? 301 SER A CA     1 
ATOM   4971  C  C      . SER A 1 301 ? 13.306  36.986  12.424  1.00 23.63  ? 301 SER A C      1 
ATOM   4972  O  O      . SER A 1 301 ? 14.189  36.371  11.830  1.00 26.48  ? 301 SER A O      1 
ATOM   4973  C  CB     . SER A 1 301 ? 13.816  39.305  13.224  1.00 12.06  ? 301 SER A CB     1 
ATOM   4974  O  OG     . SER A 1 301 ? 15.218  39.143  13.116  1.00 27.86  ? 301 SER A OG     1 
ATOM   4975  H  H      . SER A 1 301 ? 11.433  39.354  12.775  1.00 21.27  ? 301 SER A H      1 
ATOM   4976  H  HA     . SER A 1 301 ? 13.460  38.689  11.303  1.00 17.28  ? 301 SER A HA     1 
ATOM   4977  H  HB2    . SER A 1 301 ? 13.596  40.240  13.095  1.00 14.47  ? 301 SER A HB2    1 
ATOM   4978  H  HB3    . SER A 1 301 ? 13.533  39.016  14.106  1.00 14.47  ? 301 SER A HB3    1 
ATOM   4979  H  HG     . SER A 1 301 ? 15.606  39.605  13.699  1.00 33.44  ? 301 SER A HG     1 
ATOM   4980  N  N      . ARG A 1 302 ? 12.492  36.410  13.300  1.00 26.77  ? 302 ARG A N      1 
ATOM   4981  C  CA     . ARG A 1 302 ? 12.633  35.005  13.651  1.00 16.61  ? 302 ARG A CA     1 
ATOM   4982  C  C      . ARG A 1 302 ? 12.196  34.103  12.504  1.00 18.98  ? 302 ARG A C      1 
ATOM   4983  O  O      . ARG A 1 302 ? 12.889  33.145  12.176  1.00 24.87  ? 302 ARG A O      1 
ATOM   4984  C  CB     . ARG A 1 302 ? 11.838  34.692  14.922  1.00 23.42  ? 302 ARG A CB     1 
ATOM   4985  C  CG     . ARG A 1 302 ? 11.950  33.245  15.398  1.00 37.79  ? 302 ARG A CG     1 
ATOM   4986  C  CD     . ARG A 1 302 ? 11.259  33.032  16.740  1.00 30.79  ? 302 ARG A CD     1 
ATOM   4987  N  NE     . ARG A 1 302 ? 9.855   33.443  16.716  1.00 34.62  ? 302 ARG A NE     1 
ATOM   4988  C  CZ     . ARG A 1 302 ? 9.396   34.601  17.193  1.00 53.80  ? 302 ARG A CZ     1 
ATOM   4989  N  NH1    . ARG A 1 302 ? 10.220  35.483  17.750  1.00 28.13  ? 302 ARG A NH1    1 
ATOM   4990  N  NH2    . ARG A 1 302 ? 8.099   34.881  17.120  1.00 45.47  ? 302 ARG A NH2    1 
ATOM   4991  H  H      . ARG A 1 302 ? 11.850  36.813  13.707  1.00 32.12  ? 302 ARG A H      1 
ATOM   4992  H  HA     . ARG A 1 302 ? 13.568  34.821  13.833  1.00 19.94  ? 302 ARG A HA     1 
ATOM   4993  H  HB2    . ARG A 1 302 ? 12.159  35.263  15.637  1.00 28.10  ? 302 ARG A HB2    1 
ATOM   4994  H  HB3    . ARG A 1 302 ? 10.900  34.875  14.754  1.00 28.10  ? 302 ARG A HB3    1 
ATOM   4995  H  HG2    . ARG A 1 302 ? 11.532  32.662  14.746  1.00 45.35  ? 302 ARG A HG2    1 
ATOM   4996  H  HG3    . ARG A 1 302 ? 12.887  33.015  15.500  1.00 45.35  ? 302 ARG A HG3    1 
ATOM   4997  H  HD2    . ARG A 1 302 ? 11.293  32.090  16.968  1.00 36.95  ? 302 ARG A HD2    1 
ATOM   4998  H  HD3    . ARG A 1 302 ? 11.714  33.555  17.418  1.00 36.95  ? 302 ARG A HD3    1 
ATOM   4999  H  HE     . ARG A 1 302 ? 9.286   32.900  16.370  1.00 41.54  ? 302 ARG A HE     1 
ATOM   5000  H  HH11   . ARG A 1 302 ? 11.061  35.313  17.802  1.00 33.75  ? 302 ARG A HH11   1 
ATOM   5001  H  HH12   . ARG A 1 302 ? 9.912   36.226  18.055  1.00 33.75  ? 302 ARG A HH12   1 
ATOM   5002  H  HH21   . ARG A 1 302 ? 7.557   34.316  16.764  1.00 54.57  ? 302 ARG A HH21   1 
ATOM   5003  H  HH22   . ARG A 1 302 ? 7.802   35.626  17.430  1.00 54.57  ? 302 ARG A HH22   1 
ATOM   5004  N  N      . LYS A 1 303 ? 11.068  34.418  11.877  1.00 21.25  ? 303 LYS A N      1 
ATOM   5005  C  CA     . LYS A 1 303 ? 10.552  33.589  10.788  1.00 24.30  ? 303 LYS A CA     1 
ATOM   5006  C  C      . LYS A 1 303 ? 11.547  33.476  9.637   1.00 21.19  ? 303 LYS A C      1 
ATOM   5007  O  O      . LYS A 1 303 ? 11.736  32.395  9.078   1.00 20.26  ? 303 LYS A O      1 
ATOM   5008  C  CB     . LYS A 1 303 ? 9.225   34.147  10.268  1.00 21.83  ? 303 LYS A CB     1 
ATOM   5009  C  CG     . LYS A 1 303 ? 8.018   33.834  11.138  1.00 19.47  ? 303 LYS A CG     1 
ATOM   5010  C  CD     . LYS A 1 303 ? 7.773   32.333  11.217  1.00 30.58  ? 303 LYS A CD     1 
ATOM   5011  C  CE     . LYS A 1 303 ? 6.402   32.012  11.783  1.00 39.16  ? 303 LYS A CE     1 
ATOM   5012  N  NZ     . LYS A 1 303 ? 6.222   30.549  11.996  1.00 42.25  ? 303 LYS A NZ     1 
ATOM   5013  H  H      . LYS A 1 303 ? 10.582  35.103  12.060  1.00 25.50  ? 303 LYS A H      1 
ATOM   5014  H  HA     . LYS A 1 303 ? 10.387  32.695  11.127  1.00 29.17  ? 303 LYS A HA     1 
ATOM   5015  H  HB2    . LYS A 1 303 ? 9.299   35.112  10.206  1.00 26.20  ? 303 LYS A HB2    1 
ATOM   5016  H  HB3    . LYS A 1 303 ? 9.056   33.776  9.388   1.00 26.20  ? 303 LYS A HB3    1 
ATOM   5017  H  HG2    . LYS A 1 303 ? 8.174   34.165  12.037  1.00 23.36  ? 303 LYS A HG2    1 
ATOM   5018  H  HG3    . LYS A 1 303 ? 7.230   34.253  10.757  1.00 23.36  ? 303 LYS A HG3    1 
ATOM   5019  H  HD2    . LYS A 1 303 ? 7.829   31.954  10.326  1.00 36.70  ? 303 LYS A HD2    1 
ATOM   5020  H  HD3    . LYS A 1 303 ? 8.441   31.931  11.794  1.00 36.70  ? 303 LYS A HD3    1 
ATOM   5021  H  HE2    . LYS A 1 303 ? 6.297   32.458  12.637  1.00 46.99  ? 303 LYS A HE2    1 
ATOM   5022  H  HE3    . LYS A 1 303 ? 5.722   32.313  11.161  1.00 46.99  ? 303 LYS A HE3    1 
ATOM   5023  H  HZ1    . LYS A 1 303 ? 5.412   30.387  12.328  1.00 50.70  ? 303 LYS A HZ1    1 
ATOM   5024  H  HZ2    . LYS A 1 303 ? 6.310   30.116  11.224  1.00 50.70  ? 303 LYS A HZ2    1 
ATOM   5025  H  HZ3    . LYS A 1 303 ? 6.834   30.247  12.568  1.00 50.70  ? 303 LYS A HZ3    1 
ATOM   5026  N  N      . ILE A 1 304 ? 12.170  34.596  9.284   1.00 22.53  ? 304 ILE A N      1 
ATOM   5027  C  CA     . ILE A 1 304 ? 13.196  34.618  8.247   1.00 23.19  ? 304 ILE A CA     1 
ATOM   5028  C  C      . ILE A 1 304 ? 14.442  33.875  8.715   1.00 25.42  ? 304 ILE A C      1 
ATOM   5029  O  O      . ILE A 1 304 ? 15.086  33.170  7.938   1.00 22.66  ? 304 ILE A O      1 
ATOM   5030  C  CB     . ILE A 1 304 ? 13.577  36.063  7.868   1.00 14.21  ? 304 ILE A CB     1 
ATOM   5031  C  CG1    . ILE A 1 304 ? 12.380  36.769  7.234   1.00 14.68  ? 304 ILE A CG1    1 
ATOM   5032  C  CG2    . ILE A 1 304 ? 14.777  36.083  6.919   1.00 6.58   ? 304 ILE A CG2    1 
ATOM   5033  C  CD1    . ILE A 1 304 ? 12.591  38.247  7.004   1.00 18.31  ? 304 ILE A CD1    1 
ATOM   5034  H  H      . ILE A 1 304 ? 12.013  35.366  9.634   1.00 27.03  ? 304 ILE A H      1 
ATOM   5035  H  HA     . ILE A 1 304 ? 12.858  34.175  7.454   1.00 27.83  ? 304 ILE A HA     1 
ATOM   5036  H  HB     . ILE A 1 304 ? 13.819  36.538  8.677   1.00 17.05  ? 304 ILE A HB     1 
ATOM   5037  H  HG12   . ILE A 1 304 ? 12.195  36.360  6.374   1.00 17.61  ? 304 ILE A HG12   1 
ATOM   5038  H  HG13   . ILE A 1 304 ? 11.612  36.667  7.818   1.00 17.61  ? 304 ILE A HG13   1 
ATOM   5039  H  HG21   . ILE A 1 304 ? 14.991  37.003  6.700   1.00 7.90   ? 304 ILE A HG21   1 
ATOM   5040  H  HG22   . ILE A 1 304 ? 15.533  35.663  7.358   1.00 7.90   ? 304 ILE A HG22   1 
ATOM   5041  H  HG23   . ILE A 1 304 ? 14.549  35.595  6.112   1.00 7.90   ? 304 ILE A HG23   1 
ATOM   5042  H  HD11   . ILE A 1 304 ? 11.791  38.621  6.602   1.00 21.97  ? 304 ILE A HD11   1 
ATOM   5043  H  HD12   . ILE A 1 304 ? 12.765  38.676  7.857   1.00 21.97  ? 304 ILE A HD12   1 
ATOM   5044  H  HD13   . ILE A 1 304 ? 13.349  38.369  6.411   1.00 21.97  ? 304 ILE A HD13   1 
ATOM   5045  N  N      . PHE A 1 305 ? 14.779  34.042  9.990   1.00 24.67  ? 305 PHE A N      1 
ATOM   5046  C  CA     . PHE A 1 305 ? 15.946  33.383  10.561  1.00 19.75  ? 305 PHE A CA     1 
ATOM   5047  C  C      . PHE A 1 305 ? 15.779  31.869  10.500  1.00 23.43  ? 305 PHE A C      1 
ATOM   5048  O  O      . PHE A 1 305 ? 16.680  31.154  10.064  1.00 24.28  ? 305 PHE A O      1 
ATOM   5049  C  CB     . PHE A 1 305 ? 16.172  33.840  12.005  1.00 19.19  ? 305 PHE A CB     1 
ATOM   5050  C  CG     . PHE A 1 305 ? 17.424  33.288  12.625  1.00 19.28  ? 305 PHE A CG     1 
ATOM   5051  C  CD1    . PHE A 1 305 ? 17.418  32.053  13.253  1.00 22.28  ? 305 PHE A CD1    1 
ATOM   5052  C  CD2    . PHE A 1 305 ? 18.610  33.999  12.573  1.00 21.63  ? 305 PHE A CD2    1 
ATOM   5053  C  CE1    . PHE A 1 305 ? 18.570  31.542  13.819  1.00 27.21  ? 305 PHE A CE1    1 
ATOM   5054  C  CE2    . PHE A 1 305 ? 19.767  33.492  13.138  1.00 28.34  ? 305 PHE A CE2    1 
ATOM   5055  C  CZ     . PHE A 1 305 ? 19.746  32.263  13.760  1.00 25.57  ? 305 PHE A CZ     1 
ATOM   5056  H  H      . PHE A 1 305 ? 14.346  34.534  10.547  1.00 29.60  ? 305 PHE A H      1 
ATOM   5057  H  HA     . PHE A 1 305 ? 16.731  33.621  10.043  1.00 23.70  ? 305 PHE A HA     1 
ATOM   5058  H  HB2    . PHE A 1 305 ? 16.235  34.808  12.020  1.00 23.02  ? 305 PHE A HB2    1 
ATOM   5059  H  HB3    . PHE A 1 305 ? 15.421  33.550  12.545  1.00 23.02  ? 305 PHE A HB3    1 
ATOM   5060  H  HD1    . PHE A 1 305 ? 16.629  31.563  13.294  1.00 26.73  ? 305 PHE A HD1    1 
ATOM   5061  H  HD2    . PHE A 1 305 ? 18.630  34.829  12.153  1.00 25.96  ? 305 PHE A HD2    1 
ATOM   5062  H  HE1    . PHE A 1 305 ? 18.554  30.713  14.239  1.00 32.65  ? 305 PHE A HE1    1 
ATOM   5063  H  HE2    . PHE A 1 305 ? 20.557  33.980  13.097  1.00 34.00  ? 305 PHE A HE2    1 
ATOM   5064  H  HZ     . PHE A 1 305 ? 20.522  31.921  14.142  1.00 30.68  ? 305 PHE A HZ     1 
ATOM   5065  N  N      . GLU A 1 306 ? 14.613  31.392  10.926  1.00 25.98  ? 306 GLU A N      1 
ATOM   5066  C  CA     . GLU A 1 306 ? 14.296  29.970  10.893  1.00 21.65  ? 306 GLU A CA     1 
ATOM   5067  C  C      . GLU A 1 306 ? 14.312  29.445  9.465   1.00 28.66  ? 306 GLU A C      1 
ATOM   5068  O  O      . GLU A 1 306 ? 14.747  28.322  9.208   1.00 29.70  ? 306 GLU A O      1 
ATOM   5069  C  CB     . GLU A 1 306 ? 12.927  29.715  11.517  1.00 24.20  ? 306 GLU A CB     1 
ATOM   5070  C  CG     . GLU A 1 306 ? 12.856  29.983  13.004  1.00 20.35  ? 306 GLU A CG     1 
ATOM   5071  C  CD     . GLU A 1 306 ? 11.450  29.838  13.544  1.00 39.03  ? 306 GLU A CD     1 
ATOM   5072  O  OE1    . GLU A 1 306 ? 10.493  29.872  12.738  1.00 40.10  ? 306 GLU A OE1    1 
ATOM   5073  O  OE2    . GLU A 1 306 ? 11.301  29.693  14.776  1.00 41.40  ? 306 GLU A OE2    1 
ATOM   5074  H  H      . GLU A 1 306 ? 13.981  31.880  11.244  1.00 31.18  ? 306 GLU A H      1 
ATOM   5075  H  HA     . GLU A 1 306 ? 14.960  29.481  11.405  1.00 25.98  ? 306 GLU A HA     1 
ATOM   5076  H  HB2    . GLU A 1 306 ? 12.276  30.289  11.083  1.00 29.04  ? 306 GLU A HB2    1 
ATOM   5077  H  HB3    . GLU A 1 306 ? 12.689  28.786  11.374  1.00 29.04  ? 306 GLU A HB3    1 
ATOM   5078  H  HG2    . GLU A 1 306 ? 13.424  29.349  13.468  1.00 24.41  ? 306 GLU A HG2    1 
ATOM   5079  H  HG3    . GLU A 1 306 ? 13.154  30.889  13.178  1.00 24.41  ? 306 GLU A HG3    1 
ATOM   5080  N  N      . PHE A 1 307 ? 13.820  30.265  8.541   1.00 29.22  ? 307 PHE A N      1 
ATOM   5081  C  CA     . PHE A 1 307 ? 13.823  29.928  7.124   1.00 22.31  ? 307 PHE A CA     1 
ATOM   5082  C  C      . PHE A 1 307 ? 15.244  29.718  6.607   1.00 22.90  ? 307 PHE A C      1 
ATOM   5083  O  O      . PHE A 1 307 ? 15.512  28.757  5.887   1.00 26.44  ? 307 PHE A O      1 
ATOM   5084  C  CB     . PHE A 1 307 ? 13.119  31.031  6.328   1.00 25.76  ? 307 PHE A CB     1 
ATOM   5085  C  CG     . PHE A 1 307 ? 13.521  31.096  4.883   1.00 24.31  ? 307 PHE A CG     1 
ATOM   5086  C  CD1    . PHE A 1 307 ? 12.917  30.279  3.945   1.00 21.27  ? 307 PHE A CD1    1 
ATOM   5087  C  CD2    . PHE A 1 307 ? 14.494  31.988  4.460   1.00 25.35  ? 307 PHE A CD2    1 
ATOM   5088  C  CE1    . PHE A 1 307 ? 13.281  30.342  2.617   1.00 24.75  ? 307 PHE A CE1    1 
ATOM   5089  C  CE2    . PHE A 1 307 ? 14.862  32.055  3.135   1.00 25.06  ? 307 PHE A CE2    1 
ATOM   5090  C  CZ     . PHE A 1 307 ? 14.253  31.232  2.211   1.00 25.49  ? 307 PHE A CZ     1 
ATOM   5091  H  H      . PHE A 1 307 ? 13.474  31.034  8.714   1.00 35.07  ? 307 PHE A H      1 
ATOM   5092  H  HA     . PHE A 1 307 ? 13.331  29.103  6.995   1.00 26.77  ? 307 PHE A HA     1 
ATOM   5093  H  HB2    . PHE A 1 307 ? 12.162  30.876  6.362   1.00 30.91  ? 307 PHE A HB2    1 
ATOM   5094  H  HB3    . PHE A 1 307 ? 13.327  31.888  6.732   1.00 30.91  ? 307 PHE A HB3    1 
ATOM   5095  H  HD1    . PHE A 1 307 ? 12.260  29.678  4.214   1.00 25.52  ? 307 PHE A HD1    1 
ATOM   5096  H  HD2    . PHE A 1 307 ? 14.907  32.545  5.080   1.00 30.42  ? 307 PHE A HD2    1 
ATOM   5097  H  HE1    . PHE A 1 307 ? 12.870  29.785  1.996   1.00 29.70  ? 307 PHE A HE1    1 
ATOM   5098  H  HE2    . PHE A 1 307 ? 15.518  32.655  2.863   1.00 30.08  ? 307 PHE A HE2    1 
ATOM   5099  H  HZ     . PHE A 1 307 ? 14.500  31.274  1.315   1.00 30.58  ? 307 PHE A HZ     1 
ATOM   5100  N  N      . LEU A 1 308 ? 16.156  30.603  6.995   1.00 21.10  ? 308 LEU A N      1 
ATOM   5101  C  CA     . LEU A 1 308 ? 17.536  30.525  6.529   1.00 16.80  ? 308 LEU A CA     1 
ATOM   5102  C  C      . LEU A 1 308 ? 18.216  29.251  7.032   1.00 17.10  ? 308 LEU A C      1 
ATOM   5103  O  O      . LEU A 1 308 ? 19.059  28.684  6.336   1.00 20.49  ? 308 LEU A O      1 
ATOM   5104  C  CB     . LEU A 1 308 ? 18.333  31.764  6.958   1.00 16.20  ? 308 LEU A CB     1 
ATOM   5105  C  CG     . LEU A 1 308 ? 18.046  33.049  6.169   1.00 22.22  ? 308 LEU A CG     1 
ATOM   5106  C  CD1    . LEU A 1 308 ? 18.608  34.272  6.873   1.00 13.54  ? 308 LEU A CD1    1 
ATOM   5107  C  CD2    . LEU A 1 308 ? 18.608  32.958  4.757   1.00 16.75  ? 308 LEU A CD2    1 
ATOM   5108  H  H      . LEU A 1 308 ? 16.000  31.260  7.528   1.00 25.32  ? 308 LEU A H      1 
ATOM   5109  H  HA     . LEU A 1 308 ? 17.536  30.496  5.560   1.00 20.16  ? 308 LEU A HA     1 
ATOM   5110  H  HB2    . LEU A 1 308 ? 18.135  31.947  7.890   1.00 19.44  ? 308 LEU A HB2    1 
ATOM   5111  H  HB3    . LEU A 1 308 ? 19.278  31.569  6.861   1.00 19.44  ? 308 LEU A HB3    1 
ATOM   5112  H  HG     . LEU A 1 308 ? 17.086  33.164  6.098   1.00 26.66  ? 308 LEU A HG     1 
ATOM   5113  H  HD11   . LEU A 1 308 ? 18.407  35.060  6.345   1.00 16.25  ? 308 LEU A HD11   1 
ATOM   5114  H  HD12   . LEU A 1 308 ? 18.199  34.347  7.749   1.00 16.25  ? 308 LEU A HD12   1 
ATOM   5115  H  HD13   . LEU A 1 308 ? 19.569  34.170  6.964   1.00 16.25  ? 308 LEU A HD13   1 
ATOM   5116  H  HD21   . LEU A 1 308 ? 18.411  33.783  4.285   1.00 20.09  ? 308 LEU A HD21   1 
ATOM   5117  H  HD22   . LEU A 1 308 ? 19.568  32.826  4.807   1.00 20.09  ? 308 LEU A HD22   1 
ATOM   5118  H  HD23   . LEU A 1 308 ? 18.194  32.209  4.300   1.00 20.09  ? 308 LEU A HD23   1 
ATOM   5119  N  N      . GLU A 1 309 ? 17.851  28.806  8.234   1.00 25.33  ? 309 GLU A N      1 
ATOM   5120  C  CA     . GLU A 1 309 ? 18.454  27.610  8.830   1.00 28.43  ? 309 GLU A CA     1 
ATOM   5121  C  C      . GLU A 1 309 ? 18.082  26.343  8.073   1.00 23.95  ? 309 GLU A C      1 
ATOM   5122  O  O      . GLU A 1 309 ? 18.951  25.560  7.693   1.00 28.61  ? 309 GLU A O      1 
ATOM   5123  C  CB     . GLU A 1 309 ? 18.018  27.450  10.293  1.00 18.30  ? 309 GLU A CB     1 
ATOM   5124  C  CG     . GLU A 1 309 ? 18.631  28.449  11.266  1.00 54.48  ? 309 GLU A CG     1 
ATOM   5125  C  CD     . GLU A 1 309 ? 18.203  28.215  12.715  1.00 76.49  ? 309 GLU A CD     1 
ATOM   5126  O  OE1    . GLU A 1 309 ? 16.981  28.190  12.991  1.00 49.14  ? 309 GLU A OE1    1 
ATOM   5127  O  OE2    . GLU A 1 309 ? 19.094  28.062  13.580  1.00 66.99  ? 309 GLU A OE2    1 
ATOM   5128  H  H      . GLU A 1 309 ? 17.255  29.180  8.728   1.00 30.40  ? 309 GLU A H      1 
ATOM   5129  H  HA     . GLU A 1 309 ? 19.420  27.700  8.812   1.00 34.11  ? 309 GLU A HA     1 
ATOM   5130  H  HB2    . GLU A 1 309 ? 17.054  27.551  10.340  1.00 21.96  ? 309 GLU A HB2    1 
ATOM   5131  H  HB3    . GLU A 1 309 ? 18.266  26.561  10.592  1.00 21.96  ? 309 GLU A HB3    1 
ATOM   5132  H  HG2    . GLU A 1 309 ? 19.597  28.376  11.224  1.00 65.38  ? 309 GLU A HG2    1 
ATOM   5133  H  HG3    . GLU A 1 309 ? 18.355  29.344  11.013  1.00 65.38  ? 309 GLU A HG3    1 
ATOM   5134  N  N      . ARG A 1 310 ? 16.787  26.145  7.855   1.00 19.31  ? 310 ARG A N      1 
ATOM   5135  C  CA     . ARG A 1 310 ? 16.309  24.921  7.228   1.00 21.18  ? 310 ARG A CA     1 
ATOM   5136  C  C      . ARG A 1 310 ? 16.639  24.904  5.746   1.00 23.72  ? 310 ARG A C      1 
ATOM   5137  O  O      . ARG A 1 310 ? 16.456  23.889  5.073   1.00 42.39  ? 310 ARG A O      1 
ATOM   5138  C  CB     . ARG A 1 310 ? 14.804  24.753  7.456   1.00 22.42  ? 310 ARG A CB     1 
ATOM   5139  C  CG     . ARG A 1 310 ? 13.918  25.771  6.770   1.00 18.70  ? 310 ARG A CG     1 
ATOM   5140  C  CD     . ARG A 1 310 ? 12.457  25.404  6.975   1.00 24.71  ? 310 ARG A CD     1 
ATOM   5141  N  NE     . ARG A 1 310 ? 11.540  26.388  6.404   1.00 35.92  ? 310 ARG A NE     1 
ATOM   5142  C  CZ     . ARG A 1 310 ? 11.055  27.438  7.060   1.00 35.29  ? 310 ARG A CZ     1 
ATOM   5143  N  NH1    . ARG A 1 310 ? 11.401  27.663  8.321   1.00 33.71  ? 310 ARG A NH1    1 
ATOM   5144  N  NH2    . ARG A 1 310 ? 10.222  28.272  6.451   1.00 49.34  ? 310 ARG A NH2    1 
ATOM   5145  H  H      . ARG A 1 310 ? 16.166  26.703  8.061   1.00 23.17  ? 310 ARG A H      1 
ATOM   5146  H  HA     . ARG A 1 310 ? 16.757  24.165  7.639   1.00 25.42  ? 310 ARG A HA     1 
ATOM   5147  H  HB2    . ARG A 1 310 ? 14.542  23.876  7.134   1.00 26.90  ? 310 ARG A HB2    1 
ATOM   5148  H  HB3    . ARG A 1 310 ? 14.631  24.812  8.409   1.00 26.90  ? 310 ARG A HB3    1 
ATOM   5149  H  HG2    . ARG A 1 310 ? 14.073  26.648  7.154   1.00 22.43  ? 310 ARG A HG2    1 
ATOM   5150  H  HG3    . ARG A 1 310 ? 14.105  25.777  5.819   1.00 22.43  ? 310 ARG A HG3    1 
ATOM   5151  H  HD2    . ARG A 1 310 ? 12.284  24.550  6.549   1.00 29.65  ? 310 ARG A HD2    1 
ATOM   5152  H  HD3    . ARG A 1 310 ? 12.277  25.343  7.926   1.00 29.65  ? 310 ARG A HD3    1 
ATOM   5153  H  HE     . ARG A 1 310 ? 11.297  26.280  5.586   1.00 43.11  ? 310 ARG A HE     1 
ATOM   5154  H  HH11   . ARG A 1 310 ? 11.940  27.125  8.721   1.00 40.45  ? 310 ARG A HH11   1 
ATOM   5155  H  HH12   . ARG A 1 310 ? 11.085  28.345  8.739   1.00 40.45  ? 310 ARG A HH12   1 
ATOM   5156  H  HH21   . ARG A 1 310 ? 9.996   28.133  5.633   1.00 59.20  ? 310 ARG A HH21   1 
ATOM   5157  H  HH22   . ARG A 1 310 ? 9.911   28.954  6.874   1.00 59.20  ? 310 ARG A HH22   1 
ATOM   5158  N  N      . GLU A 1 311 ? 17.139  26.028  5.247   1.00 22.65  ? 311 GLU A N      1 
ATOM   5159  C  CA     . GLU A 1 311 ? 17.598  26.112  3.871   1.00 20.05  ? 311 GLU A CA     1 
ATOM   5160  C  C      . GLU A 1 311 ? 19.121  26.018  3.818   1.00 26.16  ? 311 GLU A C      1 
ATOM   5161  O  O      . GLU A 1 311 ? 19.733  26.229  2.772   1.00 31.09  ? 311 GLU A O      1 
ATOM   5162  C  CB     . GLU A 1 311 ? 17.110  27.409  3.237   1.00 16.05  ? 311 GLU A CB     1 
ATOM   5163  C  CG     . GLU A 1 311 ? 16.707  27.270  1.786   1.00 44.17  ? 311 GLU A CG     1 
ATOM   5164  C  CD     . GLU A 1 311 ? 15.497  26.373  1.585   1.00 41.73  ? 311 GLU A CD     1 
ATOM   5165  O  OE1    . GLU A 1 311 ? 14.549  26.452  2.394   1.00 30.35  ? 311 GLU A OE1    1 
ATOM   5166  O  OE2    . GLU A 1 311 ? 15.499  25.586  0.615   1.00 46.17  ? 311 GLU A OE2    1 
ATOM   5167  H  H      . GLU A 1 311 ? 17.224  26.760  5.690   1.00 27.17  ? 311 GLU A H      1 
ATOM   5168  H  HA     . GLU A 1 311 ? 17.230  25.371  3.366   1.00 24.06  ? 311 GLU A HA     1 
ATOM   5169  H  HB2    . GLU A 1 311 ? 16.337  27.727  3.730   1.00 19.26  ? 311 GLU A HB2    1 
ATOM   5170  H  HB3    . GLU A 1 311 ? 17.822  28.067  3.285   1.00 19.26  ? 311 GLU A HB3    1 
ATOM   5171  H  HG2    . GLU A 1 311 ? 16.490  28.148  1.434   1.00 53.00  ? 311 GLU A HG2    1 
ATOM   5172  H  HG3    . GLU A 1 311 ? 17.448  26.889  1.289   1.00 53.00  ? 311 GLU A HG3    1 
ATOM   5173  N  N      . ASN A 1 312 ? 19.718  25.698  4.963   1.00 28.32  ? 312 ASN A N      1 
ATOM   5174  C  CA     . ASN A 1 312 ? 21.147  25.410  5.065   1.00 31.46  ? 312 ASN A CA     1 
ATOM   5175  C  C      . ASN A 1 312 ? 22.058  26.579  4.690   1.00 22.44  ? 312 ASN A C      1 
ATOM   5176  O  O      . ASN A 1 312 ? 23.172  26.367  4.207   1.00 17.52  ? 312 ASN A O      1 
ATOM   5177  C  CB     . ASN A 1 312 ? 21.490  24.190  4.203   1.00 21.68  ? 312 ASN A CB     1 
ATOM   5178  C  CG     . ASN A 1 312 ? 20.732  22.949  4.630   1.00 19.27  ? 312 ASN A CG     1 
ATOM   5179  O  OD1    . ASN A 1 312 ? 20.061  22.306  3.822   1.00 38.46  ? 312 ASN A OD1    1 
ATOM   5180  N  ND2    . ASN A 1 312 ? 20.832  22.609  5.908   1.00 25.99  ? 312 ASN A ND2    1 
ATOM   5181  H  H      . ASN A 1 312 ? 19.305  25.641  5.715   1.00 33.98  ? 312 ASN A H      1 
ATOM   5182  H  HA     . ASN A 1 312 ? 21.343  25.177  5.986   1.00 37.76  ? 312 ASN A HA     1 
ATOM   5183  H  HB2    . ASN A 1 312 ? 21.261  24.380  3.280   1.00 26.02  ? 312 ASN A HB2    1 
ATOM   5184  H  HB3    . ASN A 1 312 ? 22.439  24.005  4.279   1.00 26.02  ? 312 ASN A HB3    1 
ATOM   5185  H  HD21   . ASN A 1 312 ? 20.421  21.913  6.201   1.00 31.19  ? 312 ASN A HD21   1 
ATOM   5186  H  HD22   . ASN A 1 312 ? 21.307  23.085  6.444   1.00 31.19  ? 312 ASN A HD22   1 
ATOM   5187  N  N      . PHE A 1 313 ? 21.601  27.805  4.928   1.00 17.86  ? 313 PHE A N      1 
ATOM   5188  C  CA     . PHE A 1 313 ? 22.458  28.975  4.740   1.00 23.48  ? 313 PHE A CA     1 
ATOM   5189  C  C      . PHE A 1 313 ? 23.239  29.289  6.017   1.00 24.89  ? 313 PHE A C      1 
ATOM   5190  O  O      . PHE A 1 313 ? 24.043  30.220  6.042   1.00 18.79  ? 313 PHE A O      1 
ATOM   5191  C  CB     . PHE A 1 313 ? 21.643  30.196  4.314   1.00 17.90  ? 313 PHE A CB     1 
ATOM   5192  C  CG     . PHE A 1 313 ? 21.112  30.109  2.913   1.00 25.01  ? 313 PHE A CG     1 
ATOM   5193  C  CD1    . PHE A 1 313 ? 21.969  30.191  1.829   1.00 21.94  ? 313 PHE A CD1    1 
ATOM   5194  C  CD2    . PHE A 1 313 ? 19.757  29.954  2.679   1.00 28.80  ? 313 PHE A CD2    1 
ATOM   5195  C  CE1    . PHE A 1 313 ? 21.485  30.110  0.537   1.00 19.08  ? 313 PHE A CE1    1 
ATOM   5196  C  CE2    . PHE A 1 313 ? 19.266  29.874  1.390   1.00 21.01  ? 313 PHE A CE2    1 
ATOM   5197  C  CZ     . PHE A 1 313 ? 20.132  29.954  0.318   1.00 25.78  ? 313 PHE A CZ     1 
ATOM   5198  H  H      . PHE A 1 313 ? 20.805  27.988  5.197   1.00 21.44  ? 313 PHE A H      1 
ATOM   5199  H  HA     . PHE A 1 313 ? 23.100  28.784  4.038   1.00 28.17  ? 313 PHE A HA     1 
ATOM   5200  H  HB2    . PHE A 1 313 ? 20.885  30.291  4.912   1.00 21.48  ? 313 PHE A HB2    1 
ATOM   5201  H  HB3    . PHE A 1 313 ? 22.206  30.984  4.369   1.00 21.48  ? 313 PHE A HB3    1 
ATOM   5202  H  HD1    . PHE A 1 313 ? 22.882  30.296  1.971   1.00 26.33  ? 313 PHE A HD1    1 
ATOM   5203  H  HD2    . PHE A 1 313 ? 19.170  29.899  3.398   1.00 34.56  ? 313 PHE A HD2    1 
ATOM   5204  H  HE1    . PHE A 1 313 ? 22.070  30.165  -0.184  1.00 22.90  ? 313 PHE A HE1    1 
ATOM   5205  H  HE2    . PHE A 1 313 ? 18.353  29.768  1.244   1.00 25.21  ? 313 PHE A HE2    1 
ATOM   5206  H  HZ     . PHE A 1 313 ? 19.804  29.901  -0.551  1.00 30.93  ? 313 PHE A HZ     1 
ATOM   5207  N  N      . MET A 1 314 ? 22.994  28.508  7.067   1.00 26.84  ? 314 MET A N      1 
ATOM   5208  C  CA     . MET A 1 314 ? 23.746  28.610  8.316   1.00 24.56  ? 314 MET A CA     1 
ATOM   5209  C  C      . MET A 1 314 ? 23.838  30.040  8.819   1.00 20.74  ? 314 MET A C      1 
ATOM   5210  O  O      . MET A 1 314 ? 24.893  30.665  8.720   1.00 27.38  ? 314 MET A O      1 
ATOM   5211  C  CB     . MET A 1 314 ? 25.154  28.046  8.140   1.00 18.51  ? 314 MET A CB     1 
ATOM   5212  C  CG     . MET A 1 314 ? 25.183  26.582  7.764   1.00 20.61  ? 314 MET A CG     1 
ATOM   5213  S  SD     . MET A 1 314 ? 26.850  25.909  7.797   1.00 42.45  ? 314 MET A SD     1 
ATOM   5214  C  CE     . MET A 1 314 ? 27.201  25.942  9.557   1.00 21.87  ? 314 MET A CE     1 
ATOM   5215  H  H      . MET A 1 314 ? 22.385  27.901  7.081   1.00 32.21  ? 314 MET A H      1 
ATOM   5216  H  HA     . MET A 1 314 ? 23.298  28.075  8.989   1.00 29.47  ? 314 MET A HA     1 
ATOM   5217  H  HB2    . MET A 1 314 ? 25.604  28.541  7.438   1.00 22.22  ? 314 MET A HB2    1 
ATOM   5218  H  HB3    . MET A 1 314 ? 25.638  28.147  8.975   1.00 22.22  ? 314 MET A HB3    1 
ATOM   5219  H  HG2    . MET A 1 314 ? 24.642  26.081  8.395   1.00 24.74  ? 314 MET A HG2    1 
ATOM   5220  H  HG3    . MET A 1 314 ? 24.832  26.477  6.866   1.00 24.74  ? 314 MET A HG3    1 
ATOM   5221  H  HE1    . MET A 1 314 ? 28.094  25.595  9.707   1.00 26.24  ? 314 MET A HE1    1 
ATOM   5222  H  HE2    . MET A 1 314 ? 27.144  26.858  9.873   1.00 26.24  ? 314 MET A HE2    1 
ATOM   5223  H  HE3    . MET A 1 314 ? 26.549  25.391  10.019  1.00 26.24  ? 314 MET A HE3    1 
ATOM   5224  N  N      . PRO A 1 315 ? 22.733  30.564  9.361   1.00 17.96  ? 315 PRO A N      1 
ATOM   5225  C  CA     . PRO A 1 315 ? 22.718  31.938  9.860   1.00 20.96  ? 315 PRO A CA     1 
ATOM   5226  C  C      . PRO A 1 315 ? 23.359  32.049  11.241  1.00 22.73  ? 315 PRO A C      1 
ATOM   5227  O  O      . PRO A 1 315 ? 23.247  31.122  12.043  1.00 37.16  ? 315 PRO A O      1 
ATOM   5228  C  CB     . PRO A 1 315 ? 21.224  32.281  9.908   1.00 16.29  ? 315 PRO A CB     1 
ATOM   5229  C  CG     . PRO A 1 315 ? 20.484  30.988  9.650   1.00 15.66  ? 315 PRO A CG     1 
ATOM   5230  C  CD     . PRO A 1 315 ? 21.470  29.875  9.655   1.00 19.13  ? 315 PRO A CD     1 
ATOM   5231  H  HA     . PRO A 1 315 ? 23.170  32.532  9.241   1.00 25.16  ? 315 PRO A HA     1 
ATOM   5232  H  HB2    . PRO A 1 315 ? 21.000  32.632  10.785  1.00 19.54  ? 315 PRO A HB2    1 
ATOM   5233  H  HB3    . PRO A 1 315 ? 21.019  32.933  9.219   1.00 19.54  ? 315 PRO A HB3    1 
ATOM   5234  H  HG2    . PRO A 1 315 ? 19.826  30.854  10.351  1.00 18.79  ? 315 PRO A HG2    1 
ATOM   5235  H  HG3    . PRO A 1 315 ? 20.044  31.040  8.787   1.00 18.79  ? 315 PRO A HG3    1 
ATOM   5236  H  HD2    . PRO A 1 315 ? 21.506  29.456  10.529  1.00 22.95  ? 315 PRO A HD2    1 
ATOM   5237  H  HD3    . PRO A 1 315 ? 21.262  29.233  8.958   1.00 22.95  ? 315 PRO A HD3    1 
ATOM   5238  N  N      . LEU A 1 316 ? 24.029  33.166  11.503  1.00 17.82  ? 316 LEU A N      1 
ATOM   5239  C  CA     . LEU A 1 316 ? 24.695  33.386  12.782  1.00 20.72  ? 316 LEU A CA     1 
ATOM   5240  C  C      . LEU A 1 316 ? 23.779  34.096  13.776  1.00 14.68  ? 316 LEU A C      1 
ATOM   5241  O  O      . LEU A 1 316 ? 23.339  33.495  14.753  1.00 21.46  ? 316 LEU A O      1 
ATOM   5242  C  CB     . LEU A 1 316 ? 25.977  34.196  12.581  1.00 30.11  ? 316 LEU A CB     1 
ATOM   5243  C  CG     . LEU A 1 316 ? 27.079  33.507  11.771  1.00 25.15  ? 316 LEU A CG     1 
ATOM   5244  C  CD1    . LEU A 1 316 ? 28.132  34.509  11.340  1.00 24.82  ? 316 LEU A CD1    1 
ATOM   5245  C  CD2    . LEU A 1 316 ? 27.712  32.385  12.576  1.00 25.52  ? 316 LEU A CD2    1 
ATOM   5246  H  H      . LEU A 1 316 ? 24.114  33.819  10.950  1.00 21.38  ? 316 LEU A H      1 
ATOM   5247  H  HA     . LEU A 1 316 ? 24.940  32.528  13.162  1.00 24.86  ? 316 LEU A HA     1 
ATOM   5248  H  HB2    . LEU A 1 316 ? 25.750  35.019  12.120  1.00 36.13  ? 316 LEU A HB2    1 
ATOM   5249  H  HB3    . LEU A 1 316 ? 26.347  34.405  13.453  1.00 36.13  ? 316 LEU A HB3    1 
ATOM   5250  H  HG     . LEU A 1 316 ? 26.688  33.119  10.972  1.00 30.18  ? 316 LEU A HG     1 
ATOM   5251  H  HD11   . LEU A 1 316 ? 28.817  34.048  10.830  1.00 29.78  ? 316 LEU A HD11   1 
ATOM   5252  H  HD12   . LEU A 1 316 ? 27.714  35.191  10.792  1.00 29.78  ? 316 LEU A HD12   1 
ATOM   5253  H  HD13   . LEU A 1 316 ? 28.524  34.914  12.130  1.00 29.78  ? 316 LEU A HD13   1 
ATOM   5254  H  HD21   . LEU A 1 316 ? 28.405  31.966  12.042  1.00 30.63  ? 316 LEU A HD21   1 
ATOM   5255  H  HD22   . LEU A 1 316 ? 28.097  32.757  13.385  1.00 30.63  ? 316 LEU A HD22   1 
ATOM   5256  H  HD23   . LEU A 1 316 ? 27.029  31.735  12.803  1.00 30.63  ? 316 LEU A HD23   1 
ATOM   5257  N  N      . ARG A 1 317 ? 23.491  35.370  13.525  1.00 14.93  ? 317 ARG A N      1 
ATOM   5258  C  CA     . ARG A 1 317 ? 22.578  36.129  14.375  1.00 24.63  ? 317 ARG A CA     1 
ATOM   5259  C  C      . ARG A 1 317 ? 21.586  36.948  13.555  1.00 25.31  ? 317 ARG A C      1 
ATOM   5260  O  O      . ARG A 1 317 ? 21.769  37.149  12.353  1.00 19.63  ? 317 ARG A O      1 
ATOM   5261  C  CB     . ARG A 1 317 ? 23.353  37.056  15.314  1.00 19.54  ? 317 ARG A CB     1 
ATOM   5262  C  CG     . ARG A 1 317 ? 24.239  36.330  16.309  1.00 24.60  ? 317 ARG A CG     1 
ATOM   5263  C  CD     . ARG A 1 317 ? 24.819  37.291  17.333  1.00 25.14  ? 317 ARG A CD     1 
ATOM   5264  N  NE     . ARG A 1 317 ? 23.847  37.616  18.375  1.00 39.77  ? 317 ARG A NE     1 
ATOM   5265  C  CZ     . ARG A 1 317 ? 23.984  38.603  19.256  1.00 32.27  ? 317 ARG A CZ     1 
ATOM   5266  N  NH1    . ARG A 1 317 ? 25.055  39.385  19.231  1.00 9.54   ? 317 ARG A NH1    1 
ATOM   5267  N  NH2    . ARG A 1 317 ? 23.040  38.812  20.162  1.00 37.53  ? 317 ARG A NH2    1 
ATOM   5268  H  H      . ARG A 1 317 ? 23.813  35.820  12.866  1.00 17.92  ? 317 ARG A H      1 
ATOM   5269  H  HA     . ARG A 1 317 ? 22.070  35.508  14.921  1.00 29.56  ? 317 ARG A HA     1 
ATOM   5270  H  HB2    . ARG A 1 317 ? 23.920  37.635  14.781  1.00 23.45  ? 317 ARG A HB2    1 
ATOM   5271  H  HB3    . ARG A 1 317 ? 22.719  37.590  15.817  1.00 23.45  ? 317 ARG A HB3    1 
ATOM   5272  H  HG2    . ARG A 1 317 ? 23.714  35.664  16.780  1.00 29.52  ? 317 ARG A HG2    1 
ATOM   5273  H  HG3    . ARG A 1 317 ? 24.973  35.908  15.837  1.00 29.52  ? 317 ARG A HG3    1 
ATOM   5274  H  HD2    . ARG A 1 317 ? 25.591  36.881  17.755  1.00 30.17  ? 317 ARG A HD2    1 
ATOM   5275  H  HD3    . ARG A 1 317 ? 25.076  38.114  16.890  1.00 30.17  ? 317 ARG A HD3    1 
ATOM   5276  H  HE     . ARG A 1 317 ? 23.135  37.135  18.421  1.00 47.72  ? 317 ARG A HE     1 
ATOM   5277  H  HH11   . ARG A 1 317 ? 25.670  39.253  18.644  1.00 11.44  ? 317 ARG A HH11   1 
ATOM   5278  H  HH12   . ARG A 1 317 ? 25.137  40.022  19.803  1.00 11.44  ? 317 ARG A HH12   1 
ATOM   5279  H  HH21   . ARG A 1 317 ? 22.343  38.308  20.181  1.00 45.03  ? 317 ARG A HH21   1 
ATOM   5280  H  HH22   . ARG A 1 317 ? 23.125  39.450  20.732  1.00 45.03  ? 317 ARG A HH22   1 
ATOM   5281  N  N      . SER A 1 318 ? 20.527  37.399  14.222  1.00 23.84  ? 318 SER A N      1 
ATOM   5282  C  CA     . SER A 1 318 ? 19.541  38.282  13.616  1.00 20.13  ? 318 SER A CA     1 
ATOM   5283  C  C      . SER A 1 318 ? 19.469  39.571  14.414  1.00 23.15  ? 318 SER A C      1 
ATOM   5284  O  O      . SER A 1 318 ? 19.912  39.631  15.561  1.00 28.77  ? 318 SER A O      1 
ATOM   5285  C  CB     . SER A 1 318 ? 18.161  37.623  13.566  1.00 15.78  ? 318 SER A CB     1 
ATOM   5286  O  OG     . SER A 1 318 ? 17.615  37.482  14.869  1.00 25.50  ? 318 SER A OG     1 
ATOM   5287  H  H      . SER A 1 318 ? 20.357  37.203  15.042  1.00 28.60  ? 318 SER A H      1 
ATOM   5288  H  HA     . SER A 1 318 ? 19.812  38.496  12.709  1.00 24.16  ? 318 SER A HA     1 
ATOM   5289  H  HB2    . SER A 1 318 ? 17.567  38.175  13.034  1.00 18.94  ? 318 SER A HB2    1 
ATOM   5290  H  HB3    . SER A 1 318 ? 18.246  36.745  13.164  1.00 18.94  ? 318 SER A HB3    1 
ATOM   5291  H  HG     . SER A 1 318 ? 16.859  37.120  14.825  1.00 30.60  ? 318 SER A HG     1 
ATOM   5292  N  N      . ALA A 1 319 ? 18.892  40.596  13.804  1.00 22.54  ? 319 ALA A N      1 
ATOM   5293  C  CA     . ALA A 1 319 ? 18.792  41.904  14.426  1.00 16.45  ? 319 ALA A CA     1 
ATOM   5294  C  C      . ALA A 1 319 ? 17.791  42.753  13.665  1.00 21.56  ? 319 ALA A C      1 
ATOM   5295  O  O      . ALA A 1 319 ? 17.425  42.421  12.540  1.00 35.51  ? 319 ALA A O      1 
ATOM   5296  C  CB     . ALA A 1 319 ? 20.145  42.577  14.455  1.00 17.83  ? 319 ALA A CB     1 
ATOM   5297  H  H      . ALA A 1 319 ? 18.546  40.558  13.017  1.00 27.05  ? 319 ALA A H      1 
ATOM   5298  H  HA     . ALA A 1 319 ? 18.479  41.805  15.339  1.00 19.74  ? 319 ALA A HA     1 
ATOM   5299  H  HB1    . ALA A 1 319 ? 20.056  43.447  14.874  1.00 21.40  ? 319 ALA A HB1    1 
ATOM   5300  H  HB2    . ALA A 1 319 ? 20.760  42.026  14.963  1.00 21.40  ? 319 ALA A HB2    1 
ATOM   5301  H  HB3    . ALA A 1 319 ? 20.466  42.678  13.545  1.00 21.40  ? 319 ALA A HB3    1 
ATOM   5302  N  N      . PHE A 1 320 ? 17.340  43.844  14.272  1.00 15.01  ? 320 PHE A N      1 
ATOM   5303  C  CA     . PHE A 1 320 ? 16.437  44.750  13.582  1.00 15.31  ? 320 PHE A CA     1 
ATOM   5304  C  C      . PHE A 1 320 ? 16.570  46.166  14.122  1.00 16.60  ? 320 PHE A C      1 
ATOM   5305  O  O      . PHE A 1 320 ? 17.074  46.372  15.223  1.00 25.23  ? 320 PHE A O      1 
ATOM   5306  C  CB     . PHE A 1 320 ? 14.991  44.266  13.697  1.00 12.55  ? 320 PHE A CB     1 
ATOM   5307  C  CG     . PHE A 1 320 ? 14.537  44.034  15.105  1.00 27.97  ? 320 PHE A CG     1 
ATOM   5308  C  CD1    . PHE A 1 320 ? 14.110  45.090  15.892  1.00 26.44  ? 320 PHE A CD1    1 
ATOM   5309  C  CD2    . PHE A 1 320 ? 14.533  42.759  15.643  1.00 32.67  ? 320 PHE A CD2    1 
ATOM   5310  C  CE1    . PHE A 1 320 ? 13.688  44.879  17.190  1.00 21.15  ? 320 PHE A CE1    1 
ATOM   5311  C  CE2    . PHE A 1 320 ? 14.112  42.542  16.942  1.00 27.67  ? 320 PHE A CE2    1 
ATOM   5312  C  CZ     . PHE A 1 320 ? 13.689  43.604  17.715  1.00 22.14  ? 320 PHE A CZ     1 
ATOM   5313  H  H      . PHE A 1 320 ? 17.541  44.079  15.074  1.00 18.02  ? 320 PHE A H      1 
ATOM   5314  H  HA     . PHE A 1 320 ? 16.670  44.768  12.641  1.00 18.37  ? 320 PHE A HA     1 
ATOM   5315  H  HB2    . PHE A 1 320 ? 14.407  44.933  13.304  1.00 15.06  ? 320 PHE A HB2    1 
ATOM   5316  H  HB3    . PHE A 1 320 ? 14.903  43.429  13.216  1.00 15.06  ? 320 PHE A HB3    1 
ATOM   5317  H  HD1    . PHE A 1 320 ? 14.107  45.952  15.542  1.00 31.73  ? 320 PHE A HD1    1 
ATOM   5318  H  HD2    . PHE A 1 320 ? 14.817  42.041  15.126  1.00 39.21  ? 320 PHE A HD2    1 
ATOM   5319  H  HE1    . PHE A 1 320 ? 13.404  45.596  17.710  1.00 25.38  ? 320 PHE A HE1    1 
ATOM   5320  H  HE2    . PHE A 1 320 ? 14.114  41.682  17.294  1.00 33.20  ? 320 PHE A HE2    1 
ATOM   5321  H  HZ     . PHE A 1 320 ? 13.406  43.460  18.589  1.00 26.56  ? 320 PHE A HZ     1 
ATOM   5322  N  N      . LYS A 1 321 ? 16.127  47.136  13.326  1.00 21.76  ? 321 LYS A N      1 
ATOM   5323  C  CA     . LYS A 1 321 ? 16.176  48.542  13.710  1.00 26.30  ? 321 LYS A CA     1 
ATOM   5324  C  C      . LYS A 1 321 ? 14.935  49.253  13.194  1.00 19.73  ? 321 LYS A C      1 
ATOM   5325  O  O      . LYS A 1 321 ? 14.410  48.905  12.142  1.00 28.06  ? 321 LYS A O      1 
ATOM   5326  C  CB     . LYS A 1 321 ? 17.441  49.207  13.159  1.00 16.83  ? 321 LYS A CB     1 
ATOM   5327  C  CG     . LYS A 1 321 ? 17.792  50.548  13.795  1.00 26.38  ? 321 LYS A CG     1 
ATOM   5328  C  CD     . LYS A 1 321 ? 17.286  51.729  12.991  1.00 30.86  ? 321 LYS A CD     1 
ATOM   5329  C  CE     . LYS A 1 321 ? 17.802  53.045  13.565  1.00 46.02  ? 321 LYS A CE     1 
ATOM   5330  N  NZ     . LYS A 1 321 ? 17.391  53.262  14.982  1.00 36.98  ? 321 LYS A NZ     1 
ATOM   5331  H  H      . LYS A 1 321 ? 15.789  47.002  12.547  1.00 26.11  ? 321 LYS A H      1 
ATOM   5332  H  HA     . LYS A 1 321 ? 16.190  48.612  14.677  1.00 31.56  ? 321 LYS A HA     1 
ATOM   5333  H  HB2    . LYS A 1 321 ? 18.192  48.610  13.302  1.00 20.19  ? 321 LYS A HB2    1 
ATOM   5334  H  HB3    . LYS A 1 321 ? 17.322  49.357  12.208  1.00 20.19  ? 321 LYS A HB3    1 
ATOM   5335  H  HG2    . LYS A 1 321 ? 17.393  50.593  14.678  1.00 31.66  ? 321 LYS A HG2    1 
ATOM   5336  H  HG3    . LYS A 1 321 ? 18.757  50.622  13.863  1.00 31.66  ? 321 LYS A HG3    1 
ATOM   5337  H  HD2    . LYS A 1 321 ? 17.598  51.652  12.076  1.00 37.04  ? 321 LYS A HD2    1 
ATOM   5338  H  HD3    . LYS A 1 321 ? 16.317  51.744  13.017  1.00 37.04  ? 321 LYS A HD3    1 
ATOM   5339  H  HE2    . LYS A 1 321 ? 18.771  53.046  13.531  1.00 55.22  ? 321 LYS A HE2    1 
ATOM   5340  H  HE3    . LYS A 1 321 ? 17.451  53.779  13.036  1.00 55.22  ? 321 LYS A HE3    1 
ATOM   5341  H  HZ1    . LYS A 1 321 ? 17.712  54.039  15.276  1.00 44.38  ? 321 LYS A HZ1    1 
ATOM   5342  H  HZ2    . LYS A 1 321 ? 16.503  53.275  15.043  1.00 44.38  ? 321 LYS A HZ2    1 
ATOM   5343  H  HZ3    . LYS A 1 321 ? 17.707  52.606  15.494  1.00 44.38  ? 321 LYS A HZ3    1 
ATOM   5344  N  N      . ALA A 1 322 ? 14.456  50.233  13.954  1.00 28.29  ? 322 ALA A N      1 
ATOM   5345  C  CA     . ALA A 1 322 ? 13.305  51.023  13.546  1.00 18.76  ? 322 ALA A CA     1 
ATOM   5346  C  C      . ALA A 1 322 ? 13.665  52.498  13.520  1.00 21.37  ? 322 ALA A C      1 
ATOM   5347  O  O      . ALA A 1 322 ? 13.734  53.149  14.562  1.00 34.48  ? 322 ALA A O      1 
ATOM   5348  C  CB     . ALA A 1 322 ? 12.133  50.774  14.481  1.00 21.18  ? 322 ALA A CB     1 
ATOM   5349  H  H      . ALA A 1 322 ? 14.785  50.461  14.715  1.00 33.95  ? 322 ALA A H      1 
ATOM   5350  H  HA     . ALA A 1 322 ? 13.039  50.760  12.651  1.00 22.51  ? 322 ALA A HA     1 
ATOM   5351  H  HB1    . ALA A 1 322 ? 11.379  51.310  14.191  1.00 25.41  ? 322 ALA A HB1    1 
ATOM   5352  H  HB2    . ALA A 1 322 ? 11.901  49.833  14.453  1.00 25.41  ? 322 ALA A HB2    1 
ATOM   5353  H  HB3    . ALA A 1 322 ? 12.390  51.025  15.382  1.00 25.41  ? 322 ALA A HB3    1 
ATOM   5354  N  N      . SER A 1 323 ? 13.902  53.020  12.322  1.00 19.53  ? 323 SER A N      1 
ATOM   5355  C  CA     . SER A 1 323 ? 14.112  54.447  12.146  1.00 20.91  ? 323 SER A CA     1 
ATOM   5356  C  C      . SER A 1 323 ? 12.742  55.104  12.098  1.00 27.44  ? 323 SER A C      1 
ATOM   5357  O  O      . SER A 1 323 ? 11.727  54.456  12.358  1.00 27.06  ? 323 SER A O      1 
ATOM   5358  C  CB     . SER A 1 323 ? 14.921  54.745  10.876  1.00 32.18  ? 323 SER A CB     1 
ATOM   5359  O  OG     . SER A 1 323 ? 14.172  54.511  9.693   1.00 27.80  ? 323 SER A OG     1 
ATOM   5360  H  H      . SER A 1 323 ? 13.946  52.565  11.594  1.00 23.43  ? 323 SER A H      1 
ATOM   5361  H  HA     . SER A 1 323 ? 14.597  54.799  12.908  1.00 25.09  ? 323 SER A HA     1 
ATOM   5362  H  HB2    . SER A 1 323 ? 15.194  55.675  10.892  1.00 38.61  ? 323 SER A HB2    1 
ATOM   5363  H  HB3    . SER A 1 323 ? 15.705  54.174  10.865  1.00 38.61  ? 323 SER A HB3    1 
ATOM   5364  H  HG     . SER A 1 323 ? 14.640  54.683  9.018   1.00 33.36  ? 323 SER A HG     1 
ATOM   5365  N  N      . GLU A 1 324 ? 12.702  56.385  11.759  1.00 29.06  ? 324 GLU A N      1 
ATOM   5366  C  CA     . GLU A 1 324 ? 11.441  57.107  11.761  1.00 42.00  ? 324 GLU A CA     1 
ATOM   5367  C  C      . GLU A 1 324 ? 10.529  56.639  10.629  1.00 41.51  ? 324 GLU A C      1 
ATOM   5368  O  O      . GLU A 1 324 ? 9.325   56.466  10.826  1.00 36.98  ? 324 GLU A O      1 
ATOM   5369  C  CB     . GLU A 1 324 ? 11.689  58.613  11.653  1.00 51.45  ? 324 GLU A CB     1 
ATOM   5370  C  CG     . GLU A 1 324 ? 10.427  59.448  11.784  1.00 72.91  ? 324 GLU A CG     1 
ATOM   5371  C  CD     . GLU A 1 324 ? 9.638   59.108  13.034  1.00 91.84  ? 324 GLU A CD     1 
ATOM   5372  O  OE1    . GLU A 1 324 ? 8.390   59.079  12.964  1.00 83.20  ? 324 GLU A OE1    1 
ATOM   5373  O  OE2    . GLU A 1 324 ? 10.268  58.862  14.085  1.00 80.69  ? 324 GLU A OE2    1 
ATOM   5374  H  H      . GLU A 1 324 ? 13.383  56.855  11.525  1.00 34.87  ? 324 GLU A H      1 
ATOM   5375  H  HA     . GLU A 1 324 ? 10.985  56.939  12.601  1.00 50.40  ? 324 GLU A HA     1 
ATOM   5376  H  HB2    . GLU A 1 324 ? 12.298  58.882  12.358  1.00 61.74  ? 324 GLU A HB2    1 
ATOM   5377  H  HB3    . GLU A 1 324 ? 12.083  58.804  10.787  1.00 61.74  ? 324 GLU A HB3    1 
ATOM   5378  H  HG2    . GLU A 1 324 ? 10.671  60.386  11.827  1.00 87.49  ? 324 GLU A HG2    1 
ATOM   5379  H  HG3    . GLU A 1 324 ? 9.858   59.287  11.015  1.00 87.49  ? 324 GLU A HG3    1 
ATOM   5380  N  N      . GLU A 1 325 ? 11.115  56.418  9.454   1.00 42.01  ? 325 GLU A N      1 
ATOM   5381  C  CA     . GLU A 1 325 ? 10.352  56.092  8.250   1.00 38.71  ? 325 GLU A CA     1 
ATOM   5382  C  C      . GLU A 1 325 ? 10.388  54.610  7.888   1.00 24.02  ? 325 GLU A C      1 
ATOM   5383  O  O      . GLU A 1 325 ? 9.440   54.095  7.298   1.00 25.19  ? 325 GLU A O      1 
ATOM   5384  C  CB     . GLU A 1 325 ? 10.873  56.912  7.069   1.00 42.30  ? 325 GLU A CB     1 
ATOM   5385  C  CG     . GLU A 1 325 ? 9.992   56.842  5.831   1.00 63.38  ? 325 GLU A CG     1 
ATOM   5386  C  CD     . GLU A 1 325 ? 10.523  57.689  4.689   1.00 73.38  ? 325 GLU A CD     1 
ATOM   5387  O  OE1    . GLU A 1 325 ? 11.520  58.413  4.897   1.00 68.21  ? 325 GLU A OE1    1 
ATOM   5388  O  OE2    . GLU A 1 325 ? 9.941   57.637  3.585   1.00 58.00  ? 325 GLU A OE2    1 
ATOM   5389  H  H      . GLU A 1 325 ? 11.965  56.451  9.326   1.00 50.41  ? 325 GLU A H      1 
ATOM   5390  H  HA     . GLU A 1 325 ? 9.424   56.338  8.394   1.00 46.45  ? 325 GLU A HA     1 
ATOM   5391  H  HB2    . GLU A 1 325 ? 10.932  57.842  7.338   1.00 50.76  ? 325 GLU A HB2    1 
ATOM   5392  H  HB3    . GLU A 1 325 ? 11.752  56.584  6.825   1.00 50.76  ? 325 GLU A HB3    1 
ATOM   5393  H  HG2    . GLU A 1 325 ? 9.946   55.922  5.527   1.00 76.06  ? 325 GLU A HG2    1 
ATOM   5394  H  HG3    . GLU A 1 325 ? 9.104   57.163  6.056   1.00 76.06  ? 325 GLU A HG3    1 
ATOM   5395  N  N      . PHE A 1 326 ? 11.489  53.939  8.225   1.00 24.03  ? 326 PHE A N      1 
ATOM   5396  C  CA     . PHE A 1 326 ? 11.719  52.556  7.804   1.00 27.56  ? 326 PHE A CA     1 
ATOM   5397  C  C      . PHE A 1 326 ? 12.038  51.588  8.942   1.00 22.72  ? 326 PHE A C      1 
ATOM   5398  O  O      . PHE A 1 326 ? 12.451  51.989  10.027  1.00 29.44  ? 326 PHE A O      1 
ATOM   5399  C  CB     . PHE A 1 326 ? 12.865  52.504  6.791   1.00 31.49  ? 326 PHE A CB     1 
ATOM   5400  C  CG     . PHE A 1 326 ? 12.534  53.131  5.473   1.00 27.21  ? 326 PHE A CG     1 
ATOM   5401  C  CD1    . PHE A 1 326 ? 11.821  52.428  4.521   1.00 25.82  ? 326 PHE A CD1    1 
ATOM   5402  C  CD2    . PHE A 1 326 ? 12.931  54.422  5.188   1.00 21.43  ? 326 PHE A CD2    1 
ATOM   5403  C  CE1    . PHE A 1 326 ? 11.513  53.001  3.312   1.00 33.29  ? 326 PHE A CE1    1 
ATOM   5404  C  CE2    . PHE A 1 326 ? 12.625  55.000  3.982   1.00 18.73  ? 326 PHE A CE2    1 
ATOM   5405  C  CZ     . PHE A 1 326 ? 11.915  54.291  3.041   1.00 36.00  ? 326 PHE A CZ     1 
ATOM   5406  H  H      . PHE A 1 326 ? 12.125  54.267  8.702   1.00 28.84  ? 326 PHE A H      1 
ATOM   5407  H  HA     . PHE A 1 326 ? 10.919  52.232  7.361   1.00 33.07  ? 326 PHE A HA     1 
ATOM   5408  H  HB2    . PHE A 1 326 ? 13.629  52.973  7.159   1.00 37.79  ? 326 PHE A HB2    1 
ATOM   5409  H  HB3    . PHE A 1 326 ? 13.096  51.576  6.628   1.00 37.79  ? 326 PHE A HB3    1 
ATOM   5410  H  HD1    . PHE A 1 326 ? 11.548  51.558  4.702   1.00 30.98  ? 326 PHE A HD1    1 
ATOM   5411  H  HD2    . PHE A 1 326 ? 13.410  54.906  5.821   1.00 25.72  ? 326 PHE A HD2    1 
ATOM   5412  H  HE1    . PHE A 1 326 ? 11.033  52.520  2.677   1.00 39.95  ? 326 PHE A HE1    1 
ATOM   5413  H  HE2    . PHE A 1 326 ? 12.898  55.871  3.801   1.00 22.47  ? 326 PHE A HE2    1 
ATOM   5414  H  HZ     . PHE A 1 326 ? 11.709  54.681  2.223   1.00 43.20  ? 326 PHE A HZ     1 
ATOM   5415  N  N      . CYS A 1 327 ? 11.838  50.305  8.661   1.00 26.32  ? 327 CYS A N      1 
ATOM   5416  C  CA     . CYS A 1 327 ? 12.260  49.221  9.535   1.00 15.21  ? 327 CYS A CA     1 
ATOM   5417  C  C      . CYS A 1 327 ? 13.280  48.358  8.797   1.00 21.53  ? 327 CYS A C      1 
ATOM   5418  O  O      . CYS A 1 327 ? 13.188  48.184  7.585   1.00 26.47  ? 327 CYS A O      1 
ATOM   5419  C  CB     . CYS A 1 327 ? 11.065  48.378  9.969   1.00 8.10   ? 327 CYS A CB     1 
ATOM   5420  S  SG     . CYS A 1 327 ? 9.983   49.169  11.165  1.00 43.52  ? 327 CYS A SG     1 
ATOM   5421  H  H      . CYS A 1 327 ? 11.447  50.031  7.945   1.00 31.59  ? 327 CYS A H      1 
ATOM   5422  H  HA     . CYS A 1 327 ? 12.682  49.589  10.327  1.00 18.26  ? 327 CYS A HA     1 
ATOM   5423  H  HB2    . CYS A 1 327 ? 10.533  48.169  9.185   1.00 9.72   ? 327 CYS A HB2    1 
ATOM   5424  H  HB3    . CYS A 1 327 ? 11.393  47.557  10.368  1.00 9.72   ? 327 CYS A HB3    1 
ATOM   5425  H  HG     . CYS A 1 327 ? 9.083   48.422  11.433  1.00 52.22  ? 327 CYS A HG     1 
ATOM   5426  N  N      . TYR A 1 328 ? 14.249  47.822  9.531   1.00 21.07  ? 328 TYR A N      1 
ATOM   5427  C  CA     . TYR A 1 328 ? 15.291  46.986  8.947   1.00 18.06  ? 328 TYR A CA     1 
ATOM   5428  C  C      . TYR A 1 328 ? 15.376  45.650  9.677   1.00 16.93  ? 328 TYR A C      1 
ATOM   5429  O  O      . TYR A 1 328 ? 15.348  45.618  10.901  1.00 17.50  ? 328 TYR A O      1 
ATOM   5430  C  CB     . TYR A 1 328 ? 16.632  47.712  9.008   1.00 15.08  ? 328 TYR A CB     1 
ATOM   5431  C  CG     . TYR A 1 328 ? 16.614  49.068  8.340   1.00 14.61  ? 328 TYR A CG     1 
ATOM   5432  C  CD1    . TYR A 1 328 ? 16.205  50.197  9.034   1.00 24.05  ? 328 TYR A CD1    1 
ATOM   5433  C  CD2    . TYR A 1 328 ? 17.021  49.223  7.025   1.00 27.85  ? 328 TYR A CD2    1 
ATOM   5434  C  CE1    . TYR A 1 328 ? 16.188  51.441  8.434   1.00 33.51  ? 328 TYR A CE1    1 
ATOM   5435  C  CE2    . TYR A 1 328 ? 17.012  50.465  6.415   1.00 38.62  ? 328 TYR A CE2    1 
ATOM   5436  C  CZ     . TYR A 1 328 ? 16.595  51.570  7.125   1.00 34.84  ? 328 TYR A CZ     1 
ATOM   5437  O  OH     . TYR A 1 328 ? 16.583  52.807  6.522   1.00 35.30  ? 328 TYR A OH     1 
ATOM   5438  H  H      . TYR A 1 328 ? 14.325  47.929  10.381  1.00 25.29  ? 328 TYR A H      1 
ATOM   5439  H  HA     . TYR A 1 328 ? 15.079  46.813  8.016   1.00 21.68  ? 328 TYR A HA     1 
ATOM   5440  H  HB2    . TYR A 1 328 ? 16.877  47.841  9.937   1.00 18.10  ? 328 TYR A HB2    1 
ATOM   5441  H  HB3    . TYR A 1 328 ? 17.302  47.170  8.562   1.00 18.10  ? 328 TYR A HB3    1 
ATOM   5442  H  HD1    . TYR A 1 328 ? 15.929  50.114  9.919   1.00 28.86  ? 328 TYR A HD1    1 
ATOM   5443  H  HD2    . TYR A 1 328 ? 17.303  48.479  6.543   1.00 33.42  ? 328 TYR A HD2    1 
ATOM   5444  H  HE1    . TYR A 1 328 ? 15.909  52.188  8.912   1.00 40.21  ? 328 TYR A HE1    1 
ATOM   5445  H  HE2    . TYR A 1 328 ? 17.285  50.554  5.531   1.00 46.35  ? 328 TYR A HE2    1 
ATOM   5446  H  HH     . TYR A 1 328 ? 16.854  52.743  5.730   1.00 42.36  ? 328 TYR A HH     1 
ATOM   5447  N  N      . LEU A 1 329 ? 15.447  44.554  8.926   1.00 14.99  ? 329 LEU A N      1 
ATOM   5448  C  CA     . LEU A 1 329 ? 15.701  43.235  9.502   1.00 12.71  ? 329 LEU A CA     1 
ATOM   5449  C  C      . LEU A 1 329 ? 17.038  42.709  9.012   1.00 16.87  ? 329 LEU A C      1 
ATOM   5450  O  O      . LEU A 1 329 ? 17.170  42.329  7.853   1.00 21.53  ? 329 LEU A O      1 
ATOM   5451  C  CB     . LEU A 1 329 ? 14.592  42.248  9.137   1.00 12.10  ? 329 LEU A CB     1 
ATOM   5452  C  CG     . LEU A 1 329 ? 13.159  42.656  9.473   1.00 11.26  ? 329 LEU A CG     1 
ATOM   5453  C  CD1    . LEU A 1 329 ? 12.211  41.531  9.119   1.00 9.62   ? 329 LEU A CD1    1 
ATOM   5454  C  CD2    . LEU A 1 329 ? 13.024  43.023  10.936  1.00 18.81  ? 329 LEU A CD2    1 
ATOM   5455  H  H      . LEU A 1 329 ? 15.349  44.547  8.072   1.00 17.99  ? 329 LEU A H      1 
ATOM   5456  H  HA     . LEU A 1 329 ? 15.738  43.308  10.468  1.00 15.25  ? 329 LEU A HA     1 
ATOM   5457  H  HB2    . LEU A 1 329 ? 14.628  42.095  8.180   1.00 14.52  ? 329 LEU A HB2    1 
ATOM   5458  H  HB3    . LEU A 1 329 ? 14.767  41.414  9.600   1.00 14.52  ? 329 LEU A HB3    1 
ATOM   5459  H  HG     . LEU A 1 329 ? 12.918  43.433  8.943   1.00 13.51  ? 329 LEU A HG     1 
ATOM   5460  H  HD11   . LEU A 1 329 ? 11.305  41.802  9.337   1.00 11.54  ? 329 LEU A HD11   1 
ATOM   5461  H  HD12   . LEU A 1 329 ? 12.282  41.346  8.170   1.00 11.54  ? 329 LEU A HD12   1 
ATOM   5462  H  HD13   . LEU A 1 329 ? 12.452  40.743  9.630   1.00 11.54  ? 329 LEU A HD13   1 
ATOM   5463  H  HD21   . LEU A 1 329 ? 12.105  43.277  11.114  1.00 22.57  ? 329 LEU A HD21   1 
ATOM   5464  H  HD22   . LEU A 1 329 ? 13.267  42.256  11.477  1.00 22.57  ? 329 LEU A HD22   1 
ATOM   5465  H  HD23   . LEU A 1 329 ? 13.616  43.767  11.131  1.00 22.57  ? 329 LEU A HD23   1 
ATOM   5466  N  N      . LEU A 1 330 ? 18.020  42.667  9.905   1.00 17.86  ? 330 LEU A N      1 
ATOM   5467  C  CA     . LEU A 1 330 ? 19.382  42.296  9.539   1.00 14.06  ? 330 LEU A CA     1 
ATOM   5468  C  C      . LEU A 1 330 ? 19.661  40.822  9.828   1.00 13.69  ? 330 LEU A C      1 
ATOM   5469  O  O      . LEU A 1 330 ? 19.097  40.244  10.756  1.00 17.21  ? 330 LEU A O      1 
ATOM   5470  C  CB     . LEU A 1 330 ? 20.385  43.187  10.270  1.00 18.82  ? 330 LEU A CB     1 
ATOM   5471  C  CG     . LEU A 1 330 ? 20.063  44.682  10.173  1.00 20.44  ? 330 LEU A CG     1 
ATOM   5472  C  CD1    . LEU A 1 330 ? 19.439  45.181  11.464  1.00 24.49  ? 330 LEU A CD1    1 
ATOM   5473  C  CD2    . LEU A 1 330 ? 21.301  45.486  9.827   1.00 17.42  ? 330 LEU A CD2    1 
ATOM   5474  H  H      . LEU A 1 330 ? 17.922  42.851  10.739  1.00 21.43  ? 330 LEU A H      1 
ATOM   5475  H  HA     . LEU A 1 330 ? 19.499  42.438  8.587   1.00 16.87  ? 330 LEU A HA     1 
ATOM   5476  H  HB2    . LEU A 1 330 ? 20.392  42.945  11.210  1.00 22.59  ? 330 LEU A HB2    1 
ATOM   5477  H  HB3    . LEU A 1 330 ? 21.265  43.047  9.888   1.00 22.59  ? 330 LEU A HB3    1 
ATOM   5478  H  HG     . LEU A 1 330 ? 19.417  44.815  9.462   1.00 24.53  ? 330 LEU A HG     1 
ATOM   5479  H  HD11   . LEU A 1 330 ? 19.245  46.127  11.376  1.00 29.39  ? 330 LEU A HD11   1 
ATOM   5480  H  HD12   . LEU A 1 330 ? 18.619  44.689  11.628  1.00 29.39  ? 330 LEU A HD12   1 
ATOM   5481  H  HD13   . LEU A 1 330 ? 20.063  45.037  12.193  1.00 29.39  ? 330 LEU A HD13   1 
ATOM   5482  H  HD21   . LEU A 1 330 ? 21.063  46.424  9.773   1.00 20.90  ? 330 LEU A HD21   1 
ATOM   5483  H  HD22   . LEU A 1 330 ? 21.968  45.352  10.519  1.00 20.90  ? 330 LEU A HD22   1 
ATOM   5484  H  HD23   . LEU A 1 330 ? 21.646  45.182  8.973   1.00 20.90  ? 330 LEU A HD23   1 
ATOM   5485  N  N      . PHE A 1 331 ? 20.499  40.219  8.988   1.00 15.44  ? 331 PHE A N      1 
ATOM   5486  C  CA     . PHE A 1 331 ? 20.877  38.813  9.101   1.00 14.16  ? 331 PHE A CA     1 
ATOM   5487  C  C      . PHE A 1 331 ? 22.326  38.622  8.685   1.00 17.56  ? 331 PHE A C      1 
ATOM   5488  O  O      . PHE A 1 331 ? 22.815  39.323  7.803   1.00 14.22  ? 331 PHE A O      1 
ATOM   5489  C  CB     . PHE A 1 331 ? 19.982  37.935  8.229   1.00 10.60  ? 331 PHE A CB     1 
ATOM   5490  C  CG     . PHE A 1 331 ? 18.525  38.112  8.491   1.00 9.32   ? 331 PHE A CG     1 
ATOM   5491  C  CD1    . PHE A 1 331 ? 17.893  37.365  9.462   1.00 15.67  ? 331 PHE A CD1    1 
ATOM   5492  C  CD2    . PHE A 1 331 ? 17.791  39.040  7.779   1.00 10.23  ? 331 PHE A CD2    1 
ATOM   5493  C  CE1    . PHE A 1 331 ? 16.550  37.529  9.711   1.00 29.54  ? 331 PHE A CE1    1 
ATOM   5494  C  CE2    . PHE A 1 331 ? 16.449  39.212  8.023   1.00 15.44  ? 331 PHE A CE2    1 
ATOM   5495  C  CZ     . PHE A 1 331 ? 15.826  38.457  8.990   1.00 25.49  ? 331 PHE A CZ     1 
ATOM   5496  H  H      . PHE A 1 331 ? 20.874  40.618  8.324   1.00 18.53  ? 331 PHE A H      1 
ATOM   5497  H  HA     . PHE A 1 331 ? 20.782  38.526  10.023  1.00 16.99  ? 331 PHE A HA     1 
ATOM   5498  H  HB2    . PHE A 1 331 ? 20.144  38.153  7.297   1.00 12.72  ? 331 PHE A HB2    1 
ATOM   5499  H  HB3    . PHE A 1 331 ? 20.202  37.005  8.392   1.00 12.72  ? 331 PHE A HB3    1 
ATOM   5500  H  HD1    . PHE A 1 331 ? 18.378  36.738  9.950   1.00 18.80  ? 331 PHE A HD1    1 
ATOM   5501  H  HD2    . PHE A 1 331 ? 18.208  39.552  7.124   1.00 12.27  ? 331 PHE A HD2    1 
ATOM   5502  H  HE1    . PHE A 1 331 ? 16.131  37.019  10.365  1.00 35.45  ? 331 PHE A HE1    1 
ATOM   5503  H  HE2    . PHE A 1 331 ? 15.963  39.837  7.535   1.00 18.53  ? 331 PHE A HE2    1 
ATOM   5504  H  HZ     . PHE A 1 331 ? 14.918  38.570  9.156   1.00 30.59  ? 331 PHE A HZ     1 
ATOM   5505  N  N      . GLU A 1 332 ? 23.013  37.682  9.326   1.00 20.61  ? 332 GLU A N      1 
ATOM   5506  C  CA     . GLU A 1 332 ? 24.363  37.304  8.916   1.00 20.25  ? 332 GLU A CA     1 
ATOM   5507  C  C      . GLU A 1 332 ? 24.448  35.792  8.736   1.00 21.00  ? 332 GLU A C      1 
ATOM   5508  O  O      . GLU A 1 332 ? 24.002  35.036  9.597   1.00 19.48  ? 332 GLU A O      1 
ATOM   5509  C  CB     . GLU A 1 332 ? 25.395  37.776  9.931   1.00 24.60  ? 332 GLU A CB     1 
ATOM   5510  C  CG     . GLU A 1 332 ? 26.824  37.576  9.466   1.00 20.32  ? 332 GLU A CG     1 
ATOM   5511  C  CD     . GLU A 1 332 ? 27.835  37.904  10.539  1.00 33.20  ? 332 GLU A CD     1 
ATOM   5512  O  OE1    . GLU A 1 332 ? 27.461  37.904  11.734  1.00 42.86  ? 332 GLU A OE1    1 
ATOM   5513  O  OE2    . GLU A 1 332 ? 29.006  38.171  10.191  1.00 31.76  ? 332 GLU A OE2    1 
ATOM   5514  H  H      . GLU A 1 332 ? 22.719  37.245  10.006  1.00 24.73  ? 332 GLU A H      1 
ATOM   5515  H  HA     . GLU A 1 332 ? 24.565  37.721  8.064   1.00 24.30  ? 332 GLU A HA     1 
ATOM   5516  H  HB2    . GLU A 1 332 ? 25.265  38.723  10.096  1.00 29.52  ? 332 GLU A HB2    1 
ATOM   5517  H  HB3    . GLU A 1 332 ? 25.277  37.278  10.756  1.00 29.52  ? 332 GLU A HB3    1 
ATOM   5518  H  HG2    . GLU A 1 332 ? 26.947  36.648  9.212   1.00 24.38  ? 332 GLU A HG2    1 
ATOM   5519  H  HG3    . GLU A 1 332 ? 26.993  38.154  8.706   1.00 24.38  ? 332 GLU A HG3    1 
ATOM   5520  N  N      . CYS A 1 333 ? 25.013  35.359  7.612   1.00 20.92  ? 333 CYS A N      1 
ATOM   5521  C  CA     . CYS A 1 333 ? 25.041  33.942  7.263   1.00 19.26  ? 333 CYS A CA     1 
ATOM   5522  C  C      . CYS A 1 333 ? 26.448  33.458  6.916   1.00 21.24  ? 333 CYS A C      1 
ATOM   5523  O  O      . CYS A 1 333 ? 27.238  34.192  6.325   1.00 30.65  ? 333 CYS A O      1 
ATOM   5524  C  CB     . CYS A 1 333 ? 24.091  33.680  6.095   1.00 13.26  ? 333 CYS A CB     1 
ATOM   5525  S  SG     . CYS A 1 333 ? 22.351  33.993  6.482   1.00 23.86  ? 333 CYS A SG     1 
ATOM   5526  H  H      . CYS A 1 333 ? 25.389  35.869  7.031   1.00 25.11  ? 333 CYS A H      1 
ATOM   5527  H  HA     . CYS A 1 333 ? 24.729  33.426  8.023   1.00 23.11  ? 333 CYS A HA     1 
ATOM   5528  H  HB2    . CYS A 1 333 ? 24.339  34.257  5.356   1.00 15.91  ? 333 CYS A HB2    1 
ATOM   5529  H  HB3    . CYS A 1 333 ? 24.173  32.751  5.828   1.00 15.91  ? 333 CYS A HB3    1 
ATOM   5530  H  HG     . CYS A 1 333 ? 21.687  33.761  5.510   1.00 28.63  ? 333 CYS A HG     1 
ATOM   5531  N  N      . GLN A 1 334 ? 26.763  32.225  7.307   1.00 16.09  ? 334 GLN A N      1 
ATOM   5532  C  CA     . GLN A 1 334 ? 28.075  31.650  7.032   1.00 12.66  ? 334 GLN A CA     1 
ATOM   5533  C  C      . GLN A 1 334 ? 28.211  31.240  5.564   1.00 19.39  ? 334 GLN A C      1 
ATOM   5534  O  O      . GLN A 1 334 ? 29.321  31.184  5.031   1.00 28.38  ? 334 GLN A O      1 
ATOM   5535  C  CB     . GLN A 1 334 ? 28.343  30.442  7.939   1.00 15.57  ? 334 GLN A CB     1 
ATOM   5536  C  CG     . GLN A 1 334 ? 28.231  30.737  9.434   1.00 25.49  ? 334 GLN A CG     1 
ATOM   5537  C  CD     . GLN A 1 334 ? 28.664  29.568  10.309  1.00 28.79  ? 334 GLN A CD     1 
ATOM   5538  O  OE1    . GLN A 1 334 ? 29.691  28.933  10.059  1.00 22.31  ? 334 GLN A OE1    1 
ATOM   5539  N  NE2    . GLN A 1 334 ? 27.875  29.273  11.336  1.00 39.01  ? 334 GLN A NE2    1 
ATOM   5540  H  H      . GLN A 1 334 ? 26.232  31.700  7.734   1.00 19.30  ? 334 GLN A H      1 
ATOM   5541  H  HA     . GLN A 1 334 ? 28.754  32.318  7.217   1.00 15.19  ? 334 GLN A HA     1 
ATOM   5542  H  HB2    . GLN A 1 334 ? 27.701  29.746  7.728   1.00 18.69  ? 334 GLN A HB2    1 
ATOM   5543  H  HB3    . GLN A 1 334 ? 29.242  30.120  7.769   1.00 18.69  ? 334 GLN A HB3    1 
ATOM   5544  H  HG2    . GLN A 1 334 ? 28.797  31.496  9.649   1.00 30.59  ? 334 GLN A HG2    1 
ATOM   5545  H  HG3    . GLN A 1 334 ? 27.307  30.943  9.646   1.00 30.59  ? 334 GLN A HG3    1 
ATOM   5546  H  HE21   . GLN A 1 334 ? 27.163  29.735  11.477  1.00 46.81  ? 334 GLN A HE21   1 
ATOM   5547  H  HE22   . GLN A 1 334 ? 28.076  28.622  11.860  1.00 46.81  ? 334 GLN A HE22   1 
ATOM   5548  N  N      . ILE A 1 335 ? 27.081  30.960  4.917   1.00 12.40  ? 335 ILE A N      1 
ATOM   5549  C  CA     . ILE A 1 335 ? 27.073  30.549  3.515   1.00 13.92  ? 335 ILE A CA     1 
ATOM   5550  C  C      . ILE A 1 335 ? 26.639  31.690  2.600   1.00 16.41  ? 335 ILE A C      1 
ATOM   5551  O  O      . ILE A 1 335 ? 25.460  32.038  2.558   1.00 22.90  ? 335 ILE A O      1 
ATOM   5552  C  CB     . ILE A 1 335 ? 26.125  29.351  3.287   1.00 10.11  ? 335 ILE A CB     1 
ATOM   5553  C  CG1    . ILE A 1 335 ? 26.415  28.229  4.284   1.00 9.40   ? 335 ILE A CG1    1 
ATOM   5554  C  CG2    . ILE A 1 335 ? 26.240  28.838  1.860   1.00 15.44  ? 335 ILE A CG2    1 
ATOM   5555  C  CD1    . ILE A 1 335 ? 27.840  27.729  4.259   1.00 9.12   ? 335 ILE A CD1    1 
ATOM   5556  H  H      . ILE A 1 335 ? 26.299  31.002  5.271   1.00 14.88  ? 335 ILE A H      1 
ATOM   5557  H  HA     . ILE A 1 335 ? 27.969  30.279  3.258   1.00 16.70  ? 335 ILE A HA     1 
ATOM   5558  H  HB     . ILE A 1 335 ? 25.215  29.654  3.428   1.00 12.13  ? 335 ILE A HB     1 
ATOM   5559  H  HG12   . ILE A 1 335 ? 26.233  28.554  5.180   1.00 11.28  ? 335 ILE A HG12   1 
ATOM   5560  H  HG13   . ILE A 1 335 ? 25.835  27.477  4.084   1.00 11.28  ? 335 ILE A HG13   1 
ATOM   5561  H  HG21   . ILE A 1 335 ? 25.636  28.089  1.745   1.00 18.52  ? 335 ILE A HG21   1 
ATOM   5562  H  HG22   . ILE A 1 335 ? 26.002  29.553  1.249   1.00 18.52  ? 335 ILE A HG22   1 
ATOM   5563  H  HG23   . ILE A 1 335 ? 27.154  28.555  1.699   1.00 18.52  ? 335 ILE A HG23   1 
ATOM   5564  H  HD11   . ILE A 1 335 ? 27.939  27.023  4.917   1.00 10.95  ? 335 ILE A HD11   1 
ATOM   5565  H  HD12   . ILE A 1 335 ? 28.038  27.386  3.373   1.00 10.95  ? 335 ILE A HD12   1 
ATOM   5566  H  HD13   . ILE A 1 335 ? 28.436  28.464  4.470   1.00 10.95  ? 335 ILE A HD13   1 
ATOM   5567  N  N      . LYS A 1 336 ? 27.584  32.262  1.859   1.00 21.14  ? 336 LYS A N      1 
ATOM   5568  C  CA     . LYS A 1 336 ? 27.254  33.306  0.892   1.00 16.67  ? 336 LYS A CA     1 
ATOM   5569  C  C      . LYS A 1 336 ? 26.618  32.678  -0.337  1.00 21.77  ? 336 LYS A C      1 
ATOM   5570  O  O      . LYS A 1 336 ? 25.792  33.301  -1.005  1.00 31.93  ? 336 LYS A O      1 
ATOM   5571  C  CB     . LYS A 1 336 ? 28.486  34.126  0.484   1.00 18.80  ? 336 LYS A CB     1 
ATOM   5572  C  CG     . LYS A 1 336 ? 28.909  35.176  1.508   1.00 21.51  ? 336 LYS A CG     1 
ATOM   5573  C  CD     . LYS A 1 336 ? 30.102  36.002  1.046   1.00 11.82  ? 336 LYS A CD     1 
ATOM   5574  C  CE     . LYS A 1 336 ? 31.374  35.192  0.979   1.00 27.79  ? 336 LYS A CE     1 
ATOM   5575  N  NZ     . LYS A 1 336 ? 32.536  36.071  0.685   1.00 44.10  ? 336 LYS A NZ     1 
ATOM   5576  H  H      . LYS A 1 336 ? 28.421  32.065  1.896   1.00 25.37  ? 336 LYS A H      1 
ATOM   5577  H  HA     . LYS A 1 336 ? 26.608  33.911  1.288   1.00 20.00  ? 336 LYS A HA     1 
ATOM   5578  H  HB2    . LYS A 1 336 ? 29.233  33.521  0.356   1.00 22.56  ? 336 LYS A HB2    1 
ATOM   5579  H  HB3    . LYS A 1 336 ? 28.291  34.586  -0.347  1.00 22.56  ? 336 LYS A HB3    1 
ATOM   5580  H  HG2    . LYS A 1 336 ? 28.168  35.781  1.664   1.00 25.81  ? 336 LYS A HG2    1 
ATOM   5581  H  HG3    . LYS A 1 336 ? 29.154  34.730  2.334   1.00 25.81  ? 336 LYS A HG3    1 
ATOM   5582  H  HD2    . LYS A 1 336 ? 29.922  36.352  0.159   1.00 14.18  ? 336 LYS A HD2    1 
ATOM   5583  H  HD3    . LYS A 1 336 ? 30.243  36.731  1.669   1.00 14.18  ? 336 LYS A HD3    1 
ATOM   5584  H  HE2    . LYS A 1 336 ? 31.526  34.758  1.833   1.00 33.35  ? 336 LYS A HE2    1 
ATOM   5585  H  HE3    . LYS A 1 336 ? 31.300  34.533  0.272   1.00 33.35  ? 336 LYS A HE3    1 
ATOM   5586  H  HZ1    . LYS A 1 336 ? 33.282  35.586  0.647   1.00 52.92  ? 336 LYS A HZ1    1 
ATOM   5587  H  HZ2    . LYS A 1 336 ? 32.417  36.480  -0.097  1.00 52.92  ? 336 LYS A HZ2    1 
ATOM   5588  H  HZ3    . LYS A 1 336 ? 32.622  36.685  1.323   1.00 52.92  ? 336 LYS A HZ3    1 
ATOM   5589  N  N      . GLU A 1 337 ? 27.014  31.444  -0.635  1.00 21.60  ? 337 GLU A N      1 
ATOM   5590  C  CA     . GLU A 1 337 ? 26.479  30.725  -1.785  1.00 21.50  ? 337 GLU A CA     1 
ATOM   5591  C  C      . GLU A 1 337 ? 26.530  29.222  -1.562  1.00 16.21  ? 337 GLU A C      1 
ATOM   5592  O  O      . GLU A 1 337 ? 27.487  28.694  -0.991  1.00 25.29  ? 337 GLU A O      1 
ATOM   5593  C  CB     . GLU A 1 337 ? 27.255  31.088  -3.056  1.00 28.78  ? 337 GLU A CB     1 
ATOM   5594  C  CG     . GLU A 1 337 ? 26.736  30.406  -4.323  1.00 37.28  ? 337 GLU A CG     1 
ATOM   5595  C  CD     . GLU A 1 337 ? 27.473  30.847  -5.580  1.00 58.05  ? 337 GLU A CD     1 
ATOM   5596  O  OE1    . GLU A 1 337 ? 28.717  30.716  -5.629  1.00 37.78  ? 337 GLU A OE1    1 
ATOM   5597  O  OE2    . GLU A 1 337 ? 26.805  31.330  -6.519  1.00 59.28  ? 337 GLU A OE2    1 
ATOM   5598  H  H      . GLU A 1 337 ? 27.595  30.999  -0.183  1.00 25.92  ? 337 GLU A H      1 
ATOM   5599  H  HA     . GLU A 1 337 ? 25.552  30.979  -1.914  1.00 25.80  ? 337 GLU A HA     1 
ATOM   5600  H  HB2    . GLU A 1 337 ? 27.198  32.047  -3.192  1.00 34.54  ? 337 GLU A HB2    1 
ATOM   5601  H  HB3    . GLU A 1 337 ? 28.182  30.828  -2.939  1.00 34.54  ? 337 GLU A HB3    1 
ATOM   5602  H  HG2    . GLU A 1 337 ? 26.847  29.447  -4.232  1.00 44.73  ? 337 GLU A HG2    1 
ATOM   5603  H  HG3    . GLU A 1 337 ? 25.797  30.622  -4.435  1.00 44.73  ? 337 GLU A HG3    1 
ATOM   5604  N  N      . ILE A 1 338 ? 25.485  28.544  -2.021  1.00 11.38  ? 338 ILE A N      1 
ATOM   5605  C  CA     . ILE A 1 338 ? 25.400  27.095  -1.938  1.00 16.47  ? 338 ILE A CA     1 
ATOM   5606  C  C      . ILE A 1 338 ? 25.198  26.516  -3.339  1.00 28.08  ? 338 ILE A C      1 
ATOM   5607  O  O      . ILE A 1 338 ? 24.794  27.224  -4.268  1.00 18.02  ? 338 ILE A O      1 
ATOM   5608  C  CB     . ILE A 1 338 ? 24.252  26.655  -0.997  1.00 14.15  ? 338 ILE A CB     1 
ATOM   5609  C  CG1    . ILE A 1 338 ? 24.381  25.169  -0.649  1.00 17.48  ? 338 ILE A CG1    1 
ATOM   5610  C  CG2    . ILE A 1 338 ? 22.887  26.952  -1.619  1.00 11.84  ? 338 ILE A CG2    1 
ATOM   5611  C  CD1    . ILE A 1 338 ? 23.520  24.739  0.517   1.00 11.60  ? 338 ILE A CD1    1 
ATOM   5612  H  H      . ILE A 1 338 ? 24.801  28.909  -2.392  1.00 13.66  ? 338 ILE A H      1 
ATOM   5613  H  HA     . ILE A 1 338 ? 26.233  26.747  -1.584  1.00 19.76  ? 338 ILE A HA     1 
ATOM   5614  H  HB     . ILE A 1 338 ? 24.325  27.164  -0.174  1.00 16.98  ? 338 ILE A HB     1 
ATOM   5615  H  HG12   . ILE A 1 338 ? 24.119  24.644  -1.422  1.00 20.98  ? 338 ILE A HG12   1 
ATOM   5616  H  HG13   . ILE A 1 338 ? 25.305  24.981  -0.422  1.00 20.98  ? 338 ILE A HG13   1 
ATOM   5617  H  HG21   . ILE A 1 338 ? 22.192  26.665  -1.006  1.00 14.20  ? 338 ILE A HG21   1 
ATOM   5618  H  HG22   . ILE A 1 338 ? 22.815  27.906  -1.779  1.00 14.20  ? 338 ILE A HG22   1 
ATOM   5619  H  HG23   . ILE A 1 338 ? 22.810  26.469  -2.457  1.00 14.20  ? 338 ILE A HG23   1 
ATOM   5620  H  HD11   . ILE A 1 338 ? 23.655  23.792  0.676   1.00 13.92  ? 338 ILE A HD11   1 
ATOM   5621  H  HD12   . ILE A 1 338 ? 23.777  25.247  1.303   1.00 13.92  ? 338 ILE A HD12   1 
ATOM   5622  H  HD13   . ILE A 1 338 ? 22.590  24.909  0.302   1.00 13.92  ? 338 ILE A HD13   1 
ATOM   5623  N  N      . SER A 1 339 ? 25.508  25.235  -3.496  1.00 26.49  ? 339 SER A N      1 
ATOM   5624  C  CA     . SER A 1 339 ? 25.334  24.569  -4.778  1.00 24.77  ? 339 SER A CA     1 
ATOM   5625  C  C      . SER A 1 339 ? 23.850  24.487  -5.115  1.00 30.85  ? 339 SER A C      1 
ATOM   5626  O  O      . SER A 1 339 ? 22.996  24.664  -4.244  1.00 36.49  ? 339 SER A O      1 
ATOM   5627  C  CB     . SER A 1 339 ? 25.948  23.168  -4.753  1.00 19.64  ? 339 SER A CB     1 
ATOM   5628  O  OG     . SER A 1 339 ? 25.228  22.313  -3.883  1.00 31.95  ? 339 SER A OG     1 
ATOM   5629  H  H      . SER A 1 339 ? 25.821  24.729  -2.875  1.00 31.79  ? 339 SER A H      1 
ATOM   5630  H  HA     . SER A 1 339 ? 25.777  25.085  -5.471  1.00 29.73  ? 339 SER A HA     1 
ATOM   5631  H  HB2    . SER A 1 339 ? 25.925  22.798  -5.649  1.00 23.57  ? 339 SER A HB2    1 
ATOM   5632  H  HB3    . SER A 1 339 ? 26.865  23.232  -4.444  1.00 23.57  ? 339 SER A HB3    1 
ATOM   5633  H  HG     . SER A 1 339 ? 24.430  22.249  -4.139  1.00 38.34  ? 339 SER A HG     1 
ATOM   5634  N  N      . ARG A 1 340 ? 23.546  24.229  -6.381  1.00 33.74  ? 340 ARG A N      1 
ATOM   5635  C  CA     . ARG A 1 340 ? 22.163  24.098  -6.810  1.00 30.65  ? 340 ARG A CA     1 
ATOM   5636  C  C      . ARG A 1 340 ? 21.652  22.679  -6.561  1.00 24.67  ? 340 ARG A C      1 
ATOM   5637  O  O      . ARG A 1 340 ? 20.489  22.490  -6.212  1.00 29.78  ? 340 ARG A O      1 
ATOM   5638  C  CB     . ARG A 1 340 ? 22.019  24.482  -8.285  1.00 26.09  ? 340 ARG A CB     1 
ATOM   5639  C  CG     . ARG A 1 340 ? 20.574  24.711  -8.710  1.00 37.35  ? 340 ARG A CG     1 
ATOM   5640  C  CD     . ARG A 1 340 ? 20.466  25.517  -9.995  1.00 44.93  ? 340 ARG A CD     1 
ATOM   5641  N  NE     . ARG A 1 340 ? 20.864  26.910  -9.791  1.00 45.38  ? 340 ARG A NE     1 
ATOM   5642  C  CZ     . ARG A 1 340 ? 22.069  27.409  -10.060 1.00 58.54  ? 340 ARG A CZ     1 
ATOM   5643  N  NH1    . ARG A 1 340 ? 23.033  26.637  -10.554 1.00 44.00  ? 340 ARG A NH1    1 
ATOM   5644  N  NH2    . ARG A 1 340 ? 22.311  28.693  -9.830  1.00 52.52  ? 340 ARG A NH2    1 
ATOM   5645  H  H      . ARG A 1 340 ? 24.123  24.125  -7.010  1.00 40.48  ? 340 ARG A H      1 
ATOM   5646  H  HA     . ARG A 1 340 ? 21.615  24.707  -6.290  1.00 36.78  ? 340 ARG A HA     1 
ATOM   5647  H  HB2    . ARG A 1 340 ? 22.510  25.303  -8.445  1.00 31.31  ? 340 ARG A HB2    1 
ATOM   5648  H  HB3    . ARG A 1 340 ? 22.382  23.768  -8.832  1.00 31.31  ? 340 ARG A HB3    1 
ATOM   5649  H  HG2    . ARG A 1 340 ? 20.148  23.852  -8.858  1.00 44.82  ? 340 ARG A HG2    1 
ATOM   5650  H  HG3    . ARG A 1 340 ? 20.110  25.196  -8.010  1.00 44.82  ? 340 ARG A HG3    1 
ATOM   5651  H  HD2    . ARG A 1 340 ? 21.050  25.130  -10.666 1.00 53.92  ? 340 ARG A HD2    1 
ATOM   5652  H  HD3    . ARG A 1 340 ? 19.546  25.506  -10.303 1.00 53.92  ? 340 ARG A HD3    1 
ATOM   5653  H  HE     . ARG A 1 340 ? 20.274  27.449  -9.472  1.00 54.46  ? 340 ARG A HE     1 
ATOM   5654  H  HH11   . ARG A 1 340 ? 22.882  25.804  -10.705 1.00 52.80  ? 340 ARG A HH11   1 
ATOM   5655  H  HH12   . ARG A 1 340 ? 23.807  26.972  -10.724 1.00 52.80  ? 340 ARG A HH12   1 
ATOM   5656  H  HH21   . ARG A 1 340 ? 21.692  29.197  -9.510  1.00 63.02  ? 340 ARG A HH21   1 
ATOM   5657  H  HH22   . ARG A 1 340 ? 23.087  29.021  -10.002 1.00 63.02  ? 340 ARG A HH22   1 
ATOM   5658  N  N      . VAL A 1 341 ? 22.521  21.685  -6.713  1.00 24.70  ? 341 VAL A N      1 
ATOM   5659  C  CA     . VAL A 1 341 ? 22.119  20.304  -6.464  1.00 27.06  ? 341 VAL A CA     1 
ATOM   5660  C  C      . VAL A 1 341 ? 22.095  19.997  -4.977  1.00 28.52  ? 341 VAL A C      1 
ATOM   5661  O  O      . VAL A 1 341 ? 22.895  20.525  -4.204  1.00 30.84  ? 341 VAL A O      1 
ATOM   5662  C  CB     . VAL A 1 341 ? 23.057  19.276  -7.147  1.00 23.13  ? 341 VAL A CB     1 
ATOM   5663  C  CG1    . VAL A 1 341 ? 22.823  19.249  -8.646  1.00 43.36  ? 341 VAL A CG1    1 
ATOM   5664  C  CG2    . VAL A 1 341 ? 24.523  19.559  -6.823  1.00 26.50  ? 341 VAL A CG2    1 
ATOM   5665  H  H      . VAL A 1 341 ? 23.340  21.781  -6.957  1.00 29.64  ? 341 VAL A H      1 
ATOM   5666  H  HA     . VAL A 1 341 ? 21.224  20.169  -6.812  1.00 32.47  ? 341 VAL A HA     1 
ATOM   5667  H  HB     . VAL A 1 341 ? 22.847  18.393  -6.804  1.00 27.76  ? 341 VAL A HB     1 
ATOM   5668  H  HG11   . VAL A 1 341 ? 23.422  18.599  -9.047  1.00 52.03  ? 341 VAL A HG11   1 
ATOM   5669  H  HG12   . VAL A 1 341 ? 21.902  19.001  -8.818  1.00 52.03  ? 341 VAL A HG12   1 
ATOM   5670  H  HG13   . VAL A 1 341 ? 23.002  20.131  -9.009  1.00 52.03  ? 341 VAL A HG13   1 
ATOM   5671  H  HG21   . VAL A 1 341 ? 25.077  18.898  -7.266  1.00 31.80  ? 341 VAL A HG21   1 
ATOM   5672  H  HG22   . VAL A 1 341 ? 24.750  20.447  -7.140  1.00 31.80  ? 341 VAL A HG22   1 
ATOM   5673  H  HG23   . VAL A 1 341 ? 24.649  19.508  -5.863  1.00 31.80  ? 341 VAL A HG23   1 
ATOM   5674  N  N      . PHE A 1 342 ? 21.153  19.150  -4.586  1.00 21.44  ? 342 PHE A N      1 
ATOM   5675  C  CA     . PHE A 1 342 ? 21.125  18.588  -3.245  1.00 30.02  ? 342 PHE A CA     1 
ATOM   5676  C  C      . PHE A 1 342 ? 20.516  17.204  -3.373  1.00 27.26  ? 342 PHE A C      1 
ATOM   5677  O  O      . PHE A 1 342 ? 19.867  16.910  -4.376  1.00 36.12  ? 342 PHE A O      1 
ATOM   5678  C  CB     . PHE A 1 342 ? 20.329  19.467  -2.273  1.00 28.57  ? 342 PHE A CB     1 
ATOM   5679  C  CG     . PHE A 1 342 ? 18.854  19.533  -2.570  1.00 32.26  ? 342 PHE A CG     1 
ATOM   5680  C  CD1    . PHE A 1 342 ? 18.366  20.375  -3.559  1.00 29.84  ? 342 PHE A CD1    1 
ATOM   5681  C  CD2    . PHE A 1 342 ? 17.953  18.761  -1.848  1.00 30.62  ? 342 PHE A CD2    1 
ATOM   5682  C  CE1    . PHE A 1 342 ? 17.010  20.438  -3.830  1.00 29.40  ? 342 PHE A CE1    1 
ATOM   5683  C  CE2    . PHE A 1 342 ? 16.597  18.822  -2.114  1.00 28.91  ? 342 PHE A CE2    1 
ATOM   5684  C  CZ     . PHE A 1 342 ? 16.126  19.661  -3.106  1.00 33.68  ? 342 PHE A CZ     1 
ATOM   5685  H  H      . PHE A 1 342 ? 20.508  18.882  -5.087  1.00 25.73  ? 342 PHE A H      1 
ATOM   5686  H  HA     . PHE A 1 342 ? 22.031  18.498  -2.910  1.00 36.02  ? 342 PHE A HA     1 
ATOM   5687  H  HB2    . PHE A 1 342 ? 20.434  19.114  -1.376  1.00 34.29  ? 342 PHE A HB2    1 
ATOM   5688  H  HB3    . PHE A 1 342 ? 20.679  20.371  -2.313  1.00 34.29  ? 342 PHE A HB3    1 
ATOM   5689  H  HD1    . PHE A 1 342 ? 18.957  20.898  -4.050  1.00 35.80  ? 342 PHE A HD1    1 
ATOM   5690  H  HD2    . PHE A 1 342 ? 18.265  18.194  -1.181  1.00 36.75  ? 342 PHE A HD2    1 
ATOM   5691  H  HE1    . PHE A 1 342 ? 16.695  21.004  -4.497  1.00 35.28  ? 342 PHE A HE1    1 
ATOM   5692  H  HE2    . PHE A 1 342 ? 16.003  18.298  -1.626  1.00 34.69  ? 342 PHE A HE2    1 
ATOM   5693  H  HZ     . PHE A 1 342 ? 15.215  19.703  -3.286  1.00 40.42  ? 342 PHE A HZ     1 
ATOM   5694  N  N      . ARG A 1 343 ? 20.713  16.357  -2.369  1.00 23.56  ? 343 ARG A N      1 
ATOM   5695  C  CA     . ARG A 1 343 ? 20.215  14.990  -2.445  1.00 34.51  ? 343 ARG A CA     1 
ATOM   5696  C  C      . ARG A 1 343 ? 18.939  14.826  -1.630  1.00 33.69  ? 343 ARG A C      1 
ATOM   5697  O  O      . ARG A 1 343 ? 18.896  15.138  -0.439  1.00 23.08  ? 343 ARG A O      1 
ATOM   5698  C  CB     . ARG A 1 343 ? 21.281  13.984  -1.989  1.00 32.43  ? 343 ARG A CB     1 
ATOM   5699  C  CG     . ARG A 1 343 ? 22.194  14.455  -0.872  1.00 45.96  ? 343 ARG A CG     1 
ATOM   5700  C  CD     . ARG A 1 343 ? 23.281  13.431  -0.611  1.00 28.54  ? 343 ARG A CD     1 
ATOM   5701  N  NE     . ARG A 1 343 ? 22.737  12.213  -0.022  1.00 38.90  ? 343 ARG A NE     1 
ATOM   5702  C  CZ     . ARG A 1 343 ? 23.426  11.089  0.145   1.00 40.08  ? 343 ARG A CZ     1 
ATOM   5703  N  NH1    . ARG A 1 343 ? 24.696  11.018  -0.234  1.00 33.49  ? 343 ARG A NH1    1 
ATOM   5704  N  NH2    . ARG A 1 343 ? 22.841  10.033  0.692   1.00 31.84  ? 343 ARG A NH2    1 
ATOM   5705  H  H      . ARG A 1 343 ? 21.128  16.547  -1.640  1.00 28.27  ? 343 ARG A H      1 
ATOM   5706  H  HA     . ARG A 1 343 ? 20.000  14.791  -3.370  1.00 41.41  ? 343 ARG A HA     1 
ATOM   5707  H  HB2    . ARG A 1 343 ? 20.833  13.182  -1.679  1.00 38.91  ? 343 ARG A HB2    1 
ATOM   5708  H  HB3    . ARG A 1 343 ? 21.842  13.767  -2.750  1.00 38.91  ? 343 ARG A HB3    1 
ATOM   5709  H  HG2    . ARG A 1 343 ? 22.615  15.291  -1.129  1.00 55.16  ? 343 ARG A HG2    1 
ATOM   5710  H  HG3    . ARG A 1 343 ? 21.678  14.570  -0.059  1.00 55.16  ? 343 ARG A HG3    1 
ATOM   5711  H  HD2    . ARG A 1 343 ? 23.710  13.199  -1.449  1.00 34.25  ? 343 ARG A HD2    1 
ATOM   5712  H  HD3    . ARG A 1 343 ? 23.929  13.804  0.007   1.00 34.25  ? 343 ARG A HD3    1 
ATOM   5713  H  HE     . ARG A 1 343 ? 21.916  12.222  0.233   1.00 46.69  ? 343 ARG A HE     1 
ATOM   5714  H  HH11   . ARG A 1 343 ? 25.078  11.703  -0.589  1.00 40.19  ? 343 ARG A HH11   1 
ATOM   5715  H  HH12   . ARG A 1 343 ? 25.138  10.289  -0.123  1.00 40.19  ? 343 ARG A HH12   1 
ATOM   5716  H  HH21   . ARG A 1 343 ? 22.018  10.076  0.938   1.00 38.21  ? 343 ARG A HH21   1 
ATOM   5717  H  HH22   . ARG A 1 343 ? 23.284  9.304   0.801   1.00 38.21  ? 343 ARG A HH22   1 
ATOM   5718  N  N      . ARG A 1 344 ? 17.897  14.359  -2.314  1.00 42.66  ? 344 ARG A N      1 
ATOM   5719  C  CA     . ARG A 1 344 ? 16.612  14.044  -1.702  1.00 39.26  ? 344 ARG A CA     1 
ATOM   5720  C  C      . ARG A 1 344 ? 16.498  12.541  -1.476  1.00 32.62  ? 344 ARG A C      1 
ATOM   5721  O  O      . ARG A 1 344 ? 16.807  11.744  -2.365  1.00 32.39  ? 344 ARG A O      1 
ATOM   5722  C  CB     . ARG A 1 344 ? 15.465  14.538  -2.587  1.00 54.02  ? 344 ARG A CB     1 
ATOM   5723  C  CG     . ARG A 1 344 ? 14.079  14.101  -2.129  1.00 60.64  ? 344 ARG A CG     1 
ATOM   5724  C  CD     . ARG A 1 344 ? 13.010  15.093  -2.570  1.00 59.69  ? 344 ARG A CD     1 
ATOM   5725  N  NE     . ARG A 1 344 ? 13.083  16.347  -1.819  1.00 77.15  ? 344 ARG A NE     1 
ATOM   5726  C  CZ     . ARG A 1 344 ? 12.520  17.491  -2.201  1.00 81.27  ? 344 ARG A CZ     1 
ATOM   5727  N  NH1    . ARG A 1 344 ? 11.844  17.561  -3.340  1.00 82.95  ? 344 ARG A NH1    1 
ATOM   5728  N  NH2    . ARG A 1 344 ? 12.641  18.573  -1.443  1.00 73.40  ? 344 ARG A NH2    1 
ATOM   5729  H  H      . ARG A 1 344 ? 17.913  14.213  -3.162  1.00 51.20  ? 344 ARG A H      1 
ATOM   5730  H  HA     . ARG A 1 344 ? 16.547  14.489  -0.843  1.00 47.12  ? 344 ARG A HA     1 
ATOM   5731  H  HB2    . ARG A 1 344 ? 15.478  15.508  -2.600  1.00 64.83  ? 344 ARG A HB2    1 
ATOM   5732  H  HB3    . ARG A 1 344 ? 15.598  14.198  -3.486  1.00 64.83  ? 344 ARG A HB3    1 
ATOM   5733  H  HG2    . ARG A 1 344 ? 13.870  13.237  -2.518  1.00 72.76  ? 344 ARG A HG2    1 
ATOM   5734  H  HG3    . ARG A 1 344 ? 14.063  14.047  -1.161  1.00 72.76  ? 344 ARG A HG3    1 
ATOM   5735  H  HD2    . ARG A 1 344 ? 13.133  15.297  -3.511  1.00 71.62  ? 344 ARG A HD2    1 
ATOM   5736  H  HD3    . ARG A 1 344 ? 12.134  14.704  -2.424  1.00 71.62  ? 344 ARG A HD3    1 
ATOM   5737  H  HE     . ARG A 1 344 ? 13.521  16.344  -1.079  1.00 92.58  ? 344 ARG A HE     1 
ATOM   5738  H  HH11   . ARG A 1 344 ? 11.762  16.863  -3.835  1.00 99.54  ? 344 ARG A HH11   1 
ATOM   5739  H  HH12   . ARG A 1 344 ? 11.485  18.304  -3.582  1.00 99.54  ? 344 ARG A HH12   1 
ATOM   5740  H  HH21   . ARG A 1 344 ? 13.080  18.534  -0.705  1.00 88.08  ? 344 ARG A HH21   1 
ATOM   5741  H  HH22   . ARG A 1 344 ? 12.281  19.314  -1.691  1.00 88.08  ? 344 ARG A HH22   1 
ATOM   5742  N  N      . MET A 1 345 ? 16.032  12.159  -0.292  1.00 25.84  ? 345 MET A N      1 
ATOM   5743  C  CA     . MET A 1 345 ? 15.973  10.752  0.084   1.00 29.20  ? 345 MET A CA     1 
ATOM   5744  C  C      . MET A 1 345 ? 14.815  10.025  -0.591  1.00 45.48  ? 345 MET A C      1 
ATOM   5745  O  O      . MET A 1 345 ? 13.706  10.553  -0.691  1.00 44.84  ? 345 MET A O      1 
ATOM   5746  C  CB     . MET A 1 345 ? 15.845  10.617  1.603   1.00 27.75  ? 345 MET A CB     1 
ATOM   5747  C  CG     . MET A 1 345 ? 15.946  9.185   2.112   1.00 39.28  ? 345 MET A CG     1 
ATOM   5748  S  SD     . MET A 1 345 ? 15.921  9.065   3.914   1.00 60.92  ? 345 MET A SD     1 
ATOM   5749  C  CE     . MET A 1 345 ? 14.339  9.827   4.293   1.00 48.14  ? 345 MET A CE     1 
ATOM   5750  H  H      . MET A 1 345 ? 15.743  12.697  0.314   1.00 31.01  ? 345 MET A H      1 
ATOM   5751  H  HA     . MET A 1 345 ? 16.804  10.325  -0.180  1.00 35.04  ? 345 MET A HA     1 
ATOM   5752  H  HB2    . MET A 1 345 ? 16.554  11.130  2.022   1.00 33.30  ? 345 MET A HB2    1 
ATOM   5753  H  HB3    . MET A 1 345 ? 14.983  10.968  1.875   1.00 33.30  ? 345 MET A HB3    1 
ATOM   5754  H  HG2    . MET A 1 345 ? 15.195  8.676   1.769   1.00 47.14  ? 345 MET A HG2    1 
ATOM   5755  H  HG3    . MET A 1 345 ? 16.778  8.798   1.799   1.00 47.14  ? 345 MET A HG3    1 
ATOM   5756  H  HE1    . MET A 1 345 ? 14.209  9.821   5.254   1.00 57.77  ? 345 MET A HE1    1 
ATOM   5757  H  HE2    . MET A 1 345 ? 14.342  10.739  3.965   1.00 57.77  ? 345 MET A HE2    1 
ATOM   5758  H  HE3    . MET A 1 345 ? 13.634  9.321   3.860   1.00 57.77  ? 345 MET A HE3    1 
ATOM   5759  N  N      . GLY A 1 346 ? 15.091  8.805   -1.045  1.00 51.82  ? 346 GLY A N      1 
ATOM   5760  C  CA     . GLY A 1 346 ? 14.087  7.946   -1.646  1.00 39.54  ? 346 GLY A CA     1 
ATOM   5761  C  C      . GLY A 1 346 ? 13.783  6.766   -0.740  1.00 42.08  ? 346 GLY A C      1 
ATOM   5762  O  O      . GLY A 1 346 ? 14.299  6.687   0.376   1.00 36.89  ? 346 GLY A O      1 
ATOM   5763  H  H      . GLY A 1 346 ? 15.873  8.448   -1.012  1.00 62.19  ? 346 GLY A H      1 
ATOM   5764  H  HA2    . GLY A 1 346 ? 13.270  8.447   -1.792  1.00 47.44  ? 346 GLY A HA2    1 
ATOM   5765  H  HA3    . GLY A 1 346 ? 14.407  7.612   -2.499  1.00 47.44  ? 346 GLY A HA3    1 
ATOM   5766  N  N      . PRO A 1 347 ? 12.938  5.840   -1.217  1.00 51.58  ? 347 PRO A N      1 
ATOM   5767  C  CA     . PRO A 1 347 ? 12.506  4.663   -0.449  1.00 60.87  ? 347 PRO A CA     1 
ATOM   5768  C  C      . PRO A 1 347 ? 13.530  3.527   -0.435  1.00 54.93  ? 347 PRO A C      1 
ATOM   5769  O  O      . PRO A 1 347 ? 14.426  3.505   -1.280  1.00 56.13  ? 347 PRO A O      1 
ATOM   5770  C  CB     . PRO A 1 347 ? 11.234  4.228   -1.178  1.00 54.38  ? 347 PRO A CB     1 
ATOM   5771  C  CG     . PRO A 1 347 ? 11.447  4.667   -2.591  1.00 45.34  ? 347 PRO A CG     1 
ATOM   5772  C  CD     . PRO A 1 347 ? 12.273  5.922   -2.530  1.00 43.11  ? 347 PRO A CD     1 
ATOM   5773  H  HA     . PRO A 1 347 ? 12.287  4.914   0.462   1.00 73.05  ? 347 PRO A HA     1 
ATOM   5774  H  HB2    . PRO A 1 347 ? 11.139  3.264   -1.127  1.00 65.26  ? 347 PRO A HB2    1 
ATOM   5775  H  HB3    . PRO A 1 347 ? 10.464  4.673   -0.791  1.00 65.26  ? 347 PRO A HB3    1 
ATOM   5776  H  HG2    . PRO A 1 347 ? 11.921  3.974   -3.076  1.00 54.41  ? 347 PRO A HG2    1 
ATOM   5777  H  HG3    . PRO A 1 347 ? 10.589  4.846   -3.006  1.00 54.41  ? 347 PRO A HG3    1 
ATOM   5778  H  HD2    . PRO A 1 347 ? 12.931  5.927   -3.242  1.00 51.73  ? 347 PRO A HD2    1 
ATOM   5779  H  HD3    . PRO A 1 347 ? 11.700  6.704   -2.570  1.00 51.73  ? 347 PRO A HD3    1 
ATOM   5780  N  N      . GLN A 1 348 ? 13.389  2.596   0.509   1.00 35.75  ? 348 GLN A N      1 
ATOM   5781  C  CA     . GLN A 1 348 ? 14.246  1.413   0.554   1.00 26.78  ? 348 GLN A CA     1 
ATOM   5782  C  C      . GLN A 1 348 ? 13.996  0.517   -0.660  1.00 44.09  ? 348 GLN A C      1 
ATOM   5783  O  O      . GLN A 1 348 ? 12.899  0.507   -1.218  1.00 59.09  ? 348 GLN A O      1 
ATOM   5784  C  CB     . GLN A 1 348 ? 14.018  0.632   1.847   1.00 39.71  ? 348 GLN A CB     1 
ATOM   5785  C  CG     . GLN A 1 348 ? 14.291  1.444   3.101   1.00 54.03  ? 348 GLN A CG     1 
ATOM   5786  C  CD     . GLN A 1 348 ? 14.408  0.582   4.344   1.00 64.62  ? 348 GLN A CD     1 
ATOM   5787  O  OE1    . GLN A 1 348 ? 13.657  -0.378  4.524   1.00 72.18  ? 348 GLN A OE1    1 
ATOM   5788  N  NE2    . GLN A 1 348 ? 15.361  0.919   5.208   1.00 47.11  ? 348 GLN A NE2    1 
ATOM   5789  H  H      . GLN A 1 348 ? 12.803  2.628   1.137   1.00 42.90  ? 348 GLN A H      1 
ATOM   5790  H  HA     . GLN A 1 348 ? 15.174  1.694   0.533   1.00 32.14  ? 348 GLN A HA     1 
ATOM   5791  H  HB2    . GLN A 1 348 ? 13.094  0.339   1.877   1.00 47.65  ? 348 GLN A HB2    1 
ATOM   5792  H  HB3    . GLN A 1 348 ? 14.608  -0.138  1.856   1.00 47.65  ? 348 GLN A HB3    1 
ATOM   5793  H  HG2    . GLN A 1 348 ? 15.126  1.925   2.990   1.00 64.83  ? 348 GLN A HG2    1 
ATOM   5794  H  HG3    . GLN A 1 348 ? 13.563  2.070   3.237   1.00 64.83  ? 348 GLN A HG3    1 
ATOM   5795  H  HE21   . GLN A 1 348 ? 15.870  1.593   5.047   1.00 56.53  ? 348 GLN A HE21   1 
ATOM   5796  H  HE22   . GLN A 1 348 ? 15.469  0.462   5.929   1.00 56.53  ? 348 GLN A HE22   1 
ATOM   5797  N  N      . PHE A 1 349 ? 15.017  -0.232  -1.069  1.00 52.80  ? 349 PHE A N      1 
ATOM   5798  C  CA     . PHE A 1 349 ? 14.958  -0.998  -2.313  1.00 43.72  ? 349 PHE A CA     1 
ATOM   5799  C  C      . PHE A 1 349 ? 13.899  -2.105  -2.279  1.00 50.17  ? 349 PHE A C      1 
ATOM   5800  O  O      . PHE A 1 349 ? 13.521  -2.628  -3.328  1.00 53.36  ? 349 PHE A O      1 
ATOM   5801  C  CB     . PHE A 1 349 ? 16.333  -1.609  -2.624  1.00 43.47  ? 349 PHE A CB     1 
ATOM   5802  C  CG     . PHE A 1 349 ? 16.704  -2.773  -1.736  1.00 43.57  ? 349 PHE A CG     1 
ATOM   5803  C  CD1    . PHE A 1 349 ? 17.293  -2.561  -0.497  1.00 46.87  ? 349 PHE A CD1    1 
ATOM   5804  C  CD2    . PHE A 1 349 ? 16.473  -4.079  -2.147  1.00 43.42  ? 349 PHE A CD2    1 
ATOM   5805  C  CE1    . PHE A 1 349 ? 17.635  -3.631  0.320   1.00 53.18  ? 349 PHE A CE1    1 
ATOM   5806  C  CE2    . PHE A 1 349 ? 16.813  -5.152  -1.334  1.00 50.00  ? 349 PHE A CE2    1 
ATOM   5807  C  CZ     . PHE A 1 349 ? 17.395  -4.927  -0.100  1.00 50.59  ? 349 PHE A CZ     1 
ATOM   5808  H  H      . PHE A 1 349 ? 15.759  -0.314  -0.642  1.00 63.36  ? 349 PHE A H      1 
ATOM   5809  H  HA     . PHE A 1 349 ? 14.731  -0.395  -3.038  1.00 52.46  ? 349 PHE A HA     1 
ATOM   5810  H  HB2    . PHE A 1 349 ? 16.333  -1.924  -3.541  1.00 52.17  ? 349 PHE A HB2    1 
ATOM   5811  H  HB3    . PHE A 1 349 ? 17.011  -0.924  -2.513  1.00 52.17  ? 349 PHE A HB3    1 
ATOM   5812  H  HD1    . PHE A 1 349 ? 17.455  -1.692  -0.208  1.00 56.25  ? 349 PHE A HD1    1 
ATOM   5813  H  HD2    . PHE A 1 349 ? 16.080  -4.237  -2.975  1.00 52.10  ? 349 PHE A HD2    1 
ATOM   5814  H  HE1    . PHE A 1 349 ? 18.027  -3.476  1.149   1.00 63.81  ? 349 PHE A HE1    1 
ATOM   5815  H  HE2    . PHE A 1 349 ? 16.651  -6.022  -1.620  1.00 60.00  ? 349 PHE A HE2    1 
ATOM   5816  H  HZ     . PHE A 1 349 ? 17.625  -5.644  0.445   1.00 60.70  ? 349 PHE A HZ     1 
ATOM   5817  N  N      . GLU A 1 350 ? 13.420  -2.457  -1.085  1.00 53.15  ? 350 GLU A N      1 
ATOM   5818  C  CA     . GLU A 1 350 ? 12.464  -3.559  -0.937  1.00 47.15  ? 350 GLU A CA     1 
ATOM   5819  C  C      . GLU A 1 350 ? 11.125  -3.295  -1.636  1.00 59.76  ? 350 GLU A C      1 
ATOM   5820  O  O      . GLU A 1 350 ? 10.836  -3.902  -2.668  1.00 51.58  ? 350 GLU A O      1 
ATOM   5821  C  CB     . GLU A 1 350 ? 12.203  -3.858  0.547   1.00 48.19  ? 350 GLU A CB     1 
ATOM   5822  C  CG     . GLU A 1 350 ? 13.243  -4.765  1.216   1.00 42.48  ? 350 GLU A CG     1 
ATOM   5823  C  CD     . GLU A 1 350 ? 14.435  -4.012  1.790   1.00 56.84  ? 350 GLU A CD     1 
ATOM   5824  O  OE1    . GLU A 1 350 ? 14.515  -2.776  1.617   1.00 59.62  ? 350 GLU A OE1    1 
ATOM   5825  O  OE2    . GLU A 1 350 ? 15.300  -4.667  2.417   1.00 44.59  ? 350 GLU A OE2    1 
ATOM   5826  H  H      . GLU A 1 350 ? 13.632  -2.074  -0.344  1.00 63.79  ? 350 GLU A H      1 
ATOM   5827  H  HA     . GLU A 1 350 ? 12.849  -4.356  -1.333  1.00 56.58  ? 350 GLU A HA     1 
ATOM   5828  H  HB2    . GLU A 1 350 ? 12.191  -3.019  1.034   1.00 57.83  ? 350 GLU A HB2    1 
ATOM   5829  H  HB3    . GLU A 1 350 ? 11.340  -4.293  0.627   1.00 57.83  ? 350 GLU A HB3    1 
ATOM   5830  H  HG2    . GLU A 1 350 ? 12.818  -5.246  1.943   1.00 50.97  ? 350 GLU A HG2    1 
ATOM   5831  H  HG3    . GLU A 1 350 ? 13.579  -5.393  0.558   1.00 50.97  ? 350 GLU A HG3    1 
ATOM   5832  N  N      . ASP A 1 351 ? 10.311  -2.398  -1.077  1.00 64.95  ? 351 ASP A N      1 
ATOM   5833  C  CA     . ASP A 1 351 ? 8.951   -2.175  -1.586  1.00 77.13  ? 351 ASP A CA     1 
ATOM   5834  C  C      . ASP A 1 351 ? 8.956   -1.406  -2.910  1.00 61.83  ? 351 ASP A C      1 
ATOM   5835  O  O      . ASP A 1 351 ? 8.995   -0.173  -2.933  1.00 39.15  ? 351 ASP A O      1 
ATOM   5836  C  CB     . ASP A 1 351 ? 8.097   -1.440  -0.543  1.00 78.38  ? 351 ASP A CB     1 
ATOM   5837  C  CG     . ASP A 1 351 ? 8.763   -0.184  -0.009  1.00 73.31  ? 351 ASP A CG     1 
ATOM   5838  O  OD1    . ASP A 1 351 ? 9.739   -0.307  0.761   1.00 81.51  ? 351 ASP A OD1    1 
ATOM   5839  O  OD2    . ASP A 1 351 ? 8.301   0.924   -0.351  1.00 56.47  ? 351 ASP A OD2    1 
ATOM   5840  H  H      . ASP A 1 351 ? 10.520  -1.905  -0.404  1.00 77.94  ? 351 ASP A H      1 
ATOM   5841  H  HA     . ASP A 1 351 ? 8.537   -3.037  -1.749  1.00 92.56  ? 351 ASP A HA     1 
ATOM   5842  H  HB2    . ASP A 1 351 ? 7.255   -1.182  -0.950  1.00 94.05  ? 351 ASP A HB2    1 
ATOM   5843  H  HB3    . ASP A 1 351 ? 7.934   -2.034  0.206   1.00 94.05  ? 351 ASP A HB3    1 
ATOM   5844  N  N      . GLU A 1 352 ? 8.880   -2.156  -4.008  1.00 63.89  ? 352 GLU A N      1 
ATOM   5845  C  CA     . GLU A 1 352 ? 9.072   -1.610  -5.351  1.00 59.30  ? 352 GLU A CA     1 
ATOM   5846  C  C      . GLU A 1 352 ? 7.983   -0.638  -5.793  1.00 58.25  ? 352 GLU A C      1 
ATOM   5847  O  O      . GLU A 1 352 ? 8.202   0.164   -6.703  1.00 56.34  ? 352 GLU A O      1 
ATOM   5848  C  CB     . GLU A 1 352 ? 9.165   -2.747  -6.370  1.00 58.35  ? 352 GLU A CB     1 
ATOM   5849  C  CG     . GLU A 1 352 ? 7.965   -3.675  -6.408  1.00 47.24  ? 352 GLU A CG     1 
ATOM   5850  C  CD     . GLU A 1 352 ? 8.089   -4.721  -7.500  1.00 73.11  ? 352 GLU A CD     1 
ATOM   5851  O  OE1    . GLU A 1 352 ? 8.513   -4.365  -8.623  1.00 61.44  ? 352 GLU A OE1    1 
ATOM   5852  O  OE2    . GLU A 1 352 ? 7.766   -5.898  -7.234  1.00 89.33  ? 352 GLU A OE2    1 
ATOM   5853  H  H      . GLU A 1 352 ? 8.716   -3.000  -4.001  1.00 76.67  ? 352 GLU A H      1 
ATOM   5854  H  HA     . GLU A 1 352 ? 9.915   -1.130  -5.369  1.00 71.16  ? 352 GLU A HA     1 
ATOM   5855  H  HB2    . GLU A 1 352 ? 9.265   -2.361  -7.254  1.00 70.02  ? 352 GLU A HB2    1 
ATOM   5856  H  HB3    . GLU A 1 352 ? 9.945   -3.286  -6.161  1.00 70.02  ? 352 GLU A HB3    1 
ATOM   5857  H  HG2    . GLU A 1 352 ? 7.891   -4.133  -5.557  1.00 56.68  ? 352 GLU A HG2    1 
ATOM   5858  H  HG3    . GLU A 1 352 ? 7.165   -3.153  -6.578  1.00 56.68  ? 352 GLU A HG3    1 
ATOM   5859  N  N      . ARG A 1 353 ? 6.809   -0.728  -5.172  1.00 65.07  ? 353 ARG A N      1 
ATOM   5860  C  CA     . ARG A 1 353 ? 5.693   0.149   -5.521  1.00 65.16  ? 353 ARG A CA     1 
ATOM   5861  C  C      . ARG A 1 353 ? 6.084   1.604   -5.301  1.00 68.00  ? 353 ARG A C      1 
ATOM   5862  O  O      . ARG A 1 353 ? 5.785   2.470   -6.126  1.00 66.50  ? 353 ARG A O      1 
ATOM   5863  C  CB     . ARG A 1 353 ? 4.442   -0.204  -4.711  1.00 76.56  ? 353 ARG A CB     1 
ATOM   5864  C  CG     . ARG A 1 353 ? 3.712   -1.438  -5.229  1.00 85.65  ? 353 ARG A CG     1 
ATOM   5865  C  CD     . ARG A 1 353 ? 2.406   -1.686  -4.491  1.00 94.87  ? 353 ARG A CD     1 
ATOM   5866  N  NE     . ARG A 1 353 ? 1.748   -2.906  -4.953  1.00 107.49 ? 353 ARG A NE     1 
ATOM   5867  C  CZ     . ARG A 1 353 ? 0.704   -3.470  -4.354  1.00 112.07 ? 353 ARG A CZ     1 
ATOM   5868  N  NH1    . ARG A 1 353 ? 0.189   -2.929  -3.258  1.00 106.40 ? 353 ARG A NH1    1 
ATOM   5869  N  NH2    . ARG A 1 353 ? 0.176   -4.581  -4.850  1.00 98.49  ? 353 ARG A NH2    1 
ATOM   5870  H  H      . ARG A 1 353 ? 6.633   -1.289  -4.544  1.00 78.09  ? 353 ARG A H      1 
ATOM   5871  H  HA     . ARG A 1 353 ? 5.483   0.033   -6.461  1.00 78.19  ? 353 ARG A HA     1 
ATOM   5872  H  HB2    . ARG A 1 353 ? 4.701   -0.375  -3.792  1.00 91.87  ? 353 ARG A HB2    1 
ATOM   5873  H  HB3    . ARG A 1 353 ? 3.825   0.544   -4.745  1.00 91.87  ? 353 ARG A HB3    1 
ATOM   5874  H  HG2    . ARG A 1 353 ? 3.508   -1.315  -6.169  1.00 102.79 ? 353 ARG A HG2    1 
ATOM   5875  H  HG3    . ARG A 1 353 ? 4.278   -2.216  -5.110  1.00 102.79 ? 353 ARG A HG3    1 
ATOM   5876  H  HD2    . ARG A 1 353 ? 2.588   -1.781  -3.543  1.00 113.84 ? 353 ARG A HD2    1 
ATOM   5877  H  HD3    . ARG A 1 353 ? 1.805   -0.941  -4.644  1.00 113.84 ? 353 ARG A HD3    1 
ATOM   5878  H  HE     . ARG A 1 353 ? 2.058   -3.285  -5.661  1.00 128.98 ? 353 ARG A HE     1 
ATOM   5879  H  HH11   . ARG A 1 353 ? 0.529   -2.209  -2.933  1.00 127.68 ? 353 ARG A HH11   1 
ATOM   5880  H  HH12   . ARG A 1 353 ? -0.486  -3.298  -2.874  1.00 127.68 ? 353 ARG A HH12   1 
ATOM   5881  H  HH21   . ARG A 1 353 ? 0.507   -4.936  -5.560  1.00 118.19 ? 353 ARG A HH21   1 
ATOM   5882  H  HH22   . ARG A 1 353 ? -0.500  -4.946  -4.462  1.00 118.19 ? 353 ARG A HH22   1 
ATOM   5883  N  N      . ASN A 1 354 ? 6.753   1.865   -4.184  1.00 68.50  ? 354 ASN A N      1 
ATOM   5884  C  CA     . ASN A 1 354 ? 7.213   3.210   -3.874  1.00 65.49  ? 354 ASN A CA     1 
ATOM   5885  C  C      . ASN A 1 354 ? 8.437   3.575   -4.706  1.00 56.63  ? 354 ASN A C      1 
ATOM   5886  O  O      . ASN A 1 354 ? 8.566   4.709   -5.171  1.00 49.84  ? 354 ASN A O      1 
ATOM   5887  C  CB     . ASN A 1 354 ? 7.547   3.327   -2.387  1.00 71.07  ? 354 ASN A CB     1 
ATOM   5888  C  CG     . ASN A 1 354 ? 6.327   3.175   -1.501  1.00 80.30  ? 354 ASN A CG     1 
ATOM   5889  O  OD1    . ASN A 1 354 ? 5.211   3.510   -1.900  1.00 78.18  ? 354 ASN A OD1    1 
ATOM   5890  N  ND2    . ASN A 1 354 ? 6.532   2.666   -0.290  1.00 72.10  ? 354 ASN A ND2    1 
ATOM   5891  H  H      . ASN A 1 354 ? 6.952   1.279   -3.587  1.00 82.20  ? 354 ASN A H      1 
ATOM   5892  H  HA     . ASN A 1 354 ? 6.508   3.843   -4.078  1.00 78.59  ? 354 ASN A HA     1 
ATOM   5893  H  HB2    . ASN A 1 354 ? 8.180   2.632   -2.149  1.00 85.29  ? 354 ASN A HB2    1 
ATOM   5894  H  HB3    . ASN A 1 354 ? 7.933   4.201   -2.218  1.00 85.29  ? 354 ASN A HB3    1 
ATOM   5895  H  HD21   . ASN A 1 354 ? 5.871   2.559   0.250   1.00 86.52  ? 354 ASN A HD21   1 
ATOM   5896  H  HD22   . ASN A 1 354 ? 7.326   2.443   -0.047  1.00 86.52  ? 354 ASN A HD22   1 
ATOM   5897  N  N      . VAL A 1 355 ? 9.327   2.606   -4.901  1.00 56.44  ? 355 VAL A N      1 
ATOM   5898  C  CA     . VAL A 1 355 ? 10.534  2.827   -5.691  1.00 56.28  ? 355 VAL A CA     1 
ATOM   5899  C  C      . VAL A 1 355 ? 10.178  3.152   -7.139  1.00 50.14  ? 355 VAL A C      1 
ATOM   5900  O  O      . VAL A 1 355 ? 10.795  4.022   -7.754  1.00 42.50  ? 355 VAL A O      1 
ATOM   5901  C  CB     . VAL A 1 355 ? 11.476  1.601   -5.665  1.00 49.61  ? 355 VAL A CB     1 
ATOM   5902  C  CG1    . VAL A 1 355 ? 12.743  1.888   -6.465  1.00 39.87  ? 355 VAL A CG1    1 
ATOM   5903  C  CG2    . VAL A 1 355 ? 11.845  1.233   -4.234  1.00 45.25  ? 355 VAL A CG2    1 
ATOM   5904  H  H      . VAL A 1 355 ? 9.255   1.809   -4.586  1.00 67.73  ? 355 VAL A H      1 
ATOM   5905  H  HA     . VAL A 1 355 ? 11.017  3.583   -5.324  1.00 67.53  ? 355 VAL A HA     1 
ATOM   5906  H  HB     . VAL A 1 355 ? 11.026  0.842   -6.068  1.00 59.53  ? 355 VAL A HB     1 
ATOM   5907  H  HG11   . VAL A 1 355 ? 13.318  1.107   -6.436  1.00 47.85  ? 355 VAL A HG11   1 
ATOM   5908  H  HG12   . VAL A 1 355 ? 12.498  2.084   -7.383  1.00 47.85  ? 355 VAL A HG12   1 
ATOM   5909  H  HG13   . VAL A 1 355 ? 13.197  2.650   -6.074  1.00 47.85  ? 355 VAL A HG13   1 
ATOM   5910  H  HG21   . VAL A 1 355 ? 12.435  0.463   -4.249  1.00 54.30  ? 355 VAL A HG21   1 
ATOM   5911  H  HG22   . VAL A 1 355 ? 12.294  1.987   -3.821  1.00 54.30  ? 355 VAL A HG22   1 
ATOM   5912  H  HG23   . VAL A 1 355 ? 11.035  1.021   -3.744  1.00 54.30  ? 355 VAL A HG23   1 
ATOM   5913  N  N      . LYS A 1 356 ? 9.184   2.453   -7.680  1.00 55.85  ? 356 LYS A N      1 
ATOM   5914  C  CA     . LYS A 1 356 ? 8.782   2.671   -9.064  1.00 56.89  ? 356 LYS A CA     1 
ATOM   5915  C  C      . LYS A 1 356 ? 8.250   4.088   -9.231  1.00 56.93  ? 356 LYS A C      1 
ATOM   5916  O  O      . LYS A 1 356 ? 8.554   4.762   -10.218 1.00 48.65  ? 356 LYS A O      1 
ATOM   5917  C  CB     . LYS A 1 356 ? 7.724   1.654   -9.498  1.00 55.35  ? 356 LYS A CB     1 
ATOM   5918  C  CG     . LYS A 1 356 ? 7.579   1.549   -11.009 1.00 58.67  ? 356 LYS A CG     1 
ATOM   5919  C  CD     . LYS A 1 356 ? 6.707   0.375   -11.418 1.00 77.50  ? 356 LYS A CD     1 
ATOM   5920  C  CE     . LYS A 1 356 ? 6.850   0.076   -12.905 1.00 89.57  ? 356 LYS A CE     1 
ATOM   5921  N  NZ     . LYS A 1 356 ? 6.130   -1.165  -13.308 1.00 57.28  ? 356 LYS A NZ     1 
ATOM   5922  H  H      . LYS A 1 356 ? 8.728   1.851   -7.269  1.00 67.02  ? 356 LYS A H      1 
ATOM   5923  H  HA     . LYS A 1 356 ? 9.556   2.569   -9.640  1.00 68.27  ? 356 LYS A HA     1 
ATOM   5924  H  HB2    . LYS A 1 356 ? 7.972   0.779   -9.160  1.00 66.42  ? 356 LYS A HB2    1 
ATOM   5925  H  HB3    . LYS A 1 356 ? 6.865   1.918   -9.134  1.00 66.42  ? 356 LYS A HB3    1 
ATOM   5926  H  HG2    . LYS A 1 356 ? 7.171   2.361   -11.346 1.00 70.40  ? 356 LYS A HG2    1 
ATOM   5927  H  HG3    . LYS A 1 356 ? 8.456   1.426   -11.405 1.00 70.40  ? 356 LYS A HG3    1 
ATOM   5928  H  HD2    . LYS A 1 356 ? 6.976   -0.414  -10.922 1.00 93.00  ? 356 LYS A HD2    1 
ATOM   5929  H  HD3    . LYS A 1 356 ? 5.778   0.586   -11.238 1.00 93.00  ? 356 LYS A HD3    1 
ATOM   5930  H  HE2    . LYS A 1 356 ? 6.483   0.816   -13.413 1.00 107.49 ? 356 LYS A HE2    1 
ATOM   5931  H  HE3    . LYS A 1 356 ? 7.789   -0.040  -13.116 1.00 107.49 ? 356 LYS A HE3    1 
ATOM   5932  H  HZ1    . LYS A 1 356 ? 6.452   -1.863  -12.860 1.00 68.74  ? 356 LYS A HZ1    1 
ATOM   5933  H  HZ2    . LYS A 1 356 ? 5.261   -1.083  -13.130 1.00 68.74  ? 356 LYS A HZ2    1 
ATOM   5934  H  HZ3    . LYS A 1 356 ? 6.235   -1.307  -14.180 1.00 68.74  ? 356 LYS A HZ3    1 
ATOM   5935  N  N      . LYS A 1 357 ? 7.476   4.540   -8.249  1.00 48.87  ? 357 LYS A N      1 
ATOM   5936  C  CA     . LYS A 1 357 ? 6.948   5.900   -8.252  1.00 55.92  ? 357 LYS A CA     1 
ATOM   5937  C  C      . LYS A 1 357 ? 8.084   6.916   -8.151  1.00 45.95  ? 357 LYS A C      1 
ATOM   5938  O  O      . LYS A 1 357 ? 8.083   7.935   -8.840  1.00 44.42  ? 357 LYS A O      1 
ATOM   5939  C  CB     . LYS A 1 357 ? 5.962   6.096   -7.094  1.00 64.92  ? 357 LYS A CB     1 
ATOM   5940  C  CG     . LYS A 1 357 ? 4.672   5.283   -7.206  1.00 68.31  ? 357 LYS A CG     1 
ATOM   5941  C  CD     . LYS A 1 357 ? 3.656   5.935   -8.138  1.00 67.18  ? 357 LYS A CD     1 
ATOM   5942  C  CE     . LYS A 1 357 ? 2.335   5.171   -8.142  1.00 71.37  ? 357 LYS A CE     1 
ATOM   5943  N  NZ     . LYS A 1 357 ? 1.307   5.809   -9.012  1.00 50.65  ? 357 LYS A NZ     1 
ATOM   5944  H  H      . LYS A 1 357 ? 7.240   4.075   -7.564  1.00 58.64  ? 357 LYS A H      1 
ATOM   5945  H  HA     . LYS A 1 357 ? 6.474   6.056   -9.084  1.00 67.10  ? 357 LYS A HA     1 
ATOM   5946  H  HB2    . LYS A 1 357 ? 6.399   5.838   -6.268  1.00 77.90  ? 357 LYS A HB2    1 
ATOM   5947  H  HB3    . LYS A 1 357 ? 5.715   7.033   -7.053  1.00 77.90  ? 357 LYS A HB3    1 
ATOM   5948  H  HG2    . LYS A 1 357 ? 4.881   4.403   -7.556  1.00 81.97  ? 357 LYS A HG2    1 
ATOM   5949  H  HG3    . LYS A 1 357 ? 4.268   5.205   -6.328  1.00 81.97  ? 357 LYS A HG3    1 
ATOM   5950  H  HD2    . LYS A 1 357 ? 3.483   6.841   -7.840  1.00 80.61  ? 357 LYS A HD2    1 
ATOM   5951  H  HD3    . LYS A 1 357 ? 4.007   5.939   -9.043  1.00 80.61  ? 357 LYS A HD3    1 
ATOM   5952  H  HE2    . LYS A 1 357 ? 2.490   4.271   -8.470  1.00 85.64  ? 357 LYS A HE2    1 
ATOM   5953  H  HE3    . LYS A 1 357 ? 1.985   5.140   -7.238  1.00 85.64  ? 357 LYS A HE3    1 
ATOM   5954  H  HZ1    . LYS A 1 357 ? 0.553   5.336   -8.988  1.00 60.78  ? 357 LYS A HZ1    1 
ATOM   5955  H  HZ2    . LYS A 1 357 ? 1.139   6.636   -8.729  1.00 60.78  ? 357 LYS A HZ2    1 
ATOM   5956  H  HZ3    . LYS A 1 357 ? 1.599   5.844   -9.852  1.00 60.78  ? 357 LYS A HZ3    1 
ATOM   5957  N  N      . PHE A 1 358 ? 9.062   6.615   -7.302  1.00 49.45  ? 358 PHE A N      1 
ATOM   5958  C  CA     . PHE A 1 358 ? 10.182  7.517   -7.046  1.00 48.00  ? 358 PHE A CA     1 
ATOM   5959  C  C      . PHE A 1 358 ? 11.041  7.711   -8.293  1.00 46.33  ? 358 PHE A C      1 
ATOM   5960  O  O      . PHE A 1 358 ? 11.372  8.840   -8.663  1.00 53.41  ? 358 PHE A O      1 
ATOM   5961  C  CB     . PHE A 1 358 ? 11.036  6.971   -5.894  1.00 51.70  ? 358 PHE A CB     1 
ATOM   5962  C  CG     . PHE A 1 358 ? 12.121  7.911   -5.426  1.00 60.09  ? 358 PHE A CG     1 
ATOM   5963  C  CD1    . PHE A 1 358 ? 11.813  9.020   -4.653  1.00 56.57  ? 358 PHE A CD1    1 
ATOM   5964  C  CD2    . PHE A 1 358 ? 13.449  7.672   -5.744  1.00 60.71  ? 358 PHE A CD2    1 
ATOM   5965  C  CE1    . PHE A 1 358 ? 12.809  9.879   -4.214  1.00 43.52  ? 358 PHE A CE1    1 
ATOM   5966  C  CE2    . PHE A 1 358 ? 14.449  8.526   -5.309  1.00 58.14  ? 358 PHE A CE2    1 
ATOM   5967  C  CZ     . PHE A 1 358 ? 14.127  9.631   -4.542  1.00 50.91  ? 358 PHE A CZ     1 
ATOM   5968  H  H      . PHE A 1 358 ? 9.101   5.881   -6.854  1.00 59.34  ? 358 PHE A H      1 
ATOM   5969  H  HA     . PHE A 1 358 ? 9.837   8.384   -6.780  1.00 57.61  ? 358 PHE A HA     1 
ATOM   5970  H  HB2    . PHE A 1 358 ? 10.458  6.788   -5.137  1.00 62.04  ? 358 PHE A HB2    1 
ATOM   5971  H  HB3    . PHE A 1 358 ? 11.463  6.150   -6.185  1.00 62.04  ? 358 PHE A HB3    1 
ATOM   5972  H  HD1    . PHE A 1 358 ? 10.927  9.191   -4.428  1.00 67.89  ? 358 PHE A HD1    1 
ATOM   5973  H  HD2    . PHE A 1 358 ? 13.672  6.930   -6.259  1.00 72.85  ? 358 PHE A HD2    1 
ATOM   5974  H  HE1    . PHE A 1 358 ? 12.589  10.621  -3.698  1.00 52.23  ? 358 PHE A HE1    1 
ATOM   5975  H  HE2    . PHE A 1 358 ? 15.336  8.357   -5.532  1.00 69.76  ? 358 PHE A HE2    1 
ATOM   5976  H  HZ     . PHE A 1 358 ? 14.796  10.207  -4.249  1.00 61.09  ? 358 PHE A HZ     1 
ATOM   5977  N  N      . LEU A 1 359 ? 11.394  6.605   -8.941  1.00 44.98  ? 359 LEU A N      1 
ATOM   5978  C  CA     . LEU A 1 359 ? 12.281  6.645   -10.100 1.00 53.36  ? 359 LEU A CA     1 
ATOM   5979  C  C      . LEU A 1 359 ? 11.569  7.092   -11.372 1.00 48.21  ? 359 LEU A C      1 
ATOM   5980  O  O      . LEU A 1 359 ? 12.214  7.358   -12.389 1.00 37.13  ? 359 LEU A O      1 
ATOM   5981  C  CB     . LEU A 1 359 ? 12.915  5.271   -10.331 1.00 46.41  ? 359 LEU A CB     1 
ATOM   5982  C  CG     . LEU A 1 359 ? 13.713  4.686   -9.162  1.00 46.81  ? 359 LEU A CG     1 
ATOM   5983  C  CD1    . LEU A 1 359 ? 14.177  3.266   -9.491  1.00 48.51  ? 359 LEU A CD1    1 
ATOM   5984  C  CD2    . LEU A 1 359 ? 14.893  5.577   -8.795  1.00 47.26  ? 359 LEU A CD2    1 
ATOM   5985  H  H      . LEU A 1 359 ? 11.132  5.814   -8.728  1.00 53.97  ? 359 LEU A H      1 
ATOM   5986  H  HA     . LEU A 1 359 ? 12.997  7.276   -9.924  1.00 64.03  ? 359 LEU A HA     1 
ATOM   5987  H  HB2    . LEU A 1 359 ? 12.207  4.641   -10.541 1.00 55.69  ? 359 LEU A HB2    1 
ATOM   5988  H  HB3    . LEU A 1 359 ? 13.519  5.338   -11.087 1.00 55.69  ? 359 LEU A HB3    1 
ATOM   5989  H  HG     . LEU A 1 359 ? 13.132  4.633   -8.387  1.00 56.17  ? 359 LEU A HG     1 
ATOM   5990  H  HD11   . LEU A 1 359 ? 14.679  2.917   -8.738  1.00 58.21  ? 359 LEU A HD11   1 
ATOM   5991  H  HD12   . LEU A 1 359 ? 13.400  2.711   -9.657  1.00 58.21  ? 359 LEU A HD12   1 
ATOM   5992  H  HD13   . LEU A 1 359 ? 14.740  3.293   -10.280 1.00 58.21  ? 359 LEU A HD13   1 
ATOM   5993  H  HD21   . LEU A 1 359 ? 15.372  5.175   -8.054  1.00 56.71  ? 359 LEU A HD21   1 
ATOM   5994  H  HD22   . LEU A 1 359 ? 15.478  5.657   -9.564  1.00 56.71  ? 359 LEU A HD22   1 
ATOM   5995  H  HD23   . LEU A 1 359 ? 14.560  6.451   -8.540  1.00 56.71  ? 359 LEU A HD23   1 
ATOM   5996  N  N      . SER A 1 360 ? 10.243  7.178   -11.318 1.00 46.07  ? 360 SER A N      1 
ATOM   5997  C  CA     . SER A 1 360 ? 9.471   7.583   -12.487 1.00 62.72  ? 360 SER A CA     1 
ATOM   5998  C  C      . SER A 1 360 ? 9.604   9.080   -12.724 1.00 50.13  ? 360 SER A C      1 
ATOM   5999  O  O      . SER A 1 360 ? 9.543   9.548   -13.863 1.00 38.39  ? 360 SER A O      1 
ATOM   6000  C  CB     . SER A 1 360 ? 7.999   7.208   -12.313 1.00 66.17  ? 360 SER A CB     1 
ATOM   6001  O  OG     . SER A 1 360 ? 7.416   7.945   -11.255 1.00 59.51  ? 360 SER A OG     1 
ATOM   6002  H  H      . SER A 1 360 ? 9.770   7.009   -10.621 1.00 55.28  ? 360 SER A H      1 
ATOM   6003  H  HA     . SER A 1 360 ? 9.811   7.121   -13.269 1.00 75.27  ? 360 SER A HA     1 
ATOM   6004  H  HB2    . SER A 1 360 ? 7.524   7.405   -13.136 1.00 79.41  ? 360 SER A HB2    1 
ATOM   6005  H  HB3    . SER A 1 360 ? 7.936   6.261   -12.112 1.00 79.41  ? 360 SER A HB3    1 
ATOM   6006  H  HG     . SER A 1 360 ? 7.820   7.784   -10.536 1.00 71.41  ? 360 SER A HG     1 
ATOM   6007  N  N      . ARG A 1 361 ? 9.796   9.823   -11.640 1.00 53.95  ? 361 ARG A N      1 
ATOM   6008  C  CA     . ARG A 1 361 ? 9.925   11.271  -11.716 1.00 59.86  ? 361 ARG A CA     1 
ATOM   6009  C  C      . ARG A 1 361 ? 11.086  11.678  -12.625 1.00 39.05  ? 361 ARG A C      1 
ATOM   6010  O  O      . ARG A 1 361 ? 12.208  11.197  -12.468 1.00 55.68  ? 361 ARG A O      1 
ATOM   6011  C  CB     . ARG A 1 361 ? 10.111  11.860  -10.316 1.00 44.96  ? 361 ARG A CB     1 
ATOM   6012  C  CG     . ARG A 1 361 ? 10.086  13.379  -10.281 1.00 71.29  ? 361 ARG A CG     1 
ATOM   6013  C  CD     . ARG A 1 361 ? 10.031  13.903  -8.856  1.00 80.58  ? 361 ARG A CD     1 
ATOM   6014  N  NE     . ARG A 1 361 ? 10.129  15.359  -8.805  1.00 92.31  ? 361 ARG A NE     1 
ATOM   6015  C  CZ     . ARG A 1 361 ? 10.081  16.074  -7.685  1.00 103.26 ? 361 ARG A CZ     1 
ATOM   6016  N  NH1    . ARG A 1 361 ? 9.933   15.469  -6.513  1.00 90.38  ? 361 ARG A NH1    1 
ATOM   6017  N  NH2    . ARG A 1 361 ? 10.181  17.397  -7.736  1.00 98.31  ? 361 ARG A NH2    1 
ATOM   6018  H  H      . ARG A 1 361 ? 9.856   9.508   -10.842 1.00 64.73  ? 361 ARG A H      1 
ATOM   6019  H  HA     . ARG A 1 361 ? 9.109   11.641  -12.090 1.00 71.83  ? 361 ARG A HA     1 
ATOM   6020  H  HB2    . ARG A 1 361 ? 9.396   11.538  -9.744  1.00 53.96  ? 361 ARG A HB2    1 
ATOM   6021  H  HB3    . ARG A 1 361 ? 10.968  11.569  -9.966  1.00 53.96  ? 361 ARG A HB3    1 
ATOM   6022  H  HG2    . ARG A 1 361 ? 10.891  13.722  -10.700 1.00 85.55  ? 361 ARG A HG2    1 
ATOM   6023  H  HG3    . ARG A 1 361 ? 9.300   13.697  -10.752 1.00 85.55  ? 361 ARG A HG3    1 
ATOM   6024  H  HD2    . ARG A 1 361 ? 9.188   13.642  -8.453  1.00 96.70  ? 361 ARG A HD2    1 
ATOM   6025  H  HD3    . ARG A 1 361 ? 10.772  13.532  -8.351  1.00 96.70  ? 361 ARG A HD3    1 
ATOM   6026  H  HE     . ARG A 1 361 ? 10.224  15.782  -9.548  1.00 110.77 ? 361 ARG A HE     1 
ATOM   6027  H  HH11   . ARG A 1 361 ? 9.868   14.613  -6.476  1.00 108.46 ? 361 ARG A HH11   1 
ATOM   6028  H  HH12   . ARG A 1 361 ? 9.902   15.934  -5.790  1.00 108.46 ? 361 ARG A HH12   1 
ATOM   6029  H  HH21   . ARG A 1 361 ? 10.276  17.792  -8.494  1.00 117.97 ? 361 ARG A HH21   1 
ATOM   6030  H  HH22   . ARG A 1 361 ? 10.148  17.859  -7.012  1.00 117.97 ? 361 ARG A HH22   1 
ATOM   6031  N  N      . ASN A 1 362 ? 10.801  12.559  -13.580 1.00 32.85  ? 362 ASN A N      1 
ATOM   6032  C  CA     . ASN A 1 362 ? 11.807  13.048  -14.520 1.00 54.65  ? 362 ASN A CA     1 
ATOM   6033  C  C      . ASN A 1 362 ? 12.826  13.947  -13.826 1.00 50.25  ? 362 ASN A C      1 
ATOM   6034  O  O      . ASN A 1 362 ? 12.477  15.014  -13.320 1.00 52.70  ? 362 ASN A O      1 
ATOM   6035  C  CB     . ASN A 1 362 ? 11.143  13.808  -15.672 1.00 66.96  ? 362 ASN A CB     1 
ATOM   6036  C  CG     . ASN A 1 362 ? 12.153  14.414  -16.637 1.00 58.92  ? 362 ASN A CG     1 
ATOM   6037  O  OD1    . ASN A 1 362 ? 13.253  13.888  -16.820 1.00 52.76  ? 362 ASN A OD1    1 
ATOM   6038  N  ND2    . ASN A 1 362 ? 11.780  15.530  -17.257 1.00 59.68  ? 362 ASN A ND2    1 
ATOM   6039  H  H      . ASN A 1 362 ? 10.019  12.894  -13.706 1.00 39.42  ? 362 ASN A H      1 
ATOM   6040  H  HA     . ASN A 1 362 ? 12.283  12.291  -14.896 1.00 65.58  ? 362 ASN A HA     1 
ATOM   6041  H  HB2    . ASN A 1 362 ? 10.581  13.196  -16.172 1.00 80.35  ? 362 ASN A HB2    1 
ATOM   6042  H  HB3    . ASN A 1 362 ? 10.606  14.529  -15.307 1.00 80.35  ? 362 ASN A HB3    1 
ATOM   6043  H  HD21   . ASN A 1 362 ? 12.314  15.912  -17.812 1.00 71.62  ? 362 ASN A HD21   1 
ATOM   6044  H  HD22   . ASN A 1 362 ? 11.005  15.869  -17.103 1.00 71.62  ? 362 ASN A HD22   1 
ATOM   6045  N  N      . ARG A 1 363 ? 14.080  13.499  -13.797 1.00 54.28  ? 363 ARG A N      1 
ATOM   6046  C  CA     . ARG A 1 363 ? 15.162  14.251  -13.166 1.00 39.52  ? 363 ARG A CA     1 
ATOM   6047  C  C      . ARG A 1 363 ? 16.302  14.486  -14.149 1.00 42.28  ? 363 ARG A C      1 
ATOM   6048  O  O      . ARG A 1 363 ? 16.462  13.739  -15.115 1.00 49.72  ? 363 ARG A O      1 
ATOM   6049  C  CB     . ARG A 1 363 ? 15.677  13.493  -11.946 1.00 23.89  ? 363 ARG A CB     1 
ATOM   6050  C  CG     . ARG A 1 363 ? 14.626  13.284  -10.874 1.00 26.46  ? 363 ARG A CG     1 
ATOM   6051  C  CD     . ARG A 1 363 ? 15.177  12.465  -9.732  1.00 34.10  ? 363 ARG A CD     1 
ATOM   6052  N  NE     . ARG A 1 363 ? 14.142  11.671  -9.072  1.00 35.84  ? 363 ARG A NE     1 
ATOM   6053  C  CZ     . ARG A 1 363 ? 13.444  12.067  -8.011  1.00 46.07  ? 363 ARG A CZ     1 
ATOM   6054  N  NH1    . ARG A 1 363 ? 13.655  13.262  -7.470  1.00 51.03  ? 363 ARG A NH1    1 
ATOM   6055  N  NH2    . ARG A 1 363 ? 12.529  11.264  -7.486  1.00 50.76  ? 363 ARG A NH2    1 
ATOM   6056  H  H      . ARG A 1 363 ? 14.332  12.752  -14.141 1.00 65.14  ? 363 ARG A H      1 
ATOM   6057  H  HA     . ARG A 1 363 ? 14.828  15.113  -12.873 1.00 47.42  ? 363 ARG A HA     1 
ATOM   6058  H  HB2    . ARG A 1 363 ? 15.992  12.620  -12.229 1.00 28.67  ? 363 ARG A HB2    1 
ATOM   6059  H  HB3    . ARG A 1 363 ? 16.408  13.995  -11.552 1.00 28.67  ? 363 ARG A HB3    1 
ATOM   6060  H  HG2    . ARG A 1 363 ? 14.345  14.144  -10.526 1.00 31.75  ? 363 ARG A HG2    1 
ATOM   6061  H  HG3    . ARG A 1 363 ? 13.869  12.810  -11.253 1.00 31.75  ? 363 ARG A HG3    1 
ATOM   6062  H  HD2    . ARG A 1 363 ? 15.851  11.857  -10.073 1.00 40.91  ? 363 ARG A HD2    1 
ATOM   6063  H  HD3    . ARG A 1 363 ? 15.567  13.060  -9.073  1.00 40.91  ? 363 ARG A HD3    1 
ATOM   6064  H  HE     . ARG A 1 363 ? 13.971  10.891  -9.393  1.00 43.00  ? 363 ARG A HE     1 
ATOM   6065  H  HH11   . ARG A 1 363 ? 14.248  13.787  -7.805  1.00 61.24  ? 363 ARG A HH11   1 
ATOM   6066  H  HH12   . ARG A 1 363 ? 13.198  13.510  -6.785  1.00 61.24  ? 363 ARG A HH12   1 
ATOM   6067  H  HH21   . ARG A 1 363 ? 12.387  10.489  -7.832  1.00 60.91  ? 363 ARG A HH21   1 
ATOM   6068  H  HH22   . ARG A 1 363 ? 12.075  11.518  -6.801  1.00 60.91  ? 363 ARG A HH22   1 
ATOM   6069  N  N      . ALA A 1 364 ? 17.096  15.523  -13.894 1.00 41.72  ? 364 ALA A N      1 
ATOM   6070  C  CA     . ALA A 1 364 ? 18.187  15.890  -14.792 1.00 39.43  ? 364 ALA A CA     1 
ATOM   6071  C  C      . ALA A 1 364 ? 19.346  14.897  -14.687 1.00 51.73  ? 364 ALA A C      1 
ATOM   6072  O  O      . ALA A 1 364 ? 20.040  14.641  -15.675 1.00 48.47  ? 364 ALA A O      1 
ATOM   6073  C  CB     . ALA A 1 364 ? 18.669  17.301  -14.489 1.00 37.24  ? 364 ALA A CB     1 
ATOM   6074  H  H      . ALA A 1 364 ? 17.023  16.032  -13.205 1.00 50.07  ? 364 ALA A H      1 
ATOM   6075  H  HA     . ALA A 1 364 ? 17.862  15.875  -15.706 1.00 47.32  ? 364 ALA A HA     1 
ATOM   6076  H  HB1    . ALA A 1 364 ? 19.392  17.525  -15.096 1.00 44.68  ? 364 ALA A HB1    1 
ATOM   6077  H  HB2    . ALA A 1 364 ? 17.931  17.919  -14.611 1.00 44.68  ? 364 ALA A HB2    1 
ATOM   6078  H  HB3    . ALA A 1 364 ? 18.983  17.337  -13.572 1.00 44.68  ? 364 ALA A HB3    1 
ATOM   6079  N  N      . PHE A 1 365 ? 19.553  14.353  -13.487 1.00 58.06  ? 365 PHE A N      1 
ATOM   6080  C  CA     . PHE A 1 365 ? 20.605  13.365  -13.245 1.00 32.19  ? 365 PHE A CA     1 
ATOM   6081  C  C      . PHE A 1 365 ? 20.016  12.013  -12.855 1.00 34.08  ? 365 PHE A C      1 
ATOM   6082  O  O      . PHE A 1 365 ? 18.834  11.906  -12.532 1.00 39.57  ? 365 PHE A O      1 
ATOM   6083  C  CB     . PHE A 1 365 ? 21.558  13.845  -12.147 1.00 26.79  ? 365 PHE A CB     1 
ATOM   6084  C  CG     . PHE A 1 365 ? 22.315  15.088  -12.506 1.00 25.11  ? 365 PHE A CG     1 
ATOM   6085  C  CD1    . PHE A 1 365 ? 23.440  15.019  -13.310 1.00 35.87  ? 365 PHE A CD1    1 
ATOM   6086  C  CD2    . PHE A 1 365 ? 21.917  16.321  -12.023 1.00 28.30  ? 365 PHE A CD2    1 
ATOM   6087  C  CE1    . PHE A 1 365 ? 24.144  16.162  -13.643 1.00 21.59  ? 365 PHE A CE1    1 
ATOM   6088  C  CE2    . PHE A 1 365 ? 22.618  17.467  -12.348 1.00 26.77  ? 365 PHE A CE2    1 
ATOM   6089  C  CZ     . PHE A 1 365 ? 23.733  17.386  -13.159 1.00 22.79  ? 365 PHE A CZ     1 
ATOM   6090  H  H      . PHE A 1 365 ? 19.091  14.544  -12.787 1.00 69.67  ? 365 PHE A H      1 
ATOM   6091  H  HA     . PHE A 1 365 ? 21.119  13.246  -14.058 1.00 38.63  ? 365 PHE A HA     1 
ATOM   6092  H  HB2    . PHE A 1 365 ? 21.043  14.031  -11.346 1.00 32.15  ? 365 PHE A HB2    1 
ATOM   6093  H  HB3    . PHE A 1 365 ? 22.204  13.145  -11.967 1.00 32.15  ? 365 PHE A HB3    1 
ATOM   6094  H  HD1    . PHE A 1 365 ? 23.719  14.196  -13.640 1.00 43.05  ? 365 PHE A HD1    1 
ATOM   6095  H  HD2    . PHE A 1 365 ? 21.166  16.381  -11.479 1.00 33.96  ? 365 PHE A HD2    1 
ATOM   6096  H  HE1    . PHE A 1 365 ? 24.896  16.104  -14.187 1.00 25.90  ? 365 PHE A HE1    1 
ATOM   6097  H  HE2    . PHE A 1 365 ? 22.339  18.292  -12.022 1.00 32.13  ? 365 PHE A HE2    1 
ATOM   6098  H  HZ     . PHE A 1 365 ? 24.206  18.156  -13.379 1.00 27.34  ? 365 PHE A HZ     1 
ATOM   6099  N  N      . ARG A 1 366 ? 20.859  10.986  -12.874 1.00 39.73  ? 366 ARG A N      1 
ATOM   6100  C  CA     . ARG A 1 366 ? 20.435  9.628   -12.549 1.00 37.93  ? 366 ARG A CA     1 
ATOM   6101  C  C      . ARG A 1 366 ? 20.488  9.400   -11.031 1.00 31.71  ? 366 ARG A C      1 
ATOM   6102  O  O      . ARG A 1 366 ? 21.482  9.746   -10.393 1.00 45.17  ? 366 ARG A O      1 
ATOM   6103  C  CB     . ARG A 1 366 ? 21.323  8.617   -13.284 1.00 40.72  ? 366 ARG A CB     1 
ATOM   6104  C  CG     . ARG A 1 366 ? 20.950  7.155   -13.070 1.00 55.48  ? 366 ARG A CG     1 
ATOM   6105  C  CD     . ARG A 1 366 ? 21.794  6.238   -13.952 1.00 50.04  ? 366 ARG A CD     1 
ATOM   6106  N  NE     . ARG A 1 366 ? 21.628  4.825   -13.608 1.00 58.72  ? 366 ARG A NE     1 
ATOM   6107  C  CZ     . ARG A 1 366 ? 22.410  4.150   -12.765 1.00 77.73  ? 366 ARG A CZ     1 
ATOM   6108  N  NH1    . ARG A 1 366 ? 23.433  4.747   -12.165 1.00 76.88  ? 366 ARG A NH1    1 
ATOM   6109  N  NH2    . ARG A 1 366 ? 22.169  2.869   -12.522 1.00 58.82  ? 366 ARG A NH2    1 
ATOM   6110  H  H      . ARG A 1 366 ? 21.693  11.050  -13.074 1.00 47.68  ? 366 ARG A H      1 
ATOM   6111  H  HA     . ARG A 1 366 ? 19.519  9.500   -12.843 1.00 45.52  ? 366 ARG A HA     1 
ATOM   6112  H  HB2    . ARG A 1 366 ? 21.271  8.796   -14.236 1.00 48.87  ? 366 ARG A HB2    1 
ATOM   6113  H  HB3    . ARG A 1 366 ? 22.237  8.733   -12.981 1.00 48.87  ? 366 ARG A HB3    1 
ATOM   6114  H  HG2    . ARG A 1 366 ? 21.107  6.916   -12.144 1.00 66.57  ? 366 ARG A HG2    1 
ATOM   6115  H  HG3    . ARG A 1 366 ? 20.017  7.025   -13.299 1.00 66.57  ? 366 ARG A HG3    1 
ATOM   6116  H  HD2    . ARG A 1 366 ? 21.528  6.355   -14.878 1.00 60.04  ? 366 ARG A HD2    1 
ATOM   6117  H  HD3    . ARG A 1 366 ? 22.730  6.466   -13.844 1.00 60.04  ? 366 ARG A HD3    1 
ATOM   6118  H  HE     . ARG A 1 366 ? 20.978  4.398   -13.975 1.00 70.47  ? 366 ARG A HE     1 
ATOM   6119  H  HH11   . ARG A 1 366 ? 23.596  5.577   -12.316 1.00 92.26  ? 366 ARG A HH11   1 
ATOM   6120  H  HH12   . ARG A 1 366 ? 23.932  4.302   -11.623 1.00 92.26  ? 366 ARG A HH12   1 
ATOM   6121  H  HH21   . ARG A 1 366 ? 21.509  2.474   -12.907 1.00 70.59  ? 366 ARG A HH21   1 
ATOM   6122  H  HH22   . ARG A 1 366 ? 22.674  2.432   -11.979 1.00 70.59  ? 366 ARG A HH22   1 
ATOM   6123  N  N      . PRO A 1 367 ? 19.427  8.810   -10.445 1.00 32.89  ? 367 PRO A N      1 
ATOM   6124  C  CA     . PRO A 1 367 ? 19.437  8.482   -9.009  1.00 46.97  ? 367 PRO A CA     1 
ATOM   6125  C  C      . PRO A 1 367 ? 20.395  7.344   -8.651  1.00 30.50  ? 367 PRO A C      1 
ATOM   6126  O  O      . PRO A 1 367 ? 20.962  6.725   -9.551  1.00 35.76  ? 367 PRO A O      1 
ATOM   6127  C  CB     . PRO A 1 367 ? 17.986  8.074   -8.728  1.00 41.11  ? 367 PRO A CB     1 
ATOM   6128  C  CG     . PRO A 1 367 ? 17.456  7.624   -10.036 1.00 56.37  ? 367 PRO A CG     1 
ATOM   6129  C  CD     . PRO A 1 367 ? 18.140  8.464   -11.076 1.00 44.61  ? 367 PRO A CD     1 
ATOM   6130  H  HA     . PRO A 1 367 ? 19.658  9.267   -8.484  1.00 56.37  ? 367 PRO A HA     1 
ATOM   6131  H  HB2    . PRO A 1 367 ? 17.968  7.350   -8.082  1.00 49.33  ? 367 PRO A HB2    1 
ATOM   6132  H  HB3    . PRO A 1 367 ? 17.488  8.840   -8.400  1.00 49.33  ? 367 PRO A HB3    1 
ATOM   6133  H  HG2    . PRO A 1 367 ? 17.666  6.686   -10.165 1.00 67.65  ? 367 PRO A HG2    1 
ATOM   6134  H  HG3    . PRO A 1 367 ? 16.497  7.765   -10.063 1.00 67.65  ? 367 PRO A HG3    1 
ATOM   6135  H  HD2    . PRO A 1 367 ? 18.287  7.948   -11.884 1.00 53.53  ? 367 PRO A HD2    1 
ATOM   6136  H  HD3    . PRO A 1 367 ? 17.625  9.266   -11.255 1.00 53.53  ? 367 PRO A HD3    1 
ATOM   6137  N  N      . PHE A 1 368 ? 20.581  7.087   -7.357  1.00 19.34  ? 368 PHE A N      1 
ATOM   6138  C  CA     . PHE A 1 368 ? 21.537  6.075   -6.911  1.00 23.08  ? 368 PHE A CA     1 
ATOM   6139  C  C      . PHE A 1 368 ? 21.107  5.384   -5.625  1.00 24.03  ? 368 PHE A C      1 
ATOM   6140  O  O      . PHE A 1 368 ? 20.213  5.852   -4.923  1.00 32.64  ? 368 PHE A O      1 
ATOM   6141  C  CB     . PHE A 1 368 ? 22.913  6.707   -6.700  1.00 33.80  ? 368 PHE A CB     1 
ATOM   6142  C  CG     . PHE A 1 368 ? 22.928  7.793   -5.660  1.00 32.70  ? 368 PHE A CG     1 
ATOM   6143  C  CD1    . PHE A 1 368 ? 22.641  9.105   -6.003  1.00 34.83  ? 368 PHE A CD1    1 
ATOM   6144  C  CD2    . PHE A 1 368 ? 23.228  7.501   -4.339  1.00 31.48  ? 368 PHE A CD2    1 
ATOM   6145  C  CE1    . PHE A 1 368 ? 22.656  10.106  -5.049  1.00 20.42  ? 368 PHE A CE1    1 
ATOM   6146  C  CE2    . PHE A 1 368 ? 23.244  8.497   -3.380  1.00 28.70  ? 368 PHE A CE2    1 
ATOM   6147  C  CZ     . PHE A 1 368 ? 22.957  9.801   -3.736  1.00 22.02  ? 368 PHE A CZ     1 
ATOM   6148  H  H      . PHE A 1 368 ? 20.165  7.484   -6.717  1.00 23.21  ? 368 PHE A H      1 
ATOM   6149  H  HA     . PHE A 1 368 ? 21.621  5.398   -7.600  1.00 27.70  ? 368 PHE A HA     1 
ATOM   6150  H  HB2    . PHE A 1 368 ? 23.534  6.017   -6.418  1.00 40.56  ? 368 PHE A HB2    1 
ATOM   6151  H  HB3    . PHE A 1 368 ? 23.211  7.095   -7.538  1.00 40.56  ? 368 PHE A HB3    1 
ATOM   6152  H  HD1    . PHE A 1 368 ? 22.439  9.315   -6.886  1.00 41.79  ? 368 PHE A HD1    1 
ATOM   6153  H  HD2    . PHE A 1 368 ? 23.422  6.625   -4.094  1.00 37.78  ? 368 PHE A HD2    1 
ATOM   6154  H  HE1    . PHE A 1 368 ? 22.462  10.983  -5.291  1.00 24.51  ? 368 PHE A HE1    1 
ATOM   6155  H  HE2    . PHE A 1 368 ? 23.447  8.290   -2.497  1.00 34.44  ? 368 PHE A HE2    1 
ATOM   6156  H  HZ     . PHE A 1 368 ? 22.967  10.472  -3.092  1.00 26.43  ? 368 PHE A HZ     1 
ATOM   6157  N  N      . ILE A 1 369 ? 21.769  4.271   -5.322  1.00 27.92  ? 369 ILE A N      1 
ATOM   6158  C  CA     . ILE A 1 369 ? 21.521  3.526   -4.093  1.00 35.26  ? 369 ILE A CA     1 
ATOM   6159  C  C      . ILE A 1 369 ? 22.647  3.780   -3.103  1.00 33.50  ? 369 ILE A C      1 
ATOM   6160  O  O      . ILE A 1 369 ? 23.821  3.793   -3.477  1.00 39.54  ? 369 ILE A O      1 
ATOM   6161  C  CB     . ILE A 1 369 ? 21.410  2.011   -4.346  1.00 41.92  ? 369 ILE A CB     1 
ATOM   6162  C  CG1    . ILE A 1 369 ? 20.376  1.727   -5.440  1.00 30.55  ? 369 ILE A CG1    1 
ATOM   6163  C  CG2    . ILE A 1 369 ? 21.043  1.283   -3.046  1.00 34.38  ? 369 ILE A CG2    1 
ATOM   6164  C  CD1    . ILE A 1 369 ? 20.302  0.273   -5.852  1.00 40.94  ? 369 ILE A CD1    1 
ATOM   6165  H  H      . ILE A 1 369 ? 22.376  3.922   -5.822  1.00 33.51  ? 369 ILE A H      1 
ATOM   6166  H  HA     . ILE A 1 369 ? 20.690  3.831   -3.696  1.00 42.31  ? 369 ILE A HA     1 
ATOM   6167  H  HB     . ILE A 1 369 ? 22.273  1.686   -4.647  1.00 50.31  ? 369 ILE A HB     1 
ATOM   6168  H  HG12   . ILE A 1 369 ? 19.500  1.989   -5.116  1.00 36.66  ? 369 ILE A HG12   1 
ATOM   6169  H  HG13   . ILE A 1 369 ? 20.604  2.247   -6.227  1.00 36.66  ? 369 ILE A HG13   1 
ATOM   6170  H  HG21   . ILE A 1 369 ? 20.978  0.332   -3.226  1.00 41.25  ? 369 ILE A HG21   1 
ATOM   6171  H  HG22   . ILE A 1 369 ? 21.733  1.449   -2.386  1.00 41.25  ? 369 ILE A HG22   1 
ATOM   6172  H  HG23   . ILE A 1 369 ? 20.191  1.619   -2.727  1.00 41.25  ? 369 ILE A HG23   1 
ATOM   6173  H  HD11   . ILE A 1 369 ? 19.629  0.175   -6.543  1.00 49.12  ? 369 ILE A HD11   1 
ATOM   6174  H  HD12   . ILE A 1 369 ? 21.168  -0.003  -6.191  1.00 49.12  ? 369 ILE A HD12   1 
ATOM   6175  H  HD13   . ILE A 1 369 ? 20.063  -0.262  -5.079  1.00 49.12  ? 369 ILE A HD13   1 
ATOM   6176  N  N      . GLU A 1 370 ? 22.279  3.981   -1.841  1.00 33.29  ? 370 GLU A N      1 
ATOM   6177  C  CA     . GLU A 1 370 ? 23.252  4.212   -0.777  1.00 34.78  ? 370 GLU A CA     1 
ATOM   6178  C  C      . GLU A 1 370 ? 22.780  3.629   0.555   1.00 35.00  ? 370 GLU A C      1 
ATOM   6179  O  O      . GLU A 1 370 ? 21.702  3.963   1.051   1.00 24.80  ? 370 GLU A O      1 
ATOM   6180  C  CB     . GLU A 1 370 ? 23.531  5.710   -0.622  1.00 23.11  ? 370 GLU A CB     1 
ATOM   6181  C  CG     . GLU A 1 370 ? 24.475  6.039   0.529   1.00 32.98  ? 370 GLU A CG     1 
ATOM   6182  C  CD     . GLU A 1 370 ? 24.949  7.480   0.517   1.00 40.31  ? 370 GLU A CD     1 
ATOM   6183  O  OE1    . GLU A 1 370 ? 25.299  7.989   -0.571  1.00 40.21  ? 370 GLU A OE1    1 
ATOM   6184  O  OE2    . GLU A 1 370 ? 24.969  8.102   1.601   1.00 42.21  ? 370 GLU A OE2    1 
ATOM   6185  H  H      . GLU A 1 370 ? 21.463  3.988   -1.572  1.00 39.94  ? 370 GLU A H      1 
ATOM   6186  H  HA     . GLU A 1 370 ? 24.086  3.777   -1.015  1.00 41.73  ? 370 GLU A HA     1 
ATOM   6187  H  HB2    . GLU A 1 370 ? 23.934  6.040   -1.440  1.00 27.74  ? 370 GLU A HB2    1 
ATOM   6188  H  HB3    . GLU A 1 370 ? 22.693  6.170   -0.459  1.00 27.74  ? 370 GLU A HB3    1 
ATOM   6189  H  HG2    . GLU A 1 370 ? 24.015  5.883   1.368   1.00 39.57  ? 370 GLU A HG2    1 
ATOM   6190  H  HG3    . GLU A 1 370 ? 25.256  5.468   0.468   1.00 39.57  ? 370 GLU A HG3    1 
ATOM   6191  N  N      . ASN A 1 371 ? 23.604  2.749   1.117   1.00 35.32  ? 371 ASN A N      1 
ATOM   6192  C  CA     . ASN A 1 371 ? 23.335  2.122   2.410   1.00 38.93  ? 371 ASN A CA     1 
ATOM   6193  C  C      . ASN A 1 371 ? 21.930  1.524   2.511   1.00 39.94  ? 371 ASN A C      1 
ATOM   6194  O  O      . ASN A 1 371 ? 21.338  1.477   3.592   1.00 43.71  ? 371 ASN A O      1 
ATOM   6195  C  CB     . ASN A 1 371 ? 23.553  3.137   3.535   1.00 41.54  ? 371 ASN A CB     1 
ATOM   6196  C  CG     . ASN A 1 371 ? 25.007  3.556   3.666   1.00 61.42  ? 371 ASN A CG     1 
ATOM   6197  O  OD1    . ASN A 1 371 ? 25.918  2.743   3.502   1.00 73.51  ? 371 ASN A OD1    1 
ATOM   6198  N  ND2    . ASN A 1 371 ? 25.232  4.831   3.964   1.00 54.35  ? 371 ASN A ND2    1 
ATOM   6199  H  H      . ASN A 1 371 ? 24.343  2.492   0.761   1.00 42.39  ? 371 ASN A H      1 
ATOM   6200  H  HA     . ASN A 1 371 ? 23.969  1.400   2.540   1.00 46.71  ? 371 ASN A HA     1 
ATOM   6201  H  HB2    . ASN A 1 371 ? 23.027  3.931   3.353   1.00 49.85  ? 371 ASN A HB2    1 
ATOM   6202  H  HB3    . ASN A 1 371 ? 23.278  2.741   4.377   1.00 49.85  ? 371 ASN A HB3    1 
ATOM   6203  H  HD21   . ASN A 1 371 ? 26.039  5.117   4.049   1.00 65.22  ? 371 ASN A HD21   1 
ATOM   6204  H  HD22   . ASN A 1 371 ? 24.571  5.370   4.073   1.00 65.22  ? 371 ASN A HD22   1 
ATOM   6205  N  N      . GLY A 1 372 ? 21.406  1.064   1.377   1.00 34.44  ? 372 GLY A N      1 
ATOM   6206  C  CA     . GLY A 1 372 ? 20.184  0.281   1.364   1.00 39.83  ? 372 GLY A CA     1 
ATOM   6207  C  C      . GLY A 1 372 ? 18.925  1.000   0.913   1.00 47.09  ? 372 GLY A C      1 
ATOM   6208  O  O      . GLY A 1 372 ? 17.854  0.389   0.883   1.00 53.81  ? 372 GLY A O      1 
ATOM   6209  H  H      . GLY A 1 372 ? 21.746  1.196   0.598   1.00 41.33  ? 372 GLY A H      1 
ATOM   6210  H  HA2    . GLY A 1 372 ? 20.312  -0.481  0.779   1.00 47.80  ? 372 GLY A HA2    1 
ATOM   6211  H  HA3    . GLY A 1 372 ? 20.024  -0.057  2.259   1.00 47.80  ? 372 GLY A HA3    1 
ATOM   6212  N  N      . ARG A 1 373 ? 19.029  2.287   0.586   1.00 31.41  ? 373 ARG A N      1 
ATOM   6213  C  CA     . ARG A 1 373 ? 17.876  3.015   0.051   1.00 37.53  ? 373 ARG A CA     1 
ATOM   6214  C  C      . ARG A 1 373 ? 18.248  3.929   -1.117  1.00 31.83  ? 373 ARG A C      1 
ATOM   6215  O  O      . ARG A 1 373 ? 19.419  4.235   -1.339  1.00 39.59  ? 373 ARG A O      1 
ATOM   6216  C  CB     . ARG A 1 373 ? 17.189  3.819   1.160   1.00 42.56  ? 373 ARG A CB     1 
ATOM   6217  C  CG     . ARG A 1 373 ? 17.999  4.955   1.761   1.00 50.14  ? 373 ARG A CG     1 
ATOM   6218  C  CD     . ARG A 1 373 ? 17.361  5.403   3.072   1.00 46.57  ? 373 ARG A CD     1 
ATOM   6219  N  NE     . ARG A 1 373 ? 15.918  5.595   2.921   1.00 46.19  ? 373 ARG A NE     1 
ATOM   6220  C  CZ     . ARG A 1 373 ? 15.022  5.421   3.891   1.00 47.50  ? 373 ARG A CZ     1 
ATOM   6221  N  NH1    . ARG A 1 373 ? 15.405  5.046   5.107   1.00 33.44  ? 373 ARG A NH1    1 
ATOM   6222  N  NH2    . ARG A 1 373 ? 13.733  5.619   3.640   1.00 42.90  ? 373 ARG A NH2    1 
ATOM   6223  H  H      . ARG A 1 373 ? 19.744  2.758   0.662   1.00 37.69  ? 373 ARG A H      1 
ATOM   6224  H  HA     . ARG A 1 373 ? 17.233  2.369   -0.279  1.00 45.04  ? 373 ARG A HA     1 
ATOM   6225  H  HB2    . ARG A 1 373 ? 16.376  4.204   0.798   1.00 51.08  ? 373 ARG A HB2    1 
ATOM   6226  H  HB3    . ARG A 1 373 ? 16.964  3.212   1.882   1.00 51.08  ? 373 ARG A HB3    1 
ATOM   6227  H  HG2    . ARG A 1 373 ? 18.902  4.651   1.943   1.00 60.17  ? 373 ARG A HG2    1 
ATOM   6228  H  HG3    . ARG A 1 373 ? 18.009  5.707   1.149   1.00 60.17  ? 373 ARG A HG3    1 
ATOM   6229  H  HD2    . ARG A 1 373 ? 17.510  4.724   3.749   1.00 55.88  ? 373 ARG A HD2    1 
ATOM   6230  H  HD3    . ARG A 1 373 ? 17.754  6.245   3.348   1.00 55.88  ? 373 ARG A HD3    1 
ATOM   6231  H  HE     . ARG A 1 373 ? 15.627  5.839   2.150   1.00 55.43  ? 373 ARG A HE     1 
ATOM   6232  H  HH11   . ARG A 1 373 ? 16.238  4.914   5.275   1.00 40.13  ? 373 ARG A HH11   1 
ATOM   6233  H  HH12   . ARG A 1 373 ? 14.819  4.935   5.727   1.00 40.13  ? 373 ARG A HH12   1 
ATOM   6234  H  HH21   . ARG A 1 373 ? 13.480  5.862   2.855   1.00 51.48  ? 373 ARG A HH21   1 
ATOM   6235  H  HH22   . ARG A 1 373 ? 13.152  5.509   4.264   1.00 51.48  ? 373 ARG A HH22   1 
ATOM   6236  N  N      . TRP A 1 374 ? 17.233  4.332   -1.877  1.00 30.72  ? 374 TRP A N      1 
ATOM   6237  C  CA     . TRP A 1 374 ? 17.427  5.134   -3.080  1.00 26.01  ? 374 TRP A CA     1 
ATOM   6238  C  C      . TRP A 1 374 ? 17.546  6.615   -2.753  1.00 35.04  ? 374 TRP A C      1 
ATOM   6239  O  O      . TRP A 1 374 ? 16.952  7.102   -1.793  1.00 46.40  ? 374 TRP A O      1 
ATOM   6240  C  CB     . TRP A 1 374 ? 16.270  4.914   -4.056  1.00 24.96  ? 374 TRP A CB     1 
ATOM   6241  C  CG     . TRP A 1 374 ? 16.351  3.614   -4.789  1.00 27.70  ? 374 TRP A CG     1 
ATOM   6242  C  CD1    . TRP A 1 374 ? 15.842  2.409   -4.389  1.00 42.28  ? 374 TRP A CD1    1 
ATOM   6243  C  CD2    . TRP A 1 374 ? 16.972  3.385   -6.059  1.00 33.48  ? 374 TRP A CD2    1 
ATOM   6244  N  NE1    . TRP A 1 374 ? 16.115  1.443   -5.330  1.00 38.34  ? 374 TRP A NE1    1 
ATOM   6245  C  CE2    . TRP A 1 374 ? 16.807  2.018   -6.366  1.00 29.94  ? 374 TRP A CE2    1 
ATOM   6246  C  CE3    . TRP A 1 374 ? 17.655  4.203   -6.966  1.00 36.48  ? 374 TRP A CE3    1 
ATOM   6247  C  CZ2    . TRP A 1 374 ? 17.297  1.452   -7.541  1.00 34.61  ? 374 TRP A CZ2    1 
ATOM   6248  C  CZ3    . TRP A 1 374 ? 18.142  3.639   -8.133  1.00 40.27  ? 374 TRP A CZ3    1 
ATOM   6249  C  CH2    . TRP A 1 374 ? 17.961  2.276   -8.410  1.00 43.11  ? 374 TRP A CH2    1 
ATOM   6250  H  H      . TRP A 1 374 ? 16.409  4.149   -1.713  1.00 36.86  ? 374 TRP A H      1 
ATOM   6251  H  HA     . TRP A 1 374 ? 18.247  4.856   -3.518  1.00 31.21  ? 374 TRP A HA     1 
ATOM   6252  H  HB2    . TRP A 1 374 ? 15.435  4.925   -3.561  1.00 29.95  ? 374 TRP A HB2    1 
ATOM   6253  H  HB3    . TRP A 1 374 ? 16.273  5.628   -4.713  1.00 29.95  ? 374 TRP A HB3    1 
ATOM   6254  H  HD1    . TRP A 1 374 ? 15.383  2.263   -3.593  1.00 50.74  ? 374 TRP A HD1    1 
ATOM   6255  H  HE1    . TRP A 1 374 ? 15.887  0.616   -5.278  1.00 46.01  ? 374 TRP A HE1    1 
ATOM   6256  H  HE3    . TRP A 1 374 ? 17.778  5.108   -6.790  1.00 43.78  ? 374 TRP A HE3    1 
ATOM   6257  H  HZ2    . TRP A 1 374 ? 17.179  0.548   -7.727  1.00 41.53  ? 374 TRP A HZ2    1 
ATOM   6258  H  HZ3    . TRP A 1 374 ? 18.597  4.172   -8.744  1.00 48.32  ? 374 TRP A HZ3    1 
ATOM   6259  H  HH2    . TRP A 1 374 ? 18.299  1.924   -9.201  1.00 51.73  ? 374 TRP A HH2    1 
ATOM   6260  N  N      . TRP A 1 375 ? 18.325  7.319   -3.563  1.00 33.52  ? 375 TRP A N      1 
ATOM   6261  C  CA     . TRP A 1 375 ? 18.506  8.754   -3.419  1.00 29.72  ? 375 TRP A CA     1 
ATOM   6262  C  C      . TRP A 1 375 ? 18.502  9.397   -4.796  1.00 32.83  ? 375 TRP A C      1 
ATOM   6263  O  O      . TRP A 1 375 ? 18.852  8.754   -5.788  1.00 31.70  ? 375 TRP A O      1 
ATOM   6264  C  CB     . TRP A 1 375 ? 19.811  9.059   -2.690  1.00 24.93  ? 375 TRP A CB     1 
ATOM   6265  C  CG     . TRP A 1 375 ? 19.870  8.513   -1.298  1.00 29.45  ? 375 TRP A CG     1 
ATOM   6266  C  CD1    . TRP A 1 375 ? 20.096  7.219   -0.939  1.00 35.14  ? 375 TRP A CD1    1 
ATOM   6267  C  CD2    . TRP A 1 375 ? 19.725  9.250   -0.075  1.00 28.50  ? 375 TRP A CD2    1 
ATOM   6268  N  NE1    . TRP A 1 375 ? 20.090  7.098   0.431   1.00 42.55  ? 375 TRP A NE1    1 
ATOM   6269  C  CE2    . TRP A 1 375 ? 19.867  8.331   0.984   1.00 29.19  ? 375 TRP A CE2    1 
ATOM   6270  C  CE3    . TRP A 1 375 ? 19.488  10.593  0.226   1.00 31.30  ? 375 TRP A CE3    1 
ATOM   6271  C  CZ2    . TRP A 1 375 ? 19.776  8.713   2.320   1.00 23.76  ? 375 TRP A CZ2    1 
ATOM   6272  C  CZ3    . TRP A 1 375 ? 19.399  10.968  1.552   1.00 35.18  ? 375 TRP A CZ3    1 
ATOM   6273  C  CH2    . TRP A 1 375 ? 19.541  10.031  2.582   1.00 18.71  ? 375 TRP A CH2    1 
ATOM   6274  H  H      . TRP A 1 375 ? 18.768  6.980   -4.218  1.00 40.23  ? 375 TRP A H      1 
ATOM   6275  H  HA     . TRP A 1 375 ? 17.772  9.124   -2.904  1.00 35.66  ? 375 TRP A HA     1 
ATOM   6276  H  HB2    . TRP A 1 375 ? 20.546  8.673   -3.191  1.00 29.92  ? 375 TRP A HB2    1 
ATOM   6277  H  HB3    . TRP A 1 375 ? 19.921  10.021  -2.636  1.00 29.92  ? 375 TRP A HB3    1 
ATOM   6278  H  HD1    . TRP A 1 375 ? 20.229  6.517   -1.534  1.00 42.16  ? 375 TRP A HD1    1 
ATOM   6279  H  HE1    . TRP A 1 375 ? 20.209  6.368   0.869   1.00 51.06  ? 375 TRP A HE1    1 
ATOM   6280  H  HE3    . TRP A 1 375 ? 19.391  11.221  -0.453  1.00 37.56  ? 375 TRP A HE3    1 
ATOM   6281  H  HZ2    . TRP A 1 375 ? 19.870  8.093   3.007   1.00 28.51  ? 375 TRP A HZ2    1 
ATOM   6282  H  HZ3    . TRP A 1 375 ? 19.240  11.859  1.764   1.00 42.22  ? 375 TRP A HZ3    1 
ATOM   6283  H  HH2    . TRP A 1 375 ? 19.476  10.314  3.466   1.00 22.45  ? 375 TRP A HH2    1 
ATOM   6284  N  N      . ALA A 1 376 ? 18.095  10.659  -4.856  1.00 30.69  ? 376 ALA A N      1 
ATOM   6285  C  CA     . ALA A 1 376 ? 18.075  11.396  -6.112  1.00 29.98  ? 376 ALA A CA     1 
ATOM   6286  C  C      . ALA A 1 376 ? 18.682  12.781  -5.934  1.00 27.97  ? 376 ALA A C      1 
ATOM   6287  O  O      . ALA A 1 376 ? 18.576  13.379  -4.863  1.00 20.58  ? 376 ALA A O      1 
ATOM   6288  C  CB     . ALA A 1 376 ? 16.655  11.502  -6.640  1.00 29.33  ? 376 ALA A CB     1 
ATOM   6289  H  H      . ALA A 1 376 ? 17.823  11.114  -4.178  1.00 36.83  ? 376 ALA A H      1 
ATOM   6290  H  HA     . ALA A 1 376 ? 18.605  10.917  -6.768  1.00 35.97  ? 376 ALA A HA     1 
ATOM   6291  H  HB1    . ALA A 1 376 ? 16.666  11.995  -7.476  1.00 35.20  ? 376 ALA A HB1    1 
ATOM   6292  H  HB2    . ALA A 1 376 ? 16.306  10.609  -6.787  1.00 35.20  ? 376 ALA A HB2    1 
ATOM   6293  H  HB3    . ALA A 1 376 ? 16.110  11.968  -5.987  1.00 35.20  ? 376 ALA A HB3    1 
ATOM   6294  N  N      . PHE A 1 377 ? 19.335  13.269  -6.985  1.00 21.43  ? 377 PHE A N      1 
ATOM   6295  C  CA     . PHE A 1 377 ? 19.813  14.646  -7.032  1.00 16.85  ? 377 PHE A CA     1 
ATOM   6296  C  C      . PHE A 1 377 ? 18.722  15.559  -7.578  1.00 31.06  ? 377 PHE A C      1 
ATOM   6297  O  O      . PHE A 1 377 ? 18.171  15.304  -8.650  1.00 38.19  ? 377 PHE A O      1 
ATOM   6298  C  CB     . PHE A 1 377 ? 21.064  14.765  -7.901  1.00 21.74  ? 377 PHE A CB     1 
ATOM   6299  C  CG     . PHE A 1 377 ? 22.262  14.057  -7.345  1.00 28.60  ? 377 PHE A CG     1 
ATOM   6300  C  CD1    . PHE A 1 377 ? 22.906  14.539  -6.220  1.00 34.17  ? 377 PHE A CD1    1 
ATOM   6301  C  CD2    . PHE A 1 377 ? 22.753  12.916  -7.956  1.00 33.64  ? 377 PHE A CD2    1 
ATOM   6302  C  CE1    . PHE A 1 377 ? 24.014  13.892  -5.712  1.00 34.04  ? 377 PHE A CE1    1 
ATOM   6303  C  CE2    . PHE A 1 377 ? 23.861  12.266  -7.452  1.00 28.00  ? 377 PHE A CE2    1 
ATOM   6304  C  CZ     . PHE A 1 377 ? 24.492  12.754  -6.330  1.00 26.86  ? 377 PHE A CZ     1 
ATOM   6305  H  H      . PHE A 1 377 ? 19.516  12.816  -7.693  1.00 25.72  ? 377 PHE A H      1 
ATOM   6306  H  HA     . PHE A 1 377 ? 20.035  14.940  -6.134  1.00 20.22  ? 377 PHE A HA     1 
ATOM   6307  H  HB2    . PHE A 1 377 ? 20.875  14.385  -8.773  1.00 26.08  ? 377 PHE A HB2    1 
ATOM   6308  H  HB3    . PHE A 1 377 ? 21.292  15.703  -7.994  1.00 26.08  ? 377 PHE A HB3    1 
ATOM   6309  H  HD1    . PHE A 1 377 ? 22.588  15.306  -5.801  1.00 41.00  ? 377 PHE A HD1    1 
ATOM   6310  H  HD2    . PHE A 1 377 ? 22.331  12.583  -8.715  1.00 40.37  ? 377 PHE A HD2    1 
ATOM   6311  H  HE1    . PHE A 1 377 ? 24.438  14.223  -4.954  1.00 40.85  ? 377 PHE A HE1    1 
ATOM   6312  H  HE2    . PHE A 1 377 ? 24.181  11.499  -7.870  1.00 33.60  ? 377 PHE A HE2    1 
ATOM   6313  H  HZ     . PHE A 1 377 ? 25.237  12.316  -5.988  1.00 32.23  ? 377 PHE A HZ     1 
ATOM   6314  N  N      . GLU A 1 378 ? 18.409  16.613  -6.828  1.00 35.33  ? 378 GLU A N      1 
ATOM   6315  C  CA     . GLU A 1 378 ? 17.447  17.623  -7.260  1.00 42.72  ? 378 GLU A CA     1 
ATOM   6316  C  C      . GLU A 1 378 ? 18.047  19.015  -7.102  1.00 35.02  ? 378 GLU A C      1 
ATOM   6317  O  O      . GLU A 1 378 ? 19.004  19.204  -6.350  1.00 36.08  ? 378 GLU A O      1 
ATOM   6318  C  CB     . GLU A 1 378 ? 16.143  17.502  -6.470  1.00 43.74  ? 378 GLU A CB     1 
ATOM   6319  C  CG     . GLU A 1 378 ? 15.367  16.229  -6.775  1.00 45.59  ? 378 GLU A CG     1 
ATOM   6320  C  CD     . GLU A 1 378 ? 14.021  16.179  -6.080  1.00 76.37  ? 378 GLU A CD     1 
ATOM   6321  O  OE1    . GLU A 1 378 ? 13.754  17.049  -5.223  1.00 74.95  ? 378 GLU A OE1    1 
ATOM   6322  O  OE2    . GLU A 1 378 ? 13.229  15.263  -6.386  1.00 79.40  ? 378 GLU A OE2    1 
ATOM   6323  H  H      . GLU A 1 378 ? 18.747  16.768  -6.052  1.00 42.40  ? 378 GLU A H      1 
ATOM   6324  H  HA     . GLU A 1 378 ? 17.245  17.487  -8.199  1.00 51.27  ? 378 GLU A HA     1 
ATOM   6325  H  HB2    . GLU A 1 378 ? 16.349  17.506  -5.522  1.00 52.49  ? 378 GLU A HB2    1 
ATOM   6326  H  HB3    . GLU A 1 378 ? 15.574  18.257  -6.687  1.00 52.49  ? 378 GLU A HB3    1 
ATOM   6327  H  HG2    . GLU A 1 378 ? 15.212  16.174  -7.732  1.00 54.71  ? 378 GLU A HG2    1 
ATOM   6328  H  HG3    . GLU A 1 378 ? 15.886  15.464  -6.480  1.00 54.71  ? 378 GLU A HG3    1 
ATOM   6329  N  N      . MET A 1 379 ? 17.472  19.983  -7.808  1.00 33.50  ? 379 MET A N      1 
ATOM   6330  C  CA     . MET A 1 379 ? 18.017  21.338  -7.867  1.00 41.05  ? 379 MET A CA     1 
ATOM   6331  C  C      . MET A 1 379 ? 17.316  22.307  -6.908  1.00 37.85  ? 379 MET A C      1 
ATOM   6332  O  O      . MET A 1 379 ? 16.119  22.180  -6.649  1.00 38.58  ? 379 MET A O      1 
ATOM   6333  C  CB     . MET A 1 379 ? 17.915  21.872  -9.298  1.00 28.77  ? 379 MET A CB     1 
ATOM   6334  C  CG     . MET A 1 379 ? 18.517  20.953  -10.351 1.00 33.76  ? 379 MET A CG     1 
ATOM   6335  S  SD     . MET A 1 379 ? 20.296  20.735  -10.178 1.00 43.67  ? 379 MET A SD     1 
ATOM   6336  C  CE     . MET A 1 379 ? 20.901  22.084  -11.192 1.00 54.86  ? 379 MET A CE     1 
ATOM   6337  H  H      . MET A 1 379 ? 16.754  19.880  -8.270  1.00 40.20  ? 379 MET A H      1 
ATOM   6338  H  HA     . MET A 1 379 ? 18.958  21.302  -7.634  1.00 49.27  ? 379 MET A HA     1 
ATOM   6339  H  HB2    . MET A 1 379 ? 16.978  21.998  -9.518  1.00 34.52  ? 379 MET A HB2    1 
ATOM   6340  H  HB3    . MET A 1 379 ? 18.380  22.721  -9.348  1.00 34.52  ? 379 MET A HB3    1 
ATOM   6341  H  HG2    . MET A 1 379 ? 18.102  20.079  -10.279 1.00 40.51  ? 379 MET A HG2    1 
ATOM   6342  H  HG3    . MET A 1 379 ? 18.347  21.328  -11.229 1.00 40.51  ? 379 MET A HG3    1 
ATOM   6343  H  HE1    . MET A 1 379 ? 21.871  22.075  -11.181 1.00 65.83  ? 379 MET A HE1    1 
ATOM   6344  H  HE2    . MET A 1 379 ? 20.579  21.965  -12.099 1.00 65.83  ? 379 MET A HE2    1 
ATOM   6345  H  HE3    . MET A 1 379 ? 20.573  22.922  -10.831 1.00 65.83  ? 379 MET A HE3    1 
ATOM   6346  N  N      . ARG A 1 380 ? 18.077  23.253  -6.360  1.00 29.57  ? 380 ARG A N      1 
ATOM   6347  C  CA     . ARG A 1 380 ? 17.513  24.323  -5.539  1.00 23.93  ? 380 ARG A CA     1 
ATOM   6348  C  C      . ARG A 1 380 ? 16.959  25.423  -6.435  1.00 39.69  ? 380 ARG A C      1 
ATOM   6349  O  O      . ARG A 1 380 ? 17.426  25.599  -7.563  1.00 32.82  ? 380 ARG A O      1 
ATOM   6350  C  CB     . ARG A 1 380 ? 18.566  24.906  -4.600  1.00 20.14  ? 380 ARG A CB     1 
ATOM   6351  C  CG     . ARG A 1 380 ? 18.973  23.976  -3.480  1.00 25.43  ? 380 ARG A CG     1 
ATOM   6352  C  CD     . ARG A 1 380 ? 19.813  24.699  -2.448  1.00 19.22  ? 380 ARG A CD     1 
ATOM   6353  N  NE     . ARG A 1 380 ? 19.985  23.895  -1.241  1.00 20.68  ? 380 ARG A NE     1 
ATOM   6354  C  CZ     . ARG A 1 380 ? 20.984  23.043  -1.040  1.00 25.41  ? 380 ARG A CZ     1 
ATOM   6355  N  NH1    . ARG A 1 380 ? 21.920  22.871  -1.964  1.00 13.42  ? 380 ARG A NH1    1 
ATOM   6356  N  NH2    . ARG A 1 380 ? 21.048  22.359  0.096   1.00 43.08  ? 380 ARG A NH2    1 
ATOM   6357  H  H      . ARG A 1 380 ? 18.931  23.297  -6.449  1.00 35.49  ? 380 ARG A H      1 
ATOM   6358  H  HA     . ARG A 1 380 ? 16.786  23.970  -5.003  1.00 28.71  ? 380 ARG A HA     1 
ATOM   6359  H  HB2    . ARG A 1 380 ? 19.361  25.115  -5.115  1.00 24.17  ? 380 ARG A HB2    1 
ATOM   6360  H  HB3    . ARG A 1 380 ? 18.212  25.715  -4.199  1.00 24.17  ? 380 ARG A HB3    1 
ATOM   6361  H  HG2    . ARG A 1 380 ? 18.178  23.634  -3.042  1.00 30.51  ? 380 ARG A HG2    1 
ATOM   6362  H  HG3    . ARG A 1 380 ? 19.497  23.246  -3.844  1.00 30.51  ? 380 ARG A HG3    1 
ATOM   6363  H  HD2    . ARG A 1 380 ? 20.690  24.881  -2.819  1.00 23.06  ? 380 ARG A HD2    1 
ATOM   6364  H  HD3    . ARG A 1 380 ? 19.374  25.528  -2.201  1.00 23.06  ? 380 ARG A HD3    1 
ATOM   6365  H  HE     . ARG A 1 380 ? 19.399  23.980  -0.617  1.00 24.81  ? 380 ARG A HE     1 
ATOM   6366  H  HH11   . ARG A 1 380 ? 21.883  23.312  -2.702  1.00 16.10  ? 380 ARG A HH11   1 
ATOM   6367  H  HH12   . ARG A 1 380 ? 22.564  22.318  -1.827  1.00 16.10  ? 380 ARG A HH12   1 
ATOM   6368  H  HH21   . ARG A 1 380 ? 20.444  22.468  0.698   1.00 51.69  ? 380 ARG A HH21   1 
ATOM   6369  H  HH22   . ARG A 1 380 ? 21.694  21.807  0.229   1.00 51.69  ? 380 ARG A HH22   1 
ATOM   6370  N  N      . LYS A 1 381 ? 16.004  26.192  -5.920  1.00 35.37  ? 381 LYS A N      1 
ATOM   6371  C  CA     . LYS A 1 381 ? 15.401  27.268  -6.700  1.00 45.43  ? 381 LYS A CA     1 
ATOM   6372  C  C      . LYS A 1 381 ? 16.112  28.599  -6.456  1.00 32.83  ? 381 LYS A C      1 
ATOM   6373  O  O      . LYS A 1 381 ? 15.843  29.591  -7.132  1.00 27.90  ? 381 LYS A O      1 
ATOM   6374  C  CB     . LYS A 1 381 ? 13.911  27.389  -6.375  1.00 53.82  ? 381 LYS A CB     1 
ATOM   6375  C  CG     . LYS A 1 381 ? 13.043  27.700  -7.595  1.00 43.55  ? 381 LYS A CG     1 
ATOM   6376  C  CD     . LYS A 1 381 ? 11.601  27.250  -7.410  1.00 50.94  ? 381 LYS A CD     1 
ATOM   6377  C  CE     . LYS A 1 381 ? 11.449  25.735  -7.467  1.00 70.04  ? 381 LYS A CE     1 
ATOM   6378  N  NZ     . LYS A 1 381 ? 11.787  25.188  -8.811  1.00 64.83  ? 381 LYS A NZ     1 
ATOM   6379  H  H      . LYS A 1 381 ? 15.689  26.112  -5.124  1.00 42.44  ? 381 LYS A H      1 
ATOM   6380  H  HA     . LYS A 1 381 ? 15.483  27.056  -7.643  1.00 54.51  ? 381 LYS A HA     1 
ATOM   6381  H  HB2    . LYS A 1 381 ? 13.604  26.550  -5.997  1.00 64.58  ? 381 LYS A HB2    1 
ATOM   6382  H  HB3    . LYS A 1 381 ? 13.788  28.105  -5.732  1.00 64.58  ? 381 LYS A HB3    1 
ATOM   6383  H  HG2    . LYS A 1 381 ? 13.043  28.658  -7.748  1.00 52.26  ? 381 LYS A HG2    1 
ATOM   6384  H  HG3    . LYS A 1 381 ? 13.406  27.239  -8.368  1.00 52.26  ? 381 LYS A HG3    1 
ATOM   6385  H  HD2    . LYS A 1 381 ? 11.284  27.552  -6.544  1.00 61.12  ? 381 LYS A HD2    1 
ATOM   6386  H  HD3    . LYS A 1 381 ? 11.057  27.634  -8.115  1.00 61.12  ? 381 LYS A HD3    1 
ATOM   6387  H  HE2    . LYS A 1 381 ? 12.045  25.331  -6.817  1.00 84.04  ? 381 LYS A HE2    1 
ATOM   6388  H  HE3    . LYS A 1 381 ? 10.529  25.500  -7.267  1.00 84.04  ? 381 LYS A HE3    1 
ATOM   6389  H  HZ1    . LYS A 1 381 ? 11.689  24.304  -8.812  1.00 77.80  ? 381 LYS A HZ1    1 
ATOM   6390  H  HZ2    . LYS A 1 381 ? 11.249  25.540  -9.426  1.00 77.80  ? 381 LYS A HZ2    1 
ATOM   6391  H  HZ3    . LYS A 1 381 ? 12.630  25.386  -9.016  1.00 77.80  ? 381 LYS A HZ3    1 
ATOM   6392  N  N      . PHE A 1 382 ? 17.010  28.610  -5.478  1.00 26.85  ? 382 PHE A N      1 
ATOM   6393  C  CA     . PHE A 1 382 ? 17.847  29.771  -5.195  1.00 26.63  ? 382 PHE A CA     1 
ATOM   6394  C  C      . PHE A 1 382 ? 19.135  29.278  -4.554  1.00 29.96  ? 382 PHE A C      1 
ATOM   6395  O  O      . PHE A 1 382 ? 19.149  28.222  -3.918  1.00 29.63  ? 382 PHE A O      1 
ATOM   6396  C  CB     . PHE A 1 382 ? 17.129  30.773  -4.289  1.00 31.24  ? 382 PHE A CB     1 
ATOM   6397  C  CG     . PHE A 1 382 ? 16.299  30.132  -3.220  1.00 31.67  ? 382 PHE A CG     1 
ATOM   6398  C  CD1    . PHE A 1 382 ? 16.899  29.505  -2.144  1.00 39.98  ? 382 PHE A CD1    1 
ATOM   6399  C  CD2    . PHE A 1 382 ? 14.915  30.167  -3.285  1.00 35.95  ? 382 PHE A CD2    1 
ATOM   6400  C  CE1    . PHE A 1 382 ? 16.138  28.914  -1.158  1.00 36.12  ? 382 PHE A CE1    1 
ATOM   6401  C  CE2    . PHE A 1 382 ? 14.145  29.578  -2.299  1.00 39.68  ? 382 PHE A CE2    1 
ATOM   6402  C  CZ     . PHE A 1 382 ? 14.759  28.950  -1.232  1.00 41.31  ? 382 PHE A CZ     1 
ATOM   6403  H  H      . PHE A 1 382 ? 17.157  27.944  -4.954  1.00 32.21  ? 382 PHE A H      1 
ATOM   6404  H  HA     . PHE A 1 382 ? 18.070  30.217  -6.026  1.00 31.96  ? 382 PHE A HA     1 
ATOM   6405  H  HB2    . PHE A 1 382 ? 17.792  31.332  -3.854  1.00 37.49  ? 382 PHE A HB2    1 
ATOM   6406  H  HB3    . PHE A 1 382 ? 16.542  31.321  -4.832  1.00 37.49  ? 382 PHE A HB3    1 
ATOM   6407  H  HD1    . PHE A 1 382 ? 17.827  29.475  -2.088  1.00 47.98  ? 382 PHE A HD1    1 
ATOM   6408  H  HD2    . PHE A 1 382 ? 14.499  30.587  -4.003  1.00 43.15  ? 382 PHE A HD2    1 
ATOM   6409  H  HE1    . PHE A 1 382 ? 16.554  28.493  -0.440  1.00 43.34  ? 382 PHE A HE1    1 
ATOM   6410  H  HE2    . PHE A 1 382 ? 13.217  29.604  -2.353  1.00 47.62  ? 382 PHE A HE2    1 
ATOM   6411  H  HZ     . PHE A 1 382 ? 14.245  28.553  -0.566  1.00 49.58  ? 382 PHE A HZ     1 
ATOM   6412  N  N      . THR A 1 383 ? 20.211  30.041  -4.719  1.00 23.50  ? 383 THR A N      1 
ATOM   6413  C  CA     . THR A 1 383 ? 21.534  29.592  -4.301  1.00 17.00  ? 383 THR A CA     1 
ATOM   6414  C  C      . THR A 1 383 ? 22.250  30.571  -3.373  1.00 19.76  ? 383 THR A C      1 
ATOM   6415  O  O      . THR A 1 383 ? 23.416  30.369  -3.037  1.00 23.47  ? 383 THR A O      1 
ATOM   6416  C  CB     . THR A 1 383 ? 22.419  29.331  -5.529  1.00 17.21  ? 383 THR A CB     1 
ATOM   6417  O  OG1    . THR A 1 383 ? 22.489  30.514  -6.336  1.00 35.04  ? 383 THR A OG1    1 
ATOM   6418  C  CG2    . THR A 1 383 ? 21.842  28.198  -6.356  1.00 28.69  ? 383 THR A CG2    1 
ATOM   6419  H  H      . THR A 1 383 ? 20.201  30.825  -5.072  1.00 28.21  ? 383 THR A H      1 
ATOM   6420  H  HA     . THR A 1 383 ? 21.438  28.753  -3.824  1.00 20.40  ? 383 THR A HA     1 
ATOM   6421  H  HB     . THR A 1 383 ? 23.311  29.081  -5.241  1.00 20.65  ? 383 THR A HB     1 
ATOM   6422  H  HG1    . THR A 1 383 ? 22.973  30.374  -7.009  1.00 42.05  ? 383 THR A HG1    1 
ATOM   6423  H  HG21   . THR A 1 383 ? 22.402  28.035  -7.131  1.00 34.43  ? 383 THR A HG21   1 
ATOM   6424  H  HG22   . THR A 1 383 ? 21.797  27.389  -5.823  1.00 34.43  ? 383 THR A HG22   1 
ATOM   6425  H  HG23   . THR A 1 383 ? 20.948  28.428  -6.655  1.00 34.43  ? 383 THR A HG23   1 
ATOM   6426  N  N      . THR A 1 384 ? 21.557  31.624  -2.958  1.00 21.70  ? 384 THR A N      1 
ATOM   6427  C  CA     . THR A 1 384 ? 22.115  32.573  -1.999  1.00 22.36  ? 384 THR A CA     1 
ATOM   6428  C  C      . THR A 1 384 ? 21.068  32.952  -0.954  1.00 19.61  ? 384 THR A C      1 
ATOM   6429  O  O      . THR A 1 384 ? 19.872  32.778  -1.183  1.00 16.20  ? 384 THR A O      1 
ATOM   6430  C  CB     . THR A 1 384 ? 22.637  33.842  -2.696  1.00 19.11  ? 384 THR A CB     1 
ATOM   6431  O  OG1    . THR A 1 384 ? 21.573  34.461  -3.428  1.00 20.93  ? 384 THR A OG1    1 
ATOM   6432  C  CG2    . THR A 1 384 ? 23.768  33.497  -3.651  1.00 21.43  ? 384 THR A CG2    1 
ATOM   6433  H  H      . THR A 1 384 ? 20.758  31.814  -3.216  1.00 26.04  ? 384 THR A H      1 
ATOM   6434  H  HA     . THR A 1 384 ? 22.860  32.156  -1.540  1.00 26.84  ? 384 THR A HA     1 
ATOM   6435  H  HB     . THR A 1 384 ? 22.974  34.461  -2.030  1.00 22.93  ? 384 THR A HB     1 
ATOM   6436  H  HG1    . THR A 1 384 ? 21.854  35.154  -3.810  1.00 25.12  ? 384 THR A HG1    1 
ATOM   6437  H  HG21   . THR A 1 384 ? 24.091  34.301  -4.086  1.00 25.72  ? 384 THR A HG21   1 
ATOM   6438  H  HG22   . THR A 1 384 ? 24.499  33.086  -3.163  1.00 25.72  ? 384 THR A HG22   1 
ATOM   6439  H  HG23   . THR A 1 384 ? 23.453  32.877  -4.327  1.00 25.72  ? 384 THR A HG23   1 
ATOM   6440  N  N      . PRO A 1 385 ? 21.515  33.422  0.221   1.00 19.10  ? 385 PRO A N      1 
ATOM   6441  C  CA     . PRO A 1 385 ? 20.541  33.838  1.232   1.00 13.53  ? 385 PRO A CA     1 
ATOM   6442  C  C      . PRO A 1 385 ? 19.660  34.982  0.737   1.00 19.26  ? 385 PRO A C      1 
ATOM   6443  O  O      . PRO A 1 385 ? 18.445  34.942  0.933   1.00 16.53  ? 385 PRO A O      1 
ATOM   6444  C  CB     . PRO A 1 385 ? 21.416  34.287  2.408   1.00 15.91  ? 385 PRO A CB     1 
ATOM   6445  C  CG     . PRO A 1 385 ? 22.741  33.667  2.178   1.00 14.38  ? 385 PRO A CG     1 
ATOM   6446  C  CD     . PRO A 1 385 ? 22.900  33.572  0.699   1.00 19.29  ? 385 PRO A CD     1 
ATOM   6447  H  HA     . PRO A 1 385 ? 19.986  33.089  1.503   1.00 16.24  ? 385 PRO A HA     1 
ATOM   6448  H  HB2    . PRO A 1 385 ? 21.487  35.254  2.409   1.00 19.09  ? 385 PRO A HB2    1 
ATOM   6449  H  HB3    . PRO A 1 385 ? 21.031  33.971  3.240   1.00 19.09  ? 385 PRO A HB3    1 
ATOM   6450  H  HG2    . PRO A 1 385 ? 23.433  34.229  2.559   1.00 17.26  ? 385 PRO A HG2    1 
ATOM   6451  H  HG3    . PRO A 1 385 ? 22.760  32.784  2.579   1.00 17.26  ? 385 PRO A HG3    1 
ATOM   6452  H  HD2    . PRO A 1 385 ? 23.293  34.387  0.347   1.00 23.15  ? 385 PRO A HD2    1 
ATOM   6453  H  HD3    . PRO A 1 385 ? 23.426  32.792  0.463   1.00 23.15  ? 385 PRO A HD3    1 
ATOM   6454  N  N      . GLU A 1 386 ? 20.263  35.967  0.073   1.00 18.92  ? 386 GLU A N      1 
ATOM   6455  C  CA     . GLU A 1 386 ? 19.521  37.121  -0.428  1.00 14.58  ? 386 GLU A CA     1 
ATOM   6456  C  C      . GLU A 1 386 ? 18.400  36.678  -1.368  1.00 21.44  ? 386 GLU A C      1 
ATOM   6457  O  O      . GLU A 1 386 ? 17.270  37.157  -1.268  1.00 19.99  ? 386 GLU A O      1 
ATOM   6458  C  CB     . GLU A 1 386 ? 20.450  38.102  -1.150  1.00 20.89  ? 386 GLU A CB     1 
ATOM   6459  C  CG     . GLU A 1 386 ? 21.495  38.780  -0.267  1.00 19.52  ? 386 GLU A CG     1 
ATOM   6460  C  CD     . GLU A 1 386 ? 22.805  38.011  -0.178  1.00 37.39  ? 386 GLU A CD     1 
ATOM   6461  O  OE1    . GLU A 1 386 ? 22.815  36.796  -0.482  1.00 28.32  ? 386 GLU A OE1    1 
ATOM   6462  O  OE2    . GLU A 1 386 ? 23.830  38.633  0.186   1.00 24.17  ? 386 GLU A OE2    1 
ATOM   6463  H  H      . GLU A 1 386 ? 21.105  35.989  -0.102  1.00 22.70  ? 386 GLU A H      1 
ATOM   6464  H  HA     . GLU A 1 386 ? 19.118  37.587  0.322   1.00 17.50  ? 386 GLU A HA     1 
ATOM   6465  H  HB2    . GLU A 1 386 ? 20.925  37.620  -1.845  1.00 25.07  ? 386 GLU A HB2    1 
ATOM   6466  H  HB3    . GLU A 1 386 ? 19.909  38.800  -1.551  1.00 25.07  ? 386 GLU A HB3    1 
ATOM   6467  H  HG2    . GLU A 1 386 ? 21.689  39.659  -0.629  1.00 23.42  ? 386 GLU A HG2    1 
ATOM   6468  H  HG3    . GLU A 1 386 ? 21.138  38.866  0.632   1.00 23.42  ? 386 GLU A HG3    1 
ATOM   6469  N  N      . GLU A 1 387 ? 18.715  35.753  -2.271  1.00 20.16  ? 387 GLU A N      1 
ATOM   6470  C  CA     . GLU A 1 387 ? 17.734  35.247  -3.221  1.00 16.02  ? 387 GLU A CA     1 
ATOM   6471  C  C      . GLU A 1 387 ? 16.641  34.461  -2.506  1.00 21.97  ? 387 GLU A C      1 
ATOM   6472  O  O      . GLU A 1 387 ? 15.482  34.476  -2.918  1.00 34.61  ? 387 GLU A O      1 
ATOM   6473  C  CB     . GLU A 1 387 ? 18.407  34.359  -4.273  1.00 21.32  ? 387 GLU A CB     1 
ATOM   6474  C  CG     . GLU A 1 387 ? 19.194  35.123  -5.335  1.00 55.11  ? 387 GLU A CG     1 
ATOM   6475  C  CD     . GLU A 1 387 ? 19.758  34.216  -6.421  1.00 61.35  ? 387 GLU A CD     1 
ATOM   6476  O  OE1    . GLU A 1 387 ? 19.730  32.977  -6.244  1.00 41.12  ? 387 GLU A OE1    1 
ATOM   6477  O  OE2    . GLU A 1 387 ? 20.224  34.746  -7.455  1.00 41.43  ? 387 GLU A OE2    1 
ATOM   6478  H  H      . GLU A 1 387 ? 19.496  35.402  -2.352  1.00 24.19  ? 387 GLU A H      1 
ATOM   6479  H  HA     . GLU A 1 387 ? 17.318  35.994  -3.678  1.00 19.22  ? 387 GLU A HA     1 
ATOM   6480  H  HB2    . GLU A 1 387 ? 19.024  33.760  -3.824  1.00 25.58  ? 387 GLU A HB2    1 
ATOM   6481  H  HB3    . GLU A 1 387 ? 17.723  33.843  -4.728  1.00 25.58  ? 387 GLU A HB3    1 
ATOM   6482  H  HG2    . GLU A 1 387 ? 18.607  35.768  -5.759  1.00 66.14  ? 387 GLU A HG2    1 
ATOM   6483  H  HG3    . GLU A 1 387 ? 19.936  35.579  -4.910  1.00 66.14  ? 387 GLU A HG3    1 
ATOM   6484  N  N      . GLY A 1 388 ? 17.014  33.778  -1.431  1.00 22.63  ? 388 GLY A N      1 
ATOM   6485  C  CA     . GLY A 1 388 ? 16.067  32.974  -0.684  1.00 19.85  ? 388 GLY A CA     1 
ATOM   6486  C  C      . GLY A 1 388 ? 15.101  33.846  0.084   1.00 20.01  ? 388 GLY A C      1 
ATOM   6487  O  O      . GLY A 1 388 ? 13.893  33.614  0.073   1.00 23.74  ? 388 GLY A O      1 
ATOM   6488  H  H      . GLY A 1 388 ? 17.814  33.766  -1.114  1.00 27.16  ? 388 GLY A H      1 
ATOM   6489  H  HA2    . GLY A 1 388 ? 15.564  32.411  -1.292  1.00 23.82  ? 388 GLY A HA2    1 
ATOM   6490  H  HA3    . GLY A 1 388 ? 16.542  32.407  -0.056  1.00 23.82  ? 388 GLY A HA3    1 
ATOM   6491  N  N      . VAL A 1 389 ? 15.643  34.858  0.751   1.00 20.77  ? 389 VAL A N      1 
ATOM   6492  C  CA     . VAL A 1 389 ? 14.842  35.770  1.558   1.00 15.19  ? 389 VAL A CA     1 
ATOM   6493  C  C      . VAL A 1 389 ? 13.911  36.592  0.675   1.00 24.73  ? 389 VAL A C      1 
ATOM   6494  O  O      . VAL A 1 389 ? 12.804  36.939  1.087   1.00 26.78  ? 389 VAL A O      1 
ATOM   6495  C  CB     . VAL A 1 389 ? 15.733  36.698  2.395   1.00 17.67  ? 389 VAL A CB     1 
ATOM   6496  C  CG1    . VAL A 1 389 ? 14.905  37.781  3.087   1.00 21.42  ? 389 VAL A CG1    1 
ATOM   6497  C  CG2    . VAL A 1 389 ? 16.499  35.882  3.423   1.00 19.77  ? 389 VAL A CG2    1 
ATOM   6498  H  H      . VAL A 1 389 ? 16.483  35.041  0.752   1.00 24.92  ? 389 VAL A H      1 
ATOM   6499  H  HA     . VAL A 1 389 ? 14.294  35.252  2.168   1.00 18.23  ? 389 VAL A HA     1 
ATOM   6500  H  HB     . VAL A 1 389 ? 16.376  37.133  1.814   1.00 21.21  ? 389 VAL A HB     1 
ATOM   6501  H  HG11   . VAL A 1 389 ? 15.497  38.348  3.606   1.00 25.71  ? 389 VAL A HG11   1 
ATOM   6502  H  HG12   . VAL A 1 389 ? 14.448  38.308  2.412   1.00 25.71  ? 389 VAL A HG12   1 
ATOM   6503  H  HG13   . VAL A 1 389 ? 14.256  37.357  3.671   1.00 25.71  ? 389 VAL A HG13   1 
ATOM   6504  H  HG21   . VAL A 1 389 ? 17.058  36.478  3.946   1.00 23.72  ? 389 VAL A HG21   1 
ATOM   6505  H  HG22   . VAL A 1 389 ? 15.865  35.430  4.002   1.00 23.72  ? 389 VAL A HG22   1 
ATOM   6506  H  HG23   . VAL A 1 389 ? 17.050  35.231  2.962   1.00 23.72  ? 389 VAL A HG23   1 
ATOM   6507  N  N      . ARG A 1 390 ? 14.372  36.913  -0.531  1.00 23.95  ? 390 ARG A N      1 
ATOM   6508  C  CA     . ARG A 1 390 ? 13.548  37.625  -1.499  1.00 21.32  ? 390 ARG A CA     1 
ATOM   6509  C  C      . ARG A 1 390 ? 12.282  36.822  -1.760  1.00 23.49  ? 390 ARG A C      1 
ATOM   6510  O  O      . ARG A 1 390 ? 11.182  37.367  -1.799  1.00 28.38  ? 390 ARG A O      1 
ATOM   6511  C  CB     . ARG A 1 390 ? 14.296  37.812  -2.814  1.00 19.89  ? 390 ARG A CB     1 
ATOM   6512  C  CG     . ARG A 1 390 ? 13.487  38.482  -3.916  1.00 15.72  ? 390 ARG A CG     1 
ATOM   6513  C  CD     . ARG A 1 390 ? 14.099  38.193  -5.272  1.00 28.75  ? 390 ARG A CD     1 
ATOM   6514  N  NE     . ARG A 1 390 ? 15.440  38.738  -5.445  1.00 43.30  ? 390 ARG A NE     1 
ATOM   6515  C  CZ     . ARG A 1 390 ? 16.369  38.197  -6.231  1.00 48.90  ? 390 ARG A CZ     1 
ATOM   6516  N  NH1    . ARG A 1 390 ? 16.116  37.085  -6.915  1.00 30.25  ? 390 ARG A NH1    1 
ATOM   6517  N  NH2    . ARG A 1 390 ? 17.563  38.764  -6.327  1.00 49.38  ? 390 ARG A NH2    1 
ATOM   6518  H  H      . ARG A 1 390 ? 15.163  36.728  -0.814  1.00 28.74  ? 390 ARG A H      1 
ATOM   6519  H  HA     . ARG A 1 390 ? 13.303  38.495  -1.148  1.00 25.58  ? 390 ARG A HA     1 
ATOM   6520  H  HB2    . ARG A 1 390 ? 15.079  38.362  -2.650  1.00 23.86  ? 390 ARG A HB2    1 
ATOM   6521  H  HB3    . ARG A 1 390 ? 14.572  36.942  -3.141  1.00 23.86  ? 390 ARG A HB3    1 
ATOM   6522  H  HG2    . ARG A 1 390 ? 12.581  38.136  -3.908  1.00 18.86  ? 390 ARG A HG2    1 
ATOM   6523  H  HG3    . ARG A 1 390 ? 13.485  39.442  -3.778  1.00 18.86  ? 390 ARG A HG3    1 
ATOM   6524  H  HD2    . ARG A 1 390 ? 14.152  37.231  -5.391  1.00 34.50  ? 390 ARG A HD2    1 
ATOM   6525  H  HD3    . ARG A 1 390 ? 13.532  38.578  -5.958  1.00 34.50  ? 390 ARG A HD3    1 
ATOM   6526  H  HE     . ARG A 1 390 ? 15.622  39.487  -5.063  1.00 51.96  ? 390 ARG A HE     1 
ATOM   6527  H  HH11   . ARG A 1 390 ? 15.343  36.712  -6.857  1.00 36.30  ? 390 ARG A HH11   1 
ATOM   6528  H  HH12   . ARG A 1 390 ? 16.723  36.743  -7.418  1.00 36.30  ? 390 ARG A HH12   1 
ATOM   6529  H  HH21   . ARG A 1 390 ? 17.736  39.482  -5.887  1.00 59.26  ? 390 ARG A HH21   1 
ATOM   6530  H  HH22   . ARG A 1 390 ? 18.165  38.414  -6.833  1.00 59.26  ? 390 ARG A HH22   1 
ATOM   6531  N  N      . SER A 1 391 ? 12.460  35.517  -1.939  1.00 16.77  ? 391 SER A N      1 
ATOM   6532  C  CA     . SER A 1 391 ? 11.352  34.616  -2.222  1.00 23.46  ? 391 SER A CA     1 
ATOM   6533  C  C      . SER A 1 391 ? 10.407  34.461  -1.033  1.00 25.86  ? 391 SER A C      1 
ATOM   6534  O  O      . SER A 1 391 ? 9.189   34.571  -1.181  1.00 19.66  ? 391 SER A O      1 
ATOM   6535  C  CB     . SER A 1 391 ? 11.894  33.245  -2.636  1.00 28.14  ? 391 SER A CB     1 
ATOM   6536  O  OG     . SER A 1 391 ? 10.845  32.316  -2.844  1.00 27.46  ? 391 SER A OG     1 
ATOM   6537  H  H      . SER A 1 391 ? 13.224  35.126  -1.900  1.00 20.12  ? 391 SER A H      1 
ATOM   6538  H  HA     . SER A 1 391 ? 10.840  34.972  -2.965  1.00 28.15  ? 391 SER A HA     1 
ATOM   6539  H  HB2    . SER A 1 391 ? 12.396  33.341  -3.460  1.00 33.77  ? 391 SER A HB2    1 
ATOM   6540  H  HB3    . SER A 1 391 ? 12.474  32.911  -1.933  1.00 33.77  ? 391 SER A HB3    1 
ATOM   6541  H  HG     . SER A 1 391 ? 11.162  31.571  -3.070  1.00 32.96  ? 391 SER A HG     1 
ATOM   6542  N  N      . TYR A 1 392 ? 10.977  34.208  0.143   1.00 29.19  ? 392 TYR A N      1 
ATOM   6543  C  CA     . TYR A 1 392 ? 10.188  33.984  1.352   1.00 29.20  ? 392 TYR A CA     1 
ATOM   6544  C  C      . TYR A 1 392 ? 9.379   35.218  1.729   1.00 27.93  ? 392 TYR A C      1 
ATOM   6545  O  O      . TYR A 1 392 ? 8.191   35.124  2.031   1.00 30.42  ? 392 TYR A O      1 
ATOM   6546  C  CB     . TYR A 1 392 ? 11.097  33.579  2.514   1.00 17.44  ? 392 TYR A CB     1 
ATOM   6547  C  CG     . TYR A 1 392 ? 10.364  33.238  3.799   1.00 22.02  ? 392 TYR A CG     1 
ATOM   6548  C  CD1    . TYR A 1 392 ? 9.777   31.992  3.972   1.00 30.13  ? 392 TYR A CD1    1 
ATOM   6549  C  CD2    . TYR A 1 392 ? 10.279  34.151  4.844   1.00 22.84  ? 392 TYR A CD2    1 
ATOM   6550  C  CE1    . TYR A 1 392 ? 9.116   31.665  5.145   1.00 43.20  ? 392 TYR A CE1    1 
ATOM   6551  C  CE2    . TYR A 1 392 ? 9.619   33.833  6.023   1.00 29.79  ? 392 TYR A CE2    1 
ATOM   6552  C  CZ     . TYR A 1 392 ? 9.040   32.587  6.167   1.00 35.95  ? 392 TYR A CZ     1 
ATOM   6553  O  OH     . TYR A 1 392 ? 8.381   32.256  7.331   1.00 29.08  ? 392 TYR A OH     1 
ATOM   6554  H  H      . TYR A 1 392 ? 11.826  34.160  0.268   1.00 35.03  ? 392 TYR A H      1 
ATOM   6555  H  HA     . TYR A 1 392 ? 9.566   33.257  1.192   1.00 35.04  ? 392 TYR A HA     1 
ATOM   6556  H  HB2    . TYR A 1 392 ? 11.607  32.797  2.250   1.00 20.93  ? 392 TYR A HB2    1 
ATOM   6557  H  HB3    . TYR A 1 392 ? 11.701  34.313  2.706   1.00 20.93  ? 392 TYR A HB3    1 
ATOM   6558  H  HD1    . TYR A 1 392 ? 9.826   31.365  3.287   1.00 36.15  ? 392 TYR A HD1    1 
ATOM   6559  H  HD2    . TYR A 1 392 ? 10.669  34.990  4.750   1.00 27.41  ? 392 TYR A HD2    1 
ATOM   6560  H  HE1    . TYR A 1 392 ? 8.726   30.827  5.243   1.00 51.85  ? 392 TYR A HE1    1 
ATOM   6561  H  HE2    . TYR A 1 392 ? 9.567   34.455  6.712   1.00 35.75  ? 392 TYR A HE2    1 
ATOM   6562  H  HH     . TYR A 1 392 ? 8.080   31.474  7.279   1.00 34.89  ? 392 TYR A HH     1 
ATOM   6563  N  N      . ALA A 1 393 ? 10.026  36.377  1.711   1.00 20.80  ? 393 ALA A N      1 
ATOM   6564  C  CA     . ALA A 1 393 ? 9.361   37.615  2.089   1.00 17.57  ? 393 ALA A CA     1 
ATOM   6565  C  C      . ALA A 1 393 ? 8.286   37.990  1.080   1.00 27.80  ? 393 ALA A C      1 
ATOM   6566  O  O      . ALA A 1 393 ? 7.335   38.698  1.408   1.00 39.73  ? 393 ALA A O      1 
ATOM   6567  C  CB     . ALA A 1 393 ? 10.369  38.732  2.221   1.00 14.97  ? 393 ALA A CB     1 
ATOM   6568  H  H      . ALA A 1 393 ? 10.850  36.472  1.484   1.00 24.96  ? 393 ALA A H      1 
ATOM   6569  H  HA     . ALA A 1 393 ? 8.934   37.493  2.951   1.00 21.08  ? 393 ALA A HA     1 
ATOM   6570  H  HB1    . ALA A 1 393 ? 9.906   39.546  2.473   1.00 17.97  ? 393 ALA A HB1    1 
ATOM   6571  H  HB2    . ALA A 1 393 ? 11.016  38.494  2.904   1.00 17.97  ? 393 ALA A HB2    1 
ATOM   6572  H  HB3    . ALA A 1 393 ? 10.816  38.855  1.369   1.00 17.97  ? 393 ALA A HB3    1 
ATOM   6573  N  N      . SER A 1 394 ? 8.449   37.527  -0.153  1.00 31.56  ? 394 SER A N      1 
ATOM   6574  C  CA     . SER A 1 394 ? 7.480   37.811  -1.202  1.00 26.89  ? 394 SER A CA     1 
ATOM   6575  C  C      . SER A 1 394 ? 6.219   36.973  -1.037  1.00 20.11  ? 394 SER A C      1 
ATOM   6576  O  O      . SER A 1 394 ? 5.108   37.496  -1.095  1.00 20.63  ? 394 SER A O      1 
ATOM   6577  C  CB     . SER A 1 394 ? 8.098   37.562  -2.576  1.00 23.37  ? 394 SER A CB     1 
ATOM   6578  O  OG     . SER A 1 394 ? 9.038   38.574  -2.889  1.00 29.95  ? 394 SER A OG     1 
ATOM   6579  H  H      . SER A 1 394 ? 9.113   37.045  -0.409  1.00 37.87  ? 394 SER A H      1 
ATOM   6580  H  HA     . SER A 1 394 ? 7.226   38.746  -1.153  1.00 32.27  ? 394 SER A HA     1 
ATOM   6581  H  HB2    . SER A 1 394 ? 8.548   36.703  -2.569  1.00 28.04  ? 394 SER A HB2    1 
ATOM   6582  H  HB3    . SER A 1 394 ? 7.395   37.564  -3.244  1.00 28.04  ? 394 SER A HB3    1 
ATOM   6583  H  HG     . SER A 1 394 ? 9.652   38.584  -2.316  1.00 35.94  ? 394 SER A HG     1 
ATOM   6584  N  N      . THR A 1 395 ? 6.401   35.671  -0.839  1.00 23.45  ? 395 THR A N      1 
ATOM   6585  C  CA     . THR A 1 395 ? 5.285   34.732  -0.763  1.00 23.81  ? 395 THR A CA     1 
ATOM   6586  C  C      . THR A 1 395 ? 4.703   34.615  0.644   1.00 21.68  ? 395 THR A C      1 
ATOM   6587  O  O      . THR A 1 395 ? 3.487   34.577  0.815   1.00 31.97  ? 395 THR A O      1 
ATOM   6588  C  CB     . THR A 1 395 ? 5.706   33.330  -1.233  1.00 22.73  ? 395 THR A CB     1 
ATOM   6589  O  OG1    . THR A 1 395 ? 6.796   32.858  -0.434  1.00 41.55  ? 395 THR A OG1    1 
ATOM   6590  C  CG2    . THR A 1 395 ? 6.130   33.359  -2.693  1.00 20.82  ? 395 THR A CG2    1 
ATOM   6591  H  H      . THR A 1 395 ? 7.172   35.302  -0.745  1.00 28.14  ? 395 THR A H      1 
ATOM   6592  H  HA     . THR A 1 395 ? 4.578   35.041  -1.350  1.00 28.57  ? 395 THR A HA     1 
ATOM   6593  H  HB     . THR A 1 395 ? 4.955   32.722  -1.145  1.00 27.28  ? 395 THR A HB     1 
ATOM   6594  H  HG1    . THR A 1 395 ? 7.451   33.380  -0.506  1.00 49.86  ? 395 THR A HG1    1 
ATOM   6595  H  HG21   . THR A 1 395 ? 6.393   32.470  -2.979  1.00 24.98  ? 395 THR A HG21   1 
ATOM   6596  H  HG22   . THR A 1 395 ? 5.394   33.663  -3.246  1.00 24.98  ? 395 THR A HG22   1 
ATOM   6597  H  HG23   . THR A 1 395 ? 6.881   33.962  -2.807  1.00 24.98  ? 395 THR A HG23   1 
ATOM   6598  N  N      . HIS A 1 396 ? 5.573   34.536  1.646   1.00 31.40  ? 396 HIS A N      1 
ATOM   6599  C  CA     . HIS A 1 396 ? 5.136   34.346  3.026   1.00 30.19  ? 396 HIS A CA     1 
ATOM   6600  C  C      . HIS A 1 396 ? 5.118   35.664  3.799   1.00 25.10  ? 396 HIS A C      1 
ATOM   6601  O  O      . HIS A 1 396 ? 5.506   35.713  4.961   1.00 27.50  ? 396 HIS A O      1 
ATOM   6602  C  CB     . HIS A 1 396 ? 6.047   33.344  3.739   1.00 22.69  ? 396 HIS A CB     1 
ATOM   6603  C  CG     . HIS A 1 396 ? 6.013   31.969  3.151   1.00 22.65  ? 396 HIS A CG     1 
ATOM   6604  N  ND1    . HIS A 1 396 ? 6.495   31.683  1.893   1.00 31.61  ? 396 HIS A ND1    1 
ATOM   6605  C  CD2    . HIS A 1 396 ? 5.547   30.799  3.648   1.00 35.06  ? 396 HIS A CD2    1 
ATOM   6606  C  CE1    . HIS A 1 396 ? 6.334   30.396  1.643   1.00 41.60  ? 396 HIS A CE1    1 
ATOM   6607  N  NE2    . HIS A 1 396 ? 5.760   29.837  2.692   1.00 33.46  ? 396 HIS A NE2    1 
ATOM   6608  H  H      . HIS A 1 396 ? 6.427   34.590  1.553   1.00 37.68  ? 396 HIS A H      1 
ATOM   6609  H  HA     . HIS A 1 396 ? 4.236   33.986  3.025   1.00 36.23  ? 396 HIS A HA     1 
ATOM   6610  H  HB2    . HIS A 1 396 ? 6.961   33.664  3.691   1.00 27.23  ? 396 HIS A HB2    1 
ATOM   6611  H  HB3    . HIS A 1 396 ? 5.770   33.276  4.666   1.00 27.23  ? 396 HIS A HB3    1 
ATOM   6612  H  HD1    . HIS A 1 396 ? 6.850   32.253  1.355   1.00 37.93  ? 396 HIS A HD1    1 
ATOM   6613  H  HD2    . HIS A 1 396 ? 5.159   30.671  4.484   1.00 42.07  ? 396 HIS A HD2    1 
ATOM   6614  H  HE1    . HIS A 1 396 ? 6.580   29.959  0.860   1.00 49.92  ? 396 HIS A HE1    1 
ATOM   6615  H  HE2    . HIS A 1 396 ? 5.553   29.005  2.765   1.00 40.15  ? 396 HIS A HE2    1 
ATOM   6616  N  N      . TRP A 1 397 ? 4.662   36.732  3.157   1.00 27.83  ? 397 TRP A N      1 
ATOM   6617  C  CA     . TRP A 1 397 ? 4.605   38.037  3.807   1.00 29.71  ? 397 TRP A CA     1 
ATOM   6618  C  C      . TRP A 1 397 ? 3.650   38.026  4.997   1.00 27.45  ? 397 TRP A C      1 
ATOM   6619  O  O      . TRP A 1 397 ? 3.862   38.733  5.979   1.00 32.40  ? 397 TRP A O      1 
ATOM   6620  C  CB     . TRP A 1 397 ? 4.172   39.118  2.810   1.00 32.03  ? 397 TRP A CB     1 
ATOM   6621  C  CG     . TRP A 1 397 ? 2.843   38.840  2.183   1.00 34.46  ? 397 TRP A CG     1 
ATOM   6622  C  CD1    . TRP A 1 397 ? 2.616   38.198  1.003   1.00 37.78  ? 397 TRP A CD1    1 
ATOM   6623  C  CD2    . TRP A 1 397 ? 1.556   39.182  2.707   1.00 33.94  ? 397 TRP A CD2    1 
ATOM   6624  N  NE1    . TRP A 1 397 ? 1.268   38.119  0.758   1.00 45.52  ? 397 TRP A NE1    1 
ATOM   6625  C  CE2    . TRP A 1 397 ? 0.593   38.717  1.792   1.00 26.53  ? 397 TRP A CE2    1 
ATOM   6626  C  CE3    . TRP A 1 397 ? 1.122   39.838  3.863   1.00 40.07  ? 397 TRP A CE3    1 
ATOM   6627  C  CZ2    . TRP A 1 397 ? -0.774  38.885  1.991   1.00 33.06  ? 397 TRP A CZ2    1 
ATOM   6628  C  CZ3    . TRP A 1 397 ? -0.238  40.003  4.061   1.00 45.34  ? 397 TRP A CZ3    1 
ATOM   6629  C  CH2    . TRP A 1 397 ? -1.168  39.530  3.131   1.00 38.46  ? 397 TRP A CH2    1 
ATOM   6630  H  H      . TRP A 1 397 ? 4.380   36.730  2.345   1.00 33.40  ? 397 TRP A H      1 
ATOM   6631  H  HA     . TRP A 1 397 ? 5.489   38.267  4.134   1.00 35.66  ? 397 TRP A HA     1 
ATOM   6632  H  HB2    . TRP A 1 397 ? 4.112   39.968  3.274   1.00 38.44  ? 397 TRP A HB2    1 
ATOM   6633  H  HB3    . TRP A 1 397 ? 4.832   39.175  2.101   1.00 38.44  ? 397 TRP A HB3    1 
ATOM   6634  H  HD1    . TRP A 1 397 ? 3.279   37.860  0.445   1.00 45.34  ? 397 TRP A HD1    1 
ATOM   6635  H  HE1    . TRP A 1 397 ? 0.905   37.755  0.068   1.00 54.63  ? 397 TRP A HE1    1 
ATOM   6636  H  HE3    . TRP A 1 397 ? 1.734   40.153  4.488   1.00 48.09  ? 397 TRP A HE3    1 
ATOM   6637  H  HZ2    . TRP A 1 397 ? -1.394  38.573  1.373   1.00 39.68  ? 397 TRP A HZ2    1 
ATOM   6638  H  HZ3    . TRP A 1 397 ? -0.538  40.438  4.827   1.00 54.40  ? 397 TRP A HZ3    1 
ATOM   6639  H  HH2    . TRP A 1 397 ? -2.075  39.658  3.290   1.00 46.15  ? 397 TRP A HH2    1 
ATOM   6640  N  N      . HIS A 1 398 ? 2.608   37.209  4.909   1.00 26.84  ? 398 HIS A N      1 
ATOM   6641  C  CA     . HIS A 1 398 ? 1.512   37.265  5.869   1.00 29.54  ? 398 HIS A CA     1 
ATOM   6642  C  C      . HIS A 1 398 ? 1.877   36.722  7.246   1.00 28.12  ? 398 HIS A C      1 
ATOM   6643  O  O      . HIS A 1 398 ? 1.259   37.094  8.243   1.00 31.37  ? 398 HIS A O      1 
ATOM   6644  C  CB     . HIS A 1 398 ? 0.312   36.498  5.312   1.00 34.59  ? 398 HIS A CB     1 
ATOM   6645  C  CG     . HIS A 1 398 ? -0.890  36.523  6.203   1.00 25.44  ? 398 HIS A CG     1 
ATOM   6646  N  ND1    . HIS A 1 398 ? -1.045  35.663  7.266   1.00 33.29  ? 398 HIS A ND1    1 
ATOM   6647  C  CD2    . HIS A 1 398 ? -1.996  37.305  6.186   1.00 42.01  ? 398 HIS A CD2    1 
ATOM   6648  C  CE1    . HIS A 1 398 ? -2.194  35.909  7.867   1.00 47.20  ? 398 HIS A CE1    1 
ATOM   6649  N  NE2    . HIS A 1 398 ? -2.791  36.902  7.232   1.00 49.08  ? 398 HIS A NE2    1 
ATOM   6650  H  H      . HIS A 1 398 ? 2.511   36.609  4.300   1.00 32.21  ? 398 HIS A H      1 
ATOM   6651  H  HA     . HIS A 1 398 ? 1.244   38.191  5.980   1.00 35.45  ? 398 HIS A HA     1 
ATOM   6652  H  HB2    . HIS A 1 398 ? 0.058   36.890  4.462   1.00 41.51  ? 398 HIS A HB2    1 
ATOM   6653  H  HB3    . HIS A 1 398 ? 0.566   35.571  5.183   1.00 41.51  ? 398 HIS A HB3    1 
ATOM   6654  H  HD1    . HIS A 1 398 ? -0.481  35.057  7.501   1.00 39.95  ? 398 HIS A HD1    1 
ATOM   6655  H  HD2    . HIS A 1 398 ? -2.182  37.985  5.580   1.00 50.42  ? 398 HIS A HD2    1 
ATOM   6656  H  HE1    . HIS A 1 398 ? -2.525  35.462  8.612   1.00 56.64  ? 398 HIS A HE1    1 
ATOM   6657  H  HE2    . HIS A 1 398 ? -3.554  37.242  7.440   1.00 58.89  ? 398 HIS A HE2    1 
ATOM   6658  N  N      . THR A 1 399 ? 2.889   35.865  7.309   1.00 22.06  ? 399 THR A N      1 
ATOM   6659  C  CA     . THR A 1 399 ? 3.243   35.224  8.566   1.00 26.20  ? 399 THR A CA     1 
ATOM   6660  C  C      . THR A 1 399 ? 4.251   36.051  9.371   1.00 27.61  ? 399 THR A C      1 
ATOM   6661  O  O      . THR A 1 399 ? 4.632   35.662  10.475  1.00 32.30  ? 399 THR A O      1 
ATOM   6662  C  CB     . THR A 1 399 ? 3.810   33.803  8.321   1.00 28.71  ? 399 THR A CB     1 
ATOM   6663  O  OG1    . THR A 1 399 ? 3.786   33.056  9.544   1.00 51.09  ? 399 THR A OG1    1 
ATOM   6664  C  CG2    . THR A 1 399 ? 5.234   33.851  7.776   1.00 22.12  ? 399 THR A CG2    1 
ATOM   6665  H  H      . THR A 1 399 ? 3.383   35.640  6.642   1.00 26.48  ? 399 THR A H      1 
ATOM   6666  H  HA     . THR A 1 399 ? 2.441   35.132  9.104   1.00 31.44  ? 399 THR A HA     1 
ATOM   6667  H  HB     . THR A 1 399 ? 3.254   33.352  7.667   1.00 34.46  ? 399 THR A HB     1 
ATOM   6668  H  HG1    . THR A 1 399 ? 4.093   32.285  9.415   1.00 61.31  ? 399 THR A HG1    1 
ATOM   6669  H  HG21   . THR A 1 399 ? 5.563   32.950  7.632   1.00 26.55  ? 399 THR A HG21   1 
ATOM   6670  H  HG22   . THR A 1 399 ? 5.250   34.331  6.933   1.00 26.55  ? 399 THR A HG22   1 
ATOM   6671  H  HG23   . THR A 1 399 ? 5.815   34.302  8.407   1.00 26.55  ? 399 THR A HG23   1 
ATOM   6672  N  N      . LEU A 1 400 ? 4.665   37.196  8.832   1.00 17.69  ? 400 LEU A N      1 
ATOM   6673  C  CA     . LEU A 1 400 ? 5.702   38.011  9.468   1.00 18.34  ? 400 LEU A CA     1 
ATOM   6674  C  C      . LEU A 1 400 ? 5.132   39.074  10.415  1.00 22.39  ? 400 LEU A C      1 
ATOM   6675  O  O      . LEU A 1 400 ? 5.744   40.123  10.619  1.00 16.01  ? 400 LEU A O      1 
ATOM   6676  C  CB     . LEU A 1 400 ? 6.564   38.690  8.400   1.00 16.63  ? 400 LEU A CB     1 
ATOM   6677  C  CG     . LEU A 1 400 ? 7.165   37.784  7.325   1.00 12.69  ? 400 LEU A CG     1 
ATOM   6678  C  CD1    . LEU A 1 400 ? 7.919   38.606  6.300   1.00 12.57  ? 400 LEU A CD1    1 
ATOM   6679  C  CD2    . LEU A 1 400 ? 8.080   36.750  7.945   1.00 22.49  ? 400 LEU A CD2    1 
ATOM   6680  H  H      . LEU A 1 400 ? 4.362   37.525  8.098   1.00 21.22  ? 400 LEU A H      1 
ATOM   6681  H  HA     . LEU A 1 400 ? 6.279   37.430  9.988   1.00 22.01  ? 400 LEU A HA     1 
ATOM   6682  H  HB2    . LEU A 1 400 ? 6.018   39.351  7.946   1.00 19.96  ? 400 LEU A HB2    1 
ATOM   6683  H  HB3    . LEU A 1 400 ? 7.302   39.136  8.844   1.00 19.96  ? 400 LEU A HB3    1 
ATOM   6684  H  HG     . LEU A 1 400 ? 6.448   37.317  6.867   1.00 15.22  ? 400 LEU A HG     1 
ATOM   6685  H  HD11   . LEU A 1 400 ? 8.290   38.010  5.630   1.00 15.08  ? 400 LEU A HD11   1 
ATOM   6686  H  HD12   . LEU A 1 400 ? 7.306   39.232  5.884   1.00 15.08  ? 400 LEU A HD12   1 
ATOM   6687  H  HD13   . LEU A 1 400 ? 8.633   39.088  6.746   1.00 15.08  ? 400 LEU A HD13   1 
ATOM   6688  H  HD21   . LEU A 1 400 ? 8.446   36.191  7.242   1.00 26.98  ? 400 LEU A HD21   1 
ATOM   6689  H  HD22   . LEU A 1 400 ? 8.798   37.205  8.413   1.00 26.98  ? 400 LEU A HD22   1 
ATOM   6690  H  HD23   . LEU A 1 400 ? 7.569   36.209  8.566   1.00 26.98  ? 400 LEU A HD23   1 
ATOM   6691  N  N      . GLY A 1 401 ? 3.980   38.788  11.014  1.00 23.57  ? 401 GLY A N      1 
ATOM   6692  C  CA     . GLY A 1 401 ? 3.308   39.735  11.890  1.00 11.81  ? 401 GLY A CA     1 
ATOM   6693  C  C      . GLY A 1 401 ? 2.315   40.581  11.120  1.00 22.08  ? 401 GLY A C      1 
ATOM   6694  O  O      . GLY A 1 401 ? 2.576   40.967  9.981   1.00 31.17  ? 401 GLY A O      1 
ATOM   6695  H  H      . GLY A 1 401 ? 3.563   38.041  10.926  1.00 28.28  ? 401 GLY A H      1 
ATOM   6696  H  HA2    . GLY A 1 401 ? 2.834   39.256  12.588  1.00 14.18  ? 401 GLY A HA2    1 
ATOM   6697  H  HA3    . GLY A 1 401 ? 3.963   40.320  12.302  1.00 14.18  ? 401 GLY A HA3    1 
ATOM   6698  N  N      . LYS A 1 402 ? 1.186   40.886  11.754  1.00 20.20  ? 402 LYS A N      1 
ATOM   6699  C  CA     . LYS A 1 402 ? 0.059   41.525  11.072  1.00 27.53  ? 402 LYS A CA     1 
ATOM   6700  C  C      . LYS A 1 402 ? 0.443   42.789  10.305  1.00 31.03  ? 402 LYS A C      1 
ATOM   6701  O  O      . LYS A 1 402 ? 0.280   42.857  9.090   1.00 39.19  ? 402 LYS A O      1 
ATOM   6702  C  CB     . LYS A 1 402 ? -1.049  41.860  12.076  1.00 26.36  ? 402 LYS A CB     1 
ATOM   6703  C  CG     . LYS A 1 402 ? -2.224  42.617  11.461  1.00 42.77  ? 402 LYS A CG     1 
ATOM   6704  C  CD     . LYS A 1 402 ? -3.496  42.463  12.282  1.00 53.85  ? 402 LYS A CD     1 
ATOM   6705  C  CE     . LYS A 1 402 ? -4.644  43.274  11.705  1.00 56.81  ? 402 LYS A CE     1 
ATOM   6706  N  NZ     . LYS A 1 402 ? -5.030  42.822  10.340  1.00 75.47  ? 402 LYS A NZ     1 
ATOM   6707  H  H      . LYS A 1 402 ? 1.045   40.733  12.588  1.00 24.25  ? 402 LYS A H      1 
ATOM   6708  H  HA     . LYS A 1 402 ? -0.308  40.896  10.431  1.00 33.03  ? 402 LYS A HA     1 
ATOM   6709  H  HB2    . LYS A 1 402 ? -1.392  41.034  12.452  1.00 31.63  ? 402 LYS A HB2    1 
ATOM   6710  H  HB3    . LYS A 1 402 ? -0.676  42.413  12.781  1.00 31.63  ? 402 LYS A HB3    1 
ATOM   6711  H  HG2    . LYS A 1 402 ? -2.006  43.561  11.415  1.00 51.32  ? 402 LYS A HG2    1 
ATOM   6712  H  HG3    . LYS A 1 402 ? -2.395  42.270  10.571  1.00 51.32  ? 402 LYS A HG3    1 
ATOM   6713  H  HD2    . LYS A 1 402 ? -3.759  41.529  12.291  1.00 64.62  ? 402 LYS A HD2    1 
ATOM   6714  H  HD3    . LYS A 1 402 ? -3.331  42.772  13.187  1.00 64.62  ? 402 LYS A HD3    1 
ATOM   6715  H  HE2    . LYS A 1 402 ? -5.418  43.182  12.282  1.00 68.18  ? 402 LYS A HE2    1 
ATOM   6716  H  HE3    . LYS A 1 402 ? -4.378  44.205  11.650  1.00 68.18  ? 402 LYS A HE3    1 
ATOM   6717  H  HZ1    . LYS A 1 402 ? -5.703  43.318  10.035  1.00 90.56  ? 402 LYS A HZ1    1 
ATOM   6718  H  HZ2    . LYS A 1 402 ? -4.337  42.901  9.787   1.00 90.56  ? 402 LYS A HZ2    1 
ATOM   6719  H  HZ3    . LYS A 1 402 ? -5.285  41.970  10.363  1.00 90.56  ? 402 LYS A HZ3    1 
ATOM   6720  N  N      . ASN A 1 403 ? 0.971   43.778  11.012  1.00 29.01  ? 403 ASN A N      1 
ATOM   6721  C  CA     . ASN A 1 403 ? 1.245   45.077  10.416  1.00 24.89  ? 403 ASN A CA     1 
ATOM   6722  C  C      . ASN A 1 403 ? 2.558   45.101  9.642   1.00 27.29  ? 403 ASN A C      1 
ATOM   6723  O  O      . ASN A 1 403 ? 2.658   45.746  8.598   1.00 29.00  ? 403 ASN A O      1 
ATOM   6724  C  CB     . ASN A 1 403 ? 1.257   46.143  11.505  1.00 21.25  ? 403 ASN A CB     1 
ATOM   6725  C  CG     . ASN A 1 403 ? -0.081  46.277  12.192  1.00 17.55  ? 403 ASN A CG     1 
ATOM   6726  O  OD1    . ASN A 1 403 ? -0.250  45.856  13.335  1.00 21.39  ? 403 ASN A OD1    1 
ATOM   6727  N  ND2    . ASN A 1 403 ? -1.042  46.872  11.500  1.00 23.27  ? 403 ASN A ND2    1 
ATOM   6728  H  H      . ASN A 1 403 ? 1.181   43.722  11.844  1.00 34.81  ? 403 ASN A H      1 
ATOM   6729  H  HA     . ASN A 1 403 ? 0.531   45.293  9.796   1.00 29.86  ? 403 ASN A HA     1 
ATOM   6730  H  HB2    . ASN A 1 403 ? 1.917   45.905  12.175  1.00 25.51  ? 403 ASN A HB2    1 
ATOM   6731  H  HB3    . ASN A 1 403 ? 1.480   47.000  11.108  1.00 25.51  ? 403 ASN A HB3    1 
ATOM   6732  H  HD21   . ASN A 1 403 ? -1.822  46.973  11.846  1.00 27.93  ? 403 ASN A HD21   1 
ATOM   6733  H  HD22   . ASN A 1 403 ? -0.885  47.157  10.704  1.00 27.93  ? 403 ASN A HD22   1 
ATOM   6734  N  N      . VAL A 1 404 ? 3.568   44.414  10.163  1.00 25.86  ? 404 VAL A N      1 
ATOM   6735  C  CA     . VAL A 1 404 ? 4.846   44.317  9.471   1.00 31.98  ? 404 VAL A CA     1 
ATOM   6736  C  C      . VAL A 1 404 ? 4.652   43.575  8.148   1.00 28.10  ? 404 VAL A C      1 
ATOM   6737  O  O      . VAL A 1 404 ? 5.136   44.011  7.105   1.00 23.49  ? 404 VAL A O      1 
ATOM   6738  C  CB     . VAL A 1 404 ? 5.910   43.597  10.345  1.00 22.28  ? 404 VAL A CB     1 
ATOM   6739  C  CG1    . VAL A 1 404 ? 7.130   43.183  9.524   1.00 17.75  ? 404 VAL A CG1    1 
ATOM   6740  C  CG2    . VAL A 1 404 ? 6.336   44.491  11.498  1.00 18.00  ? 404 VAL A CG2    1 
ATOM   6741  H  H      . VAL A 1 404 ? 3.539   43.996  10.914  1.00 31.03  ? 404 VAL A H      1 
ATOM   6742  H  HA     . VAL A 1 404 ? 5.170   45.209  9.273   1.00 38.37  ? 404 VAL A HA     1 
ATOM   6743  H  HB     . VAL A 1 404 ? 5.516   42.794  10.721  1.00 26.73  ? 404 VAL A HB     1 
ATOM   6744  H  HG11   . VAL A 1 404 ? 7.766   42.740  10.107  1.00 21.30  ? 404 VAL A HG11   1 
ATOM   6745  H  HG12   . VAL A 1 404 ? 6.847   42.578  8.821   1.00 21.30  ? 404 VAL A HG12   1 
ATOM   6746  H  HG13   . VAL A 1 404 ? 7.533   43.976  9.137   1.00 21.30  ? 404 VAL A HG13   1 
ATOM   6747  H  HG21   . VAL A 1 404 ? 6.999   44.024  12.031  1.00 21.60  ? 404 VAL A HG21   1 
ATOM   6748  H  HG22   . VAL A 1 404 ? 6.716   45.308  11.140  1.00 21.60  ? 404 VAL A HG22   1 
ATOM   6749  H  HG23   . VAL A 1 404 ? 5.560   44.696  12.042  1.00 21.60  ? 404 VAL A HG23   1 
ATOM   6750  N  N      . GLY A 1 405 ? 3.909   42.474  8.197   1.00 18.75  ? 405 GLY A N      1 
ATOM   6751  C  CA     . GLY A 1 405 ? 3.703   41.634  7.031   1.00 24.73  ? 405 GLY A CA     1 
ATOM   6752  C  C      . GLY A 1 405 ? 2.944   42.325  5.914   1.00 32.34  ? 405 GLY A C      1 
ATOM   6753  O  O      . GLY A 1 405 ? 3.201   42.087  4.734   1.00 30.34  ? 405 GLY A O      1 
ATOM   6754  H  H      . GLY A 1 405 ? 3.509   42.191  8.905   1.00 22.49  ? 405 GLY A H      1 
ATOM   6755  H  HA2    . GLY A 1 405 ? 4.564   41.352  6.684   1.00 29.67  ? 405 GLY A HA2    1 
ATOM   6756  H  HA3    . GLY A 1 405 ? 3.205   40.843  7.291   1.00 29.67  ? 405 GLY A HA3    1 
ATOM   6757  N  N      . GLU A 1 406 ? 1.998   43.177  6.292   1.00 31.48  ? 406 GLU A N      1 
ATOM   6758  C  CA     . GLU A 1 406 ? 1.206   43.925  5.328   1.00 16.29  ? 406 GLU A CA     1 
ATOM   6759  C  C      . GLU A 1 406 ? 2.032   45.065  4.744   1.00 22.36  ? 406 GLU A C      1 
ATOM   6760  O  O      . GLU A 1 406 ? 1.808   45.486  3.611   1.00 45.48  ? 406 GLU A O      1 
ATOM   6761  C  CB     . GLU A 1 406 ? -0.063  44.461  5.986   1.00 22.58  ? 406 GLU A CB     1 
ATOM   6762  C  CG     . GLU A 1 406 ? -1.087  43.383  6.309   1.00 35.37  ? 406 GLU A CG     1 
ATOM   6763  C  CD     . GLU A 1 406 ? -2.261  43.905  7.118   1.00 52.39  ? 406 GLU A CD     1 
ATOM   6764  O  OE1    . GLU A 1 406 ? -3.148  43.099  7.466   1.00 53.07  ? 406 GLU A OE1    1 
ATOM   6765  O  OE2    . GLU A 1 406 ? -2.302  45.120  7.405   1.00 52.05  ? 406 GLU A OE2    1 
ATOM   6766  H  H      . GLU A 1 406 ? 1.794   43.340  7.111   1.00 37.77  ? 406 GLU A H      1 
ATOM   6767  H  HA     . GLU A 1 406 ? 0.946   43.336  4.603   1.00 19.55  ? 406 GLU A HA     1 
ATOM   6768  H  HB2    . GLU A 1 406 ? 0.176   44.901  6.817   1.00 27.09  ? 406 GLU A HB2    1 
ATOM   6769  H  HB3    . GLU A 1 406 ? -0.482  45.098  5.386   1.00 27.09  ? 406 GLU A HB3    1 
ATOM   6770  H  HG2    . GLU A 1 406 ? -1.434  43.019  5.479   1.00 42.44  ? 406 GLU A HG2    1 
ATOM   6771  H  HG3    . GLU A 1 406 ? -0.656  42.683  6.824   1.00 42.44  ? 406 GLU A HG3    1 
ATOM   6772  N  N      . SER A 1 407 ? 2.971   45.577  5.532   1.00 24.94  ? 407 SER A N      1 
ATOM   6773  C  CA     . SER A 1 407 ? 3.871   46.624  5.061   1.00 30.19  ? 407 SER A CA     1 
ATOM   6774  C  C      . SER A 1 407 ? 4.944   46.032  4.150   1.00 28.86  ? 407 SER A C      1 
ATOM   6775  O  O      . SER A 1 407 ? 5.399   46.679  3.209   1.00 38.39  ? 407 SER A O      1 
ATOM   6776  C  CB     . SER A 1 407 ? 4.521   47.355  6.237   1.00 26.45  ? 407 SER A CB     1 
ATOM   6777  O  OG     . SER A 1 407 ? 5.399   48.370  5.780   1.00 14.12  ? 407 SER A OG     1 
ATOM   6778  H  H      . SER A 1 407 ? 3.108   45.336  6.345   1.00 29.93  ? 407 SER A H      1 
ATOM   6779  H  HA     . SER A 1 407 ? 3.364   47.271  4.547   1.00 36.23  ? 407 SER A HA     1 
ATOM   6780  H  HB2    . SER A 1 407 ? 3.826   47.760  6.780   1.00 31.73  ? 407 SER A HB2    1 
ATOM   6781  H  HB3    . SER A 1 407 ? 5.025   46.717  6.766   1.00 31.73  ? 407 SER A HB3    1 
ATOM   6782  H  HG     . SER A 1 407 ? 5.749   48.763  6.435   1.00 16.95  ? 407 SER A HG     1 
ATOM   6783  N  N      . ILE A 1 408 ? 5.358   44.804  4.445   1.00 34.64  ? 408 ILE A N      1 
ATOM   6784  C  CA     . ILE A 1 408 ? 6.339   44.117  3.614   1.00 27.58  ? 408 ILE A CA     1 
ATOM   6785  C  C      . ILE A 1 408 ? 5.679   43.728  2.300   1.00 22.92  ? 408 ILE A C      1 
ATOM   6786  O  O      . ILE A 1 408 ? 6.330   43.701  1.256   1.00 25.23  ? 408 ILE A O      1 
ATOM   6787  C  CB     . ILE A 1 408 ? 6.928   42.878  4.331   1.00 27.19  ? 408 ILE A CB     1 
ATOM   6788  C  CG1    . ILE A 1 408 ? 7.893   43.335  5.429   1.00 27.16  ? 408 ILE A CG1    1 
ATOM   6789  C  CG2    . ILE A 1 408 ? 7.671   41.970  3.349   1.00 22.41  ? 408 ILE A CG2    1 
ATOM   6790  C  CD1    . ILE A 1 408 ? 8.426   42.220  6.310   1.00 31.11  ? 408 ILE A CD1    1 
ATOM   6791  H  H      . ILE A 1 408 ? 5.086   44.347  5.120   1.00 41.57  ? 408 ILE A H      1 
ATOM   6792  H  HA     . ILE A 1 408 ? 7.069   44.725  3.417   1.00 33.09  ? 408 ILE A HA     1 
ATOM   6793  H  HB     . ILE A 1 408 ? 6.204   42.376  4.737   1.00 32.63  ? 408 ILE A HB     1 
ATOM   6794  H  HG12   . ILE A 1 408 ? 8.654   43.769  5.011   1.00 32.60  ? 408 ILE A HG12   1 
ATOM   6795  H  HG13   . ILE A 1 408 ? 7.432   43.968  6.002   1.00 32.60  ? 408 ILE A HG13   1 
ATOM   6796  H  HG21   . ILE A 1 408 ? 8.025   41.207  3.831   1.00 26.89  ? 408 ILE A HG21   1 
ATOM   6797  H  HG22   . ILE A 1 408 ? 7.051   41.671  2.665   1.00 26.89  ? 408 ILE A HG22   1 
ATOM   6798  H  HG23   . ILE A 1 408 ? 8.396   42.471  2.943   1.00 26.89  ? 408 ILE A HG23   1 
ATOM   6799  H  HD11   . ILE A 1 408 ? 9.024   42.600  6.972   1.00 37.33  ? 408 ILE A HD11   1 
ATOM   6800  H  HD12   . ILE A 1 408 ? 7.680   41.782  6.750   1.00 37.33  ? 408 ILE A HD12   1 
ATOM   6801  H  HD13   . ILE A 1 408 ? 8.904   41.583  5.757   1.00 37.33  ? 408 ILE A HD13   1 
ATOM   6802  N  N      . ARG A 1 409 ? 4.384   43.431  2.354   1.00 22.42  ? 409 ARG A N      1 
ATOM   6803  C  CA     . ARG A 1 409 ? 3.636   43.075  1.157   1.00 21.48  ? 409 ARG A CA     1 
ATOM   6804  C  C      . ARG A 1 409 ? 3.650   44.215  0.153   1.00 20.74  ? 409 ARG A C      1 
ATOM   6805  O  O      . ARG A 1 409 ? 3.934   44.009  -1.023  1.00 25.21  ? 409 ARG A O      1 
ATOM   6806  C  CB     . ARG A 1 409 ? 2.190   42.723  1.503   1.00 21.96  ? 409 ARG A CB     1 
ATOM   6807  C  CG     . ARG A 1 409 ? 1.377   42.212  0.322   1.00 40.83  ? 409 ARG A CG     1 
ATOM   6808  C  CD     . ARG A 1 409 ? -0.102  42.117  0.659   1.00 44.43  ? 409 ARG A CD     1 
ATOM   6809  N  NE     . ARG A 1 409 ? -0.826  41.264  -0.282  1.00 53.20  ? 409 ARG A NE     1 
ATOM   6810  C  CZ     . ARG A 1 409 ? -2.131  41.014  -0.219  1.00 64.04  ? 409 ARG A CZ     1 
ATOM   6811  N  NH1    . ARG A 1 409 ? -2.697  40.220  -1.117  1.00 66.46  ? 409 ARG A NH1    1 
ATOM   6812  N  NH2    . ARG A 1 409 ? -2.873  41.557  0.738   1.00 72.09  ? 409 ARG A NH2    1 
ATOM   6813  H  H      . ARG A 1 409 ? 3.915   43.429  3.076   1.00 26.90  ? 409 ARG A H      1 
ATOM   6814  H  HA     . ARG A 1 409 ? 4.046   42.300  0.742   1.00 25.77  ? 409 ARG A HA     1 
ATOM   6815  H  HB2    . ARG A 1 409 ? 2.192   42.030  2.183   1.00 26.35  ? 409 ARG A HB2    1 
ATOM   6816  H  HB3    . ARG A 1 409 ? 1.749   43.516  1.845   1.00 26.35  ? 409 ARG A HB3    1 
ATOM   6817  H  HG2    . ARG A 1 409 ? 1.480   42.822  -0.425  1.00 48.99  ? 409 ARG A HG2    1 
ATOM   6818  H  HG3    . ARG A 1 409 ? 1.690   41.327  0.077   1.00 48.99  ? 409 ARG A HG3    1 
ATOM   6819  H  HD2    . ARG A 1 409 ? -0.203  41.740  1.548   1.00 53.31  ? 409 ARG A HD2    1 
ATOM   6820  H  HD3    . ARG A 1 409 ? -0.494  43.004  0.627   1.00 53.31  ? 409 ARG A HD3    1 
ATOM   6821  H  HE     . ARG A 1 409 ? -0.377  40.899  -0.919  1.00 63.84  ? 409 ARG A HE     1 
ATOM   6822  H  HH11   . ARG A 1 409 ? -2.220  39.868  -1.741  1.00 79.75  ? 409 ARG A HH11   1 
ATOM   6823  H  HH12   . ARG A 1 409 ? -3.541  40.061  -1.079  1.00 79.75  ? 409 ARG A HH12   1 
ATOM   6824  H  HH21   . ARG A 1 409 ? -2.510  42.072  1.324   1.00 86.51  ? 409 ARG A HH21   1 
ATOM   6825  H  HH22   . ARG A 1 409 ? -3.716  41.393  0.773   1.00 86.51  ? 409 ARG A HH22   1 
ATOM   6826  N  N      . GLU A 1 410 ? 3.345   45.420  0.624   1.00 29.62  ? 410 GLU A N      1 
ATOM   6827  C  CA     . GLU A 1 410 ? 3.239   46.575  -0.257  1.00 27.69  ? 410 GLU A CA     1 
ATOM   6828  C  C      . GLU A 1 410 ? 4.607   46.956  -0.826  1.00 22.89  ? 410 GLU A C      1 
ATOM   6829  O  O      . GLU A 1 410 ? 4.688   47.500  -1.927  1.00 42.62  ? 410 GLU A O      1 
ATOM   6830  C  CB     . GLU A 1 410 ? 2.593   47.767  0.466   1.00 30.85  ? 410 GLU A CB     1 
ATOM   6831  C  CG     . GLU A 1 410 ? 3.390   48.347  1.621   1.00 54.97  ? 410 GLU A CG     1 
ATOM   6832  C  CD     . GLU A 1 410 ? 2.741   49.589  2.211   1.00 73.59  ? 410 GLU A CD     1 
ATOM   6833  O  OE1    . GLU A 1 410 ? 1.565   49.857  1.883   1.00 70.89  ? 410 GLU A OE1    1 
ATOM   6834  O  OE2    . GLU A 1 410 ? 3.405   50.296  3.003   1.00 65.60  ? 410 GLU A OE2    1 
ATOM   6835  H  H      . GLU A 1 410 ? 3.194   45.594  1.453   1.00 35.55  ? 410 GLU A H      1 
ATOM   6836  H  HA     . GLU A 1 410 ? 2.666   46.342  -1.004  1.00 33.23  ? 410 GLU A HA     1 
ATOM   6837  H  HB2    . GLU A 1 410 ? 2.457   48.479  -0.178  1.00 37.03  ? 410 GLU A HB2    1 
ATOM   6838  H  HB3    . GLU A 1 410 ? 1.736   47.482  0.819   1.00 37.03  ? 410 GLU A HB3    1 
ATOM   6839  H  HG2    . GLU A 1 410 ? 3.459   47.681  2.323   1.00 65.97  ? 410 GLU A HG2    1 
ATOM   6840  H  HG3    . GLU A 1 410 ? 4.274   48.590  1.305   1.00 65.97  ? 410 GLU A HG3    1 
ATOM   6841  N  N      . TYR A 1 411 ? 5.675   46.684  -0.082  1.00 17.10  ? 411 TYR A N      1 
ATOM   6842  C  CA     . TYR A 1 411 ? 7.027   46.963  -0.570  1.00 19.06  ? 411 TYR A CA     1 
ATOM   6843  C  C      . TYR A 1 411 ? 8.129   46.529  0.384   1.00 21.22  ? 411 TYR A C      1 
ATOM   6844  O  O      . TYR A 1 411 ? 8.034   46.734  1.593   1.00 33.12  ? 411 TYR A O      1 
ATOM   6845  C  CB     . TYR A 1 411 ? 7.182   48.463  -0.837  1.00 29.71  ? 411 TYR A CB     1 
ATOM   6846  C  CG     . TYR A 1 411 ? 8.562   49.013  -0.531  1.00 31.44  ? 411 TYR A CG     1 
ATOM   6847  C  CD1    . TYR A 1 411 ? 9.624   48.814  -1.403  1.00 27.05  ? 411 TYR A CD1    1 
ATOM   6848  C  CD2    . TYR A 1 411 ? 8.803   49.726  0.640   1.00 44.33  ? 411 TYR A CD2    1 
ATOM   6849  C  CE1    . TYR A 1 411 ? 10.885  49.317  -1.124  1.00 39.68  ? 411 TYR A CE1    1 
ATOM   6850  C  CE2    . TYR A 1 411 ? 10.061  50.230  0.928   1.00 35.19  ? 411 TYR A CE2    1 
ATOM   6851  C  CZ     . TYR A 1 411 ? 11.098  50.022  0.042   1.00 44.88  ? 411 TYR A CZ     1 
ATOM   6852  O  OH     . TYR A 1 411 ? 12.350  50.518  0.320   1.00 37.86  ? 411 TYR A OH     1 
ATOM   6853  H  H      . TYR A 1 411 ? 5.647   46.339  0.706   1.00 20.52  ? 411 TYR A H      1 
ATOM   6854  H  HA     . TYR A 1 411 ? 7.159   46.495  -1.409  1.00 22.87  ? 411 TYR A HA     1 
ATOM   6855  H  HB2    . TYR A 1 411 ? 6.998   48.633  -1.774  1.00 35.66  ? 411 TYR A HB2    1 
ATOM   6856  H  HB3    . TYR A 1 411 ? 6.544   48.944  -0.286  1.00 35.66  ? 411 TYR A HB3    1 
ATOM   6857  H  HD1    . TYR A 1 411 ? 9.485   48.340  -2.191  1.00 32.46  ? 411 TYR A HD1    1 
ATOM   6858  H  HD2    . TYR A 1 411 ? 8.106   49.869  1.239   1.00 53.20  ? 411 TYR A HD2    1 
ATOM   6859  H  HE1    . TYR A 1 411 ? 11.586  49.176  -1.720  1.00 47.61  ? 411 TYR A HE1    1 
ATOM   6860  H  HE2    . TYR A 1 411 ? 10.206  50.706  1.714   1.00 42.23  ? 411 TYR A HE2    1 
ATOM   6861  H  HH     . TYR A 1 411 ? 12.882  50.320  -0.299  1.00 45.43  ? 411 TYR A HH     1 
ATOM   6862  N  N      . PHE A 1 412 ? 9.187   45.951  -0.179  1.00 26.77  ? 412 PHE A N      1 
ATOM   6863  C  CA     . PHE A 1 412 ? 10.415  45.690  0.563   1.00 18.74  ? 412 PHE A CA     1 
ATOM   6864  C  C      . PHE A 1 412 ? 11.568  45.523  -0.421  1.00 17.24  ? 412 PHE A C      1 
ATOM   6865  O  O      . PHE A 1 412 ? 11.347  45.306  -1.611  1.00 37.30  ? 412 PHE A O      1 
ATOM   6866  C  CB     . PHE A 1 412 ? 10.293  44.439  1.440   1.00 23.07  ? 412 PHE A CB     1 
ATOM   6867  C  CG     . PHE A 1 412 ? 10.483  43.145  0.691   1.00 15.66  ? 412 PHE A CG     1 
ATOM   6868  C  CD1    . PHE A 1 412 ? 11.749  42.594  0.544   1.00 13.43  ? 412 PHE A CD1    1 
ATOM   6869  C  CD2    . PHE A 1 412 ? 9.401   42.471  0.149   1.00 23.11  ? 412 PHE A CD2    1 
ATOM   6870  C  CE1    . PHE A 1 412 ? 11.931  41.406  -0.138  1.00 19.10  ? 412 PHE A CE1    1 
ATOM   6871  C  CE2    . PHE A 1 412 ? 9.578   41.276  -0.535  1.00 19.09  ? 412 PHE A CE2    1 
ATOM   6872  C  CZ     . PHE A 1 412 ? 10.844  40.746  -0.679  1.00 14.85  ? 412 PHE A CZ     1 
ATOM   6873  H  H      . PHE A 1 412 ? 9.218   45.699  -1.001  1.00 32.12  ? 412 PHE A H      1 
ATOM   6874  H  HA     . PHE A 1 412 ? 10.611  46.447  1.137   1.00 22.49  ? 412 PHE A HA     1 
ATOM   6875  H  HB2    . PHE A 1 412 ? 10.967  44.480  2.136   1.00 27.68  ? 412 PHE A HB2    1 
ATOM   6876  H  HB3    . PHE A 1 412 ? 9.409   44.423  1.839   1.00 27.68  ? 412 PHE A HB3    1 
ATOM   6877  H  HD1    . PHE A 1 412 ? 12.485  43.034  0.904   1.00 16.11  ? 412 PHE A HD1    1 
ATOM   6878  H  HD2    . PHE A 1 412 ? 8.546   42.826  0.241   1.00 27.73  ? 412 PHE A HD2    1 
ATOM   6879  H  HE1    . PHE A 1 412 ? 12.785  41.050  -0.232  1.00 22.92  ? 412 PHE A HE1    1 
ATOM   6880  H  HE2    . PHE A 1 412 ? 8.844   40.835  -0.898  1.00 22.91  ? 412 PHE A HE2    1 
ATOM   6881  H  HZ     . PHE A 1 412 ? 10.965  39.945  -1.137  1.00 17.82  ? 412 PHE A HZ     1 
ATOM   6882  N  N      . GLU A 1 413 ? 12.794  45.607  0.082   1.00 13.35  ? 413 GLU A N      1 
ATOM   6883  C  CA     . GLU A 1 413 ? 13.978  45.395  -0.741  1.00 21.25  ? 413 GLU A CA     1 
ATOM   6884  C  C      . GLU A 1 413 ? 15.120  44.862  0.103   1.00 20.79  ? 413 GLU A C      1 
ATOM   6885  O  O      . GLU A 1 413 ? 15.264  45.237  1.262   1.00 32.87  ? 413 GLU A O      1 
ATOM   6886  C  CB     . GLU A 1 413 ? 14.402  46.693  -1.424  1.00 24.88  ? 413 GLU A CB     1 
ATOM   6887  C  CG     . GLU A 1 413 ? 14.738  47.813  -0.457  1.00 29.39  ? 413 GLU A CG     1 
ATOM   6888  C  CD     . GLU A 1 413 ? 15.219  49.065  -1.160  1.00 50.24  ? 413 GLU A CD     1 
ATOM   6889  O  OE1    . GLU A 1 413 ? 16.089  48.950  -2.049  1.00 43.42  ? 413 GLU A OE1    1 
ATOM   6890  O  OE2    . GLU A 1 413 ? 14.724  50.163  -0.826  1.00 55.36  ? 413 GLU A OE2    1 
ATOM   6891  H  H      . GLU A 1 413 ? 12.969  45.787  0.905   1.00 16.02  ? 413 GLU A H      1 
ATOM   6892  H  HA     . GLU A 1 413 ? 13.776  44.740  -1.428  1.00 25.50  ? 413 GLU A HA     1 
ATOM   6893  H  HB2    . GLU A 1 413 ? 15.190  46.519  -1.963  1.00 29.85  ? 413 GLU A HB2    1 
ATOM   6894  H  HB3    . GLU A 1 413 ? 13.677  46.999  -1.992  1.00 29.85  ? 413 GLU A HB3    1 
ATOM   6895  H  HG2    . GLU A 1 413 ? 13.945  48.041  0.053   1.00 35.27  ? 413 GLU A HG2    1 
ATOM   6896  H  HG3    . GLU A 1 413 ? 15.442  47.515  0.140   1.00 35.27  ? 413 GLU A HG3    1 
ATOM   6897  N  N      . ILE A 1 414 ? 15.937  43.998  -0.483  1.00 16.56  ? 414 ILE A N      1 
ATOM   6898  C  CA     . ILE A 1 414 ? 17.077  43.438  0.225   1.00 15.18  ? 414 ILE A CA     1 
ATOM   6899  C  C      . ILE A 1 414 ? 18.344  44.251  -0.060  1.00 14.28  ? 414 ILE A C      1 
ATOM   6900  O  O      . ILE A 1 414 ? 18.822  44.300  -1.191  1.00 28.93  ? 414 ILE A O      1 
ATOM   6901  C  CB     . ILE A 1 414 ? 17.286  41.962  -0.143  1.00 18.47  ? 414 ILE A CB     1 
ATOM   6902  C  CG1    . ILE A 1 414 ? 15.997  41.183  0.142   1.00 18.83  ? 414 ILE A CG1    1 
ATOM   6903  C  CG2    . ILE A 1 414 ? 18.453  41.372  0.651   1.00 21.48  ? 414 ILE A CG2    1 
ATOM   6904  C  CD1    . ILE A 1 414 ? 16.069  39.700  -0.155  1.00 21.71  ? 414 ILE A CD1    1 
ATOM   6905  H  H      . ILE A 1 414 ? 15.853  43.719  -1.292  1.00 19.87  ? 414 ILE A H      1 
ATOM   6906  H  HA     . ILE A 1 414 ? 16.904  43.483  1.179   1.00 18.22  ? 414 ILE A HA     1 
ATOM   6907  H  HB     . ILE A 1 414 ? 17.487  41.900  -1.090  1.00 22.16  ? 414 ILE A HB     1 
ATOM   6908  H  HG12   . ILE A 1 414 ? 15.778  41.283  1.082   1.00 22.60  ? 414 ILE A HG12   1 
ATOM   6909  H  HG13   . ILE A 1 414 ? 15.284  41.557  -0.399  1.00 22.60  ? 414 ILE A HG13   1 
ATOM   6910  H  HG21   . ILE A 1 414 ? 18.566  40.441  0.401   1.00 25.78  ? 414 ILE A HG21   1 
ATOM   6911  H  HG22   . ILE A 1 414 ? 19.259  41.870  0.444   1.00 25.78  ? 414 ILE A HG22   1 
ATOM   6912  H  HG23   . ILE A 1 414 ? 18.256  41.439  1.598   1.00 25.78  ? 414 ILE A HG23   1 
ATOM   6913  H  HD11   . ILE A 1 414 ? 15.213  39.294  0.055   1.00 26.05  ? 414 ILE A HD11   1 
ATOM   6914  H  HD12   . ILE A 1 414 ? 16.271  39.576  -1.096  1.00 26.05  ? 414 ILE A HD12   1 
ATOM   6915  H  HD13   . ILE A 1 414 ? 16.766  39.302  0.389   1.00 26.05  ? 414 ILE A HD13   1 
ATOM   6916  N  N      . ILE A 1 415 ? 18.863  44.900  0.979   1.00 17.11  ? 415 ILE A N      1 
ATOM   6917  C  CA     . ILE A 1 415 ? 20.065  45.729  0.888   1.00 21.64  ? 415 ILE A CA     1 
ATOM   6918  C  C      . ILE A 1 415 ? 21.288  44.944  1.356   1.00 30.99  ? 415 ILE A C      1 
ATOM   6919  O  O      . ILE A 1 415 ? 21.246  44.289  2.397   1.00 28.19  ? 415 ILE A O      1 
ATOM   6920  C  CB     . ILE A 1 415 ? 19.947  47.014  1.742   1.00 19.10  ? 415 ILE A CB     1 
ATOM   6921  C  CG1    . ILE A 1 415 ? 18.621  47.731  1.476   1.00 18.20  ? 415 ILE A CG1    1 
ATOM   6922  C  CG2    . ILE A 1 415 ? 21.121  47.948  1.474   1.00 35.21  ? 415 ILE A CG2    1 
ATOM   6923  C  CD1    . ILE A 1 415 ? 18.398  48.114  0.031   1.00 44.11  ? 415 ILE A CD1    1 
ATOM   6924  H  H      . ILE A 1 415 ? 18.527  44.874  1.771   1.00 20.53  ? 415 ILE A H      1 
ATOM   6925  H  HA     . ILE A 1 415 ? 20.205  45.989  -0.035  1.00 25.97  ? 415 ILE A HA     1 
ATOM   6926  H  HB     . ILE A 1 415 ? 19.971  46.758  2.678   1.00 22.92  ? 415 ILE A HB     1 
ATOM   6927  H  HG12   . ILE A 1 415 ? 17.893  47.148  1.743   1.00 21.84  ? 415 ILE A HG12   1 
ATOM   6928  H  HG13   . ILE A 1 415 ? 18.598  48.545  2.004   1.00 21.84  ? 415 ILE A HG13   1 
ATOM   6929  H  HG21   . ILE A 1 415 ? 21.023  48.743  2.021   1.00 42.25  ? 415 ILE A HG21   1 
ATOM   6930  H  HG22   . ILE A 1 415 ? 21.946  47.491  1.700   1.00 42.25  ? 415 ILE A HG22   1 
ATOM   6931  H  HG23   . ILE A 1 415 ? 21.123  48.190  0.535   1.00 42.25  ? 415 ILE A HG23   1 
ATOM   6932  H  HD11   . ILE A 1 415 ? 17.541  48.561  -0.048  1.00 52.93  ? 415 ILE A HD11   1 
ATOM   6933  H  HD12   . ILE A 1 415 ? 19.109  48.710  -0.251  1.00 52.93  ? 415 ILE A HD12   1 
ATOM   6934  H  HD13   . ILE A 1 415 ? 18.404  47.310  -0.512  1.00 52.93  ? 415 ILE A HD13   1 
ATOM   6935  N  N      . SER A 1 416 ? 22.374  45.017  0.590   1.00 39.37  ? 416 SER A N      1 
ATOM   6936  C  CA     . SER A 1 416 ? 23.596  44.289  0.917   1.00 24.68  ? 416 SER A CA     1 
ATOM   6937  C  C      . SER A 1 416 ? 24.839  45.121  0.626   1.00 35.68  ? 416 SER A C      1 
ATOM   6938  O  O      . SER A 1 416 ? 24.775  46.138  -0.066  1.00 49.99  ? 416 SER A O      1 
ATOM   6939  C  CB     . SER A 1 416 ? 23.648  42.978  0.127   1.00 31.97  ? 416 SER A CB     1 
ATOM   6940  O  OG     . SER A 1 416 ? 24.803  42.221  0.442   1.00 42.64  ? 416 SER A OG     1 
ATOM   6941  H  H      . SER A 1 416 ? 22.428  45.485  -0.129  1.00 47.25  ? 416 SER A H      1 
ATOM   6942  H  HA     . SER A 1 416 ? 23.593  44.072  1.863   1.00 29.62  ? 416 SER A HA     1 
ATOM   6943  H  HB2    . SER A 1 416 ? 22.861  42.452  0.341   1.00 38.36  ? 416 SER A HB2    1 
ATOM   6944  H  HB3    . SER A 1 416 ? 23.657  43.184  -0.821  1.00 38.36  ? 416 SER A HB3    1 
ATOM   6945  H  HG     . SER A 1 416 ? 24.809  41.509  -0.003  1.00 51.16  ? 416 SER A HG     1 
ATOM   6946  N  N      . GLY A 1 417 ? 25.972  44.674  1.158   1.00 36.70  ? 417 GLY A N      1 
ATOM   6947  C  CA     . GLY A 1 417 ? 27.253  45.302  0.892   1.00 55.40  ? 417 GLY A CA     1 
ATOM   6948  C  C      . GLY A 1 417 ? 27.364  46.734  1.382   1.00 49.64  ? 417 GLY A C      1 
ATOM   6949  O  O      . GLY A 1 417 ? 26.837  47.093  2.431   1.00 43.22  ? 417 GLY A O      1 
ATOM   6950  H  H      . GLY A 1 417 ? 26.021  43.996  1.684   1.00 44.04  ? 417 GLY A H      1 
ATOM   6951  H  HA2    . GLY A 1 417 ? 27.953  44.783  1.317   1.00 66.48  ? 417 GLY A HA2    1 
ATOM   6952  H  HA3    . GLY A 1 417 ? 27.414  45.299  -0.065  1.00 66.48  ? 417 GLY A HA3    1 
ATOM   6953  N  N      . GLU A 1 418 ? 28.074  47.549  0.612   1.00 61.65  ? 418 GLU A N      1 
ATOM   6954  C  CA     . GLU A 1 418 ? 28.351  48.934  0.977   1.00 64.58  ? 418 GLU A CA     1 
ATOM   6955  C  C      . GLU A 1 418 ? 27.078  49.779  1.066   1.00 51.22  ? 418 GLU A C      1 
ATOM   6956  O  O      . GLU A 1 418 ? 27.008  50.718  1.858   1.00 48.70  ? 418 GLU A O      1 
ATOM   6957  C  CB     . GLU A 1 418 ? 29.335  49.543  -0.023  1.00 87.57  ? 418 GLU A CB     1 
ATOM   6958  C  CG     . GLU A 1 418 ? 30.744  48.960  0.100   1.00 94.30  ? 418 GLU A CG     1 
ATOM   6959  C  CD     . GLU A 1 418 ? 31.627  49.260  -1.098  1.00 121.91 ? 418 GLU A CD     1 
ATOM   6960  O  OE1    . GLU A 1 418 ? 31.146  49.902  -2.056  1.00 134.97 ? 418 GLU A OE1    1 
ATOM   6961  O  OE2    . GLU A 1 418 ? 32.807  48.848  -1.083  1.00 106.60 ? 418 GLU A OE2    1 
ATOM   6962  H  H      . GLU A 1 418 ? 28.414  47.318  -0.144  1.00 73.98  ? 418 GLU A H      1 
ATOM   6963  H  HA     . GLU A 1 418 ? 28.773  48.945  1.850   1.00 77.50  ? 418 GLU A HA     1 
ATOM   6964  H  HB2    . GLU A 1 418 ? 29.017  49.371  -0.923  1.00 105.08 ? 418 GLU A HB2    1 
ATOM   6965  H  HB3    . GLU A 1 418 ? 29.391  50.499  0.132   1.00 105.08 ? 418 GLU A HB3    1 
ATOM   6966  H  HG2    . GLU A 1 418 ? 31.172  49.336  0.886   1.00 113.16 ? 418 GLU A HG2    1 
ATOM   6967  H  HG3    . GLU A 1 418 ? 30.679  47.997  0.188   1.00 113.16 ? 418 GLU A HG3    1 
ATOM   6968  N  N      . LYS A 1 419 ? 26.081  49.463  0.245   1.00 48.28  ? 419 LYS A N      1 
ATOM   6969  C  CA     . LYS A 1 419 ? 24.840  50.229  0.244   1.00 43.69  ? 419 LYS A CA     1 
ATOM   6970  C  C      . LYS A 1 419 ? 24.135  50.108  1.587   1.00 41.74  ? 419 LYS A C      1 
ATOM   6971  O  O      . LYS A 1 419 ? 23.346  50.976  1.962   1.00 44.99  ? 419 LYS A O      1 
ATOM   6972  C  CB     . LYS A 1 419 ? 23.905  49.762  -0.876  1.00 57.79  ? 419 LYS A CB     1 
ATOM   6973  C  CG     . LYS A 1 419 ? 24.288  50.254  -2.264  1.00 79.88  ? 419 LYS A CG     1 
ATOM   6974  C  CD     . LYS A 1 419 ? 23.184  51.131  -2.851  1.00 76.50  ? 419 LYS A CD     1 
ATOM   6975  C  CE     . LYS A 1 419 ? 23.562  51.698  -4.213  1.00 66.67  ? 419 LYS A CE     1 
ATOM   6976  N  NZ     . LYS A 1 419 ? 23.722  50.641  -5.250  1.00 48.11  ? 419 LYS A NZ     1 
ATOM   6977  H  H      . LYS A 1 419 ? 26.098  48.813  -0.318  1.00 57.94  ? 419 LYS A H      1 
ATOM   6978  H  HA     . LYS A 1 419 ? 25.045  51.165  0.095   1.00 52.42  ? 419 LYS A HA     1 
ATOM   6979  H  HB2    . LYS A 1 419 ? 23.907  48.792  -0.897  1.00 69.35  ? 419 LYS A HB2    1 
ATOM   6980  H  HB3    . LYS A 1 419 ? 23.010  50.083  -0.686  1.00 69.35  ? 419 LYS A HB3    1 
ATOM   6981  H  HG2    . LYS A 1 419 ? 25.100  50.781  -2.208  1.00 95.85  ? 419 LYS A HG2    1 
ATOM   6982  H  HG3    . LYS A 1 419 ? 24.419  49.493  -2.851  1.00 95.85  ? 419 LYS A HG3    1 
ATOM   6983  H  HD2    . LYS A 1 419 ? 22.380  50.600  -2.958  1.00 91.80  ? 419 LYS A HD2    1 
ATOM   6984  H  HD3    . LYS A 1 419 ? 23.016  51.874  -2.251  1.00 91.80  ? 419 LYS A HD3    1 
ATOM   6985  H  HE2    . LYS A 1 419 ? 22.865  52.304  -4.508  1.00 80.00  ? 419 LYS A HE2    1 
ATOM   6986  H  HE3    . LYS A 1 419 ? 24.404  52.172  -4.135  1.00 80.00  ? 419 LYS A HE3    1 
ATOM   6987  H  HZ1    . LYS A 1 419 ? 23.942  51.011  -6.029  1.00 57.73  ? 419 LYS A HZ1    1 
ATOM   6988  H  HZ2    . LYS A 1 419 ? 24.363  50.072  -5.008  1.00 57.73  ? 419 LYS A HZ2    1 
ATOM   6989  H  HZ3    . LYS A 1 419 ? 22.959  50.193  -5.347  1.00 57.73  ? 419 LYS A HZ3    1 
ATOM   6990  N  N      . LEU A 1 420 ? 24.434  49.030  2.308   1.00 44.93  ? 420 LEU A N      1 
ATOM   6991  C  CA     . LEU A 1 420 ? 23.849  48.782  3.623   1.00 34.80  ? 420 LEU A CA     1 
ATOM   6992  C  C      . LEU A 1 420 ? 24.469  49.674  4.690   1.00 29.91  ? 420 LEU A C      1 
ATOM   6993  O  O      . LEU A 1 420 ? 23.769  50.204  5.547   1.00 35.65  ? 420 LEU A O      1 
ATOM   6994  C  CB     . LEU A 1 420 ? 24.033  47.313  4.016   1.00 36.78  ? 420 LEU A CB     1 
ATOM   6995  C  CG     . LEU A 1 420 ? 23.590  46.890  5.420   1.00 25.39  ? 420 LEU A CG     1 
ATOM   6996  C  CD1    . LEU A 1 420 ? 22.083  46.991  5.567   1.00 24.24  ? 420 LEU A CD1    1 
ATOM   6997  C  CD2    . LEU A 1 420 ? 24.075  45.484  5.726   1.00 23.73  ? 420 LEU A CD2    1 
ATOM   6998  H  H      . LEU A 1 420 ? 24.982  48.418  2.053   1.00 53.92  ? 420 LEU A H      1 
ATOM   6999  H  HA     . LEU A 1 420 ? 22.898  48.968  3.588   1.00 41.76  ? 420 LEU A HA     1 
ATOM   7000  H  HB2    . LEU A 1 420 ? 23.534  46.770  3.386   1.00 44.14  ? 420 LEU A HB2    1 
ATOM   7001  H  HB3    . LEU A 1 420 ? 24.976  47.099  3.941   1.00 44.14  ? 420 LEU A HB3    1 
ATOM   7002  H  HG     . LEU A 1 420 ? 23.992  47.490  6.067   1.00 30.47  ? 420 LEU A HG     1 
ATOM   7003  H  HD11   . LEU A 1 420 ? 21.835  46.717  6.464   1.00 29.09  ? 420 LEU A HD11   1 
ATOM   7004  H  HD12   . LEU A 1 420 ? 21.812  47.909  5.414   1.00 29.09  ? 420 LEU A HD12   1 
ATOM   7005  H  HD13   . LEU A 1 420 ? 21.663  46.408  4.915   1.00 29.09  ? 420 LEU A HD13   1 
ATOM   7006  H  HD21   . LEU A 1 420 ? 23.784  45.237  6.618   1.00 28.48  ? 420 LEU A HD21   1 
ATOM   7007  H  HD22   . LEU A 1 420 ? 23.700  44.871  5.074   1.00 28.48  ? 420 LEU A HD22   1 
ATOM   7008  H  HD23   . LEU A 1 420 ? 25.044  45.467  5.678   1.00 28.48  ? 420 LEU A HD23   1 
ATOM   7009  N  N      . PHE A 1 421 ? 25.783  49.858  4.613   1.00 30.85  ? 421 PHE A N      1 
ATOM   7010  C  CA     . PHE A 1 421 ? 26.523  50.580  5.642   1.00 26.52  ? 421 PHE A CA     1 
ATOM   7011  C  C      . PHE A 1 421 ? 26.162  52.062  5.670   1.00 39.37  ? 421 PHE A C      1 
ATOM   7012  O  O      . PHE A 1 421 ? 26.416  52.753  6.659   1.00 48.96  ? 421 PHE A O      1 
ATOM   7013  C  CB     . PHE A 1 421 ? 28.024  50.413  5.416   1.00 29.39  ? 421 PHE A CB     1 
ATOM   7014  C  CG     . PHE A 1 421 ? 28.463  48.979  5.305   1.00 38.89  ? 421 PHE A CG     1 
ATOM   7015  C  CD1    . PHE A 1 421 ? 27.743  47.966  5.918   1.00 38.34  ? 421 PHE A CD1    1 
ATOM   7016  C  CD2    . PHE A 1 421 ? 29.592  48.644  4.578   1.00 42.06  ? 421 PHE A CD2    1 
ATOM   7017  C  CE1    . PHE A 1 421 ? 28.143  46.650  5.812   1.00 38.82  ? 421 PHE A CE1    1 
ATOM   7018  C  CE2    . PHE A 1 421 ? 29.997  47.330  4.469   1.00 41.64  ? 421 PHE A CE2    1 
ATOM   7019  C  CZ     . PHE A 1 421 ? 29.272  46.331  5.087   1.00 43.16  ? 421 PHE A CZ     1 
ATOM   7020  H  H      . PHE A 1 421 ? 26.274  49.570  3.969   1.00 37.02  ? 421 PHE A H      1 
ATOM   7021  H  HA     . PHE A 1 421 ? 26.306  50.203  6.509   1.00 31.82  ? 421 PHE A HA     1 
ATOM   7022  H  HB2    . PHE A 1 421 ? 28.269  50.863  4.592   1.00 35.27  ? 421 PHE A HB2    1 
ATOM   7023  H  HB3    . PHE A 1 421 ? 28.499  50.811  6.162   1.00 35.27  ? 421 PHE A HB3    1 
ATOM   7024  H  HD1    . PHE A 1 421 ? 26.981  48.177  6.408   1.00 46.01  ? 421 PHE A HD1    1 
ATOM   7025  H  HD2    . PHE A 1 421 ? 30.085  49.313  4.160   1.00 50.47  ? 421 PHE A HD2    1 
ATOM   7026  H  HE1    . PHE A 1 421 ? 27.653  45.979  6.229   1.00 46.58  ? 421 PHE A HE1    1 
ATOM   7027  H  HE2    . PHE A 1 421 ? 30.759  47.117  3.979   1.00 49.96  ? 421 PHE A HE2    1 
ATOM   7028  H  HZ     . PHE A 1 421 ? 29.544  45.444  5.014   1.00 51.79  ? 421 PHE A HZ     1 
ATOM   7029  N  N      . LYS A 1 422 ? 25.568  52.544  4.585   1.00 39.20  ? 422 LYS A N      1 
ATOM   7030  C  CA     . LYS A 1 422 ? 25.111  53.926  4.512   1.00 47.24  ? 422 LYS A CA     1 
ATOM   7031  C  C      . LYS A 1 422 ? 23.704  54.072  5.094   1.00 37.35  ? 422 LYS A C      1 
ATOM   7032  O  O      . LYS A 1 422 ? 23.145  55.168  5.115   1.00 49.43  ? 422 LYS A O      1 
ATOM   7033  C  CB     . LYS A 1 422 ? 25.149  54.421  3.065   1.00 57.97  ? 422 LYS A CB     1 
ATOM   7034  C  CG     . LYS A 1 422 ? 26.562  54.623  2.524   1.00 49.04  ? 422 LYS A CG     1 
ATOM   7035  C  CD     . LYS A 1 422 ? 26.601  54.597  1.003   1.00 64.60  ? 422 LYS A CD     1 
ATOM   7036  C  CE     . LYS A 1 422 ? 25.741  55.690  0.385   1.00 66.55  ? 422 LYS A CE     1 
ATOM   7037  N  NZ     . LYS A 1 422 ? 25.576  55.488  -1.078  1.00 58.17  ? 422 LYS A NZ     1 
ATOM   7038  H  H      . LYS A 1 422 ? 25.416  52.087  3.872   1.00 47.04  ? 422 LYS A H      1 
ATOM   7039  H  HA     . LYS A 1 422 ? 25.710  54.483  5.033   1.00 56.69  ? 422 LYS A HA     1 
ATOM   7040  H  HB2    . LYS A 1 422 ? 24.705  53.769  2.499   1.00 69.56  ? 422 LYS A HB2    1 
ATOM   7041  H  HB3    . LYS A 1 422 ? 24.687  55.272  3.012   1.00 69.56  ? 422 LYS A HB3    1 
ATOM   7042  H  HG2    . LYS A 1 422 ? 26.896  55.484  2.820   1.00 58.85  ? 422 LYS A HG2    1 
ATOM   7043  H  HG3    . LYS A 1 422 ? 27.133  53.911  2.854   1.00 58.85  ? 422 LYS A HG3    1 
ATOM   7044  H  HD2    . LYS A 1 422 ? 27.515  54.729  0.707   1.00 77.52  ? 422 LYS A HD2    1 
ATOM   7045  H  HD3    . LYS A 1 422 ? 26.270  53.740  0.692   1.00 77.52  ? 422 LYS A HD3    1 
ATOM   7046  H  HE2    . LYS A 1 422 ? 24.862  55.675  0.795   1.00 79.86  ? 422 LYS A HE2    1 
ATOM   7047  H  HE3    . LYS A 1 422 ? 26.164  56.550  0.528   1.00 79.86  ? 422 LYS A HE3    1 
ATOM   7048  H  HZ1    . LYS A 1 422 ? 25.070  56.137  -1.419  1.00 69.80  ? 422 LYS A HZ1    1 
ATOM   7049  H  HZ2    . LYS A 1 422 ? 26.370  55.501  -1.478  1.00 69.80  ? 422 LYS A HZ2    1 
ATOM   7050  H  HZ3    . LYS A 1 422 ? 25.185  54.704  -1.235  1.00 69.80  ? 422 LYS A HZ3    1 
ATOM   7051  N  N      . GLU A 1 423 ? 23.141  52.965  5.568   1.00 28.74  ? 423 GLU A N      1 
ATOM   7052  C  CA     . GLU A 1 423 ? 21.834  52.982  6.218   1.00 29.23  ? 423 GLU A CA     1 
ATOM   7053  C  C      . GLU A 1 423 ? 21.997  53.180  7.726   1.00 36.68  ? 423 GLU A C      1 
ATOM   7054  O  O      . GLU A 1 423 ? 23.074  52.937  8.270   1.00 41.76  ? 423 GLU A O      1 
ATOM   7055  C  CB     . GLU A 1 423 ? 21.073  51.684  5.939   1.00 41.95  ? 423 GLU A CB     1 
ATOM   7056  C  CG     . GLU A 1 423 ? 20.841  51.393  4.461   1.00 41.20  ? 423 GLU A CG     1 
ATOM   7057  C  CD     . GLU A 1 423 ? 19.715  52.219  3.860   1.00 38.57  ? 423 GLU A CD     1 
ATOM   7058  O  OE1    . GLU A 1 423 ? 18.899  52.783  4.620   1.00 32.34  ? 423 GLU A OE1    1 
ATOM   7059  O  OE2    . GLU A 1 423 ? 19.651  52.311  2.618   1.00 42.44  ? 423 GLU A OE2    1 
ATOM   7060  H  H      . GLU A 1 423 ? 23.498  52.184  5.525   1.00 34.49  ? 423 GLU A H      1 
ATOM   7061  H  HA     . GLU A 1 423 ? 21.312  53.722  5.868   1.00 35.08  ? 423 GLU A HA     1 
ATOM   7062  H  HB2    . GLU A 1 423 ? 21.578  50.943  6.309   1.00 50.34  ? 423 GLU A HB2    1 
ATOM   7063  H  HB3    . GLU A 1 423 ? 20.205  51.735  6.369   1.00 50.34  ? 423 GLU A HB3    1 
ATOM   7064  H  HG2    . GLU A 1 423 ? 21.653  51.593  3.970   1.00 49.45  ? 423 GLU A HG2    1 
ATOM   7065  H  HG3    . GLU A 1 423 ? 20.613  50.456  4.357   1.00 49.45  ? 423 GLU A HG3    1 
ATOM   7066  N  N      . PRO A 1 424 ? 20.931  53.632  8.409   1.00 26.68  ? 424 PRO A N      1 
ATOM   7067  C  CA     . PRO A 1 424 ? 21.020  53.872  9.855   1.00 24.52  ? 424 PRO A CA     1 
ATOM   7068  C  C      . PRO A 1 424 ? 21.076  52.591  10.693  1.00 35.68  ? 424 PRO A C      1 
ATOM   7069  O  O      . PRO A 1 424 ? 20.342  52.481  11.677  1.00 32.91  ? 424 PRO A O      1 
ATOM   7070  C  CB     . PRO A 1 424 ? 19.729  54.654  10.156  1.00 23.33  ? 424 PRO A CB     1 
ATOM   7071  C  CG     . PRO A 1 424 ? 19.243  55.144  8.842   1.00 39.83  ? 424 PRO A CG     1 
ATOM   7072  C  CD     . PRO A 1 424 ? 19.645  54.099  7.867   1.00 34.35  ? 424 PRO A CD     1 
ATOM   7073  H  HA     . PRO A 1 424 ? 21.788  54.427  10.060  1.00 29.43  ? 424 PRO A HA     1 
ATOM   7074  H  HB2    . PRO A 1 424 ? 19.076  54.062  10.562  1.00 28.00  ? 424 PRO A HB2    1 
ATOM   7075  H  HB3    . PRO A 1 424 ? 19.929  55.398  10.745  1.00 28.00  ? 424 PRO A HB3    1 
ATOM   7076  H  HG2    . PRO A 1 424 ? 18.278  55.240  8.865   1.00 47.79  ? 424 PRO A HG2    1 
ATOM   7077  H  HG3    . PRO A 1 424 ? 19.668  55.991  8.631   1.00 47.79  ? 424 PRO A HG3    1 
ATOM   7078  H  HD2    . PRO A 1 424 ? 18.998  53.377  7.857   1.00 41.22  ? 424 PRO A HD2    1 
ATOM   7079  H  HD3    . PRO A 1 424 ? 19.767  54.484  6.985   1.00 41.22  ? 424 PRO A HD3    1 
ATOM   7080  N  N      . VAL A 1 425 ? 21.947  51.651  10.328  1.00 35.60  ? 425 VAL A N      1 
ATOM   7081  C  CA     . VAL A 1 425 ? 22.007  50.359  11.011  1.00 26.16  ? 425 VAL A CA     1 
ATOM   7082  C  C      . VAL A 1 425 ? 23.415  49.973  11.456  1.00 31.06  ? 425 VAL A C      1 
ATOM   7083  O  O      . VAL A 1 425 ? 23.654  48.829  11.838  1.00 27.28  ? 425 VAL A O      1 
ATOM   7084  C  CB     . VAL A 1 425 ? 21.468  49.239  10.105  1.00 17.83  ? 425 VAL A CB     1 
ATOM   7085  C  CG1    . VAL A 1 425 ? 19.982  49.423  9.857   1.00 23.87  ? 425 VAL A CG1    1 
ATOM   7086  C  CG2    . VAL A 1 425 ? 22.228  49.214  8.790   1.00 28.76  ? 425 VAL A CG2    1 
ATOM   7087  H  H      . VAL A 1 425 ? 22.514  51.737  9.688   1.00 42.72  ? 425 VAL A H      1 
ATOM   7088  H  HA     . VAL A 1 425 ? 21.446  50.398  11.801  1.00 31.39  ? 425 VAL A HA     1 
ATOM   7089  H  HB     . VAL A 1 425 ? 21.598  48.385  10.545  1.00 21.40  ? 425 VAL A HB     1 
ATOM   7090  H  HG11   . VAL A 1 425 ? 19.667  48.706  9.285   1.00 28.64  ? 425 VAL A HG11   1 
ATOM   7091  H  HG12   . VAL A 1 425 ? 19.515  49.398  10.707  1.00 28.64  ? 425 VAL A HG12   1 
ATOM   7092  H  HG13   . VAL A 1 425 ? 19.837  50.279  9.425   1.00 28.64  ? 425 VAL A HG13   1 
ATOM   7093  H  HG21   . VAL A 1 425 ? 21.873  48.502  8.235   1.00 34.51  ? 425 VAL A HG21   1 
ATOM   7094  H  HG22   . VAL A 1 425 ? 22.115  50.068  8.345   1.00 34.51  ? 425 VAL A HG22   1 
ATOM   7095  H  HG23   . VAL A 1 425 ? 23.167  49.056  8.972   1.00 34.51  ? 425 VAL A HG23   1 
ATOM   7096  N  N      . THR A 1 426 ? 24.343  50.920  11.417  1.00 39.47  ? 426 THR A N      1 
ATOM   7097  C  CA     . THR A 1 426 ? 25.722  50.631  11.785  1.00 31.49  ? 426 THR A CA     1 
ATOM   7098  C  C      . THR A 1 426 ? 25.813  50.139  13.231  1.00 32.81  ? 426 THR A C      1 
ATOM   7099  O  O      . THR A 1 426 ? 26.426  49.109  13.505  1.00 27.99  ? 426 THR A O      1 
ATOM   7100  C  CB     . THR A 1 426 ? 26.625  51.861  11.599  1.00 26.33  ? 426 THR A CB     1 
ATOM   7101  O  OG1    . THR A 1 426 ? 26.127  52.953  12.380  1.00 45.85  ? 426 THR A OG1    1 
ATOM   7102  C  CG2    . THR A 1 426 ? 26.668  52.262  10.135  1.00 22.57  ? 426 THR A CG2    1 
ATOM   7103  H  H      . THR A 1 426 ? 24.202  51.735  11.181  1.00 47.37  ? 426 THR A H      1 
ATOM   7104  H  HA     . THR A 1 426 ? 26.058  49.926  11.210  1.00 37.79  ? 426 THR A HA     1 
ATOM   7105  H  HB     . THR A 1 426 ? 27.526  51.645  11.883  1.00 31.60  ? 426 THR A HB     1 
ATOM   7106  H  HG1    . THR A 1 426 ? 26.620  53.626  12.279  1.00 55.02  ? 426 THR A HG1    1 
ATOM   7107  H  HG21   . THR A 1 426 ? 27.238  53.038  10.020  1.00 27.08  ? 426 THR A HG21   1 
ATOM   7108  H  HG22   . THR A 1 426 ? 27.019  51.531  9.602   1.00 27.08  ? 426 THR A HG22   1 
ATOM   7109  H  HG23   . THR A 1 426 ? 25.775  52.478  9.824   1.00 27.08  ? 426 THR A HG23   1 
ATOM   7110  N  N      . ALA A 1 427 ? 25.186  50.865  14.148  1.00 28.11  ? 427 ALA A N      1 
ATOM   7111  C  CA     . ALA A 1 427 ? 25.211  50.491  15.556  1.00 28.12  ? 427 ALA A CA     1 
ATOM   7112  C  C      . ALA A 1 427 ? 24.686  49.069  15.757  1.00 26.01  ? 427 ALA A C      1 
ATOM   7113  O  O      . ALA A 1 427 ? 25.257  48.298  16.528  1.00 28.68  ? 427 ALA A O      1 
ATOM   7114  C  CB     . ALA A 1 427 ? 24.400  51.475  16.375  1.00 44.33  ? 427 ALA A CB     1 
ATOM   7115  H  H      . ALA A 1 427 ? 24.738  51.580  13.982  1.00 33.74  ? 427 ALA A H      1 
ATOM   7116  H  HA     . ALA A 1 427 ? 26.127  50.520  15.873  1.00 33.74  ? 427 ALA A HA     1 
ATOM   7117  H  HB1    . ALA A 1 427 ? 24.430  51.209  17.308  1.00 53.20  ? 427 ALA A HB1    1 
ATOM   7118  H  HB2    . ALA A 1 427 ? 24.781  52.361  16.272  1.00 53.20  ? 427 ALA A HB2    1 
ATOM   7119  H  HB3    . ALA A 1 427 ? 23.484  51.470  16.058  1.00 53.20  ? 427 ALA A HB3    1 
ATOM   7120  N  N      . GLU A 1 428 ? 23.604  48.727  15.061  1.00 36.30  ? 428 GLU A N      1 
ATOM   7121  C  CA     . GLU A 1 428 ? 22.989  47.403  15.185  1.00 27.92  ? 428 GLU A CA     1 
ATOM   7122  C  C      . GLU A 1 428 ? 23.888  46.316  14.613  1.00 27.65  ? 428 GLU A C      1 
ATOM   7123  O  O      . GLU A 1 428 ? 23.919  45.198  15.119  1.00 35.38  ? 428 GLU A O      1 
ATOM   7124  C  CB     . GLU A 1 428 ? 21.632  47.354  14.480  1.00 18.64  ? 428 GLU A CB     1 
ATOM   7125  C  CG     . GLU A 1 428 ? 20.465  47.896  15.291  1.00 19.28  ? 428 GLU A CG     1 
ATOM   7126  C  CD     . GLU A 1 428 ? 20.514  49.400  15.482  1.00 35.14  ? 428 GLU A CD     1 
ATOM   7127  O  OE1    . GLU A 1 428 ? 21.383  50.060  14.873  1.00 38.74  ? 428 GLU A OE1    1 
ATOM   7128  O  OE2    . GLU A 1 428 ? 19.669  49.923  16.239  1.00 38.16  ? 428 GLU A OE2    1 
ATOM   7129  H  H      . GLU A 1 428 ? 23.202  49.246  14.505  1.00 43.56  ? 428 GLU A H      1 
ATOM   7130  H  HA     . GLU A 1 428 ? 22.846  47.209  16.125  1.00 33.50  ? 428 GLU A HA     1 
ATOM   7131  H  HB2    . GLU A 1 428 ? 21.689  47.877  13.664  1.00 22.37  ? 428 GLU A HB2    1 
ATOM   7132  H  HB3    . GLU A 1 428 ? 21.431  46.431  14.260  1.00 22.37  ? 428 GLU A HB3    1 
ATOM   7133  H  HG2    . GLU A 1 428 ? 19.637  47.681  14.834  1.00 23.13  ? 428 GLU A HG2    1 
ATOM   7134  H  HG3    . GLU A 1 428 ? 20.474  47.484  16.169  1.00 23.13  ? 428 GLU A HG3    1 
ATOM   7135  N  N      . LEU A 1 429 ? 24.595  46.644  13.537  1.00 35.01  ? 429 LEU A N      1 
ATOM   7136  C  CA     . LEU A 1 429 ? 25.506  45.703  12.896  1.00 30.40  ? 429 LEU A CA     1 
ATOM   7137  C  C      . LEU A 1 429 ? 26.677  45.371  13.805  1.00 29.53  ? 429 LEU A C      1 
ATOM   7138  O  O      . LEU A 1 429 ? 27.082  44.216  13.919  1.00 26.51  ? 429 LEU A O      1 
ATOM   7139  C  CB     . LEU A 1 429 ? 26.028  46.273  11.578  1.00 23.62  ? 429 LEU A CB     1 
ATOM   7140  C  CG     . LEU A 1 429 ? 25.048  46.294  10.411  1.00 21.00  ? 429 LEU A CG     1 
ATOM   7141  C  CD1    . LEU A 1 429 ? 25.619  47.113  9.268   1.00 24.36  ? 429 LEU A CD1    1 
ATOM   7142  C  CD2    . LEU A 1 429 ? 24.741  44.880  9.952   1.00 17.29  ? 429 LEU A CD2    1 
ATOM   7143  H  H      . LEU A 1 429 ? 24.564  47.414  13.155  1.00 42.01  ? 429 LEU A H      1 
ATOM   7144  H  HA     . LEU A 1 429 ? 25.030  44.880  12.703  1.00 36.48  ? 429 LEU A HA     1 
ATOM   7145  H  HB2    . LEU A 1 429 ? 26.309  47.189  11.734  1.00 28.34  ? 429 LEU A HB2    1 
ATOM   7146  H  HB3    . LEU A 1 429 ? 26.793  45.746  11.301  1.00 28.34  ? 429 LEU A HB3    1 
ATOM   7147  H  HG     . LEU A 1 429 ? 24.218  46.708  10.696  1.00 25.20  ? 429 LEU A HG     1 
ATOM   7148  H  HD11   . LEU A 1 429 ? 24.984  47.117  8.534   1.00 29.23  ? 429 LEU A HD11   1 
ATOM   7149  H  HD12   . LEU A 1 429 ? 25.773  48.020  9.577   1.00 29.23  ? 429 LEU A HD12   1 
ATOM   7150  H  HD13   . LEU A 1 429 ? 26.455  46.714  8.981   1.00 29.23  ? 429 LEU A HD13   1 
ATOM   7151  H  HD21   . LEU A 1 429 ? 24.117  44.918  9.210   1.00 20.75  ? 429 LEU A HD21   1 
ATOM   7152  H  HD22   . LEU A 1 429 ? 25.565  44.454  9.670   1.00 20.75  ? 429 LEU A HD22   1 
ATOM   7153  H  HD23   . LEU A 1 429 ? 24.349  44.387  10.690  1.00 20.75  ? 429 LEU A HD23   1 
ATOM   7154  N  N      . CYS A 1 430 ? 27.229  46.397  14.439  1.00 35.29  ? 430 CYS A N      1 
ATOM   7155  C  CA     . CYS A 1 430 ? 28.383  46.220  15.304  1.00 33.86  ? 430 CYS A CA     1 
ATOM   7156  C  C      . CYS A 1 430 ? 28.049  45.367  16.519  1.00 32.55  ? 430 CYS A C      1 
ATOM   7157  O  O      . CYS A 1 430 ? 28.872  44.576  16.973  1.00 47.24  ? 430 CYS A O      1 
ATOM   7158  C  CB     . CYS A 1 430 ? 28.922  47.579  15.744  1.00 32.18  ? 430 CYS A CB     1 
ATOM   7159  S  SG     . CYS A 1 430 ? 29.609  48.547  14.385  1.00 16.71  ? 430 CYS A SG     1 
ATOM   7160  H  H      . CYS A 1 430 ? 26.952  47.209  14.383  1.00 42.35  ? 430 CYS A H      1 
ATOM   7161  H  HA     . CYS A 1 430 ? 29.083  45.769  14.807  1.00 40.63  ? 430 CYS A HA     1 
ATOM   7162  H  HB2    . CYS A 1 430 ? 28.200  48.091  16.139  1.00 38.61  ? 430 CYS A HB2    1 
ATOM   7163  H  HB3    . CYS A 1 430 ? 29.626  47.441  16.397  1.00 38.61  ? 430 CYS A HB3    1 
ATOM   7164  H  HG     . CYS A 1 430 ? 28.750  48.740  13.570  1.00 20.05  ? 430 CYS A HG     1 
ATOM   7165  N  N      . GLU A 1 431 ? 26.840  45.527  17.044  1.00 31.33  ? 431 GLU A N      1 
ATOM   7166  C  CA     . GLU A 1 431 ? 26.392  44.707  18.159  1.00 33.49  ? 431 GLU A CA     1 
ATOM   7167  C  C      . GLU A 1 431 ? 26.238  43.258  17.713  1.00 27.59  ? 431 GLU A C      1 
ATOM   7168  O  O      . GLU A 1 431 ? 26.680  42.331  18.389  1.00 31.31  ? 431 GLU A O      1 
ATOM   7169  C  CB     . GLU A 1 431 ? 25.074  45.239  18.721  1.00 35.88  ? 431 GLU A CB     1 
ATOM   7170  C  CG     . GLU A 1 431 ? 24.500  44.398  19.852  1.00 66.17  ? 431 GLU A CG     1 
ATOM   7171  C  CD     . GLU A 1 431 ? 25.440  44.298  21.039  1.00 79.87  ? 431 GLU A CD     1 
ATOM   7172  O  OE1    . GLU A 1 431 ? 26.016  45.336  21.432  1.00 79.67  ? 431 GLU A OE1    1 
ATOM   7173  O  OE2    . GLU A 1 431 ? 25.610  43.179  21.572  1.00 78.10  ? 431 GLU A OE2    1 
ATOM   7174  H  H      . GLU A 1 431 ? 26.262  46.103  16.773  1.00 37.60  ? 431 GLU A H      1 
ATOM   7175  H  HA     . GLU A 1 431 ? 27.057  44.738  18.865  1.00 40.18  ? 431 GLU A HA     1 
ATOM   7176  H  HB2    . GLU A 1 431 ? 25.220  46.135  19.064  1.00 43.06  ? 431 GLU A HB2    1 
ATOM   7177  H  HB3    . GLU A 1 431 ? 24.418  45.263  18.008  1.00 43.06  ? 431 GLU A HB3    1 
ATOM   7178  H  HG2    . GLU A 1 431 ? 23.672  44.801  20.158  1.00 79.41  ? 431 GLU A HG2    1 
ATOM   7179  H  HG3    . GLU A 1 431 ? 24.331  43.500  19.525  1.00 79.41  ? 431 GLU A HG3    1 
ATOM   7180  N  N      . MET A 1 432 ? 25.616  43.082  16.555  1.00 37.62  ? 432 MET A N      1 
ATOM   7181  C  CA     . MET A 1 432 ? 25.317  41.765  16.009  1.00 31.73  ? 432 MET A CA     1 
ATOM   7182  C  C      . MET A 1 432 ? 26.571  40.964  15.687  1.00 31.99  ? 432 MET A C      1 
ATOM   7183  O  O      . MET A 1 432 ? 26.618  39.754  15.899  1.00 37.64  ? 432 MET A O      1 
ATOM   7184  C  CB     . MET A 1 432 ? 24.470  41.921  14.749  1.00 29.28  ? 432 MET A CB     1 
ATOM   7185  C  CG     . MET A 1 432 ? 24.038  40.619  14.112  1.00 34.11  ? 432 MET A CG     1 
ATOM   7186  S  SD     . MET A 1 432 ? 22.946  40.918  12.712  1.00 36.75  ? 432 MET A SD     1 
ATOM   7187  C  CE     . MET A 1 432 ? 24.076  41.705  11.569  1.00 36.32  ? 432 MET A CE     1 
ATOM   7188  H  H      . MET A 1 432 ? 25.351  43.728  16.053  1.00 45.15  ? 432 MET A H      1 
ATOM   7189  H  HA     . MET A 1 432 ? 24.792  41.272  16.659  1.00 38.08  ? 432 MET A HA     1 
ATOM   7190  H  HB2    . MET A 1 432 ? 23.667  42.417  14.975  1.00 35.13  ? 432 MET A HB2    1 
ATOM   7191  H  HB3    . MET A 1 432 ? 24.983  42.414  14.090  1.00 35.13  ? 432 MET A HB3    1 
ATOM   7192  H  HG2    . MET A 1 432 ? 24.820  40.142  13.794  1.00 40.93  ? 432 MET A HG2    1 
ATOM   7193  H  HG3    . MET A 1 432 ? 23.559  40.084  14.765  1.00 40.93  ? 432 MET A HG3    1 
ATOM   7194  H  HE1    . MET A 1 432 ? 23.599  41.922  10.753  1.00 43.59  ? 432 MET A HE1    1 
ATOM   7195  H  HE2    . MET A 1 432 ? 24.423  42.515  11.975  1.00 43.59  ? 432 MET A HE2    1 
ATOM   7196  H  HE3    . MET A 1 432 ? 24.804  41.094  11.374  1.00 43.59  ? 432 MET A HE3    1 
ATOM   7197  N  N      . MET A 1 433 ? 27.575  41.640  15.143  1.00 29.43  ? 433 MET A N      1 
ATOM   7198  C  CA     . MET A 1 433 ? 28.802  40.979  14.721  1.00 33.77  ? 433 MET A CA     1 
ATOM   7199  C  C      . MET A 1 433 ? 29.844  40.892  15.845  1.00 30.95  ? 433 MET A C      1 
ATOM   7200  O  O      . MET A 1 433 ? 30.845  40.181  15.722  1.00 22.63  ? 433 MET A O      1 
ATOM   7201  C  CB     . MET A 1 433 ? 29.383  41.711  13.508  1.00 32.10  ? 433 MET A CB     1 
ATOM   7202  C  CG     . MET A 1 433 ? 28.464  41.691  12.289  1.00 21.70  ? 433 MET A CG     1 
ATOM   7203  S  SD     . MET A 1 433 ? 29.295  42.184  10.773  1.00 20.02  ? 433 MET A SD     1 
ATOM   7204  C  CE     . MET A 1 433 ? 29.592  43.918  11.104  1.00 25.91  ? 433 MET A CE     1 
ATOM   7205  H  H      . MET A 1 433 ? 27.570  42.489  15.008  1.00 35.31  ? 433 MET A H      1 
ATOM   7206  H  HA     . MET A 1 433 ? 28.582  40.078  14.438  1.00 40.52  ? 433 MET A HA     1 
ATOM   7207  H  HB2    . MET A 1 433 ? 29.541  42.638  13.747  1.00 38.52  ? 433 MET A HB2    1 
ATOM   7208  H  HB3    . MET A 1 433 ? 30.219  41.288  13.258  1.00 38.52  ? 433 MET A HB3    1 
ATOM   7209  H  HG2    . MET A 1 433 ? 28.125  40.791  12.165  1.00 26.05  ? 433 MET A HG2    1 
ATOM   7210  H  HG3    . MET A 1 433 ? 27.728  42.304  12.440  1.00 26.05  ? 433 MET A HG3    1 
ATOM   7211  H  HE1    . MET A 1 433 ? 30.047  44.311  10.342  1.00 31.09  ? 433 MET A HE1    1 
ATOM   7212  H  HE2    . MET A 1 433 ? 28.741  44.362  11.246  1.00 31.09  ? 433 MET A HE2    1 
ATOM   7213  H  HE3    . MET A 1 433 ? 30.144  43.998  11.897  1.00 31.09  ? 433 MET A HE3    1 
ATOM   7214  N  N      . GLY A 1 434 ? 29.599  41.596  16.947  1.00 30.21  ? 434 GLY A N      1 
ATOM   7215  C  CA     . GLY A 1 434 ? 30.511  41.572  18.077  1.00 29.68  ? 434 GLY A CA     1 
ATOM   7216  C  C      . GLY A 1 434 ? 31.702  42.490  17.881  1.00 24.85  ? 434 GLY A C      1 
ATOM   7217  O  O      . GLY A 1 434 ? 32.764  42.278  18.461  1.00 29.38  ? 434 GLY A O      1 
ATOM   7218  H  H      . GLY A 1 434 ? 28.908  42.095  17.062  1.00 36.25  ? 434 GLY A H      1 
ATOM   7219  H  HA2    . GLY A 1 434 ? 30.040  41.848  18.879  1.00 35.62  ? 434 GLY A HA2    1 
ATOM   7220  H  HA3    . GLY A 1 434 ? 30.839  40.668  18.209  1.00 35.62  ? 434 GLY A HA3    1 
ATOM   7221  N  N      . VAL A 1 435 ? 31.514  43.519  17.062  1.00 34.67  ? 435 VAL A N      1 
ATOM   7222  C  CA     . VAL A 1 435 ? 32.551  44.506  16.791  1.00 25.72  ? 435 VAL A CA     1 
ATOM   7223  C  C      . VAL A 1 435 ? 32.996  45.145  18.093  1.00 26.01  ? 435 VAL A C      1 
ATOM   7224  O  O      . VAL A 1 435 ? 32.168  45.547  18.908  1.00 35.08  ? 435 VAL A O      1 
ATOM   7225  C  CB     . VAL A 1 435 ? 32.065  45.595  15.813  1.00 29.61  ? 435 VAL A CB     1 
ATOM   7226  C  CG1    . VAL A 1 435 ? 33.163  46.626  15.551  1.00 38.94  ? 435 VAL A CG1    1 
ATOM   7227  C  CG2    . VAL A 1 435 ? 31.613  44.968  14.506  1.00 22.24  ? 435 VAL A CG2    1 
ATOM   7228  H  H      . VAL A 1 435 ? 30.778  43.669  16.643  1.00 41.60  ? 435 VAL A H      1 
ATOM   7229  H  HA     . VAL A 1 435 ? 33.317  44.063  16.394  1.00 30.87  ? 435 VAL A HA     1 
ATOM   7230  H  HB     . VAL A 1 435 ? 31.306  46.056  16.203  1.00 35.53  ? 435 VAL A HB     1 
ATOM   7231  H  HG11   . VAL A 1 435 ? 32.827  47.295  14.935  1.00 46.73  ? 435 VAL A HG11   1 
ATOM   7232  H  HG12   . VAL A 1 435 ? 33.409  47.043  16.391  1.00 46.73  ? 435 VAL A HG12   1 
ATOM   7233  H  HG13   . VAL A 1 435 ? 33.931  46.177  15.166  1.00 46.73  ? 435 VAL A HG13   1 
ATOM   7234  H  HG21   . VAL A 1 435 ? 31.312  45.668  13.907  1.00 26.68  ? 435 VAL A HG21   1 
ATOM   7235  H  HG22   . VAL A 1 435 ? 32.360  44.491  14.110  1.00 26.68  ? 435 VAL A HG22   1 
ATOM   7236  H  HG23   . VAL A 1 435 ? 30.886  44.351  14.687  1.00 26.68  ? 435 VAL A HG23   1 
ATOM   7237  N  N      . LYS A 1 436 ? 34.309  45.243  18.274  1.00 32.41  ? 436 LYS A N      1 
ATOM   7238  C  CA     . LYS A 1 436 ? 34.875  45.791  19.498  1.00 42.12  ? 436 LYS A CA     1 
ATOM   7239  C  C      . LYS A 1 436 ? 35.123  47.286  19.370  1.00 35.79  ? 436 LYS A C      1 
ATOM   7240  O  O      . LYS A 1 436 ? 35.490  47.779  18.304  1.00 28.75  ? 436 LYS A O      1 
ATOM   7241  C  CB     . LYS A 1 436 ? 36.203  45.106  19.836  1.00 40.70  ? 436 LYS A CB     1 
ATOM   7242  C  CG     . LYS A 1 436 ? 36.118  43.686  20.371  1.00 24.58  ? 436 LYS A CG     1 
ATOM   7243  C  CD     . LYS A 1 436 ? 37.523  43.174  20.670  1.00 32.18  ? 436 LYS A CD     1 
ATOM   7244  C  CE     . LYS A 1 436 ? 37.526  41.868  21.444  1.00 48.16  ? 436 LYS A CE     1 
ATOM   7245  N  NZ     . LYS A 1 436 ? 38.908  41.488  21.869  1.00 31.75  ? 436 LYS A NZ     1 
ATOM   7246  H  H      . LYS A 1 436 ? 34.897  44.997  17.697  1.00 38.89  ? 436 LYS A H      1 
ATOM   7247  H  HA     . LYS A 1 436 ? 34.259  45.644  20.232  1.00 50.55  ? 436 LYS A HA     1 
ATOM   7248  H  HB2    . LYS A 1 436 ? 36.743  45.077  19.030  1.00 48.84  ? 436 LYS A HB2    1 
ATOM   7249  H  HB3    . LYS A 1 436 ? 36.657  45.639  20.507  1.00 48.84  ? 436 LYS A HB3    1 
ATOM   7250  H  HG2    . LYS A 1 436 ? 35.602  43.677  21.192  1.00 29.50  ? 436 LYS A HG2    1 
ATOM   7251  H  HG3    . LYS A 1 436 ? 35.713  43.109  19.704  1.00 29.50  ? 436 LYS A HG3    1 
ATOM   7252  H  HD2    . LYS A 1 436 ? 37.990  43.027  19.833  1.00 38.62  ? 436 LYS A HD2    1 
ATOM   7253  H  HD3    . LYS A 1 436 ? 37.994  43.837  21.200  1.00 38.62  ? 436 LYS A HD3    1 
ATOM   7254  H  HE2    . LYS A 1 436 ? 36.979  41.965  22.239  1.00 57.80  ? 436 LYS A HE2    1 
ATOM   7255  H  HE3    . LYS A 1 436 ? 37.176  41.161  20.879  1.00 57.80  ? 436 LYS A HE3    1 
ATOM   7256  H  HZ1    . LYS A 1 436 ? 38.887  40.720  22.320  1.00 38.10  ? 436 LYS A HZ1    1 
ATOM   7257  H  HZ2    . LYS A 1 436 ? 39.430  41.389  21.155  1.00 38.10  ? 436 LYS A HZ2    1 
ATOM   7258  H  HZ3    . LYS A 1 436 ? 39.250  42.121  22.392  1.00 38.10  ? 436 LYS A HZ3    1 
ATOM   7259  N  N      . ASP A 1 437 ? 34.915  47.993  20.476  1.00 51.51  ? 437 ASP A N      1 
ATOM   7260  C  CA     . ASP A 1 437 ? 35.248  49.406  20.575  1.00 33.57  ? 437 ASP A CA     1 
ATOM   7261  C  C      . ASP A 1 437 ? 34.451  50.223  19.565  1.00 36.62  ? 437 ASP A C      1 
ATOM   7262  O  O      . ASP A 1 437 ? 35.001  51.048  18.837  1.00 44.91  ? 437 ASP A O      1 
ATOM   7263  C  CB     . ASP A 1 437 ? 36.750  49.610  20.379  1.00 45.66  ? 437 ASP A CB     1 
ATOM   7264  C  CG     . ASP A 1 437 ? 37.577  48.848  21.401  1.00 55.65  ? 437 ASP A CG     1 
ATOM   7265  O  OD1    . ASP A 1 437 ? 37.155  48.782  22.574  1.00 46.52  ? 437 ASP A OD1    1 
ATOM   7266  O  OD2    . ASP A 1 437 ? 38.643  48.308  21.035  1.00 53.85  ? 437 ASP A OD2    1 
ATOM   7267  H  H      . ASP A 1 437 ? 34.575  47.669  21.196  1.00 61.81  ? 437 ASP A H      1 
ATOM   7268  H  HA     . ASP A 1 437 ? 35.017  49.722  21.463  1.00 40.28  ? 437 ASP A HA     1 
ATOM   7269  H  HB2    . ASP A 1 437 ? 37.000  49.297  19.496  1.00 54.79  ? 437 ASP A HB2    1 
ATOM   7270  H  HB3    . ASP A 1 437 ? 36.956  50.554  20.468  1.00 54.79  ? 437 ASP A HB3    1 
ATOM   7271  N  N      . SER A 1 438 ? 33.147  49.967  19.528  1.00 23.64  ? 438 SER A N      1 
ATOM   7272  C  CA     . SER A 1 438 ? 32.212  50.762  18.740  1.00 21.56  ? 438 SER A CA     1 
ATOM   7273  C  C      . SER A 1 438 ? 31.296  51.557  19.669  1.00 23.58  ? 438 SER A C      1 
ATOM   7274  O  O      . SER A 1 438 ? 30.286  52.115  19.237  1.00 27.10  ? 438 SER A O      1 
ATOM   7275  C  CB     . SER A 1 438 ? 31.390  49.861  17.817  1.00 23.51  ? 438 SER A CB     1 
ATOM   7276  O  OG     . SER A 1 438 ? 30.795  48.802  18.544  1.00 24.94  ? 438 SER A OG     1 
ATOM   7277  H  H      . SER A 1 438 ? 32.772  49.325  19.960  1.00 28.36  ? 438 SER A H      1 
ATOM   7278  H  HA     . SER A 1 438 ? 32.708  51.389  18.190  1.00 25.87  ? 438 SER A HA     1 
ATOM   7279  H  HB2    . SER A 1 438 ? 30.692  50.390  17.401  1.00 28.21  ? 438 SER A HB2    1 
ATOM   7280  H  HB3    . SER A 1 438 ? 31.974  49.489  17.138  1.00 28.21  ? 438 SER A HB3    1 
ATOM   7281  H  HG     . SER A 1 438 ? 30.347  48.315  18.027  1.00 29.92  ? 438 SER A HG     1 
ATOM   7282  N  N      . ASN A 1 439 ? 31.669  51.599  20.947  1.00 35.19  ? 439 ASN A N      1 
ATOM   7283  C  CA     . ASN A 1 439 ? 30.902  52.279  21.988  1.00 26.68  ? 439 ASN A CA     1 
ATOM   7284  C  C      . ASN A 1 439 ? 31.784  53.173  22.845  1.00 23.21  ? 439 ASN A C      1 
ATOM   7285  O  O      . ASN A 1 439 ? 32.988  52.947  22.955  1.00 28.33  ? 439 ASN A O      1 
ATOM   7286  C  CB     . ASN A 1 439 ? 30.206  51.261  22.893  1.00 45.65  ? 439 ASN A CB     1 
ATOM   7287  C  CG     . ASN A 1 439 ? 28.879  50.802  22.345  1.00 31.03  ? 439 ASN A CG     1 
ATOM   7288  O  OD1    . ASN A 1 439 ? 28.544  51.070  21.193  1.00 43.18  ? 439 ASN A OD1    1 
ATOM   7289  N  ND2    . ASN A 1 439 ? 28.111  50.101  23.170  1.00 42.93  ? 439 ASN A ND2    1 
ATOM   7290  H  H      . ASN A 1 439 ? 32.386  51.228  21.244  1.00 42.23  ? 439 ASN A H      1 
ATOM   7291  H  HA     . ASN A 1 439 ? 30.221  52.832  21.574  1.00 32.02  ? 439 ASN A HA     1 
ATOM   7292  H  HB2    . ASN A 1 439 ? 30.776  50.482  22.989  1.00 54.77  ? 439 ASN A HB2    1 
ATOM   7293  H  HB3    . ASN A 1 439 ? 30.048  51.665  23.761  1.00 54.77  ? 439 ASN A HB3    1 
ATOM   7294  H  HD21   . ASN A 1 439 ? 27.344  49.815  22.906  1.00 51.52  ? 439 ASN A HD21   1 
ATOM   7295  H  HD22   . ASN A 1 439 ? 28.380  49.932  23.969  1.00 51.52  ? 439 ASN A HD22   1 
ATOM   7296  N  N      . SER A 1 440 ? 31.176  54.175  23.468  1.00 17.20  ? 440 SER A N      1 
ATOM   7297  C  CA     . SER A 1 440 ? 31.895  55.033  24.397  1.00 26.37  ? 440 SER A CA     1 
ATOM   7298  C  C      . SER A 1 440 ? 30.944  55.633  25.427  1.00 34.09  ? 440 SER A C      1 
ATOM   7299  O  O      . SER A 1 440 ? 29.737  55.712  25.200  1.00 36.22  ? 440 SER A O      1 
ATOM   7300  C  CB     . SER A 1 440 ? 32.628  56.141  23.645  1.00 28.30  ? 440 SER A CB     1 
ATOM   7301  O  OG     . SER A 1 440 ? 33.381  56.939  24.540  1.00 49.31  ? 440 SER A OG     1 
ATOM   7302  H  H      . SER A 1 440 ? 30.346  54.378  23.370  1.00 20.64  ? 440 SER A H      1 
ATOM   7303  H  HA     . SER A 1 440 ? 32.555  54.503  24.871  1.00 31.65  ? 440 SER A HA     1 
ATOM   7304  H  HB2    . SER A 1 440 ? 33.229  55.739  22.997  1.00 33.96  ? 440 SER A HB2    1 
ATOM   7305  H  HB3    . SER A 1 440 ? 31.978  56.700  23.192  1.00 33.96  ? 440 SER A HB3    1 
ATOM   7306  H  HG     . SER A 1 440 ? 33.780  57.545  24.118  1.00 59.17  ? 440 SER A HG     1 
ATOM   7307  N  N      . SER A 1 441 ? 31.502  56.042  26.562  1.00 33.09  ? 441 SER A N      1 
ATOM   7308  C  CA     . SER A 1 441 ? 30.734  56.673  27.627  1.00 33.56  ? 441 SER A CA     1 
ATOM   7309  C  C      . SER A 1 441 ? 31.285  58.069  27.900  1.00 39.91  ? 441 SER A C      1 
ATOM   7310  O  O      . SER A 1 441 ? 31.205  58.577  29.018  1.00 57.78  ? 441 SER A O      1 
ATOM   7311  C  CB     . SER A 1 441 ? 30.766  55.817  28.897  1.00 41.49  ? 441 SER A CB     1 
ATOM   7312  O  OG     . SER A 1 441 ? 32.094  55.580  29.335  1.00 34.37  ? 441 SER A OG     1 
ATOM   7313  H  H      . SER A 1 441 ? 32.340  55.964  26.741  1.00 39.71  ? 441 SER A H      1 
ATOM   7314  H  HA     . SER A 1 441 ? 29.810  56.762  27.344  1.00 40.27  ? 441 SER A HA     1 
ATOM   7315  H  HB2    . SER A 1 441 ? 30.282  56.279  29.599  1.00 49.79  ? 441 SER A HB2    1 
ATOM   7316  H  HB3    . SER A 1 441 ? 30.342  54.965  28.711  1.00 49.79  ? 441 SER A HB3    1 
ATOM   7317  H  HG     . SER A 1 441 ? 32.088  55.110  30.031  1.00 41.24  ? 441 SER A HG     1 
ATOM   7318  N  N      . SER A 1 442 ? 31.844  58.683  26.863  1.00 29.15  ? 442 SER A N      1 
ATOM   7319  C  CA     . SER A 1 442 ? 32.403  60.024  26.974  1.00 35.56  ? 442 SER A CA     1 
ATOM   7320  C  C      . SER A 1 442 ? 31.294  61.067  27.051  1.00 50.00  ? 442 SER A C      1 
ATOM   7321  O  O      . SER A 1 442 ? 30.271  60.947  26.377  1.00 37.12  ? 442 SER A O      1 
ATOM   7322  C  CB     . SER A 1 442 ? 33.320  60.319  25.787  1.00 47.81  ? 442 SER A CB     1 
ATOM   7323  O  OG     . SER A 1 442 ? 32.609  60.224  24.563  1.00 55.97  ? 442 SER A OG     1 
ATOM   7324  H  H      . SER A 1 442 ? 31.913  58.341  26.077  1.00 34.98  ? 442 SER A H      1 
ATOM   7325  H  HA     . SER A 1 442 ? 32.931  60.082  27.786  1.00 42.67  ? 442 SER A HA     1 
ATOM   7326  H  HB2    . SER A 1 442 ? 33.673  61.218  25.878  1.00 57.37  ? 442 SER A HB2    1 
ATOM   7327  H  HB3    . SER A 1 442 ? 34.046  59.676  25.781  1.00 57.37  ? 442 SER A HB3    1 
ATOM   7328  H  HG     . SER A 1 442 ? 33.123  60.388  23.919  1.00 67.16  ? 442 SER A HG     1 
ATOM   7329  N  N      . VAL A 1 443 ? 31.508  62.088  27.878  1.00 82.23  ? 443 VAL A N      1 
ATOM   7330  C  CA     . VAL A 1 443 ? 30.536  63.163  28.062  1.00 73.61  ? 443 VAL A CA     1 
ATOM   7331  C  C      . VAL A 1 443 ? 31.033  64.446  27.402  1.00 60.21  ? 443 VAL A C      1 
ATOM   7332  O  O      . VAL A 1 443 ? 32.029  64.440  26.676  1.00 54.49  ? 443 VAL A O      1 
ATOM   7333  C  CB     . VAL A 1 443 ? 30.262  63.429  29.560  1.00 75.47  ? 443 VAL A CB     1 
ATOM   7334  C  CG1    . VAL A 1 443 ? 29.152  64.464  29.729  1.00 89.72  ? 443 VAL A CG1    1 
ATOM   7335  C  CG2    . VAL A 1 443 ? 29.894  62.134  30.277  1.00 32.48  ? 443 VAL A CG2    1 
ATOM   7336  H  H      . VAL A 1 443 ? 32.221  62.183  28.350  1.00 98.68  ? 443 VAL A H      1 
ATOM   7337  H  HA     . VAL A 1 443 ? 29.699  62.911  27.641  1.00 88.34  ? 443 VAL A HA     1 
ATOM   7338  H  HB     . VAL A 1 443 ? 31.067  63.782  29.971  1.00 90.56  ? 443 VAL A HB     1 
ATOM   7339  H  HG11   . VAL A 1 443 ? 29.001  64.612  30.676  1.00 107.67 ? 443 VAL A HG11   1 
ATOM   7340  H  HG12   . VAL A 1 443 ? 29.426  65.292  29.304  1.00 107.67 ? 443 VAL A HG12   1 
ATOM   7341  H  HG13   . VAL A 1 443 ? 28.343  64.130  29.313  1.00 107.67 ? 443 VAL A HG13   1 
ATOM   7342  H  HG21   . VAL A 1 443 ? 29.727  62.328  31.213  1.00 38.97  ? 443 VAL A HG21   1 
ATOM   7343  H  HG22   . VAL A 1 443 ? 29.096  61.763  29.868  1.00 38.97  ? 443 VAL A HG22   1 
ATOM   7344  H  HG23   . VAL A 1 443 ? 30.630  61.508  30.194  1.00 38.97  ? 443 VAL A HG23   1 
ATOM   7345  O  OP3    . G   B 2 1   ? -5.800  42.716  17.157  1.00 58.84  ? 1   G   B OP3    1 
ATOM   7346  P  P      . G   B 2 1   ? -4.882  42.598  16.002  1.00 64.19  ? 1   G   B P      1 
ATOM   7347  O  OP1    . G   B 2 1   ? -5.115  43.773  15.125  1.00 42.70  ? 1   G   B OP1    1 
ATOM   7348  O  OP2    . G   B 2 1   ? -5.016  41.228  15.445  1.00 32.62  ? 1   G   B OP2    1 
ATOM   7349  O  "O5'"  . G   B 2 1   ? -3.393  42.724  16.548  1.00 50.50  ? 1   G   B "O5'"  1 
ATOM   7350  C  "C5'"  . G   B 2 1   ? -2.378  43.322  15.757  1.00 42.14  ? 1   G   B "C5'"  1 
ATOM   7351  C  "C4'"  . G   B 2 1   ? -1.084  43.443  16.516  1.00 28.92  ? 1   G   B "C4'"  1 
ATOM   7352  O  "O4'"  . G   B 2 1   ? -1.306  44.199  17.737  1.00 34.99  ? 1   G   B "O4'"  1 
ATOM   7353  C  "C3'"  . G   B 2 1   ? -0.461  42.137  16.991  1.00 23.94  ? 1   G   B "C3'"  1 
ATOM   7354  O  "O3'"  . G   B 2 1   ? 0.292   41.489  15.976  1.00 28.20  ? 1   G   B "O3'"  1 
ATOM   7355  C  "C2'"  . G   B 2 1   ? 0.370   42.583  18.184  1.00 26.80  ? 1   G   B "C2'"  1 
ATOM   7356  O  "O2'"  . G   B 2 1   ? 1.594   43.171  17.765  1.00 33.13  ? 1   G   B "O2'"  1 
ATOM   7357  C  "C1'"  . G   B 2 1   ? -0.516  43.675  18.780  1.00 32.04  ? 1   G   B "C1'"  1 
ATOM   7358  N  N9     . G   B 2 1   ? -1.411  43.169  19.841  1.00 30.75  ? 1   G   B N9     1 
ATOM   7359  C  C8     . G   B 2 1   ? -2.784  43.099  19.813  1.00 34.83  ? 1   G   B C8     1 
ATOM   7360  N  N7     . G   B 2 1   ? -3.301  42.615  20.908  1.00 35.81  ? 1   G   B N7     1 
ATOM   7361  C  C5     . G   B 2 1   ? -2.203  42.360  21.718  1.00 32.75  ? 1   G   B C5     1 
ATOM   7362  C  C6     . G   B 2 1   ? -2.131  41.828  23.032  1.00 30.54  ? 1   G   B C6     1 
ATOM   7363  O  O6     . G   B 2 1   ? -3.054  41.463  23.770  1.00 35.04  ? 1   G   B O6     1 
ATOM   7364  N  N1     . G   B 2 1   ? -0.816  41.739  23.475  1.00 29.93  ? 1   G   B N1     1 
ATOM   7365  C  C2     . G   B 2 1   ? 0.290   42.112  22.750  1.00 33.24  ? 1   G   B C2     1 
ATOM   7366  N  N2     . G   B 2 1   ? 1.477   41.948  23.351  1.00 29.09  ? 1   G   B N2     1 
ATOM   7367  N  N3     . G   B 2 1   ? 0.240   42.608  21.525  1.00 37.06  ? 1   G   B N3     1 
ATOM   7368  C  C4     . G   B 2 1   ? -1.031  42.708  21.078  1.00 35.11  ? 1   G   B C4     1 
ATOM   7369  H  "H5'"  . G   B 2 1   ? -2.669  44.206  15.484  1.00 50.57  ? 1   G   B "H5'"  1 
ATOM   7370  H  "H5''" . G   B 2 1   ? -2.231  42.779  14.967  1.00 50.57  ? 1   G   B "H5''" 1 
ATOM   7371  H  "H4'"  . G   B 2 1   ? -0.440  43.916  15.966  1.00 34.70  ? 1   G   B "H4'"  1 
ATOM   7372  H  "H3'"  . G   B 2 1   ? -1.164  41.542  17.296  1.00 28.73  ? 1   G   B "H3'"  1 
ATOM   7373  H  "H2'"  . G   B 2 1   ? 0.514   41.858  18.812  1.00 32.16  ? 1   G   B "H2'"  1 
ATOM   7374  H  "HO2'" . G   B 2 1   ? 2.025   43.417  18.443  1.00 39.76  ? 1   G   B "HO2'" 1 
ATOM   7375  H  "H1'"  . G   B 2 1   ? 0.044   44.380  19.143  1.00 38.45  ? 1   G   B "H1'"  1 
ATOM   7376  H  H8     . G   B 2 1   ? -3.293  43.360  19.080  1.00 41.80  ? 1   G   B H8     1 
ATOM   7377  H  H1     . G   B 2 1   ? -0.685  41.426  24.265  1.00 35.91  ? 1   G   B H1     1 
ATOM   7378  H  H21    . G   B 2 1   ? 1.515   41.626  24.148  1.00 34.91  ? 1   G   B H21    1 
ATOM   7379  H  H22    . G   B 2 1   ? 2.201   42.164  22.940  1.00 34.91  ? 1   G   B H22    1 
ATOM   7380  P  P      . G   B 2 2   ? 0.352   39.882  15.872  1.00 19.37  ? 2   G   B P      1 
ATOM   7381  O  OP1    . G   B 2 2   ? 1.010   39.552  14.583  1.00 31.85  ? 2   G   B OP1    1 
ATOM   7382  O  OP2    . G   B 2 2   ? -0.983  39.307  16.171  1.00 32.35  ? 2   G   B OP2    1 
ATOM   7383  O  "O5'"  . G   B 2 2   ? 1.346   39.461  17.042  1.00 29.21  ? 2   G   B "O5'"  1 
ATOM   7384  C  "C5'"  . G   B 2 2   ? 2.718   39.826  16.990  1.00 29.55  ? 2   G   B "C5'"  1 
ATOM   7385  C  "C4'"  . G   B 2 2   ? 3.433   39.521  18.283  1.00 28.91  ? 2   G   B "C4'"  1 
ATOM   7386  O  "O4'"  . G   B 2 2   ? 2.859   40.302  19.364  1.00 34.06  ? 2   G   B "O4'"  1 
ATOM   7387  C  "C3'"  . G   B 2 2   ? 3.345   38.089  18.782  1.00 25.78  ? 2   G   B "C3'"  1 
ATOM   7388  O  "O3'"  . G   B 2 2   ? 4.248   37.217  18.128  1.00 38.69  ? 2   G   B "O3'"  1 
ATOM   7389  C  "C2'"  . G   B 2 2   ? 3.614   38.248  20.273  1.00 38.49  ? 2   G   B "C2'"  1 
ATOM   7390  O  "O2'"  . G   B 2 2   ? 4.998   38.425  20.540  1.00 29.03  ? 2   G   B "O2'"  1 
ATOM   7391  C  "C1'"  . G   B 2 2   ? 2.888   39.558  20.564  1.00 35.79  ? 2   G   B "C1'"  1 
ATOM   7392  N  N9     . G   B 2 2   ? 1.502   39.327  21.005  1.00 34.80  ? 2   G   B N9     1 
ATOM   7393  C  C8     . G   B 2 2   ? 0.369   39.407  20.235  1.00 31.90  ? 2   G   B C8     1 
ATOM   7394  N  N7     . G   B 2 2   ? -0.720  39.140  20.900  1.00 37.83  ? 2   G   B N7     1 
ATOM   7395  C  C5     . G   B 2 2   ? -0.279  38.858  22.184  1.00 35.41  ? 2   G   B C5     1 
ATOM   7396  C  C6     . G   B 2 2   ? -1.011  38.501  23.342  1.00 40.93  ? 2   G   B C6     1 
ATOM   7397  O  O6     . G   B 2 2   ? -2.235  38.359  23.466  1.00 37.85  ? 2   G   B O6     1 
ATOM   7398  N  N1     . G   B 2 2   ? -0.165  38.306  24.430  1.00 37.07  ? 2   G   B N1     1 
ATOM   7399  C  C2     . G   B 2 2   ? 1.201   38.437  24.407  1.00 27.28  ? 2   G   B C2     1 
ATOM   7400  N  N2     . G   B 2 2   ? 1.839   38.203  25.562  1.00 30.80  ? 2   G   B N2     1 
ATOM   7401  N  N3     . G   B 2 2   ? 1.893   38.769  23.333  1.00 34.91  ? 2   G   B N3     1 
ATOM   7402  C  C4     . G   B 2 2   ? 1.093   38.960  22.264  1.00 36.32  ? 2   G   B C4     1 
ATOM   7403  H  "H5'"  . G   B 2 2   ? 2.784   40.777  16.810  1.00 35.45  ? 2   G   B "H5'"  1 
ATOM   7404  H  "H5''" . G   B 2 2   ? 3.146   39.338  16.270  1.00 35.45  ? 2   G   B "H5''" 1 
ATOM   7405  H  "H4'"  . G   B 2 2   ? 4.368   39.761  18.186  1.00 34.70  ? 2   G   B "H4'"  1 
ATOM   7406  H  "H3'"  . G   B 2 2   ? 2.440   37.763  18.656  1.00 30.93  ? 2   G   B "H3'"  1 
ATOM   7407  H  "H2'"  . G   B 2 2   ? 3.239   37.514  20.783  1.00 46.19  ? 2   G   B "H2'"  1 
ATOM   7408  H  "HO2'" . G   B 2 2   ? 5.110   38.494  21.369  1.00 34.83  ? 2   G   B "HO2'" 1 
ATOM   7409  H  "H1'"  . G   B 2 2   ? 3.369   40.054  21.245  1.00 42.94  ? 2   G   B "H1'"  1 
ATOM   7410  H  H8     . G   B 2 2   ? 0.377   39.637  19.334  1.00 38.28  ? 2   G   B H8     1 
ATOM   7411  H  H1     . G   B 2 2   ? -0.528  38.083  25.177  1.00 44.48  ? 2   G   B H1     1 
ATOM   7412  H  H21    . G   B 2 2   ? 1.392   37.986  26.264  1.00 36.96  ? 2   G   B H21    1 
ATOM   7413  H  H22    . G   B 2 2   ? 2.695   38.270  25.601  1.00 36.96  ? 2   G   B H22    1 
ATOM   7414  P  P      . C   B 2 3   ? 3.889   35.660  17.968  1.00 24.86  ? 3   C   B P      1 
ATOM   7415  O  OP1    . C   B 2 3   ? 5.008   35.017  17.233  1.00 30.68  ? 3   C   B OP1    1 
ATOM   7416  O  OP2    . C   B 2 3   ? 2.496   35.531  17.471  1.00 28.10  ? 3   C   B OP2    1 
ATOM   7417  O  "O5'"  . C   B 2 3   ? 3.923   35.116  19.459  1.00 26.24  ? 3   C   B "O5'"  1 
ATOM   7418  C  "C5'"  . C   B 2 3   ? 5.127   35.152  20.204  1.00 33.47  ? 3   C   B "C5'"  1 
ATOM   7419  C  "C4'"  . C   B 2 3   ? 4.899   34.752  21.635  1.00 35.16  ? 3   C   B "C4'"  1 
ATOM   7420  O  "O4'"  . C   B 2 3   ? 4.000   35.687  22.284  1.00 35.56  ? 3   C   B "O4'"  1 
ATOM   7421  C  "C3'"  . C   B 2 3   ? 4.232   33.405  21.848  1.00 40.06  ? 3   C   B "C3'"  1 
ATOM   7422  O  "O3'"  . C   B 2 3   ? 5.125   32.320  21.687  1.00 59.92  ? 3   C   B "O3'"  1 
ATOM   7423  C  "C2'"  . C   B 2 3   ? 3.669   33.548  23.250  1.00 33.27  ? 3   C   B "C2'"  1 
ATOM   7424  O  "O2'"  . C   B 2 3   ? 4.692   33.405  24.224  1.00 36.71  ? 3   C   B "O2'"  1 
ATOM   7425  C  "C1'"  . C   B 2 3   ? 3.209   35.005  23.233  1.00 37.64  ? 3   C   B "C1'"  1 
ATOM   7426  N  N1     . C   B 2 3   ? 1.789   35.134  22.845  1.00 33.54  ? 3   C   B N1     1 
ATOM   7427  C  C2     . C   B 2 3   ? 0.808   34.922  23.815  1.00 44.59  ? 3   C   B C2     1 
ATOM   7428  O  O2     . C   B 2 3   ? 1.154   34.622  24.968  1.00 42.09  ? 3   C   B O2     1 
ATOM   7429  N  N3     . C   B 2 3   ? -0.495  35.041  23.472  1.00 47.56  ? 3   C   B N3     1 
ATOM   7430  C  C4     . C   B 2 3   ? -0.830  35.362  22.222  1.00 36.26  ? 3   C   B C4     1 
ATOM   7431  N  N4     . C   B 2 3   ? -2.127  35.471  21.931  1.00 38.45  ? 3   C   B N4     1 
ATOM   7432  C  C5     . C   B 2 3   ? 0.150   35.588  21.216  1.00 35.35  ? 3   C   B C5     1 
ATOM   7433  C  C6     . C   B 2 3   ? 1.436   35.465  21.567  1.00 34.51  ? 3   C   B C6     1 
ATOM   7434  H  "H5'"  . C   B 2 3   ? 5.489   36.052  20.181  1.00 40.16  ? 3   C   B "H5'"  1 
ATOM   7435  H  "H5''" . C   B 2 3   ? 5.767   34.543  19.803  1.00 40.16  ? 3   C   B "H5''" 1 
ATOM   7436  H  "H4'"  . C   B 2 3   ? 5.749   34.758  22.103  1.00 42.19  ? 3   C   B "H4'"  1 
ATOM   7437  H  "H3'"  . C   B 2 3   ? 3.500   33.311  21.219  1.00 48.07  ? 3   C   B "H3'"  1 
ATOM   7438  H  "H2'"  . C   B 2 3   ? 2.929   32.940  23.406  1.00 39.92  ? 3   C   B "H2'"  1 
ATOM   7439  H  "HO2'" . C   B 2 3   ? 4.830   34.150  24.586  1.00 44.06  ? 3   C   B "HO2'" 1 
ATOM   7440  H  "H1'"  . C   B 2 3   ? 3.343   35.398  24.110  1.00 45.17  ? 3   C   B "H1'"  1 
ATOM   7441  H  H41    . C   B 2 3   ? -2.373  35.677  21.133  1.00 46.14  ? 3   C   B H41    1 
ATOM   7442  H  H42    . C   B 2 3   ? -2.717  35.335  22.542  1.00 46.14  ? 3   C   B H42    1 
ATOM   7443  H  H5     . C   B 2 3   ? -0.093  35.812  20.347  1.00 42.42  ? 3   C   B H5     1 
ATOM   7444  H  H6     . C   B 2 3   ? 2.099   35.607  20.932  1.00 41.42  ? 3   C   B H6     1 
ATOM   7445  P  P      . C   B 2 4   ? 4.577   30.867  21.279  1.00 33.28  ? 4   C   B P      1 
ATOM   7446  O  OP1    . C   B 2 4   ? 5.756   30.006  21.018  1.00 68.35  ? 4   C   B OP1    1 
ATOM   7447  O  OP2    . C   B 2 4   ? 3.509   30.991  20.256  1.00 30.13  ? 4   C   B OP2    1 
ATOM   7448  O  "O5'"  . C   B 2 4   ? 3.882   30.353  22.609  1.00 51.35  ? 4   C   B "O5'"  1 
ATOM   7449  C  "C5'"  . C   B 2 4   ? 4.631   30.214  23.805  1.00 68.30  ? 4   C   B "C5'"  1 
ATOM   7450  C  "C4'"  . C   B 2 4   ? 3.770   29.683  24.916  1.00 69.84  ? 4   C   B "C4'"  1 
ATOM   7451  O  "O4'"  . C   B 2 4   ? 2.772   30.666  25.291  1.00 69.46  ? 4   C   B "O4'"  1 
ATOM   7452  C  "C3'"  . C   B 2 4   ? 2.958   28.455  24.554  1.00 76.72  ? 4   C   B "C3'"  1 
ATOM   7453  O  "O3'"  . C   B 2 4   ? 3.739   27.274  24.593  1.00 88.22  ? 4   C   B "O3'"  1 
ATOM   7454  C  "C2'"  . C   B 2 4   ? 1.813   28.510  25.553  1.00 75.53  ? 4   C   B "C2'"  1 
ATOM   7455  O  "O2'"  . C   B 2 4   ? 2.219   28.048  26.833  1.00 65.92  ? 4   C   B "O2'"  1 
ATOM   7456  C  "C1'"  . C   B 2 4   ? 1.564   30.017  25.631  1.00 66.48  ? 4   C   B "C1'"  1 
ATOM   7457  N  N1     . C   B 2 4   ? 0.512   30.478  24.695  1.00 67.44  ? 4   C   B N1     1 
ATOM   7458  C  C2     . C   B 2 4   ? -0.829  30.296  25.040  1.00 74.54  ? 4   C   B C2     1 
ATOM   7459  O  O2     . C   B 2 4   ? -1.103  29.727  26.108  1.00 71.73  ? 4   C   B O2     1 
ATOM   7460  N  N3     . C   B 2 4   ? -1.796  30.731  24.196  1.00 71.00  ? 4   C   B N3     1 
ATOM   7461  C  C4     . C   B 2 4   ? -1.467  31.337  23.054  1.00 57.02  ? 4   C   B C4     1 
ATOM   7462  N  N4     . C   B 2 4   ? -2.454  31.750  22.254  1.00 66.23  ? 4   C   B N4     1 
ATOM   7463  C  C5     . C   B 2 4   ? -0.109  31.548  22.682  1.00 44.95  ? 4   C   B C5     1 
ATOM   7464  C  C6     . C   B 2 4   ? 0.837   31.111  23.525  1.00 52.96  ? 4   C   B C6     1 
ATOM   7465  H  "H5'"  . C   B 2 4   ? 4.986   31.079  24.062  1.00 81.96  ? 4   C   B "H5'"  1 
ATOM   7466  H  "H5''" . C   B 2 4   ? 5.367   29.601  23.651  1.00 81.96  ? 4   C   B "H5''" 1 
ATOM   7467  H  "H4'"  . C   B 2 4   ? 4.327   29.483  25.685  1.00 83.81  ? 4   C   B "H4'"  1 
ATOM   7468  H  "H3'"  . C   B 2 4   ? 2.601   28.566  23.659  1.00 92.06  ? 4   C   B "H3'"  1 
ATOM   7469  H  "H2'"  . C   B 2 4   ? 1.031   28.036  25.229  1.00 90.63  ? 4   C   B "H2'"  1 
ATOM   7470  H  "HO2'" . C   B 2 4   ? 2.357   27.220  26.794  1.00 79.11  ? 4   C   B "HO2'" 1 
ATOM   7471  H  "H1'"  . C   B 2 4   ? 1.316   30.256  26.537  1.00 79.78  ? 4   C   B "H1'"  1 
ATOM   7472  H  H41    . C   B 2 4   ? -2.270  32.143  21.512  1.00 79.48  ? 4   C   B H41    1 
ATOM   7473  H  H42    . C   B 2 4   ? -3.273  31.621  22.481  1.00 79.48  ? 4   C   B H42    1 
ATOM   7474  H  H5     . C   B 2 4   ? 0.113   31.970  21.884  1.00 53.94  ? 4   C   B H5     1 
ATOM   7475  H  H6     . C   B 2 4   ? 1.733   31.236  23.308  1.00 63.56  ? 4   C   B H6     1 
ATOM   7476  P  P      . G   B 2 5   ? 3.282   25.968  23.785  1.00 84.48  ? 5   G   B P      1 
ATOM   7477  O  OP1    . G   B 2 5   ? 4.458   25.066  23.687  1.00 80.91  ? 5   G   B OP1    1 
ATOM   7478  O  OP2    . G   B 2 5   ? 2.586   26.401  22.545  1.00 52.10  ? 5   G   B OP2    1 
ATOM   7479  O  "O5'"  . G   B 2 5   ? 2.206   25.307  24.751  1.00 81.69  ? 5   G   B "O5'"  1 
ATOM   7480  C  "C5'"  . G   B 2 5   ? 1.118   24.566  24.232  1.00 93.56  ? 5   G   B "C5'"  1 
ATOM   7481  C  "C4'"  . G   B 2 5   ? -0.078  24.660  25.138  1.00 102.42 ? 5   G   B "C4'"  1 
ATOM   7482  O  "O4'"  . G   B 2 5   ? -0.560  26.026  25.172  1.00 95.42  ? 5   G   B "O4'"  1 
ATOM   7483  C  "C3'"  . G   B 2 5   ? -1.283  23.842  24.706  1.00 122.98 ? 5   G   B "C3'"  1 
ATOM   7484  O  "O3'"  . G   B 2 5   ? -1.163  22.484  25.099  1.00 124.17 ? 5   G   B "O3'"  1 
ATOM   7485  C  "C2'"  . G   B 2 5   ? -2.445  24.588  25.347  1.00 111.81 ? 5   G   B "C2'"  1 
ATOM   7486  O  "O2'"  . G   B 2 5   ? -2.589  24.239  26.717  1.00 105.78 ? 5   G   B "O2'"  1 
ATOM   7487  C  "C1'"  . G   B 2 5   ? -1.967  26.040  25.254  1.00 97.12  ? 5   G   B "C1'"  1 
ATOM   7488  N  N9     . G   B 2 5   ? -2.464  26.749  24.060  1.00 95.74  ? 5   G   B N9     1 
ATOM   7489  C  C8     . G   B 2 5   ? -1.683  27.130  22.993  1.00 88.88  ? 5   G   B C8     1 
ATOM   7490  N  N7     . G   B 2 5   ? -2.340  27.777  22.073  1.00 85.40  ? 5   G   B N7     1 
ATOM   7491  C  C5     . G   B 2 5   ? -3.631  27.850  22.572  1.00 85.19  ? 5   G   B C5     1 
ATOM   7492  C  C6     . G   B 2 5   ? -4.785  28.441  22.005  1.00 93.06  ? 5   G   B C6     1 
ATOM   7493  O  O6     . G   B 2 5   ? -4.892  29.032  20.923  1.00 89.36  ? 5   G   B O6     1 
ATOM   7494  N  N1     . G   B 2 5   ? -5.889  28.290  22.838  1.00 109.04 ? 5   G   B N1     1 
ATOM   7495  C  C2     . G   B 2 5   ? -5.878  27.652  24.057  1.00 106.07 ? 5   G   B C2     1 
ATOM   7496  N  N2     . G   B 2 5   ? -7.048  27.610  24.711  1.00 114.42 ? 5   G   B N2     1 
ATOM   7497  N  N3     . G   B 2 5   ? -4.806  27.097  24.598  1.00 85.12  ? 5   G   B N3     1 
ATOM   7498  C  C4     . G   B 2 5   ? -3.722  27.240  23.809  1.00 89.92  ? 5   G   B C4     1 
ATOM   7499  H  "H5'"  . G   B 2 5   ? 1.379   23.636  24.145  1.00 112.28 ? 5   G   B "H5'"  1 
ATOM   7500  H  "H5''" . G   B 2 5   ? 0.883   24.914  23.358  1.00 112.28 ? 5   G   B "H5''" 1 
ATOM   7501  H  "H4'"  . G   B 2 5   ? 0.181   24.393  26.034  1.00 122.91 ? 5   G   B "H4'"  1 
ATOM   7502  H  "H3'"  . G   B 2 5   ? -1.369  23.888  23.741  1.00 147.58 ? 5   G   B "H3'"  1 
ATOM   7503  H  "H2'"  . G   B 2 5   ? -3.270  24.454  24.854  1.00 134.17 ? 5   G   B "H2'"  1 
ATOM   7504  H  "HO2'" . G   B 2 5   ? -2.136  23.549  26.872  1.00 126.94 ? 5   G   B "HO2'" 1 
ATOM   7505  H  "H1'"  . G   B 2 5   ? -2.238  26.521  26.051  1.00 116.55 ? 5   G   B "H1'"  1 
ATOM   7506  H  H8     . G   B 2 5   ? -0.777  26.931  22.928  1.00 106.66 ? 5   G   B H8     1 
ATOM   7507  H  H1     . G   B 2 5   ? -6.636  28.621  22.570  1.00 130.85 ? 5   G   B H1     1 
ATOM   7508  H  H21    . G   B 2 5   ? -7.748  27.970  24.365  1.00 137.30 ? 5   G   B H21    1 
ATOM   7509  H  H22    . G   B 2 5   ? -7.098  27.224  25.478  1.00 137.30 ? 5   G   B H22    1 
ATOM   7510  P  P      . C   B 2 6   ? -1.145  21.299  24.012  1.00 124.68 ? 6   C   B P      1 
ATOM   7511  O  OP1    . C   B 2 6   ? -0.341  20.189  24.582  1.00 120.69 ? 6   C   B OP1    1 
ATOM   7512  O  OP2    . C   B 2 6   ? -0.786  21.846  22.679  1.00 93.88  ? 6   C   B OP2    1 
ATOM   7513  O  "O5'"  . C   B 2 6   ? -2.667  20.837  23.958  1.00 146.49 ? 6   C   B "O5'"  1 
ATOM   7514  C  "C5'"  . C   B 2 6   ? -3.309  20.378  25.139  1.00 147.99 ? 6   C   B "C5'"  1 
ATOM   7515  C  "C4'"  . C   B 2 6   ? -4.801  20.585  25.087  1.00 149.66 ? 6   C   B "C4'"  1 
ATOM   7516  O  "O4'"  . C   B 2 6   ? -5.093  22.007  25.107  1.00 132.10 ? 6   C   B "O4'"  1 
ATOM   7517  C  "C3'"  . C   B 2 6   ? -5.518  20.084  23.844  1.00 157.82 ? 6   C   B "C3'"  1 
ATOM   7518  O  "O3'"  . C   B 2 6   ? -5.749  18.684  23.864  1.00 170.08 ? 6   C   B "O3'"  1 
ATOM   7519  C  "C2'"  . C   B 2 6   ? -6.785  20.926  23.847  1.00 142.67 ? 6   C   B "C2'"  1 
ATOM   7520  O  "O2'"  . C   B 2 6   ? -7.724  20.441  24.794  1.00 142.69 ? 6   C   B "O2'"  1 
ATOM   7521  C  "C1'"  . C   B 2 6   ? -6.241  22.271  24.328  1.00 131.03 ? 6   C   B "C1'"  1 
ATOM   7522  N  N1     . C   B 2 6   ? -5.837  23.131  23.194  1.00 107.29 ? 6   C   B N1     1 
ATOM   7523  C  C2     . C   B 2 6   ? -6.793  23.929  22.561  1.00 114.68 ? 6   C   B C2     1 
ATOM   7524  O  O2     . C   B 2 6   ? -7.964  23.908  22.968  1.00 112.73 ? 6   C   B O2     1 
ATOM   7525  N  N3     . C   B 2 6   ? -6.413  24.709  21.521  1.00 113.41 ? 6   C   B N3     1 
ATOM   7526  C  C4     . C   B 2 6   ? -5.144  24.706  21.108  1.00 102.35 ? 6   C   B C4     1 
ATOM   7527  N  N4     . C   B 2 6   ? -4.813  25.490  20.080  1.00 85.46  ? 6   C   B N4     1 
ATOM   7528  C  C5     . C   B 2 6   ? -4.152  23.900  21.732  1.00 106.29 ? 6   C   B C5     1 
ATOM   7529  C  C6     . C   B 2 6   ? -4.540  23.135  22.759  1.00 103.63 ? 6   C   B C6     1 
ATOM   7530  H  "H5'"  . C   B 2 6   ? -2.950  20.860  25.900  1.00 177.58 ? 6   C   B "H5'"  1 
ATOM   7531  H  "H5''" . C   B 2 6   ? -3.126  19.432  25.250  1.00 177.58 ? 6   C   B "H5''" 1 
ATOM   7532  H  "H4'"  . C   B 2 6   ? -5.201  20.172  25.868  1.00 179.59 ? 6   C   B "H4'"  1 
ATOM   7533  H  "H3'"  . C   B 2 6   ? -4.990  20.307  23.061  1.00 189.38 ? 6   C   B "H3'"  1 
ATOM   7534  H  "H2'"  . C   B 2 6   ? -7.170  20.996  22.959  1.00 171.20 ? 6   C   B "H2'"  1 
ATOM   7535  H  "HO2'" . C   B 2 6   ? -8.023  19.702  24.530  1.00 171.22 ? 6   C   B "HO2'" 1 
ATOM   7536  H  "H1'"  . C   B 2 6   ? -6.909  22.724  24.867  1.00 157.24 ? 6   C   B "H1'"  1 
ATOM   7537  H  H41    . C   B 2 6   ? -4.002  25.506  19.795  1.00 102.55 ? 6   C   B H41    1 
ATOM   7538  H  H42    . C   B 2 6   ? -5.411  25.979  19.702  1.00 102.55 ? 6   C   B H42    1 
ATOM   7539  H  H5     . C   B 2 6   ? -3.270  23.905  21.439  1.00 127.55 ? 6   C   B H5     1 
ATOM   7540  H  H6     . C   B 2 6   ? -3.915  22.597  23.188  1.00 124.35 ? 6   C   B H6     1 
ATOM   7541  P  P      . G   B 2 7   ? -4.868  17.690  22.955  1.00 170.62 ? 7   G   B P      1 
ATOM   7542  O  OP1    . G   B 2 7   ? -4.866  16.359  23.613  1.00 166.85 ? 7   G   B OP1    1 
ATOM   7543  O  OP2    . G   B 2 7   ? -3.569  18.345  22.652  1.00 131.66 ? 7   G   B OP2    1 
ATOM   7544  O  "O5'"  . G   B 2 7   ? -5.695  17.566  21.596  1.00 158.45 ? 7   G   B "O5'"  1 
ATOM   7545  C  "C5'"  . G   B 2 7   ? -5.851  18.676  20.725  1.00 145.74 ? 7   G   B "C5'"  1 
ATOM   7546  C  "C4'"  . G   B 2 7   ? -7.299  19.075  20.584  1.00 140.67 ? 7   G   B "C4'"  1 
ATOM   7547  O  "O4'"  . G   B 2 7   ? -7.403  20.516  20.722  1.00 131.33 ? 7   G   B "O4'"  1 
ATOM   7548  C  "C3'"  . G   B 2 7   ? -7.968  18.786  19.243  1.00 150.73 ? 7   G   B "C3'"  1 
ATOM   7549  O  "O3'"  . G   B 2 7   ? -8.427  17.452  19.097  1.00 165.24 ? 7   G   B "O3'"  1 
ATOM   7550  C  "C2'"  . G   B 2 7   ? -9.080  19.821  19.197  1.00 143.54 ? 7   G   B "C2'"  1 
ATOM   7551  O  "O2'"  . G   B 2 7   ? -10.188 19.421  19.990  1.00 140.31 ? 7   G   B "O2'"  1 
ATOM   7552  C  "C1'"  . G   B 2 7   ? -8.405  21.014  19.864  1.00 140.22 ? 7   G   B "C1'"  1 
ATOM   7553  N  N9     . G   B 2 7   ? -7.747  21.899  18.887  1.00 146.19 ? 7   G   B N9     1 
ATOM   7554  C  C8     . G   B 2 7   ? -6.388  22.022  18.718  1.00 141.45 ? 7   G   B C8     1 
ATOM   7555  N  N7     . G   B 2 7   ? -6.059  22.891  17.804  1.00 140.85 ? 7   G   B N7     1 
ATOM   7556  C  C5     . G   B 2 7   ? -7.275  23.381  17.351  1.00 145.52 ? 7   G   B C5     1 
ATOM   7557  C  C6     . G   B 2 7   ? -7.550  24.353  16.357  1.00 139.74 ? 7   G   B C6     1 
ATOM   7558  O  O6     . G   B 2 7   ? -6.745  24.988  15.664  1.00 128.46 ? 7   G   B O6     1 
ATOM   7559  N  N1     . G   B 2 7   ? -8.919  24.555  16.207  1.00 143.90 ? 7   G   B N1     1 
ATOM   7560  C  C2     . G   B 2 7   ? -9.898  23.906  16.922  1.00 144.06 ? 7   G   B C2     1 
ATOM   7561  N  N2     . G   B 2 7   ? -11.165 24.240  16.633  1.00 139.45 ? 7   G   B N2     1 
ATOM   7562  N  N3     . G   B 2 7   ? -9.655  22.997  17.853  1.00 140.83 ? 7   G   B N3     1 
ATOM   7563  C  C4     . G   B 2 7   ? -8.330  22.791  18.019  1.00 145.96 ? 7   G   B C4     1 
ATOM   7564  H  "H5'"  . G   B 2 7   ? -5.500  18.444  19.851  1.00 174.88 ? 7   G   B "H5'"  1 
ATOM   7565  H  "H5''" . G   B 2 7   ? -5.349  19.427  21.078  1.00 174.88 ? 7   G   B "H5''" 1 
ATOM   7566  H  "H4'"  . G   B 2 7   ? -7.813  18.653  21.290  1.00 168.80 ? 7   G   B "H4'"  1 
ATOM   7567  H  "H3'"  . G   B 2 7   ? -7.335  18.977  18.533  1.00 180.87 ? 7   G   B "H3'"  1 
ATOM   7568  H  "H2'"  . G   B 2 7   ? -9.342  20.024  18.285  1.00 172.25 ? 7   G   B "H2'"  1 
ATOM   7569  H  "HO2'" . G   B 2 7   ? -10.214 18.582  20.020  1.00 168.37 ? 7   G   B "HO2'" 1 
ATOM   7570  H  "H1'"  . G   B 2 7   ? -9.057  21.517  20.378  1.00 168.27 ? 7   G   B "H1'"  1 
ATOM   7571  H  H8     . G   B 2 7   ? -5.766  21.529  19.202  1.00 169.74 ? 7   G   B H8     1 
ATOM   7572  H  H1     . G   B 2 7   ? -9.173  25.132  15.621  1.00 172.68 ? 7   G   B H1     1 
ATOM   7573  H  H21    . G   B 2 7   ? -11.327 24.830  16.028  1.00 167.34 ? 7   G   B H21    1 
ATOM   7574  H  H22    . G   B 2 7   ? -11.815 23.863  17.051  1.00 167.34 ? 7   G   B H22    1 
ATOM   7575  P  P      . G   B 2 8   ? -7.574  16.368  18.268  1.00 173.69 ? 8   G   B P      1 
ATOM   7576  O  OP1    . G   B 2 8   ? -8.014  15.018  18.703  1.00 152.83 ? 8   G   B OP1    1 
ATOM   7577  O  OP2    . G   B 2 8   ? -6.132  16.713  18.330  1.00 166.20 ? 8   G   B OP2    1 
ATOM   7578  O  "O5'"  . G   B 2 8   ? -8.061  16.578  16.763  1.00 144.30 ? 8   G   B "O5'"  1 
ATOM   7579  C  "C5'"  . G   B 2 8   ? -7.683  17.728  16.017  1.00 133.79 ? 8   G   B "C5'"  1 
ATOM   7580  C  "C4'"  . G   B 2 8   ? -8.879  18.562  15.624  1.00 124.45 ? 8   G   B "C4'"  1 
ATOM   7581  O  "O4'"  . G   B 2 8   ? -8.649  19.948  15.988  1.00 138.21 ? 8   G   B "O4'"  1 
ATOM   7582  C  "C3'"  . G   B 2 8   ? -9.196  18.612  14.135  1.00 128.54 ? 8   G   B "C3'"  1 
ATOM   7583  O  "O3'"  . G   B 2 8   ? -9.960  17.507  13.688  1.00 141.19 ? 8   G   B "O3'"  1 
ATOM   7584  C  "C2'"  . G   B 2 8   ? -9.917  19.944  13.976  1.00 122.99 ? 8   G   B "C2'"  1 
ATOM   7585  O  "O2'"  . G   B 2 8   ? -11.291 19.833  14.318  1.00 96.93  ? 8   G   B "O2'"  1 
ATOM   7586  C  "C1'"  . G   B 2 8   ? -9.212  20.808  15.020  1.00 145.24 ? 8   G   B "C1'"  1 
ATOM   7587  N  N9     . G   B 2 8   ? -8.136  21.636  14.442  1.00 154.12 ? 8   G   B N9     1 
ATOM   7588  C  C8     . G   B 2 8   ? -6.788  21.514  14.685  1.00 147.43 ? 8   G   B C8     1 
ATOM   7589  N  N7     . G   B 2 8   ? -6.068  22.401  14.054  1.00 138.50 ? 8   G   B N7     1 
ATOM   7590  C  C5     . G   B 2 8   ? -6.997  23.164  13.360  1.00 144.43 ? 8   G   B C5     1 
ATOM   7591  C  C6     . G   B 2 8   ? -6.809  24.278  12.501  1.00 133.93 ? 8   G   B C6     1 
ATOM   7592  O  O6     . G   B 2 8   ? -5.749  24.823  12.169  1.00 122.87 ? 8   G   B O6     1 
ATOM   7593  N  N1     . G   B 2 8   ? -8.019  24.750  12.005  1.00 128.55 ? 8   G   B N1     1 
ATOM   7594  C  C2     . G   B 2 8   ? -9.253  24.224  12.301  1.00 130.93 ? 8   G   B C2     1 
ATOM   7595  N  N2     . G   B 2 8   ? -10.302 24.825  11.722  1.00 123.03 ? 8   G   B N2     1 
ATOM   7596  N  N3     . G   B 2 8   ? -9.445  23.188  13.102  1.00 134.26 ? 8   G   B N3     1 
ATOM   7597  C  C4     . G   B 2 8   ? -8.281  22.714  13.599  1.00 147.07 ? 8   G   B C4     1 
ATOM   7598  H  "H5'"  . G   B 2 8   ? -7.219  17.445  15.214  1.00 160.55 ? 8   G   B "H5'"  1 
ATOM   7599  H  "H5''" . G   B 2 8   ? -7.084  18.270  16.554  1.00 160.55 ? 8   G   B "H5''" 1 
ATOM   7600  H  "H4'"  . G   B 2 8   ? -9.659  18.237  16.100  1.00 149.34 ? 8   G   B "H4'"  1 
ATOM   7601  H  "H3'"  . G   B 2 8   ? -8.364  18.642  13.637  1.00 154.24 ? 8   G   B "H3'"  1 
ATOM   7602  H  "H2'"  . G   B 2 8   ? -9.799  20.305  13.083  1.00 147.58 ? 8   G   B "H2'"  1 
ATOM   7603  H  "HO2'" . G   B 2 8   ? -11.545 19.046  14.175  1.00 116.31 ? 8   G   B "HO2'" 1 
ATOM   7604  H  "H1'"  . G   B 2 8   ? -9.864  21.385  15.447  1.00 174.29 ? 8   G   B "H1'"  1 
ATOM   7605  H  H8     . G   B 2 8   ? -6.425  20.861  15.238  1.00 176.92 ? 8   G   B H8     1 
ATOM   7606  H  H1     . G   B 2 8   ? -7.993  25.426  11.474  1.00 154.25 ? 8   G   B H1     1 
ATOM   7607  H  H21    . G   B 2 8   ? -10.179 25.498  11.202  1.00 147.63 ? 8   G   B H21    1 
ATOM   7608  H  H22    . G   B 2 8   ? -11.099 24.537  11.872  1.00 147.63 ? 8   G   B H22    1 
ATOM   7609  P  P      . C   B 2 9   ? -9.480  16.658  12.413  1.00 147.16 ? 9   C   B P      1 
ATOM   7610  O  OP1    . C   B 2 9   ? -10.363 15.468  12.306  1.00 122.87 ? 9   C   B OP1    1 
ATOM   7611  O  OP2    . C   B 2 9   ? -8.008  16.473  12.475  1.00 134.97 ? 9   C   B OP2    1 
ATOM   7612  O  "O5'"  . C   B 2 9   ? -9.812  17.627  11.194  1.00 116.90 ? 9   C   B "O5'"  1 
ATOM   7613  C  "C5'"  . C   B 2 9   ? -11.119 18.153  11.029  1.00 105.24 ? 9   C   B "C5'"  1 
ATOM   7614  C  "C4'"  . C   B 2 9   ? -11.171 19.209  9.953   1.00 107.58 ? 9   C   B "C4'"  1 
ATOM   7615  O  "O4'"  . C   B 2 9   ? -10.786 20.502  10.497  1.00 104.24 ? 9   C   B "O4'"  1 
ATOM   7616  C  "C3'"  . C   B 2 9   ? -10.232 19.032  8.772   1.00 119.39 ? 9   C   B "C3'"  1 
ATOM   7617  O  "O3'"  . C   B 2 9   ? -10.636 18.046  7.839   1.00 128.68 ? 9   C   B "O3'"  1 
ATOM   7618  C  "C2'"  . C   B 2 9   ? -10.177 20.443  8.207   1.00 121.81 ? 9   C   B "C2'"  1 
ATOM   7619  O  "O2'"  . C   B 2 9   ? -11.360 20.764  7.490   1.00 102.97 ? 9   C   B "O2'"  1 
ATOM   7620  C  "C1'"  . C   B 2 9   ? -10.136 21.262  9.493   1.00 121.58 ? 9   C   B "C1'"  1 
ATOM   7621  N  N1     . C   B 2 9   ? -8.731  21.496  9.890   1.00 130.84 ? 9   C   B N1     1 
ATOM   7622  C  C2     . C   B 2 9   ? -8.036  22.551  9.289   1.00 123.34 ? 9   C   B C2     1 
ATOM   7623  O  O2     . C   B 2 9   ? -8.629  23.282  8.480   1.00 117.08 ? 9   C   B O2     1 
ATOM   7624  N  N3     . C   B 2 9   ? -6.741  22.760  9.615   1.00 121.51 ? 9   C   B N3     1 
ATOM   7625  C  C4     . C   B 2 9   ? -6.135  21.950  10.484  1.00 122.19 ? 9   C   B C4     1 
ATOM   7626  N  N4     . C   B 2 9   ? -4.857  22.198  10.781  1.00 114.45 ? 9   C   B N4     1 
ATOM   7627  C  C5     . C   B 2 9   ? -6.813  20.858  11.099  1.00 130.61 ? 9   C   B C5     1 
ATOM   7628  C  C6     . C   B 2 9   ? -8.095  20.662  10.768  1.00 133.01 ? 9   C   B C6     1 
ATOM   7629  H  "H5'"  . C   B 2 9   ? -11.409 18.543  11.868  1.00 126.29 ? 9   C   B "H5'"  1 
ATOM   7630  H  "H5''" . C   B 2 9   ? -11.722 17.432  10.791  1.00 126.29 ? 9   C   B "H5''" 1 
ATOM   7631  H  "H4'"  . C   B 2 9   ? -12.081 19.270  9.622   1.00 129.10 ? 9   C   B "H4'"  1 
ATOM   7632  H  "H3'"  . C   B 2 9   ? -9.353  18.798  9.108   1.00 143.26 ? 9   C   B "H3'"  1 
ATOM   7633  H  "H2'"  . C   B 2 9   ? -9.381  20.582  7.671   1.00 146.17 ? 9   C   B "H2'"  1 
ATOM   7634  H  "HO2'" . C   B 2 9   ? -11.382 20.312  6.782   1.00 123.57 ? 9   C   B "HO2'" 1 
ATOM   7635  H  "H1'"  . C   B 2 9   ? -10.593 22.108  9.366   1.00 145.90 ? 9   C   B "H1'"  1 
ATOM   7636  H  H41    . C   B 2 9   ? -4.439  21.693  11.338  1.00 137.34 ? 9   C   B H41    1 
ATOM   7637  H  H42    . C   B 2 9   ? -4.452  22.862  10.415  1.00 137.34 ? 9   C   B H42    1 
ATOM   7638  H  H5     . C   B 2 9   ? -6.381  20.303  11.707  1.00 156.74 ? 9   C   B H5     1 
ATOM   7639  H  H6     . C   B 2 9   ? -8.564  19.956  11.150  1.00 159.61 ? 9   C   B H6     1 
ATOM   7640  P  P      . A   B 2 10  ? -9.513  17.231  7.024   1.00 131.66 ? 10  A   B P      1 
ATOM   7641  O  OP1    . A   B 2 10  ? -10.185 16.219  6.169   1.00 124.90 ? 10  A   B OP1    1 
ATOM   7642  O  OP2    . A   B 2 10  ? -8.480  16.779  7.992   1.00 131.03 ? 10  A   B OP2    1 
ATOM   7643  O  "O5'"  . A   B 2 10  ? -8.864  18.331  6.071   1.00 104.32 ? 10  A   B "O5'"  1 
ATOM   7644  C  "C5'"  . A   B 2 10  ? -9.287  18.449  4.724   1.00 101.17 ? 10  A   B "C5'"  1 
ATOM   7645  C  "C4'"  . A   B 2 10  ? -9.107  19.847  4.190   1.00 105.10 ? 10  A   B "C4'"  1 
ATOM   7646  O  "O4'"  . A   B 2 10  ? -8.949  20.789  5.286   1.00 100.73 ? 10  A   B "O4'"  1 
ATOM   7647  C  "C3'"  . A   B 2 10  ? -7.873  20.063  3.334   1.00 122.04 ? 10  A   B "C3'"  1 
ATOM   7648  O  "O3'"  . A   B 2 10  ? -8.061  19.622  2.000   1.00 124.88 ? 10  A   B "O3'"  1 
ATOM   7649  C  "C2'"  . A   B 2 10  ? -7.628  21.559  3.475   1.00 119.85 ? 10  A   B "C2'"  1 
ATOM   7650  O  "O2'"  . A   B 2 10  ? -8.512  22.308  2.652   1.00 101.92 ? 10  A   B "O2'"  1 
ATOM   7651  C  "C1'"  . A   B 2 10  ? -8.007  21.783  4.937   1.00 112.81 ? 10  A   B "C1'"  1 
ATOM   7652  N  N9     . A   B 2 10  ? -6.842  21.662  5.836   1.00 113.86 ? 10  A   B N9     1 
ATOM   7653  C  C8     . A   B 2 10  ? -6.625  20.704  6.795   1.00 117.46 ? 10  A   B C8     1 
ATOM   7654  N  N7     . A   B 2 10  ? -5.495  20.845  7.446   1.00 103.27 ? 10  A   B N7     1 
ATOM   7655  C  C5     . A   B 2 10  ? -4.925  21.973  6.878   1.00 100.31 ? 10  A   B C5     1 
ATOM   7656  C  C6     . A   B 2 10  ? -3.717  22.645  7.131   1.00 100.36 ? 10  A   B C6     1 
ATOM   7657  N  N6     . A   B 2 10  ? -2.835  22.262  8.057   1.00 87.30  ? 10  A   B N6     1 
ATOM   7658  N  N1     . A   B 2 10  ? -3.442  23.740  6.390   1.00 111.02 ? 10  A   B N1     1 
ATOM   7659  C  C2     . A   B 2 10  ? -4.328  24.122  5.460   1.00 113.23 ? 10  A   B C2     1 
ATOM   7660  N  N3     . A   B 2 10  ? -5.497  23.574  5.131   1.00 115.08 ? 10  A   B N3     1 
ATOM   7661  C  C4     . A   B 2 10  ? -5.742  22.488  5.885   1.00 112.38 ? 10  A   B C4     1 
ATOM   7662  H  "H5'"  . A   B 2 10  ? -10.226 18.209  4.667   1.00 121.41 ? 10  A   B "H5'"  1 
ATOM   7663  H  "H5''" . A   B 2 10  ? -8.772  17.835  4.178   1.00 121.41 ? 10  A   B "H5''" 1 
ATOM   7664  H  "H4'"  . A   B 2 10  ? -9.893  20.091  3.676   1.00 126.12 ? 10  A   B "H4'"  1 
ATOM   7665  H  "H3'"  . A   B 2 10  ? -7.127  19.581  3.725   1.00 146.45 ? 10  A   B "H3'"  1 
ATOM   7666  H  "H2'"  . A   B 2 10  ? -6.700  21.786  3.309   1.00 143.82 ? 10  A   B "H2'"  1 
ATOM   7667  H  "HO2'" . A   B 2 10  ? -8.305  22.186  1.847   1.00 122.30 ? 10  A   B "HO2'" 1 
ATOM   7668  H  "H1'"  . A   B 2 10  ? -8.408  22.660  5.039   1.00 135.37 ? 10  A   B "H1'"  1 
ATOM   7669  H  H8     . A   B 2 10  ? -7.227  20.016  6.969   1.00 140.96 ? 10  A   B H8     1 
ATOM   7670  H  H61    . A   B 2 10  ? -2.110  22.709  8.172   1.00 104.76 ? 10  A   B H61    1 
ATOM   7671  H  H62    . A   B 2 10  ? -2.993  21.567  8.539   1.00 104.76 ? 10  A   B H62    1 
ATOM   7672  H  H2     . A   B 2 10  ? -4.094  24.882  4.977   1.00 135.88 ? 10  A   B H2     1 
ATOM   7673  P  P      . G   B 2 11  ? -6.887  18.834  1.239   1.00 125.22 ? 11  G   B P      1 
ATOM   7674  O  OP1    . G   B 2 11  ? -7.443  18.303  -0.030  1.00 122.90 ? 11  G   B OP1    1 
ATOM   7675  O  OP2    . G   B 2 11  ? -6.240  17.903  2.197   1.00 142.91 ? 11  G   B OP2    1 
ATOM   7676  O  "O5'"  . G   B 2 11  ? -5.846  19.978  0.875   1.00 113.41 ? 11  G   B "O5'"  1 
ATOM   7677  C  "C5'"  . G   B 2 11  ? -6.245  21.084  0.081   1.00 120.39 ? 11  G   B "C5'"  1 
ATOM   7678  C  "C4'"  . G   B 2 11  ? -5.217  22.181  0.121   1.00 122.26 ? 11  G   B "C4'"  1 
ATOM   7679  O  "O4'"  . G   B 2 11  ? -5.110  22.715  1.466   1.00 123.69 ? 11  G   B "O4'"  1 
ATOM   7680  C  "C3'"  . G   B 2 11  ? -3.800  21.756  -0.213  1.00 120.16 ? 11  G   B "C3'"  1 
ATOM   7681  O  "O3'"  . G   B 2 11  ? -3.564  21.614  -1.600  1.00 123.56 ? 11  G   B "O3'"  1 
ATOM   7682  C  "C2'"  . G   B 2 11  ? -2.975  22.849  0.446   1.00 115.03 ? 11  G   B "C2'"  1 
ATOM   7683  O  "O2'"  . G   B 2 11  ? -2.991  24.041  -0.327  1.00 112.37 ? 11  G   B "O2'"  1 
ATOM   7684  C  "C1'"  . G   B 2 11  ? -3.771  23.079  1.729   1.00 106.53 ? 11  G   B "C1'"  1 
ATOM   7685  N  N9     . G   B 2 11  ? -3.264  22.240  2.828   1.00 104.08 ? 11  G   B N9     1 
ATOM   7686  C  C8     . G   B 2 11  ? -3.839  21.126  3.391   1.00 100.50 ? 11  G   B C8     1 
ATOM   7687  N  N7     . G   B 2 11  ? -3.114  20.606  4.347   1.00 99.45  ? 11  G   B N7     1 
ATOM   7688  C  C5     . G   B 2 11  ? -1.992  21.424  4.410   1.00 110.84 ? 11  G   B C5     1 
ATOM   7689  C  C6     . G   B 2 11  ? -0.847  21.371  5.249   1.00 99.15  ? 11  G   B C6     1 
ATOM   7690  O  O6     . G   B 2 11  ? -0.582  20.557  6.142   1.00 85.65  ? 11  G   B O6     1 
ATOM   7691  N  N1     . G   B 2 11  ? 0.043   22.405  4.963   1.00 98.65  ? 11  G   B N1     1 
ATOM   7692  C  C2     . G   B 2 11  ? -0.141  23.367  3.996   1.00 94.67  ? 11  G   B C2     1 
ATOM   7693  N  N2     . G   B 2 11  ? 0.826   24.287  3.861   1.00 82.60  ? 11  G   B N2     1 
ATOM   7694  N  N3     . G   B 2 11  ? -1.200  23.426  3.212   1.00 106.80 ? 11  G   B N3     1 
ATOM   7695  C  C4     . G   B 2 11  ? -2.072  22.432  3.475   1.00 113.00 ? 11  G   B C4     1 
ATOM   7696  H  "H5'"  . G   B 2 11  ? -7.088  21.427  0.414   1.00 144.46 ? 11  G   B "H5'"  1 
ATOM   7697  H  "H5''" . G   B 2 11  ? -6.361  20.791  -0.836  1.00 144.46 ? 11  G   B "H5''" 1 
ATOM   7698  H  "H4'"  . G   B 2 11  ? -5.487  22.891  -0.482  1.00 146.71 ? 11  G   B "H4'"  1 
ATOM   7699  H  "H3'"  . G   B 2 11  ? -3.613  20.912  0.226   1.00 144.19 ? 11  G   B "H3'"  1 
ATOM   7700  H  "H2'"  . G   B 2 11  ? -2.071  22.551  0.635   1.00 138.04 ? 11  G   B "H2'"  1 
ATOM   7701  H  "HO2'" . G   B 2 11  ? -3.238  23.858  -1.109  1.00 134.85 ? 11  G   B "HO2'" 1 
ATOM   7702  H  "H1'"  . G   B 2 11  ? -3.728  24.015  1.981   1.00 127.83 ? 11  G   B "H1'"  1 
ATOM   7703  H  H8     . G   B 2 11  ? -4.661  20.782  3.124   1.00 120.60 ? 11  G   B H8     1 
ATOM   7704  H  H1     . G   B 2 11  ? 0.765   22.445  5.428   1.00 118.38 ? 11  G   B H1     1 
ATOM   7705  H  H21    . G   B 2 11  ? 1.521   24.258  4.367   1.00 99.12  ? 11  G   B H21    1 
ATOM   7706  H  H22    . G   B 2 11  ? 0.751   24.906  3.269   1.00 99.12  ? 11  G   B H22    1 
ATOM   7707  P  P      . G   B 2 12  ? -2.541  20.490  -2.118  1.00 122.14 ? 12  G   B P      1 
ATOM   7708  O  OP1    . G   B 2 12  ? -2.721  20.347  -3.584  1.00 116.76 ? 12  G   B OP1    1 
ATOM   7709  O  OP2    . G   B 2 12  ? -2.662  19.296  -1.239  1.00 85.29  ? 12  G   B OP2    1 
ATOM   7710  O  "O5'"  . G   B 2 12  ? -1.109  21.138  -1.877  1.00 125.72 ? 12  G   B "O5'"  1 
ATOM   7711  C  "C5'"  . G   B 2 12  ? -0.753  22.376  -2.472  1.00 111.57 ? 12  G   B "C5'"  1 
ATOM   7712  C  "C4'"  . G   B 2 12  ? 0.516   22.912  -1.865  1.00 108.27 ? 12  G   B "C4'"  1 
ATOM   7713  O  "O4'"  . G   B 2 12  ? 0.341   23.061  -0.433  1.00 93.57  ? 12  G   B "O4'"  1 
ATOM   7714  C  "C3'"  . G   B 2 12  ? 1.737   22.015  -2.000  1.00 121.28 ? 12  G   B "C3'"  1 
ATOM   7715  O  "O3'"  . G   B 2 12  ? 2.373   22.134  -3.261  1.00 127.63 ? 12  G   B "O3'"  1 
ATOM   7716  C  "C2'"  . G   B 2 12  ? 2.604   22.451  -0.827  1.00 110.52 ? 12  G   B "C2'"  1 
ATOM   7717  O  "O2'"  . G   B 2 12  ? 3.321   23.640  -1.131  1.00 106.89 ? 12  G   B "O2'"  1 
ATOM   7718  C  "C1'"  . G   B 2 12  ? 1.549   22.765  0.234   1.00 100.98 ? 12  G   B "C1'"  1 
ATOM   7719  N  N9     . G   B 2 12  ? 1.317   21.632  1.151   1.00 101.24 ? 12  G   B N9     1 
ATOM   7720  C  C8     . G   B 2 12  ? 0.232   20.789  1.186   1.00 95.82  ? 12  G   B C8     1 
ATOM   7721  N  N7     . G   B 2 12  ? 0.318   19.883  2.123   1.00 82.88  ? 12  G   B N7     1 
ATOM   7722  C  C5     . G   B 2 12  ? 1.530   20.146  2.745   1.00 91.68  ? 12  G   B C5     1 
ATOM   7723  C  C6     . G   B 2 12  ? 2.168   19.498  3.834   1.00 91.83  ? 12  G   B C6     1 
ATOM   7724  O  O6     . G   B 2 12  ? 1.772   18.524  4.485   1.00 93.98  ? 12  G   B O6     1 
ATOM   7725  N  N1     . G   B 2 12  ? 3.391   20.092  4.140   1.00 93.85  ? 12  G   B N1     1 
ATOM   7726  C  C2     . G   B 2 12  ? 3.932   21.174  3.484   1.00 94.00  ? 12  G   B C2     1 
ATOM   7727  N  N2     . G   B 2 12  ? 5.124   21.611  3.920   1.00 79.99  ? 12  G   B N2     1 
ATOM   7728  N  N3     . G   B 2 12  ? 3.345   21.786  2.469   1.00 103.95 ? 12  G   B N3     1 
ATOM   7729  C  C4     . G   B 2 12  ? 2.158   21.223  2.157   1.00 107.42 ? 12  G   B C4     1 
ATOM   7730  H  "H5'"  . G   B 2 12  ? -1.469  23.015  -2.332  1.00 133.88 ? 12  G   B "H5'"  1 
ATOM   7731  H  "H5''" . G   B 2 12  ? -0.622  22.246  -3.424  1.00 133.88 ? 12  G   B "H5''" 1 
ATOM   7732  H  "H4'"  . G   B 2 12  ? 0.713   23.779  -2.254  1.00 129.92 ? 12  G   B "H4'"  1 
ATOM   7733  H  "H3'"  . G   B 2 12  ? 1.467   21.092  -1.867  1.00 145.54 ? 12  G   B "H3'"  1 
ATOM   7734  H  "H2'"  . G   B 2 12  ? 3.196   21.739  -0.538  1.00 132.62 ? 12  G   B "H2'"  1 
ATOM   7735  H  "HO2'" . G   B 2 12  ? 3.465   23.668  -1.958  1.00 128.27 ? 12  G   B "HO2'" 1 
ATOM   7736  H  "H1'"  . G   B 2 12  ? 1.830   23.540  0.747   1.00 121.17 ? 12  G   B "H1'"  1 
ATOM   7737  H  H8     . G   B 2 12  ? -0.489  20.856  0.603   1.00 114.99 ? 12  G   B H8     1 
ATOM   7738  H  H1     . G   B 2 12  ? 3.844   19.756  4.789   1.00 112.61 ? 12  G   B H1     1 
ATOM   7739  H  H21    . G   B 2 12  ? 5.511   21.218  4.579   1.00 95.99  ? 12  G   B H21    1 
ATOM   7740  H  H22    . G   B 2 12  ? 5.500   22.285  3.539   1.00 95.99  ? 12  G   B H22    1 
ATOM   7741  P  P      . U   B 2 13  ? 3.033   20.846  -3.961  1.00 83.85  ? 13  U   B P      1 
ATOM   7742  O  OP1    . U   B 2 13  ? 3.586   21.280  -5.269  1.00 99.05  ? 13  U   B OP1    1 
ATOM   7743  O  OP2    . U   B 2 13  ? 2.048   19.735  -3.911  1.00 96.02  ? 13  U   B OP2    1 
ATOM   7744  O  "O5'"  . U   B 2 13  ? 4.260   20.469  -3.018  1.00 87.02  ? 13  U   B "O5'"  1 
ATOM   7745  C  "C5'"  . U   B 2 13  ? 5.368   21.347  -2.882  1.00 108.41 ? 13  U   B "C5'"  1 
ATOM   7746  C  "C4'"  . U   B 2 13  ? 6.396   20.808  -1.918  1.00 102.11 ? 13  U   B "C4'"  1 
ATOM   7747  O  "O4'"  . U   B 2 13  ? 5.877   20.827  -0.565  1.00 108.92 ? 13  U   B "O4'"  1 
ATOM   7748  C  "C3'"  . U   B 2 13  ? 6.812   19.362  -2.132  1.00 98.57  ? 13  U   B "C3'"  1 
ATOM   7749  O  "O3'"  . U   B 2 13  ? 7.749   19.214  -3.185  1.00 97.95  ? 13  U   B "O3'"  1 
ATOM   7750  C  "C2'"  . U   B 2 13  ? 7.347   18.966  -0.761  1.00 100.42 ? 13  U   B "C2'"  1 
ATOM   7751  O  "O2'"  . U   B 2 13  ? 8.678   19.425  -0.573  1.00 102.47 ? 13  U   B "O2'"  1 
ATOM   7752  C  "C1'"  . U   B 2 13  ? 6.414   19.747  0.171   1.00 92.39  ? 13  U   B "C1'"  1 
ATOM   7753  N  N1     . U   B 2 13  ? 5.297   18.920  0.686   1.00 79.75  ? 13  U   B N1     1 
ATOM   7754  C  C2     . U   B 2 13  ? 5.527   18.158  1.816   1.00 81.37  ? 13  U   B C2     1 
ATOM   7755  O  O2     . U   B 2 13  ? 6.601   18.134  2.392   1.00 80.05  ? 13  U   B O2     1 
ATOM   7756  N  N3     . U   B 2 13  ? 4.452   17.419  2.245   1.00 83.45  ? 13  U   B N3     1 
ATOM   7757  C  C4     . U   B 2 13  ? 3.197   17.365  1.674   1.00 85.88  ? 13  U   B C4     1 
ATOM   7758  O  O4     . U   B 2 13  ? 2.332   16.649  2.183   1.00 82.61  ? 13  U   B O4     1 
ATOM   7759  C  C5     . U   B 2 13  ? 3.032   18.184  0.512   1.00 87.08  ? 13  U   B C5     1 
ATOM   7760  C  C6     . U   B 2 13  ? 4.064   18.914  0.072   1.00 88.64  ? 13  U   B C6     1 
ATOM   7761  H  "H5'"  . U   B 2 13  ? 5.053   22.206  -2.559  1.00 130.10 ? 13  U   B "H5'"  1 
ATOM   7762  H  "H5''" . U   B 2 13  ? 5.783   21.469  -3.750  1.00 130.10 ? 13  U   B "H5''" 1 
ATOM   7763  H  "H4'"  . U   B 2 13  ? 7.186   21.369  -1.958  1.00 122.54 ? 13  U   B "H4'"  1 
ATOM   7764  H  "H3'"  . U   B 2 13  ? 6.025   18.831  -2.331  1.00 118.29 ? 13  U   B "H3'"  1 
ATOM   7765  H  "H2'"  . U   B 2 13  ? 7.274   18.010  -0.614  1.00 120.50 ? 13  U   B "H2'"  1 
ATOM   7766  H  "HO2'" . U   B 2 13  ? 9.190   18.997  -1.084  1.00 122.96 ? 13  U   B "HO2'" 1 
ATOM   7767  H  "H1'"  . U   B 2 13  ? 6.926   20.093  0.918   1.00 110.87 ? 13  U   B "H1'"  1 
ATOM   7768  H  H3     . U   B 2 13  ? 4.575   16.935  2.945   1.00 100.14 ? 13  U   B H3     1 
ATOM   7769  H  H5     . U   B 2 13  ? 2.216   18.207  0.065   1.00 104.49 ? 13  U   B H5     1 
ATOM   7770  H  H6     . U   B 2 13  ? 3.944   19.441  -0.685  1.00 106.37 ? 13  U   B H6     1 
ATOM   7771  P  P      . U   B 2 14  ? 7.553   18.059  -4.286  1.00 89.98  ? 14  U   B P      1 
ATOM   7772  O  OP1    . U   B 2 14  ? 8.663   18.170  -5.266  1.00 83.08  ? 14  U   B OP1    1 
ATOM   7773  O  OP2    . U   B 2 14  ? 6.149   18.109  -4.767  1.00 86.86  ? 14  U   B OP2    1 
ATOM   7774  O  "O5'"  . U   B 2 14  ? 7.741   16.709  -3.463  1.00 95.16  ? 14  U   B "O5'"  1 
ATOM   7775  C  "C5'"  . U   B 2 14  ? 8.974   16.430  -2.817  1.00 94.80  ? 14  U   B "C5'"  1 
ATOM   7776  C  "C4'"  . U   B 2 14  ? 8.882   15.244  -1.890  1.00 93.68  ? 14  U   B "C4'"  1 
ATOM   7777  O  "O4'"  . U   B 2 14  ? 7.987   15.537  -0.787  1.00 70.44  ? 14  U   B "O4'"  1 
ATOM   7778  C  "C3'"  . U   B 2 14  ? 8.328   13.954  -2.478  1.00 89.41  ? 14  U   B "C3'"  1 
ATOM   7779  O  "O3'"  . U   B 2 14  ? 9.290   13.253  -3.255  1.00 79.35  ? 14  U   B "O3'"  1 
ATOM   7780  C  "C2'"  . U   B 2 14  ? 7.869   13.201  -1.233  1.00 98.37  ? 14  U   B "C2'"  1 
ATOM   7781  O  "O2'"  . U   B 2 14  ? 8.959   12.555  -0.590  1.00 98.78  ? 14  U   B "O2'"  1 
ATOM   7782  C  "C1'"  . U   B 2 14  ? 7.367   14.347  -0.345  1.00 84.59  ? 14  U   B "C1'"  1 
ATOM   7783  N  N1     . U   B 2 14  ? 5.896   14.517  -0.410  1.00 92.13  ? 14  U   B N1     1 
ATOM   7784  C  C2     . U   B 2 14  ? 5.123   13.836  0.515   1.00 97.51  ? 14  U   B C2     1 
ATOM   7785  O  O2     . U   B 2 14  ? 5.596   13.109  1.373   1.00 91.96  ? 14  U   B O2     1 
ATOM   7786  N  N3     . U   B 2 14  ? 3.768   14.040  0.402   1.00 102.16 ? 14  U   B N3     1 
ATOM   7787  C  C4     . U   B 2 14  ? 3.118   14.834  -0.521  1.00 109.91 ? 14  U   B C4     1 
ATOM   7788  O  O4     . U   B 2 14  ? 1.886   14.914  -0.493  1.00 105.68 ? 14  U   B O4     1 
ATOM   7789  C  C5     . U   B 2 14  ? 3.984   15.506  -1.444  1.00 109.06 ? 14  U   B C5     1 
ATOM   7790  C  C6     . U   B 2 14  ? 5.309   15.326  -1.356  1.00 94.13  ? 14  U   B C6     1 
ATOM   7791  H  "H5'"  . U   B 2 14  ? 9.243   17.209  -2.305  1.00 113.76 ? 14  U   B "H5'"  1 
ATOM   7792  H  "H5''" . U   B 2 14  ? 9.647   16.250  -3.492  1.00 113.76 ? 14  U   B "H5''" 1 
ATOM   7793  H  "H4'"  . U   B 2 14  ? 9.765   15.065  -1.531  1.00 112.42 ? 14  U   B "H4'"  1 
ATOM   7794  H  "H3'"  . U   B 2 14  ? 7.558   14.160  -3.030  1.00 107.29 ? 14  U   B "H3'"  1 
ATOM   7795  H  "H2'"  . U   B 2 14  ? 7.156   12.577  -1.441  1.00 118.04 ? 14  U   B "H2'"  1 
ATOM   7796  H  "HO2'" . U   B 2 14  ? 9.106   12.933  0.146   1.00 118.53 ? 14  U   B "HO2'" 1 
ATOM   7797  H  "H1'"  . U   B 2 14  ? 7.627   14.175  0.574   1.00 101.51 ? 14  U   B "H1'"  1 
ATOM   7798  H  H3     . U   B 2 14  ? 3.271   13.625  0.968   1.00 122.59 ? 14  U   B H3     1 
ATOM   7799  H  H5     . U   B 2 14  ? 3.630   16.062  -2.099  1.00 130.87 ? 14  U   B H5     1 
ATOM   7800  H  H6     . U   B 2 14  ? 5.858   15.769  -1.962  1.00 112.96 ? 14  U   B H6     1 
ATOM   7801  P  P      . C   B 2 15  ? 8.870   12.469  -4.598  1.00 88.41  ? 15  C   B P      1 
ATOM   7802  O  OP1    . C   B 2 15  ? 10.118  12.177  -5.348  1.00 73.67  ? 15  C   B OP1    1 
ATOM   7803  O  OP2    . C   B 2 15  ? 7.786   13.219  -5.285  1.00 75.87  ? 15  C   B OP2    1 
ATOM   7804  O  "O5'"  . C   B 2 15  ? 8.273   11.086  -4.072  1.00 84.80  ? 15  C   B "O5'"  1 
ATOM   7805  C  "C5'"  . C   B 2 15  ? 7.548   10.226  -4.940  1.00 77.68  ? 15  C   B "C5'"  1 
ATOM   7806  C  "C4'"  . C   B 2 15  ? 7.077   8.971   -4.240  1.00 78.61  ? 15  C   B "C4'"  1 
ATOM   7807  O  "O4'"  . C   B 2 15  ? 8.211   8.190   -3.778  1.00 77.97  ? 15  C   B "O4'"  1 
ATOM   7808  C  "C3'"  . C   B 2 15  ? 6.235   9.165   -2.990  1.00 92.89  ? 15  C   B "C3'"  1 
ATOM   7809  O  "O3'"  . C   B 2 15  ? 4.880   9.470   -3.272  1.00 98.82  ? 15  C   B "O3'"  1 
ATOM   7810  C  "C2'"  . C   B 2 15  ? 6.408   7.832   -2.265  1.00 87.31  ? 15  C   B "C2'"  1 
ATOM   7811  O  "O2'"  . C   B 2 15  ? 5.539   6.842   -2.798  1.00 91.69  ? 15  C   B "O2'"  1 
ATOM   7812  C  "C1'"  . C   B 2 15  ? 7.852   7.463   -2.619  1.00 76.99  ? 15  C   B "C1'"  1 
ATOM   7813  N  N1     . C   B 2 15  ? 8.803   7.756   -1.515  1.00 83.82  ? 15  C   B N1     1 
ATOM   7814  C  C2     . C   B 2 15  ? 8.784   6.923   -0.383  1.00 75.80  ? 15  C   B C2     1 
ATOM   7815  O  O2     . C   B 2 15  ? 7.983   5.979   -0.339  1.00 68.46  ? 15  C   B O2     1 
ATOM   7816  N  N3     . C   B 2 15  ? 9.637   7.159   0.642   1.00 73.27  ? 15  C   B N3     1 
ATOM   7817  C  C4     . C   B 2 15  ? 10.492  8.178   0.577   1.00 60.88  ? 15  C   B C4     1 
ATOM   7818  N  N4     . C   B 2 15  ? 11.312  8.369   1.615   1.00 59.84  ? 15  C   B N4     1 
ATOM   7819  C  C5     . C   B 2 15  ? 10.538  9.044   -0.556  1.00 60.10  ? 15  C   B C5     1 
ATOM   7820  C  C6     . C   B 2 15  ? 9.688   8.800   -1.568  1.00 70.63  ? 15  C   B C6     1 
ATOM   7821  H  "H5'"  . C   B 2 15  ? 8.119   9.976   -5.684  1.00 93.22  ? 15  C   B "H5'"  1 
ATOM   7822  H  "H5''" . C   B 2 15  ? 6.776   10.703  -5.283  1.00 93.22  ? 15  C   B "H5''" 1 
ATOM   7823  H  "H4'"  . C   B 2 15  ? 6.571   8.437   -4.873  1.00 94.33  ? 15  C   B "H4'"  1 
ATOM   7824  H  "H3'"  . C   B 2 15  ? 6.619   9.875   -2.452  1.00 111.47 ? 15  C   B "H3'"  1 
ATOM   7825  H  "H2'"  . C   B 2 15  ? 6.293   7.931   -1.307  1.00 104.77 ? 15  C   B "H2'"  1 
ATOM   7826  H  "HO2'" . C   B 2 15  ? 4.746   7.042   -2.606  1.00 110.03 ? 15  C   B "HO2'" 1 
ATOM   7827  H  "H1'"  . C   B 2 15  ? 7.891   6.515   -2.820  1.00 92.39  ? 15  C   B "H1'"  1 
ATOM   7828  H  H41    . C   B 2 15  ? 11.876  9.018   1.604   1.00 71.81  ? 15  C   B H41    1 
ATOM   7829  H  H42    . C   B 2 15  ? 11.276  7.842   2.294   1.00 71.81  ? 15  C   B H42    1 
ATOM   7830  H  H5     . C   B 2 15  ? 11.138  9.753   -0.594  1.00 72.12  ? 15  C   B H5     1 
ATOM   7831  H  H6     . C   B 2 15  ? 9.700   9.351   -2.317  1.00 84.76  ? 15  C   B H6     1 
ATOM   7832  P  P      . G   B 2 16  ? 4.118   10.619  -2.443  1.00 89.41  ? 16  G   B P      1 
ATOM   7833  O  OP1    . G   B 2 16  ? 2.703   10.627  -2.892  1.00 93.65  ? 16  G   B OP1    1 
ATOM   7834  O  OP2    . G   B 2 16  ? 4.912   11.869  -2.549  1.00 76.50  ? 16  G   B OP2    1 
ATOM   7835  O  "O5'"  . G   B 2 16  ? 4.154   10.112  -0.929  1.00 86.33  ? 16  G   B "O5'"  1 
ATOM   7836  C  "C5'"  . G   B 2 16  ? 3.415   8.970   -0.516  1.00 79.74  ? 16  G   B "C5'"  1 
ATOM   7837  C  "C4'"  . G   B 2 16  ? 3.760   8.544   0.894   1.00 83.02  ? 16  G   B "C4'"  1 
ATOM   7838  O  "O4'"  . G   B 2 16  ? 5.164   8.193   1.004   1.00 84.36  ? 16  G   B "O4'"  1 
ATOM   7839  C  "C3'"  . G   B 2 16  ? 3.559   9.590   1.975   1.00 104.06 ? 16  G   B "C3'"  1 
ATOM   7840  O  "O3'"  . G   B 2 16  ? 2.200   9.707   2.361   1.00 110.88 ? 16  G   B "O3'"  1 
ATOM   7841  C  "C2'"  . G   B 2 16  ? 4.460   9.078   3.099   1.00 112.21 ? 16  G   B "C2'"  1 
ATOM   7842  O  "O2'"  . G   B 2 16  ? 3.816   8.066   3.861   1.00 98.53  ? 16  G   B "O2'"  1 
ATOM   7843  C  "C1'"  . G   B 2 16  ? 5.621   8.451   2.317   1.00 92.42  ? 16  G   B "C1'"  1 
ATOM   7844  N  N9     . G   B 2 16  ? 6.821   9.314   2.281   1.00 97.79  ? 16  G   B N9     1 
ATOM   7845  C  C8     . G   B 2 16  ? 7.203   10.208  1.309   1.00 91.07  ? 16  G   B C8     1 
ATOM   7846  N  N7     . G   B 2 16  ? 8.319   10.828  1.591   1.00 77.35  ? 16  G   B N7     1 
ATOM   7847  C  C5     . G   B 2 16  ? 8.698   10.322  2.828   1.00 90.55  ? 16  G   B C5     1 
ATOM   7848  C  C6     . G   B 2 16  ? 9.825   10.616  3.644   1.00 90.02  ? 16  G   B C6     1 
ATOM   7849  O  O6     . G   B 2 16  ? 10.749  11.410  3.430   1.00 106.05 ? 16  G   B O6     1 
ATOM   7850  N  N1     . G   B 2 16  ? 9.820   9.875   4.820   1.00 84.13  ? 16  G   B N1     1 
ATOM   7851  C  C2     . G   B 2 16  ? 8.855   8.965   5.171   1.00 106.73 ? 16  G   B C2     1 
ATOM   7852  N  N2     . G   B 2 16  ? 9.028   8.349   6.350   1.00 114.17 ? 16  G   B N2     1 
ATOM   7853  N  N3     . G   B 2 16  ? 7.800   8.680   4.422   1.00 105.90 ? 16  G   B N3     1 
ATOM   7854  C  C4     . G   B 2 16  ? 7.778   9.395   3.273   1.00 99.79  ? 16  G   B C4     1 
ATOM   7855  H  "H5'"  . G   B 2 16  ? 3.606   8.236   -1.122  1.00 95.68  ? 16  G   B "H5'"  1 
ATOM   7856  H  "H5''" . G   B 2 16  ? 2.468   9.176   -0.559  1.00 95.68  ? 16  G   B "H5''" 1 
ATOM   7857  H  "H4'"  . G   B 2 16  ? 3.229   7.764   1.118   1.00 99.62  ? 16  G   B "H4'"  1 
ATOM   7858  H  "H3'"  . G   B 2 16  ? 3.885   10.449  1.662   1.00 124.87 ? 16  G   B "H3'"  1 
ATOM   7859  H  "H2'"  . G   B 2 16  ? 4.768   9.805   3.663   1.00 134.65 ? 16  G   B "H2'"  1 
ATOM   7860  H  "HO2'" . G   B 2 16  ? 2.993   8.079   3.693   1.00 118.24 ? 16  G   B "HO2'" 1 
ATOM   7861  H  "H1'"  . G   B 2 16  ? 5.857   7.608   2.735   1.00 110.90 ? 16  G   B "H1'"  1 
ATOM   7862  H  H8     . G   B 2 16  ? 6.720   10.352  0.528   1.00 109.28 ? 16  G   B H8     1 
ATOM   7863  H  H1     . G   B 2 16  ? 10.471  9.996   5.369   1.00 100.96 ? 16  G   B H1     1 
ATOM   7864  H  H21    . G   B 2 16  ? 9.713   8.535   6.836   1.00 137.00 ? 16  G   B H21    1 
ATOM   7865  H  H22    . G   B 2 16  ? 8.453   7.769   6.621   1.00 137.00 ? 16  G   B H22    1 
ATOM   7866  P  P      . A   B 2 17  ? 1.577   11.136  2.753   1.00 108.75 ? 17  A   B P      1 
ATOM   7867  O  OP1    . A   B 2 17  ? 0.112   10.948  2.900   1.00 116.87 ? 17  A   B OP1    1 
ATOM   7868  O  OP2    . A   B 2 17  ? 2.088   12.160  1.806   1.00 109.70 ? 17  A   B OP2    1 
ATOM   7869  O  "O5'"  . A   B 2 17  ? 2.165   11.459  4.195   1.00 114.68 ? 17  A   B "O5'"  1 
ATOM   7870  C  "C5'"  . A   B 2 17  ? 1.928   10.609  5.310   1.00 125.29 ? 17  A   B "C5'"  1 
ATOM   7871  C  "C4'"  . A   B 2 17  ? 2.175   11.350  6.599   1.00 132.86 ? 17  A   B "C4'"  1 
ATOM   7872  O  "O4'"  . A   B 2 17  ? 3.481   11.979  6.522   1.00 141.77 ? 17  A   B "O4'"  1 
ATOM   7873  C  "C3'"  . A   B 2 17  ? 1.162   12.456  6.895   1.00 141.71 ? 17  A   B "C3'"  1 
ATOM   7874  O  "O3'"  . A   B 2 17  ? 0.761   12.390  8.264   1.00 140.51 ? 17  A   B "O3'"  1 
ATOM   7875  C  "C2'"  . A   B 2 17  ? 1.931   13.755  6.646   1.00 149.07 ? 17  A   B "C2'"  1 
ATOM   7876  O  "O2'"  . A   B 2 17  ? 1.550   14.832  7.475   1.00 148.67 ? 17  A   B "O2'"  1 
ATOM   7877  C  "C1'"  . A   B 2 17  ? 3.391   13.346  6.866   1.00 145.33 ? 17  A   B "C1'"  1 
ATOM   7878  N  N9     . A   B 2 17  ? 4.363   14.097  6.061   1.00 140.19 ? 17  A   B N9     1 
ATOM   7879  C  C8     . A   B 2 17  ? 4.257   14.495  4.749   1.00 121.67 ? 17  A   B C8     1 
ATOM   7880  N  N7     . A   B 2 17  ? 5.293   15.169  4.312   1.00 115.88 ? 17  A   B N7     1 
ATOM   7881  C  C5     . A   B 2 17  ? 6.141   15.229  5.409   1.00 129.13 ? 17  A   B C5     1 
ATOM   7882  C  C6     . A   B 2 17  ? 7.409   15.810  5.593   1.00 120.83 ? 17  A   B C6     1 
ATOM   7883  N  N6     . A   B 2 17  ? 8.063   16.466  4.632   1.00 112.07 ? 17  A   B N6     1 
ATOM   7884  N  N1     . A   B 2 17  ? 7.988   15.693  6.810   1.00 115.12 ? 17  A   B N1     1 
ATOM   7885  C  C2     . A   B 2 17  ? 7.327   15.035  7.770   1.00 107.65 ? 17  A   B C2     1 
ATOM   7886  N  N3     . A   B 2 17  ? 6.133   14.446  7.717   1.00 123.28 ? 17  A   B N3     1 
ATOM   7887  C  C4     . A   B 2 17  ? 5.579   14.583  6.496   1.00 137.73 ? 17  A   B C4     1 
ATOM   7888  H  "H5'"  . A   B 2 17  ? 2.522   9.844   5.261   1.00 150.35 ? 17  A   B "H5'"  1 
ATOM   7889  H  "H5''" . A   B 2 17  ? 1.008   10.302  5.288   1.00 150.35 ? 17  A   B "H5''" 1 
ATOM   7890  H  "H4'"  . A   B 2 17  ? 2.173   10.715  7.332   1.00 159.44 ? 17  A   B "H4'"  1 
ATOM   7891  H  "H3'"  . A   B 2 17  ? 0.395   12.390  6.305   1.00 170.06 ? 17  A   B "H3'"  1 
ATOM   7892  H  "H2'"  . A   B 2 17  ? 1.814   14.017  5.719   1.00 178.89 ? 17  A   B "H2'"  1 
ATOM   7893  H  "HO2'" . A   B 2 17  ? 2.206   15.058  7.949   1.00 178.40 ? 17  A   B "HO2'" 1 
ATOM   7894  H  "H1'"  . A   B 2 17  ? 3.610   13.451  7.805   1.00 174.39 ? 17  A   B "H1'"  1 
ATOM   7895  H  H8     . A   B 2 17  ? 3.519   14.299  4.218   1.00 146.01 ? 17  A   B H8     1 
ATOM   7896  H  H61    . A   B 2 17  ? 8.837   16.805  4.793   1.00 134.49 ? 17  A   B H61    1 
ATOM   7897  H  H62    . A   B 2 17  ? 7.710   16.549  3.852   1.00 134.49 ? 17  A   B H62    1 
ATOM   7898  H  H2     . A   B 2 17  ? 7.763   14.980  8.590   1.00 129.18 ? 17  A   B H2     1 
ATOM   7899  P  P      . G   B 2 18  ? -0.595  11.635  8.682   1.00 172.71 ? 18  G   B P      1 
ATOM   7900  O  OP1    . G   B 2 18  ? -0.288  10.189  8.827   1.00 151.37 ? 18  G   B OP1    1 
ATOM   7901  O  OP2    . G   B 2 18  ? -1.673  12.076  7.761   1.00 174.57 ? 18  G   B OP2    1 
ATOM   7902  O  "O5'"  . G   B 2 18  ? -0.928  12.218  10.127  1.00 163.64 ? 18  G   B "O5'"  1 
ATOM   7903  C  "C5'"  . G   B 2 18  ? -1.350  13.564  10.296  1.00 156.26 ? 18  G   B "C5'"  1 
ATOM   7904  C  "C4'"  . G   B 2 18  ? -1.150  14.027  11.716  1.00 167.53 ? 18  G   B "C4'"  1 
ATOM   7905  O  "O4'"  . G   B 2 18  ? -1.292  12.894  12.615  1.00 169.77 ? 18  G   B "O4'"  1 
ATOM   7906  C  "C3'"  . G   B 2 18  ? 0.224   14.594  12.048  1.00 190.11 ? 18  G   B "C3'"  1 
ATOM   7907  O  "O3'"  . G   B 2 18  ? 0.369   15.958  11.680  1.00 197.55 ? 18  G   B "O3'"  1 
ATOM   7908  C  "C2'"  . G   B 2 18  ? 0.327   14.359  13.549  1.00 198.49 ? 18  G   B "C2'"  1 
ATOM   7909  O  "O2'"  . G   B 2 18  ? -0.385  15.351  14.275  1.00 213.06 ? 18  G   B "O2'"  1 
ATOM   7910  C  "C1'"  . G   B 2 18  ? -0.397  13.021  13.700  1.00 189.49 ? 18  G   B "C1'"  1 
ATOM   7911  N  N9     . G   B 2 18  ? 0.536   11.875  13.685  1.00 198.79 ? 18  G   B N9     1 
ATOM   7912  C  C8     . G   B 2 18  ? 0.652   10.914  12.709  1.00 193.29 ? 18  G   B C8     1 
ATOM   7913  N  N7     . G   B 2 18  ? 1.568   10.021  12.970  1.00 190.39 ? 18  G   B N7     1 
ATOM   7914  C  C5     . G   B 2 18  ? 2.092   10.411  14.196  1.00 194.78 ? 18  G   B C5     1 
ATOM   7915  C  C6     . G   B 2 18  ? 3.118   9.828   14.987  1.00 174.07 ? 18  G   B C6     1 
ATOM   7916  O  O6     . G   B 2 18  ? 3.791   8.816   14.754  1.00 148.70 ? 18  G   B O6     1 
ATOM   7917  N  N1     . G   B 2 18  ? 3.333   10.548  16.158  1.00 163.56 ? 18  G   B N1     1 
ATOM   7918  C  C2     . G   B 2 18  ? 2.650   11.683  16.522  1.00 171.39 ? 18  G   B C2     1 
ATOM   7919  N  N2     . G   B 2 18  ? 2.998   12.240  17.692  1.00 170.34 ? 18  G   B N2     1 
ATOM   7920  N  N3     . G   B 2 18  ? 1.692   12.235  15.794  1.00 186.00 ? 18  G   B N3     1 
ATOM   7921  C  C4     . G   B 2 18  ? 1.465   11.553  14.651  1.00 197.91 ? 18  G   B C4     1 
ATOM   7922  H  "H5'"  . G   B 2 18  ? -2.290  13.633  10.068  1.00 187.51 ? 18  G   B "H5'"  1 
ATOM   7923  H  "H5''" . G   B 2 18  ? -0.837  14.134  9.701   1.00 187.51 ? 18  G   B "H5''" 1 
ATOM   7924  H  "H4'"  . G   B 2 18  ? -1.826  14.689  11.932  1.00 201.04 ? 18  G   B "H4'"  1 
ATOM   7925  H  "H3'"  . G   B 2 18  ? 0.903   14.069  11.596  1.00 228.13 ? 18  G   B "H3'"  1 
ATOM   7926  H  "H2'"  . G   B 2 18  ? 1.251   14.296  13.837  1.00 238.19 ? 18  G   B "H2'"  1 
ATOM   7927  H  "HO2'" . G   B 2 18  ? -0.526  16.009  13.772  1.00 255.68 ? 18  G   B "HO2'" 1 
ATOM   7928  H  "H1'"  . G   B 2 18  ? -0.897  13.017  14.531  1.00 227.39 ? 18  G   B "H1'"  1 
ATOM   7929  H  H8     . G   B 2 18  ? 0.131   10.902  11.938  1.00 231.95 ? 18  G   B H8     1 
ATOM   7930  H  H1     . G   B 2 18  ? 3.940   10.261  16.695  1.00 196.28 ? 18  G   B H1     1 
ATOM   7931  H  H21    . G   B 2 18  ? 3.620   11.885  18.169  1.00 204.41 ? 18  G   B H21    1 
ATOM   7932  H  H22    . G   B 2 18  ? 2.600   12.951  17.965  1.00 204.41 ? 18  G   B H22    1 
ATOM   7933  P  P      . U   B 2 19  ? 1.564   16.425  10.708  1.00 171.47 ? 19  U   B P      1 
ATOM   7934  O  OP1    . U   B 2 19  ? 1.471   17.899  10.545  1.00 139.26 ? 19  U   B OP1    1 
ATOM   7935  O  OP2    . U   B 2 19  ? 1.538   15.561  9.504   1.00 165.01 ? 19  U   B OP2    1 
ATOM   7936  O  "O5'"  . U   B 2 19  ? 2.896   16.095  11.522  1.00 178.75 ? 19  U   B "O5'"  1 
ATOM   7937  C  "C5'"  . U   B 2 19  ? 3.244   16.830  12.693  1.00 176.63 ? 19  U   B "C5'"  1 
ATOM   7938  C  "C4'"  . U   B 2 19  ? 4.649   16.525  13.160  1.00 166.10 ? 19  U   B "C4'"  1 
ATOM   7939  O  "O4'"  . U   B 2 19  ? 4.743   15.115  13.505  1.00 163.74 ? 19  U   B "O4'"  1 
ATOM   7940  C  "C3'"  . U   B 2 19  ? 5.755   16.790  12.139  1.00 151.03 ? 19  U   B "C3'"  1 
ATOM   7941  O  "O3'"  . U   B 2 19  ? 6.927   17.268  12.801  1.00 132.98 ? 19  U   B "O3'"  1 
ATOM   7942  C  "C2'"  . U   B 2 19  ? 6.016   15.406  11.552  1.00 148.62 ? 19  U   B "C2'"  1 
ATOM   7943  O  "O2'"  . U   B 2 19  ? 7.307   15.233  11.006  1.00 138.99 ? 19  U   B "O2'"  1 
ATOM   7944  C  "C1'"  . U   B 2 19  ? 5.788   14.510  12.767  1.00 158.41 ? 19  U   B "C1'"  1 
ATOM   7945  N  N1     . U   B 2 19  ? 5.375   13.135  12.438  1.00 170.10 ? 19  U   B N1     1 
ATOM   7946  C  C2     . U   B 2 19  ? 6.212   12.080  12.762  1.00 174.87 ? 19  U   B C2     1 
ATOM   7947  O  O2     . U   B 2 19  ? 7.295   12.218  13.307  1.00 165.00 ? 19  U   B O2     1 
ATOM   7948  N  N3     . U   B 2 19  ? 5.733   10.839  12.419  1.00 179.77 ? 19  U   B N3     1 
ATOM   7949  C  C4     . U   B 2 19  ? 4.534   10.546  11.803  1.00 171.35 ? 19  U   B C4     1 
ATOM   7950  O  O4     . U   B 2 19  ? 4.247   9.372   11.561  1.00 163.80 ? 19  U   B O4     1 
ATOM   7951  C  C5     . U   B 2 19  ? 3.724   11.686  11.501  1.00 166.37 ? 19  U   B C5     1 
ATOM   7952  C  C6     . U   B 2 19  ? 4.165   12.906  11.825  1.00 168.58 ? 19  U   B C6     1 
ATOM   7953  H  "H5'"  . U   B 2 19  ? 2.621   16.607  13.401  1.00 211.95 ? 19  U   B "H5'"  1 
ATOM   7954  H  "H5''" . U   B 2 19  ? 3.175   17.779  12.501  1.00 211.95 ? 19  U   B "H5''" 1 
ATOM   7955  H  "H4'"  . U   B 2 19  ? 4.831   17.051  13.955  1.00 199.33 ? 19  U   B "H4'"  1 
ATOM   7956  H  "H3'"  . U   B 2 19  ? 5.459   17.410  11.455  1.00 181.23 ? 19  U   B "H3'"  1 
ATOM   7957  H  "H2'"  . U   B 2 19  ? 5.349   15.210  10.876  1.00 178.34 ? 19  U   B "H2'"  1 
ATOM   7958  H  "HO2'" . U   B 2 19  ? 7.721   14.659  11.459  1.00 166.79 ? 19  U   B "HO2'" 1 
ATOM   7959  H  "H1'"  . U   B 2 19  ? 6.593   14.486  13.308  1.00 190.10 ? 19  U   B "H1'"  1 
ATOM   7960  H  H3     . U   B 2 19  ? 6.238   10.169  12.609  1.00 215.72 ? 19  U   B H3     1 
ATOM   7961  H  H5     . U   B 2 19  ? 2.899   11.580  11.086  1.00 199.65 ? 19  U   B H5     1 
ATOM   7962  H  H6     . U   B 2 19  ? 3.628   13.638  11.624  1.00 202.30 ? 19  U   B H6     1 
ATOM   7963  P  P      . C   B 2 20  ? 7.083   18.831  13.146  1.00 121.60 ? 20  C   B P      1 
ATOM   7964  O  OP1    . C   B 2 20  ? 8.169   18.970  14.149  1.00 111.16 ? 20  C   B OP1    1 
ATOM   7965  O  OP2    . C   B 2 20  ? 5.740   19.388  13.448  1.00 111.49 ? 20  C   B OP2    1 
ATOM   7966  O  "O5'"  . C   B 2 20  ? 7.583   19.482  11.781  1.00 107.41 ? 20  C   B "O5'"  1 
ATOM   7967  C  "C5'"  . C   B 2 20  ? 8.950   19.815  11.591  1.00 98.55  ? 20  C   B "C5'"  1 
ATOM   7968  C  "C4'"  . C   B 2 20  ? 9.212   20.324  10.194  1.00 92.67  ? 20  C   B "C4'"  1 
ATOM   7969  O  "O4'"  . C   B 2 20  ? 8.866   19.314  9.213   1.00 107.69 ? 20  C   B "O4'"  1 
ATOM   7970  C  "C3'"  . C   B 2 20  ? 8.405   21.540  9.770   1.00 90.64  ? 20  C   B "C3'"  1 
ATOM   7971  O  "O3'"  . C   B 2 20  ? 8.925   22.750  10.297  1.00 82.81  ? 20  C   B "O3'"  1 
ATOM   7972  C  "C2'"  . C   B 2 20  ? 8.451   21.452  8.248   1.00 89.25  ? 20  C   B "C2'"  1 
ATOM   7973  O  "O2'"  . C   B 2 20  ? 9.667   21.972  7.729   1.00 46.95  ? 20  C   B "O2'"  1 
ATOM   7974  C  "C1'"  . C   B 2 20  ? 8.418   19.935  8.025   1.00 110.60 ? 20  C   B "C1'"  1 
ATOM   7975  N  N1     . C   B 2 20  ? 7.056   19.443  7.714   1.00 116.51 ? 20  C   B N1     1 
ATOM   7976  C  C2     . C   B 2 20  ? 6.602   19.512  6.393   1.00 110.87 ? 20  C   B C2     1 
ATOM   7977  O  O2     . C   B 2 20  ? 7.351   19.984  5.522   1.00 97.67  ? 20  C   B O2     1 
ATOM   7978  N  N3     . C   B 2 20  ? 5.358   19.066  6.099   1.00 113.58 ? 20  C   B N3     1 
ATOM   7979  C  C4     . C   B 2 20  ? 4.581   18.566  7.061   1.00 104.75 ? 20  C   B C4     1 
ATOM   7980  N  N4     . C   B 2 20  ? 3.363   18.138  6.724   1.00 106.15 ? 20  C   B N4     1 
ATOM   7981  C  C5     . C   B 2 20  ? 5.019   18.483  8.414   1.00 104.74 ? 20  C   B C5     1 
ATOM   7982  C  C6     . C   B 2 20  ? 6.251   18.928  8.693   1.00 110.13 ? 20  C   B C6     1 
ATOM   7983  H  "H5'"  . C   B 2 20  ? 9.492   19.025  11.746  1.00 118.27 ? 20  C   B "H5'"  1 
ATOM   7984  H  "H5''" . C   B 2 20  ? 9.200   20.501  12.229  1.00 118.27 ? 20  C   B "H5''" 1 
ATOM   7985  H  "H4'"  . C   B 2 20  ? 10.156  20.530  10.110  1.00 111.21 ? 20  C   B "H4'"  1 
ATOM   7986  H  "H3'"  . C   B 2 20  ? 7.488   21.433  10.068  1.00 108.77 ? 20  C   B "H3'"  1 
ATOM   7987  H  "H2'"  . C   B 2 20  ? 7.680   21.882  7.847   1.00 107.10 ? 20  C   B "H2'"  1 
ATOM   7988  H  "HO2'" . C   B 2 20  ? 9.684   22.803  7.852   1.00 56.34  ? 20  C   B "HO2'" 1 
ATOM   7989  H  "H1'"  . C   B 2 20  ? 9.016   19.705  7.298   1.00 132.72 ? 20  C   B "H1'"  1 
ATOM   7990  H  H41    . C   B 2 20  ? 2.841   17.811  7.325   1.00 127.38 ? 20  C   B H41    1 
ATOM   7991  H  H42    . C   B 2 20  ? 3.100   18.188  5.907   1.00 127.38 ? 20  C   B H42    1 
ATOM   7992  H  H5     . C   B 2 20  ? 4.470   18.133  9.078   1.00 125.68 ? 20  C   B H5     1 
ATOM   7993  H  H6     . C   B 2 20  ? 6.564   18.887  9.567   1.00 132.16 ? 20  C   B H6     1 
ATOM   7994  P  P      . C   B 2 21  ? 7.943   23.958  10.700  1.00 68.96  ? 21  C   B P      1 
ATOM   7995  O  OP1    . C   B 2 21  ? 8.762   25.018  11.339  1.00 68.46  ? 21  C   B OP1    1 
ATOM   7996  O  OP2    . C   B 2 21  ? 6.773   23.400  11.427  1.00 87.66  ? 21  C   B OP2    1 
ATOM   7997  O  "O5'"  . C   B 2 21  ? 7.434   24.539  9.310   1.00 76.13  ? 21  C   B "O5'"  1 
ATOM   7998  C  "C5'"  . C   B 2 21  ? 8.304   25.288  8.477   1.00 65.94  ? 21  C   B "C5'"  1 
ATOM   7999  C  "C4'"  . C   B 2 21  ? 7.607   25.730  7.219   1.00 65.65  ? 21  C   B "C4'"  1 
ATOM   8000  O  "O4'"  . C   B 2 21  ? 7.161   24.572  6.465   1.00 78.07  ? 21  C   B "O4'"  1 
ATOM   8001  C  "C3'"  . C   B 2 21  ? 6.336   26.534  7.429   1.00 78.95  ? 21  C   B "C3'"  1 
ATOM   8002  O  "O3'"  . C   B 2 21  ? 6.563   27.892  7.760   1.00 77.02  ? 21  C   B "O3'"  1 
ATOM   8003  C  "C2'"  . C   B 2 21  ? 5.604   26.324  6.112   1.00 80.14  ? 21  C   B "C2'"  1 
ATOM   8004  O  "O2'"  . C   B 2 21  ? 6.160   27.124  5.078   1.00 74.11  ? 21  C   B "O2'"  1 
ATOM   8005  C  "C1'"  . C   B 2 21  ? 5.936   24.863  5.824   1.00 76.23  ? 21  C   B "C1'"  1 
ATOM   8006  N  N1     . C   B 2 21  ? 4.894   23.959  6.360   1.00 83.77  ? 21  C   B N1     1 
ATOM   8007  C  C2     . C   B 2 21  ? 3.727   23.784  5.615   1.00 86.94  ? 21  C   B C2     1 
ATOM   8008  O  O2     . C   B 2 21  ? 3.613   24.383  4.534   1.00 87.99  ? 21  C   B O2     1 
ATOM   8009  N  N3     . C   B 2 21  ? 2.757   22.966  6.088   1.00 89.69  ? 21  C   B N3     1 
ATOM   8010  C  C4     . C   B 2 21  ? 2.919   22.340  7.255   1.00 79.06  ? 21  C   B C4     1 
ATOM   8011  N  N4     . C   B 2 21  ? 1.936   21.543  7.681   1.00 80.12  ? 21  C   B N4     1 
ATOM   8012  C  C5     . C   B 2 21  ? 4.096   22.505  8.038   1.00 71.97  ? 21  C   B C5     1 
ATOM   8013  C  C6     . C   B 2 21  ? 5.048   23.317  7.559   1.00 78.00  ? 21  C   B C6     1 
ATOM   8014  H  "H5'"  . C   B 2 21  ? 9.068   24.739  8.240   1.00 79.13  ? 21  C   B "H5'"  1 
ATOM   8015  H  "H5''" . C   B 2 21  ? 8.613   26.070  8.961   1.00 79.13  ? 21  C   B "H5''" 1 
ATOM   8016  H  "H4'"  . C   B 2 21  ? 8.224   26.245  6.676   1.00 78.78  ? 21  C   B "H4'"  1 
ATOM   8017  H  "H3'"  . C   B 2 21  ? 5.821   26.123  8.141   1.00 94.74  ? 21  C   B "H3'"  1 
ATOM   8018  H  "H2'"  . C   B 2 21  ? 4.648   26.463  6.205   1.00 96.17  ? 21  C   B "H2'"  1 
ATOM   8019  H  "HO2'" . C   B 2 21  ? 5.981   27.931  5.230   1.00 88.94  ? 21  C   B "HO2'" 1 
ATOM   8020  H  "H1'"  . C   B 2 21  ? 6.027   24.729  4.868   1.00 91.47  ? 21  C   B "H1'"  1 
ATOM   8021  H  H41    . C   B 2 21  ? 2.013   21.127  8.430   1.00 96.15  ? 21  C   B H41    1 
ATOM   8022  H  H42    . C   B 2 21  ? 1.225   21.446  7.206   1.00 96.15  ? 21  C   B H42    1 
ATOM   8023  H  H5     . C   B 2 21  ? 4.202   22.064  8.850   1.00 86.36  ? 21  C   B H5     1 
ATOM   8024  H  H6     . C   B 2 21  ? 5.829   23.443  8.047   1.00 93.60  ? 21  C   B H6     1 
ATOM   8025  P  P      . U   B 2 22  ? 5.452   28.697  8.598   1.00 72.76  ? 22  U   B P      1 
ATOM   8026  O  OP1    . U   B 2 22  ? 5.926   30.100  8.725   1.00 59.53  ? 22  U   B OP1    1 
ATOM   8027  O  OP2    . U   B 2 22  ? 5.120   27.908  9.813   1.00 42.24  ? 22  U   B OP2    1 
ATOM   8028  O  "O5'"  . U   B 2 22  ? 4.166   28.663  7.660   1.00 74.13  ? 22  U   B "O5'"  1 
ATOM   8029  C  "C5'"  . U   B 2 22  ? 4.079   29.522  6.538   1.00 59.25  ? 22  U   B "C5'"  1 
ATOM   8030  C  "C4'"  . U   B 2 22  ? 2.807   29.320  5.754   1.00 53.15  ? 22  U   B "C4'"  1 
ATOM   8031  O  "O4'"  . U   B 2 22  ? 2.609   27.909  5.464   1.00 65.67  ? 22  U   B "O4'"  1 
ATOM   8032  C  "C3'"  . U   B 2 22  ? 1.509   29.732  6.421   1.00 60.40  ? 22  U   B "C3'"  1 
ATOM   8033  O  "O3'"  . U   B 2 22  ? 1.299   31.131  6.403   1.00 59.41  ? 22  U   B "O3'"  1 
ATOM   8034  C  "C2'"  . U   B 2 22  ? 0.478   28.935  5.634   1.00 60.90  ? 22  U   B "C2'"  1 
ATOM   8035  O  "O2'"  . U   B 2 22  ? 0.224   29.523  4.368   1.00 60.41  ? 22  U   B "O2'"  1 
ATOM   8036  C  "C1'"  . U   B 2 22  ? 1.225   27.620  5.419   1.00 55.62  ? 22  U   B "C1'"  1 
ATOM   8037  N  N1     . U   B 2 22  ? 0.898   26.621  6.461   1.00 66.02  ? 22  U   B N1     1 
ATOM   8038  C  C2     . U   B 2 22  ? -0.321  25.981  6.354   1.00 70.36  ? 22  U   B C2     1 
ATOM   8039  O  O2     . U   B 2 22  ? -1.106  26.201  5.450   1.00 72.62  ? 22  U   B O2     1 
ATOM   8040  N  N3     . U   B 2 22  ? -0.589  25.067  7.340   1.00 79.88  ? 22  U   B N3     1 
ATOM   8041  C  C4     . U   B 2 22  ? 0.223   24.740  8.405   1.00 87.05  ? 22  U   B C4     1 
ATOM   8042  O  O4     . U   B 2 22  ? -0.159  23.893  9.215   1.00 87.70  ? 22  U   B O4     1 
ATOM   8043  C  C5     . U   B 2 22  ? 1.468   25.448  8.452   1.00 75.63  ? 22  U   B C5     1 
ATOM   8044  C  C6     . U   B 2 22  ? 1.753   26.345  7.501   1.00 70.25  ? 22  U   B C6     1 
ATOM   8045  H  "H5'"  . U   B 2 22  ? 4.836   29.355  5.955   1.00 71.11  ? 22  U   B "H5'"  1 
ATOM   8046  H  "H5''" . U   B 2 22  ? 4.115   30.442  6.844   1.00 71.11  ? 22  U   B "H5''" 1 
ATOM   8047  H  "H4'"  . U   B 2 22  ? 2.885   29.798  4.914   1.00 63.78  ? 22  U   B "H4'"  1 
ATOM   8048  H  "H3'"  . U   B 2 22  ? 1.513   29.424  7.341   1.00 72.48  ? 22  U   B "H3'"  1 
ATOM   8049  H  "H2'"  . U   B 2 22  ? -0.338  28.802  6.143   1.00 73.08  ? 22  U   B "H2'"  1 
ATOM   8050  H  "HO2'" . U   B 2 22  ? -0.187  30.247  4.480   1.00 72.49  ? 22  U   B "HO2'" 1 
ATOM   8051  H  "H1'"  . U   B 2 22  ? 1.000   27.261  4.546   1.00 66.74  ? 22  U   B "H1'"  1 
ATOM   8052  H  H3     . U   B 2 22  ? -1.342  24.656  7.289   1.00 95.86  ? 22  U   B H3     1 
ATOM   8053  H  H5     . U   B 2 22  ? 2.074   25.285  9.139   1.00 90.75  ? 22  U   B H5     1 
ATOM   8054  H  H6     . U   B 2 22  ? 2.564   26.797  7.543   1.00 84.30  ? 22  U   B H6     1 
ATOM   8055  P  P      . G   B 2 23  ? 0.445   31.834  7.568   1.00 63.40  ? 23  G   B P      1 
ATOM   8056  O  OP1    . G   B 2 23  ? 0.624   33.303  7.437   1.00 51.00  ? 23  G   B OP1    1 
ATOM   8057  O  OP2    . G   B 2 23  ? 0.735   31.173  8.867   1.00 50.21  ? 23  G   B OP2    1 
ATOM   8058  O  "O5'"  . G   B 2 23  ? -1.049  31.466  7.172   1.00 63.81  ? 23  G   B "O5'"  1 
ATOM   8059  C  "C5'"  . G   B 2 23  ? -1.620  32.013  5.994   1.00 73.20  ? 23  G   B "C5'"  1 
ATOM   8060  C  "C4'"  . G   B 2 23  ? -2.916  31.337  5.630   1.00 87.82  ? 23  G   B "C4'"  1 
ATOM   8061  O  "O4'"  . G   B 2 23  ? -2.711  29.906  5.492   1.00 88.44  ? 23  G   B "O4'"  1 
ATOM   8062  C  "C3'"  . G   B 2 23  ? -4.039  31.446  6.643   1.00 101.84 ? 23  G   B "C3'"  1 
ATOM   8063  O  "O3'"  . G   B 2 23  ? -4.697  32.699  6.593   1.00 90.89  ? 23  G   B "O3'"  1 
ATOM   8064  C  "C2'"  . G   B 2 23  ? -4.922  30.260  6.280   1.00 101.87 ? 23  G   B "C2'"  1 
ATOM   8065  O  "O2'"  . G   B 2 23  ? -5.721  30.544  5.142   1.00 101.67 ? 23  G   B "O2'"  1 
ATOM   8066  C  "C1'"  . G   B 2 23  ? -3.874  29.213  5.901   1.00 83.07  ? 23  G   B "C1'"  1 
ATOM   8067  N  N9     . G   B 2 23  ? -3.527  28.336  7.036   1.00 91.22  ? 23  G   B N9     1 
ATOM   8068  C  C8     . G   B 2 23  ? -2.407  28.416  7.828   1.00 82.63  ? 23  G   B C8     1 
ATOM   8069  N  N7     . G   B 2 23  ? -2.371  27.508  8.764   1.00 81.35  ? 23  G   B N7     1 
ATOM   8070  C  C5     . G   B 2 23  ? -3.542  26.789  8.587   1.00 90.02  ? 23  G   B C5     1 
ATOM   8071  C  C6     . G   B 2 23  ? -4.049  25.680  9.309   1.00 96.73  ? 23  G   B C6     1 
ATOM   8072  O  O6     . G   B 2 23  ? -3.540  25.103  10.278  1.00 89.52  ? 23  G   B O6     1 
ATOM   8073  N  N1     . G   B 2 23  ? -5.273  25.253  8.800   1.00 104.82 ? 23  G   B N1     1 
ATOM   8074  C  C2     . G   B 2 23  ? -5.925  25.822  7.732   1.00 99.65  ? 23  G   B C2     1 
ATOM   8075  N  N2     . G   B 2 23  ? -7.099  25.271  7.384   1.00 101.05 ? 23  G   B N2     1 
ATOM   8076  N  N3     . G   B 2 23  ? -5.459  26.856  7.050   1.00 105.09 ? 23  G   B N3     1 
ATOM   8077  C  C4     . G   B 2 23  ? -4.274  27.291  7.532   1.00 103.02 ? 23  G   B C4     1 
ATOM   8078  H  "H5'"  . G   B 2 23  ? -0.993  31.908  5.262   1.00 87.84  ? 23  G   B "H5'"  1 
ATOM   8079  H  "H5''" . G   B 2 23  ? -1.787  32.958  6.134   1.00 87.84  ? 23  G   B "H5''" 1 
ATOM   8080  H  "H4'"  . G   B 2 23  ? -3.225  31.691  4.781   1.00 105.38 ? 23  G   B "H4'"  1 
ATOM   8081  H  "H3'"  . G   B 2 23  ? -3.678  31.312  7.533   1.00 122.20 ? 23  G   B "H3'"  1 
ATOM   8082  H  "H2'"  . G   B 2 23  ? -5.458  29.970  7.034   1.00 122.25 ? 23  G   B "H2'"  1 
ATOM   8083  H  "HO2'" . G   B 2 23  ? -5.814  31.376  5.073   1.00 122.01 ? 23  G   B "HO2'" 1 
ATOM   8084  H  "H1'"  . G   B 2 23  ? -4.205  28.675  5.165   1.00 99.69  ? 23  G   B "H1'"  1 
ATOM   8085  H  H8     . G   B 2 23  ? -1.737  29.049  7.704   1.00 99.16  ? 23  G   B H8     1 
ATOM   8086  H  H1     . G   B 2 23  ? -5.650  24.583  9.184   1.00 125.78 ? 23  G   B H1     1 
ATOM   8087  H  H21    . G   B 2 23  ? -7.405  24.599  7.824   1.00 121.26 ? 23  G   B H21    1 
ATOM   8088  H  H22    . G   B 2 23  ? -7.544  25.590  6.721   1.00 121.26 ? 23  G   B H22    1 
ATOM   8089  P  P      . C   B 2 24  ? -5.361  33.316  7.918   1.00 92.15  ? 24  C   B P      1 
ATOM   8090  O  OP1    . C   B 2 24  ? -5.848  34.678  7.586   1.00 82.81  ? 24  C   B OP1    1 
ATOM   8091  O  OP2    . C   B 2 24  ? -4.439  33.118  9.069   1.00 69.77  ? 24  C   B OP2    1 
ATOM   8092  O  "O5'"  . C   B 2 24  ? -6.624  32.376  8.133   1.00 118.54 ? 24  C   B "O5'"  1 
ATOM   8093  C  "C5'"  . C   B 2 24  ? -7.744  32.473  7.267   1.00 105.78 ? 24  C   B "C5'"  1 
ATOM   8094  C  "C4'"  . C   B 2 24  ? -8.790  31.442  7.599   1.00 113.20 ? 24  C   B "C4'"  1 
ATOM   8095  O  "O4'"  . C   B 2 24  ? -8.229  30.110  7.447   1.00 105.72 ? 24  C   B "O4'"  1 
ATOM   8096  C  "C3'"  . C   B 2 24  ? -9.317  31.447  9.022   1.00 123.11 ? 24  C   B "C3'"  1 
ATOM   8097  O  "O3'"  . C   B 2 24  ? -10.276 32.458  9.273   1.00 112.31 ? 24  C   B "O3'"  1 
ATOM   8098  C  "C2'"  . C   B 2 24  ? -9.853  30.031  9.168   1.00 116.29 ? 24  C   B "C2'"  1 
ATOM   8099  O  "O2'"  . C   B 2 24  ? -11.096 29.878  8.500   1.00 108.02 ? 24  C   B "O2'"  1 
ATOM   8100  C  "C1'"  . C   B 2 24  ? -8.793  29.240  8.407   1.00 108.41 ? 24  C   B "C1'"  1 
ATOM   8101  N  N1     . C   B 2 24  ? -7.722  28.773  9.316   1.00 103.93 ? 24  C   B N1     1 
ATOM   8102  C  C2     . C   B 2 24  ? -7.923  27.599  10.048  1.00 121.62 ? 24  C   B C2     1 
ATOM   8103  O  O2     . C   B 2 24  ? -8.979  26.966  9.899   1.00 125.48 ? 24  C   B O2     1 
ATOM   8104  N  N3     . C   B 2 24  ? -6.954  27.170  10.890  1.00 123.85 ? 24  C   B N3     1 
ATOM   8105  C  C4     . C   B 2 24  ? -5.828  27.872  11.028  1.00 119.07 ? 24  C   B C4     1 
ATOM   8106  N  N4     . C   B 2 24  ? -4.902  27.408  11.871  1.00 117.37 ? 24  C   B N4     1 
ATOM   8107  C  C5     . C   B 2 24  ? -5.602  29.078  10.305  1.00 101.31 ? 24  C   B C5     1 
ATOM   8108  C  C6     . C   B 2 24  ? -6.568  29.490  9.475   1.00 87.94  ? 24  C   B C6     1 
ATOM   8109  H  "H5'"  . C   B 2 24  ? -7.449  32.341  6.353   1.00 126.93 ? 24  C   B "H5'"  1 
ATOM   8110  H  "H5''" . C   B 2 24  ? -8.133  33.357  7.351   1.00 126.93 ? 24  C   B "H5''" 1 
ATOM   8111  H  "H4'"  . C   B 2 24  ? -9.535  31.542  6.986   1.00 135.84 ? 24  C   B "H4'"  1 
ATOM   8112  H  "H3'"  . C   B 2 24  ? -8.572  31.564  9.632   1.00 147.73 ? 24  C   B "H3'"  1 
ATOM   8113  H  "H2'"  . C   B 2 24  ? -9.904  29.759  10.098  1.00 139.55 ? 24  C   B "H2'"  1 
ATOM   8114  H  "HO2'" . C   B 2 24  ? -11.685 30.311  8.914   1.00 129.62 ? 24  C   B "HO2'" 1 
ATOM   8115  H  "H1'"  . C   B 2 24  ? -9.203  28.481  7.964   1.00 130.09 ? 24  C   B "H1'"  1 
ATOM   8116  H  H41    . C   B 2 24  ? -4.166  27.839  11.980  1.00 140.84 ? 24  C   B H41    1 
ATOM   8117  H  H42    . C   B 2 24  ? -5.041  26.678  12.304  1.00 140.84 ? 24  C   B H42    1 
ATOM   8118  H  H5     . C   B 2 24  ? -4.813  29.561  10.406  1.00 121.57 ? 24  C   B H5     1 
ATOM   8119  H  H6     . C   B 2 24  ? -6.447  30.273  8.989   1.00 105.53 ? 24  C   B H6     1 
ATOM   8120  P  P      . C   B 2 25  ? -10.472 33.011  10.768  1.00 105.54 ? 25  C   B P      1 
ATOM   8121  O  OP1    . C   B 2 25  ? -11.420 34.153  10.712  1.00 125.80 ? 25  C   B OP1    1 
ATOM   8122  O  OP2    . C   B 2 25  ? -9.139  33.200  11.395  1.00 104.75 ? 25  C   B OP2    1 
ATOM   8123  O  "O5'"  . C   B 2 25  ? -11.191 31.792  11.497  1.00 119.26 ? 25  C   B "O5'"  1 
ATOM   8124  C  "C5'"  . C   B 2 25  ? -12.555 31.504  11.239  1.00 119.88 ? 25  C   B "C5'"  1 
ATOM   8125  C  "C4'"  . C   B 2 25  ? -13.055 30.361  12.082  1.00 121.44 ? 25  C   B "C4'"  1 
ATOM   8126  O  "O4'"  . C   B 2 25  ? -12.342 29.147  11.727  1.00 117.18 ? 25  C   B "O4'"  1 
ATOM   8127  C  "C3'"  . C   B 2 25  ? -12.840 30.474  13.580  1.00 122.49 ? 25  C   B "C3'"  1 
ATOM   8128  O  "O3'"  . C   B 2 25  ? -13.774 31.325  14.220  1.00 120.63 ? 25  C   B "O3'"  1 
ATOM   8129  C  "C2'"  . C   B 2 25  ? -12.913 29.020  14.022  1.00 123.69 ? 25  C   B "C2'"  1 
ATOM   8130  O  "O2'"  . C   B 2 25  ? -14.255 28.557  14.054  1.00 113.12 ? 25  C   B "O2'"  1 
ATOM   8131  C  "C1'"  . C   B 2 25  ? -12.195 28.326  12.868  1.00 120.22 ? 25  C   B "C1'"  1 
ATOM   8132  N  N1     . C   B 2 25  ? -10.753 28.165  13.157  1.00 122.06 ? 25  C   B N1     1 
ATOM   8133  C  C2     . C   B 2 25  ? -10.346 27.090  13.953  1.00 132.47 ? 25  C   B C2     1 
ATOM   8134  O  O2     . C   B 2 25  ? -11.196 26.288  14.369  1.00 125.68 ? 25  C   B O2     1 
ATOM   8135  N  N3     . C   B 2 25  ? -9.032  26.937  14.234  1.00 141.03 ? 25  C   B N3     1 
ATOM   8136  C  C4     . C   B 2 25  ? -8.143  27.815  13.769  1.00 135.60 ? 25  C   B C4     1 
ATOM   8137  N  N4     . C   B 2 25  ? -6.859  27.619  14.078  1.00 139.01 ? 25  C   B N4     1 
ATOM   8138  C  C5     . C   B 2 25  ? -8.530  28.929  12.970  1.00 116.75 ? 25  C   B C5     1 
ATOM   8139  C  C6     . C   B 2 25  ? -9.833  29.067  12.697  1.00 113.13 ? 25  C   B C6     1 
ATOM   8140  H  "H5'"  . C   B 2 25  ? -12.658 31.274  10.302  1.00 143.86 ? 25  C   B "H5'"  1 
ATOM   8141  H  "H5''" . C   B 2 25  ? -13.086 32.293  11.431  1.00 143.86 ? 25  C   B "H5''" 1 
ATOM   8142  H  "H4'"  . C   B 2 25  ? -14.001 30.233  11.909  1.00 145.73 ? 25  C   B "H4'"  1 
ATOM   8143  H  "H3'"  . C   B 2 25  ? -11.944 30.809  13.745  1.00 146.99 ? 25  C   B "H3'"  1 
ATOM   8144  H  "H2'"  . C   B 2 25  ? -12.457 28.876  14.866  1.00 148.43 ? 25  C   B "H2'"  1 
ATOM   8145  H  "HO2'" . C   B 2 25  ? -14.659 28.934  14.687  1.00 135.74 ? 25  C   B "HO2'" 1 
ATOM   8146  H  "H1'"  . C   B 2 25  ? -12.597 27.459  12.703  1.00 144.27 ? 25  C   B "H1'"  1 
ATOM   8147  H  H41    . C   B 2 25  ? -6.260  28.167  13.793  1.00 166.82 ? 25  C   B H41    1 
ATOM   8148  H  H42    . C   B 2 25  ? -6.631  26.945  14.560  1.00 166.82 ? 25  C   B H42    1 
ATOM   8149  H  H5     . C   B 2 25  ? -7.902  29.535  12.648  1.00 140.10 ? 25  C   B H5     1 
ATOM   8150  H  H6     . C   B 2 25  ? -10.117 29.782  12.175  1.00 135.75 ? 25  C   B H6     1 
ATOM   8151  P  P      . G   B 2 26  ? -13.401 32.036  15.614  1.00 155.83 ? 26  G   B P      1 
ATOM   8152  O  OP1    . G   B 2 26  ? -14.352 33.157  15.827  1.00 163.41 ? 26  G   B OP1    1 
ATOM   8153  O  OP2    . G   B 2 26  ? -11.942 32.310  15.641  1.00 149.44 ? 26  G   B OP2    1 
ATOM   8154  O  "O5'"  . G   B 2 26  ? -13.714 30.916  16.701  1.00 165.18 ? 26  G   B "O5'"  1 
ATOM   8155  C  "C5'"  . G   B 2 26  ? -15.006 30.334  16.787  1.00 171.44 ? 26  G   B "C5'"  1 
ATOM   8156  C  "C4'"  . G   B 2 26  ? -14.972 28.998  17.484  1.00 169.22 ? 26  G   B "C4'"  1 
ATOM   8157  O  "O4'"  . G   B 2 26  ? -13.975 28.133  16.877  1.00 152.20 ? 26  G   B "O4'"  1 
ATOM   8158  C  "C3'"  . G   B 2 26  ? -14.578 29.035  18.949  1.00 185.75 ? 26  G   B "C3'"  1 
ATOM   8159  O  "O3'"  . G   B 2 26  ? -15.647 29.436  19.789  1.00 196.57 ? 26  G   B "O3'"  1 
ATOM   8160  C  "C2'"  . G   B 2 26  ? -14.088 27.614  19.193  1.00 175.29 ? 26  G   B "C2'"  1 
ATOM   8161  O  "O2'"  . G   B 2 26  ? -15.172 26.712  19.370  1.00 149.68 ? 26  G   B "O2'"  1 
ATOM   8162  C  "C1'"  . G   B 2 26  ? -13.395 27.303  17.865  1.00 166.98 ? 26  G   B "C1'"  1 
ATOM   8163  N  N9     . G   B 2 26  ? -11.944 27.572  17.920  1.00 178.19 ? 26  G   B N9     1 
ATOM   8164  C  C8     . G   B 2 26  ? -11.258 28.577  17.278  1.00 159.93 ? 26  G   B C8     1 
ATOM   8165  N  N7     . G   B 2 26  ? -9.976  28.563  17.518  1.00 147.70 ? 26  G   B N7     1 
ATOM   8166  C  C5     . G   B 2 26  ? -9.801  27.483  18.371  1.00 166.48 ? 26  G   B C5     1 
ATOM   8167  C  C6     . G   B 2 26  ? -8.621  26.973  18.972  1.00 156.57 ? 26  G   B C6     1 
ATOM   8168  O  O6     . G   B 2 26  ? -7.462  27.392  18.860  1.00 140.92 ? 26  G   B O6     1 
ATOM   8169  N  N1     . G   B 2 26  ? -8.891  25.862  19.768  1.00 164.58 ? 26  G   B N1     1 
ATOM   8170  C  C2     . G   B 2 26  ? -10.137 25.312  19.964  1.00 163.83 ? 26  G   B C2     1 
ATOM   8171  N  N2     . G   B 2 26  ? -10.197 24.239  20.769  1.00 161.69 ? 26  G   B N2     1 
ATOM   8172  N  N3     . G   B 2 26  ? -11.245 25.779  19.408  1.00 168.70 ? 26  G   B N3     1 
ATOM   8173  C  C4     . G   B 2 26  ? -11.005 26.858  18.630  1.00 177.20 ? 26  G   B C4     1 
ATOM   8174  H  "H5'"  . G   B 2 26  ? -15.358 30.214  15.891  1.00 205.73 ? 26  G   B "H5'"  1 
ATOM   8175  H  "H5''" . G   B 2 26  ? -15.590 30.932  17.278  1.00 205.73 ? 26  G   B "H5''" 1 
ATOM   8176  H  "H4'"  . G   B 2 26  ? -15.843 28.579  17.403  1.00 203.06 ? 26  G   B "H4'"  1 
ATOM   8177  H  "H3'"  . G   B 2 26  ? -13.837 29.650  19.064  1.00 222.90 ? 26  G   B "H3'"  1 
ATOM   8178  H  "H2'"  . G   B 2 26  ? -13.464 27.575  19.935  1.00 210.34 ? 26  G   B "H2'"  1 
ATOM   8179  H  "HO2'" . G   B 2 26  ? -15.853 27.145  19.602  1.00 179.62 ? 26  G   B "HO2'" 1 
ATOM   8180  H  "H1'"  . G   B 2 26  ? -13.543 26.373  17.632  1.00 200.38 ? 26  G   B "H1'"  1 
ATOM   8181  H  H8     . G   B 2 26  ? -11.669 29.204  16.727  1.00 191.92 ? 26  G   B H8     1 
ATOM   8182  H  H1     . G   B 2 26  ? -8.227  25.491  20.169  1.00 197.50 ? 26  G   B H1     1 
ATOM   8183  H  H21    . G   B 2 26  ? -9.479  23.932  21.132  1.00 194.03 ? 26  G   B H21    1 
ATOM   8184  H  H22    . G   B 2 26  ? -10.952 23.858  20.923  1.00 194.03 ? 26  G   B H22    1 
ATOM   8185  P  P      . C   B 2 27  ? -15.501 30.717  20.750  1.00 185.37 ? 27  C   B P      1 
ATOM   8186  O  OP1    . C   B 2 27  ? -16.867 31.236  21.008  1.00 211.31 ? 27  C   B OP1    1 
ATOM   8187  O  OP2    . C   B 2 27  ? -14.465 31.639  20.214  1.00 160.65 ? 27  C   B OP2    1 
ATOM   8188  O  "O5'"  . C   B 2 27  ? -14.954 30.099  22.109  1.00 182.58 ? 27  C   B "O5'"  1 
ATOM   8189  C  "C5'"  . C   B 2 27  ? -15.582 28.966  22.689  1.00 188.27 ? 27  C   B "C5'"  1 
ATOM   8190  C  "C4'"  . C   B 2 27  ? -14.609 28.154  23.502  1.00 184.68 ? 27  C   B "C4'"  1 
ATOM   8191  O  "O4'"  . C   B 2 27  ? -13.583 27.597  22.639  1.00 165.64 ? 27  C   B "O4'"  1 
ATOM   8192  C  "C3'"  . C   B 2 27  ? -13.824 28.918  24.553  1.00 193.95 ? 27  C   B "C3'"  1 
ATOM   8193  O  "O3'"  . C   B 2 27  ? -14.568 29.157  25.734  1.00 204.30 ? 27  C   B "O3'"  1 
ATOM   8194  C  "C2'"  . C   B 2 27  ? -12.606 28.029  24.760  1.00 182.69 ? 27  C   B "C2'"  1 
ATOM   8195  O  "O2'"  . C   B 2 27  ? -12.913 26.924  25.597  1.00 182.97 ? 27  C   B "O2'"  1 
ATOM   8196  C  "C1'"  . C   B 2 27  ? -12.357 27.524  23.338  1.00 172.91 ? 27  C   B "C1'"  1 
ATOM   8197  N  N1     . C   B 2 27  ? -11.345 28.342  22.628  1.00 173.33 ? 27  C   B N1     1 
ATOM   8198  C  C2     . C   B 2 27  ? -9.989  28.039  22.800  1.00 161.44 ? 27  C   B C2     1 
ATOM   8199  O  O2     . C   B 2 27  ? -9.671  27.091  23.535  1.00 154.98 ? 27  C   B O2     1 
ATOM   8200  N  N3     . C   B 2 27  ? -9.053  28.781  22.160  1.00 142.57 ? 27  C   B N3     1 
ATOM   8201  C  C4     . C   B 2 27  ? -9.421  29.795  21.376  1.00 140.49 ? 27  C   B C4     1 
ATOM   8202  N  N4     . C   B 2 27  ? -8.461  30.498  20.766  1.00 81.21  ? 27  C   B N4     1 
ATOM   8203  C  C5     . C   B 2 27  ? -10.794 30.130  21.185  1.00 171.48 ? 27  C   B C5     1 
ATOM   8204  C  C6     . C   B 2 27  ? -11.712 29.387  21.823  1.00 176.30 ? 27  C   B C6     1 
ATOM   8205  H  "H5'"  . C   B 2 27  ? -15.948 28.410  21.984  1.00 225.93 ? 27  C   B "H5'"  1 
ATOM   8206  H  "H5''" . C   B 2 27  ? -16.304 29.264  23.265  1.00 225.93 ? 27  C   B "H5''" 1 
ATOM   8207  H  "H4'"  . C   B 2 27  ? -15.087 27.427  23.932  1.00 221.61 ? 27  C   B "H4'"  1 
ATOM   8208  H  "H3'"  . C   B 2 27  ? -13.538 29.766  24.181  1.00 232.74 ? 27  C   B "H3'"  1 
ATOM   8209  H  "H2'"  . C   B 2 27  ? -11.849 28.535  25.095  1.00 219.23 ? 27  C   B "H2'"  1 
ATOM   8210  H  "HO2'" . C   B 2 27  ? -13.050 27.202  26.378  1.00 219.57 ? 27  C   B "HO2'" 1 
ATOM   8211  H  "H1'"  . C   B 2 27  ? -12.059 26.601  23.372  1.00 207.50 ? 27  C   B "H1'"  1 
ATOM   8212  H  H41    . C   B 2 27  ? -8.670  31.157  20.254  1.00 97.45  ? 27  C   B H41    1 
ATOM   8213  H  H42    . C   B 2 27  ? -7.635  30.291  20.885  1.00 97.45  ? 27  C   B H42    1 
ATOM   8214  H  H5     . C   B 2 27  ? -11.045 30.837  20.636  1.00 205.78 ? 27  C   B H5     1 
ATOM   8215  H  H6     . C   B 2 27  ? -12.614 29.585  21.715  1.00 211.55 ? 27  C   B H6     1 
ATOM   8216  P  P      . G   B 2 28  ? -13.915 29.993  26.938  1.00 211.26 ? 28  G   B P      1 
ATOM   8217  O  OP1    . G   B 2 28  ? -15.014 30.434  27.836  1.00 225.41 ? 28  G   B OP1    1 
ATOM   8218  O  OP2    . G   B 2 28  ? -12.997 31.004  26.351  1.00 188.33 ? 28  G   B OP2    1 
ATOM   8219  O  "O5'"  . G   B 2 28  ? -13.035 28.911  27.708  1.00 198.10 ? 28  G   B "O5'"  1 
ATOM   8220  C  "C5'"  . G   B 2 28  ? -12.123 29.297  28.730  1.00 193.86 ? 28  G   B "C5'"  1 
ATOM   8221  C  "C4'"  . G   B 2 28  ? -10.876 28.448  28.710  1.00 175.89 ? 28  G   B "C4'"  1 
ATOM   8222  O  "O4'"  . G   B 2 28  ? -10.199 28.636  27.436  1.00 177.71 ? 28  G   B "O4'"  1 
ATOM   8223  C  "C3'"  . G   B 2 28  ? -9.851  28.781  29.790  1.00 150.99 ? 28  G   B "C3'"  1 
ATOM   8224  O  "O3'"  . G   B 2 28  ? -9.174  27.594  30.204  1.00 135.68 ? 28  G   B "O3'"  1 
ATOM   8225  C  "C2'"  . G   B 2 28  ? -8.883  29.709  29.063  1.00 149.17 ? 28  G   B "C2'"  1 
ATOM   8226  O  "O2'"  . G   B 2 28  ? -7.584  29.749  29.615  1.00 132.05 ? 28  G   B "O2'"  1 
ATOM   8227  C  "C1'"  . G   B 2 28  ? -8.884  29.113  27.658  1.00 163.00 ? 28  G   B "C1'"  1 
ATOM   8228  N  N9     . G   B 2 28  ? -8.542  30.062  26.590  1.00 144.25 ? 28  G   B N9     1 
ATOM   8229  C  C8     . G   B 2 28  ? -9.388  30.823  25.814  1.00 137.30 ? 28  G   B C8     1 
ATOM   8230  N  N7     . G   B 2 28  ? -8.760  31.560  24.934  1.00 124.78 ? 28  G   B N7     1 
ATOM   8231  C  C5     . G   B 2 28  ? -7.415  31.267  25.129  1.00 129.63 ? 28  G   B C5     1 
ATOM   8232  C  C6     . G   B 2 28  ? -6.248  31.755  24.474  1.00 101.59 ? 28  G   B C6     1 
ATOM   8233  O  O6     . G   B 2 28  ? -6.163  32.579  23.551  1.00 53.58  ? 28  G   B O6     1 
ATOM   8234  N  N1     . G   B 2 28  ? -5.091  31.179  25.002  1.00 99.20  ? 28  G   B N1     1 
ATOM   8235  C  C2     . G   B 2 28  ? -5.059  30.257  26.024  1.00 98.93  ? 28  G   B C2     1 
ATOM   8236  N  N2     . G   B 2 28  ? -3.854  29.809  26.406  1.00 80.60  ? 28  G   B N2     1 
ATOM   8237  N  N3     . G   B 2 28  ? -6.136  29.799  26.637  1.00 115.68 ? 28  G   B N3     1 
ATOM   8238  C  C4     . G   B 2 28  ? -7.270  30.338  26.142  1.00 135.11 ? 28  G   B C4     1 
ATOM   8239  H  "H5'"  . G   B 2 28  ? -12.556 29.203  29.593  1.00 232.64 ? 28  G   B "H5'"  1 
ATOM   8240  H  "H5''" . G   B 2 28  ? -11.875 30.226  28.600  1.00 232.64 ? 28  G   B "H5''" 1 
ATOM   8241  H  "H4'"  . G   B 2 28  ? -11.131 27.516  28.796  1.00 211.07 ? 28  G   B "H4'"  1 
ATOM   8242  H  "H3'"  . G   B 2 28  ? -10.268 29.230  30.542  1.00 181.19 ? 28  G   B "H3'"  1 
ATOM   8243  H  "H2'"  . G   B 2 28  ? -9.252  30.606  29.035  1.00 179.01 ? 28  G   B "H2'"  1 
ATOM   8244  H  "HO2'" . G   B 2 28  ? -7.311  30.543  29.615  1.00 158.46 ? 28  G   B "HO2'" 1 
ATOM   8245  H  "H1'"  . G   B 2 28  ? -8.266  28.366  27.629  1.00 195.60 ? 28  G   B "H1'"  1 
ATOM   8246  H  H8     . G   B 2 28  ? -10.313 30.817  25.910  1.00 164.76 ? 28  G   B H8     1 
ATOM   8247  H  H1     . G   B 2 28  ? -4.338  31.420  24.662  1.00 119.04 ? 28  G   B H1     1 
ATOM   8248  H  H21    . G   B 2 28  ? -3.144  30.098  26.015  1.00 96.72  ? 28  G   B H21    1 
ATOM   8249  H  H22    . G   B 2 28  ? -3.791  29.232  27.040  1.00 96.72  ? 28  G   B H22    1 
ATOM   8250  P  P      . C   B 2 31  ? -11.404 34.433  35.840  1.00 142.42 ? 31  C   B P      1 
ATOM   8251  O  OP1    . C   B 2 31  ? -11.493 35.539  36.828  1.00 153.69 ? 31  C   B OP1    1 
ATOM   8252  O  OP2    . C   B 2 31  ? -12.604 33.609  35.548  1.00 176.99 ? 31  C   B OP2    1 
ATOM   8253  O  "O5'"  . C   B 2 31  ? -10.876 35.037  34.463  1.00 173.92 ? 31  C   B "O5'"  1 
ATOM   8254  C  "C5'"  . C   B 2 31  ? -11.280 36.327  34.030  1.00 182.83 ? 31  C   B "C5'"  1 
ATOM   8255  C  "C4'"  . C   B 2 31  ? -11.942 36.273  32.677  1.00 173.96 ? 31  C   B "C4'"  1 
ATOM   8256  O  "O4'"  . C   B 2 31  ? -12.956 37.302  32.587  1.00 175.06 ? 31  C   B "O4'"  1 
ATOM   8257  C  "C3'"  . C   B 2 31  ? -11.046 36.531  31.476  1.00 176.97 ? 31  C   B "C3'"  1 
ATOM   8258  O  "O3'"  . C   B 2 31  ? -10.295 35.392  31.093  1.00 162.85 ? 31  C   B "O3'"  1 
ATOM   8259  C  "C2'"  . C   B 2 31  ? -12.037 36.992  30.412  1.00 178.16 ? 31  C   B "C2'"  1 
ATOM   8260  O  "O2'"  . C   B 2 31  ? -12.660 35.885  29.776  1.00 164.40 ? 31  C   B "O2'"  1 
ATOM   8261  C  "C1'"  . C   B 2 31  ? -13.081 37.739  31.250  1.00 182.03 ? 31  C   B "C1'"  1 
ATOM   8262  N  N1     . C   B 2 31  ? -12.908 39.214  31.201  1.00 184.02 ? 31  C   B N1     1 
ATOM   8263  C  C2     . C   B 2 31  ? -14.024 40.019  30.930  1.00 180.60 ? 31  C   B C2     1 
ATOM   8264  O  O2     . C   B 2 31  ? -15.137 39.495  30.763  1.00 160.26 ? 31  C   B O2     1 
ATOM   8265  N  N3     . C   B 2 31  ? -13.878 41.363  30.878  1.00 185.21 ? 31  C   B N3     1 
ATOM   8266  C  C4     . C   B 2 31  ? -12.682 41.921  31.065  1.00 164.64 ? 31  C   B C4     1 
ATOM   8267  N  N4     . C   B 2 31  ? -12.599 43.253  30.997  1.00 134.70 ? 31  C   B N4     1 
ATOM   8268  C  C5     . C   B 2 31  ? -11.525 41.131  31.330  1.00 153.76 ? 31  C   B C5     1 
ATOM   8269  C  C6     . C   B 2 31  ? -11.682 39.799  31.385  1.00 171.32 ? 31  C   B C6     1 
ATOM   8270  H  "H5'"  . C   B 2 31  ? -10.501 36.903  33.979  1.00 219.39 ? 31  C   B "H5'"  1 
ATOM   8271  H  "H5''" . C   B 2 31  ? -11.905 36.696  34.674  1.00 219.39 ? 31  C   B "H5''" 1 
ATOM   8272  H  "H4'"  . C   B 2 31  ? -12.365 35.407  32.571  1.00 208.75 ? 31  C   B "H4'"  1 
ATOM   8273  H  "H3'"  . C   B 2 31  ? -10.439 37.259  31.683  1.00 212.37 ? 31  C   B "H3'"  1 
ATOM   8274  H  "H2'"  . C   B 2 31  ? -11.615 37.582  29.768  1.00 213.79 ? 31  C   B "H2'"  1 
ATOM   8275  H  "HO2'" . C   B 2 31  ? -12.088 35.476  29.316  1.00 197.28 ? 31  C   B "HO2'" 1 
ATOM   8276  H  "H1'"  . C   B 2 31  ? -13.967 37.515  30.926  1.00 218.43 ? 31  C   B "H1'"  1 
ATOM   8277  H  H41    . C   B 2 31  ? -11.842 43.644  31.113  1.00 161.64 ? 31  C   B H41    1 
ATOM   8278  H  H42    . C   B 2 31  ? -13.304 43.720  30.838  1.00 161.64 ? 31  C   B H42    1 
ATOM   8279  H  H5     . C   B 2 31  ? -10.693 41.525  31.461  1.00 184.51 ? 31  C   B H5     1 
ATOM   8280  H  H6     . C   B 2 31  ? -10.943 39.262  31.557  1.00 205.58 ? 31  C   B H6     1 
ATOM   8281  P  P      . G   B 2 32  ? -9.321  35.457  29.816  1.00 131.16 ? 32  G   B P      1 
ATOM   8282  O  OP1    . G   B 2 32  ? -8.428  36.633  29.969  1.00 97.66  ? 32  G   B OP1    1 
ATOM   8283  O  OP2    . G   B 2 32  ? -10.165 35.340  28.599  1.00 121.45 ? 32  G   B OP2    1 
ATOM   8284  O  "O5'"  . G   B 2 32  ? -8.435  34.136  29.934  1.00 94.67  ? 32  G   B "O5'"  1 
ATOM   8285  C  "C5'"  . G   B 2 32  ? -8.064  33.606  31.200  1.00 68.77  ? 32  G   B "C5'"  1 
ATOM   8286  C  "C4'"  . G   B 2 32  ? -6.688  32.982  31.162  1.00 82.22  ? 32  G   B "C4'"  1 
ATOM   8287  O  "O4'"  . G   B 2 32  ? -6.518  32.258  29.912  1.00 97.15  ? 32  G   B "O4'"  1 
ATOM   8288  C  "C3'"  . G   B 2 32  ? -5.510  33.949  31.192  1.00 76.48  ? 32  G   B "C3'"  1 
ATOM   8289  O  "O3'"  . G   B 2 32  ? -5.179  34.399  32.496  1.00 47.25  ? 32  G   B "O3'"  1 
ATOM   8290  C  "C2'"  . G   B 2 32  ? -4.405  33.145  30.522  1.00 71.75  ? 32  G   B "C2'"  1 
ATOM   8291  O  "O2'"  . G   B 2 32  ? -3.842  32.194  31.417  1.00 43.01  ? 32  G   B "O2'"  1 
ATOM   8292  C  "C1'"  . G   B 2 32  ? -5.192  32.407  29.442  1.00 80.79  ? 32  G   B "C1'"  1 
ATOM   8293  N  N9     . G   B 2 32  ? -5.233  33.164  28.173  1.00 71.03  ? 32  G   B N9     1 
ATOM   8294  C  C8     . G   B 2 32  ? -6.350  33.713  27.586  1.00 73.19  ? 32  G   B C8     1 
ATOM   8295  N  N7     . G   B 2 32  ? -6.098  34.331  26.464  1.00 62.66  ? 32  G   B N7     1 
ATOM   8296  C  C5     . G   B 2 32  ? -4.729  34.184  26.294  1.00 61.83  ? 32  G   B C5     1 
ATOM   8297  C  C6     . G   B 2 32  ? -3.885  34.648  25.251  1.00 55.19  ? 32  G   B C6     1 
ATOM   8298  O  O6     . G   B 2 32  ? -4.193  35.299  24.243  1.00 47.54  ? 32  G   B O6     1 
ATOM   8299  N  N1     . G   B 2 32  ? -2.560  34.280  25.469  1.00 49.48  ? 32  G   B N1     1 
ATOM   8300  C  C2     . G   B 2 32  ? -2.106  33.561  26.548  1.00 46.58  ? 32  G   B C2     1 
ATOM   8301  N  N2     . G   B 2 32  ? -0.789  33.307  26.577  1.00 36.25  ? 32  G   B N2     1 
ATOM   8302  N  N3     . G   B 2 32  ? -2.884  33.122  27.528  1.00 50.62  ? 32  G   B N3     1 
ATOM   8303  C  C4     . G   B 2 32  ? -4.177  33.466  27.339  1.00 60.65  ? 32  G   B C4     1 
ATOM   8304  H  "H5'"  . G   B 2 32  ? -8.710  32.931  31.461  1.00 82.53  ? 32  G   B "H5'"  1 
ATOM   8305  H  "H5''" . G   B 2 32  ? -8.069  34.320  31.856  1.00 82.53  ? 32  G   B "H5''" 1 
ATOM   8306  H  "H4'"  . G   B 2 32  ? -6.604  32.359  31.901  1.00 98.67  ? 32  G   B "H4'"  1 
ATOM   8307  H  "H3'"  . G   B 2 32  ? -5.720  34.717  30.638  1.00 91.78  ? 32  G   B "H3'"  1 
ATOM   8308  H  "H2'"  . G   B 2 32  ? -3.728  33.722  30.136  1.00 86.10  ? 32  G   B "H2'"  1 
ATOM   8309  H  "HO2'" . G   B 2 32  ? -4.019  32.423  32.205  1.00 51.61  ? 32  G   B "HO2'" 1 
ATOM   8310  H  "H1'"  . G   B 2 32  ? -4.799  31.533  29.290  1.00 96.94  ? 32  G   B "H1'"  1 
ATOM   8311  H  H8     . G   B 2 32  ? -7.202  33.649  27.953  1.00 87.83  ? 32  G   B H8     1 
ATOM   8312  H  H1     . G   B 2 32  ? -1.980  34.523  24.882  1.00 59.38  ? 32  G   B H1     1 
ATOM   8313  H  H21    . G   B 2 32  ? -0.282  33.591  25.942  1.00 43.50  ? 32  G   B H21    1 
ATOM   8314  H  H22    . G   B 2 32  ? -0.451  32.861  27.230  1.00 43.50  ? 32  G   B H22    1 
ATOM   8315  P  P      . C   B 2 33  ? -4.694  35.915  32.730  1.00 41.70  ? 33  C   B P      1 
ATOM   8316  O  OP1    . C   B 2 33  ? -4.613  36.158  34.192  1.00 63.09  ? 33  C   B OP1    1 
ATOM   8317  O  OP2    . C   B 2 33  ? -5.528  36.814  31.889  1.00 36.34  ? 33  C   B OP2    1 
ATOM   8318  O  "O5'"  . C   B 2 33  ? -3.207  35.934  32.161  1.00 44.44  ? 33  C   B "O5'"  1 
ATOM   8319  C  "C5'"  . C   B 2 33  ? -2.197  35.111  32.727  1.00 39.35  ? 33  C   B "C5'"  1 
ATOM   8320  C  "C4'"  . C   B 2 33  ? -0.878  35.279  32.014  1.00 36.48  ? 33  C   B "C4'"  1 
ATOM   8321  O  "O4'"  . C   B 2 33  ? -0.981  34.774  30.655  1.00 52.94  ? 33  C   B "O4'"  1 
ATOM   8322  C  "C3'"  . C   B 2 33  ? -0.391  36.709  31.836  1.00 25.39  ? 33  C   B "C3'"  1 
ATOM   8323  O  "O3'"  . C   B 2 33  ? 0.222   37.240  32.996  1.00 39.09  ? 33  C   B "O3'"  1 
ATOM   8324  C  "C2'"  . C   B 2 33  ? 0.545   36.591  30.641  1.00 32.89  ? 33  C   B "C2'"  1 
ATOM   8325  O  "O2'"  . C   B 2 33  ? 1.805   36.050  31.017  1.00 23.81  ? 33  C   B "O2'"  1 
ATOM   8326  C  "C1'"  . C   B 2 33  ? -0.200  35.569  29.784  1.00 37.74  ? 33  C   B "C1'"  1 
ATOM   8327  N  N1     . C   B 2 33  ? -1.097  36.228  28.804  1.00 16.68  ? 33  C   B N1     1 
ATOM   8328  C  C2     . C   B 2 33  ? -0.533  36.809  27.666  1.00 27.28  ? 33  C   B C2     1 
ATOM   8329  O  O2     . C   B 2 33  ? 0.699   36.750  27.509  1.00 26.80  ? 33  C   B O2     1 
ATOM   8330  N  N3     . C   B 2 33  ? -1.343  37.419  26.767  1.00 43.20  ? 33  C   B N3     1 
ATOM   8331  C  C4     . C   B 2 33  ? -2.663  37.464  26.967  1.00 29.66  ? 33  C   B C4     1 
ATOM   8332  N  N4     . C   B 2 33  ? -3.425  38.074  26.054  1.00 26.90  ? 33  C   B N4     1 
ATOM   8333  C  C5     . C   B 2 33  ? -3.261  36.880  28.119  1.00 20.29  ? 33  C   B C5     1 
ATOM   8334  C  C6     . C   B 2 33  ? -2.450  36.282  29.001  1.00 23.83  ? 33  C   B C6     1 
ATOM   8335  H  "H5'"  . C   B 2 33  ? -2.474  34.183  32.665  1.00 47.22  ? 33  C   B "H5'"  1 
ATOM   8336  H  "H5''" . C   B 2 33  ? -2.084  35.346  33.661  1.00 47.22  ? 33  C   B "H5''" 1 
ATOM   8337  H  "H4'"  . C   B 2 33  ? -0.199  34.772  32.486  1.00 43.78  ? 33  C   B "H4'"  1 
ATOM   8338  H  "H3'"  . C   B 2 33  ? -1.143  37.271  31.592  1.00 30.46  ? 33  C   B "H3'"  1 
ATOM   8339  H  "H2'"  . C   B 2 33  ? 0.641   37.438  30.179  1.00 39.46  ? 33  C   B "H2'"  1 
ATOM   8340  H  "HO2'" . C   B 2 33  ? 1.881   35.280  30.691  1.00 28.57  ? 33  C   B "HO2'" 1 
ATOM   8341  H  "H1'"  . C   B 2 33  ? 0.438   35.008  29.316  1.00 45.28  ? 33  C   B "H1'"  1 
ATOM   8342  H  H41    . C   B 2 33  ? -4.277  38.115  26.162  1.00 32.28  ? 33  C   B H41    1 
ATOM   8343  H  H42    . C   B 2 33  ? -3.063  38.427  25.358  1.00 32.28  ? 33  C   B H42    1 
ATOM   8344  H  H5     . C   B 2 33  ? -4.181  36.914  28.254  1.00 24.35  ? 33  C   B H5     1 
ATOM   8345  H  H6     . C   B 2 33  ? -2.815  35.893  29.763  1.00 28.60  ? 33  C   B H6     1 
ATOM   8346  P  P      . C   B 2 34  ? 0.235   38.827  33.243  1.00 24.51  ? 34  C   B P      1 
ATOM   8347  O  OP1    . C   B 2 34  ? 0.901   39.063  34.551  1.00 30.80  ? 34  C   B OP1    1 
ATOM   8348  O  OP2    . C   B 2 34  ? -1.125  39.367  32.996  1.00 19.39  ? 34  C   B OP2    1 
ATOM   8349  O  "O5'"  . C   B 2 34  ? 1.177   39.382  32.086  1.00 19.79  ? 34  C   B "O5'"  1 
ATOM   8350  C  "C5'"  . C   B 2 34  ? 2.553   39.039  32.043  1.00 26.03  ? 34  C   B "C5'"  1 
ATOM   8351  C  "C4'"  . C   B 2 34  ? 3.225   39.579  30.807  1.00 18.39  ? 34  C   B "C4'"  1 
ATOM   8352  O  "O4'"  . C   B 2 34  ? 2.613   39.024  29.615  1.00 23.55  ? 34  C   B "O4'"  1 
ATOM   8353  C  "C3'"  . C   B 2 34  ? 3.129   41.079  30.598  1.00 6.31   ? 34  C   B "C3'"  1 
ATOM   8354  O  "O3'"  . C   B 2 34  ? 4.056   41.796  31.386  1.00 8.29   ? 34  C   B "O3'"  1 
ATOM   8355  C  "C2'"  . C   B 2 34  ? 3.365   41.215  29.103  1.00 13.13  ? 34  C   B "C2'"  1 
ATOM   8356  O  "O2'"  . C   B 2 34  ? 4.747   41.108  28.792  1.00 27.18  ? 34  C   B "O2'"  1 
ATOM   8357  C  "C1'"  . C   B 2 34  ? 2.640   39.980  28.574  1.00 19.75  ? 34  C   B "C1'"  1 
ATOM   8358  N  N1     . C   B 2 34  ? 1.250   40.291  28.176  1.00 15.05  ? 34  C   B N1     1 
ATOM   8359  C  C2     . C   B 2 34  ? 1.038   40.911  26.946  1.00 17.94  ? 34  C   B C2     1 
ATOM   8360  O  O2     . C   B 2 34  ? 2.019   41.176  26.236  1.00 20.93  ? 34  C   B O2     1 
ATOM   8361  N  N3     . C   B 2 34  ? -0.226  41.204  26.565  1.00 23.63  ? 34  C   B N3     1 
ATOM   8362  C  C4     . C   B 2 34  ? -1.249  40.901  27.363  1.00 9.06   ? 34  C   B C4     1 
ATOM   8363  N  N4     . C   B 2 34  ? -2.481  41.202  26.959  1.00 23.09  ? 34  C   B N4     1 
ATOM   8364  C  C5     . C   B 2 34  ? -1.061  40.270  28.619  1.00 13.55  ? 34  C   B C5     1 
ATOM   8365  C  C6     . C   B 2 34  ? 0.193   39.986  28.985  1.00 21.67  ? 34  C   B C6     1 
ATOM   8366  H  "H5'"  . C   B 2 34  ? 2.638   38.072  32.052  1.00 31.23  ? 34  C   B "H5'"  1 
ATOM   8367  H  "H5''" . C   B 2 34  ? 2.994   39.402  32.827  1.00 31.23  ? 34  C   B "H5''" 1 
ATOM   8368  H  "H4'"  . C   B 2 34  ? 4.161   39.326  30.824  1.00 22.07  ? 34  C   B "H4'"  1 
ATOM   8369  H  "H3'"  . C   B 2 34  ? 2.230   41.376  30.810  1.00 7.58   ? 34  C   B "H3'"  1 
ATOM   8370  H  "H2'"  . C   B 2 34  ? 2.978   42.033  28.753  1.00 15.75  ? 34  C   B "H2'"  1 
ATOM   8371  H  "HO2'" . C   B 2 34  ? 4.880   40.388  28.382  1.00 32.61  ? 34  C   B "HO2'" 1 
ATOM   8372  H  "H1'"  . C   B 2 34  ? 3.123   39.619  27.815  1.00 23.70  ? 34  C   B "H1'"  1 
ATOM   8373  H  H41    . C   B 2 34  ? -3.156  41.015  27.459  1.00 27.71  ? 34  C   B H41    1 
ATOM   8374  H  H42    . C   B 2 34  ? -2.603  41.584  26.198  1.00 27.71  ? 34  C   B H42    1 
ATOM   8375  H  H5     . C   B 2 34  ? -1.783  40.063  29.168  1.00 16.26  ? 34  C   B H5     1 
ATOM   8376  H  H6     . C   B 2 34  ? 0.349   39.572  29.803  1.00 26.01  ? 34  C   B H6     1 
ATOM   8377  P  P      . A   B 2 35  ? 3.718   43.278  31.890  1.00 11.95  ? 35  A   B P      1 
ATOM   8378  O  OP1    . A   B 2 35  ? 4.811   43.656  32.821  1.00 22.45  ? 35  A   B OP1    1 
ATOM   8379  O  OP2    . A   B 2 35  ? 2.306   43.322  32.347  1.00 21.05  ? 35  A   B OP2    1 
ATOM   8380  O  "O5'"  . A   B 2 35  ? 3.862   44.174  30.580  1.00 16.45  ? 35  A   B "O5'"  1 
ATOM   8381  C  "C5'"  . A   B 2 35  ? 5.123   44.309  29.943  1.00 20.50  ? 35  A   B "C5'"  1 
ATOM   8382  C  "C4'"  . A   B 2 35  ? 5.029   45.074  28.647  1.00 14.86  ? 35  A   B "C4'"  1 
ATOM   8383  O  "O4'"  . A   B 2 35  ? 4.212   44.347  27.698  1.00 18.41  ? 35  A   B "O4'"  1 
ATOM   8384  C  "C3'"  . A   B 2 35  ? 4.374   46.442  28.721  1.00 28.32  ? 35  A   B "C3'"  1 
ATOM   8385  O  "O3'"  . A   B 2 35  ? 5.254   47.444  29.203  1.00 31.62  ? 35  A   B "O3'"  1 
ATOM   8386  C  "C2'"  . A   B 2 35  ? 3.913   46.672  27.287  1.00 18.64  ? 35  A   B "C2'"  1 
ATOM   8387  O  "O2'"  . A   B 2 35  ? 4.977   47.143  26.472  1.00 14.72  ? 35  A   B "O2'"  1 
ATOM   8388  C  "C1'"  . A   B 2 35  ? 3.548   45.254  26.844  1.00 17.68  ? 35  A   B "C1'"  1 
ATOM   8389  N  N9     . A   B 2 35  ? 2.100   44.985  26.890  1.00 18.59  ? 35  A   B N9     1 
ATOM   8390  C  C8     . A   B 2 35  ? 1.325   44.578  27.948  1.00 19.44  ? 35  A   B C8     1 
ATOM   8391  N  N7     . A   B 2 35  ? 0.058   44.417  27.640  1.00 23.20  ? 35  A   B N7     1 
ATOM   8392  C  C5     . A   B 2 35  ? -0.001  44.734  26.287  1.00 29.20  ? 35  A   B C5     1 
ATOM   8393  C  C6     . A   B 2 35  ? -1.058  44.764  25.353  1.00 31.14  ? 35  A   B C6     1 
ATOM   8394  N  N6     . A   B 2 35  ? -2.323  44.453  25.644  1.00 20.98  ? 35  A   B N6     1 
ATOM   8395  N  N1     . A   B 2 35  ? -0.766  45.129  24.084  1.00 38.12  ? 35  A   B N1     1 
ATOM   8396  C  C2     . A   B 2 35  ? 0.500   45.441  23.777  1.00 19.38  ? 35  A   B C2     1 
ATOM   8397  N  N3     . A   B 2 35  ? 1.575   45.449  24.561  1.00 15.13  ? 35  A   B N3     1 
ATOM   8398  C  C4     . A   B 2 35  ? 1.252   45.085  25.815  1.00 23.89  ? 35  A   B C4     1 
ATOM   8399  H  "H5'"  . A   B 2 35  ? 5.480   43.425  29.761  1.00 24.60  ? 35  A   B "H5'"  1 
ATOM   8400  H  "H5''" . A   B 2 35  ? 5.729   44.776  30.540  1.00 24.60  ? 35  A   B "H5''" 1 
ATOM   8401  H  "H4'"  . A   B 2 35  ? 5.920   45.174  28.279  1.00 17.83  ? 35  A   B "H4'"  1 
ATOM   8402  H  "H3'"  . A   B 2 35  ? 3.599   46.393  29.301  1.00 33.99  ? 35  A   B "H3'"  1 
ATOM   8403  H  "H2'"  . A   B 2 35  ? 3.145   47.263  27.251  1.00 22.37  ? 35  A   B "H2'"  1 
ATOM   8404  H  "HO2'" . A   B 2 35  ? 5.180   47.922  26.711  1.00 17.66  ? 35  A   B "HO2'" 1 
ATOM   8405  H  "H1'"  . A   B 2 35  ? 3.864   45.118  25.937  1.00 21.21  ? 35  A   B "H1'"  1 
ATOM   8406  H  H8     . A   B 2 35  ? 1.664   44.432  28.801  1.00 23.32  ? 35  A   B H8     1 
ATOM   8407  H  H61    . A   B 2 35  ? -2.926  44.488  25.032  1.00 25.17  ? 35  A   B H61    1 
ATOM   8408  H  H62    . A   B 2 35  ? -2.535  44.217  26.444  1.00 25.17  ? 35  A   B H62    1 
ATOM   8409  H  H2     . A   B 2 35  ? 0.649   45.683  22.891  1.00 23.25  ? 35  A   B H2     1 
ATOM   8410  P  P      . C   B 2 36  ? 4.730   48.534  30.259  1.00 30.23  ? 36  C   B P      1 
ATOM   8411  O  OP1    . C   B 2 36  ? 5.899   49.283  30.789  1.00 33.38  ? 36  C   B OP1    1 
ATOM   8412  O  OP2    . C   B 2 36  ? 3.803   47.839  31.195  1.00 27.75  ? 36  C   B OP2    1 
ATOM   8413  O  "O5'"  . C   B 2 36  ? 3.881   49.544  29.368  1.00 24.05  ? 36  C   B "O5'"  1 
ATOM   8414  C  "C5'"  . C   B 2 36  ? 4.478   50.226  28.276  1.00 18.71  ? 36  C   B "C5'"  1 
ATOM   8415  C  "C4'"  . C   B 2 36  ? 3.445   50.923  27.430  1.00 28.42  ? 36  C   B "C4'"  1 
ATOM   8416  O  "O4'"  . C   B 2 36  ? 2.577   49.935  26.825  1.00 28.19  ? 36  C   B "O4'"  1 
ATOM   8417  C  "C3'"  . C   B 2 36  ? 2.496   51.866  28.159  1.00 23.98  ? 36  C   B "C3'"  1 
ATOM   8418  O  "O3'"  . C   B 2 36  ? 3.056   53.156  28.368  1.00 24.17  ? 36  C   B "O3'"  1 
ATOM   8419  C  "C2'"  . C   B 2 36  ? 1.269   51.880  27.247  1.00 25.29  ? 36  C   B "C2'"  1 
ATOM   8420  O  "O2'"  . C   B 2 36  ? 1.428   52.805  26.181  1.00 33.87  ? 36  C   B "O2'"  1 
ATOM   8421  C  "C1'"  . C   B 2 36  ? 1.277   50.460  26.674  1.00 24.71  ? 36  C   B "C1'"  1 
ATOM   8422  N  N1     . C   B 2 36  ? 0.312   49.556  27.341  1.00 21.23  ? 36  C   B N1     1 
ATOM   8423  C  C2     . C   B 2 36  ? -1.041  49.694  27.029  1.00 16.77  ? 36  C   B C2     1 
ATOM   8424  O  O2     . C   B 2 36  ? -1.372  50.580  26.227  1.00 22.90  ? 36  C   B O2     1 
ATOM   8425  N  N3     . C   B 2 36  ? -1.945  48.872  27.613  1.00 13.61  ? 36  C   B N3     1 
ATOM   8426  C  C4     . C   B 2 36  ? -1.534  47.937  28.472  1.00 18.35  ? 36  C   B C4     1 
ATOM   8427  N  N4     . C   B 2 36  ? -2.447  47.143  29.031  1.00 25.60  ? 36  C   B N4     1 
ATOM   8428  C  C5     . C   B 2 36  ? -0.159  47.768  28.802  1.00 24.92  ? 36  C   B C5     1 
ATOM   8429  C  C6     . C   B 2 36  ? 0.723   48.587  28.216  1.00 27.47  ? 36  C   B C6     1 
ATOM   8430  H  "H5'"  . C   B 2 36  ? 4.958   49.586  27.727  1.00 22.46  ? 36  C   B "H5'"  1 
ATOM   8431  H  "H5''" . C   B 2 36  ? 5.105   50.883  28.617  1.00 22.46  ? 36  C   B "H5''" 1 
ATOM   8432  H  "H4'"  . C   B 2 36  ? 3.897   51.416  26.727  1.00 34.11  ? 36  C   B "H4'"  1 
ATOM   8433  H  "H3'"  . C   B 2 36  ? 2.254   51.478  29.015  1.00 28.78  ? 36  C   B "H3'"  1 
ATOM   8434  H  "H2'"  . C   B 2 36  ? 0.458   52.052  27.750  1.00 30.34  ? 36  C   B "H2'"  1 
ATOM   8435  H  "HO2'" . C   B 2 36  ? 1.493   52.381  25.459  1.00 40.64  ? 36  C   B "HO2'" 1 
ATOM   8436  H  "H1'"  . C   B 2 36  ? 1.064   50.502  25.729  1.00 29.66  ? 36  C   B "H1'"  1 
ATOM   8437  H  H41    . C   B 2 36  ? -2.204  46.533  29.587  1.00 30.72  ? 36  C   B H41    1 
ATOM   8438  H  H42    . C   B 2 36  ? -3.279  47.239  28.835  1.00 30.72  ? 36  C   B H42    1 
ATOM   8439  H  H5     . C   B 2 36  ? 0.115   47.112  29.402  1.00 29.90  ? 36  C   B H5     1 
ATOM   8440  H  H6     . C   B 2 36  ? 1.628   48.501  28.412  1.00 32.96  ? 36  C   B H6     1 
ATOM   8441  P  P      . C   B 2 37  ? 3.674   53.577  29.794  1.00 33.83  ? 37  C   B P      1 
ATOM   8442  O  OP1    . C   B 2 37  ? 4.125   54.991  29.694  1.00 31.40  ? 37  C   B OP1    1 
ATOM   8443  O  OP2    . C   B 2 37  ? 4.659   52.557  30.231  1.00 16.40  ? 37  C   B OP2    1 
ATOM   8444  O  "O5'"  . C   B 2 37  ? 2.430   53.507  30.787  1.00 19.27  ? 37  C   B "O5'"  1 
ATOM   8445  C  "C5'"  . C   B 2 37  ? 1.395   54.485  30.739  1.00 23.10  ? 37  C   B "C5'"  1 
ATOM   8446  C  "C4'"  . C   B 2 37  ? 0.775   54.713  32.097  1.00 32.38  ? 37  C   B "C4'"  1 
ATOM   8447  O  "O4'"  . C   B 2 37  ? 0.098   53.499  32.520  1.00 23.26  ? 37  C   B "O4'"  1 
ATOM   8448  C  "C3'"  . C   B 2 37  ? 1.756   55.068  33.212  1.00 25.06  ? 37  C   B "C3'"  1 
ATOM   8449  O  "O3'"  . C   B 2 37  ? 1.155   55.991  34.118  1.00 55.42  ? 37  C   B "O3'"  1 
ATOM   8450  C  "C2'"  . C   B 2 37  ? 1.980   53.733  33.911  1.00 23.29  ? 37  C   B "C2'"  1 
ATOM   8451  O  "O2'"  . C   B 2 37  ? 2.358   53.841  35.265  1.00 49.50  ? 37  C   B "O2'"  1 
ATOM   8452  C  "C1'"  . C   B 2 37  ? 0.615   53.066  33.763  1.00 17.98  ? 37  C   B "C1'"  1 
ATOM   8453  N  N1     . C   B 2 37  ? 0.681   51.596  33.739  1.00 28.40  ? 37  C   B N1     1 
ATOM   8454  C  C2     . C   B 2 37  ? 0.358   50.846  34.878  1.00 29.12  ? 37  C   B C2     1 
ATOM   8455  O  O2     . C   B 2 37  ? 0.006   51.428  35.913  1.00 39.68  ? 37  C   B O2     1 
ATOM   8456  N  N3     . C   B 2 37  ? 0.434   49.494  34.826  1.00 16.86  ? 37  C   B N3     1 
ATOM   8457  C  C4     . C   B 2 37  ? 0.817   48.891  33.700  1.00 23.99  ? 37  C   B C4     1 
ATOM   8458  N  N4     . C   B 2 37  ? 0.882   47.557  33.688  1.00 35.22  ? 37  C   B N4     1 
ATOM   8459  C  C5     . C   B 2 37  ? 1.153   49.628  32.528  1.00 28.64  ? 37  C   B C5     1 
ATOM   8460  C  C6     . C   B 2 37  ? 1.073   50.962  32.593  1.00 27.09  ? 37  C   B C6     1 
ATOM   8461  H  "H5'"  . C   B 2 37  ? 0.707   54.186  30.124  1.00 27.72  ? 37  C   B "H5'"  1 
ATOM   8462  H  "H5''" . C   B 2 37  ? 1.766   55.321  30.416  1.00 27.72  ? 37  C   B "H5''" 1 
ATOM   8463  H  "H4'"  . C   B 2 37  ? 0.120   55.425  32.023  1.00 38.85  ? 37  C   B "H4'"  1 
ATOM   8464  H  "H3'"  . C   B 2 37  ? 2.586   55.417  32.851  1.00 30.08  ? 37  C   B "H3'"  1 
ATOM   8465  H  "HO3'" . C   B 2 37  ? 1.502   56.747  34.239  1.00 66.51  ? 37  C   B "HO3'" 1 
ATOM   8466  H  "H2'"  . C   B 2 37  ? 2.645   53.221  33.427  1.00 27.95  ? 37  C   B "H2'"  1 
ATOM   8467  H  "HO2'" . C   B 2 37  ? 3.111   54.211  35.310  1.00 59.40  ? 37  C   B "HO2'" 1 
ATOM   8468  H  "H1'"  . C   B 2 37  ? 0.029   53.357  34.480  1.00 21.57  ? 37  C   B "H1'"  1 
ATOM   8469  H  H41    . C   B 2 37  ? 1.126   47.145  32.974  1.00 42.27  ? 37  C   B H41    1 
ATOM   8470  H  H42    . C   B 2 37  ? 0.679   47.111  34.395  1.00 42.27  ? 37  C   B H42    1 
ATOM   8471  H  H5     . C   B 2 37  ? 1.418   49.198  31.748  1.00 34.37  ? 37  C   B H5     1 
ATOM   8472  H  H6     . C   B 2 37  ? 1.288   51.468  31.843  1.00 32.51  ? 37  C   B H6     1 
ATOM   8473  N  N      . MET C 1 1   ? 13.247  -12.063 -30.594 1.00 120.80 ? 1   MET C N      1 
ATOM   8474  C  CA     . MET C 1 1   ? 13.489  -10.900 -29.690 1.00 122.09 ? 1   MET C CA     1 
ATOM   8475  C  C      . MET C 1 1   ? 12.532  -10.914 -28.499 1.00 117.54 ? 1   MET C C      1 
ATOM   8476  O  O      . MET C 1 1   ? 12.394  -9.915  -27.792 1.00 114.93 ? 1   MET C O      1 
ATOM   8477  C  CB     . MET C 1 1   ? 13.344  -9.586  -30.463 1.00 122.16 ? 1   MET C CB     1 
ATOM   8478  C  CG     . MET C 1 1   ? 14.381  -9.382  -31.559 1.00 124.33 ? 1   MET C CG     1 
ATOM   8479  S  SD     . MET C 1 1   ? 15.762  -8.329  -31.060 1.00 128.11 ? 1   MET C SD     1 
ATOM   8480  C  CE     . MET C 1 1   ? 16.619  -9.366  -29.876 1.00 92.59  ? 1   MET C CE     1 
ATOM   8481  H  H1     . MET C 1 1   ? 13.532  -11.865 -31.414 1.00 144.96 ? 1   MET C H1     1 
ATOM   8482  H  H2     . MET C 1 1   ? 13.688  -12.773 -30.289 1.00 144.96 ? 1   MET C H2     1 
ATOM   8483  H  H3     . MET C 1 1   ? 12.375  -12.242 -30.618 1.00 144.96 ? 1   MET C H3     1 
ATOM   8484  H  HA     . MET C 1 1   ? 14.400  -10.949 -29.358 1.00 146.51 ? 1   MET C HA     1 
ATOM   8485  H  HB2    . MET C 1 1   ? 12.468  -9.566  -30.880 1.00 146.60 ? 1   MET C HB2    1 
ATOM   8486  H  HB3    . MET C 1 1   ? 13.426  -8.848  -29.839 1.00 146.60 ? 1   MET C HB3    1 
ATOM   8487  H  HG2    . MET C 1 1   ? 14.743  -10.246 -31.812 1.00 149.19 ? 1   MET C HG2    1 
ATOM   8488  H  HG3    . MET C 1 1   ? 13.952  -8.967  -32.323 1.00 149.19 ? 1   MET C HG3    1 
ATOM   8489  H  HE1    . MET C 1 1   ? 16.016  -9.577  -29.146 1.00 111.11 ? 1   MET C HE1    1 
ATOM   8490  H  HE2    . MET C 1 1   ? 16.902  -10.182 -30.317 1.00 111.11 ? 1   MET C HE2    1 
ATOM   8491  H  HE3    . MET C 1 1   ? 17.392  -8.887  -29.539 1.00 111.11 ? 1   MET C HE3    1 
ATOM   8492  N  N      . LYS C 1 2   ? 11.878  -12.051 -28.281 1.00 126.23 ? 2   LYS C N      1 
ATOM   8493  C  CA     . LYS C 1 2   ? 10.906  -12.194 -27.202 1.00 130.14 ? 2   LYS C CA     1 
ATOM   8494  C  C      . LYS C 1 2   ? 11.605  -12.336 -25.849 1.00 108.93 ? 2   LYS C C      1 
ATOM   8495  O  O      . LYS C 1 2   ? 12.777  -11.983 -25.704 1.00 96.76  ? 2   LYS C O      1 
ATOM   8496  C  CB     . LYS C 1 2   ? 10.006  -13.405 -27.465 1.00 125.87 ? 2   LYS C CB     1 
ATOM   8497  C  CG     . LYS C 1 2   ? 8.556   -13.231 -27.018 1.00 127.33 ? 2   LYS C CG     1 
ATOM   8498  C  CD     . LYS C 1 2   ? 7.731   -14.483 -27.275 1.00 111.99 ? 2   LYS C CD     1 
ATOM   8499  C  CE     . LYS C 1 2   ? 8.225   -15.671 -26.461 1.00 94.90  ? 2   LYS C CE     1 
ATOM   8500  N  NZ     . LYS C 1 2   ? 7.386   -16.876 -26.681 1.00 84.24  ? 2   LYS C NZ     1 
ATOM   8501  H  H      . LYS C 1 2   ? 11.982  -12.764 -28.751 1.00 151.48 ? 2   LYS C H      1 
ATOM   8502  H  HA     . LYS C 1 2   ? 10.346  -11.403 -27.172 1.00 156.16 ? 2   LYS C HA     1 
ATOM   8503  H  HB2    . LYS C 1 2   ? 10.000  -13.585 -28.418 1.00 151.05 ? 2   LYS C HB2    1 
ATOM   8504  H  HB3    . LYS C 1 2   ? 10.370  -14.170 -26.991 1.00 151.05 ? 2   LYS C HB3    1 
ATOM   8505  H  HG2    . LYS C 1 2   ? 8.535   -13.045 -26.067 1.00 152.80 ? 2   LYS C HG2    1 
ATOM   8506  H  HG3    . LYS C 1 2   ? 8.156   -12.498 -27.512 1.00 152.80 ? 2   LYS C HG3    1 
ATOM   8507  H  HD2    . LYS C 1 2   ? 6.808   -14.312 -27.030 1.00 134.39 ? 2   LYS C HD2    1 
ATOM   8508  H  HD3    . LYS C 1 2   ? 7.789   -14.716 -28.215 1.00 134.39 ? 2   LYS C HD3    1 
ATOM   8509  H  HE2    . LYS C 1 2   ? 9.135   -15.882 -26.725 1.00 113.88 ? 2   LYS C HE2    1 
ATOM   8510  H  HE3    . LYS C 1 2   ? 8.193   -15.447 -25.518 1.00 113.88 ? 2   LYS C HE3    1 
ATOM   8511  H  HZ1    . LYS C 1 2   ? 7.696   -17.555 -26.196 1.00 101.09 ? 2   LYS C HZ1    1 
ATOM   8512  H  HZ2    . LYS C 1 2   ? 6.546   -16.709 -26.443 1.00 101.09 ? 2   LYS C HZ2    1 
ATOM   8513  H  HZ3    . LYS C 1 2   ? 7.403   -17.105 -27.541 1.00 101.09 ? 2   LYS C HZ3    1 
ATOM   8514  N  N      . VAL C 1 3   ? 10.880  -12.856 -24.861 1.00 100.63 ? 3   VAL C N      1 
ATOM   8515  C  CA     . VAL C 1 3   ? 11.423  -13.053 -23.521 1.00 100.11 ? 3   VAL C CA     1 
ATOM   8516  C  C      . VAL C 1 3   ? 12.302  -14.302 -23.471 1.00 94.16  ? 3   VAL C C      1 
ATOM   8517  O  O      . VAL C 1 3   ? 13.308  -14.344 -22.760 1.00 67.89  ? 3   VAL C O      1 
ATOM   8518  C  CB     . VAL C 1 3   ? 10.292  -13.178 -22.467 1.00 87.04  ? 3   VAL C CB     1 
ATOM   8519  C  CG1    . VAL C 1 3   ? 9.518   -11.872 -22.366 1.00 72.57  ? 3   VAL C CG1    1 
ATOM   8520  C  CG2    . VAL C 1 3   ? 9.341   -14.327 -22.808 1.00 94.97  ? 3   VAL C CG2    1 
ATOM   8521  H  H      . VAL C 1 3   ? 10.061  -13.105 -24.944 1.00 120.76 ? 3   VAL C H      1 
ATOM   8522  H  HA     . VAL C 1 3   ? 11.971  -12.288 -23.285 1.00 120.13 ? 3   VAL C HA     1 
ATOM   8523  H  HB     . VAL C 1 3   ? 10.687  -13.361 -21.600 1.00 104.45 ? 3   VAL C HB     1 
ATOM   8524  H  HG11   . VAL C 1 3   ? 8.817   -11.972 -21.703 1.00 87.08  ? 3   VAL C HG11   1 
ATOM   8525  H  HG12   . VAL C 1 3   ? 10.126  -11.164 -22.101 1.00 87.08  ? 3   VAL C HG12   1 
ATOM   8526  H  HG13   . VAL C 1 3   ? 9.129   -11.668 -23.231 1.00 87.08  ? 3   VAL C HG13   1 
ATOM   8527  H  HG21   . VAL C 1 3   ? 8.649   -14.375 -22.130 1.00 113.97 ? 3   VAL C HG21   1 
ATOM   8528  H  HG22   . VAL C 1 3   ? 8.943   -14.159 -23.677 1.00 113.97 ? 3   VAL C HG22   1 
ATOM   8529  H  HG23   . VAL C 1 3   ? 9.844   -15.156 -22.828 1.00 113.97 ? 3   VAL C HG23   1 
ATOM   8530  N  N      . GLU C 1 4   ? 11.908  -15.315 -24.237 1.00 109.75 ? 4   GLU C N      1 
ATOM   8531  C  CA     . GLU C 1 4   ? 12.618  -16.588 -24.283 1.00 103.42 ? 4   GLU C CA     1 
ATOM   8532  C  C      . GLU C 1 4   ? 13.658  -16.599 -25.403 1.00 100.78 ? 4   GLU C C      1 
ATOM   8533  O  O      . GLU C 1 4   ? 14.666  -17.303 -25.320 1.00 86.92  ? 4   GLU C O      1 
ATOM   8534  C  CB     . GLU C 1 4   ? 11.625  -17.736 -24.466 1.00 109.32 ? 4   GLU C CB     1 
ATOM   8535  C  CG     . GLU C 1 4   ? 12.208  -19.108 -24.172 1.00 120.89 ? 4   GLU C CG     1 
ATOM   8536  C  CD     . GLU C 1 4   ? 11.172  -20.213 -24.247 1.00 145.49 ? 4   GLU C CD     1 
ATOM   8537  O  OE1    . GLU C 1 4   ? 9.962   -19.901 -24.239 1.00 139.42 ? 4   GLU C OE1    1 
ATOM   8538  O  OE2    . GLU C 1 4   ? 11.569  -21.396 -24.310 1.00 149.28 ? 4   GLU C OE2    1 
ATOM   8539  H  H      . GLU C 1 4   ? 11.218  -15.288 -24.749 1.00 131.70 ? 4   GLU C H      1 
ATOM   8540  H  HA     . GLU C 1 4   ? 13.081  -16.722 -23.441 1.00 124.10 ? 4   GLU C HA     1 
ATOM   8541  H  HB2    . GLU C 1 4   ? 10.875  -17.599 -23.866 1.00 131.18 ? 4   GLU C HB2    1 
ATOM   8542  H  HB3    . GLU C 1 4   ? 11.314  -17.737 -25.385 1.00 131.18 ? 4   GLU C HB3    1 
ATOM   8543  H  HG2    . GLU C 1 4   ? 12.902  -19.302 -24.821 1.00 145.07 ? 4   GLU C HG2    1 
ATOM   8544  H  HG3    . GLU C 1 4   ? 12.582  -19.107 -23.277 1.00 145.07 ? 4   GLU C HG3    1 
ATOM   8545  N  N      . GLU C 1 5   ? 13.400  -15.819 -26.449 1.00 110.18 ? 5   GLU C N      1 
ATOM   8546  C  CA     . GLU C 1 5   ? 14.287  -15.741 -27.608 1.00 101.02 ? 5   GLU C CA     1 
ATOM   8547  C  C      . GLU C 1 5   ? 15.645  -15.133 -27.252 1.00 92.13  ? 5   GLU C C      1 
ATOM   8548  O  O      . GLU C 1 5   ? 16.655  -15.436 -27.889 1.00 83.92  ? 5   GLU C O      1 
ATOM   8549  C  CB     . GLU C 1 5   ? 13.635  -14.910 -28.719 1.00 97.41  ? 5   GLU C CB     1 
ATOM   8550  C  CG     . GLU C 1 5   ? 12.251  -15.392 -29.162 1.00 106.33 ? 5   GLU C CG     1 
ATOM   8551  C  CD     . GLU C 1 5   ? 12.290  -16.673 -29.980 1.00 122.08 ? 5   GLU C CD     1 
ATOM   8552  O  OE1    . GLU C 1 5   ? 11.270  -17.398 -30.000 1.00 87.12  ? 5   GLU C OE1    1 
ATOM   8553  O  OE2    . GLU C 1 5   ? 13.332  -16.953 -30.613 1.00 124.23 ? 5   GLU C OE2    1 
ATOM   8554  H  H      . GLU C 1 5   ? 12.705  -15.317 -26.513 1.00 132.22 ? 5   GLU C H      1 
ATOM   8555  H  HA     . GLU C 1 5   ? 14.439  -16.636 -27.951 1.00 121.22 ? 5   GLU C HA     1 
ATOM   8556  H  HB2    . GLU C 1 5   ? 13.540  -13.997 -28.406 1.00 116.89 ? 5   GLU C HB2    1 
ATOM   8557  H  HB3    . GLU C 1 5   ? 14.214  -14.928 -29.498 1.00 116.89 ? 5   GLU C HB3    1 
ATOM   8558  H  HG2    . GLU C 1 5   ? 11.709  -15.558 -28.374 1.00 127.59 ? 5   GLU C HG2    1 
ATOM   8559  H  HG3    . GLU C 1 5   ? 11.838  -14.703 -29.706 1.00 127.59 ? 5   GLU C HG3    1 
ATOM   8560  N  N      . ILE C 1 6   ? 15.660  -14.275 -26.234 1.00 84.83  ? 6   ILE C N      1 
ATOM   8561  C  CA     . ILE C 1 6   ? 16.873  -13.553 -25.852 1.00 81.67  ? 6   ILE C CA     1 
ATOM   8562  C  C      . ILE C 1 6   ? 17.803  -14.387 -24.961 1.00 81.21  ? 6   ILE C C      1 
ATOM   8563  O  O      . ILE C 1 6   ? 19.023  -14.317 -25.112 1.00 66.53  ? 6   ILE C O      1 
ATOM   8564  C  CB     . ILE C 1 6   ? 16.518  -12.220 -25.145 1.00 78.47  ? 6   ILE C CB     1 
ATOM   8565  C  CG1    . ILE C 1 6   ? 15.868  -11.263 -26.154 1.00 85.63  ? 6   ILE C CG1    1 
ATOM   8566  C  CG2    . ILE C 1 6   ? 17.766  -11.561 -24.545 1.00 73.87  ? 6   ILE C CG2    1 
ATOM   8567  C  CD1    . ILE C 1 6   ? 15.341  -9.966  -25.558 1.00 71.46  ? 6   ILE C CD1    1 
ATOM   8568  H  H      . ILE C 1 6   ? 14.977  -14.092 -25.745 1.00 101.79 ? 6   ILE C H      1 
ATOM   8569  H  HA     . ILE C 1 6   ? 17.365  -13.333 -26.659 1.00 98.01  ? 6   ILE C HA     1 
ATOM   8570  H  HB     . ILE C 1 6   ? 15.886  -12.401 -24.432 1.00 94.17  ? 6   ILE C HB     1 
ATOM   8571  H  HG12   . ILE C 1 6   ? 16.527  -11.030 -26.827 1.00 102.75 ? 6   ILE C HG12   1 
ATOM   8572  H  HG13   . ILE C 1 6   ? 15.121  -11.718 -26.573 1.00 102.75 ? 6   ILE C HG13   1 
ATOM   8573  H  HG21   . ILE C 1 6   ? 17.508  -10.732 -24.112 1.00 88.65  ? 6   ILE C HG21   1 
ATOM   8574  H  HG22   . ILE C 1 6   ? 18.161  -12.165 -23.897 1.00 88.65  ? 6   ILE C HG22   1 
ATOM   8575  H  HG23   . ILE C 1 6   ? 18.400  -11.379 -25.257 1.00 88.65  ? 6   ILE C HG23   1 
ATOM   8576  H  HD11   . ILE C 1 6   ? 14.951  -9.430  -26.267 1.00 85.75  ? 6   ILE C HD11   1 
ATOM   8577  H  HD12   . ILE C 1 6   ? 14.667  -10.175 -24.892 1.00 85.75  ? 6   ILE C HD12   1 
ATOM   8578  H  HD13   . ILE C 1 6   ? 16.076  -9.486  -25.146 1.00 85.75  ? 6   ILE C HD13   1 
ATOM   8579  N  N      . LEU C 1 7   ? 17.241  -15.181 -24.050 1.00 74.66  ? 7   LEU C N      1 
ATOM   8580  C  CA     . LEU C 1 7   ? 18.061  -16.045 -23.198 1.00 58.36  ? 7   LEU C CA     1 
ATOM   8581  C  C      . LEU C 1 7   ? 18.806  -17.085 -24.033 1.00 65.79  ? 7   LEU C C      1 
ATOM   8582  O  O      . LEU C 1 7   ? 19.807  -17.652 -23.590 1.00 62.95  ? 7   LEU C O      1 
ATOM   8583  C  CB     . LEU C 1 7   ? 17.207  -16.750 -22.138 1.00 46.67  ? 7   LEU C CB     1 
ATOM   8584  C  CG     . LEU C 1 7   ? 16.604  -15.902 -21.014 1.00 76.07  ? 7   LEU C CG     1 
ATOM   8585  C  CD1    . LEU C 1 7   ? 15.873  -16.789 -20.011 1.00 53.50  ? 7   LEU C CD1    1 
ATOM   8586  C  CD2    . LEU C 1 7   ? 17.666  -15.071 -20.302 1.00 81.93  ? 7   LEU C CD2    1 
ATOM   8587  H  H      . LEU C 1 7   ? 16.395  -15.238 -23.906 1.00 89.60  ? 7   LEU C H      1 
ATOM   8588  H  HA     . LEU C 1 7   ? 18.720  -15.501 -22.739 1.00 70.03  ? 7   LEU C HA     1 
ATOM   8589  H  HB2    . LEU C 1 7   ? 16.467  -17.183 -22.592 1.00 56.00  ? 7   LEU C HB2    1 
ATOM   8590  H  HB3    . LEU C 1 7   ? 17.758  -17.428 -21.716 1.00 56.00  ? 7   LEU C HB3    1 
ATOM   8591  H  HG     . LEU C 1 7   ? 15.956  -15.290 -21.397 1.00 91.28  ? 7   LEU C HG     1 
ATOM   8592  H  HD11   . LEU C 1 7   ? 15.500  -16.232 -19.310 1.00 64.20  ? 7   LEU C HD11   1 
ATOM   8593  H  HD12   . LEU C 1 7   ? 15.162  -17.264 -20.469 1.00 64.20  ? 7   LEU C HD12   1 
ATOM   8594  H  HD13   . LEU C 1 7   ? 16.503  -17.422 -19.632 1.00 64.20  ? 7   LEU C HD13   1 
ATOM   8595  H  HD21   . LEU C 1 7   ? 17.243  -14.552 -19.601 1.00 98.31  ? 7   LEU C HD21   1 
ATOM   8596  H  HD22   . LEU C 1 7   ? 18.328  -15.668 -19.919 1.00 98.31  ? 7   LEU C HD22   1 
ATOM   8597  H  HD23   . LEU C 1 7   ? 18.087  -14.479 -20.945 1.00 98.31  ? 7   LEU C HD23   1 
ATOM   8598  N  N      . GLU C 1 8   ? 18.303  -17.338 -25.237 1.00 78.04  ? 8   GLU C N      1 
ATOM   8599  C  CA     . GLU C 1 8   ? 18.964  -18.227 -26.186 1.00 81.31  ? 8   GLU C CA     1 
ATOM   8600  C  C      . GLU C 1 8   ? 20.200  -17.553 -26.777 1.00 71.85  ? 8   GLU C C      1 
ATOM   8601  O  O      . GLU C 1 8   ? 21.291  -18.129 -26.799 1.00 56.89  ? 8   GLU C O      1 
ATOM   8602  C  CB     . GLU C 1 8   ? 17.995  -18.626 -27.297 1.00 82.51  ? 8   GLU C CB     1 
ATOM   8603  C  CG     . GLU C 1 8   ? 16.764  -19.362 -26.794 1.00 90.07  ? 8   GLU C CG     1 
ATOM   8604  C  CD     . GLU C 1 8   ? 15.626  -19.349 -27.793 1.00 108.96 ? 8   GLU C CD     1 
ATOM   8605  O  OE1    . GLU C 1 8   ? 15.858  -18.967 -28.960 1.00 104.68 ? 8   GLU C OE1    1 
ATOM   8606  O  OE2    . GLU C 1 8   ? 14.496  -19.717 -27.406 1.00 104.43 ? 8   GLU C OE2    1 
ATOM   8607  H  H      . GLU C 1 8   ? 17.569  -17.002 -25.532 1.00 93.65  ? 8   GLU C H      1 
ATOM   8608  H  HA     . GLU C 1 8   ? 19.248  -19.032 -25.726 1.00 97.57  ? 8   GLU C HA     1 
ATOM   8609  H  HB2    . GLU C 1 8   ? 17.696  -17.826 -27.755 1.00 99.01  ? 8   GLU C HB2    1 
ATOM   8610  H  HB3    . GLU C 1 8   ? 18.456  -19.210 -27.920 1.00 99.01  ? 8   GLU C HB3    1 
ATOM   8611  H  HG2    . GLU C 1 8   ? 16.998  -20.287 -26.618 1.00 108.08 ? 8   GLU C HG2    1 
ATOM   8612  H  HG3    . GLU C 1 8   ? 16.453  -18.938 -25.979 1.00 108.08 ? 8   GLU C HG3    1 
ATOM   8613  N  N      . LYS C 1 9   ? 20.012  -16.329 -27.262 1.00 68.73  ? 9   LYS C N      1 
ATOM   8614  C  CA     . LYS C 1 9   ? 21.092  -15.559 -27.869 1.00 70.59  ? 9   LYS C CA     1 
ATOM   8615  C  C      . LYS C 1 9   ? 22.159  -15.194 -26.833 1.00 68.18  ? 9   LYS C C      1 
ATOM   8616  O  O      . LYS C 1 9   ? 23.308  -14.920 -27.185 1.00 60.20  ? 9   LYS C O      1 
ATOM   8617  C  CB     . LYS C 1 9   ? 20.538  -14.298 -28.541 1.00 61.95  ? 9   LYS C CB     1 
ATOM   8618  C  CG     . LYS C 1 9   ? 19.489  -14.584 -29.608 1.00 68.58  ? 9   LYS C CG     1 
ATOM   8619  C  CD     . LYS C 1 9   ? 18.668  -13.351 -29.952 1.00 79.97  ? 9   LYS C CD     1 
ATOM   8620  C  CE     . LYS C 1 9   ? 17.465  -13.723 -30.807 1.00 80.70  ? 9   LYS C CE     1 
ATOM   8621  N  NZ     . LYS C 1 9   ? 16.551  -12.575 -31.054 1.00 61.13  ? 9   LYS C NZ     1 
ATOM   8622  H  H      . LYS C 1 9   ? 19.257  -15.917 -27.251 1.00 82.48  ? 9   LYS C H      1 
ATOM   8623  H  HA     . LYS C 1 9   ? 21.516  -16.100 -28.555 1.00 84.71  ? 9   LYS C HA     1 
ATOM   8624  H  HB2    . LYS C 1 9   ? 20.128  -13.738 -27.864 1.00 74.35  ? 9   LYS C HB2    1 
ATOM   8625  H  HB3    . LYS C 1 9   ? 21.270  -13.822 -28.964 1.00 74.35  ? 9   LYS C HB3    1 
ATOM   8626  H  HG2    . LYS C 1 9   ? 19.932  -14.886 -30.416 1.00 82.29  ? 9   LYS C HG2    1 
ATOM   8627  H  HG3    . LYS C 1 9   ? 18.883  -15.268 -29.283 1.00 82.29  ? 9   LYS C HG3    1 
ATOM   8628  H  HD2    . LYS C 1 9   ? 18.347  -12.940 -29.134 1.00 95.96  ? 9   LYS C HD2    1 
ATOM   8629  H  HD3    . LYS C 1 9   ? 19.217  -12.727 -30.451 1.00 95.96  ? 9   LYS C HD3    1 
ATOM   8630  H  HE2    . LYS C 1 9   ? 17.777  -14.047 -31.666 1.00 96.84  ? 9   LYS C HE2    1 
ATOM   8631  H  HE3    . LYS C 1 9   ? 16.959  -14.416 -30.355 1.00 96.84  ? 9   LYS C HE3    1 
ATOM   8632  H  HZ1    . LYS C 1 9   ? 15.864  -12.836 -31.556 1.00 73.36  ? 9   LYS C HZ1    1 
ATOM   8633  H  HZ2    . LYS C 1 9   ? 16.242  -12.261 -30.281 1.00 73.36  ? 9   LYS C HZ2    1 
ATOM   8634  H  HZ3    . LYS C 1 9   ? 16.987  -11.924 -31.477 1.00 73.36  ? 9   LYS C HZ3    1 
ATOM   8635  N  N      . ALA C 1 10  ? 21.769  -15.184 -25.559 1.00 67.64  ? 10  ALA C N      1 
ATOM   8636  C  CA     . ALA C 1 10  ? 22.682  -14.845 -24.466 1.00 64.88  ? 10  ALA C CA     1 
ATOM   8637  C  C      . ALA C 1 10  ? 23.581  -16.027 -24.092 1.00 62.17  ? 10  ALA C C      1 
ATOM   8638  O  O      . ALA C 1 10  ? 24.652  -15.843 -23.512 1.00 48.54  ? 10  ALA C O      1 
ATOM   8639  C  CB     . ALA C 1 10  ? 21.896  -14.380 -23.247 1.00 59.27  ? 10  ALA C CB     1 
ATOM   8640  H  H      . ALA C 1 10  ? 20.971  -15.371 -25.299 1.00 81.17  ? 10  ALA C H      1 
ATOM   8641  H  HA     . ALA C 1 10  ? 23.254  -14.114 -24.750 1.00 77.85  ? 10  ALA C HA     1 
ATOM   8642  H  HB1    . ALA C 1 10  ? 22.518  -14.161 -22.535 1.00 71.13  ? 10  ALA C HB1    1 
ATOM   8643  H  HB2    . ALA C 1 10  ? 21.377  -13.596 -23.486 1.00 71.13  ? 10  ALA C HB2    1 
ATOM   8644  H  HB3    . ALA C 1 10  ? 21.305  -15.094 -22.962 1.00 71.13  ? 10  ALA C HB3    1 
ATOM   8645  N  N      . LEU C 1 11  ? 23.134  -17.238 -24.413 1.00 71.07  ? 11  LEU C N      1 
ATOM   8646  C  CA     . LEU C 1 11  ? 23.934  -18.437 -24.183 1.00 58.01  ? 11  LEU C CA     1 
ATOM   8647  C  C      . LEU C 1 11  ? 25.141  -18.473 -25.120 1.00 53.46  ? 11  LEU C C      1 
ATOM   8648  O  O      . LEU C 1 11  ? 26.113  -19.188 -24.867 1.00 47.86  ? 11  LEU C O      1 
ATOM   8649  C  CB     . LEU C 1 11  ? 23.091  -19.702 -24.360 1.00 57.82  ? 11  LEU C CB     1 
ATOM   8650  C  CG     . LEU C 1 11  ? 22.198  -20.082 -23.174 1.00 53.33  ? 11  LEU C CG     1 
ATOM   8651  C  CD1    . LEU C 1 11  ? 21.213  -21.167 -23.583 1.00 74.34  ? 11  LEU C CD1    1 
ATOM   8652  C  CD2    . LEU C 1 11  ? 23.030  -20.537 -21.976 1.00 40.64  ? 11  LEU C CD2    1 
ATOM   8653  H  H      . LEU C 1 11  ? 22.366  -17.393 -24.767 1.00 85.28  ? 11  LEU C H      1 
ATOM   8654  H  HA     . LEU C 1 11  ? 24.265  -18.425 -23.271 1.00 69.61  ? 11  LEU C HA     1 
ATOM   8655  H  HB2    . LEU C 1 11  ? 22.513  -19.579 -25.129 1.00 69.38  ? 11  LEU C HB2    1 
ATOM   8656  H  HB3    . LEU C 1 11  ? 23.689  -20.448 -24.522 1.00 69.38  ? 11  LEU C HB3    1 
ATOM   8657  H  HG     . LEU C 1 11  ? 21.688  -19.302 -22.904 1.00 64.00  ? 11  LEU C HG     1 
ATOM   8658  H  HD11   . LEU C 1 11  ? 20.658  -21.393 -22.820 1.00 89.21  ? 11  LEU C HD11   1 
ATOM   8659  H  HD12   . LEU C 1 11  ? 20.660  -20.835 -24.308 1.00 89.21  ? 11  LEU C HD12   1 
ATOM   8660  H  HD13   . LEU C 1 11  ? 21.708  -21.949 -23.876 1.00 89.21  ? 11  LEU C HD13   1 
ATOM   8661  H  HD21   . LEU C 1 11  ? 22.433  -20.768 -21.247 1.00 48.76  ? 11  LEU C HD21   1 
ATOM   8662  H  HD22   . LEU C 1 11  ? 23.555  -21.311 -22.233 1.00 48.76  ? 11  LEU C HD22   1 
ATOM   8663  H  HD23   . LEU C 1 11  ? 23.617  -19.813 -21.707 1.00 48.76  ? 11  LEU C HD23   1 
ATOM   8664  N  N      . GLU C 1 12  ? 25.070  -17.708 -26.207 1.00 46.71  ? 12  GLU C N      1 
ATOM   8665  C  CA     . GLU C 1 12  ? 26.148  -17.673 -27.190 1.00 55.88  ? 12  GLU C CA     1 
ATOM   8666  C  C      . GLU C 1 12  ? 27.385  -16.943 -26.660 1.00 60.52  ? 12  GLU C C      1 
ATOM   8667  O  O      . GLU C 1 12  ? 28.463  -17.018 -27.257 1.00 53.88  ? 12  GLU C O      1 
ATOM   8668  C  CB     . GLU C 1 12  ? 25.664  -16.997 -28.478 1.00 63.70  ? 12  GLU C CB     1 
ATOM   8669  C  CG     . GLU C 1 12  ? 24.387  -17.597 -29.058 1.00 85.31  ? 12  GLU C CG     1 
ATOM   8670  C  CD     . GLU C 1 12  ? 23.949  -16.921 -30.347 1.00 96.88  ? 12  GLU C CD     1 
ATOM   8671  O  OE1    . GLU C 1 12  ? 24.618  -15.955 -30.775 1.00 80.89  ? 12  GLU C OE1    1 
ATOM   8672  O  OE2    . GLU C 1 12  ? 22.934  -17.355 -30.932 1.00 89.71  ? 12  GLU C OE2    1 
ATOM   8673  H  H      . GLU C 1 12  ? 24.404  -17.199 -26.399 1.00 56.05  ? 12  GLU C H      1 
ATOM   8674  H  HA     . GLU C 1 12  ? 26.407  -18.582 -27.408 1.00 67.06  ? 12  GLU C HA     1 
ATOM   8675  H  HB2    . GLU C 1 12  ? 25.492  -16.060 -28.292 1.00 76.44  ? 12  GLU C HB2    1 
ATOM   8676  H  HB3    . GLU C 1 12  ? 26.359  -17.074 -29.150 1.00 76.44  ? 12  GLU C HB3    1 
ATOM   8677  H  HG2    . GLU C 1 12  ? 24.539  -18.536 -29.249 1.00 102.37 ? 12  GLU C HG2    1 
ATOM   8678  H  HG3    . GLU C 1 12  ? 23.671  -17.502 -28.411 1.00 102.37 ? 12  GLU C HG3    1 
ATOM   8679  N  N      . LEU C 1 13  ? 27.221  -16.233 -25.546 1.00 64.04  ? 13  LEU C N      1 
ATOM   8680  C  CA     . LEU C 1 13  ? 28.311  -15.464 -24.946 1.00 49.53  ? 13  LEU C CA     1 
ATOM   8681  C  C      . LEU C 1 13  ? 28.815  -16.056 -23.625 1.00 58.93  ? 13  LEU C C      1 
ATOM   8682  O  O      . LEU C 1 13  ? 29.996  -15.922 -23.301 1.00 66.64  ? 13  LEU C O      1 
ATOM   8683  C  CB     . LEU C 1 13  ? 27.874  -14.012 -24.746 1.00 34.15  ? 13  LEU C CB     1 
ATOM   8684  C  CG     . LEU C 1 13  ? 27.488  -13.295 -26.045 1.00 45.32  ? 13  LEU C CG     1 
ATOM   8685  C  CD1    . LEU C 1 13  ? 26.955  -11.898 -25.757 1.00 39.29  ? 13  LEU C CD1    1 
ATOM   8686  C  CD2    . LEU C 1 13  ? 28.672  -13.226 -27.006 1.00 33.09  ? 13  LEU C CD2    1 
ATOM   8687  H  H      . LEU C 1 13  ? 26.480  -16.179 -25.113 1.00 76.85  ? 13  LEU C H      1 
ATOM   8688  H  HA     . LEU C 1 13  ? 29.058  -15.460 -25.565 1.00 59.44  ? 13  LEU C HA     1 
ATOM   8689  H  HB2    . LEU C 1 13  ? 27.102  -13.997 -24.158 1.00 40.98  ? 13  LEU C HB2    1 
ATOM   8690  H  HB3    . LEU C 1 13  ? 28.605  -13.519 -24.341 1.00 40.98  ? 13  LEU C HB3    1 
ATOM   8691  H  HG     . LEU C 1 13  ? 26.782  -13.797 -26.481 1.00 54.38  ? 13  LEU C HG     1 
ATOM   8692  H  HD11   . LEU C 1 13  ? 26.721  -11.471 -26.596 1.00 47.14  ? 13  LEU C HD11   1 
ATOM   8693  H  HD12   . LEU C 1 13  ? 26.171  -11.970 -25.191 1.00 47.14  ? 13  LEU C HD12   1 
ATOM   8694  H  HD13   . LEU C 1 13  ? 27.644  -11.385 -25.305 1.00 47.14  ? 13  LEU C HD13   1 
ATOM   8695  H  HD21   . LEU C 1 13  ? 28.396  -12.768 -27.815 1.00 39.71  ? 13  LEU C HD21   1 
ATOM   8696  H  HD22   . LEU C 1 13  ? 29.396  -12.740 -26.581 1.00 39.71  ? 13  LEU C HD22   1 
ATOM   8697  H  HD23   . LEU C 1 13  ? 28.959  -14.128 -27.218 1.00 39.71  ? 13  LEU C HD23   1 
ATOM   8698  N  N      . VAL C 1 14  ? 27.940  -16.722 -22.873 1.00 57.71  ? 14  VAL C N      1 
ATOM   8699  C  CA     . VAL C 1 14  ? 28.315  -17.214 -21.545 1.00 57.57  ? 14  VAL C CA     1 
ATOM   8700  C  C      . VAL C 1 14  ? 28.829  -18.651 -21.589 1.00 59.42  ? 14  VAL C C      1 
ATOM   8701  O  O      . VAL C 1 14  ? 29.447  -19.115 -20.628 1.00 65.74  ? 14  VAL C O      1 
ATOM   8702  C  CB     . VAL C 1 14  ? 27.135  -17.150 -20.546 1.00 56.10  ? 14  VAL C CB     1 
ATOM   8703  C  CG1    . VAL C 1 14  ? 26.704  -15.707 -20.320 1.00 53.75  ? 14  VAL C CG1    1 
ATOM   8704  C  CG2    . VAL C 1 14  ? 25.964  -18.000 -21.024 1.00 50.42  ? 14  VAL C CG2    1 
ATOM   8705  H  H      . VAL C 1 14  ? 27.132  -16.902 -23.105 1.00 69.26  ? 14  VAL C H      1 
ATOM   8706  H  HA     . VAL C 1 14  ? 29.027  -16.655 -21.196 1.00 69.09  ? 14  VAL C HA     1 
ATOM   8707  H  HB     . VAL C 1 14  ? 27.430  -17.507 -19.693 1.00 67.32  ? 14  VAL C HB     1 
ATOM   8708  H  HG11   . VAL C 1 14  ? 25.965  -15.694 -19.692 1.00 64.50  ? 14  VAL C HG11   1 
ATOM   8709  H  HG12   . VAL C 1 14  ? 27.453  -15.207 -19.961 1.00 64.50  ? 14  VAL C HG12   1 
ATOM   8710  H  HG13   . VAL C 1 14  ? 26.425  -15.325 -21.167 1.00 64.50  ? 14  VAL C HG13   1 
ATOM   8711  H  HG21   . VAL C 1 14  ? 25.244  -17.938 -20.376 1.00 60.51  ? 14  VAL C HG21   1 
ATOM   8712  H  HG22   . VAL C 1 14  ? 25.665  -17.669 -21.885 1.00 60.51  ? 14  VAL C HG22   1 
ATOM   8713  H  HG23   . VAL C 1 14  ? 26.256  -18.922 -21.106 1.00 60.51  ? 14  VAL C HG23   1 
ATOM   8714  N  N      . ILE C 1 15  ? 28.563  -19.355 -22.688 1.00 64.54  ? 15  ILE C N      1 
ATOM   8715  C  CA     . ILE C 1 15  ? 29.082  -20.711 -22.866 1.00 72.36  ? 15  ILE C CA     1 
ATOM   8716  C  C      . ILE C 1 15  ? 30.394  -20.628 -23.662 1.00 77.52  ? 15  ILE C C      1 
ATOM   8717  O  O      . ILE C 1 15  ? 30.424  -20.026 -24.742 1.00 59.03  ? 15  ILE C O      1 
ATOM   8718  C  CB     . ILE C 1 15  ? 28.062  -21.634 -23.573 1.00 56.76  ? 15  ILE C CB     1 
ATOM   8719  C  CG1    . ILE C 1 15  ? 26.900  -21.939 -22.621 1.00 55.27  ? 15  ILE C CG1    1 
ATOM   8720  C  CG2    . ILE C 1 15  ? 28.725  -22.943 -24.007 1.00 55.55  ? 15  ILE C CG2    1 
ATOM   8721  C  CD1    . ILE C 1 15  ? 25.778  -22.770 -23.221 1.00 39.94  ? 15  ILE C CD1    1 
ATOM   8722  H  H      . ILE C 1 15  ? 28.086  -19.072 -23.344 1.00 77.45  ? 15  ILE C H      1 
ATOM   8723  H  HA     . ILE C 1 15  ? 29.280  -21.092 -21.996 1.00 86.83  ? 15  ILE C HA     1 
ATOM   8724  H  HB     . ILE C 1 15  ? 27.717  -21.181 -24.358 1.00 68.11  ? 15  ILE C HB     1 
ATOM   8725  H  HG12   . ILE C 1 15  ? 27.247  -22.425 -21.856 1.00 66.32  ? 15  ILE C HG12   1 
ATOM   8726  H  HG13   . ILE C 1 15  ? 26.515  -21.099 -22.325 1.00 66.32  ? 15  ILE C HG13   1 
ATOM   8727  H  HG21   . ILE C 1 15  ? 28.064  -23.501 -24.446 1.00 66.66  ? 15  ILE C HG21   1 
ATOM   8728  H  HG22   . ILE C 1 15  ? 29.449  -22.742 -24.620 1.00 66.66  ? 15  ILE C HG22   1 
ATOM   8729  H  HG23   . ILE C 1 15  ? 29.072  -23.396 -23.222 1.00 66.66  ? 15  ILE C HG23   1 
ATOM   8730  H  HD11   . ILE C 1 15  ? 25.094  -22.910 -22.547 1.00 47.92  ? 15  ILE C HD11   1 
ATOM   8731  H  HD12   . ILE C 1 15  ? 25.404  -22.295 -23.979 1.00 47.92  ? 15  ILE C HD12   1 
ATOM   8732  H  HD13   . ILE C 1 15  ? 26.137  -23.624 -23.509 1.00 47.92  ? 15  ILE C HD13   1 
ATOM   8733  N  N      . PRO C 1 16  ? 31.486  -21.218 -23.128 1.00 76.26  ? 16  PRO C N      1 
ATOM   8734  C  CA     . PRO C 1 16  ? 32.780  -21.181 -23.828 1.00 62.99  ? 16  PRO C CA     1 
ATOM   8735  C  C      . PRO C 1 16  ? 32.788  -21.943 -25.149 1.00 64.44  ? 16  PRO C C      1 
ATOM   8736  O  O      . PRO C 1 16  ? 32.326  -23.086 -25.205 1.00 57.65  ? 16  PRO C O      1 
ATOM   8737  C  CB     . PRO C 1 16  ? 33.744  -21.842 -22.833 1.00 64.80  ? 16  PRO C CB     1 
ATOM   8738  C  CG     . PRO C 1 16  ? 33.073  -21.752 -21.514 1.00 65.33  ? 16  PRO C CG     1 
ATOM   8739  C  CD     . PRO C 1 16  ? 31.612  -21.836 -21.794 1.00 56.68  ? 16  PRO C CD     1 
ATOM   8740  H  HA     . PRO C 1 16  ? 33.055  -20.264 -23.983 1.00 75.59  ? 16  PRO C HA     1 
ATOM   8741  H  HB2    . PRO C 1 16  ? 33.885  -22.769 -23.082 1.00 77.76  ? 16  PRO C HB2    1 
ATOM   8742  H  HB3    . PRO C 1 16  ? 34.585  -21.358 -22.823 1.00 77.76  ? 16  PRO C HB3    1 
ATOM   8743  H  HG2    . PRO C 1 16  ? 33.356  -22.492 -20.954 1.00 78.40  ? 16  PRO C HG2    1 
ATOM   8744  H  HG3    . PRO C 1 16  ? 33.291  -20.905 -21.095 1.00 78.40  ? 16  PRO C HG3    1 
ATOM   8745  H  HD2    . PRO C 1 16  ? 31.325  -22.762 -21.821 1.00 68.02  ? 16  PRO C HD2    1 
ATOM   8746  H  HD3    . PRO C 1 16  ? 31.111  -21.327 -21.137 1.00 68.02  ? 16  PRO C HD3    1 
ATOM   8747  N  N      . ASP C 1 17  ? 33.330  -21.318 -26.191 1.00 61.00  ? 17  ASP C N      1 
ATOM   8748  C  CA     . ASP C 1 17  ? 33.477  -21.968 -27.489 1.00 63.78  ? 17  ASP C CA     1 
ATOM   8749  C  C      . ASP C 1 17  ? 34.452  -23.143 -27.390 1.00 76.31  ? 17  ASP C C      1 
ATOM   8750  O  O      . ASP C 1 17  ? 35.249  -23.223 -26.454 1.00 71.17  ? 17  ASP C O      1 
ATOM   8751  C  CB     . ASP C 1 17  ? 33.955  -20.965 -28.537 1.00 64.29  ? 17  ASP C CB     1 
ATOM   8752  C  CG     . ASP C 1 17  ? 35.253  -20.295 -28.148 1.00 78.00  ? 17  ASP C CG     1 
ATOM   8753  O  OD1    . ASP C 1 17  ? 35.250  -19.504 -27.181 1.00 67.50  ? 17  ASP C OD1    1 
ATOM   8754  O  OD2    . ASP C 1 17  ? 36.277  -20.558 -28.814 1.00 84.19  ? 17  ASP C OD2    1 
ATOM   8755  H  H      . ASP C 1 17  ? 33.622  -20.509 -26.171 1.00 73.20  ? 17  ASP C H      1 
ATOM   8756  H  HA     . ASP C 1 17  ? 32.616  -22.313 -27.771 1.00 76.54  ? 17  ASP C HA     1 
ATOM   8757  H  HB2    . ASP C 1 17  ? 34.095  -21.428 -29.378 1.00 77.15  ? 17  ASP C HB2    1 
ATOM   8758  H  HB3    . ASP C 1 17  ? 33.281  -20.275 -28.645 1.00 77.15  ? 17  ASP C HB3    1 
ATOM   8759  N  N      . GLU C 1 18  ? 34.382  -24.049 -28.361 1.00 89.23  ? 18  GLU C N      1 
ATOM   8760  C  CA     . GLU C 1 18  ? 35.140  -25.299 -28.317 1.00 87.78  ? 18  GLU C CA     1 
ATOM   8761  C  C      . GLU C 1 18  ? 36.653  -25.111 -28.465 1.00 75.90  ? 18  GLU C C      1 
ATOM   8762  O  O      . GLU C 1 18  ? 37.431  -25.981 -28.070 1.00 68.90  ? 18  GLU C O      1 
ATOM   8763  C  CB     . GLU C 1 18  ? 34.632  -26.243 -29.409 1.00 87.03  ? 18  GLU C CB     1 
ATOM   8764  C  CG     . GLU C 1 18  ? 33.226  -26.771 -29.156 1.00 83.44  ? 18  GLU C CG     1 
ATOM   8765  C  CD     . GLU C 1 18  ? 32.640  -27.493 -30.356 1.00 105.20 ? 18  GLU C CD     1 
ATOM   8766  O  OE1    . GLU C 1 18  ? 33.310  -27.548 -31.409 1.00 107.01 ? 18  GLU C OE1    1 
ATOM   8767  O  OE2    . GLU C 1 18  ? 31.505  -28.004 -30.244 1.00 86.40  ? 18  GLU C OE2    1 
ATOM   8768  H  H      . GLU C 1 18  ? 33.897  -23.963 -29.066 1.00 107.07 ? 18  GLU C H      1 
ATOM   8769  H  HA     . GLU C 1 18  ? 34.980  -25.727 -27.461 1.00 105.34 ? 18  GLU C HA     1 
ATOM   8770  H  HB2    . GLU C 1 18  ? 34.623  -25.767 -30.254 1.00 104.43 ? 18  GLU C HB2    1 
ATOM   8771  H  HB3    . GLU C 1 18  ? 35.229  -27.005 -29.467 1.00 104.43 ? 18  GLU C HB3    1 
ATOM   8772  H  HG2    . GLU C 1 18  ? 33.252  -27.395 -28.414 1.00 100.12 ? 18  GLU C HG2    1 
ATOM   8773  H  HG3    . GLU C 1 18  ? 32.643  -26.026 -28.941 1.00 100.12 ? 18  GLU C HG3    1 
ATOM   8774  N  N      . GLU C 1 19  ? 37.070  -23.982 -29.029 1.00 81.58  ? 19  GLU C N      1 
ATOM   8775  C  CA     . GLU C 1 19  ? 38.495  -23.695 -29.195 1.00 82.13  ? 19  GLU C CA     1 
ATOM   8776  C  C      . GLU C 1 19  ? 39.130  -23.376 -27.847 1.00 74.30  ? 19  GLU C C      1 
ATOM   8777  O  O      . GLU C 1 19  ? 40.319  -23.630 -27.630 1.00 53.96  ? 19  GLU C O      1 
ATOM   8778  C  CB     . GLU C 1 19  ? 38.702  -22.538 -30.176 1.00 67.89  ? 19  GLU C CB     1 
ATOM   8779  C  CG     . GLU C 1 19  ? 38.153  -22.825 -31.556 1.00 84.51  ? 19  GLU C CG     1 
ATOM   8780  C  CD     . GLU C 1 19  ? 38.604  -24.176 -32.073 1.00 98.99  ? 19  GLU C CD     1 
ATOM   8781  O  OE1    . GLU C 1 19  ? 39.828  -24.430 -32.078 1.00 94.82  ? 19  GLU C OE1    1 
ATOM   8782  O  OE2    . GLU C 1 19  ? 37.738  -24.994 -32.447 1.00 82.98  ? 19  GLU C OE2    1 
ATOM   8783  H  H      . GLU C 1 19  ? 36.550  -23.364 -29.325 1.00 97.89  ? 19  GLU C H      1 
ATOM   8784  H  HA     . GLU C 1 19  ? 38.935  -24.479 -29.558 1.00 98.55  ? 19  GLU C HA     1 
ATOM   8785  H  HB2    . GLU C 1 19  ? 38.252  -21.749 -29.833 1.00 81.47  ? 19  GLU C HB2    1 
ATOM   8786  H  HB3    . GLU C 1 19  ? 39.653  -22.365 -30.263 1.00 81.47  ? 19  GLU C HB3    1 
ATOM   8787  H  HG2    . GLU C 1 19  ? 37.183  -22.823 -31.521 1.00 101.41 ? 19  GLU C HG2    1 
ATOM   8788  H  HG3    . GLU C 1 19  ? 38.466  -22.144 -32.172 1.00 101.41 ? 19  GLU C HG3    1 
ATOM   8789  N  N      . GLU C 1 20  ? 38.321  -22.823 -26.947 1.00 80.15  ? 20  GLU C N      1 
ATOM   8790  C  CA     . GLU C 1 20  ? 38.764  -22.481 -25.601 1.00 72.12  ? 20  GLU C CA     1 
ATOM   8791  C  C      . GLU C 1 20  ? 38.827  -23.731 -24.725 1.00 74.01  ? 20  GLU C C      1 
ATOM   8792  O  O      . GLU C 1 20  ? 39.745  -23.887 -23.917 1.00 73.39  ? 20  GLU C O      1 
ATOM   8793  C  CB     . GLU C 1 20  ? 37.816  -21.446 -24.980 1.00 76.64  ? 20  GLU C CB     1 
ATOM   8794  C  CG     . GLU C 1 20  ? 38.265  -20.888 -23.629 1.00 83.42  ? 20  GLU C CG     1 
ATOM   8795  C  CD     . GLU C 1 20  ? 37.283  -19.878 -23.053 1.00 84.78  ? 20  GLU C CD     1 
ATOM   8796  O  OE1    . GLU C 1 20  ? 36.219  -19.658 -23.669 1.00 88.78  ? 20  GLU C OE1    1 
ATOM   8797  O  OE2    . GLU C 1 20  ? 37.577  -19.300 -21.986 1.00 63.18  ? 20  GLU C OE2    1 
ATOM   8798  H  H      . GLU C 1 20  ? 37.496  -22.634 -27.097 1.00 96.18  ? 20  GLU C H      1 
ATOM   8799  H  HA     . GLU C 1 20  ? 39.652  -22.094 -25.644 1.00 86.55  ? 20  GLU C HA     1 
ATOM   8800  H  HB2    . GLU C 1 20  ? 37.732  -20.698 -25.592 1.00 91.97  ? 20  GLU C HB2    1 
ATOM   8801  H  HB3    . GLU C 1 20  ? 36.949  -21.860 -24.851 1.00 91.97  ? 20  GLU C HB3    1 
ATOM   8802  H  HG2    . GLU C 1 20  ? 38.349  -21.619 -22.997 1.00 100.10 ? 20  GLU C HG2    1 
ATOM   8803  H  HG3    . GLU C 1 20  ? 39.121  -20.445 -23.739 1.00 100.10 ? 20  GLU C HG3    1 
ATOM   8804  N  N      . VAL C 1 21  ? 37.849  -24.617 -24.890 1.00 62.87  ? 21  VAL C N      1 
ATOM   8805  C  CA     . VAL C 1 21  ? 37.796  -25.857 -24.120 1.00 58.18  ? 21  VAL C CA     1 
ATOM   8806  C  C      . VAL C 1 21  ? 38.975  -26.770 -24.474 1.00 64.87  ? 21  VAL C C      1 
ATOM   8807  O  O      . VAL C 1 21  ? 39.582  -27.380 -23.589 1.00 54.52  ? 21  VAL C O      1 
ATOM   8808  C  CB     . VAL C 1 21  ? 36.468  -26.615 -24.351 1.00 56.94  ? 21  VAL C CB     1 
ATOM   8809  C  CG1    . VAL C 1 21  ? 36.418  -27.886 -23.500 1.00 52.62  ? 21  VAL C CG1    1 
ATOM   8810  C  CG2    . VAL C 1 21  ? 35.277  -25.721 -24.023 1.00 57.23  ? 21  VAL C CG2    1 
ATOM   8811  H  H      . VAL C 1 21  ? 37.200  -24.523 -25.447 1.00 75.45  ? 21  VAL C H      1 
ATOM   8812  H  HA     . VAL C 1 21  ? 37.857  -25.643 -23.176 1.00 69.82  ? 21  VAL C HA     1 
ATOM   8813  H  HB     . VAL C 1 21  ? 36.406  -26.872 -25.284 1.00 68.33  ? 21  VAL C HB     1 
ATOM   8814  H  HG11   . VAL C 1 21  ? 35.577  -28.342 -23.663 1.00 63.14  ? 21  VAL C HG11   1 
ATOM   8815  H  HG12   . VAL C 1 21  ? 37.159  -28.461 -23.747 1.00 63.14  ? 21  VAL C HG12   1 
ATOM   8816  H  HG13   . VAL C 1 21  ? 36.486  -27.642 -22.563 1.00 63.14  ? 21  VAL C HG13   1 
ATOM   8817  H  HG21   . VAL C 1 21  ? 34.459  -26.218 -24.175 1.00 68.67  ? 21  VAL C HG21   1 
ATOM   8818  H  HG22   . VAL C 1 21  ? 35.333  -25.451 -23.093 1.00 68.67  ? 21  VAL C HG22   1 
ATOM   8819  H  HG23   . VAL C 1 21  ? 35.302  -24.939 -24.597 1.00 68.67  ? 21  VAL C HG23   1 
ATOM   8820  N  N      . ARG C 1 22  ? 39.278  -26.878 -25.768 1.00 83.33  ? 22  ARG C N      1 
ATOM   8821  C  CA     . ARG C 1 22  ? 40.384  -27.714 -26.233 1.00 85.09  ? 22  ARG C CA     1 
ATOM   8822  C  C      . ARG C 1 22  ? 41.699  -27.274 -25.600 1.00 80.75  ? 22  ARG C C      1 
ATOM   8823  O  O      . ARG C 1 22  ? 42.484  -28.099 -25.127 1.00 76.39  ? 22  ARG C O      1 
ATOM   8824  C  CB     . ARG C 1 22  ? 40.509  -27.656 -27.760 1.00 72.61  ? 22  ARG C CB     1 
ATOM   8825  C  CG     . ARG C 1 22  ? 41.620  -28.549 -28.323 1.00 98.51  ? 22  ARG C CG     1 
ATOM   8826  C  CD     . ARG C 1 22  ? 41.889  -28.292 -29.802 1.00 98.87  ? 22  ARG C CD     1 
ATOM   8827  N  NE     . ARG C 1 22  ? 42.319  -26.920 -30.061 1.00 100.94 ? 22  ARG C NE     1 
ATOM   8828  C  CZ     . ARG C 1 22  ? 43.550  -26.463 -29.843 1.00 96.73  ? 22  ARG C CZ     1 
ATOM   8829  N  NH1    . ARG C 1 22  ? 44.489  -27.264 -29.353 1.00 79.88  ? 22  ARG C NH1    1 
ATOM   8830  N  NH2    . ARG C 1 22  ? 43.844  -25.198 -30.112 1.00 80.73  ? 22  ARG C NH2    1 
ATOM   8831  H  H      . ARG C 1 22  ? 38.856  -26.474 -26.399 1.00 99.99  ? 22  ARG C H      1 
ATOM   8832  H  HA     . ARG C 1 22  ? 40.218  -28.635 -25.977 1.00 102.11 ? 22  ARG C HA     1 
ATOM   8833  H  HB2    . ARG C 1 22  ? 39.670  -27.944 -28.154 1.00 87.13  ? 22  ARG C HB2    1 
ATOM   8834  H  HB3    . ARG C 1 22  ? 40.700  -26.743 -28.024 1.00 87.13  ? 22  ARG C HB3    1 
ATOM   8835  H  HG2    . ARG C 1 22  ? 42.441  -28.377 -27.836 1.00 118.21 ? 22  ARG C HG2    1 
ATOM   8836  H  HG3    . ARG C 1 22  ? 41.362  -29.478 -28.222 1.00 118.21 ? 22  ARG C HG3    1 
ATOM   8837  H  HD2    . ARG C 1 22  ? 42.590  -28.890 -30.105 1.00 118.64 ? 22  ARG C HD2    1 
ATOM   8838  H  HD3    . ARG C 1 22  ? 41.074  -28.453 -30.305 1.00 118.64 ? 22  ARG C HD3    1 
ATOM   8839  H  HE     . ARG C 1 22  ? 41.737  -26.370 -30.376 1.00 121.13 ? 22  ARG C HE     1 
ATOM   8840  H  HH11   . ARG C 1 22  ? 44.305  -28.085 -29.177 1.00 95.86  ? 22  ARG C HH11   1 
ATOM   8841  H  HH12   . ARG C 1 22  ? 45.282  -26.962 -29.214 1.00 95.86  ? 22  ARG C HH12   1 
ATOM   8842  H  HH21   . ARG C 1 22  ? 43.240  -24.674 -30.429 1.00 96.88  ? 22  ARG C HH21   1 
ATOM   8843  H  HH22   . ARG C 1 22  ? 44.639  -24.902 -29.970 1.00 96.88  ? 22  ARG C HH22   1 
ATOM   8844  N  N      . LYS C 1 23  ? 41.930  -25.965 -25.596 1.00 73.66  ? 23  LYS C N      1 
ATOM   8845  C  CA     . LYS C 1 23  ? 43.120  -25.398 -24.980 1.00 63.78  ? 23  LYS C CA     1 
ATOM   8846  C  C      . LYS C 1 23  ? 43.118  -25.685 -23.482 1.00 49.36  ? 23  LYS C C      1 
ATOM   8847  O  O      . LYS C 1 23  ? 44.175  -25.828 -22.863 1.00 38.64  ? 23  LYS C O      1 
ATOM   8848  C  CB     . LYS C 1 23  ? 43.192  -23.892 -25.245 1.00 52.32  ? 23  LYS C CB     1 
ATOM   8849  C  CG     . LYS C 1 23  ? 44.433  -23.217 -24.684 1.00 52.31  ? 23  LYS C CG     1 
ATOM   8850  C  CD     . LYS C 1 23  ? 44.401  -21.712 -24.914 1.00 57.34  ? 23  LYS C CD     1 
ATOM   8851  C  CE     . LYS C 1 23  ? 45.661  -21.042 -24.383 1.00 66.62  ? 23  LYS C CE     1 
ATOM   8852  N  NZ     . LYS C 1 23  ? 45.619  -19.559 -24.531 1.00 65.71  ? 23  LYS C NZ     1 
ATOM   8853  H  H      . LYS C 1 23  ? 41.406  -25.380 -25.947 1.00 88.39  ? 23  LYS C H      1 
ATOM   8854  H  HA     . LYS C 1 23  ? 43.908  -25.812 -25.367 1.00 76.54  ? 23  LYS C HA     1 
ATOM   8855  H  HB2    . LYS C 1 23  ? 43.184  -23.745 -26.204 1.00 62.79  ? 23  LYS C HB2    1 
ATOM   8856  H  HB3    . LYS C 1 23  ? 42.418  -23.468 -24.842 1.00 62.79  ? 23  LYS C HB3    1 
ATOM   8857  H  HG2    . LYS C 1 23  ? 44.481  -23.378 -23.729 1.00 62.77  ? 23  LYS C HG2    1 
ATOM   8858  H  HG3    . LYS C 1 23  ? 45.220  -23.575 -25.125 1.00 62.77  ? 23  LYS C HG3    1 
ATOM   8859  H  HD2    . LYS C 1 23  ? 44.339  -21.535 -25.865 1.00 68.80  ? 23  LYS C HD2    1 
ATOM   8860  H  HD3    . LYS C 1 23  ? 43.637  -21.334 -24.451 1.00 68.80  ? 23  LYS C HD3    1 
ATOM   8861  H  HE2    . LYS C 1 23  ? 45.757  -21.248 -23.440 1.00 79.94  ? 23  LYS C HE2    1 
ATOM   8862  H  HE3    . LYS C 1 23  ? 46.428  -21.372 -24.877 1.00 79.94  ? 23  LYS C HE3    1 
ATOM   8863  H  HZ1    . LYS C 1 23  ? 46.369  -19.201 -24.212 1.00 78.86  ? 23  LYS C HZ1    1 
ATOM   8864  H  HZ2    . LYS C 1 23  ? 45.537  -19.341 -25.390 1.00 78.86  ? 23  LYS C HZ2    1 
ATOM   8865  H  HZ3    . LYS C 1 23  ? 44.926  -19.228 -24.081 1.00 78.86  ? 23  LYS C HZ3    1 
ATOM   8866  N  N      . GLY C 1 24  ? 41.920  -25.771 -22.911 1.00 51.62  ? 24  GLY C N      1 
ATOM   8867  C  CA     . GLY C 1 24  ? 41.759  -26.011 -21.488 1.00 64.18  ? 24  GLY C CA     1 
ATOM   8868  C  C      . GLY C 1 24  ? 41.986  -27.453 -21.076 1.00 59.80  ? 24  GLY C C      1 
ATOM   8869  O  O      . GLY C 1 24  ? 42.674  -27.720 -20.091 1.00 59.59  ? 24  GLY C O      1 
ATOM   8870  H  H      . GLY C 1 24  ? 41.176  -25.693 -23.336 1.00 61.94  ? 24  GLY C H      1 
ATOM   8871  H  HA2    . GLY C 1 24  ? 42.386  -25.455 -20.999 1.00 77.02  ? 24  GLY C HA2    1 
ATOM   8872  H  HA3    . GLY C 1 24  ? 40.861  -25.758 -21.222 1.00 77.02  ? 24  GLY C HA3    1 
ATOM   8873  N  N      . ARG C 1 25  ? 41.399  -28.388 -21.817 1.00 67.02  ? 25  ARG C N      1 
ATOM   8874  C  CA     . ARG C 1 25  ? 41.545  -29.805 -21.500 1.00 70.92  ? 25  ARG C CA     1 
ATOM   8875  C  C      . ARG C 1 25  ? 42.974  -30.268 -21.765 1.00 65.65  ? 25  ARG C C      1 
ATOM   8876  O  O      . ARG C 1 25  ? 43.505  -31.112 -21.043 1.00 67.61  ? 25  ARG C O      1 
ATOM   8877  C  CB     . ARG C 1 25  ? 40.544  -30.643 -22.300 1.00 71.08  ? 25  ARG C CB     1 
ATOM   8878  C  CG     . ARG C 1 25  ? 39.103  -30.511 -21.813 1.00 78.51  ? 25  ARG C CG     1 
ATOM   8879  C  CD     . ARG C 1 25  ? 38.910  -31.152 -20.439 1.00 87.47  ? 25  ARG C CD     1 
ATOM   8880  N  NE     . ARG C 1 25  ? 37.606  -30.848 -19.853 1.00 104.72 ? 25  ARG C NE     1 
ATOM   8881  C  CZ     . ARG C 1 25  ? 37.224  -31.224 -18.634 1.00 99.34  ? 25  ARG C CZ     1 
ATOM   8882  N  NH1    . ARG C 1 25  ? 38.043  -31.925 -17.857 1.00 73.39  ? 25  ARG C NH1    1 
ATOM   8883  N  NH2    . ARG C 1 25  ? 36.018  -30.899 -18.189 1.00 91.61  ? 25  ARG C NH2    1 
ATOM   8884  H  H      . ARG C 1 25  ? 40.912  -28.228 -22.507 1.00 80.43  ? 25  ARG C H      1 
ATOM   8885  H  HA     . ARG C 1 25  ? 41.358  -29.937 -20.558 1.00 85.11  ? 25  ARG C HA     1 
ATOM   8886  H  HB2    . ARG C 1 25  ? 40.570  -30.361 -23.228 1.00 85.29  ? 25  ARG C HB2    1 
ATOM   8887  H  HB3    . ARG C 1 25  ? 40.795  -31.578 -22.234 1.00 85.29  ? 25  ARG C HB3    1 
ATOM   8888  H  HG2    . ARG C 1 25  ? 38.874  -29.571 -21.744 1.00 94.21  ? 25  ARG C HG2    1 
ATOM   8889  H  HG3    . ARG C 1 25  ? 38.511  -30.955 -22.441 1.00 94.21  ? 25  ARG C HG3    1 
ATOM   8890  H  HD2    . ARG C 1 25  ? 38.983  -32.115 -20.527 1.00 104.97 ? 25  ARG C HD2    1 
ATOM   8891  H  HD3    . ARG C 1 25  ? 39.595  -30.820 -19.837 1.00 104.97 ? 25  ARG C HD3    1 
ATOM   8892  H  HE     . ARG C 1 25  ? 37.048  -30.396 -20.326 1.00 125.66 ? 25  ARG C HE     1 
ATOM   8893  H  HH11   . ARG C 1 25  ? 38.827  -32.139 -18.140 1.00 88.06  ? 25  ARG C HH11   1 
ATOM   8894  H  HH12   . ARG C 1 25  ? 37.790  -32.164 -17.071 1.00 88.06  ? 25  ARG C HH12   1 
ATOM   8895  H  HH21   . ARG C 1 25  ? 35.484  -30.446 -18.687 1.00 109.94 ? 25  ARG C HH21   1 
ATOM   8896  H  HH22   . ARG C 1 25  ? 35.770  -31.142 -17.402 1.00 109.94 ? 25  ARG C HH22   1 
ATOM   8897  N  N      . GLU C 1 26  ? 43.592  -29.707 -22.799 1.00 64.80  ? 26  GLU C N      1 
ATOM   8898  C  CA     . GLU C 1 26  ? 44.975  -30.027 -23.135 1.00 66.31  ? 26  GLU C CA     1 
ATOM   8899  C  C      . GLU C 1 26  ? 45.916  -29.567 -22.023 1.00 74.80  ? 26  GLU C C      1 
ATOM   8900  O  O      . GLU C 1 26  ? 46.901  -30.238 -21.708 1.00 76.97  ? 26  GLU C O      1 
ATOM   8901  C  CB     . GLU C 1 26  ? 45.363  -29.380 -24.467 1.00 60.45  ? 26  GLU C CB     1 
ATOM   8902  C  CG     . GLU C 1 26  ? 46.809  -29.610 -24.884 1.00 75.14  ? 26  GLU C CG     1 
ATOM   8903  C  CD     . GLU C 1 26  ? 47.124  -29.022 -26.248 1.00 96.01  ? 26  GLU C CD     1 
ATOM   8904  O  OE1    . GLU C 1 26  ? 48.321  -28.945 -26.600 1.00 84.03  ? 26  GLU C OE1    1 
ATOM   8905  O  OE2    . GLU C 1 26  ? 46.175  -28.639 -26.969 1.00 87.08  ? 26  GLU C OE2    1 
ATOM   8906  H  H      . GLU C 1 26  ? 43.230  -29.132 -23.326 1.00 77.76  ? 26  GLU C H      1 
ATOM   8907  H  HA     . GLU C 1 26  ? 45.065  -30.989 -23.229 1.00 79.57  ? 26  GLU C HA     1 
ATOM   8908  H  HB2    . GLU C 1 26  ? 44.794  -29.741 -25.165 1.00 72.54  ? 26  GLU C HB2    1 
ATOM   8909  H  HB3    . GLU C 1 26  ? 45.226  -28.422 -24.397 1.00 72.54  ? 26  GLU C HB3    1 
ATOM   8910  H  HG2    . GLU C 1 26  ? 47.396  -29.193 -24.234 1.00 90.17  ? 26  GLU C HG2    1 
ATOM   8911  H  HG3    . GLU C 1 26  ? 46.979  -30.565 -24.921 1.00 90.17  ? 26  GLU C HG3    1 
ATOM   8912  N  N      . ALA C 1 27  ? 45.607  -28.414 -21.436 1.00 68.51  ? 27  ALA C N      1 
ATOM   8913  C  CA     . ALA C 1 27  ? 46.401  -27.867 -20.341 1.00 57.09  ? 27  ALA C CA     1 
ATOM   8914  C  C      . ALA C 1 27  ? 46.159  -28.640 -19.041 1.00 59.56  ? 27  ALA C C      1 
ATOM   8915  O  O      . ALA C 1 27  ? 47.055  -28.745 -18.204 1.00 63.33  ? 27  ALA C O      1 
ATOM   8916  C  CB     . ALA C 1 27  ? 46.089  -26.398 -20.148 1.00 61.87  ? 27  ALA C CB     1 
ATOM   8917  H  H      . ALA C 1 27  ? 44.935  -27.925 -21.657 1.00 82.21  ? 27  ALA C H      1 
ATOM   8918  H  HA     . ALA C 1 27  ? 47.342  -27.945 -20.564 1.00 68.51  ? 27  ALA C HA     1 
ATOM   8919  H  HB1    . ALA C 1 27  ? 46.626  -26.055 -19.417 1.00 74.24  ? 27  ALA C HB1    1 
ATOM   8920  H  HB2    . ALA C 1 27  ? 46.299  -25.921 -20.966 1.00 74.24  ? 27  ALA C HB2    1 
ATOM   8921  H  HB3    . ALA C 1 27  ? 45.146  -26.301 -19.941 1.00 74.24  ? 27  ALA C HB3    1 
ATOM   8922  N  N      . GLU C 1 28  ? 44.943  -29.160 -18.872 1.00 68.12  ? 28  GLU C N      1 
ATOM   8923  C  CA     . GLU C 1 28  ? 44.617  -30.017 -17.729 1.00 67.44  ? 28  GLU C CA     1 
ATOM   8924  C  C      . GLU C 1 28  ? 45.409  -31.313 -17.834 1.00 74.56  ? 28  GLU C C      1 
ATOM   8925  O  O      . GLU C 1 28  ? 45.846  -31.884 -16.829 1.00 53.23  ? 28  GLU C O      1 
ATOM   8926  C  CB     . GLU C 1 28  ? 43.116  -30.324 -17.674 1.00 56.50  ? 28  GLU C CB     1 
ATOM   8927  C  CG     . GLU C 1 28  ? 42.715  -31.281 -16.546 1.00 63.39  ? 28  GLU C CG     1 
ATOM   8928  C  CD     . GLU C 1 28  ? 41.254  -31.695 -16.607 1.00 74.82  ? 28  GLU C CD     1 
ATOM   8929  O  OE1    . GLU C 1 28  ? 40.770  -32.321 -15.638 1.00 62.13  ? 28  GLU C OE1    1 
ATOM   8930  O  OE2    . GLU C 1 28  ? 40.590  -31.407 -17.624 1.00 79.87  ? 28  GLU C OE2    1 
ATOM   8931  H  H      . GLU C 1 28  ? 44.284  -29.030 -19.409 1.00 81.74  ? 28  GLU C H      1 
ATOM   8932  H  HA     . GLU C 1 28  ? 44.868  -29.568 -16.907 1.00 80.93  ? 28  GLU C HA     1 
ATOM   8933  H  HB2    . GLU C 1 28  ? 42.632  -29.493 -17.543 1.00 67.80  ? 28  GLU C HB2    1 
ATOM   8934  H  HB3    . GLU C 1 28  ? 42.850  -30.729 -18.515 1.00 67.80  ? 28  GLU C HB3    1 
ATOM   8935  H  HG2    . GLU C 1 28  ? 43.256  -32.083 -16.606 1.00 76.07  ? 28  GLU C HG2    1 
ATOM   8936  H  HG3    . GLU C 1 28  ? 42.866  -30.843 -15.693 1.00 76.07  ? 28  GLU C HG3    1 
ATOM   8937  N  N      . GLU C 1 29  ? 45.558  -31.780 -19.069 1.00 67.28  ? 29  GLU C N      1 
ATOM   8938  C  CA     . GLU C 1 29  ? 46.288  -33.003 -19.367 1.00 71.22  ? 29  GLU C CA     1 
ATOM   8939  C  C      . GLU C 1 29  ? 47.770  -32.833 -19.029 1.00 74.48  ? 29  GLU C C      1 
ATOM   8940  O  O      . GLU C 1 29  ? 48.387  -33.719 -18.433 1.00 68.25  ? 29  GLU C O      1 
ATOM   8941  C  CB     . GLU C 1 29  ? 46.103  -33.371 -20.844 1.00 75.39  ? 29  GLU C CB     1 
ATOM   8942  C  CG     . GLU C 1 29  ? 46.641  -34.736 -21.238 1.00 93.10  ? 29  GLU C CG     1 
ATOM   8943  C  CD     . GLU C 1 29  ? 46.370  -35.066 -22.696 1.00 96.09  ? 29  GLU C CD     1 
ATOM   8944  O  OE1    . GLU C 1 29  ? 46.378  -34.136 -23.531 1.00 95.80  ? 29  GLU C OE1    1 
ATOM   8945  O  OE2    . GLU C 1 29  ? 46.145  -36.255 -23.006 1.00 88.74  ? 29  GLU C OE2    1 
ATOM   8946  H  H      . GLU C 1 29  ? 45.236  -31.395 -19.767 1.00 80.73  ? 29  GLU C H      1 
ATOM   8947  H  HA     . GLU C 1 29  ? 45.934  -33.726 -18.827 1.00 85.47  ? 29  GLU C HA     1 
ATOM   8948  H  HB2    . GLU C 1 29  ? 45.155  -33.361 -21.048 1.00 90.47  ? 29  GLU C HB2    1 
ATOM   8949  H  HB3    . GLU C 1 29  ? 46.560  -32.709 -21.386 1.00 90.47  ? 29  GLU C HB3    1 
ATOM   8950  H  HG2    . GLU C 1 29  ? 47.602  -34.751 -21.100 1.00 111.72 ? 29  GLU C HG2    1 
ATOM   8951  H  HG3    . GLU C 1 29  ? 46.216  -35.415 -20.692 1.00 111.72 ? 29  GLU C HG3    1 
ATOM   8952  N  N      . GLU C 1 30  ? 48.320  -31.674 -19.384 1.00 65.82  ? 30  GLU C N      1 
ATOM   8953  C  CA     . GLU C 1 30  ? 49.735  -31.380 -19.168 1.00 66.27  ? 30  GLU C CA     1 
ATOM   8954  C  C      . GLU C 1 30  ? 50.090  -31.248 -17.684 1.00 61.76  ? 30  GLU C C      1 
ATOM   8955  O  O      . GLU C 1 30  ? 51.210  -31.567 -17.277 1.00 54.67  ? 30  GLU C O      1 
ATOM   8956  C  CB     . GLU C 1 30  ? 50.109  -30.091 -19.911 1.00 51.21  ? 30  GLU C CB     1 
ATOM   8957  C  CG     . GLU C 1 30  ? 51.568  -29.677 -19.791 1.00 42.70  ? 30  GLU C CG     1 
ATOM   8958  C  CD     . GLU C 1 30  ? 52.514  -30.671 -20.430 1.00 61.74  ? 30  GLU C CD     1 
ATOM   8959  O  OE1    . GLU C 1 30  ? 52.039  -31.568 -21.159 1.00 70.38  ? 30  GLU C OE1    1 
ATOM   8960  O  OE2    . GLU C 1 30  ? 53.737  -30.549 -20.210 1.00 70.59  ? 30  GLU C OE2    1 
ATOM   8961  H  H      . GLU C 1 30  ? 47.888  -31.032 -19.759 1.00 78.99  ? 30  GLU C H      1 
ATOM   8962  H  HA     . GLU C 1 30  ? 50.266  -32.103 -19.538 1.00 79.53  ? 30  GLU C HA     1 
ATOM   8963  H  HB2    . GLU C 1 30  ? 49.917  -30.212 -20.854 1.00 61.46  ? 30  GLU C HB2    1 
ATOM   8964  H  HB3    . GLU C 1 30  ? 49.570  -29.365 -19.560 1.00 61.46  ? 30  GLU C HB3    1 
ATOM   8965  H  HG2    . GLU C 1 30  ? 51.690  -28.821 -20.230 1.00 51.24  ? 30  GLU C HG2    1 
ATOM   8966  H  HG3    . GLU C 1 30  ? 51.799  -29.604 -18.852 1.00 51.24  ? 30  GLU C HG3    1 
ATOM   8967  N  N      . LEU C 1 31  ? 49.140  -30.770 -16.885 1.00 46.40  ? 31  LEU C N      1 
ATOM   8968  C  CA     . LEU C 1 31  ? 49.349  -30.593 -15.449 1.00 52.18  ? 31  LEU C CA     1 
ATOM   8969  C  C      . LEU C 1 31  ? 49.417  -31.917 -14.685 1.00 67.62  ? 31  LEU C C      1 
ATOM   8970  O  O      . LEU C 1 31  ? 50.310  -32.123 -13.857 1.00 50.85  ? 31  LEU C O      1 
ATOM   8971  C  CB     . LEU C 1 31  ? 48.232  -29.731 -14.855 1.00 61.35  ? 31  LEU C CB     1 
ATOM   8972  C  CG     . LEU C 1 31  ? 48.241  -28.234 -15.165 1.00 46.09  ? 31  LEU C CG     1 
ATOM   8973  C  CD1    . LEU C 1 31  ? 46.968  -27.591 -14.642 1.00 51.94  ? 31  LEU C CD1    1 
ATOM   8974  C  CD2    . LEU C 1 31  ? 49.452  -27.564 -14.555 1.00 47.34  ? 31  LEU C CD2    1 
ATOM   8975  H  H      . LEU C 1 31  ? 48.356  -30.539 -17.153 1.00 55.68  ? 31  LEU C H      1 
ATOM   8976  H  HA     . LEU C 1 31  ? 50.189  -30.127 -15.311 1.00 62.61  ? 31  LEU C HA     1 
ATOM   8977  H  HB2    . LEU C 1 31  ? 47.384  -30.080 -15.173 1.00 73.62  ? 31  LEU C HB2    1 
ATOM   8978  H  HB3    . LEU C 1 31  ? 48.268  -29.820 -13.889 1.00 73.62  ? 31  LEU C HB3    1 
ATOM   8979  H  HG     . LEU C 1 31  ? 48.274  -28.106 -16.126 1.00 55.31  ? 31  LEU C HG     1 
ATOM   8980  H  HD11   . LEU C 1 31  ? 46.987  -26.642 -14.845 1.00 62.33  ? 31  LEU C HD11   1 
ATOM   8981  H  HD12   . LEU C 1 31  ? 46.205  -28.006 -15.072 1.00 62.33  ? 31  LEU C HD12   1 
ATOM   8982  H  HD13   . LEU C 1 31  ? 46.920  -27.723 -13.682 1.00 62.33  ? 31  LEU C HD13   1 
ATOM   8983  H  HD21   . LEU C 1 31  ? 49.430  -26.618 -14.769 1.00 56.81  ? 31  LEU C HD21   1 
ATOM   8984  H  HD22   . LEU C 1 31  ? 49.429  -27.687 -13.593 1.00 56.81  ? 31  LEU C HD22   1 
ATOM   8985  H  HD23   . LEU C 1 31  ? 50.254  -27.968 -14.922 1.00 56.81  ? 31  LEU C HD23   1 
ATOM   8986  N  N      . ARG C 1 32  ? 48.468  -32.807 -14.970 1.00 72.75  ? 32  ARG C N      1 
ATOM   8987  C  CA     . ARG C 1 32  ? 48.398  -34.114 -14.318 1.00 56.72  ? 32  ARG C CA     1 
ATOM   8988  C  C      . ARG C 1 32  ? 49.655  -34.930 -14.589 1.00 67.34  ? 32  ARG C C      1 
ATOM   8989  O  O      . ARG C 1 32  ? 50.067  -35.738 -13.752 1.00 48.34  ? 32  ARG C O      1 
ATOM   8990  C  CB     . ARG C 1 32  ? 47.160  -34.885 -14.781 1.00 64.46  ? 32  ARG C CB     1 
ATOM   8991  C  CG     . ARG C 1 32  ? 45.855  -34.367 -14.193 1.00 58.97  ? 32  ARG C CG     1 
ATOM   8992  C  CD     . ARG C 1 32  ? 44.833  -35.481 -14.013 1.00 42.04  ? 32  ARG C CD     1 
ATOM   8993  N  NE     . ARG C 1 32  ? 43.700  -35.054 -13.194 1.00 48.24  ? 32  ARG C NE     1 
ATOM   8994  C  CZ     . ARG C 1 32  ? 42.645  -34.386 -13.655 1.00 59.72  ? 32  ARG C CZ     1 
ATOM   8995  N  NH1    . ARG C 1 32  ? 42.566  -34.059 -14.940 1.00 44.40  ? 32  ARG C NH1    1 
ATOM   8996  N  NH2    . ARG C 1 32  ? 41.664  -34.042 -12.829 1.00 47.04  ? 32  ARG C NH2    1 
ATOM   8997  H  H      . ARG C 1 32  ? 47.844  -32.676 -15.547 1.00 87.30  ? 32  ARG C H      1 
ATOM   8998  H  HA     . ARG C 1 32  ? 48.328  -33.984 -13.359 1.00 68.06  ? 32  ARG C HA     1 
ATOM   8999  H  HB2    . ARG C 1 32  ? 47.096  -34.822 -15.747 1.00 77.35  ? 32  ARG C HB2    1 
ATOM   9000  H  HB3    . ARG C 1 32  ? 47.255  -35.814 -14.518 1.00 77.35  ? 32  ARG C HB3    1 
ATOM   9001  H  HG2    . ARG C 1 32  ? 46.031  -33.974 -13.323 1.00 70.76  ? 32  ARG C HG2    1 
ATOM   9002  H  HG3    . ARG C 1 32  ? 45.478  -33.702 -14.790 1.00 70.76  ? 32  ARG C HG3    1 
ATOM   9003  H  HD2    . ARG C 1 32  ? 44.495  -35.746 -14.883 1.00 50.45  ? 32  ARG C HD2    1 
ATOM   9004  H  HD3    . ARG C 1 32  ? 45.257  -36.235 -13.574 1.00 50.45  ? 32  ARG C HD3    1 
ATOM   9005  H  HE     . ARG C 1 32  ? 43.715  -35.248 -12.356 1.00 57.89  ? 32  ARG C HE     1 
ATOM   9006  H  HH11   . ARG C 1 32  ? 43.199  -34.280 -15.480 1.00 53.29  ? 32  ARG C HH11   1 
ATOM   9007  H  HH12   . ARG C 1 32  ? 41.883  -33.628 -15.233 1.00 53.29  ? 32  ARG C HH12   1 
ATOM   9008  H  HH21   . ARG C 1 32  ? 41.710  -34.251 -11.996 1.00 56.44  ? 32  ARG C HH21   1 
ATOM   9009  H  HH22   . ARG C 1 32  ? 40.982  -33.610 -13.127 1.00 56.44  ? 32  ARG C HH22   1 
ATOM   9010  N  N      . ARG C 1 33  ? 50.248  -34.730 -15.766 1.00 70.51  ? 33  ARG C N      1 
ATOM   9011  C  CA     . ARG C 1 33  ? 51.504  -35.386 -16.106 1.00 58.88  ? 33  ARG C CA     1 
ATOM   9012  C  C      . ARG C 1 33  ? 52.532  -35.023 -15.049 1.00 56.76  ? 33  ARG C C      1 
ATOM   9013  O  O      . ARG C 1 33  ? 53.216  -35.886 -14.499 1.00 49.35  ? 33  ARG C O      1 
ATOM   9014  C  CB     . ARG C 1 33  ? 52.012  -34.952 -17.486 1.00 59.05  ? 33  ARG C CB     1 
ATOM   9015  C  CG     . ARG C 1 33  ? 51.193  -35.436 -18.669 1.00 63.11  ? 33  ARG C CG     1 
ATOM   9016  C  CD     . ARG C 1 33  ? 51.648  -34.750 -19.955 1.00 68.31  ? 33  ARG C CD     1 
ATOM   9017  N  NE     . ARG C 1 33  ? 50.769  -35.042 -21.088 1.00 90.65  ? 33  ARG C NE     1 
ATOM   9018  C  CZ     . ARG C 1 33  ? 50.985  -35.990 -22.000 1.00 92.00  ? 33  ARG C CZ     1 
ATOM   9019  N  NH1    . ARG C 1 33  ? 52.062  -36.765 -21.939 1.00 65.12  ? 33  ARG C NH1    1 
ATOM   9020  N  NH2    . ARG C 1 33  ? 50.116  -36.165 -22.988 1.00 83.76  ? 33  ARG C NH2    1 
ATOM   9021  H  H      . ARG C 1 33  ? 49.940  -34.218 -16.385 1.00 84.61  ? 33  ARG C H      1 
ATOM   9022  H  HA     . ARG C 1 33  ? 51.382  -36.349 -16.106 1.00 70.66  ? 33  ARG C HA     1 
ATOM   9023  H  HB2    . ARG C 1 33  ? 52.022  -33.983 -17.518 1.00 70.85  ? 33  ARG C HB2    1 
ATOM   9024  H  HB3    . ARG C 1 33  ? 52.914  -35.289 -17.601 1.00 70.85  ? 33  ARG C HB3    1 
ATOM   9025  H  HG2    . ARG C 1 33  ? 51.311  -36.393 -18.774 1.00 75.73  ? 33  ARG C HG2    1 
ATOM   9026  H  HG3    . ARG C 1 33  ? 50.258  -35.224 -18.523 1.00 75.73  ? 33  ARG C HG3    1 
ATOM   9027  H  HD2    . ARG C 1 33  ? 51.653  -33.790 -19.817 1.00 81.97  ? 33  ARG C HD2    1 
ATOM   9028  H  HD3    . ARG C 1 33  ? 52.540  -35.059 -20.179 1.00 81.97  ? 33  ARG C HD3    1 
ATOM   9029  H  HE     . ARG C 1 33  ? 50.058  -34.565 -21.172 1.00 108.78 ? 33  ARG C HE     1 
ATOM   9030  H  HH11   . ARG C 1 33  ? 52.632  -36.660 -21.303 1.00 78.15  ? 33  ARG C HH11   1 
ATOM   9031  H  HH12   . ARG C 1 33  ? 52.190  -37.372 -22.534 1.00 78.15  ? 33  ARG C HH12   1 
ATOM   9032  H  HH21   . ARG C 1 33  ? 49.415  -35.668 -23.037 1.00 100.51 ? 33  ARG C HH21   1 
ATOM   9033  H  HH22   . ARG C 1 33  ? 50.252  -36.775 -23.578 1.00 100.51 ? 33  ARG C HH22   1 
ATOM   9034  N  N      . ARG C 1 34  ? 52.597  -33.729 -14.752 1.00 53.49  ? 34  ARG C N      1 
ATOM   9035  C  CA     . ARG C 1 34  ? 53.589  -33.179 -13.838 1.00 61.01  ? 34  ARG C CA     1 
ATOM   9036  C  C      . ARG C 1 34  ? 53.244  -33.453 -12.372 1.00 52.54  ? 34  ARG C C      1 
ATOM   9037  O  O      . ARG C 1 34  ? 54.132  -33.713 -11.558 1.00 46.32  ? 34  ARG C O      1 
ATOM   9038  C  CB     . ARG C 1 34  ? 53.721  -31.672 -14.088 1.00 44.53  ? 34  ARG C CB     1 
ATOM   9039  C  CG     . ARG C 1 34  ? 54.084  -31.345 -15.537 1.00 55.54  ? 34  ARG C CG     1 
ATOM   9040  C  CD     . ARG C 1 34  ? 54.062  -29.856 -15.842 1.00 38.29  ? 34  ARG C CD     1 
ATOM   9041  N  NE     . ARG C 1 34  ? 54.306  -29.606 -17.263 1.00 34.72  ? 34  ARG C NE     1 
ATOM   9042  C  CZ     . ARG C 1 34  ? 54.370  -28.398 -17.820 1.00 43.50  ? 34  ARG C CZ     1 
ATOM   9043  N  NH1    . ARG C 1 34  ? 54.212  -27.308 -17.081 1.00 53.06  ? 34  ARG C NH1    1 
ATOM   9044  N  NH2    . ARG C 1 34  ? 54.593  -28.279 -19.122 1.00 54.07  ? 34  ARG C NH2    1 
ATOM   9045  H  H      . ARG C 1 34  ? 52.063  -33.137 -15.075 1.00 64.19  ? 34  ARG C H      1 
ATOM   9046  H  HA     . ARG C 1 34  ? 54.448  -33.589 -14.024 1.00 73.21  ? 34  ARG C HA     1 
ATOM   9047  H  HB2    . ARG C 1 34  ? 52.876  -31.242 -13.886 1.00 53.43  ? 34  ARG C HB2    1 
ATOM   9048  H  HB3    . ARG C 1 34  ? 54.420  -31.317 -13.517 1.00 53.43  ? 34  ARG C HB3    1 
ATOM   9049  H  HG2    . ARG C 1 34  ? 54.978  -31.674 -15.719 1.00 66.65  ? 34  ARG C HG2    1 
ATOM   9050  H  HG3    . ARG C 1 34  ? 53.446  -31.779 -16.125 1.00 66.65  ? 34  ARG C HG3    1 
ATOM   9051  H  HD2    . ARG C 1 34  ? 53.192  -29.493 -15.613 1.00 45.94  ? 34  ARG C HD2    1 
ATOM   9052  H  HD3    . ARG C 1 34  ? 54.757  -29.413 -15.330 1.00 45.94  ? 34  ARG C HD3    1 
ATOM   9053  H  HE     . ARG C 1 34  ? 54.417  -30.288 -17.775 1.00 41.66  ? 34  ARG C HE     1 
ATOM   9054  H  HH11   . ARG C 1 34  ? 54.066  -27.379 -16.236 1.00 63.67  ? 34  ARG C HH11   1 
ATOM   9055  H  HH12   . ARG C 1 34  ? 54.255  -26.531 -17.446 1.00 63.67  ? 34  ARG C HH12   1 
ATOM   9056  H  HH21   . ARG C 1 34  ? 54.697  -28.981 -19.607 1.00 64.89  ? 34  ARG C HH21   1 
ATOM   9057  H  HH22   . ARG C 1 34  ? 54.636  -27.498 -19.481 1.00 64.89  ? 34  ARG C HH22   1 
ATOM   9058  N  N      . LEU C 1 35  ? 51.957  -33.411 -12.042 1.00 41.11  ? 35  LEU C N      1 
ATOM   9059  C  CA     . LEU C 1 35  ? 51.518  -33.626 -10.665 1.00 46.11  ? 35  LEU C CA     1 
ATOM   9060  C  C      . LEU C 1 35  ? 51.697  -35.077 -10.233 1.00 49.42  ? 35  LEU C C      1 
ATOM   9061  O  O      . LEU C 1 35  ? 52.168  -35.350 -9.128  1.00 46.20  ? 35  LEU C O      1 
ATOM   9062  C  CB     . LEU C 1 35  ? 50.051  -33.222 -10.508 1.00 50.41  ? 35  LEU C CB     1 
ATOM   9063  C  CG     . LEU C 1 35  ? 49.757  -31.721 -10.527 1.00 40.95  ? 35  LEU C CG     1 
ATOM   9064  C  CD1    . LEU C 1 35  ? 48.264  -31.481 -10.717 1.00 39.40  ? 35  LEU C CD1    1 
ATOM   9065  C  CD2    . LEU C 1 35  ? 50.260  -31.055 -9.250  1.00 24.81  ? 35  LEU C CD2    1 
ATOM   9066  H  H      . LEU C 1 35  ? 51.317  -33.259 -12.597 1.00 49.33  ? 35  LEU C H      1 
ATOM   9067  H  HA     . LEU C 1 35  ? 52.048  -33.068 -10.074 1.00 55.33  ? 35  LEU C HA     1 
ATOM   9068  H  HB2    . LEU C 1 35  ? 49.545  -33.624 -11.232 1.00 60.49  ? 35  LEU C HB2    1 
ATOM   9069  H  HB3    . LEU C 1 35  ? 49.729  -33.568 -9.661  1.00 60.49  ? 35  LEU C HB3    1 
ATOM   9070  H  HG     . LEU C 1 35  ? 50.222  -31.319 -11.277 1.00 49.14  ? 35  LEU C HG     1 
ATOM   9071  H  HD11   . LEU C 1 35  ? 48.097  -30.525 -10.727 1.00 47.28  ? 35  LEU C HD11   1 
ATOM   9072  H  HD12   . LEU C 1 35  ? 47.987  -31.874 -11.560 1.00 47.28  ? 35  LEU C HD12   1 
ATOM   9073  H  HD13   . LEU C 1 35  ? 47.782  -31.894 -9.984  1.00 47.28  ? 35  LEU C HD13   1 
ATOM   9074  H  HD21   . LEU C 1 35  ? 50.060  -30.106 -9.289  1.00 29.77  ? 35  LEU C HD21   1 
ATOM   9075  H  HD22   . LEU C 1 35  ? 49.813  -31.456 -8.488  1.00 29.77  ? 35  LEU C HD22   1 
ATOM   9076  H  HD23   . LEU C 1 35  ? 51.218  -31.189 -9.180  1.00 29.77  ? 35  LEU C HD23   1 
ATOM   9077  N  N      . ASP C 1 36  ? 51.305  -36.002 -11.106 1.00 67.53  ? 36  ASP C N      1 
ATOM   9078  C  CA     . ASP C 1 36  ? 51.447  -37.429 -10.833 1.00 56.40  ? 36  ASP C CA     1 
ATOM   9079  C  C      . ASP C 1 36  ? 52.920  -37.818 -10.823 1.00 55.07  ? 36  ASP C C      1 
ATOM   9080  O  O      . ASP C 1 36  ? 53.347  -38.659 -10.028 1.00 35.10  ? 36  ASP C O      1 
ATOM   9081  C  CB     . ASP C 1 36  ? 50.683  -38.257 -11.871 1.00 50.79  ? 36  ASP C CB     1 
ATOM   9082  C  CG     . ASP C 1 36  ? 49.174  -38.091 -11.759 1.00 62.63  ? 36  ASP C CG     1 
ATOM   9083  O  OD1    . ASP C 1 36  ? 48.679  -37.853 -10.635 1.00 56.61  ? 36  ASP C OD1    1 
ATOM   9084  O  OD2    . ASP C 1 36  ? 48.486  -38.195 -12.798 1.00 61.65  ? 36  ASP C OD2    1 
ATOM   9085  H  H      . ASP C 1 36  ? 50.951  -35.827 -11.869 1.00 81.03  ? 36  ASP C H      1 
ATOM   9086  H  HA     . ASP C 1 36  ? 51.077  -37.625 -9.958  1.00 67.68  ? 36  ASP C HA     1 
ATOM   9087  H  HB2    . ASP C 1 36  ? 50.950  -37.976 -12.759 1.00 60.95  ? 36  ASP C HB2    1 
ATOM   9088  H  HB3    . ASP C 1 36  ? 50.891  -39.196 -11.743 1.00 60.95  ? 36  ASP C HB3    1 
ATOM   9089  N  N      . GLU C 1 37  ? 53.692  -37.185 -11.703 1.00 49.47  ? 37  GLU C N      1 
ATOM   9090  C  CA     . GLU C 1 37  ? 55.130  -37.415 -11.773 1.00 47.46  ? 37  GLU C CA     1 
ATOM   9091  C  C      . GLU C 1 37  ? 55.793  -36.974 -10.472 1.00 57.11  ? 37  GLU C C      1 
ATOM   9092  O  O      . GLU C 1 37  ? 56.821  -37.522 -10.066 1.00 52.55  ? 37  GLU C O      1 
ATOM   9093  C  CB     . GLU C 1 37  ? 55.730  -36.667 -12.964 1.00 43.39  ? 37  GLU C CB     1 
ATOM   9094  C  CG     . GLU C 1 37  ? 57.173  -37.017 -13.271 1.00 58.42  ? 37  GLU C CG     1 
ATOM   9095  C  CD     . GLU C 1 37  ? 57.713  -36.230 -14.448 1.00 68.09  ? 37  GLU C CD     1 
ATOM   9096  O  OE1    . GLU C 1 37  ? 56.952  -35.423 -15.026 1.00 64.46  ? 37  GLU C OE1    1 
ATOM   9097  O  OE2    . GLU C 1 37  ? 58.895  -36.421 -14.800 1.00 83.07  ? 37  GLU C OE2    1 
ATOM   9098  H  H      . GLU C 1 37  ? 53.403  -36.612 -12.275 1.00 59.37  ? 37  GLU C H      1 
ATOM   9099  H  HA     . GLU C 1 37  ? 55.297  -38.362 -11.893 1.00 56.95  ? 37  GLU C HA     1 
ATOM   9100  H  HB2    . GLU C 1 37  ? 55.204  -36.870 -13.753 1.00 52.07  ? 37  GLU C HB2    1 
ATOM   9101  H  HB3    . GLU C 1 37  ? 55.691  -35.715 -12.783 1.00 52.07  ? 37  GLU C HB3    1 
ATOM   9102  H  HG2    . GLU C 1 37  ? 57.721  -36.815 -12.496 1.00 70.10  ? 37  GLU C HG2    1 
ATOM   9103  H  HG3    . GLU C 1 37  ? 57.232  -37.961 -13.486 1.00 70.10  ? 37  GLU C HG3    1 
ATOM   9104  N  N      . LEU C 1 38  ? 55.191  -35.983 -9.822  1.00 46.87  ? 38  LEU C N      1 
ATOM   9105  C  CA     . LEU C 1 38  ? 55.697  -35.476 -8.554  1.00 51.05  ? 38  LEU C CA     1 
ATOM   9106  C  C      . LEU C 1 38  ? 55.093  -36.257 -7.380  1.00 64.03  ? 38  LEU C C      1 
ATOM   9107  O  O      . LEU C 1 38  ? 55.555  -36.138 -6.242  1.00 50.88  ? 38  LEU C O      1 
ATOM   9108  C  CB     . LEU C 1 38  ? 55.392  -33.982 -8.422  1.00 46.83  ? 38  LEU C CB     1 
ATOM   9109  C  CG     . LEU C 1 38  ? 56.266  -33.035 -9.254  1.00 41.21  ? 38  LEU C CG     1 
ATOM   9110  C  CD1    . LEU C 1 38  ? 55.747  -31.605 -9.147  1.00 45.21  ? 38  LEU C CD1    1 
ATOM   9111  C  CD2    . LEU C 1 38  ? 57.729  -33.101 -8.831  1.00 48.09  ? 38  LEU C CD2    1 
ATOM   9112  H  H      . LEU C 1 38  ? 54.480  -35.584 -10.099 1.00 56.24  ? 38  LEU C H      1 
ATOM   9113  H  HA     . LEU C 1 38  ? 56.660  -35.591 -8.529  1.00 61.27  ? 38  LEU C HA     1 
ATOM   9114  H  HB2    . LEU C 1 38  ? 54.472  -33.834 -8.690  1.00 56.19  ? 38  LEU C HB2    1 
ATOM   9115  H  HB3    . LEU C 1 38  ? 55.500  -33.730 -7.491  1.00 56.19  ? 38  LEU C HB3    1 
ATOM   9116  H  HG     . LEU C 1 38  ? 56.215  -33.300 -10.186 1.00 49.45  ? 38  LEU C HG     1 
ATOM   9117  H  HD11   . LEU C 1 38  ? 56.313  -31.024 -9.680  1.00 54.25  ? 38  LEU C HD11   1 
ATOM   9118  H  HD12   . LEU C 1 38  ? 54.836  -31.575 -9.479  1.00 54.25  ? 38  LEU C HD12   1 
ATOM   9119  H  HD13   . LEU C 1 38  ? 55.771  -31.330 -8.218  1.00 54.25  ? 38  LEU C HD13   1 
ATOM   9120  H  HD21   . LEU C 1 38  ? 58.244  -32.490 -9.380  1.00 57.71  ? 38  LEU C HD21   1 
ATOM   9121  H  HD22   . LEU C 1 38  ? 57.799  -32.847 -7.898  1.00 57.71  ? 38  LEU C HD22   1 
ATOM   9122  H  HD23   . LEU C 1 38  ? 58.051  -34.008 -8.953  1.00 57.71  ? 38  LEU C HD23   1 
ATOM   9123  N  N      . GLY C 1 39  ? 54.073  -37.065 -7.666  1.00 61.67  ? 39  GLY C N      1 
ATOM   9124  C  CA     . GLY C 1 39  ? 53.451  -37.905 -6.655  1.00 53.88  ? 39  GLY C CA     1 
ATOM   9125  C  C      . GLY C 1 39  ? 52.868  -37.130 -5.486  1.00 62.79  ? 39  GLY C C      1 
ATOM   9126  O  O      . GLY C 1 39  ? 53.194  -37.405 -4.328  1.00 48.02  ? 39  GLY C O      1 
ATOM   9127  H  H      . GLY C 1 39  ? 53.722  -37.142 -8.447  1.00 74.01  ? 39  GLY C H      1 
ATOM   9128  H  HA2    . GLY C 1 39  ? 52.736  -38.418 -7.064  1.00 64.66  ? 39  GLY C HA2    1 
ATOM   9129  H  HA3    . GLY C 1 39  ? 54.110  -38.526 -6.307  1.00 64.66  ? 39  GLY C HA3    1 
ATOM   9130  N  N      . VAL C 1 40  ? 52.012  -36.157 -5.793  1.00 66.61  ? 40  VAL C N      1 
ATOM   9131  C  CA     . VAL C 1 40  ? 51.339  -35.355 -4.771  1.00 46.69  ? 40  VAL C CA     1 
ATOM   9132  C  C      . VAL C 1 40  ? 49.834  -35.603 -4.792  1.00 51.34  ? 40  VAL C C      1 
ATOM   9133  O  O      . VAL C 1 40  ? 49.242  -35.774 -5.859  1.00 53.17  ? 40  VAL C O      1 
ATOM   9134  C  CB     . VAL C 1 40  ? 51.584  -33.846 -4.979  1.00 51.89  ? 40  VAL C CB     1 
ATOM   9135  C  CG1    . VAL C 1 40  ? 51.236  -33.076 -3.707  1.00 62.87  ? 40  VAL C CG1    1 
ATOM   9136  C  CG2    . VAL C 1 40  ? 53.027  -33.585 -5.396  1.00 32.94  ? 40  VAL C CG2    1 
ATOM   9137  H  H      . VAL C 1 40  ? 51.801  -35.938 -6.597  1.00 79.93  ? 40  VAL C H      1 
ATOM   9138  H  HA     . VAL C 1 40  ? 51.677  -35.602 -3.896  1.00 56.02  ? 40  VAL C HA     1 
ATOM   9139  H  HB     . VAL C 1 40  ? 51.005  -33.528 -5.689  1.00 62.27  ? 40  VAL C HB     1 
ATOM   9140  H  HG11   . VAL C 1 40  ? 51.396  -32.131 -3.857  1.00 75.44  ? 40  VAL C HG11   1 
ATOM   9141  H  HG12   . VAL C 1 40  ? 50.301  -33.223 -3.495  1.00 75.44  ? 40  VAL C HG12   1 
ATOM   9142  H  HG13   . VAL C 1 40  ? 51.795  -33.395 -2.982  1.00 75.44  ? 40  VAL C HG13   1 
ATOM   9143  H  HG21   . VAL C 1 40  ? 53.152  -32.630 -5.518  1.00 39.52  ? 40  VAL C HG21   1 
ATOM   9144  H  HG22   . VAL C 1 40  ? 53.620  -33.909 -4.700  1.00 39.52  ? 40  VAL C HG22   1 
ATOM   9145  H  HG23   . VAL C 1 40  ? 53.205  -34.052 -6.227  1.00 39.52  ? 40  VAL C HG23   1 
ATOM   9146  N  N      . GLU C 1 41  ? 49.212  -35.620 -3.616  1.00 43.40  ? 41  GLU C N      1 
ATOM   9147  C  CA     . GLU C 1 41  ? 47.763  -35.774 -3.543  1.00 55.41  ? 41  GLU C CA     1 
ATOM   9148  C  C      . GLU C 1 41  ? 47.111  -34.430 -3.861  1.00 59.41  ? 41  GLU C C      1 
ATOM   9149  O  O      . GLU C 1 41  ? 47.282  -33.452 -3.127  1.00 53.98  ? 41  GLU C O      1 
ATOM   9150  C  CB     . GLU C 1 41  ? 47.321  -36.279 -2.165  1.00 41.84  ? 41  GLU C CB     1 
ATOM   9151  C  CG     . GLU C 1 41  ? 45.879  -36.795 -2.135  1.00 47.29  ? 41  GLU C CG     1 
ATOM   9152  C  CD     . GLU C 1 41  ? 45.481  -37.383 -0.790  1.00 73.08  ? 41  GLU C CD     1 
ATOM   9153  O  OE1    . GLU C 1 41  ? 46.376  -37.834 -0.043  1.00 67.57  ? 41  GLU C OE1    1 
ATOM   9154  O  OE2    . GLU C 1 41  ? 44.269  -37.391 -0.478  1.00 72.43  ? 41  GLU C OE2    1 
ATOM   9155  H  H      . GLU C 1 41  ? 49.601  -35.545 -2.853  1.00 52.08  ? 41  GLU C H      1 
ATOM   9156  H  HA     . GLU C 1 41  ? 47.475  -36.417 -4.209  1.00 66.49  ? 41  GLU C HA     1 
ATOM   9157  H  HB2    . GLU C 1 41  ? 47.903  -37.007 -1.896  1.00 50.21  ? 41  GLU C HB2    1 
ATOM   9158  H  HB3    . GLU C 1 41  ? 47.389  -35.551 -1.527  1.00 50.21  ? 41  GLU C HB3    1 
ATOM   9159  H  HG2    . GLU C 1 41  ? 45.277  -36.060 -2.329  1.00 56.74  ? 41  GLU C HG2    1 
ATOM   9160  H  HG3    . GLU C 1 41  ? 45.780  -37.489 -2.806  1.00 56.74  ? 41  GLU C HG3    1 
ATOM   9161  N  N      . TYR C 1 42  ? 46.366  -34.395 -4.962  1.00 50.25  ? 42  TYR C N      1 
ATOM   9162  C  CA     . TYR C 1 42  ? 45.742  -33.166 -5.437  1.00 49.69  ? 42  TYR C CA     1 
ATOM   9163  C  C      . TYR C 1 42  ? 44.298  -33.397 -5.882  1.00 55.33  ? 42  TYR C C      1 
ATOM   9164  O  O      . TYR C 1 42  ? 43.817  -34.530 -5.909  1.00 63.33  ? 42  TYR C O      1 
ATOM   9165  C  CB     . TYR C 1 42  ? 46.561  -32.575 -6.589  1.00 37.91  ? 42  TYR C CB     1 
ATOM   9166  C  CG     . TYR C 1 42  ? 46.563  -33.432 -7.833  1.00 32.50  ? 42  TYR C CG     1 
ATOM   9167  C  CD1    . TYR C 1 42  ? 45.578  -33.292 -8.801  1.00 35.63  ? 42  TYR C CD1    1 
ATOM   9168  C  CD2    . TYR C 1 42  ? 47.550  -34.384 -8.037  1.00 50.34  ? 42  TYR C CD2    1 
ATOM   9169  C  CE1    . TYR C 1 42  ? 45.577  -34.077 -9.937  1.00 51.59  ? 42  TYR C CE1    1 
ATOM   9170  C  CE2    . TYR C 1 42  ? 47.559  -35.174 -9.170  1.00 60.05  ? 42  TYR C CE2    1 
ATOM   9171  C  CZ     . TYR C 1 42  ? 46.570  -35.016 -10.117 1.00 52.85  ? 42  TYR C CZ     1 
ATOM   9172  O  OH     . TYR C 1 42  ? 46.575  -35.801 -11.247 1.00 52.67  ? 42  TYR C OH     1 
ATOM   9173  H  H      . TYR C 1 42  ? 46.205  -35.079 -5.458  1.00 60.30  ? 42  TYR C H      1 
ATOM   9174  H  HA     . TYR C 1 42  ? 45.732  -32.519 -4.714  1.00 59.63  ? 42  TYR C HA     1 
ATOM   9175  H  HB2    . TYR C 1 42  ? 46.190  -31.710 -6.825  1.00 45.49  ? 42  TYR C HB2    1 
ATOM   9176  H  HB3    . TYR C 1 42  ? 47.480  -32.471 -6.298  1.00 45.49  ? 42  TYR C HB3    1 
ATOM   9177  H  HD1    . TYR C 1 42  ? 44.907  -32.659 -8.681  1.00 42.76  ? 42  TYR C HD1    1 
ATOM   9178  H  HD2    . TYR C 1 42  ? 48.218  -34.493 -7.399  1.00 60.41  ? 42  TYR C HD2    1 
ATOM   9179  H  HE1    . TYR C 1 42  ? 44.911  -33.972 -10.578 1.00 61.91  ? 42  TYR C HE1    1 
ATOM   9180  H  HE2    . TYR C 1 42  ? 48.228  -35.808 -9.293  1.00 72.05  ? 42  TYR C HE2    1 
ATOM   9181  H  HH     . TYR C 1 42  ? 47.230  -36.326 -11.229 1.00 63.20  ? 42  TYR C HH     1 
ATOM   9182  N  N      . VAL C 1 43  ? 43.610  -32.306 -6.210  1.00 53.37  ? 43  VAL C N      1 
ATOM   9183  C  CA     . VAL C 1 43  ? 42.246  -32.366 -6.728  1.00 46.80  ? 43  VAL C CA     1 
ATOM   9184  C  C      . VAL C 1 43  ? 41.956  -31.135 -7.585  1.00 36.87  ? 43  VAL C C      1 
ATOM   9185  O  O      . VAL C 1 43  ? 42.429  -30.039 -7.283  1.00 40.65  ? 43  VAL C O      1 
ATOM   9186  C  CB     . VAL C 1 43  ? 41.202  -32.459 -5.586  1.00 47.41  ? 43  VAL C CB     1 
ATOM   9187  C  CG1    . VAL C 1 43  ? 41.284  -31.240 -4.668  1.00 44.94  ? 43  VAL C CG1    1 
ATOM   9188  C  CG2    . VAL C 1 43  ? 39.791  -32.616 -6.151  1.00 43.57  ? 43  VAL C CG2    1 
ATOM   9189  H  H      . VAL C 1 43  ? 43.917  -31.505 -6.139  1.00 64.04  ? 43  VAL C H      1 
ATOM   9190  H  HA     . VAL C 1 43  ? 42.153  -33.152 -7.288  1.00 56.16  ? 43  VAL C HA     1 
ATOM   9191  H  HB     . VAL C 1 43  ? 41.395  -33.245 -5.051  1.00 56.89  ? 43  VAL C HB     1 
ATOM   9192  H  HG11   . VAL C 1 43  ? 40.621  -31.329 -3.966  1.00 53.92  ? 43  VAL C HG11   1 
ATOM   9193  H  HG12   . VAL C 1 43  ? 42.172  -31.196 -4.281  1.00 53.92  ? 43  VAL C HG12   1 
ATOM   9194  H  HG13   . VAL C 1 43  ? 41.110  -30.441 -5.189  1.00 53.92  ? 43  VAL C HG13   1 
ATOM   9195  H  HG21   . VAL C 1 43  ? 39.161  -32.672 -5.416  1.00 52.29  ? 43  VAL C HG21   1 
ATOM   9196  H  HG22   . VAL C 1 43  ? 39.586  -31.847 -6.705  1.00 52.29  ? 43  VAL C HG22   1 
ATOM   9197  H  HG23   . VAL C 1 43  ? 39.753  -33.427 -6.682  1.00 52.29  ? 43  VAL C HG23   1 
ATOM   9198  N  N      . PHE C 1 44  ? 41.198  -31.324 -8.661  1.00 40.16  ? 44  PHE C N      1 
ATOM   9199  C  CA     . PHE C 1 44  ? 40.741  -30.209 -9.489  1.00 42.17  ? 44  PHE C CA     1 
ATOM   9200  C  C      . PHE C 1 44  ? 39.373  -29.713 -9.022  1.00 46.84  ? 44  PHE C C      1 
ATOM   9201  O  O      . PHE C 1 44  ? 38.424  -30.493 -8.919  1.00 48.77  ? 44  PHE C O      1 
ATOM   9202  C  CB     . PHE C 1 44  ? 40.681  -30.620 -10.961 1.00 47.54  ? 44  PHE C CB     1 
ATOM   9203  C  CG     . PHE C 1 44  ? 42.007  -30.536 -11.668 1.00 51.50  ? 44  PHE C CG     1 
ATOM   9204  C  CD1    . PHE C 1 44  ? 43.058  -31.362 -11.301 1.00 49.20  ? 44  PHE C CD1    1 
ATOM   9205  C  CD2    . PHE C 1 44  ? 42.197  -29.636 -12.706 1.00 51.66  ? 44  PHE C CD2    1 
ATOM   9206  C  CE1    . PHE C 1 44  ? 44.279  -31.286 -11.952 1.00 49.23  ? 44  PHE C CE1    1 
ATOM   9207  C  CE2    . PHE C 1 44  ? 43.414  -29.558 -13.362 1.00 46.41  ? 44  PHE C CE2    1 
ATOM   9208  C  CZ     . PHE C 1 44  ? 44.456  -30.384 -12.985 1.00 45.15  ? 44  PHE C CZ     1 
ATOM   9209  H  H      . PHE C 1 44  ? 40.933  -32.094 -8.936  1.00 48.19  ? 44  PHE C H      1 
ATOM   9210  H  HA     . PHE C 1 44  ? 41.370  -29.475 -9.407  1.00 50.60  ? 44  PHE C HA     1 
ATOM   9211  H  HB2    . PHE C 1 44  ? 40.373  -31.538 -11.018 1.00 57.05  ? 44  PHE C HB2    1 
ATOM   9212  H  HB3    . PHE C 1 44  ? 40.061  -30.035 -11.424 1.00 57.05  ? 44  PHE C HB3    1 
ATOM   9213  H  HD1    . PHE C 1 44  ? 42.944  -31.970 -10.607 1.00 59.04  ? 44  PHE C HD1    1 
ATOM   9214  H  HD2    . PHE C 1 44  ? 41.500  -29.078 -12.963 1.00 61.99  ? 44  PHE C HD2    1 
ATOM   9215  H  HE1    . PHE C 1 44  ? 44.978  -31.844 -11.696 1.00 59.08  ? 44  PHE C HE1    1 
ATOM   9216  H  HE2    . PHE C 1 44  ? 43.531  -28.949 -14.055 1.00 55.69  ? 44  PHE C HE2    1 
ATOM   9217  H  HZ     . PHE C 1 44  ? 45.275  -30.332 -13.424 1.00 54.18  ? 44  PHE C HZ     1 
ATOM   9218  N  N      . VAL C 1 45  ? 39.288  -28.416 -8.733  1.00 50.69  ? 45  VAL C N      1 
ATOM   9219  C  CA     . VAL C 1 45  ? 38.047  -27.786 -8.287  1.00 45.81  ? 45  VAL C CA     1 
ATOM   9220  C  C      . VAL C 1 45  ? 37.769  -26.543 -9.118  1.00 45.01  ? 45  VAL C C      1 
ATOM   9221  O  O      . VAL C 1 45  ? 38.458  -26.280 -10.108 1.00 43.42  ? 45  VAL C O      1 
ATOM   9222  C  CB     . VAL C 1 45  ? 38.098  -27.392 -6.788  1.00 42.26  ? 45  VAL C CB     1 
ATOM   9223  C  CG1    . VAL C 1 45  ? 38.228  -28.631 -5.912  1.00 47.09  ? 45  VAL C CG1    1 
ATOM   9224  C  CG2    . VAL C 1 45  ? 39.238  -26.410 -6.523  1.00 42.96  ? 45  VAL C CG2    1 
ATOM   9225  H  H      . VAL C 1 45  ? 39.950  -27.870 -8.789  1.00 60.83  ? 45  VAL C H      1 
ATOM   9226  H  HA     . VAL C 1 45  ? 37.312  -28.406 -8.413  1.00 54.98  ? 45  VAL C HA     1 
ATOM   9227  H  HB     . VAL C 1 45  ? 37.267  -26.950 -6.554  1.00 50.71  ? 45  VAL C HB     1 
ATOM   9228  H  HG11   . VAL C 1 45  ? 38.257  -28.357 -4.982  1.00 56.50  ? 45  VAL C HG11   1 
ATOM   9229  H  HG12   . VAL C 1 45  ? 37.462  -29.206 -6.064  1.00 56.50  ? 45  VAL C HG12   1 
ATOM   9230  H  HG13   . VAL C 1 45  ? 39.045  -29.098 -6.145  1.00 56.50  ? 45  VAL C HG13   1 
ATOM   9231  H  HG21   . VAL C 1 45  ? 39.246  -26.182 -5.580  1.00 51.56  ? 45  VAL C HG21   1 
ATOM   9232  H  HG22   . VAL C 1 45  ? 40.078  -26.828 -6.769  1.00 51.56  ? 45  VAL C HG22   1 
ATOM   9233  H  HG23   . VAL C 1 45  ? 39.097  -25.612 -7.056  1.00 51.56  ? 45  VAL C HG23   1 
ATOM   9234  N  N      . GLY C 1 46  ? 36.749  -25.790 -8.714  1.00 42.70  ? 46  GLY C N      1 
ATOM   9235  C  CA     . GLY C 1 46  ? 36.449  -24.509 -9.326  1.00 65.00  ? 46  GLY C CA     1 
ATOM   9236  C  C      . GLY C 1 46  ? 35.512  -24.606 -10.512 1.00 47.89  ? 46  GLY C C      1 
ATOM   9237  O  O      . GLY C 1 46  ? 34.909  -25.649 -10.762 1.00 43.34  ? 46  GLY C O      1 
ATOM   9238  H  H      . GLY C 1 46  ? 36.211  -26.007 -8.079  1.00 51.24  ? 46  GLY C H      1 
ATOM   9239  H  HA2    . GLY C 1 46  ? 36.042  -23.927 -8.665  1.00 78.00  ? 46  GLY C HA2    1 
ATOM   9240  H  HA3    . GLY C 1 46  ? 37.275  -24.097 -9.625  1.00 78.00  ? 46  GLY C HA3    1 
ATOM   9241  N  N      . SER C 1 47  ? 35.396  -23.507 -11.249 1.00 48.28  ? 47  SER C N      1 
ATOM   9242  C  CA     . SER C 1 47  ? 34.462  -23.431 -12.363 1.00 53.08  ? 47  SER C CA     1 
ATOM   9243  C  C      . SER C 1 47  ? 34.886  -24.339 -13.506 1.00 58.63  ? 47  SER C C      1 
ATOM   9244  O  O      . SER C 1 47  ? 34.095  -24.628 -14.404 1.00 67.86  ? 47  SER C O      1 
ATOM   9245  C  CB     . SER C 1 47  ? 34.348  -21.991 -12.864 1.00 59.25  ? 47  SER C CB     1 
ATOM   9246  O  OG     . SER C 1 47  ? 35.598  -21.515 -13.335 1.00 68.96  ? 47  SER C OG     1 
ATOM   9247  H  H      . SER C 1 47  ? 35.851  -22.788 -11.123 1.00 57.94  ? 47  SER C H      1 
ATOM   9248  H  HA     . SER C 1 47  ? 33.585  -23.715 -12.061 1.00 63.70  ? 47  SER C HA     1 
ATOM   9249  H  HB2    . SER C 1 47  ? 33.705  -21.960 -13.589 1.00 71.10  ? 47  SER C HB2    1 
ATOM   9250  H  HB3    . SER C 1 47  ? 34.051  -21.426 -12.133 1.00 71.10  ? 47  SER C HB3    1 
ATOM   9251  H  HG     . SER C 1 47  ? 36.166  -21.537 -12.716 1.00 82.76  ? 47  SER C HG     1 
ATOM   9252  N  N      . TYR C 1 48  ? 36.140  -24.780 -13.477 1.00 52.73  ? 48  TYR C N      1 
ATOM   9253  C  CA     . TYR C 1 48  ? 36.662  -25.641 -14.529 1.00 57.88  ? 48  TYR C CA     1 
ATOM   9254  C  C      . TYR C 1 48  ? 36.390  -27.119 -14.247 1.00 51.06  ? 48  TYR C C      1 
ATOM   9255  O  O      . TYR C 1 48  ? 36.125  -27.900 -15.164 1.00 51.71  ? 48  TYR C O      1 
ATOM   9256  C  CB     . TYR C 1 48  ? 38.160  -25.414 -14.701 1.00 43.54  ? 48  TYR C CB     1 
ATOM   9257  C  CG     . TYR C 1 48  ? 38.743  -26.240 -15.813 1.00 44.82  ? 48  TYR C CG     1 
ATOM   9258  C  CD1    . TYR C 1 48  ? 38.491  -25.920 -17.140 1.00 48.23  ? 48  TYR C CD1    1 
ATOM   9259  C  CD2    . TYR C 1 48  ? 39.531  -27.349 -15.540 1.00 39.57  ? 48  TYR C CD2    1 
ATOM   9260  C  CE1    . TYR C 1 48  ? 39.014  -26.674 -18.166 1.00 61.94  ? 48  TYR C CE1    1 
ATOM   9261  C  CE2    . TYR C 1 48  ? 40.062  -28.111 -16.561 1.00 55.88  ? 48  TYR C CE2    1 
ATOM   9262  C  CZ     . TYR C 1 48  ? 39.799  -27.768 -17.873 1.00 68.77  ? 48  TYR C CZ     1 
ATOM   9263  O  OH     . TYR C 1 48  ? 40.320  -28.519 -18.899 1.00 68.68  ? 48  TYR C OH     1 
ATOM   9264  H  H      . TYR C 1 48  ? 36.708  -24.595 -12.858 1.00 63.28  ? 48  TYR C H      1 
ATOM   9265  H  HA     . TYR C 1 48  ? 36.228  -25.413 -15.365 1.00 69.45  ? 48  TYR C HA     1 
ATOM   9266  H  HB2    . TYR C 1 48  ? 38.317  -24.479 -14.907 1.00 52.25  ? 48  TYR C HB2    1 
ATOM   9267  H  HB3    . TYR C 1 48  ? 38.613  -25.654 -13.878 1.00 52.25  ? 48  TYR C HB3    1 
ATOM   9268  H  HD1    . TYR C 1 48  ? 37.962  -25.181 -17.339 1.00 57.87  ? 48  TYR C HD1    1 
ATOM   9269  H  HD2    . TYR C 1 48  ? 39.708  -27.580 -14.657 1.00 47.48  ? 48  TYR C HD2    1 
ATOM   9270  H  HE1    . TYR C 1 48  ? 38.840  -26.446 -19.051 1.00 74.33  ? 48  TYR C HE1    1 
ATOM   9271  H  HE2    . TYR C 1 48  ? 40.591  -28.851 -16.367 1.00 67.05  ? 48  TYR C HE2    1 
ATOM   9272  H  HH     . TYR C 1 48  ? 40.776  -29.153 -18.588 1.00 82.42  ? 48  TYR C HH     1 
ATOM   9273  N  N      . ALA C 1 49  ? 36.459  -27.497 -12.976 1.00 40.60  ? 49  ALA C N      1 
ATOM   9274  C  CA     . ALA C 1 49  ? 36.238  -28.882 -12.574 1.00 45.38  ? 49  ALA C CA     1 
ATOM   9275  C  C      . ALA C 1 49  ? 34.753  -29.244 -12.593 1.00 55.55  ? 49  ALA C C      1 
ATOM   9276  O  O      . ALA C 1 49  ? 34.391  -30.411 -12.419 1.00 53.00  ? 49  ALA C O      1 
ATOM   9277  C  CB     . ALA C 1 49  ? 36.824  -29.129 -11.191 1.00 46.93  ? 49  ALA C CB     1 
ATOM   9278  H  H      . ALA C 1 49  ? 36.634  -26.967 -12.321 1.00 48.71  ? 49  ALA C H      1 
ATOM   9279  H  HA     . ALA C 1 49  ? 36.695  -29.467 -13.200 1.00 54.46  ? 49  ALA C HA     1 
ATOM   9280  H  HB1    . ALA C 1 49  ? 36.667  -30.053 -10.942 1.00 56.32  ? 49  ALA C HB1    1 
ATOM   9281  H  HB2    . ALA C 1 49  ? 37.777  -28.949 -11.215 1.00 56.32  ? 49  ALA C HB2    1 
ATOM   9282  H  HB3    . ALA C 1 49  ? 36.391  -28.537 -10.555 1.00 56.32  ? 49  ALA C HB3    1 
ATOM   9283  N  N      . ARG C 1 50  ? 33.901  -28.237 -12.785 1.00 50.35  ? 50  ARG C N      1 
ATOM   9284  C  CA     . ARG C 1 50  ? 32.454  -28.439 -12.865 1.00 53.57  ? 50  ARG C CA     1 
ATOM   9285  C  C      . ARG C 1 50  ? 31.883  -27.933 -14.192 1.00 51.40  ? 50  ARG C C      1 
ATOM   9286  O  O      . ARG C 1 50  ? 30.675  -28.016 -14.425 1.00 59.37  ? 50  ARG C O      1 
ATOM   9287  C  CB     . ARG C 1 50  ? 31.754  -27.746 -11.692 1.00 41.14  ? 50  ARG C CB     1 
ATOM   9288  C  CG     . ARG C 1 50  ? 32.326  -28.118 -10.328 1.00 44.76  ? 50  ARG C CG     1 
ATOM   9289  C  CD     . ARG C 1 50  ? 31.540  -27.479 -9.191  1.00 52.19  ? 50  ARG C CD     1 
ATOM   9290  N  NE     . ARG C 1 50  ? 32.330  -27.374 -7.962  1.00 59.05  ? 50  ARG C NE     1 
ATOM   9291  C  CZ     . ARG C 1 50  ? 32.956  -26.274 -7.543  1.00 61.45  ? 50  ARG C CZ     1 
ATOM   9292  N  NH1    . ARG C 1 50  ? 32.910  -25.150 -8.249  1.00 57.18  ? 50  ARG C NH1    1 
ATOM   9293  N  NH2    . ARG C 1 50  ? 33.643  -26.301 -6.407  1.00 66.40  ? 50  ARG C NH2    1 
ATOM   9294  H  H      . ARG C 1 50  ? 34.141  -27.416 -12.872 1.00 60.43  ? 50  ARG C H      1 
ATOM   9295  H  HA     . ARG C 1 50  ? 32.267  -29.389 -12.804 1.00 64.29  ? 50  ARG C HA     1 
ATOM   9296  H  HB2    . ARG C 1 50  ? 31.842  -26.786 -11.799 1.00 49.37  ? 50  ARG C HB2    1 
ATOM   9297  H  HB3    . ARG C 1 50  ? 30.816  -27.993 -11.698 1.00 49.37  ? 50  ARG C HB3    1 
ATOM   9298  H  HG2    . ARG C 1 50  ? 32.288  -29.081 -10.219 1.00 53.71  ? 50  ARG C HG2    1 
ATOM   9299  H  HG3    . ARG C 1 50  ? 33.244  -27.810 -10.273 1.00 53.71  ? 50  ARG C HG3    1 
ATOM   9300  H  HD2    . ARG C 1 50  ? 31.271  -26.585 -9.454  1.00 62.62  ? 50  ARG C HD2    1 
ATOM   9301  H  HD3    . ARG C 1 50  ? 30.757  -28.020 -9.002  1.00 62.62  ? 50  ARG C HD3    1 
ATOM   9302  H  HE     . ARG C 1 50  ? 32.396  -28.078 -7.472  1.00 70.87  ? 50  ARG C HE     1 
ATOM   9303  H  HH11   . ARG C 1 50  ? 32.467  -25.123 -8.986  1.00 68.62  ? 50  ARG C HH11   1 
ATOM   9304  H  HH12   . ARG C 1 50  ? 33.319  -24.448 -7.968  1.00 68.62  ? 50  ARG C HH12   1 
ATOM   9305  H  HH21   . ARG C 1 50  ? 33.680  -27.024 -5.944  1.00 79.69  ? 50  ARG C HH21   1 
ATOM   9306  H  HH22   . ARG C 1 50  ? 34.050  -25.594 -6.134  1.00 79.69  ? 50  ARG C HH22   1 
ATOM   9307  N  N      . ASN C 1 51  ? 32.756  -27.425 -15.059 1.00 47.74  ? 51  ASN C N      1 
ATOM   9308  C  CA     . ASN C 1 51  ? 32.349  -26.880 -16.354 1.00 52.31  ? 51  ASN C CA     1 
ATOM   9309  C  C      . ASN C 1 51  ? 31.278  -25.802 -16.215 1.00 59.46  ? 51  ASN C C      1 
ATOM   9310  O  O      . ASN C 1 51  ? 30.203  -25.895 -16.814 1.00 57.43  ? 51  ASN C O      1 
ATOM   9311  C  CB     . ASN C 1 51  ? 31.859  -28.000 -17.275 1.00 47.72  ? 51  ASN C CB     1 
ATOM   9312  C  CG     . ASN C 1 51  ? 32.997  -28.860 -17.794 1.00 82.02  ? 51  ASN C CG     1 
ATOM   9313  O  OD1    . ASN C 1 51  ? 33.428  -29.810 -17.136 1.00 69.54  ? 51  ASN C OD1    1 
ATOM   9314  N  ND2    . ASN C 1 51  ? 33.497  -28.523 -18.979 1.00 78.26  ? 51  ASN C ND2    1 
ATOM   9315  H  H      . ASN C 1 51  ? 33.604  -27.384 -14.919 1.00 57.29  ? 51  ASN C H      1 
ATOM   9316  H  HA     . ASN C 1 51  ? 33.122  -26.472 -16.774 1.00 62.77  ? 51  ASN C HA     1 
ATOM   9317  H  HB2    . ASN C 1 51  ? 31.249  -28.572 -16.783 1.00 57.27  ? 51  ASN C HB2    1 
ATOM   9318  H  HB3    . ASN C 1 51  ? 31.406  -27.608 -18.038 1.00 57.27  ? 51  ASN C HB3    1 
ATOM   9319  H  HD21   . ASN C 1 51  ? 34.143  -28.979 -19.319 1.00 93.91  ? 51  ASN C HD21   1 
ATOM   9320  H  HD22   . ASN C 1 51  ? 33.175  -27.850 -19.407 1.00 93.91  ? 51  ASN C HD22   1 
ATOM   9321  N  N      . THR C 1 52  ? 31.588  -24.785 -15.412 1.00 61.83  ? 52  THR C N      1 
ATOM   9322  C  CA     . THR C 1 52  ? 30.700  -23.646 -15.199 1.00 48.86  ? 52  THR C CA     1 
ATOM   9323  C  C      . THR C 1 52  ? 31.445  -22.328 -15.417 1.00 56.57  ? 52  THR C C      1 
ATOM   9324  O  O      . THR C 1 52  ? 31.011  -21.277 -14.942 1.00 61.54  ? 52  THR C O      1 
ATOM   9325  C  CB     . THR C 1 52  ? 30.098  -23.647 -13.772 1.00 43.16  ? 52  THR C CB     1 
ATOM   9326  O  OG1    . THR C 1 52  ? 31.149  -23.589 -12.797 1.00 38.31  ? 52  THR C OG1    1 
ATOM   9327  C  CG2    . THR C 1 52  ? 29.253  -24.893 -13.540 1.00 52.39  ? 52  THR C CG2    1 
ATOM   9328  H  H      . THR C 1 52  ? 32.324  -24.733 -14.969 1.00 74.20  ? 52  THR C H      1 
ATOM   9329  H  HA     . THR C 1 52  ? 29.969  -23.689 -15.835 1.00 58.63  ? 52  THR C HA     1 
ATOM   9330  H  HB     . THR C 1 52  ? 29.525  -22.871 -13.668 1.00 51.79  ? 52  THR C HB     1 
ATOM   9331  H  HG1    . THR C 1 52  ? 30.824  -23.589 -12.023 1.00 45.97  ? 52  THR C HG1    1 
ATOM   9332  H  HG21   . THR C 1 52  ? 28.883  -24.880 -12.643 1.00 62.86  ? 52  THR C HG21   1 
ATOM   9333  H  HG22   . THR C 1 52  ? 28.526  -24.924 -14.181 1.00 62.86  ? 52  THR C HG22   1 
ATOM   9334  H  HG23   . THR C 1 52  ? 29.800  -25.688 -13.644 1.00 62.86  ? 52  THR C HG23   1 
ATOM   9335  N  N      . TRP C 1 53  ? 32.568  -22.385 -16.129 1.00 62.66  ? 53  TRP C N      1 
ATOM   9336  C  CA     . TRP C 1 53  ? 33.359  -21.185 -16.389 1.00 62.44  ? 53  TRP C CA     1 
ATOM   9337  C  C      . TRP C 1 53  ? 32.835  -20.434 -17.613 1.00 55.01  ? 53  TRP C C      1 
ATOM   9338  O  O      . TRP C 1 53  ? 32.391  -21.044 -18.587 1.00 58.11  ? 53  TRP C O      1 
ATOM   9339  C  CB     . TRP C 1 53  ? 34.843  -21.544 -16.570 1.00 59.92  ? 53  TRP C CB     1 
ATOM   9340  C  CG     . TRP C 1 53  ? 35.212  -22.075 -17.932 1.00 56.75  ? 53  TRP C CG     1 
ATOM   9341  C  CD1    . TRP C 1 53  ? 35.592  -21.345 -19.023 1.00 57.69  ? 53  TRP C CD1    1 
ATOM   9342  C  CD2    . TRP C 1 53  ? 35.259  -23.449 -18.336 1.00 55.41  ? 53  TRP C CD2    1 
ATOM   9343  N  NE1    . TRP C 1 53  ? 35.863  -22.178 -20.081 1.00 54.09  ? 53  TRP C NE1    1 
ATOM   9344  C  CE2    . TRP C 1 53  ? 35.666  -23.475 -19.686 1.00 57.41  ? 53  TRP C CE2    1 
ATOM   9345  C  CE3    . TRP C 1 53  ? 34.992  -24.660 -17.690 1.00 51.45  ? 53  TRP C CE3    1 
ATOM   9346  C  CZ2    . TRP C 1 53  ? 35.811  -24.663 -20.400 1.00 65.08  ? 53  TRP C CZ2    1 
ATOM   9347  C  CZ3    . TRP C 1 53  ? 35.139  -25.840 -18.403 1.00 69.56  ? 53  TRP C CZ3    1 
ATOM   9348  C  CH2    . TRP C 1 53  ? 35.542  -25.832 -19.743 1.00 69.59  ? 53  TRP C CH2    1 
ATOM   9349  H  H      . TRP C 1 53  ? 32.893  -23.104 -16.471 1.00 75.20  ? 53  TRP C H      1 
ATOM   9350  H  HA     . TRP C 1 53  ? 33.289  -20.593 -15.624 1.00 74.93  ? 53  TRP C HA     1 
ATOM   9351  H  HB2    . TRP C 1 53  ? 35.373  -20.747 -16.415 1.00 71.90  ? 53  TRP C HB2    1 
ATOM   9352  H  HB3    . TRP C 1 53  ? 35.078  -22.222 -15.919 1.00 71.90  ? 53  TRP C HB3    1 
ATOM   9353  H  HD1    . TRP C 1 53  ? 35.655  -20.417 -19.046 1.00 69.23  ? 53  TRP C HD1    1 
ATOM   9354  H  HE1    . TRP C 1 53  ? 36.114  -21.926 -20.864 1.00 64.90  ? 53  TRP C HE1    1 
ATOM   9355  H  HE3    . TRP C 1 53  ? 34.722  -24.673 -16.800 1.00 61.74  ? 53  TRP C HE3    1 
ATOM   9356  H  HZ2    . TRP C 1 53  ? 36.080  -24.661 -21.290 1.00 78.10  ? 53  TRP C HZ2    1 
ATOM   9357  H  HZ3    . TRP C 1 53  ? 34.963  -26.651 -17.984 1.00 83.47  ? 53  TRP C HZ3    1 
ATOM   9358  H  HH2    . TRP C 1 53  ? 35.632  -26.639 -20.195 1.00 83.50  ? 53  TRP C HH2    1 
ATOM   9359  N  N      . LEU C 1 54  ? 32.877  -19.106 -17.548 1.00 63.18  ? 54  LEU C N      1 
ATOM   9360  C  CA     . LEU C 1 54  ? 32.396  -18.265 -18.641 1.00 57.77  ? 54  LEU C CA     1 
ATOM   9361  C  C      . LEU C 1 54  ? 33.409  -18.170 -19.776 1.00 58.04  ? 54  LEU C C      1 
ATOM   9362  O  O      . LEU C 1 54  ? 34.612  -18.347 -19.579 1.00 48.83  ? 54  LEU C O      1 
ATOM   9363  C  CB     . LEU C 1 54  ? 32.051  -16.859 -18.133 1.00 44.73  ? 54  LEU C CB     1 
ATOM   9364  C  CG     . LEU C 1 54  ? 30.684  -16.700 -17.459 1.00 44.07  ? 54  LEU C CG     1 
ATOM   9365  C  CD1    . LEU C 1 54  ? 30.437  -17.791 -16.425 1.00 42.56  ? 54  LEU C CD1    1 
ATOM   9366  C  CD2    . LEU C 1 54  ? 30.559  -15.322 -16.819 1.00 51.04  ? 54  LEU C CD2    1 
ATOM   9367  H  H      . LEU C 1 54  ? 33.182  -18.664 -16.876 1.00 75.82  ? 54  LEU C H      1 
ATOM   9368  H  HA     . LEU C 1 54  ? 31.585  -18.656 -19.001 1.00 69.32  ? 54  LEU C HA     1 
ATOM   9369  H  HB2    . LEU C 1 54  ? 32.724  -16.596 -17.486 1.00 53.68  ? 54  LEU C HB2    1 
ATOM   9370  H  HB3    . LEU C 1 54  ? 32.074  -16.250 -18.887 1.00 53.68  ? 54  LEU C HB3    1 
ATOM   9371  H  HG     . LEU C 1 54  ? 29.993  -16.774 -18.136 1.00 52.88  ? 54  LEU C HG     1 
ATOM   9372  H  HD11   . LEU C 1 54  ? 29.564  -17.654 -16.024 1.00 51.08  ? 54  LEU C HD11   1 
ATOM   9373  H  HD12   . LEU C 1 54  ? 30.467  -18.655 -16.865 1.00 51.08  ? 54  LEU C HD12   1 
ATOM   9374  H  HD13   . LEU C 1 54  ? 31.126  -17.742 -15.744 1.00 51.08  ? 54  LEU C HD13   1 
ATOM   9375  H  HD21   . LEU C 1 54  ? 29.687  -15.247 -16.401 1.00 61.25  ? 54  LEU C HD21   1 
ATOM   9376  H  HD22   . LEU C 1 54  ? 31.256  -15.220 -16.153 1.00 61.25  ? 54  LEU C HD22   1 
ATOM   9377  H  HD23   . LEU C 1 54  ? 30.656  -14.646 -17.508 1.00 61.25  ? 54  LEU C HD23   1 
ATOM   9378  N  N      . LYS C 1 55  ? 32.900  -17.879 -20.966 1.00 55.72  ? 55  LYS C N      1 
ATOM   9379  C  CA     . LYS C 1 55  ? 33.730  -17.709 -22.145 1.00 51.56  ? 55  LYS C CA     1 
ATOM   9380  C  C      . LYS C 1 55  ? 34.714  -16.566 -21.922 1.00 51.91  ? 55  LYS C C      1 
ATOM   9381  O  O      . LYS C 1 55  ? 34.330  -15.487 -21.475 1.00 56.77  ? 55  LYS C O      1 
ATOM   9382  C  CB     . LYS C 1 55  ? 32.842  -17.445 -23.361 1.00 52.11  ? 55  LYS C CB     1 
ATOM   9383  C  CG     . LYS C 1 55  ? 33.563  -17.293 -24.687 1.00 64.34  ? 55  LYS C CG     1 
ATOM   9384  C  CD     . LYS C 1 55  ? 32.540  -17.089 -25.796 1.00 79.04  ? 55  LYS C CD     1 
ATOM   9385  C  CE     . LYS C 1 55  ? 33.185  -16.864 -27.148 1.00 84.74  ? 55  LYS C CE     1 
ATOM   9386  N  NZ     . LYS C 1 55  ? 32.158  -16.768 -28.220 1.00 85.01  ? 55  LYS C NZ     1 
ATOM   9387  H  H      . LYS C 1 55  ? 32.060  -17.774 -21.116 1.00 66.86  ? 55  LYS C H      1 
ATOM   9388  H  HA     . LYS C 1 55  ? 34.235  -18.521 -22.304 1.00 61.87  ? 55  LYS C HA     1 
ATOM   9389  H  HB2    . LYS C 1 55  ? 32.222  -18.186 -23.453 1.00 62.53  ? 55  LYS C HB2    1 
ATOM   9390  H  HB3    . LYS C 1 55  ? 32.346  -16.627 -23.206 1.00 62.53  ? 55  LYS C HB3    1 
ATOM   9391  H  HG2    . LYS C 1 55  ? 34.145  -16.518 -24.655 1.00 77.21  ? 55  LYS C HG2    1 
ATOM   9392  H  HG3    . LYS C 1 55  ? 34.072  -18.096 -24.877 1.00 77.21  ? 55  LYS C HG3    1 
ATOM   9393  H  HD2    . LYS C 1 55  ? 31.979  -17.878 -25.858 1.00 94.85  ? 55  LYS C HD2    1 
ATOM   9394  H  HD3    . LYS C 1 55  ? 31.999  -16.311 -25.588 1.00 94.85  ? 55  LYS C HD3    1 
ATOM   9395  H  HE2    . LYS C 1 55  ? 33.687  -16.035 -27.131 1.00 101.68 ? 55  LYS C HE2    1 
ATOM   9396  H  HE3    . LYS C 1 55  ? 33.771  -17.609 -27.353 1.00 101.68 ? 55  LYS C HE3    1 
ATOM   9397  H  HZ1    . LYS C 1 55  ? 32.552  -16.636 -29.007 1.00 102.01 ? 55  LYS C HZ1    1 
ATOM   9398  H  HZ2    . LYS C 1 55  ? 31.685  -17.521 -28.256 1.00 102.01 ? 55  LYS C HZ2    1 
ATOM   9399  H  HZ3    . LYS C 1 55  ? 31.608  -16.088 -28.055 1.00 102.01 ? 55  LYS C HZ3    1 
ATOM   9400  N  N      . GLY C 1 56  ? 35.988  -16.823 -22.200 1.00 55.50  ? 56  GLY C N      1 
ATOM   9401  C  CA     . GLY C 1 56  ? 37.025  -15.818 -22.050 1.00 54.47  ? 56  GLY C CA     1 
ATOM   9402  C  C      . GLY C 1 56  ? 37.564  -15.745 -20.633 1.00 53.27  ? 56  GLY C C      1 
ATOM   9403  O  O      . GLY C 1 56  ? 38.609  -15.141 -20.389 1.00 57.93  ? 56  GLY C O      1 
ATOM   9404  H  H      . GLY C 1 56  ? 36.278  -17.583 -22.481 1.00 66.60  ? 56  GLY C H      1 
ATOM   9405  H  HA2    . GLY C 1 56  ? 37.761  -16.021 -22.648 1.00 65.37  ? 56  GLY C HA2    1 
ATOM   9406  H  HA3    . GLY C 1 56  ? 36.667  -14.948 -22.288 1.00 65.37  ? 56  GLY C HA3    1 
ATOM   9407  N  N      . SER C 1 57  ? 36.848  -16.365 -19.698 1.00 45.53  ? 57  SER C N      1 
ATOM   9408  C  CA     . SER C 1 57  ? 37.240  -16.371 -18.291 1.00 49.49  ? 57  SER C CA     1 
ATOM   9409  C  C      . SER C 1 57  ? 37.699  -17.764 -17.871 1.00 54.88  ? 57  SER C C      1 
ATOM   9410  O  O      . SER C 1 57  ? 37.253  -18.301 -16.851 1.00 55.01  ? 57  SER C O      1 
ATOM   9411  C  CB     . SER C 1 57  ? 36.078  -15.907 -17.411 1.00 59.75  ? 57  SER C CB     1 
ATOM   9412  O  OG     . SER C 1 57  ? 35.634  -14.618 -17.801 1.00 80.04  ? 57  SER C OG     1 
ATOM   9413  H  H      . SER C 1 57  ? 36.121  -16.796 -19.856 1.00 54.64  ? 57  SER C H      1 
ATOM   9414  H  HA     . SER C 1 57  ? 37.980  -15.757 -18.164 1.00 59.39  ? 57  SER C HA     1 
ATOM   9415  H  HB2    . SER C 1 57  ? 35.344  -16.534 -17.501 1.00 71.70  ? 57  SER C HB2    1 
ATOM   9416  H  HB3    . SER C 1 57  ? 36.375  -15.873 -16.489 1.00 71.70  ? 57  SER C HB3    1 
ATOM   9417  H  HG     . SER C 1 57  ? 35.374  -14.633 -18.600 1.00 96.05  ? 57  SER C HG     1 
ATOM   9418  N  N      . LEU C 1 58  ? 38.591  -18.343 -18.669 1.00 49.83  ? 58  LEU C N      1 
ATOM   9419  C  CA     . LEU C 1 58  ? 39.095  -19.688 -18.415 1.00 51.01  ? 58  LEU C CA     1 
ATOM   9420  C  C      . LEU C 1 58  ? 40.165  -19.686 -17.331 1.00 46.96  ? 58  LEU C C      1 
ATOM   9421  O  O      . LEU C 1 58  ? 41.219  -19.067 -17.484 1.00 53.27  ? 58  LEU C O      1 
ATOM   9422  C  CB     . LEU C 1 58  ? 39.651  -20.304 -19.702 1.00 49.99  ? 58  LEU C CB     1 
ATOM   9423  C  CG     . LEU C 1 58  ? 40.328  -21.669 -19.567 1.00 56.24  ? 58  LEU C CG     1 
ATOM   9424  C  CD1    . LEU C 1 58  ? 39.365  -22.706 -18.996 1.00 52.34  ? 58  LEU C CD1    1 
ATOM   9425  C  CD2    . LEU C 1 58  ? 40.857  -22.117 -20.923 1.00 41.17  ? 58  LEU C CD2    1 
ATOM   9426  H  H      . LEU C 1 58  ? 38.923  -17.974 -19.371 1.00 59.79  ? 58  LEU C H      1 
ATOM   9427  H  HA     . LEU C 1 58  ? 38.362  -20.245 -18.110 1.00 61.21  ? 58  LEU C HA     1 
ATOM   9428  H  HB2    . LEU C 1 58  ? 38.918  -20.407 -20.330 1.00 59.99  ? 58  LEU C HB2    1 
ATOM   9429  H  HB3    . LEU C 1 58  ? 40.307  -19.692 -20.072 1.00 59.99  ? 58  LEU C HB3    1 
ATOM   9430  H  HG     . LEU C 1 58  ? 41.081  -21.592 -18.961 1.00 67.49  ? 58  LEU C HG     1 
ATOM   9431  H  HD11   . LEU C 1 58  ? 39.824  -23.557 -18.924 1.00 62.81  ? 58  LEU C HD11   1 
ATOM   9432  H  HD12   . LEU C 1 58  ? 39.070  -22.413 -18.120 1.00 62.81  ? 58  LEU C HD12   1 
ATOM   9433  H  HD13   . LEU C 1 58  ? 38.603  -22.790 -19.591 1.00 62.81  ? 58  LEU C HD13   1 
ATOM   9434  H  HD21   . LEU C 1 58  ? 41.283  -22.982 -20.825 1.00 49.40  ? 58  LEU C HD21   1 
ATOM   9435  H  HD22   . LEU C 1 58  ? 40.115  -22.181 -21.545 1.00 49.40  ? 58  LEU C HD22   1 
ATOM   9436  H  HD23   . LEU C 1 58  ? 41.500  -21.464 -21.242 1.00 49.40  ? 58  LEU C HD23   1 
ATOM   9437  N  N      . GLU C 1 59  ? 39.884  -20.392 -16.239 1.00 42.54  ? 59  GLU C N      1 
ATOM   9438  C  CA     . GLU C 1 59  ? 40.850  -20.574 -15.163 1.00 47.54  ? 59  GLU C CA     1 
ATOM   9439  C  C      . GLU C 1 59  ? 40.749  -21.975 -14.586 1.00 51.14  ? 59  GLU C C      1 
ATOM   9440  O  O      . GLU C 1 59  ? 39.667  -22.419 -14.199 1.00 58.08  ? 59  GLU C O      1 
ATOM   9441  C  CB     . GLU C 1 59  ? 40.618  -19.554 -14.048 1.00 64.73  ? 59  GLU C CB     1 
ATOM   9442  C  CG     . GLU C 1 59  ? 41.663  -19.605 -12.935 1.00 62.98  ? 59  GLU C CG     1 
ATOM   9443  C  CD     . GLU C 1 59  ? 41.186  -18.961 -11.645 1.00 76.72  ? 59  GLU C CD     1 
ATOM   9444  O  OE1    . GLU C 1 59  ? 40.054  -18.429 -11.614 1.00 70.19  ? 59  GLU C OE1    1 
ATOM   9445  O  OE2    . GLU C 1 59  ? 41.945  -18.994 -10.654 1.00 77.03  ? 59  GLU C OE2    1 
ATOM   9446  H  H      . GLU C 1 59  ? 39.130  -20.780 -16.098 1.00 51.04  ? 59  GLU C H      1 
ATOM   9447  H  HA     . GLU C 1 59  ? 41.747  -20.449 -15.511 1.00 57.05  ? 59  GLU C HA     1 
ATOM   9448  H  HB2    . GLU C 1 59  ? 40.636  -18.663 -14.431 1.00 77.68  ? 59  GLU C HB2    1 
ATOM   9449  H  HB3    . GLU C 1 59  ? 39.750  -19.722 -13.647 1.00 77.68  ? 59  GLU C HB3    1 
ATOM   9450  H  HG2    . GLU C 1 59  ? 41.877  -20.531 -12.745 1.00 75.57  ? 59  GLU C HG2    1 
ATOM   9451  H  HG3    . GLU C 1 59  ? 42.458  -19.134 -13.228 1.00 75.57  ? 59  GLU C HG3    1 
ATOM   9452  N  N      . ILE C 1 60  ? 41.887  -22.658 -14.513 1.00 43.90  ? 60  ILE C N      1 
ATOM   9453  C  CA     . ILE C 1 60  ? 41.948  -23.983 -13.911 1.00 46.43  ? 60  ILE C CA     1 
ATOM   9454  C  C      . ILE C 1 60  ? 42.469  -23.843 -12.489 1.00 41.83  ? 60  ILE C C      1 
ATOM   9455  O  O      . ILE C 1 60  ? 43.470  -23.167 -12.253 1.00 56.76  ? 60  ILE C O      1 
ATOM   9456  C  CB     . ILE C 1 60  ? 42.855  -24.944 -14.712 1.00 49.43  ? 60  ILE C CB     1 
ATOM   9457  C  CG1    . ILE C 1 60  ? 42.421  -24.981 -16.182 1.00 49.77  ? 60  ILE C CG1    1 
ATOM   9458  C  CG2    . ILE C 1 60  ? 42.818  -26.345 -14.099 1.00 42.55  ? 60  ILE C CG2    1 
ATOM   9459  C  CD1    . ILE C 1 60  ? 43.341  -25.775 -17.083 1.00 55.14  ? 60  ILE C CD1    1 
ATOM   9460  H  H      . ILE C 1 60  ? 42.643  -22.373 -14.807 1.00 52.68  ? 60  ILE C H      1 
ATOM   9461  H  HA     . ILE C 1 60  ? 41.056  -24.363 -13.875 1.00 55.72  ? 60  ILE C HA     1 
ATOM   9462  H  HB     . ILE C 1 60  ? 43.766  -24.613 -14.669 1.00 59.32  ? 60  ILE C HB     1 
ATOM   9463  H  HG12   . ILE C 1 60  ? 41.538  -25.381 -16.236 1.00 59.73  ? 60  ILE C HG12   1 
ATOM   9464  H  HG13   . ILE C 1 60  ? 42.389  -24.073 -16.520 1.00 59.73  ? 60  ILE C HG13   1 
ATOM   9465  H  HG21   . ILE C 1 60  ? 43.393  -26.930 -14.617 1.00 51.06  ? 60  ILE C HG21   1 
ATOM   9466  H  HG22   . ILE C 1 60  ? 43.133  -26.296 -13.183 1.00 51.06  ? 60  ILE C HG22   1 
ATOM   9467  H  HG23   . ILE C 1 60  ? 41.906  -26.674 -14.119 1.00 51.06  ? 60  ILE C HG23   1 
ATOM   9468  H  HD11   . ILE C 1 60  ? 42.996  -25.748 -17.989 1.00 66.17  ? 60  ILE C HD11   1 
ATOM   9469  H  HD12   . ILE C 1 60  ? 44.227  -25.382 -17.054 1.00 66.17  ? 60  ILE C HD12   1 
ATOM   9470  H  HD13   . ILE C 1 60  ? 43.375  -26.693 -16.769 1.00 66.17  ? 60  ILE C HD13   1 
ATOM   9471  N  N      . ASP C 1 61  ? 41.777  -24.469 -11.544 1.00 41.96  ? 61  ASP C N      1 
ATOM   9472  C  CA     . ASP C 1 61  ? 42.199  -24.451 -10.150 1.00 47.30  ? 61  ASP C CA     1 
ATOM   9473  C  C      . ASP C 1 61  ? 42.553  -25.860 -9.682  1.00 50.72  ? 61  ASP C C      1 
ATOM   9474  O  O      . ASP C 1 61  ? 41.787  -26.807 -9.889  1.00 51.37  ? 61  ASP C O      1 
ATOM   9475  C  CB     . ASP C 1 61  ? 41.103  -23.838 -9.276  1.00 53.83  ? 61  ASP C CB     1 
ATOM   9476  C  CG     . ASP C 1 61  ? 40.786  -22.401 -9.666  1.00 66.88  ? 61  ASP C CG     1 
ATOM   9477  O  OD1    . ASP C 1 61  ? 41.568  -21.497 -9.300  1.00 66.32  ? 61  ASP C OD1    1 
ATOM   9478  O  OD2    . ASP C 1 61  ? 39.762  -22.175 -10.347 1.00 73.82  ? 61  ASP C OD2    1 
ATOM   9479  H  H      . ASP C 1 61  ? 41.056  -24.915 -11.686 1.00 50.35  ? 61  ASP C H      1 
ATOM   9480  H  HA     . ASP C 1 61  ? 42.992  -23.899 -10.067 1.00 56.76  ? 61  ASP C HA     1 
ATOM   9481  H  HB2    . ASP C 1 61  ? 40.292  -24.362 -9.371  1.00 64.59  ? 61  ASP C HB2    1 
ATOM   9482  H  HB3    . ASP C 1 61  ? 41.395  -23.842 -8.351  1.00 64.59  ? 61  ASP C HB3    1 
ATOM   9483  N  N      . VAL C 1 62  ? 43.725  -25.984 -9.064  1.00 46.63  ? 62  VAL C N      1 
ATOM   9484  C  CA     . VAL C 1 62  ? 44.221  -27.264 -8.563  1.00 34.10  ? 62  VAL C CA     1 
ATOM   9485  C  C      . VAL C 1 62  ? 44.660  -27.134 -7.108  1.00 33.81  ? 62  VAL C C      1 
ATOM   9486  O  O      . VAL C 1 62  ? 45.564  -26.362 -6.780  1.00 34.37  ? 62  VAL C O      1 
ATOM   9487  C  CB     . VAL C 1 62  ? 45.395  -27.786 -9.406  1.00 25.10  ? 62  VAL C CB     1 
ATOM   9488  C  CG1    . VAL C 1 62  ? 45.886  -29.125 -8.864  1.00 29.94  ? 62  VAL C CG1    1 
ATOM   9489  C  CG2    . VAL C 1 62  ? 44.975  -27.926 -10.857 1.00 30.07  ? 62  VAL C CG2    1 
ATOM   9490  H  H      . VAL C 1 62  ? 44.262  -25.328 -8.919  1.00 55.96  ? 62  VAL C H      1 
ATOM   9491  H  HA     . VAL C 1 62  ? 43.506  -27.918 -8.605  1.00 40.92  ? 62  VAL C HA     1 
ATOM   9492  H  HB     . VAL C 1 62  ? 46.128  -27.153 -9.361  1.00 30.12  ? 62  VAL C HB     1 
ATOM   9493  H  HG11   . VAL C 1 62  ? 46.626  -29.434 -9.410  1.00 35.93  ? 62  VAL C HG11   1 
ATOM   9494  H  HG12   . VAL C 1 62  ? 46.179  -29.005 -7.947  1.00 35.93  ? 62  VAL C HG12   1 
ATOM   9495  H  HG13   . VAL C 1 62  ? 45.158  -29.765 -8.898  1.00 35.93  ? 62  VAL C HG13   1 
ATOM   9496  H  HG21   . VAL C 1 62  ? 45.727  -28.256 -11.373 1.00 36.08  ? 62  VAL C HG21   1 
ATOM   9497  H  HG22   . VAL C 1 62  ? 44.236  -28.552 -10.912 1.00 36.08  ? 62  VAL C HG22   1 
ATOM   9498  H  HG23   . VAL C 1 62  ? 44.700  -27.058 -11.191 1.00 36.08  ? 62  VAL C HG23   1 
ATOM   9499  N  N      . PHE C 1 63  ? 44.003  -27.893 -6.241  1.00 29.83  ? 63  PHE C N      1 
ATOM   9500  C  CA     . PHE C 1 63  ? 44.331  -27.906 -4.826  1.00 33.15  ? 63  PHE C CA     1 
ATOM   9501  C  C      . PHE C 1 63  ? 45.292  -29.039 -4.487  1.00 39.47  ? 63  PHE C C      1 
ATOM   9502  O  O      . PHE C 1 63  ? 45.146  -30.156 -4.980  1.00 48.19  ? 63  PHE C O      1 
ATOM   9503  C  CB     . PHE C 1 63  ? 43.060  -28.033 -3.988  1.00 44.56  ? 63  PHE C CB     1 
ATOM   9504  C  CG     . PHE C 1 63  ? 42.429  -26.715 -3.648  1.00 52.88  ? 63  PHE C CG     1 
ATOM   9505  C  CD1    . PHE C 1 63  ? 42.179  -25.776 -4.638  1.00 32.17  ? 63  PHE C CD1    1 
ATOM   9506  C  CD2    . PHE C 1 63  ? 42.085  -26.414 -2.337  1.00 50.22  ? 63  PHE C CD2    1 
ATOM   9507  C  CE1    . PHE C 1 63  ? 41.598  -24.559 -4.326  1.00 35.97  ? 63  PHE C CE1    1 
ATOM   9508  C  CE2    . PHE C 1 63  ? 41.503  -25.200 -2.018  1.00 54.16  ? 63  PHE C CE2    1 
ATOM   9509  C  CZ     . PHE C 1 63  ? 41.259  -24.271 -3.014  1.00 54.06  ? 63  PHE C CZ     1 
ATOM   9510  H  H      . PHE C 1 63  ? 43.355  -28.417 -6.452  1.00 35.79  ? 63  PHE C H      1 
ATOM   9511  H  HA     . PHE C 1 63  ? 44.761  -27.068 -4.593  1.00 39.78  ? 63  PHE C HA     1 
ATOM   9512  H  HB2    . PHE C 1 63  ? 42.409  -28.554 -4.484  1.00 53.47  ? 63  PHE C HB2    1 
ATOM   9513  H  HB3    . PHE C 1 63  ? 43.276  -28.482 -3.156  1.00 53.47  ? 63  PHE C HB3    1 
ATOM   9514  H  HD1    . PHE C 1 63  ? 42.405  -25.966 -5.520  1.00 38.61  ? 63  PHE C HD1    1 
ATOM   9515  H  HD2    . PHE C 1 63  ? 42.247  -27.036 -1.665  1.00 60.27  ? 63  PHE C HD2    1 
ATOM   9516  H  HE1    . PHE C 1 63  ? 41.435  -23.936 -4.996  1.00 43.17  ? 63  PHE C HE1    1 
ATOM   9517  H  HE2    . PHE C 1 63  ? 41.277  -25.009 -1.136  1.00 65.00  ? 63  PHE C HE2    1 
ATOM   9518  H  HZ     . PHE C 1 63  ? 40.868  -23.454 -2.803  1.00 64.87  ? 63  PHE C HZ     1 
ATOM   9519  N  N      . LEU C 1 64  ? 46.286  -28.731 -3.660  1.00 39.31  ? 64  LEU C N      1 
ATOM   9520  C  CA     . LEU C 1 64  ? 47.199  -29.737 -3.133  1.00 38.15  ? 64  LEU C CA     1 
ATOM   9521  C  C      . LEU C 1 64  ? 46.819  -30.046 -1.683  1.00 54.52  ? 64  LEU C C      1 
ATOM   9522  O  O      . LEU C 1 64  ? 46.746  -29.141 -0.848  1.00 55.97  ? 64  LEU C O      1 
ATOM   9523  C  CB     . LEU C 1 64  ? 48.646  -29.246 -3.227  1.00 36.44  ? 64  LEU C CB     1 
ATOM   9524  C  CG     . LEU C 1 64  ? 49.058  -28.676 -4.589  1.00 27.18  ? 64  LEU C CG     1 
ATOM   9525  C  CD1    . LEU C 1 64  ? 50.501  -28.188 -4.548  1.00 30.26  ? 64  LEU C CD1    1 
ATOM   9526  C  CD2    . LEU C 1 64  ? 48.870  -29.709 -5.692  1.00 34.02  ? 64  LEU C CD2    1 
ATOM   9527  H  H      . LEU C 1 64  ? 46.453  -27.934 -3.386  1.00 47.18  ? 64  LEU C H      1 
ATOM   9528  H  HA     . LEU C 1 64  ? 47.117  -30.552 -3.653  1.00 45.78  ? 64  LEU C HA     1 
ATOM   9529  H  HB2    . LEU C 1 64  ? 48.777  -28.547 -2.568  1.00 43.73  ? 64  LEU C HB2    1 
ATOM   9530  H  HB3    . LEU C 1 64  ? 49.236  -29.990 -3.032  1.00 43.73  ? 64  LEU C HB3    1 
ATOM   9531  H  HG     . LEU C 1 64  ? 48.492  -27.915 -4.795  1.00 32.62  ? 64  LEU C HG     1 
ATOM   9532  H  HD11   . LEU C 1 64  ? 50.739  -27.833 -5.419  1.00 36.31  ? 64  LEU C HD11   1 
ATOM   9533  H  HD12   . LEU C 1 64  ? 50.580  -27.494 -3.874  1.00 36.31  ? 64  LEU C HD12   1 
ATOM   9534  H  HD13   . LEU C 1 64  ? 51.080  -28.934 -4.325  1.00 36.31  ? 64  LEU C HD13   1 
ATOM   9535  H  HD21   . LEU C 1 64  ? 49.139  -29.319 -6.538  1.00 40.82  ? 64  LEU C HD21   1 
ATOM   9536  H  HD22   . LEU C 1 64  ? 49.419  -30.484 -5.495  1.00 40.82  ? 64  LEU C HD22   1 
ATOM   9537  H  HD23   . LEU C 1 64  ? 47.935  -29.966 -5.727  1.00 40.82  ? 64  LEU C HD23   1 
ATOM   9538  N  N      . LEU C 1 65  ? 46.576  -31.323 -1.393  1.00 46.88  ? 65  LEU C N      1 
ATOM   9539  C  CA     . LEU C 1 65  ? 46.107  -31.747 -0.072  1.00 41.96  ? 65  LEU C CA     1 
ATOM   9540  C  C      . LEU C 1 65  ? 47.222  -32.350 0.783   1.00 41.61  ? 65  LEU C C      1 
ATOM   9541  O  O      . LEU C 1 65  ? 47.772  -33.399 0.445   1.00 52.55  ? 65  LEU C O      1 
ATOM   9542  C  CB     . LEU C 1 65  ? 44.967  -32.760 -0.218  1.00 51.40  ? 65  LEU C CB     1 
ATOM   9543  C  CG     . LEU C 1 65  ? 43.736  -32.316 -1.015  1.00 55.80  ? 65  LEU C CG     1 
ATOM   9544  C  CD1    . LEU C 1 65  ? 43.713  -32.965 -2.396  1.00 36.17  ? 65  LEU C CD1    1 
ATOM   9545  C  CD2    . LEU C 1 65  ? 42.462  -32.634 -0.237  1.00 48.06  ? 65  LEU C CD2    1 
ATOM   9546  H  H      . LEU C 1 65  ? 46.676  -31.971 -1.949  1.00 56.25  ? 65  LEU C H      1 
ATOM   9547  H  HA     . LEU C 1 65  ? 45.758  -30.973 0.398   1.00 50.36  ? 65  LEU C HA     1 
ATOM   9548  H  HB2    . LEU C 1 65  ? 45.321  -33.550 -0.656  1.00 61.68  ? 65  LEU C HB2    1 
ATOM   9549  H  HB3    . LEU C 1 65  ? 44.661  -32.998 0.671   1.00 61.68  ? 65  LEU C HB3    1 
ATOM   9550  H  HG     . LEU C 1 65  ? 43.774  -31.355 -1.140  1.00 66.96  ? 65  LEU C HG     1 
ATOM   9551  H  HD11   . LEU C 1 65  ? 42.923  -32.664 -2.873  1.00 43.40  ? 65  LEU C HD11   1 
ATOM   9552  H  HD12   . LEU C 1 65  ? 44.511  -32.705 -2.881  1.00 43.40  ? 65  LEU C HD12   1 
ATOM   9553  H  HD13   . LEU C 1 65  ? 43.689  -33.929 -2.291  1.00 43.40  ? 65  LEU C HD13   1 
ATOM   9554  H  HD21   . LEU C 1 65  ? 41.695  -32.347 -0.756  1.00 57.68  ? 65  LEU C HD21   1 
ATOM   9555  H  HD22   . LEU C 1 65  ? 42.417  -33.591 -0.082  1.00 57.68  ? 65  LEU C HD22   1 
ATOM   9556  H  HD23   . LEU C 1 65  ? 42.484  -32.163 0.611   1.00 57.68  ? 65  LEU C HD23   1 
ATOM   9557  N  N      . PHE C 1 66  ? 47.566  -31.663 1.873   1.00 49.60  ? 66  PHE C N      1 
ATOM   9558  C  CA     . PHE C 1 66  ? 48.600  -32.124 2.802   1.00 51.83  ? 66  PHE C CA     1 
ATOM   9559  C  C      . PHE C 1 66  ? 47.998  -32.531 4.157   1.00 50.32  ? 66  PHE C C      1 
ATOM   9560  O  O      . PHE C 1 66  ? 46.906  -32.081 4.508   1.00 40.98  ? 66  PHE C O      1 
ATOM   9561  C  CB     . PHE C 1 66  ? 49.647  -31.025 3.017   1.00 55.51  ? 66  PHE C CB     1 
ATOM   9562  C  CG     . PHE C 1 66  ? 50.408  -30.644 1.771   1.00 56.81  ? 66  PHE C CG     1 
ATOM   9563  C  CD1    . PHE C 1 66  ? 50.408  -31.463 0.650   1.00 64.38  ? 66  PHE C CD1    1 
ATOM   9564  C  CD2    . PHE C 1 66  ? 51.122  -29.457 1.723   1.00 43.46  ? 66  PHE C CD2    1 
ATOM   9565  C  CE1    . PHE C 1 66  ? 51.106  -31.103 -0.489  1.00 60.20  ? 66  PHE C CE1    1 
ATOM   9566  C  CE2    . PHE C 1 66  ? 51.822  -29.093 0.590   1.00 42.09  ? 66  PHE C CE2    1 
ATOM   9567  C  CZ     . PHE C 1 66  ? 51.814  -29.915 -0.517  1.00 49.17  ? 66  PHE C CZ     1 
ATOM   9568  H  H      . PHE C 1 66  ? 47.209  -30.914 2.099   1.00 59.52  ? 66  PHE C H      1 
ATOM   9569  H  HA     . PHE C 1 66  ? 49.046  -32.898 2.424   1.00 62.20  ? 66  PHE C HA     1 
ATOM   9570  H  HB2    . PHE C 1 66  ? 49.200  -30.228 3.345   1.00 66.61  ? 66  PHE C HB2    1 
ATOM   9571  H  HB3    . PHE C 1 66  ? 50.291  -31.332 3.674   1.00 66.61  ? 66  PHE C HB3    1 
ATOM   9572  H  HD1    . PHE C 1 66  ? 49.933  -32.263 0.664   1.00 77.26  ? 66  PHE C HD1    1 
ATOM   9573  H  HD2    . PHE C 1 66  ? 51.131  -28.898 2.467   1.00 52.15  ? 66  PHE C HD2    1 
ATOM   9574  H  HE1    . PHE C 1 66  ? 51.100  -31.659 -1.234  1.00 72.24  ? 66  PHE C HE1    1 
ATOM   9575  H  HE2    . PHE C 1 66  ? 52.297  -28.294 0.573   1.00 50.51  ? 66  PHE C HE2    1 
ATOM   9576  H  HZ     . PHE C 1 66  ? 52.285  -29.672 -1.280  1.00 59.00  ? 66  PHE C HZ     1 
ATOM   9577  N  N      . PRO C 1 67  ? 48.722  -33.363 4.933   1.00 55.24  ? 67  PRO C N      1 
ATOM   9578  C  CA     . PRO C 1 67  ? 48.285  -33.773 6.278   1.00 53.17  ? 67  PRO C CA     1 
ATOM   9579  C  C      . PRO C 1 67  ? 48.003  -32.587 7.199   1.00 48.17  ? 67  PRO C C      1 
ATOM   9580  O  O      . PRO C 1 67  ? 48.559  -31.509 6.989   1.00 54.47  ? 67  PRO C O      1 
ATOM   9581  C  CB     . PRO C 1 67  ? 49.471  -34.588 6.803   1.00 52.77  ? 67  PRO C CB     1 
ATOM   9582  C  CG     . PRO C 1 67  ? 50.151  -35.089 5.584   1.00 56.84  ? 67  PRO C CG     1 
ATOM   9583  C  CD     . PRO C 1 67  ? 49.988  -34.015 4.551   1.00 47.18  ? 67  PRO C CD     1 
ATOM   9584  H  HA     . PRO C 1 67  ? 47.499  -34.339 6.224   1.00 63.81  ? 67  PRO C HA     1 
ATOM   9585  H  HB2    . PRO C 1 67  ? 50.062  -34.015 7.316   1.00 63.32  ? 67  PRO C HB2    1 
ATOM   9586  H  HB3    . PRO C 1 67  ? 49.148  -35.325 7.345   1.00 63.32  ? 67  PRO C HB3    1 
ATOM   9587  H  HG2    . PRO C 1 67  ? 51.090  -35.239 5.775   1.00 68.21  ? 67  PRO C HG2    1 
ATOM   9588  H  HG3    . PRO C 1 67  ? 49.727  -35.911 5.291   1.00 68.21  ? 67  PRO C HG3    1 
ATOM   9589  H  HD2    . PRO C 1 67  ? 50.722  -33.384 4.601   1.00 56.61  ? 67  PRO C HD2    1 
ATOM   9590  H  HD3    . PRO C 1 67  ? 49.913  -34.406 3.666   1.00 56.61  ? 67  PRO C HD3    1 
ATOM   9591  N  N      . GLU C 1 68  ? 47.160  -32.789 8.208   1.00 55.07  ? 68  GLU C N      1 
ATOM   9592  C  CA     . GLU C 1 68  ? 46.822  -31.720 9.144   1.00 53.54  ? 68  GLU C CA     1 
ATOM   9593  C  C      . GLU C 1 68  ? 48.025  -31.286 9.975   1.00 60.05  ? 68  GLU C C      1 
ATOM   9594  O  O      . GLU C 1 68  ? 48.139  -30.119 10.352  1.00 65.84  ? 68  GLU C O      1 
ATOM   9595  C  CB     . GLU C 1 68  ? 45.689  -32.152 10.075  1.00 44.22  ? 68  GLU C CB     1 
ATOM   9596  C  CG     . GLU C 1 68  ? 44.362  -32.381 9.376   1.00 59.02  ? 68  GLU C CG     1 
ATOM   9597  C  CD     . GLU C 1 68  ? 43.202  -32.489 10.348  1.00 76.96  ? 68  GLU C CD     1 
ATOM   9598  O  OE1    . GLU C 1 68  ? 42.309  -33.330 10.115  1.00 84.64  ? 68  GLU C OE1    1 
ATOM   9599  O  OE2    . GLU C 1 68  ? 43.170  -31.719 11.332  1.00 58.12  ? 68  GLU C OE2    1 
ATOM   9600  H  H      . GLU C 1 68  ? 46.770  -33.538 8.374   1.00 66.09  ? 68  GLU C H      1 
ATOM   9601  H  HA     . GLU C 1 68  ? 46.515  -30.949 8.640   1.00 64.25  ? 68  GLU C HA     1 
ATOM   9602  H  HB2    . GLU C 1 68  ? 45.942  -32.983 10.508  1.00 53.06  ? 68  GLU C HB2    1 
ATOM   9603  H  HB3    . GLU C 1 68  ? 45.555  -31.462 10.744  1.00 53.06  ? 68  GLU C HB3    1 
ATOM   9604  H  HG2    . GLU C 1 68  ? 44.186  -31.636 8.779   1.00 70.83  ? 68  GLU C HG2    1 
ATOM   9605  H  HG3    . GLU C 1 68  ? 44.408  -33.207 8.870   1.00 70.83  ? 68  GLU C HG3    1 
ATOM   9606  N  N      . GLU C 1 69  ? 48.917  -32.227 10.264  1.00 59.43  ? 69  GLU C N      1 
ATOM   9607  C  CA     . GLU C 1 69  ? 50.041  -31.963 11.158  1.00 65.98  ? 69  GLU C CA     1 
ATOM   9608  C  C      . GLU C 1 69  ? 51.063  -31.018 10.540  1.00 63.86  ? 69  GLU C C      1 
ATOM   9609  O  O      . GLU C 1 69  ? 51.941  -30.511 11.243  1.00 66.77  ? 69  GLU C O      1 
ATOM   9610  C  CB     . GLU C 1 69  ? 50.715  -33.272 11.574  1.00 87.91  ? 69  GLU C CB     1 
ATOM   9611  C  CG     . GLU C 1 69  ? 49.871  -34.102 12.530  1.00 72.10  ? 69  GLU C CG     1 
ATOM   9612  C  CD     . GLU C 1 69  ? 48.648  -34.698 11.866  1.00 89.56  ? 69  GLU C CD     1 
ATOM   9613  O  OE1    . GLU C 1 69  ? 47.660  -34.963 12.584  1.00 87.59  ? 69  GLU C OE1    1 
ATOM   9614  O  OE2    . GLU C 1 69  ? 48.670  -34.893 10.629  1.00 76.98  ? 69  GLU C OE2    1 
ATOM   9615  H  H      . GLU C 1 69  ? 48.895  -33.029 9.954   1.00 71.31  ? 69  GLU C H      1 
ATOM   9616  H  HA     . GLU C 1 69  ? 49.701  -31.540 11.962  1.00 79.17  ? 69  GLU C HA     1 
ATOM   9617  H  HB2    . GLU C 1 69  ? 50.881  -33.806 10.782  1.00 105.49 ? 69  GLU C HB2    1 
ATOM   9618  H  HB3    . GLU C 1 69  ? 51.553  -33.067 12.017  1.00 105.49 ? 69  GLU C HB3    1 
ATOM   9619  H  HG2    . GLU C 1 69  ? 50.409  -34.831 12.876  1.00 86.53  ? 69  GLU C HG2    1 
ATOM   9620  H  HG3    . GLU C 1 69  ? 49.570  -33.537 13.259  1.00 86.53  ? 69  GLU C HG3    1 
ATOM   9621  N  N      . PHE C 1 70  ? 50.962  -30.791 9.232   1.00 47.28  ? 70  PHE C N      1 
ATOM   9622  C  CA     . PHE C 1 70  ? 51.859  -29.859 8.553   1.00 47.90  ? 70  PHE C CA     1 
ATOM   9623  C  C      . PHE C 1 70  ? 51.745  -28.458 9.151   1.00 63.06  ? 70  PHE C C      1 
ATOM   9624  O  O      . PHE C 1 70  ? 50.642  -27.946 9.355   1.00 55.45  ? 70  PHE C O      1 
ATOM   9625  C  CB     . PHE C 1 70  ? 51.558  -29.807 7.055   1.00 37.21  ? 70  PHE C CB     1 
ATOM   9626  C  CG     . PHE C 1 70  ? 52.360  -30.776 6.238   1.00 45.89  ? 70  PHE C CG     1 
ATOM   9627  C  CD1    . PHE C 1 70  ? 52.845  -31.949 6.792   1.00 47.29  ? 70  PHE C CD1    1 
ATOM   9628  C  CD2    . PHE C 1 70  ? 52.642  -30.502 4.910   1.00 57.14  ? 70  PHE C CD2    1 
ATOM   9629  C  CE1    . PHE C 1 70  ? 53.589  -32.834 6.034   1.00 54.07  ? 70  PHE C CE1    1 
ATOM   9630  C  CE2    . PHE C 1 70  ? 53.383  -31.382 4.147   1.00 54.22  ? 70  PHE C CE2    1 
ATOM   9631  C  CZ     . PHE C 1 70  ? 53.858  -32.549 4.709   1.00 59.14  ? 70  PHE C CZ     1 
ATOM   9632  H  H      . PHE C 1 70  ? 50.383  -31.164 8.716   1.00 56.74  ? 70  PHE C H      1 
ATOM   9633  H  HA     . PHE C 1 70  ? 52.774  -30.161 8.666   1.00 57.48  ? 70  PHE C HA     1 
ATOM   9634  H  HB2    . PHE C 1 70  ? 50.619  -30.010 6.918   1.00 44.66  ? 70  PHE C HB2    1 
ATOM   9635  H  HB3    . PHE C 1 70  ? 51.751  -28.914 6.729   1.00 44.66  ? 70  PHE C HB3    1 
ATOM   9636  H  HD1    . PHE C 1 70  ? 52.666  -32.145 7.684   1.00 56.75  ? 70  PHE C HD1    1 
ATOM   9637  H  HD2    . PHE C 1 70  ? 52.324  -29.717 4.526   1.00 68.57  ? 70  PHE C HD2    1 
ATOM   9638  H  HE1    . PHE C 1 70  ? 53.907  -33.620 6.415   1.00 64.89  ? 70  PHE C HE1    1 
ATOM   9639  H  HE2    . PHE C 1 70  ? 53.563  -31.187 3.255   1.00 65.06  ? 70  PHE C HE2    1 
ATOM   9640  H  HZ     . PHE C 1 70  ? 54.357  -33.143 4.197   1.00 70.97  ? 70  PHE C HZ     1 
ATOM   9641  N  N      . SER C 1 71  ? 52.894  -27.841 9.417   1.00 69.55  ? 71  SER C N      1 
ATOM   9642  C  CA     . SER C 1 71  ? 52.933  -26.474 9.928   1.00 56.21  ? 71  SER C CA     1 
ATOM   9643  C  C      . SER C 1 71  ? 52.296  -25.531 8.924   1.00 59.10  ? 71  SER C C      1 
ATOM   9644  O  O      . SER C 1 71  ? 52.192  -25.855 7.738   1.00 64.50  ? 71  SER C O      1 
ATOM   9645  C  CB     . SER C 1 71  ? 54.373  -26.032 10.214  1.00 57.23  ? 71  SER C CB     1 
ATOM   9646  O  OG     . SER C 1 71  ? 54.968  -26.818 11.231  1.00 81.16  ? 71  SER C OG     1 
ATOM   9647  H  H      . SER C 1 71  ? 53.670  -28.195 9.309   1.00 83.46  ? 71  SER C H      1 
ATOM   9648  H  HA     . SER C 1 71  ? 52.428  -26.426 10.755  1.00 67.45  ? 71  SER C HA     1 
ATOM   9649  H  HB2    . SER C 1 71  ? 54.895  -26.124 9.401   1.00 68.67  ? 71  SER C HB2    1 
ATOM   9650  H  HB3    . SER C 1 71  ? 54.366  -25.105 10.498  1.00 68.67  ? 71  SER C HB3    1 
ATOM   9651  H  HG     . SER C 1 71  ? 55.754  -26.560 11.370  1.00 97.39  ? 71  SER C HG     1 
ATOM   9652  N  N      . LYS C 1 72  ? 51.863  -24.367 9.396   1.00 60.96  ? 72  LYS C N      1 
ATOM   9653  C  CA     . LYS C 1 72  ? 51.319  -23.362 8.499   1.00 59.06  ? 72  LYS C CA     1 
ATOM   9654  C  C      . LYS C 1 72  ? 52.414  -22.922 7.532   1.00 55.43  ? 72  LYS C C      1 
ATOM   9655  O  O      . LYS C 1 72  ? 52.144  -22.621 6.368   1.00 46.05  ? 72  LYS C O      1 
ATOM   9656  C  CB     . LYS C 1 72  ? 50.773  -22.168 9.287   1.00 53.06  ? 72  LYS C CB     1 
ATOM   9657  C  CG     . LYS C 1 72  ? 50.227  -21.043 8.416   1.00 84.48  ? 72  LYS C CG     1 
ATOM   9658  C  CD     . LYS C 1 72  ? 49.675  -19.896 9.252   1.00 84.72  ? 72  LYS C CD     1 
ATOM   9659  C  CE     . LYS C 1 72  ? 49.341  -18.689 8.386   1.00 46.35  ? 72  LYS C CE     1 
ATOM   9660  N  NZ     . LYS C 1 72  ? 48.396  -19.027 7.282   1.00 37.55  ? 72  LYS C NZ     1 
ATOM   9661  H  H      . LYS C 1 72  ? 51.875  -24.138 10.225  1.00 73.15  ? 72  LYS C H      1 
ATOM   9662  H  HA     . LYS C 1 72  ? 50.592  -23.747 7.985   1.00 70.87  ? 72  LYS C HA     1 
ATOM   9663  H  HB2    . LYS C 1 72  ? 50.052  -22.475 9.859   1.00 63.67  ? 72  LYS C HB2    1 
ATOM   9664  H  HB3    . LYS C 1 72  ? 51.488  -21.800 9.830   1.00 63.67  ? 72  LYS C HB3    1 
ATOM   9665  H  HG2    . LYS C 1 72  ? 50.941  -20.696 7.859   1.00 101.38 ? 72  LYS C HG2    1 
ATOM   9666  H  HG3    . LYS C 1 72  ? 49.509  -21.388 7.863   1.00 101.38 ? 72  LYS C HG3    1 
ATOM   9667  H  HD2    . LYS C 1 72  ? 48.864  -20.185 9.698   1.00 101.67 ? 72  LYS C HD2    1 
ATOM   9668  H  HD3    . LYS C 1 72  ? 50.340  -19.627 9.906   1.00 101.67 ? 72  LYS C HD3    1 
ATOM   9669  H  HE2    . LYS C 1 72  ? 48.928  -18.006 8.937   1.00 55.62  ? 72  LYS C HE2    1 
ATOM   9670  H  HE3    . LYS C 1 72  ? 50.158  -18.347 7.989   1.00 55.62  ? 72  LYS C HE3    1 
ATOM   9671  H  HZ1    . LYS C 1 72  ? 48.223  -18.301 6.797   1.00 45.06  ? 72  LYS C HZ1    1 
ATOM   9672  H  HZ2    . LYS C 1 72  ? 48.754  -19.649 6.756   1.00 45.06  ? 72  LYS C HZ2    1 
ATOM   9673  H  HZ3    . LYS C 1 72  ? 47.634  -19.338 7.620   1.00 45.06  ? 72  LYS C HZ3    1 
ATOM   9674  N  N      . GLU C 1 73  ? 53.654  -22.927 8.017   1.00 52.85  ? 73  GLU C N      1 
ATOM   9675  C  CA     . GLU C 1 73  ? 54.811  -22.585 7.194   1.00 58.58  ? 73  GLU C CA     1 
ATOM   9676  C  C      . GLU C 1 73  ? 55.130  -23.703 6.203   1.00 58.48  ? 73  GLU C C      1 
ATOM   9677  O  O      . GLU C 1 73  ? 55.419  -23.446 5.033   1.00 56.51  ? 73  GLU C O      1 
ATOM   9678  C  CB     . GLU C 1 73  ? 56.037  -22.304 8.074   1.00 66.11  ? 73  GLU C CB     1 
ATOM   9679  C  CG     . GLU C 1 73  ? 55.840  -21.184 9.096   1.00 78.59  ? 73  GLU C CG     1 
ATOM   9680  C  CD     . GLU C 1 73  ? 55.228  -21.661 10.405  1.00 86.97  ? 73  GLU C CD     1 
ATOM   9681  O  OE1    . GLU C 1 73  ? 54.499  -20.869 11.039  1.00 82.15  ? 73  GLU C OE1    1 
ATOM   9682  O  OE2    . GLU C 1 73  ? 55.477  -22.818 10.806  1.00 89.52  ? 73  GLU C OE2    1 
ATOM   9683  H  H      . GLU C 1 73  ? 53.853  -23.127 8.829   1.00 63.42  ? 73  GLU C H      1 
ATOM   9684  H  HA     . GLU C 1 73  ? 54.614  -21.781 6.688   1.00 70.30  ? 73  GLU C HA     1 
ATOM   9685  H  HB2    . GLU C 1 73  ? 56.260  -23.112 8.562   1.00 79.33  ? 73  GLU C HB2    1 
ATOM   9686  H  HB3    . GLU C 1 73  ? 56.779  -22.053 7.502   1.00 79.33  ? 73  GLU C HB3    1 
ATOM   9687  H  HG2    . GLU C 1 73  ? 56.702  -20.788 9.297   1.00 94.31  ? 73  GLU C HG2    1 
ATOM   9688  H  HG3    . GLU C 1 73  ? 55.249  -20.514 8.718   1.00 94.31  ? 73  GLU C HG3    1 
ATOM   9689  N  N      . GLU C 1 74  ? 55.065  -24.943 6.680   1.00 59.18  ? 74  GLU C N      1 
ATOM   9690  C  CA     . GLU C 1 74  ? 55.373  -26.106 5.857   1.00 47.11  ? 74  GLU C CA     1 
ATOM   9691  C  C      . GLU C 1 74  ? 54.344  -26.254 4.741   1.00 51.18  ? 74  GLU C C      1 
ATOM   9692  O  O      . GLU C 1 74  ? 54.683  -26.630 3.617   1.00 47.29  ? 74  GLU C O      1 
ATOM   9693  C  CB     . GLU C 1 74  ? 55.416  -27.372 6.721   1.00 46.89  ? 74  GLU C CB     1 
ATOM   9694  C  CG     . GLU C 1 74  ? 55.699  -28.666 5.959   1.00 70.50  ? 74  GLU C CG     1 
ATOM   9695  C  CD     . GLU C 1 74  ? 57.094  -28.715 5.353   1.00 74.45  ? 74  GLU C CD     1 
ATOM   9696  O  OE1    . GLU C 1 74  ? 57.908  -27.804 5.626   1.00 67.16  ? 74  GLU C OE1    1 
ATOM   9697  O  OE2    . GLU C 1 74  ? 57.377  -29.674 4.601   1.00 70.01  ? 74  GLU C OE2    1 
ATOM   9698  H  H      . GLU C 1 74  ? 54.843  -25.138 7.488   1.00 71.01  ? 74  GLU C H      1 
ATOM   9699  H  HA     . GLU C 1 74  ? 56.245  -25.987 5.451   1.00 56.53  ? 74  GLU C HA     1 
ATOM   9700  H  HB2    . GLU C 1 74  ? 56.113  -27.266 7.388   1.00 56.27  ? 74  GLU C HB2    1 
ATOM   9701  H  HB3    . GLU C 1 74  ? 54.558  -27.473 7.162   1.00 56.27  ? 74  GLU C HB3    1 
ATOM   9702  H  HG2    . GLU C 1 74  ? 55.612  -29.415 6.569   1.00 84.60  ? 74  GLU C HG2    1 
ATOM   9703  H  HG3    . GLU C 1 74  ? 55.057  -28.752 5.237   1.00 84.60  ? 74  GLU C HG3    1 
ATOM   9704  N  N      . LEU C 1 75  ? 53.091  -25.946 5.060   1.00 54.35  ? 75  LEU C N      1 
ATOM   9705  C  CA     . LEU C 1 75  ? 52.014  -25.971 4.078   1.00 44.74  ? 75  LEU C CA     1 
ATOM   9706  C  C      . LEU C 1 75  ? 52.319  -24.999 2.942   1.00 45.43  ? 75  LEU C C      1 
ATOM   9707  O  O      . LEU C 1 75  ? 52.150  -25.327 1.765   1.00 35.95  ? 75  LEU C O      1 
ATOM   9708  C  CB     . LEU C 1 75  ? 50.681  -25.616 4.745   1.00 44.50  ? 75  LEU C CB     1 
ATOM   9709  C  CG     . LEU C 1 75  ? 49.410  -25.691 3.891   1.00 56.87  ? 75  LEU C CG     1 
ATOM   9710  C  CD1    . LEU C 1 75  ? 49.040  -27.129 3.568   1.00 57.66  ? 75  LEU C CD1    1 
ATOM   9711  C  CD2    . LEU C 1 75  ? 48.255  -24.990 4.597   1.00 53.21  ? 75  LEU C CD2    1 
ATOM   9712  H  H      . LEU C 1 75  ? 52.836  -25.717 5.849   1.00 65.22  ? 75  LEU C H      1 
ATOM   9713  H  HA     . LEU C 1 75  ? 51.941  -26.863 3.704   1.00 53.69  ? 75  LEU C HA     1 
ATOM   9714  H  HB2    . LEU C 1 75  ? 50.553  -26.218 5.495   1.00 53.40  ? 75  LEU C HB2    1 
ATOM   9715  H  HB3    . LEU C 1 75  ? 50.746  -24.707 5.077   1.00 53.40  ? 75  LEU C HB3    1 
ATOM   9716  H  HG     . LEU C 1 75  ? 49.569  -25.230 3.053   1.00 68.25  ? 75  LEU C HG     1 
ATOM   9717  H  HD11   . LEU C 1 75  ? 48.234  -27.134 3.028   1.00 69.20  ? 75  LEU C HD11   1 
ATOM   9718  H  HD12   . LEU C 1 75  ? 49.769  -27.540 3.078   1.00 69.20  ? 75  LEU C HD12   1 
ATOM   9719  H  HD13   . LEU C 1 75  ? 48.886  -27.609 4.397   1.00 69.20  ? 75  LEU C HD13   1 
ATOM   9720  H  HD21   . LEU C 1 75  ? 47.463  -25.049 4.040   1.00 63.86  ? 75  LEU C HD21   1 
ATOM   9721  H  HD22   . LEU C 1 75  ? 48.095  -25.427 5.448   1.00 63.86  ? 75  LEU C HD22   1 
ATOM   9722  H  HD23   . LEU C 1 75  ? 48.491  -24.060 4.740   1.00 63.86  ? 75  LEU C HD23   1 
ATOM   9723  N  N      . ARG C 1 76  ? 52.780  -23.806 3.306   1.00 56.55  ? 76  ARG C N      1 
ATOM   9724  C  CA     . ARG C 1 76  ? 53.149  -22.789 2.329   1.00 46.23  ? 76  ARG C CA     1 
ATOM   9725  C  C      . ARG C 1 76  ? 54.395  -23.205 1.563   1.00 44.23  ? 76  ARG C C      1 
ATOM   9726  O  O      . ARG C 1 76  ? 54.388  -23.283 0.334   1.00 41.14  ? 76  ARG C O      1 
ATOM   9727  C  CB     . ARG C 1 76  ? 53.396  -21.438 3.013   1.00 45.05  ? 76  ARG C CB     1 
ATOM   9728  C  CG     . ARG C 1 76  ? 53.906  -20.345 2.072   1.00 42.04  ? 76  ARG C CG     1 
ATOM   9729  C  CD     . ARG C 1 76  ? 54.097  -19.010 2.785   1.00 54.89  ? 76  ARG C CD     1 
ATOM   9730  N  NE     . ARG C 1 76  ? 55.076  -19.080 3.870   1.00 85.77  ? 76  ARG C NE     1 
ATOM   9731  C  CZ     . ARG C 1 76  ? 56.394  -18.997 3.701   1.00 92.41  ? 76  ARG C CZ     1 
ATOM   9732  N  NH1    . ARG C 1 76  ? 56.910  -18.834 2.488   1.00 78.58  ? 76  ARG C NH1    1 
ATOM   9733  N  NH2    . ARG C 1 76  ? 57.203  -19.071 4.751   1.00 73.06  ? 76  ARG C NH2    1 
ATOM   9734  H  H      . ARG C 1 76  ? 52.890  -23.560 4.123   1.00 67.86  ? 76  ARG C H      1 
ATOM   9735  H  HA     . ARG C 1 76  ? 52.424  -22.679 1.693   1.00 55.48  ? 76  ARG C HA     1 
ATOM   9736  H  HB2    . ARG C 1 76  ? 52.562  -21.129 3.402   1.00 54.07  ? 76  ARG C HB2    1 
ATOM   9737  H  HB3    . ARG C 1 76  ? 54.058  -21.560 3.712   1.00 54.07  ? 76  ARG C HB3    1 
ATOM   9738  H  HG2    . ARG C 1 76  ? 54.763  -20.616 1.705   1.00 50.44  ? 76  ARG C HG2    1 
ATOM   9739  H  HG3    . ARG C 1 76  ? 53.263  -20.216 1.357   1.00 50.44  ? 76  ARG C HG3    1 
ATOM   9740  H  HD2    . ARG C 1 76  ? 54.407  -18.350 2.144   1.00 65.87  ? 76  ARG C HD2    1 
ATOM   9741  H  HD3    . ARG C 1 76  ? 53.249  -18.730 3.165   1.00 65.87  ? 76  ARG C HD3    1 
ATOM   9742  H  HE     . ARG C 1 76  ? 54.780  -19.182 4.670   1.00 102.92 ? 76  ARG C HE     1 
ATOM   9743  H  HH11   . ARG C 1 76  ? 56.392  -18.784 1.804   1.00 94.30  ? 76  ARG C HH11   1 
ATOM   9744  H  HH12   . ARG C 1 76  ? 57.762  -18.780 2.387   1.00 94.30  ? 76  ARG C HH12   1 
ATOM   9745  H  HH21   . ARG C 1 76  ? 56.875  -19.176 5.539   1.00 87.67  ? 76  ARG C HH21   1 
ATOM   9746  H  HH22   . ARG C 1 76  ? 58.054  -19.016 4.643   1.00 87.67  ? 76  ARG C HH22   1 
ATOM   9747  N  N      . GLU C 1 77  ? 55.456  -23.485 2.312   1.00 41.64  ? 77  GLU C N      1 
ATOM   9748  C  CA     . GLU C 1 77  ? 56.776  -23.717 1.741   1.00 45.15  ? 77  GLU C CA     1 
ATOM   9749  C  C      . GLU C 1 77  ? 56.807  -24.908 0.786   1.00 46.51  ? 77  GLU C C      1 
ATOM   9750  O  O      . GLU C 1 77  ? 57.592  -24.910 -0.160  1.00 54.48  ? 77  GLU C O      1 
ATOM   9751  C  CB     . GLU C 1 77  ? 57.794  -23.900 2.868   1.00 61.15  ? 77  GLU C CB     1 
ATOM   9752  C  CG     . GLU C 1 77  ? 58.103  -22.596 3.608   1.00 76.64  ? 77  GLU C CG     1 
ATOM   9753  C  CD     . GLU C 1 77  ? 58.850  -22.807 4.918   1.00 99.65  ? 77  GLU C CD     1 
ATOM   9754  O  OE1    . GLU C 1 77  ? 59.159  -21.799 5.592   1.00 80.91  ? 77  GLU C OE1    1 
ATOM   9755  O  OE2    . GLU C 1 77  ? 59.126  -23.973 5.276   1.00 92.22  ? 77  GLU C OE2    1 
ATOM   9756  H  H      . GLU C 1 77  ? 55.436  -23.547 3.169   1.00 49.96  ? 77  GLU C H      1 
ATOM   9757  H  HA     . GLU C 1 77  ? 57.036  -22.931 1.235   1.00 54.18  ? 77  GLU C HA     1 
ATOM   9758  H  HB2    . GLU C 1 77  ? 57.442  -24.534 3.512   1.00 73.38  ? 77  GLU C HB2    1 
ATOM   9759  H  HB3    . GLU C 1 77  ? 58.624  -24.235 2.493   1.00 73.38  ? 77  GLU C HB3    1 
ATOM   9760  H  HG2    . GLU C 1 77  ? 58.652  -22.035 3.039   1.00 91.96  ? 77  GLU C HG2    1 
ATOM   9761  H  HG3    . GLU C 1 77  ? 57.268  -22.145 3.811   1.00 91.96  ? 77  GLU C HG3    1 
ATOM   9762  N  N      . ARG C 1 78  ? 55.974  -25.919 1.028   1.00 38.17  ? 78  ARG C N      1 
ATOM   9763  C  CA     . ARG C 1 78  ? 55.890  -27.055 0.106   1.00 48.45  ? 78  ARG C CA     1 
ATOM   9764  C  C      . ARG C 1 78  ? 54.873  -26.801 -0.996  1.00 47.94  ? 78  ARG C C      1 
ATOM   9765  O  O      . ARG C 1 78  ? 55.105  -27.148 -2.156  1.00 46.29  ? 78  ARG C O      1 
ATOM   9766  C  CB     . ARG C 1 78  ? 55.530  -28.352 0.834   1.00 52.64  ? 78  ARG C CB     1 
ATOM   9767  C  CG     . ARG C 1 78  ? 56.729  -29.156 1.325   1.00 67.40  ? 78  ARG C CG     1 
ATOM   9768  C  CD     . ARG C 1 78  ? 57.598  -29.670 0.168   1.00 58.65  ? 78  ARG C CD     1 
ATOM   9769  N  NE     . ARG C 1 78  ? 56.903  -30.625 -0.697  1.00 62.62  ? 78  ARG C NE     1 
ATOM   9770  C  CZ     . ARG C 1 78  ? 57.324  -30.986 -1.909  1.00 69.67  ? 78  ARG C CZ     1 
ATOM   9771  N  NH1    . ARG C 1 78  ? 58.439  -30.473 -2.415  1.00 69.23  ? 78  ARG C NH1    1 
ATOM   9772  N  NH2    . ARG C 1 78  ? 56.629  -31.864 -2.622  1.00 51.25  ? 78  ARG C NH2    1 
ATOM   9773  H  H      . ARG C 1 78  ? 55.453  -25.974 1.710   1.00 45.80  ? 78  ARG C H      1 
ATOM   9774  H  HA     . ARG C 1 78  ? 56.755  -27.182 -0.313  1.00 58.14  ? 78  ARG C HA     1 
ATOM   9775  H  HB2    . ARG C 1 78  ? 54.986  -28.133 1.607   1.00 63.17  ? 78  ARG C HB2    1 
ATOM   9776  H  HB3    . ARG C 1 78  ? 55.025  -28.918 0.230   1.00 63.17  ? 78  ARG C HB3    1 
ATOM   9777  H  HG2    . ARG C 1 78  ? 57.280  -28.591 1.889   1.00 80.88  ? 78  ARG C HG2    1 
ATOM   9778  H  HG3    . ARG C 1 78  ? 56.413  -29.922 1.829   1.00 80.88  ? 78  ARG C HG3    1 
ATOM   9779  H  HD2    . ARG C 1 78  ? 57.872  -28.917 -0.379  1.00 70.38  ? 78  ARG C HD2    1 
ATOM   9780  H  HD3    . ARG C 1 78  ? 58.379  -30.113 0.535   1.00 70.38  ? 78  ARG C HD3    1 
ATOM   9781  H  HE     . ARG C 1 78  ? 56.175  -30.976 -0.403  1.00 75.14  ? 78  ARG C HE     1 
ATOM   9782  H  HH11   . ARG C 1 78  ? 58.896  -29.904 -1.960  1.00 83.08  ? 78  ARG C HH11   1 
ATOM   9783  H  HH12   . ARG C 1 78  ? 58.705  -30.709 -3.198  1.00 83.08  ? 78  ARG C HH12   1 
ATOM   9784  H  HH21   . ARG C 1 78  ? 55.905  -32.201 -2.303  1.00 61.50  ? 78  ARG C HH21   1 
ATOM   9785  H  HH22   . ARG C 1 78  ? 56.901  -32.094 -3.405  1.00 61.50  ? 78  ARG C HH22   1 
ATOM   9786  N  N      . GLY C 1 79  ? 53.746  -26.200 -0.626  1.00 40.46  ? 79  GLY C N      1 
ATOM   9787  C  CA     . GLY C 1 79  ? 52.694  -25.903 -1.581  1.00 39.72  ? 79  GLY C CA     1 
ATOM   9788  C  C      . GLY C 1 79  ? 53.183  -25.032 -2.723  1.00 51.23  ? 79  GLY C C      1 
ATOM   9789  O  O      . GLY C 1 79  ? 52.987  -25.359 -3.895  1.00 49.41  ? 79  GLY C O      1 
ATOM   9790  H  H      . GLY C 1 79  ? 53.568  -25.954 0.178   1.00 48.56  ? 79  GLY C H      1 
ATOM   9791  H  HA2    . GLY C 1 79  ? 52.350  -26.732 -1.951  1.00 47.67  ? 79  GLY C HA2    1 
ATOM   9792  H  HA3    . GLY C 1 79  ? 51.969  -25.443 -1.131  1.00 47.67  ? 79  GLY C HA3    1 
ATOM   9793  N  N      . LEU C 1 80  ? 53.832  -23.925 -2.379  1.00 41.45  ? 80  LEU C N      1 
ATOM   9794  C  CA     . LEU C 1 80  ? 54.388  -23.024 -3.381  1.00 40.97  ? 80  LEU C CA     1 
ATOM   9795  C  C      . LEU C 1 80  ? 55.517  -23.698 -4.161  1.00 42.17  ? 80  LEU C C      1 
ATOM   9796  O  O      . LEU C 1 80  ? 55.671  -23.476 -5.364  1.00 38.54  ? 80  LEU C O      1 
ATOM   9797  C  CB     . LEU C 1 80  ? 54.902  -21.741 -2.719  1.00 57.20  ? 80  LEU C CB     1 
ATOM   9798  C  CG     . LEU C 1 80  ? 53.890  -20.872 -1.964  1.00 50.16  ? 80  LEU C CG     1 
ATOM   9799  C  CD1    . LEU C 1 80  ? 54.583  -19.633 -1.413  1.00 57.85  ? 80  LEU C CD1    1 
ATOM   9800  C  CD2    . LEU C 1 80  ? 52.711  -20.475 -2.850  1.00 34.85  ? 80  LEU C CD2    1 
ATOM   9801  H  H      . LEU C 1 80  ? 53.964  -23.672 -1.568  1.00 49.74  ? 80  LEU C H      1 
ATOM   9802  H  HA     . LEU C 1 80  ? 53.691  -22.781 -4.010  1.00 49.16  ? 80  LEU C HA     1 
ATOM   9803  H  HB2    . LEU C 1 80  ? 55.592  -21.988 -2.084  1.00 68.64  ? 80  LEU C HB2    1 
ATOM   9804  H  HB3    . LEU C 1 80  ? 55.292  -21.184 -3.411  1.00 68.64  ? 80  LEU C HB3    1 
ATOM   9805  H  HG     . LEU C 1 80  ? 53.541  -21.377 -1.213  1.00 60.20  ? 80  LEU C HG     1 
ATOM   9806  H  HD11   . LEU C 1 80  ? 53.932  -19.093 -0.938  1.00 69.42  ? 80  LEU C HD11   1 
ATOM   9807  H  HD12   . LEU C 1 80  ? 55.289  -19.909 -0.808  1.00 69.42  ? 80  LEU C HD12   1 
ATOM   9808  H  HD13   . LEU C 1 80  ? 54.958  -19.127 -2.151  1.00 69.42  ? 80  LEU C HD13   1 
ATOM   9809  H  HD21   . LEU C 1 80  ? 52.098  -19.928 -2.333  1.00 41.82  ? 80  LEU C HD21   1 
ATOM   9810  H  HD22   . LEU C 1 80  ? 53.043  -19.972 -3.610  1.00 41.82  ? 80  LEU C HD22   1 
ATOM   9811  H  HD23   . LEU C 1 80  ? 52.261  -21.278 -3.155  1.00 41.82  ? 80  LEU C HD23   1 
ATOM   9812  N  N      . GLU C 1 81  ? 56.301  -24.520 -3.467  1.00 41.10  ? 81  GLU C N      1 
ATOM   9813  C  CA     . GLU C 1 81  ? 57.439  -25.214 -4.070  1.00 45.48  ? 81  GLU C CA     1 
ATOM   9814  C  C      . GLU C 1 81  ? 56.987  -26.126 -5.207  1.00 44.76  ? 81  GLU C C      1 
ATOM   9815  O  O      . GLU C 1 81  ? 57.615  -26.169 -6.269  1.00 34.50  ? 81  GLU C O      1 
ATOM   9816  C  CB     . GLU C 1 81  ? 58.195  -26.018 -3.009  1.00 45.43  ? 81  GLU C CB     1 
ATOM   9817  C  CG     . GLU C 1 81  ? 59.438  -26.735 -3.521  1.00 60.19  ? 81  GLU C CG     1 
ATOM   9818  C  CD     . GLU C 1 81  ? 60.145  -27.524 -2.430  1.00 78.24  ? 81  GLU C CD     1 
ATOM   9819  O  OE1    . GLU C 1 81  ? 59.671  -27.505 -1.272  1.00 59.17  ? 81  GLU C OE1    1 
ATOM   9820  O  OE2    . GLU C 1 81  ? 61.178  -28.162 -2.731  1.00 76.53  ? 81  GLU C OE2    1 
ATOM   9821  H  H      . GLU C 1 81  ? 56.193  -24.696 -2.632  1.00 49.31  ? 81  GLU C H      1 
ATOM   9822  H  HA     . GLU C 1 81  ? 58.049  -24.556 -4.439  1.00 54.57  ? 81  GLU C HA     1 
ATOM   9823  H  HB2    . GLU C 1 81  ? 58.474  -25.414 -2.304  1.00 54.51  ? 81  GLU C HB2    1 
ATOM   9824  H  HB3    . GLU C 1 81  ? 57.598  -26.690 -2.646  1.00 54.51  ? 81  GLU C HB3    1 
ATOM   9825  H  HG2    . GLU C 1 81  ? 59.180  -27.354 -4.221  1.00 72.23  ? 81  GLU C HG2    1 
ATOM   9826  H  HG3    . GLU C 1 81  ? 60.061  -26.078 -3.870  1.00 72.23  ? 81  GLU C HG3    1 
ATOM   9827  N  N      . ILE C 1 82  ? 55.901  -26.858 -4.976  1.00 36.97  ? 82  ILE C N      1 
ATOM   9828  C  CA     . ILE C 1 82  ? 55.340  -27.731 -6.000  1.00 54.29  ? 82  ILE C CA     1 
ATOM   9829  C  C      . ILE C 1 82  ? 54.794  -26.902 -7.155  1.00 42.66  ? 82  ILE C C      1 
ATOM   9830  O  O      . ILE C 1 82  ? 55.018  -27.226 -8.321  1.00 31.59  ? 82  ILE C O      1 
ATOM   9831  C  CB     . ILE C 1 82  ? 54.216  -28.624 -5.431  1.00 50.07  ? 82  ILE C CB     1 
ATOM   9832  C  CG1    . ILE C 1 82  ? 54.779  -29.552 -4.352  1.00 34.43  ? 82  ILE C CG1    1 
ATOM   9833  C  CG2    . ILE C 1 82  ? 53.560  -29.454 -6.544  1.00 37.60  ? 82  ILE C CG2    1 
ATOM   9834  C  CD1    . ILE C 1 82  ? 53.722  -30.274 -3.553  1.00 49.32  ? 82  ILE C CD1    1 
ATOM   9835  H  H      . ILE C 1 82  ? 55.470  -26.867 -4.232  1.00 44.37  ? 82  ILE C H      1 
ATOM   9836  H  HA     . ILE C 1 82  ? 56.040  -28.308 -6.345  1.00 65.15  ? 82  ILE C HA     1 
ATOM   9837  H  HB     . ILE C 1 82  ? 53.541  -28.055 -5.029  1.00 60.08  ? 82  ILE C HB     1 
ATOM   9838  H  HG12   . ILE C 1 82  ? 55.338  -30.222 -4.777  1.00 41.31  ? 82  ILE C HG12   1 
ATOM   9839  H  HG13   . ILE C 1 82  ? 55.310  -29.026 -3.734  1.00 41.31  ? 82  ILE C HG13   1 
ATOM   9840  H  HG21   . ILE C 1 82  ? 52.860  -30.003 -6.157  1.00 45.12  ? 82  ILE C HG21   1 
ATOM   9841  H  HG22   . ILE C 1 82  ? 53.182  -28.852 -7.205  1.00 45.12  ? 82  ILE C HG22   1 
ATOM   9842  H  HG23   . ILE C 1 82  ? 54.233  -30.018 -6.956  1.00 45.12  ? 82  ILE C HG23   1 
ATOM   9843  H  HD11   . ILE C 1 82  ? 54.155  -30.838 -2.894  1.00 59.19  ? 82  ILE C HD11   1 
ATOM   9844  H  HD12   . ILE C 1 82  ? 53.160  -29.619 -3.110  1.00 59.19  ? 82  ILE C HD12   1 
ATOM   9845  H  HD13   . ILE C 1 82  ? 53.188  -30.816 -4.155  1.00 59.19  ? 82  ILE C HD13   1 
ATOM   9846  N  N      . GLY C 1 83  ? 54.082  -25.830 -6.822  1.00 34.76  ? 83  GLY C N      1 
ATOM   9847  C  CA     . GLY C 1 83  ? 53.480  -24.968 -7.822  1.00 39.90  ? 83  GLY C CA     1 
ATOM   9848  C  C      . GLY C 1 83  ? 54.479  -24.472 -8.851  1.00 41.24  ? 83  GLY C C      1 
ATOM   9849  O  O      . GLY C 1 83  ? 54.286  -24.660 -10.049 1.00 46.83  ? 83  GLY C O      1 
ATOM   9850  H  H      . GLY C 1 83  ? 53.934  -25.580 -6.012  1.00 41.71  ? 83  GLY C H      1 
ATOM   9851  H  HA2    . GLY C 1 83  ? 52.780  -25.454 -8.285  1.00 47.88  ? 83  GLY C HA2    1 
ATOM   9852  H  HA3    . GLY C 1 83  ? 53.082  -24.198 -7.386  1.00 47.88  ? 83  GLY C HA3    1 
ATOM   9853  N  N      . LYS C 1 84  ? 55.559  -23.855 -8.383  1.00 40.50  ? 84  LYS C N      1 
ATOM   9854  C  CA     . LYS C 1 84  ? 56.575  -23.307 -9.277  1.00 47.70  ? 84  LYS C CA     1 
ATOM   9855  C  C      . LYS C 1 84  ? 57.189  -24.392 -10.160 1.00 45.25  ? 84  LYS C C      1 
ATOM   9856  O  O      . LYS C 1 84  ? 57.589  -24.131 -11.297 1.00 41.74  ? 84  LYS C O      1 
ATOM   9857  C  CB     . LYS C 1 84  ? 57.676  -22.612 -8.467  1.00 47.67  ? 84  LYS C CB     1 
ATOM   9858  C  CG     . LYS C 1 84  ? 57.210  -21.364 -7.735  1.00 47.52  ? 84  LYS C CG     1 
ATOM   9859  C  CD     . LYS C 1 84  ? 58.336  -20.710 -6.944  1.00 44.14  ? 84  LYS C CD     1 
ATOM   9860  C  CE     . LYS C 1 84  ? 58.664  -21.485 -5.677  1.00 47.77  ? 84  LYS C CE     1 
ATOM   9861  N  NZ     . LYS C 1 84  ? 59.509  -20.689 -4.739  1.00 40.58  ? 84  LYS C NZ     1 
ATOM   9862  H  H      . LYS C 1 84  ? 55.729  -23.740 -7.547  1.00 48.60  ? 84  LYS C H      1 
ATOM   9863  H  HA     . LYS C 1 84  ? 56.164  -22.646 -9.855  1.00 57.24  ? 84  LYS C HA     1 
ATOM   9864  H  HB2    . LYS C 1 84  ? 58.017  -23.233 -7.806  1.00 57.20  ? 84  LYS C HB2    1 
ATOM   9865  H  HB3    . LYS C 1 84  ? 58.390  -22.351 -9.071  1.00 57.20  ? 84  LYS C HB3    1 
ATOM   9866  H  HG2    . LYS C 1 84  ? 56.880  -20.720 -8.381  1.00 57.02  ? 84  LYS C HG2    1 
ATOM   9867  H  HG3    . LYS C 1 84  ? 56.505  -21.605 -7.114  1.00 57.02  ? 84  LYS C HG3    1 
ATOM   9868  H  HD2    . LYS C 1 84  ? 59.135  -20.677 -7.494  1.00 52.97  ? 84  LYS C HD2    1 
ATOM   9869  H  HD3    . LYS C 1 84  ? 58.068  -19.813 -6.690  1.00 52.97  ? 84  LYS C HD3    1 
ATOM   9870  H  HE2    . LYS C 1 84  ? 57.839  -21.713 -5.220  1.00 57.32  ? 84  LYS C HE2    1 
ATOM   9871  H  HE3    . LYS C 1 84  ? 59.150  -22.290 -5.912  1.00 57.32  ? 84  LYS C HE3    1 
ATOM   9872  H  HZ1    . LYS C 1 84  ? 59.684  -21.165 -4.009  1.00 48.70  ? 84  LYS C HZ1    1 
ATOM   9873  H  HZ2    . LYS C 1 84  ? 60.276  -20.470 -5.133  1.00 48.70  ? 84  LYS C HZ2    1 
ATOM   9874  H  HZ3    . LYS C 1 84  ? 59.082  -19.944 -4.503  1.00 48.70  ? 84  LYS C HZ3    1 
ATOM   9875  N  N      . ALA C 1 85  ? 57.245  -25.612 -9.633  1.00 45.69  ? 85  ALA C N      1 
ATOM   9876  C  CA     . ALA C 1 85  ? 57.855  -26.728 -10.343 1.00 37.65  ? 85  ALA C CA     1 
ATOM   9877  C  C      . ALA C 1 85  ? 56.969  -27.215 -11.485 1.00 43.41  ? 85  ALA C C      1 
ATOM   9878  O  O      . ALA C 1 85  ? 57.457  -27.794 -12.457 1.00 57.83  ? 85  ALA C O      1 
ATOM   9879  C  CB     . ALA C 1 85  ? 58.141  -27.869 -9.375  1.00 37.20  ? 85  ALA C CB     1 
ATOM   9880  H  H      . ALA C 1 85  ? 56.933  -25.819 -8.859  1.00 54.83  ? 85  ALA C H      1 
ATOM   9881  H  HA     . ALA C 1 85  ? 58.700  -26.438 -10.722 1.00 45.18  ? 85  ALA C HA     1 
ATOM   9882  H  HB1    . ALA C 1 85  ? 58.547  -28.603 -9.863  1.00 44.64  ? 85  ALA C HB1    1 
ATOM   9883  H  HB2    . ALA C 1 85  ? 58.747  -27.554 -8.687  1.00 44.64  ? 85  ALA C HB2    1 
ATOM   9884  H  HB3    . ALA C 1 85  ? 57.307  -28.159 -8.974  1.00 44.64  ? 85  ALA C HB3    1 
ATOM   9885  N  N      . VAL C 1 86  ? 55.671  -26.955 -11.371 1.00 38.69  ? 86  VAL C N      1 
ATOM   9886  C  CA     . VAL C 1 86  ? 54.691  -27.488 -12.309 1.00 35.56  ? 86  VAL C CA     1 
ATOM   9887  C  C      . VAL C 1 86  ? 54.313  -26.460 -13.374 1.00 42.47  ? 86  VAL C C      1 
ATOM   9888  O  O      . VAL C 1 86  ? 53.931  -26.820 -14.487 1.00 47.16  ? 86  VAL C O      1 
ATOM   9889  C  CB     . VAL C 1 86  ? 53.427  -27.958 -11.558 1.00 23.97  ? 86  VAL C CB     1 
ATOM   9890  C  CG1    . VAL C 1 86  ? 52.323  -28.372 -12.526 1.00 53.10  ? 86  VAL C CG1    1 
ATOM   9891  C  CG2    . VAL C 1 86  ? 53.773  -29.117 -10.636 1.00 25.52  ? 86  VAL C CG2    1 
ATOM   9892  H  H      . VAL C 1 86  ? 55.329  -26.466 -10.751 1.00 46.43  ? 86  VAL C H      1 
ATOM   9893  H  HA     . VAL C 1 86  ? 55.073  -28.258 -12.760 1.00 42.67  ? 86  VAL C HA     1 
ATOM   9894  H  HB     . VAL C 1 86  ? 53.092  -27.229 -11.013 1.00 28.76  ? 86  VAL C HB     1 
ATOM   9895  H  HG11   . VAL C 1 86  ? 51.549  -28.660 -12.018 1.00 63.72  ? 86  VAL C HG11   1 
ATOM   9896  H  HG12   . VAL C 1 86  ? 52.091  -27.612 -13.083 1.00 63.72  ? 86  VAL C HG12   1 
ATOM   9897  H  HG13   . VAL C 1 86  ? 52.646  -29.101 -13.079 1.00 63.72  ? 86  VAL C HG13   1 
ATOM   9898  H  HG21   . VAL C 1 86  ? 52.971  -29.401 -10.171 1.00 30.63  ? 86  VAL C HG21   1 
ATOM   9899  H  HG22   . VAL C 1 86  ? 54.125  -29.849 -11.167 1.00 30.63  ? 86  VAL C HG22   1 
ATOM   9900  H  HG23   . VAL C 1 86  ? 54.440  -28.822 -9.995  1.00 30.63  ? 86  VAL C HG23   1 
ATOM   9901  N  N      . LEU C 1 87  ? 54.438  -25.182 -13.038 1.00 44.38  ? 87  LEU C N      1 
ATOM   9902  C  CA     . LEU C 1 87  ? 54.026  -24.114 -13.942 1.00 49.15  ? 87  LEU C CA     1 
ATOM   9903  C  C      . LEU C 1 87  ? 55.185  -23.644 -14.816 1.00 44.78  ? 87  LEU C C      1 
ATOM   9904  O  O      . LEU C 1 87  ? 56.338  -23.623 -14.380 1.00 47.69  ? 87  LEU C O      1 
ATOM   9905  C  CB     . LEU C 1 87  ? 53.455  -22.937 -13.145 1.00 47.14  ? 87  LEU C CB     1 
ATOM   9906  C  CG     . LEU C 1 87  ? 52.311  -23.287 -12.186 1.00 46.59  ? 87  LEU C CG     1 
ATOM   9907  C  CD1    . LEU C 1 87  ? 51.905  -22.072 -11.372 1.00 51.17  ? 87  LEU C CD1    1 
ATOM   9908  C  CD2    . LEU C 1 87  ? 51.115  -23.855 -12.933 1.00 54.71  ? 87  LEU C CD2    1 
ATOM   9909  H  H      . LEU C 1 87  ? 54.759  -24.905 -12.290 1.00 53.25  ? 87  LEU C H      1 
ATOM   9910  H  HA     . LEU C 1 87  ? 53.327  -24.447 -14.526 1.00 58.98  ? 87  LEU C HA     1 
ATOM   9911  H  HB2    . LEU C 1 87  ? 54.169  -22.548 -12.617 1.00 56.56  ? 87  LEU C HB2    1 
ATOM   9912  H  HB3    . LEU C 1 87  ? 53.118  -22.277 -13.771 1.00 56.56  ? 87  LEU C HB3    1 
ATOM   9913  H  HG     . LEU C 1 87  ? 52.621  -23.967 -11.567 1.00 55.90  ? 87  LEU C HG     1 
ATOM   9914  H  HD11   . LEU C 1 87  ? 51.181  -22.320 -10.775 1.00 61.41  ? 87  LEU C HD11   1 
ATOM   9915  H  HD12   . LEU C 1 87  ? 52.669  -21.767 -10.858 1.00 61.41  ? 87  LEU C HD12   1 
ATOM   9916  H  HD13   . LEU C 1 87  ? 51.611  -21.372 -11.976 1.00 61.41  ? 87  LEU C HD13   1 
ATOM   9917  H  HD21   . LEU C 1 87  ? 50.415  -24.063 -12.294 1.00 65.65  ? 87  LEU C HD21   1 
ATOM   9918  H  HD22   . LEU C 1 87  ? 50.798  -23.195 -13.569 1.00 65.65  ? 87  LEU C HD22   1 
ATOM   9919  H  HD23   . LEU C 1 87  ? 51.388  -24.660 -13.399 1.00 65.65  ? 87  LEU C HD23   1 
ATOM   9920  N  N      . ASP C 1 88  ? 54.867  -23.290 -16.059 1.00 45.07  ? 88  ASP C N      1 
ATOM   9921  C  CA     . ASP C 1 88  ? 55.862  -22.768 -16.990 1.00 53.07  ? 88  ASP C CA     1 
ATOM   9922  C  C      . ASP C 1 88  ? 56.435  -21.456 -16.448 1.00 55.62  ? 88  ASP C C      1 
ATOM   9923  O  O      . ASP C 1 88  ? 57.628  -21.360 -16.151 1.00 65.33  ? 88  ASP C O      1 
ATOM   9924  C  CB     . ASP C 1 88  ? 55.246  -22.555 -18.380 1.00 57.25  ? 88  ASP C CB     1 
ATOM   9925  C  CG     . ASP C 1 88  ? 54.653  -23.834 -18.970 1.00 67.41  ? 88  ASP C CG     1 
ATOM   9926  O  OD1    . ASP C 1 88  ? 55.030  -24.941 -18.523 1.00 57.20  ? 88  ASP C OD1    1 
ATOM   9927  O  OD2    . ASP C 1 88  ? 53.820  -23.730 -19.898 1.00 57.91  ? 88  ASP C OD2    1 
ATOM   9928  H  H      . ASP C 1 88  ? 54.075  -23.344 -16.390 1.00 54.09  ? 88  ASP C H      1 
ATOM   9929  H  HA     . ASP C 1 88  ? 56.588  -23.406 -17.074 1.00 63.68  ? 88  ASP C HA     1 
ATOM   9930  H  HB2    . ASP C 1 88  ? 54.535  -21.898 -18.312 1.00 68.71  ? 88  ASP C HB2    1 
ATOM   9931  H  HB3    . ASP C 1 88  ? 55.934  -22.237 -18.985 1.00 68.71  ? 88  ASP C HB3    1 
ATOM   9932  N  N      . SER C 1 89  ? 55.568  -20.456 -16.314 1.00 57.54  ? 89  SER C N      1 
ATOM   9933  C  CA     . SER C 1 89  ? 55.907  -19.204 -15.644 1.00 53.25  ? 89  SER C CA     1 
ATOM   9934  C  C      . SER C 1 89  ? 54.921  -18.989 -14.502 1.00 43.91  ? 89  SER C C      1 
ATOM   9935  O  O      . SER C 1 89  ? 53.801  -19.500 -14.546 1.00 49.96  ? 89  SER C O      1 
ATOM   9936  C  CB     . SER C 1 89  ? 55.868  -18.031 -16.625 1.00 59.17  ? 89  SER C CB     1 
ATOM   9937  O  OG     . SER C 1 89  ? 54.557  -17.828 -17.121 1.00 52.25  ? 89  SER C OG     1 
ATOM   9938  H  H      . SER C 1 89  ? 54.761  -20.480 -16.609 1.00 69.05  ? 89  SER C H      1 
ATOM   9939  H  HA     . SER C 1 89  ? 56.801  -19.266 -15.273 1.00 63.90  ? 89  SER C HA     1 
ATOM   9940  H  HB2    . SER C 1 89  ? 56.161  -17.228 -16.167 1.00 71.01  ? 89  SER C HB2    1 
ATOM   9941  H  HB3    . SER C 1 89  ? 56.461  -18.223 -17.369 1.00 71.01  ? 89  SER C HB3    1 
ATOM   9942  H  HG     . SER C 1 89  ? 54.550  -17.182 -17.658 1.00 62.70  ? 89  SER C HG     1 
ATOM   9943  N  N      . TYR C 1 90  ? 55.331  -18.247 -13.478 1.00 52.26  ? 90  TYR C N      1 
ATOM   9944  C  CA     . TYR C 1 90  ? 54.469  -18.026 -12.320 1.00 57.41  ? 90  TYR C CA     1 
ATOM   9945  C  C      . TYR C 1 90  ? 54.605  -16.618 -11.753 1.00 47.84  ? 90  TYR C C      1 
ATOM   9946  O  O      . TYR C 1 90  ? 55.450  -15.834 -12.183 1.00 56.35  ? 90  TYR C O      1 
ATOM   9947  C  CB     . TYR C 1 90  ? 54.772  -19.058 -11.231 1.00 48.96  ? 90  TYR C CB     1 
ATOM   9948  C  CG     . TYR C 1 90  ? 56.189  -19.013 -10.703 1.00 51.15  ? 90  TYR C CG     1 
ATOM   9949  C  CD1    . TYR C 1 90  ? 57.213  -19.704 -11.338 1.00 48.59  ? 90  TYR C CD1    1 
ATOM   9950  C  CD2    . TYR C 1 90  ? 56.501  -18.289 -9.560  1.00 48.69  ? 90  TYR C CD2    1 
ATOM   9951  C  CE1    . TYR C 1 90  ? 58.507  -19.669 -10.853 1.00 57.79  ? 90  TYR C CE1    1 
ATOM   9952  C  CE2    . TYR C 1 90  ? 57.791  -18.248 -9.068  1.00 49.31  ? 90  TYR C CE2    1 
ATOM   9953  C  CZ     . TYR C 1 90  ? 58.790  -18.940 -9.717  1.00 58.56  ? 90  TYR C CZ     1 
ATOM   9954  O  OH     . TYR C 1 90  ? 60.075  -18.899 -9.225  1.00 57.66  ? 90  TYR C OH     1 
ATOM   9955  H  H      . TYR C 1 90  ? 56.099  -17.863 -13.428 1.00 62.71  ? 90  TYR C H      1 
ATOM   9956  H  HA     . TYR C 1 90  ? 53.546  -18.146 -12.592 1.00 68.90  ? 90  TYR C HA     1 
ATOM   9957  H  HB2    . TYR C 1 90  ? 54.174  -18.905 -10.483 1.00 58.75  ? 90  TYR C HB2    1 
ATOM   9958  H  HB3    . TYR C 1 90  ? 54.622  -19.945 -11.594 1.00 58.75  ? 90  TYR C HB3    1 
ATOM   9959  H  HD1    . TYR C 1 90  ? 57.025  -20.197 -12.104 1.00 58.31  ? 90  TYR C HD1    1 
ATOM   9960  H  HD2    . TYR C 1 90  ? 55.829  -17.821 -9.119  1.00 58.42  ? 90  TYR C HD2    1 
ATOM   9961  H  HE1    . TYR C 1 90  ? 59.183  -20.135 -11.290 1.00 69.34  ? 90  TYR C HE1    1 
ATOM   9962  H  HE2    . TYR C 1 90  ? 57.984  -17.757 -8.302  1.00 59.17  ? 90  TYR C HE2    1 
ATOM   9963  H  HH     . TYR C 1 90  ? 60.103  -18.422 -8.534  1.00 69.20  ? 90  TYR C HH     1 
ATOM   9964  N  N      . GLU C 1 91  ? 53.758  -16.307 -10.781 1.00 41.70  ? 91  GLU C N      1 
ATOM   9965  C  CA     . GLU C 1 91  ? 53.739  -14.987 -10.174 1.00 64.00  ? 91  GLU C CA     1 
ATOM   9966  C  C      . GLU C 1 91  ? 53.075  -15.079 -8.803  1.00 54.22  ? 91  GLU C C      1 
ATOM   9967  O  O      . GLU C 1 91  ? 51.855  -15.204 -8.701  1.00 66.16  ? 91  GLU C O      1 
ATOM   9968  C  CB     . GLU C 1 91  ? 53.005  -13.998 -11.084 1.00 70.66  ? 91  GLU C CB     1 
ATOM   9969  C  CG     . GLU C 1 91  ? 53.118  -12.542 -10.663 1.00 95.20  ? 91  GLU C CG     1 
ATOM   9970  C  CD     . GLU C 1 91  ? 52.508  -11.591 -11.680 1.00 100.47 ? 91  GLU C CD     1 
ATOM   9971  O  OE1    . GLU C 1 91  ? 52.088  -12.059 -12.762 1.00 62.16  ? 91  GLU C OE1    1 
ATOM   9972  O  OE2    . GLU C 1 91  ? 52.448  -10.375 -11.399 1.00 91.83  ? 91  GLU C OE2    1 
ATOM   9973  H  H      . GLU C 1 91  ? 53.178  -16.850 -10.453 1.00 50.04  ? 91  GLU C H      1 
ATOM   9974  H  HA     . GLU C 1 91  ? 54.649  -14.674 -10.053 1.00 76.80  ? 91  GLU C HA     1 
ATOM   9975  H  HB2    . GLU C 1 91  ? 53.370  -14.073 -11.980 1.00 84.79  ? 91  GLU C HB2    1 
ATOM   9976  H  HB3    . GLU C 1 91  ? 52.063  -14.228 -11.096 1.00 84.79  ? 91  GLU C HB3    1 
ATOM   9977  H  HG2    . GLU C 1 91  ? 52.653  -12.419 -9.820  1.00 114.24 ? 91  GLU C HG2    1 
ATOM   9978  H  HG3    . GLU C 1 91  ? 54.055  -12.313 -10.561 1.00 114.24 ? 91  GLU C HG3    1 
ATOM   9979  N  N      . ILE C 1 92  ? 53.890  -15.030 -7.753  1.00 40.88  ? 92  ILE C N      1 
ATOM   9980  C  CA     . ILE C 1 92  ? 53.409  -15.255 -6.393  1.00 58.69  ? 92  ILE C CA     1 
ATOM   9981  C  C      . ILE C 1 92  ? 53.145  -13.945 -5.659  1.00 48.25  ? 92  ILE C C      1 
ATOM   9982  O  O      . ILE C 1 92  ? 54.056  -13.156 -5.414  1.00 46.33  ? 92  ILE C O      1 
ATOM   9983  C  CB     . ILE C 1 92  ? 54.413  -16.109 -5.598  1.00 46.76  ? 92  ILE C CB     1 
ATOM   9984  C  CG1    . ILE C 1 92  ? 54.443  -17.521 -6.188  1.00 39.72  ? 92  ILE C CG1    1 
ATOM   9985  C  CG2    . ILE C 1 92  ? 54.042  -16.153 -4.110  1.00 42.10  ? 92  ILE C CG2    1 
ATOM   9986  C  CD1    . ILE C 1 92  ? 55.467  -18.440 -5.568  1.00 71.23  ? 92  ILE C CD1    1 
ATOM   9987  H  H      . ILE C 1 92  ? 54.732  -14.866 -7.803  1.00 49.05  ? 92  ILE C H      1 
ATOM   9988  H  HA     . ILE C 1 92  ? 52.572  -15.745 -6.436  1.00 70.43  ? 92  ILE C HA     1 
ATOM   9989  H  HB     . ILE C 1 92  ? 55.295  -15.715 -5.687  1.00 56.11  ? 92  ILE C HB     1 
ATOM   9990  H  HG12   . ILE C 1 92  ? 53.571  -17.927 -6.064  1.00 47.66  ? 92  ILE C HG12   1 
ATOM   9991  H  HG13   . ILE C 1 92  ? 54.642  -17.457 -7.135  1.00 47.66  ? 92  ILE C HG13   1 
ATOM   9992  H  HG21   . ILE C 1 92  ? 54.692  -16.697 -3.639  1.00 50.53  ? 92  ILE C HG21   1 
ATOM   9993  H  HG22   . ILE C 1 92  ? 54.048  -15.249 -3.757  1.00 50.53  ? 92  ILE C HG22   1 
ATOM   9994  H  HG23   . ILE C 1 92  ? 53.157  -16.539 -4.017  1.00 50.53  ? 92  ILE C HG23   1 
ATOM   9995  H  HD11   . ILE C 1 92  ? 55.416  -19.307 -6.000  1.00 85.48  ? 92  ILE C HD11   1 
ATOM   9996  H  HD12   . ILE C 1 92  ? 56.350  -18.059 -5.694  1.00 85.48  ? 92  ILE C HD12   1 
ATOM   9997  H  HD13   . ILE C 1 92  ? 55.277  -18.530 -4.621  1.00 85.48  ? 92  ILE C HD13   1 
ATOM   9998  N  N      . ARG C 1 93  ? 51.883  -13.740 -5.296  1.00 44.04  ? 93  ARG C N      1 
ATOM   9999  C  CA     . ARG C 1 93  ? 51.446  -12.504 -4.666  1.00 42.98  ? 93  ARG C CA     1 
ATOM   10000 C  C      . ARG C 1 93  ? 50.043  -12.699 -4.089  1.00 34.74  ? 93  ARG C C      1 
ATOM   10001 O  O      . ARG C 1 93  ? 49.064  -12.799 -4.832  1.00 28.10  ? 93  ARG C O      1 
ATOM   10002 C  CB     . ARG C 1 93  ? 51.466  -11.355 -5.679  1.00 35.80  ? 93  ARG C CB     1 
ATOM   10003 C  CG     . ARG C 1 93  ? 51.431  -9.963  -5.068  1.00 46.05  ? 93  ARG C CG     1 
ATOM   10004 C  CD     . ARG C 1 93  ? 52.752  -9.603  -4.408  1.00 58.75  ? 93  ARG C CD     1 
ATOM   10005 N  NE     . ARG C 1 93  ? 52.897  -8.156  -4.244  1.00 72.12  ? 93  ARG C NE     1 
ATOM   10006 C  CZ     . ARG C 1 93  ? 52.500  -7.466  -3.178  1.00 58.08  ? 93  ARG C CZ     1 
ATOM   10007 N  NH1    . ARG C 1 93  ? 51.924  -8.077  -2.147  1.00 67.65  ? 93  ARG C NH1    1 
ATOM   10008 N  NH2    . ARG C 1 93  ? 52.684  -6.154  -3.142  1.00 38.72  ? 93  ARG C NH2    1 
ATOM   10009 H  H      . ARG C 1 93  ? 51.252  -14.313 -5.406  1.00 52.85  ? 93  ARG C H      1 
ATOM   10010 H  HA     . ARG C 1 93  ? 52.048  -12.282 -3.938  1.00 51.57  ? 93  ARG C HA     1 
ATOM   10011 H  HB2    . ARG C 1 93  ? 52.277  -11.423 -6.207  1.00 42.96  ? 93  ARG C HB2    1 
ATOM   10012 H  HB3    . ARG C 1 93  ? 50.693  -11.440 -6.258  1.00 42.96  ? 93  ARG C HB3    1 
ATOM   10013 H  HG2    . ARG C 1 93  ? 51.253  -9.313  -5.765  1.00 55.26  ? 93  ARG C HG2    1 
ATOM   10014 H  HG3    . ARG C 1 93  ? 50.736  -9.929  -4.392  1.00 55.26  ? 93  ARG C HG3    1 
ATOM   10015 H  HD2    . ARG C 1 93  ? 52.794  -10.013 -3.530  1.00 70.50  ? 93  ARG C HD2    1 
ATOM   10016 H  HD3    . ARG C 1 93  ? 53.483  -9.920  -4.961  1.00 70.50  ? 93  ARG C HD3    1 
ATOM   10017 H  HE     . ARG C 1 93  ? 53.268  -7.719  -4.885  1.00 86.54  ? 93  ARG C HE     1 
ATOM   10018 H  HH11   . ARG C 1 93  ? 51.803  -8.928  -2.165  1.00 81.18  ? 93  ARG C HH11   1 
ATOM   10019 H  HH12   . ARG C 1 93  ? 51.672  -7.620  -1.463  1.00 81.18  ? 93  ARG C HH12   1 
ATOM   10020 H  HH21   . ARG C 1 93  ? 53.056  -5.753  -3.806  1.00 46.47  ? 93  ARG C HH21   1 
ATOM   10021 H  HH22   . ARG C 1 93  ? 52.430  -5.702  -2.455  1.00 46.47  ? 93  ARG C HH22   1 
ATOM   10022 N  N      . TYR C 1 94  ? 49.957  -12.760 -2.764  1.00 37.22  ? 94  TYR C N      1 
ATOM   10023 C  CA     . TYR C 1 94  ? 48.696  -13.023 -2.076  1.00 35.60  ? 94  TYR C CA     1 
ATOM   10024 C  C      . TYR C 1 94  ? 48.524  -12.102 -0.867  1.00 34.01  ? 94  TYR C C      1 
ATOM   10025 O  O      . TYR C 1 94  ? 49.410  -11.305 -0.553  1.00 34.17  ? 94  TYR C O      1 
ATOM   10026 C  CB     . TYR C 1 94  ? 48.626  -14.492 -1.644  1.00 47.22  ? 94  TYR C CB     1 
ATOM   10027 C  CG     . TYR C 1 94  ? 49.815  -14.955 -0.825  1.00 47.07  ? 94  TYR C CG     1 
ATOM   10028 C  CD1    . TYR C 1 94  ? 50.965  -15.444 -1.440  1.00 49.73  ? 94  TYR C CD1    1 
ATOM   10029 C  CD2    . TYR C 1 94  ? 49.787  -14.906 0.562   1.00 37.57  ? 94  TYR C CD2    1 
ATOM   10030 C  CE1    . TYR C 1 94  ? 52.054  -15.869 -0.691  1.00 42.34  ? 94  TYR C CE1    1 
ATOM   10031 C  CE2    . TYR C 1 94  ? 50.868  -15.328 1.317   1.00 57.40  ? 94  TYR C CE2    1 
ATOM   10032 C  CZ     . TYR C 1 94  ? 51.998  -15.807 0.688   1.00 59.17  ? 94  TYR C CZ     1 
ATOM   10033 O  OH     . TYR C 1 94  ? 53.069  -16.224 1.448   1.00 56.70  ? 94  TYR C OH     1 
ATOM   10034 H  H      . TYR C 1 94  ? 50.625  -12.652 -2.233  1.00 44.67  ? 94  TYR C H      1 
ATOM   10035 H  HA     . TYR C 1 94  ? 47.962  -12.855 -2.687  1.00 42.72  ? 94  TYR C HA     1 
ATOM   10036 H  HB2    . TYR C 1 94  ? 47.829  -14.621 -1.106  1.00 56.66  ? 94  TYR C HB2    1 
ATOM   10037 H  HB3    . TYR C 1 94  ? 48.580  -15.048 -2.437  1.00 56.66  ? 94  TYR C HB3    1 
ATOM   10038 H  HD1    . TYR C 1 94  ? 51.004  -15.485 -2.368  1.00 59.68  ? 94  TYR C HD1    1 
ATOM   10039 H  HD2    . TYR C 1 94  ? 49.028  -14.583 0.992   1.00 45.08  ? 94  TYR C HD2    1 
ATOM   10040 H  HE1    . TYR C 1 94  ? 52.816  -16