data_4X4U
# 
_entry.id   4X4U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X4U         
WWPDB D_1000202159 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4X4N unspecified 
PDB . 4X4O unspecified 
PDB . 4X4P unspecified 
PDB . 4X4Q unspecified 
PDB . 4X4R unspecified 
PDB . 4X4S unspecified 
PDB . 4X4T unspecified 
PDB . 4X4V unspecified 
PDB . 4X4W unspecified 
PDB . 4X4X unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X4U 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuhn, C.-D.'    1 
'Joshua-Tor, L.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            160 
_citation.language                  ? 
_citation.page_first                644 
_citation.page_last                 658 
_citation.title                     'On-Enzyme Refolding Permits Small RNA and tRNA Surveillance by the CCA-Adding Enzyme.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2015.01.005 
_citation.pdbx_database_id_PubMed   25640237 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kuhn, C.D.'     1 ? 
primary 'Wilusz, J.E.'   2 ? 
primary 'Zheng, Y.'      3 ? 
primary 'Beal, P.A.'     4 ? 
primary 'Joshua-Tor, L.' 5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   103.420 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4X4U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     114.988 
_cell.length_a_esd                 ? 
_cell.length_b                     84.049 
_cell.length_b_esd                 ? 
_cell.length_c                     135.524 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4X4U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CCA-adding enzyme'                             53672.484 4  2.7.7.72 ? ? ? 
2 polymer     syn 'human MenBeta minihelix'                       11886.064 3  ?        ? ? ? 
3 polymer     syn 
;RNA (5'-D(*GP*G)-3')
;
645.454   1  ?        ? ? ? 
4 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' 505.208   2  ?        ? ? ? 
5 non-polymer syn GLYCEROL                                        92.094    5  ?        ? ? ? 
6 non-polymer syn 'DI(HYDROXYETHYL)ETHER'                         106.120   2  ?        ? ? ? 
7 water       nat water                                           18.015    99 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CCA tRNA nucleotidyltransferase,tRNA CCA-pyrophosphorylase,tRNA adenylyl-/cytidylyl- transferase,tRNA nucleotidyltransferase,tRNA-NT
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSVDKLAAALEHHHHHH
;
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKDSNSSSVDKLAAALEHHHHHH
;
A,C,E,F ? 
2 polyribonucleotide no no GGCGCUGCGGGGUUCGAGUCCCCGCAGUGUUGCCACC GGCGCUGCGGGGUUCGAGUCCCCGCAGUGUUGCCACC B,D,G   ? 
3 polyribonucleotide no no GG GG H       ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   GLU n 
1 5   GLU n 
1 6   ILE n 
1 7   LEU n 
1 8   GLU n 
1 9   LYS n 
1 10  ALA n 
1 11  LEU n 
1 12  GLU n 
1 13  LEU n 
1 14  VAL n 
1 15  ILE n 
1 16  PRO n 
1 17  ASP n 
1 18  GLU n 
1 19  GLU n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  LYS n 
1 24  GLY n 
1 25  ARG n 
1 26  GLU n 
1 27  ALA n 
1 28  GLU n 
1 29  GLU n 
1 30  GLU n 
1 31  LEU n 
1 32  ARG n 
1 33  ARG n 
1 34  ARG n 
1 35  LEU n 
1 36  ASP n 
1 37  GLU n 
1 38  LEU n 
1 39  GLY n 
1 40  VAL n 
1 41  GLU n 
1 42  TYR n 
1 43  VAL n 
1 44  PHE n 
1 45  VAL n 
1 46  GLY n 
1 47  SER n 
1 48  TYR n 
1 49  ALA n 
1 50  ARG n 
1 51  ASN n 
1 52  THR n 
1 53  TRP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLY n 
1 57  SER n 
1 58  LEU n 
1 59  GLU n 
1 60  ILE n 
1 61  ASP n 
1 62  VAL n 
1 63  PHE n 
1 64  LEU n 
1 65  LEU n 
1 66  PHE n 
1 67  PRO n 
1 68  GLU n 
1 69  GLU n 
1 70  PHE n 
1 71  SER n 
1 72  LYS n 
1 73  GLU n 
1 74  GLU n 
1 75  LEU n 
1 76  ARG n 
1 77  GLU n 
1 78  ARG n 
1 79  GLY n 
1 80  LEU n 
1 81  GLU n 
1 82  ILE n 
1 83  GLY n 
1 84  LYS n 
1 85  ALA n 
1 86  VAL n 
1 87  LEU n 
1 88  ASP n 
1 89  SER n 
1 90  TYR n 
1 91  GLU n 
1 92  ILE n 
1 93  ARG n 
1 94  TYR n 
1 95  ALA n 
1 96  GLU n 
1 97  HIS n 
1 98  PRO n 
1 99  TYR n 
1 100 VAL n 
1 101 HIS n 
1 102 GLY n 
1 103 VAL n 
1 104 VAL n 
1 105 LYS n 
1 106 GLY n 
1 107 VAL n 
1 108 GLU n 
1 109 VAL n 
1 110 ASP n 
1 111 VAL n 
1 112 VAL n 
1 113 PRO n 
1 114 CYS n 
1 115 TYR n 
1 116 LYS n 
1 117 LEU n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 LYS n 
1 122 ASN n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 ALA n 
1 127 VAL n 
1 128 ASP n 
1 129 ARG n 
1 130 THR n 
1 131 PRO n 
1 132 PHE n 
1 133 HIS n 
1 134 HIS n 
1 135 LYS n 
1 136 TRP n 
1 137 LEU n 
1 138 GLU n 
1 139 GLY n 
1 140 ARG n 
1 141 ILE n 
1 142 LYS n 
1 143 GLY n 
1 144 LYS n 
1 145 GLU n 
1 146 ASN n 
1 147 GLU n 
1 148 VAL n 
1 149 ARG n 
1 150 LEU n 
1 151 LEU n 
1 152 LYS n 
1 153 GLY n 
1 154 PHE n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ASN n 
1 159 GLY n 
1 160 ILE n 
1 161 TYR n 
1 162 GLY n 
1 163 ALA n 
1 164 GLU n 
1 165 TYR n 
1 166 LYS n 
1 167 VAL n 
1 168 ARG n 
1 169 GLY n 
1 170 PHE n 
1 171 SER n 
1 172 GLY n 
1 173 TYR n 
1 174 LEU n 
1 175 CYS n 
1 176 GLU n 
1 177 LEU n 
1 178 LEU n 
1 179 ILE n 
1 180 VAL n 
1 181 PHE n 
1 182 TYR n 
1 183 GLY n 
1 184 SER n 
1 185 PHE n 
1 186 LEU n 
1 187 GLU n 
1 188 THR n 
1 189 VAL n 
1 190 LYS n 
1 191 ASN n 
1 192 ALA n 
1 193 ARG n 
1 194 ARG n 
1 195 TRP n 
1 196 THR n 
1 197 ARG n 
1 198 ARG n 
1 199 THR n 
1 200 VAL n 
1 201 ILE n 
1 202 ASP n 
1 203 VAL n 
1 204 ALA n 
1 205 LYS n 
1 206 GLY n 
1 207 GLU n 
1 208 VAL n 
1 209 ARG n 
1 210 LYS n 
1 211 GLY n 
1 212 GLU n 
1 213 GLU n 
1 214 PHE n 
1 215 PHE n 
1 216 VAL n 
1 217 VAL n 
1 218 ASP n 
1 219 PRO n 
1 220 VAL n 
1 221 ASP n 
1 222 GLU n 
1 223 LYS n 
1 224 ARG n 
1 225 ASN n 
1 226 VAL n 
1 227 ALA n 
1 228 ALA n 
1 229 ASN n 
1 230 LEU n 
1 231 SER n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 LEU n 
1 236 ALA n 
1 237 ARG n 
1 238 PHE n 
1 239 VAL n 
1 240 HIS n 
1 241 LEU n 
1 242 CYS n 
1 243 ARG n 
1 244 GLU n 
1 245 PHE n 
1 246 MET n 
1 247 GLU n 
1 248 ALA n 
1 249 PRO n 
1 250 SER n 
1 251 LEU n 
1 252 GLY n 
1 253 PHE n 
1 254 PHE n 
1 255 LYS n 
1 256 PRO n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 LEU n 
1 261 GLU n 
1 262 ILE n 
1 263 GLU n 
1 264 PRO n 
1 265 GLU n 
1 266 ARG n 
1 267 LEU n 
1 268 ARG n 
1 269 LYS n 
1 270 ILE n 
1 271 VAL n 
1 272 GLU n 
1 273 GLU n 
1 274 ARG n 
1 275 GLY n 
1 276 THR n 
1 277 ALA n 
1 278 VAL n 
1 279 PHE n 
1 280 ALA n 
1 281 VAL n 
1 282 LYS n 
1 283 PHE n 
1 284 ARG n 
1 285 LYS n 
1 286 PRO n 
1 287 ASP n 
1 288 ILE n 
1 289 VAL n 
1 290 ASP n 
1 291 ASP n 
1 292 ASN n 
1 293 LEU n 
1 294 TYR n 
1 295 PRO n 
1 296 GLN n 
1 297 LEU n 
1 298 GLU n 
1 299 ARG n 
1 300 ALA n 
1 301 SER n 
1 302 ARG n 
1 303 LYS n 
1 304 ILE n 
1 305 PHE n 
1 306 GLU n 
1 307 PHE n 
1 308 LEU n 
1 309 GLU n 
1 310 ARG n 
1 311 GLU n 
1 312 ASN n 
1 313 PHE n 
1 314 MET n 
1 315 PRO n 
1 316 LEU n 
1 317 ARG n 
1 318 SER n 
1 319 ALA n 
1 320 PHE n 
1 321 LYS n 
1 322 ALA n 
1 323 SER n 
1 324 GLU n 
1 325 GLU n 
1 326 PHE n 
1 327 CYS n 
1 328 TYR n 
1 329 LEU n 
1 330 LEU n 
1 331 PHE n 
1 332 GLU n 
1 333 CYS n 
1 334 GLN n 
1 335 ILE n 
1 336 LYS n 
1 337 GLU n 
1 338 ILE n 
1 339 SER n 
1 340 ARG n 
1 341 VAL n 
1 342 PHE n 
1 343 ARG n 
1 344 ARG n 
1 345 MET n 
1 346 GLY n 
1 347 PRO n 
1 348 GLN n 
1 349 PHE n 
1 350 GLU n 
1 351 ASP n 
1 352 GLU n 
1 353 ARG n 
1 354 ASN n 
1 355 VAL n 
1 356 LYS n 
1 357 LYS n 
1 358 PHE n 
1 359 LEU n 
1 360 SER n 
1 361 ARG n 
1 362 ASN n 
1 363 ARG n 
1 364 ALA n 
1 365 PHE n 
1 366 ARG n 
1 367 PRO n 
1 368 PHE n 
1 369 ILE n 
1 370 GLU n 
1 371 ASN n 
1 372 GLY n 
1 373 ARG n 
1 374 TRP n 
1 375 TRP n 
1 376 ALA n 
1 377 PHE n 
1 378 GLU n 
1 379 MET n 
1 380 ARG n 
1 381 LYS n 
1 382 PHE n 
1 383 THR n 
1 384 THR n 
1 385 PRO n 
1 386 GLU n 
1 387 GLU n 
1 388 GLY n 
1 389 VAL n 
1 390 ARG n 
1 391 SER n 
1 392 TYR n 
1 393 ALA n 
1 394 SER n 
1 395 THR n 
1 396 HIS n 
1 397 TRP n 
1 398 HIS n 
1 399 THR n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 ASN n 
1 404 VAL n 
1 405 GLY n 
1 406 GLU n 
1 407 SER n 
1 408 ILE n 
1 409 ARG n 
1 410 GLU n 
1 411 TYR n 
1 412 PHE n 
1 413 GLU n 
1 414 ILE n 
1 415 ILE n 
1 416 SER n 
1 417 GLY n 
1 418 GLU n 
1 419 LYS n 
1 420 LEU n 
1 421 PHE n 
1 422 LYS n 
1 423 GLU n 
1 424 PRO n 
1 425 VAL n 
1 426 THR n 
1 427 ALA n 
1 428 GLU n 
1 429 LEU n 
1 430 CYS n 
1 431 GLU n 
1 432 MET n 
1 433 MET n 
1 434 GLY n 
1 435 VAL n 
1 436 LYS n 
1 437 ASP n 
1 438 SER n 
1 439 ASN n 
1 440 SER n 
1 441 SER n 
1 442 SER n 
1 443 VAL n 
1 444 ASP n 
1 445 LYS n 
1 446 LEU n 
1 447 ALA n 
1 448 ALA n 
1 449 ALA n 
1 450 LEU n 
1 451 GLU n 
1 452 HIS n 
1 453 HIS n 
1 454 HIS n 
1 455 HIS n 
1 456 HIS n 
1 457 HIS n 
2 1   G   n 
2 2   G   n 
2 3   C   n 
2 4   G   n 
2 5   C   n 
2 6   U   n 
2 7   G   n 
2 8   C   n 
2 9   G   n 
2 10  G   n 
2 11  G   n 
2 12  G   n 
2 13  U   n 
2 14  U   n 
2 15  C   n 
2 16  G   n 
2 17  A   n 
2 18  G   n 
2 19  U   n 
2 20  C   n 
2 21  C   n 
2 22  C   n 
2 23  C   n 
2 24  G   n 
2 25  C   n 
2 26  A   n 
2 27  G   n 
2 28  U   n 
2 29  G   n 
2 30  U   n 
2 31  U   n 
2 32  G   n 
2 33  C   n 
2 34  C   n 
2 35  A   n 
2 36  C   n 
2 37  C   n 
3 1   G   n 
3 2   G   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   457 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'cca, AF_2156' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Archaeoglobus fulgidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     224325 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)RIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET22 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 37 'Homo sapiens' ? 9606 ? 
3 1 sample 1 2  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CCA_ARCFU O28126 ? 1 
;MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGL
EIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGI
YGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVH
LCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAF
KASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD
;
1 
2 PDB 4X4U      4X4U   ? 2 ? 1 
3 PDB 4X4U      4X4U   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4X4U A 1 ? 437 ? O28126 1 ? 437 ? 1 437 
2 2 4X4U B 1 ? 37  ? 4X4U   1 ? 37  ? 1 37  
3 1 4X4U C 1 ? 437 ? O28126 1 ? 437 ? 1 437 
4 2 4X4U D 1 ? 37  ? 4X4U   1 ? 37  ? 1 37  
5 1 4X4U E 1 ? 437 ? O28126 1 ? 437 ? 1 437 
6 1 4X4U F 1 ? 437 ? O28126 1 ? 437 ? 1 437 
7 2 4X4U G 1 ? 37  ? 4X4U   1 ? 37  ? 1 37  
8 3 4X4U H 1 ? 2   ? 4X4U   1 ? 2   ? 1 2   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X4U SER A 438 ? UNP O28126 ? ? 'expression tag' 438 1  
1 4X4U ASN A 439 ? UNP O28126 ? ? 'expression tag' 439 2  
1 4X4U SER A 440 ? UNP O28126 ? ? 'expression tag' 440 3  
1 4X4U SER A 441 ? UNP O28126 ? ? 'expression tag' 441 4  
1 4X4U SER A 442 ? UNP O28126 ? ? 'expression tag' 442 5  
1 4X4U VAL A 443 ? UNP O28126 ? ? 'expression tag' 443 6  
1 4X4U ASP A 444 ? UNP O28126 ? ? 'expression tag' 444 7  
1 4X4U LYS A 445 ? UNP O28126 ? ? 'expression tag' 445 8  
1 4X4U LEU A 446 ? UNP O28126 ? ? 'expression tag' 446 9  
1 4X4U ALA A 447 ? UNP O28126 ? ? 'expression tag' 447 10 
1 4X4U ALA A 448 ? UNP O28126 ? ? 'expression tag' 448 11 
1 4X4U ALA A 449 ? UNP O28126 ? ? 'expression tag' 449 12 
1 4X4U LEU A 450 ? UNP O28126 ? ? 'expression tag' 450 13 
1 4X4U GLU A 451 ? UNP O28126 ? ? 'expression tag' 451 14 
1 4X4U HIS A 452 ? UNP O28126 ? ? 'expression tag' 452 15 
1 4X4U HIS A 453 ? UNP O28126 ? ? 'expression tag' 453 16 
1 4X4U HIS A 454 ? UNP O28126 ? ? 'expression tag' 454 17 
1 4X4U HIS A 455 ? UNP O28126 ? ? 'expression tag' 455 18 
1 4X4U HIS A 456 ? UNP O28126 ? ? 'expression tag' 456 19 
1 4X4U HIS A 457 ? UNP O28126 ? ? 'expression tag' 457 20 
3 4X4U SER C 438 ? UNP O28126 ? ? 'expression tag' 438 21 
3 4X4U ASN C 439 ? UNP O28126 ? ? 'expression tag' 439 22 
3 4X4U SER C 440 ? UNP O28126 ? ? 'expression tag' 440 23 
3 4X4U SER C 441 ? UNP O28126 ? ? 'expression tag' 441 24 
3 4X4U SER C 442 ? UNP O28126 ? ? 'expression tag' 442 25 
3 4X4U VAL C 443 ? UNP O28126 ? ? 'expression tag' 443 26 
3 4X4U ASP C 444 ? UNP O28126 ? ? 'expression tag' 444 27 
3 4X4U LYS C 445 ? UNP O28126 ? ? 'expression tag' 445 28 
3 4X4U LEU C 446 ? UNP O28126 ? ? 'expression tag' 446 29 
3 4X4U ALA C 447 ? UNP O28126 ? ? 'expression tag' 447 30 
3 4X4U ALA C 448 ? UNP O28126 ? ? 'expression tag' 448 31 
3 4X4U ALA C 449 ? UNP O28126 ? ? 'expression tag' 449 32 
3 4X4U LEU C 450 ? UNP O28126 ? ? 'expression tag' 450 33 
3 4X4U GLU C 451 ? UNP O28126 ? ? 'expression tag' 451 34 
3 4X4U HIS C 452 ? UNP O28126 ? ? 'expression tag' 452 35 
3 4X4U HIS C 453 ? UNP O28126 ? ? 'expression tag' 453 36 
3 4X4U HIS C 454 ? UNP O28126 ? ? 'expression tag' 454 37 
3 4X4U HIS C 455 ? UNP O28126 ? ? 'expression tag' 455 38 
3 4X4U HIS C 456 ? UNP O28126 ? ? 'expression tag' 456 39 
3 4X4U HIS C 457 ? UNP O28126 ? ? 'expression tag' 457 40 
5 4X4U SER E 438 ? UNP O28126 ? ? 'expression tag' 438 41 
5 4X4U ASN E 439 ? UNP O28126 ? ? 'expression tag' 439 42 
5 4X4U SER E 440 ? UNP O28126 ? ? 'expression tag' 440 43 
5 4X4U SER E 441 ? UNP O28126 ? ? 'expression tag' 441 44 
5 4X4U SER E 442 ? UNP O28126 ? ? 'expression tag' 442 45 
5 4X4U VAL E 443 ? UNP O28126 ? ? 'expression tag' 443 46 
5 4X4U ASP E 444 ? UNP O28126 ? ? 'expression tag' 444 47 
5 4X4U LYS E 445 ? UNP O28126 ? ? 'expression tag' 445 48 
5 4X4U LEU E 446 ? UNP O28126 ? ? 'expression tag' 446 49 
5 4X4U ALA E 447 ? UNP O28126 ? ? 'expression tag' 447 50 
5 4X4U ALA E 448 ? UNP O28126 ? ? 'expression tag' 448 51 
5 4X4U ALA E 449 ? UNP O28126 ? ? 'expression tag' 449 52 
5 4X4U LEU E 450 ? UNP O28126 ? ? 'expression tag' 450 53 
5 4X4U GLU E 451 ? UNP O28126 ? ? 'expression tag' 451 54 
5 4X4U HIS E 452 ? UNP O28126 ? ? 'expression tag' 452 55 
5 4X4U HIS E 453 ? UNP O28126 ? ? 'expression tag' 453 56 
5 4X4U HIS E 454 ? UNP O28126 ? ? 'expression tag' 454 57 
5 4X4U HIS E 455 ? UNP O28126 ? ? 'expression tag' 455 58 
5 4X4U HIS E 456 ? UNP O28126 ? ? 'expression tag' 456 59 
5 4X4U HIS E 457 ? UNP O28126 ? ? 'expression tag' 457 60 
6 4X4U SER F 438 ? UNP O28126 ? ? 'expression tag' 438 61 
6 4X4U ASN F 439 ? UNP O28126 ? ? 'expression tag' 439 62 
6 4X4U SER F 440 ? UNP O28126 ? ? 'expression tag' 440 63 
6 4X4U SER F 441 ? UNP O28126 ? ? 'expression tag' 441 64 
6 4X4U SER F 442 ? UNP O28126 ? ? 'expression tag' 442 65 
6 4X4U VAL F 443 ? UNP O28126 ? ? 'expression tag' 443 66 
6 4X4U ASP F 444 ? UNP O28126 ? ? 'expression tag' 444 67 
6 4X4U LYS F 445 ? UNP O28126 ? ? 'expression tag' 445 68 
6 4X4U LEU F 446 ? UNP O28126 ? ? 'expression tag' 446 69 
6 4X4U ALA F 447 ? UNP O28126 ? ? 'expression tag' 447 70 
6 4X4U ALA F 448 ? UNP O28126 ? ? 'expression tag' 448 71 
6 4X4U ALA F 449 ? UNP O28126 ? ? 'expression tag' 449 72 
6 4X4U LEU F 450 ? UNP O28126 ? ? 'expression tag' 450 73 
6 4X4U GLU F 451 ? UNP O28126 ? ? 'expression tag' 451 74 
6 4X4U HIS F 452 ? UNP O28126 ? ? 'expression tag' 452 75 
6 4X4U HIS F 453 ? UNP O28126 ? ? 'expression tag' 453 76 
6 4X4U HIS F 454 ? UNP O28126 ? ? 'expression tag' 454 77 
6 4X4U HIS F 455 ? UNP O28126 ? ? 'expression tag' 455 78 
6 4X4U HIS F 456 ? UNP O28126 ? ? 'expression tag' 456 79 
6 4X4U HIS F 457 ? UNP O28126 ? ? 'expression tag' 457 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ?                                               
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                                        'GLYCERIN; PROPANE-1,2,3-TRIOL'                 
'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ?                                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                         ?                                               
'C4 H10 O3'         106.120 
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ?                                               
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X4U 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.54 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.54 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '18.9% PEG3350, 0.27M NaK tartrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-05-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            65.200 
_reflns.entry_id                         4X4U 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.700 
_reflns.d_resolution_low                 30.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       68272 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.800 
_reflns.pdbx_Rmerge_I_obs                0.075 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         15.120 
_reflns.pdbx_netI_over_sigmaI            8.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.091 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         191792 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.700 2.750  ? ? ? ? ? 3189 ? 92.800 ? ? ? ? 0.367 ? ? ? ? ? ? ? ? 2.500 ? 0.586 ? ? ? ? 0 1  1 ? ? 
2.750 2.800  ? ? ? ? ? 3418 ? 98.400 ? ? ? ? 0.343 ? ? ? ? ? ? ? ? 2.800 ? 0.600 ? ? ? ? 0 2  1 ? ? 
2.800 2.850  ? ? ? ? ? 3418 ? 98.400 ? ? ? ? 0.312 ? ? ? ? ? ? ? ? 2.900 ? 0.606 ? ? ? ? 0 3  1 ? ? 
2.850 2.910  ? ? ? ? ? 3452 ? 98.100 ? ? ? ? 0.272 ? ? ? ? ? ? ? ? 2.900 ? 0.651 ? ? ? ? 0 4  1 ? ? 
2.910 2.970  ? ? ? ? ? 3369 ? 97.900 ? ? ? ? 0.220 ? ? ? ? ? ? ? ? 2.800 ? 0.708 ? ? ? ? 0 5  1 ? ? 
2.970 3.040  ? ? ? ? ? 3410 ? 98.300 ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 2.700 ? 0.758 ? ? ? ? 0 6  1 ? ? 
3.040 3.120  ? ? ? ? ? 3453 ? 98.600 ? ? ? ? 0.159 ? ? ? ? ? ? ? ? 2.900 ? 0.813 ? ? ? ? 0 7  1 ? ? 
3.120 3.200  ? ? ? ? ? 3417 ? 98.500 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 2.800 ? 0.848 ? ? ? ? 0 8  1 ? ? 
3.200 3.290  ? ? ? ? ? 3404 ? 98.300 ? ? ? ? 0.118 ? ? ? ? ? ? ? ? 2.800 ? 0.994 ? ? ? ? 0 9  1 ? ? 
3.290 3.400  ? ? ? ? ? 3457 ? 98.000 ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 2.800 ? 1.182 ? ? ? ? 0 10 1 ? ? 
3.400 3.520  ? ? ? ? ? 3385 ? 97.800 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 2.900 ? 1.317 ? ? ? ? 0 11 1 ? ? 
3.520 3.660  ? ? ? ? ? 3415 ? 97.700 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 2.900 ? 1.390 ? ? ? ? 0 12 1 ? ? 
3.660 3.830  ? ? ? ? ? 3407 ? 97.700 ? ? ? ? 0.082 ? ? ? ? ? ? ? ? 2.700 ? 1.459 ? ? ? ? 0 13 1 ? ? 
3.830 4.030  ? ? ? ? ? 3426 ? 98.100 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 2.900 ? 1.518 ? ? ? ? 0 14 1 ? ? 
4.030 4.280  ? ? ? ? ? 3415 ? 98.000 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 2.800 ? 1.418 ? ? ? ? 0 15 1 ? ? 
4.280 4.610  ? ? ? ? ? 3441 ? 97.500 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 2.900 ? 1.443 ? ? ? ? 0 16 1 ? ? 
4.610 5.070  ? ? ? ? ? 3410 ? 97.400 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 2.800 ? 1.470 ? ? ? ? 0 17 1 ? ? 
5.070 5.800  ? ? ? ? ? 3458 ? 98.300 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 2.900 ? 1.355 ? ? ? ? 0 18 1 ? ? 
5.800 7.300  ? ? ? ? ? 3449 ? 97.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 2.800 ? 1.276 ? ? ? ? 0 19 1 ? ? 
7.300 30.000 ? ? ? ? ? 3479 ? 95.600 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 2.800 ? 1.268 ? ? ? ? 0 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                534.480 
_refine.B_iso_mean                               84.5900 
_refine.B_iso_min                                29.100 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4X4U 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.7000 
_refine.ls_d_res_low                             29.7930 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     67874 
_refine.ls_number_reflns_R_free                  3410 
_refine.ls_number_reflns_R_work                  64464 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.8700 
_refine.ls_percent_reflns_R_free                 5.0200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1853 
_refine.ls_R_factor_R_free                       0.2334 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1827 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.4000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8293 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.7000 
_refine_hist.d_res_low                        29.7930 
_refine_hist.pdbx_number_atoms_ligand         262 
_refine_hist.number_atoms_solvent             99 
_refine_hist.number_atoms_total               16502 
_refine_hist.pdbx_number_residues_total       1820 
_refine_hist.pdbx_B_iso_mean_ligand           118.12 
_refine_hist.pdbx_B_iso_mean_solvent          57.19 
_refine_hist.pdbx_number_atoms_protein        14497 
_refine_hist.pdbx_number_atoms_nucleic_acid   1644 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 16766 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.805  ? 22914 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 2460  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 2672  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 12.288 ? 6677  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7000 2.7386  2812 . 141 2671 98.0000 . . . 0.2988 . 0.2408 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.7386 2.7794  2815 . 143 2672 98.0000 . . . 0.2983 . 0.2299 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.7794 2.8228  2821 . 137 2684 98.0000 . . . 0.2911 . 0.2385 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.8228 2.8690  2841 . 145 2696 99.0000 . . . 0.3172 . 0.2387 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.8690 2.9185  2793 . 139 2654 98.0000 . . . 0.2999 . 0.2353 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.9185 2.9715  2808 . 138 2670 98.0000 . . . 0.2869 . 0.2318 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 2.9715 3.0286  2846 . 142 2704 98.0000 . . . 0.2590 . 0.2328 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.0286 3.0904  2820 . 149 2671 98.0000 . . . 0.3124 . 0.2221 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.0904 3.1575  2823 . 134 2689 99.0000 . . . 0.2862 . 0.2143 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.1575 3.2308  2869 . 149 2720 98.0000 . . . 0.2739 . 0.2086 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.2308 3.3115  2794 . 135 2659 98.0000 . . . 0.2364 . 0.2090 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.3115 3.4010  2857 . 144 2713 98.0000 . . . 0.2583 . 0.2042 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.4010 3.5009  2786 . 144 2642 98.0000 . . . 0.2814 . 0.2044 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.5009 3.6137  2807 . 137 2670 98.0000 . . . 0.2560 . 0.1912 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.6137 3.7426  2821 . 143 2678 98.0000 . . . 0.2328 . 0.1858 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.7426 3.8922  2826 . 142 2684 98.0000 . . . 0.2047 . 0.1670 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 3.8922 4.0689  2847 . 145 2702 98.0000 . . . 0.2179 . 0.1701 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 4.0689 4.2828  2818 . 141 2677 98.0000 . . . 0.2214 . 0.1595 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 4.2828 4.5503  2836 . 140 2696 98.0000 . . . 0.2058 . 0.1518 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 4.5503 4.9002  2822 . 148 2674 97.0000 . . . 0.2062 . 0.1401 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 4.9002 5.3907  2853 . 145 2708 98.0000 . . . 0.1985 . 0.1541 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 5.3907 6.1647  2865 . 144 2721 98.0000 . . . 0.2221 . 0.1766 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 6.1647 7.7442  2828 . 141 2687 97.0000 . . . 0.2122 . 0.1860 . . . . . . 24 . . . 
'X-RAY DIFFRACTION' 7.7442 29.7949 2866 . 144 2722 95.0000 . . . 0.2179 . 0.1803 . . . . . . 24 . . . 
# 
_struct.entry_id                     4X4U 
_struct.title                        
'Crystal structure of the A.fulgidus CCA-adding enzyme in complex with a human MenBeta minihelix ending in CCACC' 
_struct.pdbx_descriptor              'A.fulgidus CCA-adding enzyme/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X4U 
_struct_keywords.text            
'protein-RNA complex, tRNA, non-coding RNA, CCA-adding enzyme, nucleotidyltransferase, ncRNA, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 5 ? 
O N N 6 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
V N N 7 ? 
W N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 2   ? LEU A 11  ? LYS A 2   LEU A 11  1 ? 10 
HELX_P HELX_P2  AA2 ASP A 17  ? GLY A 39  ? ASP A 17  GLY A 39  1 ? 23 
HELX_P HELX_P3  AA3 LEU A 75  ? LEU A 87  ? LEU A 75  LEU A 87  1 ? 13 
HELX_P HELX_P4  AA4 ARG A 129 ? GLU A 138 ? ARG A 129 GLU A 138 1 ? 10 
HELX_P HELX_P5  AA5 LYS A 144 ? ALA A 157 ? LYS A 144 ALA A 157 1 ? 14 
HELX_P HELX_P6  AA6 SER A 171 ? GLY A 183 ? SER A 171 GLY A 183 1 ? 13 
HELX_P HELX_P7  AA7 SER A 184 ? ARG A 193 ? SER A 184 ARG A 193 1 ? 10 
HELX_P HELX_P8  AA8 SER A 231 ? ALA A 248 ? SER A 231 ALA A 248 1 ? 18 
HELX_P HELX_P9  AA9 SER A 250 ? LYS A 255 ? SER A 250 LYS A 255 5 ? 6  
HELX_P HELX_P10 AB1 GLU A 263 ? GLY A 275 ? GLU A 263 GLY A 275 1 ? 13 
HELX_P HELX_P11 AB2 VAL A 289 ? GLU A 311 ? VAL A 289 GLU A 311 1 ? 23 
HELX_P HELX_P12 AB3 ASP A 351 ? ARG A 361 ? ASP A 351 ARG A 361 1 ? 11 
HELX_P HELX_P13 AB4 THR A 384 ? HIS A 396 ? THR A 384 HIS A 396 1 ? 13 
HELX_P HELX_P14 AB5 TRP A 397 ? LEU A 400 ? TRP A 397 LEU A 400 5 ? 4  
HELX_P HELX_P15 AB6 GLY A 401 ? TYR A 411 ? GLY A 401 TYR A 411 1 ? 11 
HELX_P HELX_P16 AB7 GLY A 417 ? PHE A 421 ? GLY A 417 PHE A 421 1 ? 5  
HELX_P HELX_P17 AB8 VAL A 425 ? GLY A 434 ? VAL A 425 GLY A 434 1 ? 10 
HELX_P HELX_P18 AB9 LYS C 2   ? LEU C 11  ? LYS C 2   LEU C 11  1 ? 10 
HELX_P HELX_P19 AC1 ASP C 17  ? ASP C 36  ? ASP C 17  ASP C 36  1 ? 20 
HELX_P HELX_P20 AC2 GLY C 46  ? ARG C 50  ? GLY C 46  ARG C 50  1 ? 5  
HELX_P HELX_P21 AC3 GLU C 73  ? GLU C 77  ? GLU C 73  GLU C 77  5 ? 5  
HELX_P HELX_P22 AC4 ARG C 78  ? VAL C 86  ? ARG C 78  VAL C 86  1 ? 9  
HELX_P HELX_P23 AC5 ARG C 129 ? GLU C 138 ? ARG C 129 GLU C 138 1 ? 10 
HELX_P HELX_P24 AC6 LYS C 144 ? ALA C 157 ? LYS C 144 ALA C 157 1 ? 14 
HELX_P HELX_P25 AC7 SER C 171 ? GLY C 183 ? SER C 171 GLY C 183 1 ? 13 
HELX_P HELX_P26 AC8 SER C 184 ? ARG C 193 ? SER C 184 ARG C 193 1 ? 10 
HELX_P HELX_P27 AC9 SER C 231 ? ALA C 248 ? SER C 231 ALA C 248 1 ? 18 
HELX_P HELX_P28 AD1 SER C 250 ? LYS C 255 ? SER C 250 LYS C 255 5 ? 6  
HELX_P HELX_P29 AD2 GLU C 263 ? GLY C 275 ? GLU C 263 GLY C 275 1 ? 13 
HELX_P HELX_P30 AD3 VAL C 289 ? GLU C 311 ? VAL C 289 GLU C 311 1 ? 23 
HELX_P HELX_P31 AD4 ASP C 351 ? ARG C 361 ? ASP C 351 ARG C 361 1 ? 11 
HELX_P HELX_P32 AD5 THR C 384 ? HIS C 396 ? THR C 384 HIS C 396 1 ? 13 
HELX_P HELX_P33 AD6 TRP C 397 ? GLY C 401 ? TRP C 397 GLY C 401 5 ? 5  
HELX_P HELX_P34 AD7 LYS C 402 ? TYR C 411 ? LYS C 402 TYR C 411 1 ? 10 
HELX_P HELX_P35 AD8 GLY C 417 ? PHE C 421 ? GLY C 417 PHE C 421 1 ? 5  
HELX_P HELX_P36 AD9 VAL C 425 ? MET C 433 ? VAL C 425 MET C 433 1 ? 9  
HELX_P HELX_P37 AE1 LYS E 2   ? LEU E 11  ? LYS E 2   LEU E 11  1 ? 10 
HELX_P HELX_P38 AE2 GLU E 12  ? VAL E 14  ? GLU E 12  VAL E 14  5 ? 3  
HELX_P HELX_P39 AE3 ASP E 17  ? LEU E 38  ? ASP E 17  LEU E 38  1 ? 22 
HELX_P HELX_P40 AE4 GLY E 46  ? ASN E 51  ? GLY E 46  ASN E 51  1 ? 6  
HELX_P HELX_P41 AE5 SER E 71  ? LEU E 87  ? SER E 71  LEU E 87  1 ? 17 
HELX_P HELX_P42 AE6 GLU E 119 ? ILE E 123 ? GLU E 119 ILE E 123 5 ? 5  
HELX_P HELX_P43 AE7 ALA E 126 ? ASP E 128 ? ALA E 126 ASP E 128 5 ? 3  
HELX_P HELX_P44 AE8 ARG E 129 ? ILE E 141 ? ARG E 129 ILE E 141 1 ? 13 
HELX_P HELX_P45 AE9 LYS E 144 ? ASN E 158 ? LYS E 144 ASN E 158 1 ? 15 
HELX_P HELX_P46 AF1 SER E 171 ? GLY E 183 ? SER E 171 GLY E 183 1 ? 13 
HELX_P HELX_P47 AF2 SER E 184 ? ARG E 193 ? SER E 184 ARG E 193 1 ? 10 
HELX_P HELX_P48 AF3 SER E 231 ? ALA E 248 ? SER E 231 ALA E 248 1 ? 18 
HELX_P HELX_P49 AF4 SER E 250 ? LYS E 255 ? SER E 250 LYS E 255 5 ? 6  
HELX_P HELX_P50 AF5 GLU E 263 ? GLY E 275 ? GLU E 263 GLY E 275 1 ? 13 
HELX_P HELX_P51 AF6 VAL E 289 ? GLU E 311 ? VAL E 289 GLU E 311 1 ? 23 
HELX_P HELX_P52 AF7 ASP E 351 ? ARG E 361 ? ASP E 351 ARG E 361 1 ? 11 
HELX_P HELX_P53 AF8 THR E 384 ? HIS E 396 ? THR E 384 HIS E 396 1 ? 13 
HELX_P HELX_P54 AF9 TRP E 397 ? LEU E 400 ? TRP E 397 LEU E 400 5 ? 4  
HELX_P HELX_P55 AG1 GLY E 401 ? TYR E 411 ? GLY E 401 TYR E 411 1 ? 11 
HELX_P HELX_P56 AG2 SER E 416 ? PHE E 421 ? SER E 416 PHE E 421 1 ? 6  
HELX_P HELX_P57 AG3 VAL E 425 ? GLY E 434 ? VAL E 425 GLY E 434 1 ? 10 
HELX_P HELX_P58 AG4 VAL F 3   ? LEU F 13  ? VAL F 3   LEU F 13  1 ? 11 
HELX_P HELX_P59 AG5 ASP F 17  ? GLU F 37  ? ASP F 17  GLU F 37  1 ? 21 
HELX_P HELX_P60 AG6 GLY F 46  ? ASN F 51  ? GLY F 46  ASN F 51  1 ? 6  
HELX_P HELX_P61 AG7 SER F 71  ? LEU F 87  ? SER F 71  LEU F 87  1 ? 17 
HELX_P HELX_P62 AG8 GLU F 119 ? ILE F 123 ? GLU F 119 ILE F 123 5 ? 5  
HELX_P HELX_P63 AG9 ALA F 126 ? ASP F 128 ? ALA F 126 ASP F 128 5 ? 3  
HELX_P HELX_P64 AH1 ARG F 129 ? GLU F 138 ? ARG F 129 GLU F 138 1 ? 10 
HELX_P HELX_P65 AH2 LYS F 144 ? ASN F 158 ? LYS F 144 ASN F 158 1 ? 15 
HELX_P HELX_P66 AH3 SER F 171 ? GLY F 183 ? SER F 171 GLY F 183 1 ? 13 
HELX_P HELX_P67 AH4 SER F 184 ? ARG F 193 ? SER F 184 ARG F 193 1 ? 10 
HELX_P HELX_P68 AH5 SER F 231 ? ALA F 248 ? SER F 231 ALA F 248 1 ? 18 
HELX_P HELX_P69 AH6 SER F 250 ? LYS F 255 ? SER F 250 LYS F 255 5 ? 6  
HELX_P HELX_P70 AH7 GLU F 263 ? GLY F 275 ? GLU F 263 GLY F 275 1 ? 13 
HELX_P HELX_P71 AH8 VAL F 289 ? GLU F 311 ? VAL F 289 GLU F 311 1 ? 23 
HELX_P HELX_P72 AH9 ASP F 351 ? ARG F 361 ? ASP F 351 ARG F 361 1 ? 11 
HELX_P HELX_P73 AI1 THR F 384 ? HIS F 396 ? THR F 384 HIS F 396 1 ? 13 
HELX_P HELX_P74 AI2 TRP F 397 ? LEU F 400 ? TRP F 397 LEU F 400 5 ? 4  
HELX_P HELX_P75 AI3 GLY F 401 ? TYR F 411 ? GLY F 401 TYR F 411 1 ? 11 
HELX_P HELX_P76 AI4 GLU F 418 ? LEU F 420 ? GLU F 418 LEU F 420 5 ? 3  
HELX_P HELX_P77 AI5 VAL F 425 ? GLY F 434 ? VAL F 425 GLY F 434 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B G 2  N1 ? ? ? 1_555 B C 33 N3 ? ? B G 2  B C 33 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog2  hydrog ? ? B G 2  N2 ? ? ? 1_555 B C 33 O2 ? ? B G 2  B C 33 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog3  hydrog ? ? B G 2  O6 ? ? ? 1_555 B C 33 N4 ? ? B G 2  B C 33 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog4  hydrog ? ? B C 3  N3 ? ? ? 1_555 B G 32 N1 ? ? B C 3  B G 32 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog5  hydrog ? ? B C 3  N4 ? ? ? 1_555 B G 32 O6 ? ? B C 3  B G 32 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog6  hydrog ? ? B C 3  O2 ? ? ? 1_555 B G 32 N2 ? ? B C 3  B G 32 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog7  hydrog ? ? B G 4  N2 ? ? ? 1_555 B U 31 O2 ? ? B G 4  B U 31 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ? ? 
hydrog8  hydrog ? ? B C 8  N3 ? ? ? 1_555 B G 24 N1 ? ? B C 8  B G 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog9  hydrog ? ? B C 8  N4 ? ? ? 1_555 B G 24 O6 ? ? B C 8  B G 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog10 hydrog ? ? B C 8  O2 ? ? ? 1_555 B G 24 N2 ? ? B C 8  B G 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog11 hydrog ? ? B G 9  N1 ? ? ? 1_555 B C 23 N3 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog12 hydrog ? ? B G 9  N2 ? ? ? 1_555 B C 23 O2 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog13 hydrog ? ? B G 9  O6 ? ? ? 1_555 B C 23 N4 ? ? B G 9  B C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog14 hydrog ? ? B G 10 N1 ? ? ? 1_555 B C 22 N3 ? ? B G 10 B C 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog15 hydrog ? ? B G 10 N2 ? ? ? 1_555 B C 22 O2 ? ? B G 10 B C 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog16 hydrog ? ? B G 10 O6 ? ? ? 1_555 B C 22 N4 ? ? B G 10 B C 22 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog17 hydrog ? ? B G 11 N1 ? ? ? 1_555 B C 21 N3 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog18 hydrog ? ? B G 11 N2 ? ? ? 1_555 B C 21 O2 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog19 hydrog ? ? B G 11 O6 ? ? ? 1_555 B C 21 N4 ? ? B G 11 B C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog20 hydrog ? ? B G 12 N1 ? ? ? 1_555 B C 20 N3 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog21 hydrog ? ? B G 12 N2 ? ? ? 1_555 B C 20 O2 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog22 hydrog ? ? B G 12 O6 ? ? ? 1_555 B C 20 N4 ? ? B G 12 B C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog23 hydrog ? ? B U 13 N3 ? ? ? 1_555 B A 17 N7 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog24 hydrog ? ? B U 13 O2 ? ? ? 1_555 B A 17 N6 ? ? B U 13 B A 17 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ? ? 
hydrog25 hydrog ? ? B C 15 N4 ? ? ? 1_555 H G 1  O6 ? ? B C 15 H G 1  1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog26 hydrog ? ? B C 15 O2 ? ? ? 1_555 H G 1  N1 ? ? B C 15 H G 1  1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog27 hydrog ? ? D G 1  N1 ? ? ? 1_555 D C 34 N3 ? ? D G 1  D C 34 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog28 hydrog ? ? D G 1  N2 ? ? ? 1_555 D C 34 O2 ? ? D G 1  D C 34 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog29 hydrog ? ? D G 1  O6 ? ? ? 1_555 D C 34 N4 ? ? D G 1  D C 34 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog30 hydrog ? ? D G 2  N1 ? ? ? 1_555 D C 33 N3 ? ? D G 2  D C 33 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog31 hydrog ? ? D G 2  N2 ? ? ? 1_555 D C 33 O2 ? ? D G 2  D C 33 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog32 hydrog ? ? D G 2  O6 ? ? ? 1_555 D C 33 N4 ? ? D G 2  D C 33 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog33 hydrog ? ? D C 3  N3 ? ? ? 1_555 D G 32 N1 ? ? D C 3  D G 32 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog34 hydrog ? ? D C 3  N4 ? ? ? 1_555 D G 32 O6 ? ? D C 3  D G 32 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog35 hydrog ? ? D C 3  O2 ? ? ? 1_555 D G 32 N2 ? ? D C 3  D G 32 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog36 hydrog ? ? D G 4  N2 ? ? ? 1_555 D U 31 O2 ? ? D G 4  D U 31 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ? ? 
hydrog37 hydrog ? ? D G 7  N1 ? ? ? 1_555 D C 25 N3 ? ? D G 7  D C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog38 hydrog ? ? D G 7  N2 ? ? ? 1_555 D C 25 O2 ? ? D G 7  D C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog39 hydrog ? ? D G 7  O6 ? ? ? 1_555 D C 25 N4 ? ? D G 7  D C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog40 hydrog ? ? D C 8  N3 ? ? ? 1_555 D G 24 N1 ? ? D C 8  D G 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog41 hydrog ? ? D C 8  N4 ? ? ? 1_555 D G 24 O6 ? ? D C 8  D G 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog42 hydrog ? ? D C 8  O2 ? ? ? 1_555 D G 24 N2 ? ? D C 8  D G 24 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog43 hydrog ? ? D G 9  N1 ? ? ? 1_555 D C 23 N3 ? ? D G 9  D C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog44 hydrog ? ? D G 9  N2 ? ? ? 1_555 D C 23 O2 ? ? D G 9  D C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog45 hydrog ? ? D G 9  O6 ? ? ? 1_555 D C 23 N4 ? ? D G 9  D C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog46 hydrog ? ? D G 10 N1 ? ? ? 1_555 D C 22 O2 ? ? D G 10 D C 22 1_555 ? ? ? ? ? ? 'G-C PAIR'           ? ? 
hydrog47 hydrog ? ? D G 11 N1 ? ? ? 1_555 D C 21 N3 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog48 hydrog ? ? D G 11 N2 ? ? ? 1_555 D C 21 O2 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog49 hydrog ? ? D G 11 O6 ? ? ? 1_555 D C 21 N4 ? ? D G 11 D C 21 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog50 hydrog ? ? D G 12 N1 ? ? ? 1_555 D C 20 N3 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog51 hydrog ? ? D G 12 N2 ? ? ? 1_555 D C 20 O2 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog52 hydrog ? ? D G 12 O6 ? ? ? 1_555 D C 20 N4 ? ? D G 12 D C 20 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog53 hydrog ? ? G G 1  N2 ? ? ? 1_555 G U 31 O2 ? ? G G 1  G U 31 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ? ? 
hydrog54 hydrog ? ? G G 2  N2 ? ? ? 1_555 G U 30 O2 ? ? G G 2  G U 30 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ? ? 
hydrog55 hydrog ? ? G C 3  N3 ? ? ? 1_555 G G 29 N1 ? ? G C 3  G G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog56 hydrog ? ? G C 3  N4 ? ? ? 1_555 G G 29 O6 ? ? G C 3  G G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog57 hydrog ? ? G C 3  O2 ? ? ? 1_555 G G 29 N2 ? ? G C 3  G G 29 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog58 hydrog ? ? G G 4  N1 ? ? ? 1_555 G U 28 O2 ? ? G G 4  G U 28 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog59 hydrog ? ? G G 4  O6 ? ? ? 1_555 G U 28 N3 ? ? G G 4  G U 28 1_555 ? ? ? ? ? ? TYPE_28_PAIR         ? ? 
hydrog60 hydrog ? ? G C 5  N3 ? ? ? 1_555 G G 27 N1 ? ? G C 5  G G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog61 hydrog ? ? G C 5  N4 ? ? ? 1_555 G G 27 O6 ? ? G C 5  G G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog62 hydrog ? ? G C 5  O2 ? ? ? 1_555 G G 27 N2 ? ? G C 5  G G 27 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog63 hydrog ? ? G U 6  N3 ? ? ? 1_555 G A 26 N1 ? ? G U 6  G A 26 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog64 hydrog ? ? G U 6  O4 ? ? ? 1_555 G A 26 N6 ? ? G U 6  G A 26 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog65 hydrog ? ? G G 7  N1 ? ? ? 1_555 G C 25 N3 ? ? G G 7  G C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog66 hydrog ? ? G G 7  N2 ? ? ? 1_555 G C 25 O2 ? ? G G 7  G C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog67 hydrog ? ? G G 7  O6 ? ? ? 1_555 G C 25 N4 ? ? G G 7  G C 25 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog68 hydrog ? ? G C 8  O2 ? ? ? 1_555 G G 24 N2 ? ? G C 8  G G 24 1_555 ? ? ? ? ? ? 'C-G PAIR'           ? ? 
hydrog69 hydrog ? ? G G 9  N1 ? ? ? 1_555 G C 23 N3 ? ? G G 9  G C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog70 hydrog ? ? G G 9  N2 ? ? ? 1_555 G C 23 O2 ? ? G G 9  G C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
hydrog71 hydrog ? ? G G 9  O6 ? ? ? 1_555 G C 23 N4 ? ? G G 9  G C 23 1_555 ? ? ? ? ? ? WATSON-CRICK         ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 5 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 3 ? 
AA9 ? 5 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 3 ? 
AB4 ? 5 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? parallel      
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? parallel      
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? parallel      
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 42  ? VAL A 45  ? TYR A 42  VAL A 45  
AA1 2 ILE A 60  ? PHE A 66  ? ILE A 60  PHE A 66  
AA1 3 VAL A 107 ? TYR A 115 ? VAL A 107 TYR A 115 
AA1 4 TYR A 99  ? VAL A 104 ? TYR A 99  VAL A 104 
AA1 5 GLU A 91  ? ARG A 93  ? GLU A 91  ARG A 93  
AA2 1 GLU A 207 ? LYS A 210 ? GLU A 207 LYS A 210 
AA2 2 THR A 199 ? ASP A 202 ? THR A 199 ASP A 202 
AA2 3 PHE A 215 ? ASP A 218 ? PHE A 215 ASP A 218 
AA2 4 ASP A 221 ? ASN A 225 ? ASP A 221 ASN A 225 
AA3 1 PRO A 315 ? ALA A 322 ? PRO A 315 ALA A 322 
AA3 2 PHE A 326 ? CYS A 333 ? PHE A 326 CYS A 333 
AA3 3 ALA A 277 ? ARG A 284 ? ALA A 277 ARG A 284 
AA3 4 GLU A 413 ? SER A 416 ? GLU A 413 SER A 416 
AA4 1 VAL A 341 ? GLN A 348 ? VAL A 341 GLN A 348 
AA4 2 ARG A 373 ? MET A 379 ? ARG A 373 MET A 379 
AA4 3 PHE A 368 ? GLU A 370 ? PHE A 368 GLU A 370 
AA5 1 TYR C 42  ? VAL C 45  ? TYR C 42  VAL C 45  
AA5 2 ILE C 60  ? PHE C 66  ? ILE C 60  PHE C 66  
AA5 3 VAL C 107 ? TYR C 115 ? VAL C 107 TYR C 115 
AA5 4 TYR C 99  ? VAL C 104 ? TYR C 99  VAL C 104 
AA5 5 GLU C 91  ? ARG C 93  ? GLU C 91  ARG C 93  
AA6 1 GLU C 207 ? LYS C 210 ? GLU C 207 LYS C 210 
AA6 2 THR C 199 ? ASP C 202 ? THR C 199 ASP C 202 
AA6 3 PHE C 215 ? VAL C 217 ? PHE C 215 VAL C 217 
AA7 1 PRO C 315 ? ALA C 322 ? PRO C 315 ALA C 322 
AA7 2 PHE C 326 ? CYS C 333 ? PHE C 326 CYS C 333 
AA7 3 ALA C 277 ? ARG C 284 ? ALA C 277 ARG C 284 
AA7 4 GLU C 413 ? SER C 416 ? GLU C 413 SER C 416 
AA8 1 VAL C 341 ? GLN C 348 ? VAL C 341 GLN C 348 
AA8 2 ARG C 373 ? MET C 379 ? ARG C 373 MET C 379 
AA8 3 PHE C 368 ? GLU C 370 ? PHE C 368 GLU C 370 
AA9 1 TYR E 42  ? VAL E 45  ? TYR E 42  VAL E 45  
AA9 2 GLU E 59  ? PHE E 66  ? GLU E 59  PHE E 66  
AA9 3 VAL E 107 ? TYR E 115 ? VAL E 107 TYR E 115 
AA9 4 PRO E 98  ? VAL E 104 ? PRO E 98  VAL E 104 
AA9 5 ASP E 88  ? TYR E 94  ? ASP E 88  TYR E 94  
AB1 1 GLU E 207 ? LYS E 210 ? GLU E 207 LYS E 210 
AB1 2 THR E 199 ? ASP E 202 ? THR E 199 ASP E 202 
AB1 3 PHE E 215 ? ASP E 218 ? PHE E 215 ASP E 218 
AB1 4 ASP E 221 ? ASN E 225 ? ASP E 221 ASN E 225 
AB2 1 PRO E 315 ? ALA E 322 ? PRO E 315 ALA E 322 
AB2 2 PHE E 326 ? CYS E 333 ? PHE E 326 CYS E 333 
AB2 3 ALA E 277 ? ARG E 284 ? ALA E 277 ARG E 284 
AB2 4 GLU E 413 ? ILE E 415 ? GLU E 413 ILE E 415 
AB3 1 VAL E 341 ? GLN E 348 ? VAL E 341 GLN E 348 
AB3 2 ARG E 373 ? MET E 379 ? ARG E 373 MET E 379 
AB3 3 PHE E 368 ? GLU E 370 ? PHE E 368 GLU E 370 
AB4 1 TYR F 42  ? VAL F 45  ? TYR F 42  VAL F 45  
AB4 2 GLU F 59  ? PHE F 66  ? GLU F 59  PHE F 66  
AB4 3 VAL F 107 ? TYR F 115 ? VAL F 107 TYR F 115 
AB4 4 PRO F 98  ? VAL F 104 ? PRO F 98  VAL F 104 
AB4 5 ASP F 88  ? TYR F 94  ? ASP F 88  TYR F 94  
AB5 1 GLU F 207 ? LYS F 210 ? GLU F 207 LYS F 210 
AB5 2 THR F 199 ? ASP F 202 ? THR F 199 ASP F 202 
AB5 3 PHE F 215 ? ASP F 218 ? PHE F 215 ASP F 218 
AB5 4 ASP F 221 ? ASN F 225 ? ASP F 221 ASN F 225 
AB6 1 PRO F 315 ? ALA F 322 ? PRO F 315 ALA F 322 
AB6 2 PHE F 326 ? CYS F 333 ? PHE F 326 CYS F 333 
AB6 3 ALA F 277 ? ARG F 284 ? ALA F 277 ARG F 284 
AB6 4 GLU F 413 ? SER F 416 ? GLU F 413 SER F 416 
AB7 1 VAL F 341 ? GLN F 348 ? VAL F 341 GLN F 348 
AB7 2 ARG F 373 ? MET F 379 ? ARG F 373 MET F 379 
AB7 3 PHE F 368 ? GLU F 370 ? PHE F 368 GLU F 370 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 43  ? N VAL A 43  O PHE A 63  ? O PHE A 63  
AA1 2 3 N LEU A 64  ? N LEU A 64  O VAL A 112 ? O VAL A 112 
AA1 3 4 O VAL A 109 ? O VAL A 109 N GLY A 102 ? N GLY A 102 
AA1 4 5 O TYR A 99  ? O TYR A 99  N ARG A 93  ? N ARG A 93  
AA2 1 2 O GLU A 207 ? O GLU A 207 N ASP A 202 ? N ASP A 202 
AA2 2 3 N THR A 199 ? N THR A 199 O PHE A 215 ? O PHE A 215 
AA2 3 4 N ASP A 218 ? N ASP A 218 O ARG A 224 ? O ARG A 224 
AA3 1 2 N ALA A 319 ? N ALA A 319 O LEU A 330 ? O LEU A 330 
AA3 2 3 O CYS A 333 ? O CYS A 333 N ALA A 277 ? N ALA A 277 
AA3 3 4 N ALA A 280 ? N ALA A 280 O ILE A 415 ? O ILE A 415 
AA4 1 2 N GLY A 346 ? N GLY A 346 O TRP A 374 ? O TRP A 374 
AA4 2 3 O ARG A 373 ? O ARG A 373 N GLU A 370 ? N GLU A 370 
AA5 1 2 N VAL C 43  ? N VAL C 43  O PHE C 63  ? O PHE C 63  
AA5 2 3 N ILE C 60  ? N ILE C 60  O ASP C 110 ? O ASP C 110 
AA5 3 4 O VAL C 107 ? O VAL C 107 N VAL C 104 ? N VAL C 104 
AA5 4 5 O HIS C 101 ? O HIS C 101 N GLU C 91  ? N GLU C 91  
AA6 1 2 O ARG C 209 ? O ARG C 209 N VAL C 200 ? N VAL C 200 
AA6 2 3 N THR C 199 ? N THR C 199 O PHE C 215 ? O PHE C 215 
AA7 1 2 N LEU C 316 ? N LEU C 316 O GLU C 332 ? O GLU C 332 
AA7 2 3 O CYS C 327 ? O CYS C 327 N PHE C 283 ? N PHE C 283 
AA7 3 4 N ALA C 280 ? N ALA C 280 O ILE C 415 ? O ILE C 415 
AA8 1 2 N PRO C 347 ? N PRO C 347 O TRP C 374 ? O TRP C 374 
AA8 2 3 O ARG C 373 ? O ARG C 373 N GLU C 370 ? N GLU C 370 
AA9 1 2 N VAL E 43  ? N VAL E 43  O PHE E 63  ? O PHE E 63  
AA9 2 3 N VAL E 62  ? N VAL E 62  O VAL E 112 ? O VAL E 112 
AA9 3 4 O VAL E 109 ? O VAL E 109 N GLY E 102 ? N GLY E 102 
AA9 4 5 O HIS E 101 ? O HIS E 101 N GLU E 91  ? N GLU E 91  
AB1 1 2 O GLU E 207 ? O GLU E 207 N ASP E 202 ? N ASP E 202 
AB1 2 3 N ILE E 201 ? N ILE E 201 O PHE E 215 ? O PHE E 215 
AB1 3 4 N ASP E 218 ? N ASP E 218 O ARG E 224 ? O ARG E 224 
AB2 1 2 N ALA E 319 ? N ALA E 319 O LEU E 330 ? O LEU E 330 
AB2 2 3 O CYS E 333 ? O CYS E 333 N ALA E 277 ? N ALA E 277 
AB2 3 4 N ALA E 280 ? N ALA E 280 O ILE E 415 ? O ILE E 415 
AB3 1 2 N ARG E 344 ? N ARG E 344 O ALA E 376 ? O ALA E 376 
AB3 2 3 O TRP E 375 ? O TRP E 375 N PHE E 368 ? N PHE E 368 
AB4 1 2 N VAL F 43  ? N VAL F 43  O PHE F 63  ? O PHE F 63  
AB4 2 3 N VAL F 62  ? N VAL F 62  O ASP F 110 ? O ASP F 110 
AB4 3 4 O VAL F 111 ? O VAL F 111 N VAL F 100 ? N VAL F 100 
AB4 4 5 O HIS F 101 ? O HIS F 101 N GLU F 91  ? N GLU F 91  
AB5 1 2 O ARG F 209 ? O ARG F 209 N VAL F 200 ? N VAL F 200 
AB5 2 3 N ILE F 201 ? N ILE F 201 O PHE F 215 ? O PHE F 215 
AB5 3 4 N ASP F 218 ? N ASP F 218 O ARG F 224 ? O ARG F 224 
AB6 1 2 N LEU F 316 ? N LEU F 316 O GLU F 332 ? O GLU F 332 
AB6 2 3 O CYS F 327 ? O CYS F 327 N PHE F 283 ? N PHE F 283 
AB6 3 4 N LYS F 282 ? N LYS F 282 O GLU F 413 ? O GLU F 413 
AB7 1 2 N ARG F 344 ? N ARG F 344 O ALA F 376 ? O ALA F 376 
AB7 2 3 O TRP F 375 ? O TRP F 375 N PHE F 368 ? N PHE F 368 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A APC 501 ? 14 'binding site for residue APC A 501' 
AC2 Software A GOL 502 ? 3  'binding site for residue GOL A 502' 
AC3 Software A GOL 503 ? 2  'binding site for residue GOL A 503' 
AC4 Software C PEG 501 ? 3  'binding site for residue PEG C 501' 
AC5 Software E GOL 501 ? 4  'binding site for residue GOL E 501' 
AC6 Software E PEG 502 ? 7  'binding site for residue PEG E 502' 
AC7 Software F APC 501 ? 13 'binding site for residue APC F 501' 
AC8 Software H GOL 101 ? 5  'binding site for residue GOL H 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 GLY A 46  ? GLY A 46  . ? 1_555 ? 
2  AC1 14 SER A 47  ? SER A 47  . ? 1_555 ? 
3  AC1 14 ARG A 50  ? ARG A 50  . ? 1_555 ? 
4  AC1 14 GLU A 59  ? GLU A 59  . ? 1_555 ? 
5  AC1 14 ASP A 61  ? ASP A 61  . ? 1_555 ? 
6  AC1 14 THR A 130 ? THR A 130 . ? 1_555 ? 
7  AC1 14 HIS A 133 ? HIS A 133 . ? 1_555 ? 
8  AC1 14 LYS A 152 ? LYS A 152 . ? 1_555 ? 
9  AC1 14 TYR A 161 ? TYR A 161 . ? 1_555 ? 
10 AC1 14 TYR A 173 ? TYR A 173 . ? 1_555 ? 
11 AC1 14 ARG A 224 ? ARG A 224 . ? 1_555 ? 
12 AC1 14 C   B 34  ? C   B 34  . ? 1_555 ? 
13 AC1 14 C   B 36  ? C   B 36  . ? 1_555 ? 
14 AC1 14 C   B 37  ? C   B 37  . ? 1_555 ? 
15 AC2 3  GLU A 311 ? GLU A 311 . ? 1_555 ? 
16 AC2 3  ARG A 380 ? ARG A 380 . ? 1_555 ? 
17 AC2 3  HOH R .   ? HOH A 612 . ? 1_555 ? 
18 AC3 2  VAL A 355 ? VAL A 355 . ? 1_555 ? 
19 AC3 2  LYS A 356 ? LYS A 356 . ? 1_555 ? 
20 AC4 3  GLU C 311 ? GLU C 311 . ? 1_555 ? 
21 AC4 3  ARG C 380 ? ARG C 380 . ? 1_555 ? 
22 AC4 3  LYS C 381 ? LYS C 381 . ? 1_555 ? 
23 AC5 4  ARG A 361 ? ARG A 361 . ? 1_555 ? 
24 AC5 4  U   B 14  ? U   B 14  . ? 1_555 ? 
25 AC5 4  ARG E 284 ? ARG E 284 . ? 1_555 ? 
26 AC5 4  TYR E 411 ? TYR E 411 . ? 1_555 ? 
27 AC6 7  ARG A 361 ? ARG A 361 . ? 1_555 ? 
28 AC6 7  ASN A 362 ? ASN A 362 . ? 1_555 ? 
29 AC6 7  ARG A 363 ? ARG A 363 . ? 1_555 ? 
30 AC6 7  SER E 394 ? SER E 394 . ? 1_555 ? 
31 AC6 7  ARG E 409 ? ARG E 409 . ? 1_555 ? 
32 AC6 7  TYR E 411 ? TYR E 411 . ? 1_555 ? 
33 AC6 7  PHE E 412 ? PHE E 412 . ? 1_555 ? 
34 AC7 13 GLY F 46  ? GLY F 46  . ? 1_555 ? 
35 AC7 13 ARG F 50  ? ARG F 50  . ? 1_555 ? 
36 AC7 13 THR F 130 ? THR F 130 . ? 1_555 ? 
37 AC7 13 HIS F 133 ? HIS F 133 . ? 1_555 ? 
38 AC7 13 TYR F 161 ? TYR F 161 . ? 1_555 ? 
39 AC7 13 GLY F 162 ? GLY F 162 . ? 1_555 ? 
40 AC7 13 ALA F 163 ? ALA F 163 . ? 1_555 ? 
41 AC7 13 GLU F 164 ? GLU F 164 . ? 1_555 ? 
42 AC7 13 SER F 171 ? SER F 171 . ? 1_555 ? 
43 AC7 13 GLY F 172 ? GLY F 172 . ? 1_555 ? 
44 AC7 13 TYR F 173 ? TYR F 173 . ? 1_555 ? 
45 AC7 13 ARG F 224 ? ARG F 224 . ? 1_555 ? 
46 AC7 13 G   G 9   ? G   G 9   . ? 1_555 ? 
47 AC8 5  ARG A 344 ? ARG A 344 . ? 1_555 ? 
48 AC8 5  U   B 13  ? U   B 13  . ? 1_555 ? 
49 AC8 5  U   B 14  ? U   B 14  . ? 1_555 ? 
50 AC8 5  A   B 17  ? A   B 17  . ? 1_555 ? 
51 AC8 5  G   H 2   ? G   H 2   . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X4U 
_atom_sites.fract_transf_matrix[1][1]   0.008697 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002075 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011898 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007586 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N      . MET A 1 1   ? 193.831 39.390  143.533 1.00 148.61 ? 1   MET A N      1 
ATOM   2     C CA     . MET A 1 1   ? 193.976 39.815  142.112 1.00 150.37 ? 1   MET A CA     1 
ATOM   3     C C      . MET A 1 1   ? 192.680 39.595  141.347 1.00 148.69 ? 1   MET A C      1 
ATOM   4     O O      . MET A 1 1   ? 191.701 39.095  141.902 1.00 150.34 ? 1   MET A O      1 
ATOM   5     C CB     . MET A 1 1   ? 195.112 39.043  141.442 1.00 153.92 ? 1   MET A CB     1 
ATOM   6     C CG     . MET A 1 1   ? 196.490 39.517  141.856 1.00 156.39 ? 1   MET A CG     1 
ATOM   7     S SD     . MET A 1 1   ? 197.815 38.648  141.001 1.00 195.73 ? 1   MET A SD     1 
ATOM   8     C CE     . MET A 1 1   ? 199.063 39.933  140.956 1.00 159.10 ? 1   MET A CE     1 
ATOM   9     H H1     . MET A 1 1   ? 193.952 40.093  144.066 1.00 178.34 ? 1   MET A H1     1 
ATOM   10    H H2     . MET A 1 1   ? 193.015 39.058  143.661 1.00 178.34 ? 1   MET A H2     1 
ATOM   11    H H3     . MET A 1 1   ? 194.438 38.767  143.720 1.00 178.34 ? 1   MET A H3     1 
ATOM   12    H HA     . MET A 1 1   ? 194.200 40.758  142.087 1.00 180.45 ? 1   MET A HA     1 
ATOM   13    H HB2    . MET A 1 1   ? 195.037 38.105  141.678 1.00 184.70 ? 1   MET A HB2    1 
ATOM   14    H HB3    . MET A 1 1   ? 195.038 39.148  140.480 1.00 184.70 ? 1   MET A HB3    1 
ATOM   15    H HG2    . MET A 1 1   ? 196.572 40.462  141.654 1.00 187.66 ? 1   MET A HG2    1 
ATOM   16    H HG3    . MET A 1 1   ? 196.601 39.370  142.808 1.00 187.66 ? 1   MET A HG3    1 
ATOM   17    H HE1    . MET A 1 1   ? 199.853 39.590  140.510 1.00 190.92 ? 1   MET A HE1    1 
ATOM   18    H HE2    . MET A 1 1   ? 198.713 40.696  140.470 1.00 190.92 ? 1   MET A HE2    1 
ATOM   19    H HE3    . MET A 1 1   ? 199.282 40.192  141.865 1.00 190.92 ? 1   MET A HE3    1 
ATOM   20    N N      . LYS A 1 2   ? 192.679 39.987  140.075 1.00 145.47 ? 2   LYS A N      1 
ATOM   21    C CA     . LYS A 1 2   ? 191.522 39.794  139.208 1.00 140.71 ? 2   LYS A CA     1 
ATOM   22    C C      . LYS A 1 2   ? 191.095 38.332  139.221 1.00 129.90 ? 2   LYS A C      1 
ATOM   23    O O      . LYS A 1 2   ? 191.850 37.449  138.810 1.00 131.44 ? 2   LYS A O      1 
ATOM   24    C CB     . LYS A 1 2   ? 191.844 40.234  137.777 1.00 146.17 ? 2   LYS A CB     1 
ATOM   25    C CG     . LYS A 1 2   ? 191.381 41.644  137.428 1.00 148.71 ? 2   LYS A CG     1 
ATOM   26    C CD     . LYS A 1 2   ? 192.007 42.120  136.123 1.00 149.76 ? 2   LYS A CD     1 
ATOM   27    C CE     . LYS A 1 2   ? 191.067 43.018  135.338 1.00 148.69 ? 2   LYS A CE     1 
ATOM   28    N NZ     . LYS A 1 2   ? 191.664 43.449  134.042 1.00 148.56 ? 2   LYS A NZ     1 
ATOM   29    H H      . LYS A 1 2   ? 193.344 40.370  139.688 1.00 174.57 ? 2   LYS A H      1 
ATOM   30    H HA     . LYS A 1 2   ? 190.784 40.332  139.534 1.00 168.85 ? 2   LYS A HA     1 
ATOM   31    H HB2    . LYS A 1 2   ? 192.805 40.201  137.650 1.00 175.41 ? 2   LYS A HB2    1 
ATOM   32    H HB3    . LYS A 1 2   ? 191.412 39.623  137.160 1.00 175.41 ? 2   LYS A HB3    1 
ATOM   33    H HG2    . LYS A 1 2   ? 190.417 41.650  137.324 1.00 178.45 ? 2   LYS A HG2    1 
ATOM   34    H HG3    . LYS A 1 2   ? 191.647 42.254  138.134 1.00 178.45 ? 2   LYS A HG3    1 
ATOM   35    H HD2    . LYS A 1 2   ? 192.812 42.624  136.320 1.00 179.71 ? 2   LYS A HD2    1 
ATOM   36    H HD3    . LYS A 1 2   ? 192.220 41.350  135.572 1.00 179.71 ? 2   LYS A HD3    1 
ATOM   37    H HE2    . LYS A 1 2   ? 190.248 42.535  135.149 1.00 178.42 ? 2   LYS A HE2    1 
ATOM   38    H HE3    . LYS A 1 2   ? 190.873 43.812  135.861 1.00 178.42 ? 2   LYS A HE3    1 
ATOM   39    H HZ1    . LYS A 1 2   ? 191.093 43.973  133.604 1.00 178.28 ? 2   LYS A HZ1    1 
ATOM   40    H HZ2    . LYS A 1 2   ? 192.417 43.900  134.190 1.00 178.28 ? 2   LYS A HZ2    1 
ATOM   41    H HZ3    . LYS A 1 2   ? 191.847 42.737  133.541 1.00 178.28 ? 2   LYS A HZ3    1 
ATOM   42    N N      . VAL A 1 3   ? 189.882 38.091  139.712 1.00 116.42 ? 3   VAL A N      1 
ATOM   43    C CA     . VAL A 1 3   ? 189.350 36.740  139.852 1.00 101.60 ? 3   VAL A CA     1 
ATOM   44    C C      . VAL A 1 3   ? 189.417 36.012  138.517 1.00 100.45 ? 3   VAL A C      1 
ATOM   45    O O      . VAL A 1 3   ? 189.670 34.811  138.470 1.00 96.96  ? 3   VAL A O      1 
ATOM   46    C CB     . VAL A 1 3   ? 187.883 36.753  140.323 1.00 89.50  ? 3   VAL A CB     1 
ATOM   47    C CG1    . VAL A 1 3   ? 187.392 35.333  140.586 1.00 78.44  ? 3   VAL A CG1    1 
ATOM   48    C CG2    . VAL A 1 3   ? 187.717 37.612  141.575 1.00 90.77  ? 3   VAL A CG2    1 
ATOM   49    H H      . VAL A 1 3   ? 189.340 38.704  139.976 1.00 139.71 ? 3   VAL A H      1 
ATOM   50    H HA     . VAL A 1 3   ? 189.879 36.247  140.499 1.00 121.92 ? 3   VAL A HA     1 
ATOM   51    H HB     . VAL A 1 3   ? 187.331 37.135  139.624 1.00 107.40 ? 3   VAL A HB     1 
ATOM   52    H HG11   . VAL A 1 3   ? 186.468 35.368  140.881 1.00 94.12  ? 3   VAL A HG11   1 
ATOM   53    H HG12   . VAL A 1 3   ? 187.458 34.819  139.766 1.00 94.12  ? 3   VAL A HG12   1 
ATOM   54    H HG13   . VAL A 1 3   ? 187.944 34.930  141.275 1.00 94.12  ? 3   VAL A HG13   1 
ATOM   55    H HG21   . VAL A 1 3   ? 186.786 37.599  141.845 1.00 108.93 ? 3   VAL A HG21   1 
ATOM   56    H HG22   . VAL A 1 3   ? 188.272 37.248  142.283 1.00 108.93 ? 3   VAL A HG22   1 
ATOM   57    H HG23   . VAL A 1 3   ? 187.991 38.520  141.373 1.00 108.93 ? 3   VAL A HG23   1 
ATOM   58    N N      . GLU A 1 4   ? 189.191 36.756  137.437 1.00 104.25 ? 4   GLU A N      1 
ATOM   59    C CA     . GLU A 1 4   ? 189.216 36.204  136.086 1.00 110.77 ? 4   GLU A CA     1 
ATOM   60    C C      . GLU A 1 4   ? 190.591 35.643  135.747 1.00 109.56 ? 4   GLU A C      1 
ATOM   61    O O      . GLU A 1 4   ? 190.710 34.701  134.964 1.00 107.78 ? 4   GLU A O      1 
ATOM   62    C CB     . GLU A 1 4   ? 188.835 37.277  135.059 1.00 121.08 ? 4   GLU A CB     1 
ATOM   63    C CG     . GLU A 1 4   ? 187.339 37.586  134.982 1.00 129.41 ? 4   GLU A CG     1 
ATOM   64    C CD     . GLU A 1 4   ? 186.793 38.231  136.246 1.00 135.41 ? 4   GLU A CD     1 
ATOM   65    O OE1    . GLU A 1 4   ? 187.599 38.733  137.059 1.00 140.03 ? 4   GLU A OE1    1 
ATOM   66    O OE2    . GLU A 1 4   ? 185.555 38.233  136.425 1.00 134.51 ? 4   GLU A OE2    1 
ATOM   67    H H      . GLU A 1 4   ? 189.017 37.598  137.462 1.00 125.09 ? 4   GLU A H      1 
ATOM   68    H HA     . GLU A 1 4   ? 188.571 35.483  136.024 1.00 132.93 ? 4   GLU A HA     1 
ATOM   69    H HB2    . GLU A 1 4   ? 189.293 38.101  135.287 1.00 145.29 ? 4   GLU A HB2    1 
ATOM   70    H HB3    . GLU A 1 4   ? 189.118 36.980  134.180 1.00 145.29 ? 4   GLU A HB3    1 
ATOM   71    H HG2    . GLU A 1 4   ? 187.182 38.196  134.244 1.00 155.29 ? 4   GLU A HG2    1 
ATOM   72    H HG3    . GLU A 1 4   ? 186.855 36.759  134.836 1.00 155.29 ? 4   GLU A HG3    1 
ATOM   73    N N      . GLU A 1 5   ? 191.627 36.229  136.339 1.00 111.18 ? 5   GLU A N      1 
ATOM   74    C CA     . GLU A 1 5   ? 192.995 35.814  136.066 1.00 112.94 ? 5   GLU A CA     1 
ATOM   75    C C      . GLU A 1 5   ? 193.322 34.540  136.829 1.00 102.91 ? 5   GLU A C      1 
ATOM   76    O O      . GLU A 1 5   ? 194.029 33.667  136.323 1.00 102.89 ? 5   GLU A O      1 
ATOM   77    C CB     . GLU A 1 5   ? 193.975 36.923  136.451 1.00 123.21 ? 5   GLU A CB     1 
ATOM   78    C CG     . GLU A 1 5   ? 195.431 36.596  136.152 1.00 131.50 ? 5   GLU A CG     1 
ATOM   79    C CD     . GLU A 1 5   ? 196.366 37.738  136.495 1.00 136.47 ? 5   GLU A CD     1 
ATOM   80    O OE1    . GLU A 1 5   ? 197.588 37.497  136.585 1.00 139.37 ? 5   GLU A OE1    1 
ATOM   81    O OE2    . GLU A 1 5   ? 195.881 38.876  136.674 1.00 136.44 ? 5   GLU A OE2    1 
ATOM   82    H H      . GLU A 1 5   ? 191.562 36.873  136.905 1.00 133.42 ? 5   GLU A H      1 
ATOM   83    H HA     . GLU A 1 5   ? 193.093 35.636  135.118 1.00 135.53 ? 5   GLU A HA     1 
ATOM   84    H HB2    . GLU A 1 5   ? 193.745 37.727  135.960 1.00 147.86 ? 5   GLU A HB2    1 
ATOM   85    H HB3    . GLU A 1 5   ? 193.899 37.088  137.404 1.00 147.86 ? 5   GLU A HB3    1 
ATOM   86    H HG2    . GLU A 1 5   ? 195.696 35.823  136.674 1.00 157.80 ? 5   GLU A HG2    1 
ATOM   87    H HG3    . GLU A 1 5   ? 195.524 36.405  135.205 1.00 157.80 ? 5   GLU A HG3    1 
ATOM   88    N N      . ILE A 1 6   ? 192.807 34.441  138.051 1.00 92.46  ? 6   ILE A N      1 
ATOM   89    C CA     . ILE A 1 6   ? 193.017 33.254  138.871 1.00 82.84  ? 6   ILE A CA     1 
ATOM   90    C C      . ILE A 1 6   ? 192.457 32.028  138.160 1.00 77.57  ? 6   ILE A C      1 
ATOM   91    O O      . ILE A 1 6   ? 193.077 30.965  138.154 1.00 76.57  ? 6   ILE A O      1 
ATOM   92    C CB     . ILE A 1 6   ? 192.334 33.386  140.256 1.00 79.15  ? 6   ILE A CB     1 
ATOM   93    C CG1    . ILE A 1 6   ? 192.862 34.614  141.012 1.00 80.84  ? 6   ILE A CG1    1 
ATOM   94    C CG2    . ILE A 1 6   ? 192.532 32.115  141.087 1.00 76.02  ? 6   ILE A CG2    1 
ATOM   95    C CD1    . ILE A 1 6   ? 194.329 34.535  141.411 1.00 83.40  ? 6   ILE A CD1    1 
ATOM   96    H H      . ILE A 1 6   ? 192.331 35.049  138.428 1.00 110.96 ? 6   ILE A H      1 
ATOM   97    H HA     . ILE A 1 6   ? 193.968 33.122  139.009 1.00 99.41  ? 6   ILE A HA     1 
ATOM   98    H HB     . ILE A 1 6   ? 191.382 33.507  140.112 1.00 94.98  ? 6   ILE A HB     1 
ATOM   99    H HG12   . ILE A 1 6   ? 192.753 35.396  140.448 1.00 97.01  ? 6   ILE A HG12   1 
ATOM   100   H HG13   . ILE A 1 6   ? 192.342 34.724  141.824 1.00 97.01  ? 6   ILE A HG13   1 
ATOM   101   H HG21   . ILE A 1 6   ? 192.094 32.228  141.946 1.00 91.23  ? 6   ILE A HG21   1 
ATOM   102   H HG22   . ILE A 1 6   ? 192.142 31.364  140.613 1.00 91.23  ? 6   ILE A HG22   1 
ATOM   103   H HG23   . ILE A 1 6   ? 193.482 31.968  141.217 1.00 91.23  ? 6   ILE A HG23   1 
ATOM   104   H HD11   . ILE A 1 6   ? 194.573 35.348  141.881 1.00 100.08 ? 6   ILE A HD11   1 
ATOM   105   H HD12   . ILE A 1 6   ? 194.457 33.767  141.990 1.00 100.08 ? 6   ILE A HD12   1 
ATOM   106   H HD13   . ILE A 1 6   ? 194.869 34.440  140.611 1.00 100.08 ? 6   ILE A HD13   1 
ATOM   107   N N      . LEU A 1 7   ? 191.284 32.184  137.555 1.00 75.69  ? 7   LEU A N      1 
ATOM   108   C CA     . LEU A 1 7   ? 190.592 31.056  136.948 1.00 78.42  ? 7   LEU A CA     1 
ATOM   109   C C      . LEU A 1 7   ? 191.253 30.653  135.638 1.00 86.64  ? 7   LEU A C      1 
ATOM   110   O O      . LEU A 1 7   ? 191.272 29.476  135.279 1.00 89.76  ? 7   LEU A O      1 
ATOM   111   C CB     . LEU A 1 7   ? 189.108 31.378  136.738 1.00 75.59  ? 7   LEU A CB     1 
ATOM   112   C CG     . LEU A 1 7   ? 188.301 31.716  138.002 1.00 72.88  ? 7   LEU A CG     1 
ATOM   113   C CD1    . LEU A 1 7   ? 186.843 31.981  137.656 1.00 75.48  ? 7   LEU A CD1    1 
ATOM   114   C CD2    . LEU A 1 7   ? 188.395 30.627  139.072 1.00 67.87  ? 7   LEU A CD2    1 
ATOM   115   H H      . LEU A 1 7   ? 190.868 32.933  137.483 1.00 90.83  ? 7   LEU A H      1 
ATOM   116   H HA     . LEU A 1 7   ? 190.647 30.297  137.551 1.00 94.11  ? 7   LEU A HA     1 
ATOM   117   H HB2    . LEU A 1 7   ? 189.044 32.140  136.142 1.00 90.71  ? 7   LEU A HB2    1 
ATOM   118   H HB3    . LEU A 1 7   ? 188.686 30.609  136.323 1.00 90.71  ? 7   LEU A HB3    1 
ATOM   119   H HG     . LEU A 1 7   ? 188.661 32.531  138.386 1.00 87.46  ? 7   LEU A HG     1 
ATOM   120   H HD11   . LEU A 1 7   ? 186.359 32.191  138.469 1.00 90.58  ? 7   LEU A HD11   1 
ATOM   121   H HD12   . LEU A 1 7   ? 186.797 32.729  137.040 1.00 90.58  ? 7   LEU A HD12   1 
ATOM   122   H HD13   . LEU A 1 7   ? 186.468 31.188  137.242 1.00 90.58  ? 7   LEU A HD13   1 
ATOM   123   H HD21   . LEU A 1 7   ? 187.868 30.895  139.842 1.00 81.44  ? 7   LEU A HD21   1 
ATOM   124   H HD22   . LEU A 1 7   ? 188.050 29.797  138.708 1.00 81.44  ? 7   LEU A HD22   1 
ATOM   125   H HD23   . LEU A 1 7   ? 189.323 30.516  139.328 1.00 81.44  ? 7   LEU A HD23   1 
ATOM   126   N N      . GLU A 1 8   ? 191.806 31.628  134.928 1.00 92.33  ? 8   GLU A N      1 
ATOM   127   C CA     . GLU A 1 8   ? 192.519 31.344  133.693 1.00 98.23  ? 8   GLU A CA     1 
ATOM   128   C C      . GLU A 1 8   ? 193.752 30.490  133.994 1.00 97.48  ? 8   GLU A C      1 
ATOM   129   O O      . GLU A 1 8   ? 194.005 29.489  133.320 1.00 103.86 ? 8   GLU A O      1 
ATOM   130   C CB     . GLU A 1 8   ? 192.917 32.646  133.005 1.00 105.08 ? 8   GLU A CB     1 
ATOM   131   C CG     . GLU A 1 8   ? 193.531 32.460  131.631 1.00 113.31 ? 8   GLU A CG     1 
ATOM   132   C CD     . GLU A 1 8   ? 193.832 33.782  130.951 1.00 120.11 ? 8   GLU A CD     1 
ATOM   133   O OE1    . GLU A 1 8   ? 193.240 34.805  131.357 1.00 120.39 ? 8   GLU A OE1    1 
ATOM   134   O OE2    . GLU A 1 8   ? 194.663 33.799  130.016 1.00 124.34 ? 8   GLU A OE2    1 
ATOM   135   H H      . GLU A 1 8   ? 191.781 32.462  135.140 1.00 110.80 ? 8   GLU A H      1 
ATOM   136   H HA     . GLU A 1 8   ? 191.941 30.846  133.095 1.00 117.88 ? 8   GLU A HA     1 
ATOM   137   H HB2    . GLU A 1 8   ? 192.125 33.197  132.903 1.00 126.10 ? 8   GLU A HB2    1 
ATOM   138   H HB3    . GLU A 1 8   ? 193.567 33.105  133.560 1.00 126.10 ? 8   GLU A HB3    1 
ATOM   139   H HG2    . GLU A 1 8   ? 194.364 31.970  131.719 1.00 135.97 ? 8   GLU A HG2    1 
ATOM   140   H HG3    . GLU A 1 8   ? 192.912 31.967  131.070 1.00 135.97 ? 8   GLU A HG3    1 
ATOM   141   N N      . LYS A 1 9   ? 194.503 30.870  135.022 1.00 88.30  ? 9   LYS A N      1 
ATOM   142   C CA     . LYS A 1 9   ? 195.675 30.101  135.420 1.00 86.85  ? 9   LYS A CA     1 
ATOM   143   C C      . LYS A 1 9   ? 195.272 28.786  136.067 1.00 84.92  ? 9   LYS A C      1 
ATOM   144   O O      . LYS A 1 9   ? 196.086 27.868  136.179 1.00 82.34  ? 9   LYS A O      1 
ATOM   145   C CB     . LYS A 1 9   ? 196.550 30.902  136.387 1.00 92.42  ? 9   LYS A CB     1 
ATOM   146   C CG     . LYS A 1 9   ? 197.180 32.143  135.765 1.00 101.47 ? 9   LYS A CG     1 
ATOM   147   C CD     . LYS A 1 9   ? 198.233 32.766  136.674 1.00 107.02 ? 9   LYS A CD     1 
ATOM   148   C CE     . LYS A 1 9   ? 199.504 31.920  136.748 1.00 108.92 ? 9   LYS A CE     1 
ATOM   149   N NZ     . LYS A 1 9   ? 200.554 32.550  137.600 1.00 108.17 ? 9   LYS A NZ     1 
ATOM   150   H H      . LYS A 1 9   ? 194.356 31.568  135.504 1.00 105.96 ? 9   LYS A H      1 
ATOM   151   H HA     . LYS A 1 9   ? 196.204 29.899  134.633 1.00 104.22 ? 9   LYS A HA     1 
ATOM   152   H HB2    . LYS A 1 9   ? 196.004 31.191  137.135 1.00 110.91 ? 9   LYS A HB2    1 
ATOM   153   H HB3    . LYS A 1 9   ? 197.268 30.332  136.704 1.00 110.91 ? 9   LYS A HB3    1 
ATOM   154   H HG2    . LYS A 1 9   ? 197.609 31.898  134.930 1.00 121.76 ? 9   LYS A HG2    1 
ATOM   155   H HG3    . LYS A 1 9   ? 196.490 32.805  135.605 1.00 121.76 ? 9   LYS A HG3    1 
ATOM   156   H HD2    . LYS A 1 9   ? 198.473 33.641  136.331 1.00 128.42 ? 9   LYS A HD2    1 
ATOM   157   H HD3    . LYS A 1 9   ? 197.872 32.847  137.571 1.00 128.42 ? 9   LYS A HD3    1 
ATOM   158   H HE2    . LYS A 1 9   ? 199.287 31.054  137.128 1.00 130.71 ? 9   LYS A HE2    1 
ATOM   159   H HE3    . LYS A 1 9   ? 199.865 31.811  135.855 1.00 130.71 ? 9   LYS A HE3    1 
ATOM   160   H HZ1    . LYS A 1 9   ? 201.278 32.033  137.622 1.00 129.81 ? 9   LYS A HZ1    1 
ATOM   161   H HZ2    . LYS A 1 9   ? 200.776 33.346  137.270 1.00 129.81 ? 9   LYS A HZ2    1 
ATOM   162   H HZ3    . LYS A 1 9   ? 200.249 32.656  138.430 1.00 129.81 ? 9   LYS A HZ3    1 
ATOM   163   N N      . ALA A 1 10  ? 194.019 28.697  136.501 1.00 89.39  ? 10  ALA A N      1 
ATOM   164   C CA     . ALA A 1 10  ? 193.523 27.484  137.143 1.00 89.43  ? 10  ALA A CA     1 
ATOM   165   C C      . ALA A 1 10  ? 193.208 26.416  136.106 1.00 86.80  ? 10  ALA A C      1 
ATOM   166   O O      . ALA A 1 10  ? 193.227 25.226  136.412 1.00 92.15  ? 10  ALA A O      1 
ATOM   167   C CB     . ALA A 1 10  ? 192.301 27.784  137.985 1.00 89.29  ? 10  ALA A CB     1 
ATOM   168   H H      . ALA A 1 10  ? 193.435 29.325  136.436 1.00 107.27 ? 10  ALA A H      1 
ATOM   169   H HA     . ALA A 1 10  ? 194.212 27.136  137.731 1.00 107.32 ? 10  ALA A HA     1 
ATOM   170   H HB1    . ALA A 1 10  ? 191.993 26.963  138.399 1.00 107.15 ? 10  ALA A HB1    1 
ATOM   171   H HB2    . ALA A 1 10  ? 192.539 28.430  138.668 1.00 107.15 ? 10  ALA A HB2    1 
ATOM   172   H HB3    . ALA A 1 10  ? 191.606 28.147  137.414 1.00 107.15 ? 10  ALA A HB3    1 
ATOM   173   N N      . LEU A 1 11  ? 192.928 26.840  134.877 1.00 77.83  ? 11  LEU A N      1 
ATOM   174   C CA     . LEU A 1 11  ? 192.676 25.899  133.793 1.00 76.48  ? 11  LEU A CA     1 
ATOM   175   C C      . LEU A 1 11  ? 193.891 25.011  133.532 1.00 80.67  ? 11  LEU A C      1 
ATOM   176   O O      . LEU A 1 11  ? 193.756 23.868  133.084 1.00 75.75  ? 11  LEU A O      1 
ATOM   177   C CB     . LEU A 1 11  ? 192.310 26.650  132.515 1.00 77.55  ? 11  LEU A CB     1 
ATOM   178   C CG     . LEU A 1 11  ? 190.985 27.415  132.531 1.00 80.20  ? 11  LEU A CG     1 
ATOM   179   C CD1    . LEU A 1 11  ? 190.793 28.194  131.235 1.00 81.38  ? 11  LEU A CD1    1 
ATOM   180   C CD2    . LEU A 1 11  ? 189.803 26.479  132.771 1.00 80.80  ? 11  LEU A CD2    1 
ATOM   181   H H      . LEU A 1 11  ? 192.879 27.667  134.646 1.00 93.40  ? 11  LEU A H      1 
ATOM   182   H HA     . LEU A 1 11  ? 191.930 25.328  134.033 1.00 91.78  ? 11  LEU A HA     1 
ATOM   183   H HB2    . LEU A 1 11  ? 193.012 27.293  132.329 1.00 93.06  ? 11  LEU A HB2    1 
ATOM   184   H HB3    . LEU A 1 11  ? 192.262 26.008  131.789 1.00 93.06  ? 11  LEU A HB3    1 
ATOM   185   H HG     . LEU A 1 11  ? 191.005 28.056  133.259 1.00 96.24  ? 11  LEU A HG     1 
ATOM   186   H HD11   . LEU A 1 11  ? 189.947 28.668  131.274 1.00 97.65  ? 11  LEU A HD11   1 
ATOM   187   H HD12   . LEU A 1 11  ? 191.522 28.826  131.135 1.00 97.65  ? 11  LEU A HD12   1 
ATOM   188   H HD13   . LEU A 1 11  ? 190.790 27.572  130.491 1.00 97.65  ? 11  LEU A HD13   1 
ATOM   189   H HD21   . LEU A 1 11  ? 188.984 26.998  132.775 1.00 96.97  ? 11  LEU A HD21   1 
ATOM   190   H HD22   . LEU A 1 11  ? 189.774 25.819  132.060 1.00 96.97  ? 11  LEU A HD22   1 
ATOM   191   H HD23   . LEU A 1 11  ? 189.919 26.037  133.627 1.00 96.97  ? 11  LEU A HD23   1 
ATOM   192   N N      . GLU A 1 12  ? 195.075 25.545  133.818 1.00 90.50  ? 12  GLU A N      1 
ATOM   193   C CA     . GLU A 1 12  ? 196.327 24.836  133.577 1.00 97.40  ? 12  GLU A CA     1 
ATOM   194   C C      . GLU A 1 12  ? 196.427 23.586  134.440 1.00 95.85  ? 12  GLU A C      1 
ATOM   195   O O      . GLU A 1 12  ? 196.806 22.518  133.959 1.00 93.25  ? 12  GLU A O      1 
ATOM   196   C CB     . GLU A 1 12  ? 197.516 25.755  133.863 1.00 103.81 ? 12  GLU A CB     1 
ATOM   197   C CG     . GLU A 1 12  ? 197.543 27.015  133.015 1.00 111.54 ? 12  GLU A CG     1 
ATOM   198   C CD     . GLU A 1 12  ? 198.711 27.919  133.356 1.00 119.49 ? 12  GLU A CD     1 
ATOM   199   O OE1    . GLU A 1 12  ? 199.439 27.610  134.323 1.00 120.06 ? 12  GLU A OE1    1 
ATOM   200   O OE2    . GLU A 1 12  ? 198.902 28.938  132.656 1.00 124.51 ? 12  GLU A OE2    1 
ATOM   201   H H      . GLU A 1 12  ? 195.181 26.329  134.157 1.00 108.60 ? 12  GLU A H      1 
ATOM   202   H HA     . GLU A 1 12  ? 196.368 24.567  132.646 1.00 116.88 ? 12  GLU A HA     1 
ATOM   203   H HB2    . GLU A 1 12  ? 197.483 26.026  134.794 1.00 124.57 ? 12  GLU A HB2    1 
ATOM   204   H HB3    . GLU A 1 12  ? 198.336 25.266  133.692 1.00 124.57 ? 12  GLU A HB3    1 
ATOM   205   H HG2    . GLU A 1 12  ? 197.618 26.766  132.080 1.00 133.84 ? 12  GLU A HG2    1 
ATOM   206   H HG3    . GLU A 1 12  ? 196.724 27.513  133.162 1.00 133.84 ? 12  GLU A HG3    1 
ATOM   207   N N      . LEU A 1 13  ? 196.077 23.726  135.716 1.00 96.70  ? 13  LEU A N      1 
ATOM   208   C CA     . LEU A 1 13  ? 196.147 22.616  136.661 1.00 94.87  ? 13  LEU A CA     1 
ATOM   209   C C      . LEU A 1 13  ? 194.987 21.650  136.471 1.00 92.83  ? 13  LEU A C      1 
ATOM   210   O O      . LEU A 1 13  ? 194.899 20.638  137.164 1.00 96.69  ? 13  LEU A O      1 
ATOM   211   C CB     . LEU A 1 13  ? 196.118 23.137  138.100 1.00 91.95  ? 13  LEU A CB     1 
ATOM   212   C CG     . LEU A 1 13  ? 197.250 24.070  138.527 1.00 91.62  ? 13  LEU A CG     1 
ATOM   213   C CD1    . LEU A 1 13  ? 196.958 24.652  139.903 1.00 89.54  ? 13  LEU A CD1    1 
ATOM   214   C CD2    . LEU A 1 13  ? 198.593 23.347  138.519 1.00 92.23  ? 13  LEU A CD2    1 
ATOM   215   H H      . LEU A 1 13  ? 195.794 24.461  136.062 1.00 116.04 ? 13  LEU A H      1 
ATOM   216   H HA     . LEU A 1 13  ? 196.976 22.130  136.527 1.00 113.85 ? 13  LEU A HA     1 
ATOM   217   H HB2    . LEU A 1 13  ? 195.287 23.620  138.228 1.00 110.34 ? 13  LEU A HB2    1 
ATOM   218   H HB3    . LEU A 1 13  ? 196.138 22.373  138.697 1.00 110.34 ? 13  LEU A HB3    1 
ATOM   219   H HG     . LEU A 1 13  ? 197.305 24.806  137.898 1.00 109.94 ? 13  LEU A HG     1 
ATOM   220   H HD11   . LEU A 1 13  ? 197.686 25.240  140.157 1.00 107.44 ? 13  LEU A HD11   1 
ATOM   221   H HD12   . LEU A 1 13  ? 196.127 25.150  139.864 1.00 107.44 ? 13  LEU A HD12   1 
ATOM   222   H HD13   . LEU A 1 13  ? 196.879 23.926  140.542 1.00 107.44 ? 13  LEU A HD13   1 
ATOM   223   H HD21   . LEU A 1 13  ? 199.286 23.967  138.794 1.00 110.68 ? 13  LEU A HD21   1 
ATOM   224   H HD22   . LEU A 1 13  ? 198.552 22.600  139.136 1.00 110.68 ? 13  LEU A HD22   1 
ATOM   225   H HD23   . LEU A 1 13  ? 198.773 23.026  137.622 1.00 110.68 ? 13  LEU A HD23   1 
ATOM   226   N N      . VAL A 1 14  ? 194.109 21.952  135.520 1.00 85.84  ? 14  VAL A N      1 
ATOM   227   C CA     . VAL A 1 14  ? 192.804 21.309  135.466 1.00 81.16  ? 14  VAL A CA     1 
ATOM   228   C C      . VAL A 1 14  ? 192.480 20.696  134.098 1.00 84.85  ? 14  VAL A C      1 
ATOM   229   O O      . VAL A 1 14  ? 191.818 19.661  134.029 1.00 91.36  ? 14  VAL A O      1 
ATOM   230   C CB     . VAL A 1 14  ? 191.725 22.324  135.899 1.00 75.26  ? 14  VAL A CB     1 
ATOM   231   C CG1    . VAL A 1 14  ? 190.388 21.992  135.327 1.00 77.03  ? 14  VAL A CG1    1 
ATOM   232   C CG2    . VAL A 1 14  ? 191.644 22.385  137.417 1.00 68.93  ? 14  VAL A CG2    1 
ATOM   233   H H      . VAL A 1 14  ? 194.246 22.526  134.895 1.00 103.00 ? 14  VAL A H      1 
ATOM   234   H HA     . VAL A 1 14  ? 192.796 20.587  136.112 1.00 97.40  ? 14  VAL A HA     1 
ATOM   235   H HB     . VAL A 1 14  ? 191.975 23.205  135.578 1.00 90.31  ? 14  VAL A HB     1 
ATOM   236   H HG11   . VAL A 1 14  ? 189.745 22.653  135.624 1.00 92.44  ? 14  VAL A HG11   1 
ATOM   237   H HG12   . VAL A 1 14  ? 190.449 22.000  134.359 1.00 92.44  ? 14  VAL A HG12   1 
ATOM   238   H HG13   . VAL A 1 14  ? 190.124 21.111  135.634 1.00 92.44  ? 14  VAL A HG13   1 
ATOM   239   H HG21   . VAL A 1 14  ? 190.962 23.026  137.671 1.00 82.72  ? 14  VAL A HG21   1 
ATOM   240   H HG22   . VAL A 1 14  ? 191.415 21.505  137.756 1.00 82.72  ? 14  VAL A HG22   1 
ATOM   241   H HG23   . VAL A 1 14  ? 192.505 22.661  137.768 1.00 82.72  ? 14  VAL A HG23   1 
ATOM   242   N N      . ILE A 1 15  ? 192.943 21.325  133.020 1.00 81.19  ? 15  ILE A N      1 
ATOM   243   C CA     . ILE A 1 15  ? 192.694 20.812  131.670 1.00 83.23  ? 15  ILE A CA     1 
ATOM   244   C C      . ILE A 1 15  ? 193.817 19.881  131.206 1.00 92.99  ? 15  ILE A C      1 
ATOM   245   O O      . ILE A 1 15  ? 194.990 20.247  131.276 1.00 91.27  ? 15  ILE A O      1 
ATOM   246   C CB     . ILE A 1 15  ? 192.563 21.958  130.650 1.00 83.21  ? 15  ILE A CB     1 
ATOM   247   C CG1    . ILE A 1 15  ? 191.359 22.835  131.000 1.00 86.00  ? 15  ILE A CG1    1 
ATOM   248   C CG2    . ILE A 1 15  ? 192.423 21.404  129.223 1.00 80.91  ? 15  ILE A CG2    1 
ATOM   249   C CD1    . ILE A 1 15  ? 191.181 24.044  130.099 1.00 88.27  ? 15  ILE A CD1    1 
ATOM   250   H H      . ILE A 1 15  ? 193.404 22.051  133.040 1.00 97.43  ? 15  ILE A H      1 
ATOM   251   H HA     . ILE A 1 15  ? 191.864 20.309  131.669 1.00 99.88  ? 15  ILE A HA     1 
ATOM   252   H HB     . ILE A 1 15  ? 193.365 22.503  130.693 1.00 99.85  ? 15  ILE A HB     1 
ATOM   253   H HG12   . ILE A 1 15  ? 190.554 22.298  130.935 1.00 103.20 ? 15  ILE A HG12   1 
ATOM   254   H HG13   . ILE A 1 15  ? 191.464 23.158  131.909 1.00 103.20 ? 15  ILE A HG13   1 
ATOM   255   H HG21   . ILE A 1 15  ? 192.342 22.145  128.603 1.00 97.09  ? 15  ILE A HG21   1 
ATOM   256   H HG22   . ILE A 1 15  ? 193.210 20.878  129.010 1.00 97.09  ? 15  ILE A HG22   1 
ATOM   257   H HG23   . ILE A 1 15  ? 191.630 20.847  129.178 1.00 97.09  ? 15  ILE A HG23   1 
ATOM   258   H HD11   . ILE A 1 15  ? 190.400 24.541  130.389 1.00 105.92 ? 15  ILE A HD11   1 
ATOM   259   H HD12   . ILE A 1 15  ? 191.971 24.603  130.161 1.00 105.92 ? 15  ILE A HD12   1 
ATOM   260   H HD13   . ILE A 1 15  ? 191.060 23.741  129.185 1.00 105.92 ? 15  ILE A HD13   1 
ATOM   261   N N      . PRO A 1 16  ? 193.465 18.682  130.706 1.00 107.96 ? 16  PRO A N      1 
ATOM   262   C CA     . PRO A 1 16  ? 194.510 17.771  130.217 1.00 120.07 ? 16  PRO A CA     1 
ATOM   263   C C      . PRO A 1 16  ? 195.177 18.272  128.932 1.00 130.82 ? 16  PRO A C      1 
ATOM   264   O O      . PRO A 1 16  ? 194.480 18.685  128.006 1.00 135.53 ? 16  PRO A O      1 
ATOM   265   C CB     . PRO A 1 16  ? 193.745 16.470  129.955 1.00 116.61 ? 16  PRO A CB     1 
ATOM   266   C CG     . PRO A 1 16  ? 192.348 16.899  129.692 1.00 112.80 ? 16  PRO A CG     1 
ATOM   267   C CD     . PRO A 1 16  ? 192.116 18.106  130.549 1.00 109.83 ? 16  PRO A CD     1 
ATOM   268   H HA     . PRO A 1 16  ? 195.183 17.623  130.900 1.00 144.08 ? 16  PRO A HA     1 
ATOM   269   H HB2    . PRO A 1 16  ? 194.118 16.021  129.180 1.00 139.93 ? 16  PRO A HB2    1 
ATOM   270   H HB3    . PRO A 1 16  ? 193.788 15.900  130.738 1.00 139.93 ? 16  PRO A HB3    1 
ATOM   271   H HG2    . PRO A 1 16  ? 192.250 17.125  128.754 1.00 135.36 ? 16  PRO A HG2    1 
ATOM   272   H HG3    . PRO A 1 16  ? 191.739 16.186  129.937 1.00 135.36 ? 16  PRO A HG3    1 
ATOM   273   H HD2    . PRO A 1 16  ? 191.531 18.733  130.098 1.00 131.79 ? 16  PRO A HD2    1 
ATOM   274   H HD3    . PRO A 1 16  ? 191.759 17.843  131.412 1.00 131.79 ? 16  PRO A HD3    1 
ATOM   275   N N      . ASP A 1 17  ? 196.507 18.229  128.883 1.00 131.67 ? 17  ASP A N      1 
ATOM   276   C CA     . ASP A 1 17  ? 197.260 18.719  127.726 1.00 133.00 ? 17  ASP A CA     1 
ATOM   277   C C      . ASP A 1 17  ? 197.093 17.812  126.505 1.00 128.39 ? 17  ASP A C      1 
ATOM   278   O O      . ASP A 1 17  ? 196.525 16.724  126.604 1.00 129.43 ? 17  ASP A O      1 
ATOM   279   C CB     . ASP A 1 17  ? 198.746 18.842  128.073 1.00 139.06 ? 17  ASP A CB     1 
ATOM   280   C CG     . ASP A 1 17  ? 199.357 17.520  128.500 1.00 142.82 ? 17  ASP A CG     1 
ATOM   281   O OD1    . ASP A 1 17  ? 198.678 16.753  129.214 1.00 142.99 ? 17  ASP A OD1    1 
ATOM   282   O OD2    . ASP A 1 17  ? 200.515 17.245  128.119 1.00 145.40 ? 17  ASP A OD2    1 
ATOM   283   H H      . ASP A 1 17  ? 197.003 17.919  129.513 1.00 158.01 ? 17  ASP A H      1 
ATOM   284   H HA     . ASP A 1 17  ? 196.934 19.601  127.489 1.00 159.60 ? 17  ASP A HA     1 
ATOM   285   H HB2    . ASP A 1 17  ? 199.228 19.158  127.292 1.00 166.87 ? 17  ASP A HB2    1 
ATOM   286   H HB3    . ASP A 1 17  ? 198.849 19.471  128.804 1.00 166.87 ? 17  ASP A HB3    1 
ATOM   287   N N      . GLU A 1 18  ? 197.603 18.269  125.362 1.00 122.17 ? 18  GLU A N      1 
ATOM   288   C CA     . GLU A 1 18  ? 197.482 17.545  124.094 1.00 117.67 ? 18  GLU A CA     1 
ATOM   289   C C      . GLU A 1 18  ? 198.033 16.120  124.162 1.00 116.15 ? 18  GLU A C      1 
ATOM   290   O O      . GLU A 1 18  ? 197.552 15.227  123.463 1.00 108.12 ? 18  GLU A O      1 
ATOM   291   C CB     . GLU A 1 18  ? 198.222 18.297  122.985 1.00 118.74 ? 18  GLU A CB     1 
ATOM   292   C CG     . GLU A 1 18  ? 197.713 19.702  122.705 1.00 118.99 ? 18  GLU A CG     1 
ATOM   293   C CD     . GLU A 1 18  ? 198.521 20.397  121.619 1.00 121.47 ? 18  GLU A CD     1 
ATOM   294   O OE1    . GLU A 1 18  ? 198.171 21.539  121.246 1.00 121.79 ? 18  GLU A OE1    1 
ATOM   295   O OE2    . GLU A 1 18  ? 199.508 19.798  121.138 1.00 122.10 ? 18  GLU A OE2    1 
ATOM   296   H H      . GLU A 1 18  ? 198.032 19.011  125.293 1.00 146.60 ? 18  GLU A H      1 
ATOM   297   H HA     . GLU A 1 18  ? 196.545 17.493  123.848 1.00 141.20 ? 18  GLU A HA     1 
ATOM   298   H HB2    . GLU A 1 18  ? 199.157 18.369  123.234 1.00 142.49 ? 18  GLU A HB2    1 
ATOM   299   H HB3    . GLU A 1 18  ? 198.144 17.788  122.163 1.00 142.49 ? 18  GLU A HB3    1 
ATOM   300   H HG2    . GLU A 1 18  ? 196.790 19.653  122.410 1.00 142.79 ? 18  GLU A HG2    1 
ATOM   301   H HG3    . GLU A 1 18  ? 197.777 20.231  123.515 1.00 142.79 ? 18  GLU A HG3    1 
ATOM   302   N N      . GLU A 1 19  ? 199.047 15.921  124.999 1.00 127.09 ? 19  GLU A N      1 
ATOM   303   C CA     . GLU A 1 19  ? 199.708 14.625  125.127 1.00 136.96 ? 19  GLU A CA     1 
ATOM   304   C C      . GLU A 1 19  ? 198.785 13.580  125.756 1.00 135.20 ? 19  GLU A C      1 
ATOM   305   O O      . GLU A 1 19  ? 198.869 12.393  125.437 1.00 134.99 ? 19  GLU A O      1 
ATOM   306   C CB     . GLU A 1 19  ? 200.980 14.773  125.968 1.00 144.21 ? 19  GLU A CB     1 
ATOM   307   C CG     . GLU A 1 19  ? 201.904 13.563  125.936 1.00 150.32 ? 19  GLU A CG     1 
ATOM   308   C CD     . GLU A 1 19  ? 203.178 13.777  126.740 1.00 153.24 ? 19  GLU A CD     1 
ATOM   309   O OE1    . GLU A 1 19  ? 203.225 14.728  127.552 1.00 151.98 ? 19  GLU A OE1    1 
ATOM   310   O OE2    . GLU A 1 19  ? 204.135 12.994  126.559 1.00 155.95 ? 19  GLU A OE2    1 
ATOM   311   H H      . GLU A 1 19  ? 199.376 16.529  125.510 1.00 152.50 ? 19  GLU A H      1 
ATOM   312   H HA     . GLU A 1 19  ? 199.964 14.310  124.246 1.00 164.35 ? 19  GLU A HA     1 
ATOM   313   H HB2    . GLU A 1 19  ? 201.482 15.535  125.638 1.00 173.05 ? 19  GLU A HB2    1 
ATOM   314   H HB3    . GLU A 1 19  ? 200.725 14.924  126.891 1.00 173.05 ? 19  GLU A HB3    1 
ATOM   315   H HG2    . GLU A 1 19  ? 201.438 12.799  126.310 1.00 180.39 ? 19  GLU A HG2    1 
ATOM   316   H HG3    . GLU A 1 19  ? 202.156 13.382  125.017 1.00 180.39 ? 19  GLU A HG3    1 
ATOM   317   N N      . GLU A 1 20  ? 197.903 14.028  126.645 1.00 132.22 ? 20  GLU A N      1 
ATOM   318   C CA     . GLU A 1 20  ? 196.987 13.132  127.344 1.00 126.85 ? 20  GLU A CA     1 
ATOM   319   C C      . GLU A 1 20  ? 195.719 12.883  126.524 1.00 118.42 ? 20  GLU A C      1 
ATOM   320   O O      . GLU A 1 20  ? 195.092 11.831  126.640 1.00 116.89 ? 20  GLU A O      1 
ATOM   321   C CB     . GLU A 1 20  ? 196.633 13.709  128.716 1.00 126.99 ? 20  GLU A CB     1 
ATOM   322   C CG     . GLU A 1 20  ? 195.864 12.755  129.619 1.00 126.92 ? 20  GLU A CG     1 
ATOM   323   C CD     . GLU A 1 20  ? 195.611 13.335  131.003 1.00 126.37 ? 20  GLU A CD     1 
ATOM   324   O OE1    . GLU A 1 20  ? 196.195 14.392  131.328 1.00 126.72 ? 20  GLU A OE1    1 
ATOM   325   O OE2    . GLU A 1 20  ? 194.824 12.735  131.767 1.00 125.33 ? 20  GLU A OE2    1 
ATOM   326   H H      . GLU A 1 20  ? 197.814 14.856  126.862 1.00 158.66 ? 20  GLU A H      1 
ATOM   327   H HA     . GLU A 1 20  ? 197.426 12.278  127.482 1.00 152.22 ? 20  GLU A HA     1 
ATOM   328   H HB2    . GLU A 1 20  ? 197.454 13.949  129.173 1.00 152.39 ? 20  GLU A HB2    1 
ATOM   329   H HB3    . GLU A 1 20  ? 196.086 14.500  128.589 1.00 152.39 ? 20  GLU A HB3    1 
ATOM   330   H HG2    . GLU A 1 20  ? 195.005 12.559  129.213 1.00 152.31 ? 20  GLU A HG2    1 
ATOM   331   H HG3    . GLU A 1 20  ? 196.376 11.938  129.725 1.00 152.31 ? 20  GLU A HG3    1 
ATOM   332   N N      . VAL A 1 21  ? 195.349 13.854  125.692 1.00 110.89 ? 21  VAL A N      1 
ATOM   333   C CA     . VAL A 1 21  ? 194.183 13.720  124.820 1.00 104.72 ? 21  VAL A CA     1 
ATOM   334   C C      . VAL A 1 21  ? 194.422 12.656  123.754 1.00 111.54 ? 21  VAL A C      1 
ATOM   335   O O      . VAL A 1 21  ? 193.659 11.696  123.648 1.00 106.95 ? 21  VAL A O      1 
ATOM   336   C CB     . VAL A 1 21  ? 193.834 15.059  124.123 1.00 94.63  ? 21  VAL A CB     1 
ATOM   337   C CG1    . VAL A 1 21  ? 192.658 14.890  123.160 1.00 88.88  ? 21  VAL A CG1    1 
ATOM   338   C CG2    . VAL A 1 21  ? 193.517 16.121  125.155 1.00 91.39  ? 21  VAL A CG2    1 
ATOM   339   H H      . VAL A 1 21  ? 195.759 14.606  125.614 1.00 133.07 ? 21  VAL A H      1 
ATOM   340   H HA     . VAL A 1 21  ? 193.419 13.449  125.352 1.00 125.66 ? 21  VAL A HA     1 
ATOM   341   H HB     . VAL A 1 21  ? 194.602 15.359  123.611 1.00 113.55 ? 21  VAL A HB     1 
ATOM   342   H HG11   . VAL A 1 21  ? 192.467 15.745  122.743 1.00 106.65 ? 21  VAL A HG11   1 
ATOM   343   H HG12   . VAL A 1 21  ? 192.896 14.237  122.483 1.00 106.65 ? 21  VAL A HG12   1 
ATOM   344   H HG13   . VAL A 1 21  ? 191.884 14.585  123.658 1.00 106.65 ? 21  VAL A HG13   1 
ATOM   345   H HG21   . VAL A 1 21  ? 193.301 16.950  124.699 1.00 109.66 ? 21  VAL A HG21   1 
ATOM   346   H HG22   . VAL A 1 21  ? 192.759 15.828  125.686 1.00 109.66 ? 21  VAL A HG22   1 
ATOM   347   H HG23   . VAL A 1 21  ? 194.291 16.248  125.725 1.00 109.66 ? 21  VAL A HG23   1 
ATOM   348   N N      . ARG A 1 22  ? 195.480 12.834  122.965 1.00 123.43 ? 22  ARG A N      1 
ATOM   349   C CA     . ARG A 1 22  ? 195.794 11.906  121.884 1.00 132.20 ? 22  ARG A CA     1 
ATOM   350   C C      . ARG A 1 22  ? 196.001 10.501  122.429 1.00 126.20 ? 22  ARG A C      1 
ATOM   351   O O      . ARG A 1 22  ? 195.685 9.518   121.760 1.00 131.87 ? 22  ARG A O      1 
ATOM   352   C CB     . ARG A 1 22  ? 197.040 12.358  121.119 1.00 144.13 ? 22  ARG A CB     1 
ATOM   353   C CG     . ARG A 1 22  ? 197.312 11.541  119.859 1.00 153.39 ? 22  ARG A CG     1 
ATOM   354   C CD     . ARG A 1 22  ? 198.483 12.092  119.056 1.00 159.46 ? 22  ARG A CD     1 
ATOM   355   N NE     . ARG A 1 22  ? 199.775 11.673  119.600 1.00 161.69 ? 22  ARG A NE     1 
ATOM   356   C CZ     . ARG A 1 22  ? 200.459 12.333  120.533 1.00 160.86 ? 22  ARG A CZ     1 
ATOM   357   N NH1    . ARG A 1 22  ? 199.990 13.462  121.050 1.00 156.32 ? 22  ARG A NH1    1 
ATOM   358   N NH2    . ARG A 1 22  ? 201.623 11.857  120.952 1.00 164.03 ? 22  ARG A NH2    1 
ATOM   359   H H      . ARG A 1 22  ? 196.033 13.489  123.037 1.00 148.11 ? 22  ARG A H      1 
ATOM   360   H HA     . ARG A 1 22  ? 195.051 11.881  121.261 1.00 158.64 ? 22  ARG A HA     1 
ATOM   361   H HB2    . ARG A 1 22  ? 196.926 13.284  120.854 1.00 172.96 ? 22  ARG A HB2    1 
ATOM   362   H HB3    . ARG A 1 22  ? 197.812 12.275  121.700 1.00 172.96 ? 22  ARG A HB3    1 
ATOM   363   H HG2    . ARG A 1 22  ? 197.522 10.629  120.112 1.00 184.07 ? 22  ARG A HG2    1 
ATOM   364   H HG3    . ARG A 1 22  ? 196.524 11.558  119.294 1.00 184.07 ? 22  ARG A HG3    1 
ATOM   365   H HD2    . ARG A 1 22  ? 198.422 11.768  118.143 1.00 191.35 ? 22  ARG A HD2    1 
ATOM   366   H HD3    . ARG A 1 22  ? 198.450 13.061  119.069 1.00 191.35 ? 22  ARG A HD3    1 
ATOM   367   H HE     . ARG A 1 22  ? 200.118 10.946  119.294 1.00 194.02 ? 22  ARG A HE     1 
ATOM   368   H HH11   . ARG A 1 22  ? 199.236 13.777  120.783 1.00 187.58 ? 22  ARG A HH11   1 
ATOM   369   H HH12   . ARG A 1 22  ? 200.441 13.879  121.652 1.00 187.58 ? 22  ARG A HH12   1 
ATOM   370   H HH21   . ARG A 1 22  ? 201.934 11.126  120.622 1.00 196.84 ? 22  ARG A HH21   1 
ATOM   371   H HH22   . ARG A 1 22  ? 202.069 12.280  121.555 1.00 196.84 ? 22  ARG A HH22   1 
ATOM   372   N N      . LYS A 1 23  ? 196.533 10.412  123.644 1.00 113.38 ? 23  LYS A N      1 
ATOM   373   C CA     . LYS A 1 23  ? 196.653 9.133   124.323 1.00 105.56 ? 23  LYS A CA     1 
ATOM   374   C C      . LYS A 1 23  ? 195.271 8.486   124.396 1.00 104.21 ? 23  LYS A C      1 
ATOM   375   O O      . LYS A 1 23  ? 195.109 7.302   124.098 1.00 95.74  ? 23  LYS A O      1 
ATOM   376   C CB     . LYS A 1 23  ? 197.224 9.330   125.728 1.00 103.19 ? 23  LYS A CB     1 
ATOM   377   C CG     . LYS A 1 23  ? 197.399 8.042   126.525 1.00 104.48 ? 23  LYS A CG     1 
ATOM   378   C CD     . LYS A 1 23  ? 197.728 8.330   127.988 1.00 102.89 ? 23  LYS A CD     1 
ATOM   379   C CE     . LYS A 1 23  ? 197.765 7.057   128.829 1.00 99.30  ? 23  LYS A CE     1 
ATOM   380   N NZ     . LYS A 1 23  ? 197.966 7.347   130.280 1.00 94.62  ? 23  LYS A NZ     1 
ATOM   381   H H      . LYS A 1 23  ? 196.832 11.081  124.095 1.00 136.05 ? 23  LYS A H      1 
ATOM   382   H HA     . LYS A 1 23  ? 197.245 8.549   123.823 1.00 126.67 ? 23  LYS A HA     1 
ATOM   383   H HB2    . LYS A 1 23  ? 198.096 9.749   125.652 1.00 123.83 ? 23  LYS A HB2    1 
ATOM   384   H HB3    . LYS A 1 23  ? 196.626 9.907   126.228 1.00 123.83 ? 23  LYS A HB3    1 
ATOM   385   H HG2    . LYS A 1 23  ? 196.574 7.532   126.494 1.00 125.37 ? 23  LYS A HG2    1 
ATOM   386   H HG3    . LYS A 1 23  ? 198.128 7.526   126.146 1.00 125.37 ? 23  LYS A HG3    1 
ATOM   387   H HD2    . LYS A 1 23  ? 198.599 8.753   128.041 1.00 123.47 ? 23  LYS A HD2    1 
ATOM   388   H HD3    . LYS A 1 23  ? 197.049 8.916   128.357 1.00 123.47 ? 23  LYS A HD3    1 
ATOM   389   H HE2    . LYS A 1 23  ? 196.923 6.585   128.729 1.00 119.16 ? 23  LYS A HE2    1 
ATOM   390   H HE3    . LYS A 1 23  ? 198.499 6.499   128.529 1.00 119.16 ? 23  LYS A HE3    1 
ATOM   391   H HZ1    . LYS A 1 23  ? 197.983 6.587   130.742 1.00 113.55 ? 23  LYS A HZ1    1 
ATOM   392   H HZ2    . LYS A 1 23  ? 198.736 7.777   130.400 1.00 113.55 ? 23  LYS A HZ2    1 
ATOM   393   H HZ3    . LYS A 1 23  ? 197.301 7.855   130.583 1.00 113.55 ? 23  LYS A HZ3    1 
ATOM   394   N N      . GLY A 1 24  ? 194.276 9.286   124.773 1.00 114.42 ? 24  GLY A N      1 
ATOM   395   C CA     . GLY A 1 24  ? 192.912 8.809   124.912 1.00 118.54 ? 24  GLY A CA     1 
ATOM   396   C C      . GLY A 1 24  ? 192.182 8.722   123.586 1.00 119.05 ? 24  GLY A C      1 
ATOM   397   O O      . GLY A 1 24  ? 191.335 7.850   123.397 1.00 118.86 ? 24  GLY A O      1 
ATOM   398   H H      . GLY A 1 24  ? 194.372 10.121  124.955 1.00 137.30 ? 24  GLY A H      1 
ATOM   399   H HA2    . GLY A 1 24  ? 192.919 7.927   125.316 1.00 142.25 ? 24  GLY A HA2    1 
ATOM   400   H HA3    . GLY A 1 24  ? 192.420 9.409   125.493 1.00 142.25 ? 24  GLY A HA3    1 
ATOM   401   N N      . ARG A 1 25  ? 192.503 9.629   122.668 1.00 118.77 ? 25  ARG A N      1 
ATOM   402   C CA     . ARG A 1 25  ? 191.863 9.638   121.359 1.00 123.58 ? 25  ARG A CA     1 
ATOM   403   C C      . ARG A 1 25  ? 192.298 8.422   120.558 1.00 129.19 ? 25  ARG A C      1 
ATOM   404   O O      . ARG A 1 25  ? 191.498 7.826   119.839 1.00 129.93 ? 25  ARG A O      1 
ATOM   405   C CB     . ARG A 1 25  ? 192.202 10.916  120.589 1.00 126.87 ? 25  ARG A CB     1 
ATOM   406   C CG     . ARG A 1 25  ? 191.493 11.014  119.241 1.00 131.37 ? 25  ARG A CG     1 
ATOM   407   C CD     . ARG A 1 25  ? 191.685 12.369  118.569 1.00 135.53 ? 25  ARG A CD     1 
ATOM   408   N NE     . ARG A 1 25  ? 193.008 12.518  117.962 1.00 140.61 ? 25  ARG A NE     1 
ATOM   409   C CZ     . ARG A 1 25  ? 194.052 13.112  118.538 1.00 143.13 ? 25  ARG A CZ     1 
ATOM   410   N NH1    . ARG A 1 25  ? 193.955 13.633  119.757 1.00 141.49 ? 25  ARG A NH1    1 
ATOM   411   N NH2    . ARG A 1 25  ? 195.205 13.190  117.887 1.00 146.13 ? 25  ARG A NH2    1 
ATOM   412   H H      . ARG A 1 25  ? 193.088 10.249  122.780 1.00 142.53 ? 25  ARG A H      1 
ATOM   413   H HA     . ARG A 1 25  ? 190.901 9.599   121.474 1.00 148.30 ? 25  ARG A HA     1 
ATOM   414   H HB2    . ARG A 1 25  ? 191.938 11.683  121.121 1.00 152.24 ? 25  ARG A HB2    1 
ATOM   415   H HB3    . ARG A 1 25  ? 193.158 10.941  120.426 1.00 152.24 ? 25  ARG A HB3    1 
ATOM   416   H HG2    . ARG A 1 25  ? 191.847 10.332  118.648 1.00 157.64 ? 25  ARG A HG2    1 
ATOM   417   H HG3    . ARG A 1 25  ? 190.542 10.877  119.374 1.00 157.64 ? 25  ARG A HG3    1 
ATOM   418   H HD2    . ARG A 1 25  ? 191.021 12.471  117.870 1.00 162.64 ? 25  ARG A HD2    1 
ATOM   419   H HD3    . ARG A 1 25  ? 191.579 13.068  119.233 1.00 162.64 ? 25  ARG A HD3    1 
ATOM   420   H HE     . ARG A 1 25  ? 193.121 12.197  117.172 1.00 168.73 ? 25  ARG A HE     1 
ATOM   421   H HH11   . ARG A 1 25  ? 193.211 13.588  120.186 1.00 169.78 ? 25  ARG A HH11   1 
ATOM   422   H HH12   . ARG A 1 25  ? 194.637 14.014  120.117 1.00 169.78 ? 25  ARG A HH12   1 
ATOM   423   H HH21   . ARG A 1 25  ? 195.277 12.856  117.098 1.00 175.36 ? 25  ARG A HH21   1 
ATOM   424   H HH22   . ARG A 1 25  ? 195.882 13.572  118.255 1.00 175.36 ? 25  ARG A HH22   1 
ATOM   425   N N      . GLU A 1 26  ? 193.569 8.057   120.683 1.00 133.46 ? 26  GLU A N      1 
ATOM   426   C CA     . GLU A 1 26  ? 194.088 6.882   119.996 1.00 137.69 ? 26  GLU A CA     1 
ATOM   427   C C      . GLU A 1 26  ? 193.582 5.601   120.655 1.00 132.81 ? 26  GLU A C      1 
ATOM   428   O O      . GLU A 1 26  ? 193.618 4.535   120.050 1.00 139.71 ? 26  GLU A O      1 
ATOM   429   C CB     . GLU A 1 26  ? 195.619 6.904   119.959 1.00 143.92 ? 26  GLU A CB     1 
ATOM   430   C CG     . GLU A 1 26  ? 196.195 7.879   118.938 1.00 148.90 ? 26  GLU A CG     1 
ATOM   431   C CD     . GLU A 1 26  ? 197.711 7.875   118.911 1.00 153.51 ? 26  GLU A CD     1 
ATOM   432   O OE1    . GLU A 1 26  ? 198.286 7.883   117.802 1.00 155.88 ? 26  GLU A OE1    1 
ATOM   433   O OE2    . GLU A 1 26  ? 198.327 7.868   119.998 1.00 154.49 ? 26  GLU A OE2    1 
ATOM   434   H H      . GLU A 1 26  ? 194.151 8.474   121.160 1.00 160.15 ? 26  GLU A H      1 
ATOM   435   H HA     . GLU A 1 26  ? 193.769 6.890   119.080 1.00 165.23 ? 26  GLU A HA     1 
ATOM   436   H HB2    . GLU A 1 26  ? 195.949 7.161   120.834 1.00 172.70 ? 26  GLU A HB2    1 
ATOM   437   H HB3    . GLU A 1 26  ? 195.939 6.017   119.734 1.00 172.70 ? 26  GLU A HB3    1 
ATOM   438   H HG2    . GLU A 1 26  ? 195.878 7.635   118.054 1.00 178.68 ? 26  GLU A HG2    1 
ATOM   439   H HG3    . GLU A 1 26  ? 195.901 8.777   119.159 1.00 178.68 ? 26  GLU A HG3    1 
ATOM   440   N N      . ALA A 1 27  ? 193.104 5.710   121.891 1.00 119.16 ? 27  ALA A N      1 
ATOM   441   C CA     . ALA A 1 27  ? 192.535 4.563   122.592 1.00 110.54 ? 27  ALA A CA     1 
ATOM   442   C C      . ALA A 1 27  ? 191.048 4.442   122.269 1.00 111.86 ? 27  ALA A C      1 
ATOM   443   O O      . ALA A 1 27  ? 190.513 3.338   122.155 1.00 107.36 ? 27  ALA A O      1 
ATOM   444   C CB     . ALA A 1 27  ? 192.742 4.700   124.084 1.00 104.93 ? 27  ALA A CB     1 
ATOM   445   H H      . ALA A 1 27  ? 193.098 6.439   122.347 1.00 142.99 ? 27  ALA A H      1 
ATOM   446   H HA     . ALA A 1 27  ? 192.978 3.753   122.295 1.00 132.65 ? 27  ALA A HA     1 
ATOM   447   H HB1    . ALA A 1 27  ? 192.357 3.929   124.528 1.00 125.92 ? 27  ALA A HB1    1 
ATOM   448   H HB2    . ALA A 1 27  ? 193.693 4.747   124.267 1.00 125.92 ? 27  ALA A HB2    1 
ATOM   449   H HB3    . ALA A 1 27  ? 192.305 5.511   124.389 1.00 125.92 ? 27  ALA A HB3    1 
ATOM   450   N N      . GLU A 1 28  ? 190.390 5.591   122.129 1.00 120.87 ? 28  GLU A N      1 
ATOM   451   C CA     . GLU A 1 28  ? 188.974 5.649   121.779 1.00 126.27 ? 28  GLU A CA     1 
ATOM   452   C C      . GLU A 1 28  ? 188.749 5.054   120.395 1.00 130.72 ? 28  GLU A C      1 
ATOM   453   O O      . GLU A 1 28  ? 187.916 4.163   120.216 1.00 134.61 ? 28  GLU A O      1 
ATOM   454   C CB     . GLU A 1 28  ? 188.488 7.104   121.810 1.00 123.62 ? 28  GLU A CB     1 
ATOM   455   C CG     . GLU A 1 28  ? 187.058 7.328   121.310 1.00 121.71 ? 28  GLU A CG     1 
ATOM   456   C CD     . GLU A 1 28  ? 186.682 8.805   121.250 1.00 120.63 ? 28  GLU A CD     1 
ATOM   457   O OE1    . GLU A 1 28  ? 187.514 9.652   121.643 1.00 121.96 ? 28  GLU A OE1    1 
ATOM   458   O OE2    . GLU A 1 28  ? 185.556 9.124   120.809 1.00 118.13 ? 28  GLU A OE2    1 
ATOM   459   H H      . GLU A 1 28  ? 190.750 6.365   122.235 1.00 145.05 ? 28  GLU A H      1 
ATOM   460   H HA     . GLU A 1 28  ? 188.459 5.138   122.423 1.00 151.52 ? 28  GLU A HA     1 
ATOM   461   H HB2    . GLU A 1 28  ? 188.529 7.423   122.726 1.00 148.34 ? 28  GLU A HB2    1 
ATOM   462   H HB3    . GLU A 1 28  ? 189.078 7.638   121.255 1.00 148.34 ? 28  GLU A HB3    1 
ATOM   463   H HG2    . GLU A 1 28  ? 186.974 6.960   120.416 1.00 146.06 ? 28  GLU A HG2    1 
ATOM   464   H HG3    . GLU A 1 28  ? 186.439 6.884   121.911 1.00 146.06 ? 28  GLU A HG3    1 
ATOM   465   N N      . GLU A 1 29  ? 189.500 5.553   119.420 1.00 128.15 ? 29  GLU A N      1 
ATOM   466   C CA     . GLU A 1 29  ? 189.355 5.126   118.035 1.00 127.25 ? 29  GLU A CA     1 
ATOM   467   C C      . GLU A 1 29  ? 189.702 3.651   117.871 1.00 130.03 ? 29  GLU A C      1 
ATOM   468   O O      . GLU A 1 29  ? 189.055 2.938   117.108 1.00 125.97 ? 29  GLU A O      1 
ATOM   469   C CB     . GLU A 1 29  ? 190.238 5.983   117.126 1.00 126.96 ? 29  GLU A CB     1 
ATOM   470   C CG     . GLU A 1 29  ? 189.842 7.456   117.106 1.00 126.90 ? 29  GLU A CG     1 
ATOM   471   C CD     . GLU A 1 29  ? 190.857 8.330   116.397 1.00 129.51 ? 29  GLU A CD     1 
ATOM   472   O OE1    . GLU A 1 29  ? 191.758 7.781   115.730 1.00 132.52 ? 29  GLU A OE1    1 
ATOM   473   O OE2    . GLU A 1 29  ? 190.753 9.570   116.511 1.00 128.62 ? 29  GLU A OE2    1 
ATOM   474   H H      . GLU A 1 29  ? 190.109 6.149   119.537 1.00 153.78 ? 29  GLU A H      1 
ATOM   475   H HA     . GLU A 1 29  ? 188.433 5.249   117.761 1.00 152.70 ? 29  GLU A HA     1 
ATOM   476   H HB2    . GLU A 1 29  ? 191.156 5.926   117.436 1.00 152.35 ? 29  GLU A HB2    1 
ATOM   477   H HB3    . GLU A 1 29  ? 190.175 5.645   116.219 1.00 152.35 ? 29  GLU A HB3    1 
ATOM   478   H HG2    . GLU A 1 29  ? 188.994 7.548   116.645 1.00 152.28 ? 29  GLU A HG2    1 
ATOM   479   H HG3    . GLU A 1 29  ? 189.760 7.773   118.019 1.00 152.28 ? 29  GLU A HG3    1 
ATOM   480   N N      . GLU A 1 30  ? 190.715 3.194   118.601 1.00 138.19 ? 30  GLU A N      1 
ATOM   481   C CA     . GLU A 1 30  ? 191.144 1.802   118.519 1.00 145.28 ? 30  GLU A CA     1 
ATOM   482   C C      . GLU A 1 30  ? 190.224 0.874   119.306 1.00 144.40 ? 30  GLU A C      1 
ATOM   483   O O      . GLU A 1 30  ? 190.167 -0.325  119.038 1.00 147.30 ? 30  GLU A O      1 
ATOM   484   C CB     . GLU A 1 30  ? 192.583 1.654   119.019 1.00 149.45 ? 30  GLU A CB     1 
ATOM   485   C CG     . GLU A 1 30  ? 193.624 2.308   118.118 1.00 152.31 ? 30  GLU A CG     1 
ATOM   486   C CD     . GLU A 1 30  ? 193.714 1.667   116.747 1.00 154.27 ? 30  GLU A CD     1 
ATOM   487   O OE1    . GLU A 1 30  ? 193.228 0.527   116.582 1.00 153.55 ? 30  GLU A OE1    1 
ATOM   488   O OE2    . GLU A 1 30  ? 194.268 2.310   115.830 1.00 156.28 ? 30  GLU A OE2    1 
ATOM   489   H H      . GLU A 1 30  ? 191.171 3.671   119.152 1.00 165.82 ? 30  GLU A H      1 
ATOM   490   H HA     . GLU A 1 30  ? 191.123 1.523   117.591 1.00 174.34 ? 30  GLU A HA     1 
ATOM   491   H HB2    . GLU A 1 30  ? 192.652 2.062   119.896 1.00 179.34 ? 30  GLU A HB2    1 
ATOM   492   H HB3    . GLU A 1 30  ? 192.796 0.709   119.080 1.00 179.34 ? 30  GLU A HB3    1 
ATOM   493   H HG2    . GLU A 1 30  ? 193.393 3.242   117.996 1.00 182.77 ? 30  GLU A HG2    1 
ATOM   494   H HG3    . GLU A 1 30  ? 194.495 2.235   118.539 1.00 182.77 ? 30  GLU A HG3    1 
ATOM   495   N N      . LEU A 1 31  ? 189.506 1.426   120.279 1.00 139.33 ? 31  LEU A N      1 
ATOM   496   C CA     . LEU A 1 31  ? 188.557 0.639   121.055 1.00 134.50 ? 31  LEU A CA     1 
ATOM   497   C C      . LEU A 1 31  ? 187.283 0.403   120.250 1.00 139.40 ? 31  LEU A C      1 
ATOM   498   O O      . LEU A 1 31  ? 186.626 -0.627  120.399 1.00 137.80 ? 31  LEU A O      1 
ATOM   499   C CB     . LEU A 1 31  ? 188.232 1.339   122.377 1.00 125.37 ? 31  LEU A CB     1 
ATOM   500   C CG     . LEU A 1 31  ? 187.179 0.676   123.268 1.00 118.01 ? 31  LEU A CG     1 
ATOM   501   C CD1    . LEU A 1 31  ? 187.528 -0.775  123.564 1.00 118.36 ? 31  LEU A CD1    1 
ATOM   502   C CD2    . LEU A 1 31  ? 187.030 1.454   124.559 1.00 112.37 ? 31  LEU A CD2    1 
ATOM   503   H H      . LEU A 1 31  ? 189.551 2.254   120.508 1.00 167.19 ? 31  LEU A H      1 
ATOM   504   H HA     . LEU A 1 31  ? 188.950 -0.224  121.258 1.00 161.40 ? 31  LEU A HA     1 
ATOM   505   H HB2    . LEU A 1 31  ? 189.050 1.399   122.896 1.00 150.45 ? 31  LEU A HB2    1 
ATOM   506   H HB3    . LEU A 1 31  ? 187.915 2.233   122.175 1.00 150.45 ? 31  LEU A HB3    1 
ATOM   507   H HG     . LEU A 1 31  ? 186.324 0.690   122.809 1.00 141.61 ? 31  LEU A HG     1 
ATOM   508   H HD11   . LEU A 1 31  ? 186.838 -1.157  124.129 1.00 142.03 ? 31  LEU A HD11   1 
ATOM   509   H HD12   . LEU A 1 31  ? 187.580 -1.264  122.728 1.00 142.03 ? 31  LEU A HD12   1 
ATOM   510   H HD13   . LEU A 1 31  ? 188.384 -0.807  124.019 1.00 142.03 ? 31  LEU A HD13   1 
ATOM   511   H HD21   . LEU A 1 31  ? 186.360 1.022   125.112 1.00 134.84 ? 31  LEU A HD21   1 
ATOM   512   H HD22   . LEU A 1 31  ? 187.883 1.466   125.020 1.00 134.84 ? 31  LEU A HD22   1 
ATOM   513   H HD23   . LEU A 1 31  ? 186.754 2.360   124.351 1.00 134.84 ? 31  LEU A HD23   1 
ATOM   514   N N      . ARG A 1 32  ? 186.946 1.359   119.389 1.00 146.73 ? 32  ARG A N      1 
ATOM   515   C CA     . ARG A 1 32  ? 185.741 1.267   118.570 1.00 151.17 ? 32  ARG A CA     1 
ATOM   516   C C      . ARG A 1 32  ? 185.913 0.294   117.407 1.00 153.70 ? 32  ARG A C      1 
ATOM   517   O O      . ARG A 1 32  ? 185.009 -0.487  117.110 1.00 154.15 ? 32  ARG A O      1 
ATOM   518   C CB     . ARG A 1 32  ? 185.351 2.649   118.043 1.00 151.53 ? 32  ARG A CB     1 
ATOM   519   C CG     . ARG A 1 32  ? 184.768 3.558   119.105 1.00 149.14 ? 32  ARG A CG     1 
ATOM   520   C CD     . ARG A 1 32  ? 184.547 4.960   118.578 1.00 147.85 ? 32  ARG A CD     1 
ATOM   521   N NE     . ARG A 1 32  ? 183.931 5.821   119.582 1.00 145.56 ? 32  ARG A NE     1 
ATOM   522   C CZ     . ARG A 1 32  ? 183.744 7.128   119.434 1.00 145.09 ? 32  ARG A CZ     1 
ATOM   523   N NH1    . ARG A 1 32  ? 184.131 7.736   118.320 1.00 147.70 ? 32  ARG A NH1    1 
ATOM   524   N NH2    . ARG A 1 32  ? 183.173 7.829   120.404 1.00 142.29 ? 32  ARG A NH2    1 
ATOM   525   H H      . ARG A 1 32  ? 187.402 2.076   119.260 1.00 176.08 ? 32  ARG A H      1 
ATOM   526   H HA     . ARG A 1 32  ? 185.012 0.943   119.122 1.00 181.41 ? 32  ARG A HA     1 
ATOM   527   H HB2    . ARG A 1 32  ? 186.141 3.081   117.683 1.00 181.84 ? 32  ARG A HB2    1 
ATOM   528   H HB3    . ARG A 1 32  ? 184.687 2.542   117.345 1.00 181.84 ? 32  ARG A HB3    1 
ATOM   529   H HG2    . ARG A 1 32  ? 183.912 3.204   119.395 1.00 178.97 ? 32  ARG A HG2    1 
ATOM   530   H HG3    . ARG A 1 32  ? 185.381 3.609   119.855 1.00 178.97 ? 32  ARG A HG3    1 
ATOM   531   H HD2    . ARG A 1 32  ? 185.401 5.346   118.330 1.00 177.42 ? 32  ARG A HD2    1 
ATOM   532   H HD3    . ARG A 1 32  ? 183.959 4.923   117.808 1.00 177.42 ? 32  ARG A HD3    1 
ATOM   533   H HE     . ARG A 1 32  ? 183.673 5.459   120.318 1.00 174.68 ? 32  ARG A HE     1 
ATOM   534   H HH11   . ARG A 1 32  ? 184.501 7.284   117.689 1.00 177.24 ? 32  ARG A HH11   1 
ATOM   535   H HH12   . ARG A 1 32  ? 184.009 8.582   118.228 1.00 177.24 ? 32  ARG A HH12   1 
ATOM   536   H HH21   . ARG A 1 32  ? 182.923 7.437   121.127 1.00 170.75 ? 32  ARG A HH21   1 
ATOM   537   H HH22   . ARG A 1 32  ? 183.053 8.675   120.309 1.00 170.75 ? 32  ARG A HH22   1 
ATOM   538   N N      . ARG A 1 33  ? 187.070 0.345   116.751 1.00 155.14 ? 33  ARG A N      1 
ATOM   539   C CA     . ARG A 1 33  ? 187.355 -0.551  115.633 1.00 157.62 ? 33  ARG A CA     1 
ATOM   540   C C      . ARG A 1 33  ? 187.255 -2.014  116.060 1.00 156.90 ? 33  ARG A C      1 
ATOM   541   O O      . ARG A 1 33  ? 186.912 -2.883  115.257 1.00 160.95 ? 33  ARG A O      1 
ATOM   542   C CB     . ARG A 1 33  ? 188.747 -0.275  115.054 1.00 159.77 ? 33  ARG A CB     1 
ATOM   543   C CG     . ARG A 1 33  ? 188.871 1.050   114.316 1.00 160.69 ? 33  ARG A CG     1 
ATOM   544   C CD     . ARG A 1 33  ? 190.061 1.048   113.370 1.00 163.91 ? 33  ARG A CD     1 
ATOM   545   N NE     . ARG A 1 33  ? 191.294 0.616   114.024 1.00 166.94 ? 33  ARG A NE     1 
ATOM   546   C CZ     . ARG A 1 33  ? 192.442 0.395   113.388 1.00 172.20 ? 33  ARG A CZ     1 
ATOM   547   N NH1    . ARG A 1 33  ? 192.523 0.564   112.074 1.00 175.69 ? 33  ARG A NH1    1 
ATOM   548   N NH2    . ARG A 1 33  ? 193.511 0.002   114.064 1.00 173.10 ? 33  ARG A NH2    1 
ATOM   549   H H      . ARG A 1 33  ? 187.708 0.891   116.935 1.00 186.16 ? 33  ARG A H      1 
ATOM   550   H HA     . ARG A 1 33  ? 186.703 -0.398  114.931 1.00 189.15 ? 33  ARG A HA     1 
ATOM   551   H HB2    . ARG A 1 33  ? 189.389 -0.269  115.780 1.00 191.73 ? 33  ARG A HB2    1 
ATOM   552   H HB3    . ARG A 1 33  ? 188.968 -0.982  114.428 1.00 191.73 ? 33  ARG A HB3    1 
ATOM   553   H HG2    . ARG A 1 33  ? 188.068 1.203   113.794 1.00 192.83 ? 33  ARG A HG2    1 
ATOM   554   H HG3    . ARG A 1 33  ? 188.995 1.765   114.959 1.00 192.83 ? 33  ARG A HG3    1 
ATOM   555   H HD2    . ARG A 1 33  ? 189.882 0.440   112.635 1.00 196.69 ? 33  ARG A HD2    1 
ATOM   556   H HD3    . ARG A 1 33  ? 190.199 1.947   113.032 1.00 196.69 ? 33  ARG A HD3    1 
ATOM   557   H HE     . ARG A 1 33  ? 191.277 0.497   114.876 1.00 200.33 ? 33  ARG A HE     1 
ATOM   558   H HH11   . ARG A 1 33  ? 191.832 0.818   111.629 1.00 210.83 ? 33  ARG A HH11   1 
ATOM   559   H HH12   . ARG A 1 33  ? 193.267 0.420   111.667 1.00 210.83 ? 33  ARG A HH12   1 
ATOM   560   H HH21   . ARG A 1 33  ? 193.465 -0.109  114.916 1.00 207.72 ? 33  ARG A HH21   1 
ATOM   561   H HH22   . ARG A 1 33  ? 194.253 -0.140  113.652 1.00 207.72 ? 33  ARG A HH22   1 
ATOM   562   N N      . ARG A 1 34  ? 187.554 -2.279  117.328 1.00 150.50 ? 34  ARG A N      1 
ATOM   563   C CA     . ARG A 1 34  ? 187.475 -3.629  117.869 1.00 147.75 ? 34  ARG A CA     1 
ATOM   564   C C      . ARG A 1 34  ? 186.036 -3.978  118.232 1.00 150.90 ? 34  ARG A C      1 
ATOM   565   O O      . ARG A 1 34  ? 185.592 -5.103  118.018 1.00 149.92 ? 34  ARG A O      1 
ATOM   566   C CB     . ARG A 1 34  ? 188.374 -3.763  119.100 1.00 143.64 ? 34  ARG A CB     1 
ATOM   567   C CG     . ARG A 1 34  ? 189.852 -3.560  118.807 1.00 143.34 ? 34  ARG A CG     1 
ATOM   568   C CD     . ARG A 1 34  ? 190.674 -3.521  120.087 1.00 141.03 ? 34  ARG A CD     1 
ATOM   569   N NE     . ARG A 1 34  ? 192.075 -3.194  119.834 1.00 138.93 ? 34  ARG A NE     1 
ATOM   570   C CZ     . ARG A 1 34  ? 193.007 -3.098  120.778 1.00 134.98 ? 34  ARG A CZ     1 
ATOM   571   N NH1    . ARG A 1 34  ? 192.700 -3.307  122.052 1.00 129.19 ? 34  ARG A NH1    1 
ATOM   572   N NH2    . ARG A 1 34  ? 194.254 -2.793  120.447 1.00 138.00 ? 34  ARG A NH2    1 
ATOM   573   H H      . ARG A 1 34  ? 187.808 -1.687  117.899 1.00 180.60 ? 34  ARG A H      1 
ATOM   574   H HA     . ARG A 1 34  ? 187.781 -4.260  117.200 1.00 177.30 ? 34  ARG A HA     1 
ATOM   575   H HB2    . ARG A 1 34  ? 188.108 -3.099  119.755 1.00 172.37 ? 34  ARG A HB2    1 
ATOM   576   H HB3    . ARG A 1 34  ? 188.265 -4.652  119.471 1.00 172.37 ? 34  ARG A HB3    1 
ATOM   577   H HG2    . ARG A 1 34  ? 190.174 -4.294  118.261 1.00 172.00 ? 34  ARG A HG2    1 
ATOM   578   H HG3    . ARG A 1 34  ? 189.974 -2.717  118.342 1.00 172.00 ? 34  ARG A HG3    1 
ATOM   579   H HD2    . ARG A 1 34  ? 190.309 -2.845  120.679 1.00 169.23 ? 34  ARG A HD2    1 
ATOM   580   H HD3    . ARG A 1 34  ? 190.640 -4.392  120.513 1.00 169.23 ? 34  ARG A HD3    1 
ATOM   581   H HE     . ARG A 1 34  ? 192.314 -3.054  119.019 1.00 166.71 ? 34  ARG A HE     1 
ATOM   582   H HH11   . ARG A 1 34  ? 191.892 -3.504  122.272 1.00 155.02 ? 34  ARG A HH11   1 
ATOM   583   H HH12   . ARG A 1 34  ? 193.308 -3.243  122.657 1.00 155.02 ? 34  ARG A HH12   1 
ATOM   584   H HH21   . ARG A 1 34  ? 194.459 -2.658  119.623 1.00 165.60 ? 34  ARG A HH21   1 
ATOM   585   H HH22   . ARG A 1 34  ? 194.858 -2.732  121.057 1.00 165.60 ? 34  ARG A HH22   1 
ATOM   586   N N      . LEU A 1 35  ? 185.311 -3.007  118.777 1.00 156.63 ? 35  LEU A N      1 
ATOM   587   C CA     . LEU A 1 35  ? 183.925 -3.222  119.181 1.00 160.75 ? 35  LEU A CA     1 
ATOM   588   C C      . LEU A 1 35  ? 183.000 -3.410  117.981 1.00 164.07 ? 35  LEU A C      1 
ATOM   589   O O      . LEU A 1 35  ? 181.937 -4.023  118.100 1.00 168.75 ? 35  LEU A O      1 
ATOM   590   C CB     . LEU A 1 35  ? 183.429 -2.049  120.028 1.00 158.83 ? 35  LEU A CB     1 
ATOM   591   C CG     . LEU A 1 35  ? 183.929 -1.990  121.472 1.00 156.64 ? 35  LEU A CG     1 
ATOM   592   C CD1    . LEU A 1 35  ? 183.591 -0.645  122.090 1.00 153.48 ? 35  LEU A CD1    1 
ATOM   593   C CD2    . LEU A 1 35  ? 183.334 -3.120  122.299 1.00 156.91 ? 35  LEU A CD2    1 
ATOM   594   H H      . LEU A 1 35  ? 185.599 -2.210  118.925 1.00 187.96 ? 35  LEU A H      1 
ATOM   595   H HA     . LEU A 1 35  ? 183.876 -4.025  119.724 1.00 192.90 ? 35  LEU A HA     1 
ATOM   596   H HB2    . LEU A 1 35  ? 183.703 -1.225  119.595 1.00 190.60 ? 35  LEU A HB2    1 
ATOM   597   H HB3    . LEU A 1 35  ? 182.460 -2.087  120.061 1.00 190.60 ? 35  LEU A HB3    1 
ATOM   598   H HG     . LEU A 1 35  ? 184.894 -2.090  121.478 1.00 187.96 ? 35  LEU A HG     1 
ATOM   599   H HD11   . LEU A 1 35  ? 183.916 -0.627  123.004 1.00 184.17 ? 35  LEU A HD11   1 
ATOM   600   H HD12   . LEU A 1 35  ? 184.018 0.056   121.573 1.00 184.17 ? 35  LEU A HD12   1 
ATOM   601   H HD13   . LEU A 1 35  ? 182.628 -0.525  122.078 1.00 184.17 ? 35  LEU A HD13   1 
ATOM   602   H HD21   . LEU A 1 35  ? 183.668 -3.056  123.207 1.00 188.29 ? 35  LEU A HD21   1 
ATOM   603   H HD22   . LEU A 1 35  ? 182.367 -3.037  122.296 1.00 188.29 ? 35  LEU A HD22   1 
ATOM   604   H HD23   . LEU A 1 35  ? 183.595 -3.968  121.908 1.00 188.29 ? 35  LEU A HD23   1 
ATOM   605   N N      . ASP A 1 36  ? 183.404 -2.880  116.829 1.00 159.80 ? 36  ASP A N      1 
ATOM   606   C CA     . ASP A 1 36  ? 182.586 -2.954  115.621 1.00 155.62 ? 36  ASP A CA     1 
ATOM   607   C C      . ASP A 1 36  ? 182.724 -4.303  114.918 1.00 155.47 ? 36  ASP A C      1 
ATOM   608   O O      . ASP A 1 36  ? 181.765 -4.800  114.327 1.00 156.26 ? 36  ASP A O      1 
ATOM   609   C CB     . ASP A 1 36  ? 182.962 -1.830  114.651 1.00 153.58 ? 36  ASP A CB     1 
ATOM   610   C CG     . ASP A 1 36  ? 182.610 -0.453  115.184 1.00 150.56 ? 36  ASP A CG     1 
ATOM   611   O OD1    . ASP A 1 36  ? 181.609 -0.332  115.921 1.00 148.72 ? 36  ASP A OD1    1 
ATOM   612   O OD2    . ASP A 1 36  ? 183.333 0.513   114.859 1.00 150.40 ? 36  ASP A OD2    1 
ATOM   613   H H      . ASP A 1 36  ? 184.152 -2.470  116.721 1.00 191.76 ? 36  ASP A H      1 
ATOM   614   H HA     . ASP A 1 36  ? 181.655 -2.839  115.865 1.00 186.74 ? 36  ASP A HA     1 
ATOM   615   H HB2    . ASP A 1 36  ? 183.918 -1.855  114.492 1.00 184.29 ? 36  ASP A HB2    1 
ATOM   616   H HB3    . ASP A 1 36  ? 182.484 -1.960  113.816 1.00 184.29 ? 36  ASP A HB3    1 
ATOM   617   N N      . GLU A 1 37  ? 183.915 -4.890  114.981 1.00 154.29 ? 37  GLU A N      1 
ATOM   618   C CA     . GLU A 1 37  ? 184.182 -6.158  114.306 1.00 154.41 ? 37  GLU A CA     1 
ATOM   619   C C      . GLU A 1 37  ? 183.379 -7.303  114.924 1.00 153.24 ? 37  GLU A C      1 
ATOM   620   O O      . GLU A 1 37  ? 183.135 -8.321  114.274 1.00 157.20 ? 37  GLU A O      1 
ATOM   621   C CB     . GLU A 1 37  ? 185.679 -6.483  114.344 1.00 155.37 ? 37  GLU A CB     1 
ATOM   622   C CG     . GLU A 1 37  ? 186.066 -7.714  113.532 1.00 158.13 ? 37  GLU A CG     1 
ATOM   623   C CD     . GLU A 1 37  ? 187.565 -7.953  113.497 1.00 161.08 ? 37  GLU A CD     1 
ATOM   624   O OE1    . GLU A 1 37  ? 188.322 -7.091  113.993 1.00 162.63 ? 37  GLU A OE1    1 
ATOM   625   O OE2    . GLU A 1 37  ? 187.988 -9.005  112.974 1.00 161.79 ? 37  GLU A OE2    1 
ATOM   626   H H      . GLU A 1 37  ? 184.590 -4.573  115.411 1.00 185.14 ? 37  GLU A H      1 
ATOM   627   H HA     . GLU A 1 37  ? 183.918 -6.079  113.376 1.00 185.29 ? 37  GLU A HA     1 
ATOM   628   H HB2    . GLU A 1 37  ? 186.171 -5.727  113.987 1.00 186.45 ? 37  GLU A HB2    1 
ATOM   629   H HB3    . GLU A 1 37  ? 185.941 -6.640  115.264 1.00 186.45 ? 37  GLU A HB3    1 
ATOM   630   H HG2    . GLU A 1 37  ? 185.648 -8.496  113.927 1.00 189.75 ? 37  GLU A HG2    1 
ATOM   631   H HG3    . GLU A 1 37  ? 185.760 -7.599  112.619 1.00 189.75 ? 37  GLU A HG3    1 
ATOM   632   N N      . LEU A 1 38  ? 182.972 -7.132  116.180 1.00 146.73 ? 38  LEU A N      1 
ATOM   633   C CA     . LEU A 1 38  ? 182.150 -8.127  116.864 1.00 139.81 ? 38  LEU A CA     1 
ATOM   634   C C      . LEU A 1 38  ? 180.672 -7.941  116.518 1.00 134.88 ? 38  LEU A C      1 
ATOM   635   O O      . LEU A 1 38  ? 179.916 -8.911  116.453 1.00 138.24 ? 38  LEU A O      1 
ATOM   636   C CB     . LEU A 1 38  ? 182.358 -8.048  118.381 1.00 135.23 ? 38  LEU A CB     1 
ATOM   637   C CG     . LEU A 1 38  ? 183.542 -8.843  118.943 1.00 134.27 ? 38  LEU A CG     1 
ATOM   638   C CD1    . LEU A 1 38  ? 184.860 -8.390  118.330 1.00 137.13 ? 38  LEU A CD1    1 
ATOM   639   C CD2    . LEU A 1 38  ? 183.594 -8.733  120.458 1.00 130.14 ? 38  LEU A CD2    1 
ATOM   640   H H      . LEU A 1 38  ? 183.159 -6.444  116.660 1.00 176.08 ? 38  LEU A H      1 
ATOM   641   H HA     . LEU A 1 38  ? 182.417 -9.012  116.571 1.00 167.77 ? 38  LEU A HA     1 
ATOM   642   H HB2    . LEU A 1 38  ? 182.495 -7.118  118.621 1.00 162.27 ? 38  LEU A HB2    1 
ATOM   643   H HB3    . LEU A 1 38  ? 181.556 -8.378  118.816 1.00 162.27 ? 38  LEU A HB3    1 
ATOM   644   H HG     . LEU A 1 38  ? 183.421 -9.779  118.720 1.00 161.12 ? 38  LEU A HG     1 
ATOM   645   H HD11   . LEU A 1 38  ? 185.582 -8.915  118.710 1.00 164.55 ? 38  LEU A HD11   1 
ATOM   646   H HD12   . LEU A 1 38  ? 184.824 -8.523  117.370 1.00 164.55 ? 38  LEU A HD12   1 
ATOM   647   H HD13   . LEU A 1 38  ? 184.994 -7.450  118.530 1.00 164.55 ? 38  LEU A HD13   1 
ATOM   648   H HD21   . LEU A 1 38  ? 184.351 -9.244  120.785 1.00 156.17 ? 38  LEU A HD21   1 
ATOM   649   H HD22   . LEU A 1 38  ? 183.694 -7.800  120.703 1.00 156.17 ? 38  LEU A HD22   1 
ATOM   650   H HD23   . LEU A 1 38  ? 182.771 -9.086  120.828 1.00 156.17 ? 38  LEU A HD23   1 
ATOM   651   N N      . GLY A 1 39  ? 180.269 -6.693  116.297 1.00 125.74 ? 39  GLY A N      1 
ATOM   652   C CA     . GLY A 1 39  ? 178.907 -6.385  115.896 1.00 124.52 ? 39  GLY A CA     1 
ATOM   653   C C      . GLY A 1 39  ? 177.949 -6.270  117.068 1.00 134.45 ? 39  GLY A C      1 
ATOM   654   O O      . GLY A 1 39  ? 176.803 -6.715  116.986 1.00 119.52 ? 39  GLY A O      1 
ATOM   655   H H      . GLY A 1 39  ? 180.774 -6.001  116.374 1.00 150.88 ? 39  GLY A H      1 
ATOM   656   H HA2    . GLY A 1 39  ? 178.897 -5.545  115.412 1.00 149.42 ? 39  GLY A HA2    1 
ATOM   657   H HA3    . GLY A 1 39  ? 178.582 -7.082  115.305 1.00 149.42 ? 39  GLY A HA3    1 
ATOM   658   N N      . VAL A 1 40  ? 178.422 -5.666  118.155 1.00 166.45 ? 40  VAL A N      1 
ATOM   659   C CA     . VAL A 1 40  ? 177.619 -5.482  119.362 1.00 185.80 ? 40  VAL A CA     1 
ATOM   660   C C      . VAL A 1 40  ? 177.220 -4.015  119.511 1.00 180.07 ? 40  VAL A C      1 
ATOM   661   O O      . VAL A 1 40  ? 177.961 -3.121  119.101 1.00 190.58 ? 40  VAL A O      1 
ATOM   662   C CB     . VAL A 1 40  ? 178.390 -5.941  120.626 1.00 198.00 ? 40  VAL A CB     1 
ATOM   663   C CG1    . VAL A 1 40  ? 179.685 -5.147  120.798 1.00 202.08 ? 40  VAL A CG1    1 
ATOM   664   C CG2    . VAL A 1 40  ? 177.511 -5.831  121.871 1.00 198.80 ? 40  VAL A CG2    1 
ATOM   665   H H      . VAL A 1 40  ? 179.219 -5.349  118.220 1.00 199.74 ? 40  VAL A H      1 
ATOM   666   H HA     . VAL A 1 40  ? 176.809 -6.011  119.291 1.00 222.96 ? 40  VAL A HA     1 
ATOM   667   H HB     . VAL A 1 40  ? 178.630 -6.875  120.518 1.00 237.60 ? 40  VAL A HB     1 
ATOM   668   H HG11   . VAL A 1 40  ? 180.142 -5.458  121.595 1.00 242.49 ? 40  VAL A HG11   1 
ATOM   669   H HG12   . VAL A 1 40  ? 180.246 -5.286  120.018 1.00 242.49 ? 40  VAL A HG12   1 
ATOM   670   H HG13   . VAL A 1 40  ? 179.468 -4.206  120.886 1.00 242.49 ? 40  VAL A HG13   1 
ATOM   671   H HG21   . VAL A 1 40  ? 178.020 -6.125  122.643 1.00 238.57 ? 40  VAL A HG21   1 
ATOM   672   H HG22   . VAL A 1 40  ? 177.241 -4.907  121.985 1.00 238.57 ? 40  VAL A HG22   1 
ATOM   673   H HG23   . VAL A 1 40  ? 176.730 -6.394  121.756 1.00 238.57 ? 40  VAL A HG23   1 
ATOM   674   N N      . GLU A 1 41  ? 176.047 -3.774  120.090 1.00 157.61 ? 41  GLU A N      1 
ATOM   675   C CA     . GLU A 1 41  ? 175.591 -2.411  120.348 1.00 140.34 ? 41  GLU A CA     1 
ATOM   676   C C      . GLU A 1 41  ? 176.258 -1.852  121.603 1.00 131.88 ? 41  GLU A C      1 
ATOM   677   O O      . GLU A 1 41  ? 176.195 -2.461  122.672 1.00 126.86 ? 41  GLU A O      1 
ATOM   678   C CB     . GLU A 1 41  ? 174.072 -2.369  120.511 1.00 136.33 ? 41  GLU A CB     1 
ATOM   679   C CG     . GLU A 1 41  ? 173.297 -2.793  119.276 1.00 136.54 ? 41  GLU A CG     1 
ATOM   680   C CD     . GLU A 1 41  ? 171.797 -2.614  119.436 1.00 136.74 ? 41  GLU A CD     1 
ATOM   681   O OE1    . GLU A 1 41  ? 171.374 -1.848  120.330 1.00 133.50 ? 41  GLU A OE1    1 
ATOM   682   O OE2    . GLU A 1 41  ? 171.039 -3.242  118.667 1.00 140.13 ? 41  GLU A OE2    1 
ATOM   683   H H      . GLU A 1 41  ? 175.495 -4.383  120.343 1.00 189.13 ? 41  GLU A H      1 
ATOM   684   H HA     . GLU A 1 41  ? 175.833 -1.846  119.598 1.00 168.41 ? 41  GLU A HA     1 
ATOM   685   H HB2    . GLU A 1 41  ? 173.821 -2.964  121.235 1.00 163.60 ? 41  GLU A HB2    1 
ATOM   686   H HB3    . GLU A 1 41  ? 173.808 -1.461  120.727 1.00 163.60 ? 41  GLU A HB3    1 
ATOM   687   H HG2    . GLU A 1 41  ? 173.585 -2.255  118.522 1.00 163.84 ? 41  GLU A HG2    1 
ATOM   688   H HG3    . GLU A 1 41  ? 173.471 -3.731  119.100 1.00 163.84 ? 41  GLU A HG3    1 
ATOM   689   N N      . TYR A 1 42  ? 176.891 -0.691  121.461 1.00 130.66 ? 42  TYR A N      1 
ATOM   690   C CA     . TYR A 1 42  ? 177.592 -0.045  122.565 1.00 126.54 ? 42  TYR A CA     1 
ATOM   691   C C      . TYR A 1 42  ? 177.434 1.468   122.475 1.00 121.07 ? 42  TYR A C      1 
ATOM   692   O O      . TYR A 1 42  ? 176.985 1.994   121.458 1.00 125.10 ? 42  TYR A O      1 
ATOM   693   C CB     . TYR A 1 42  ? 179.079 -0.410  122.542 1.00 129.18 ? 42  TYR A CB     1 
ATOM   694   C CG     . TYR A 1 42  ? 179.818 0.102   121.323 1.00 132.56 ? 42  TYR A CG     1 
ATOM   695   C CD1    . TYR A 1 42  ? 179.824 -0.619  120.134 1.00 135.76 ? 42  TYR A CD1    1 
ATOM   696   C CD2    . TYR A 1 42  ? 180.512 1.304   121.360 1.00 132.53 ? 42  TYR A CD2    1 
ATOM   697   C CE1    . TYR A 1 42  ? 180.498 -0.155  119.019 1.00 137.48 ? 42  TYR A CE1    1 
ATOM   698   C CE2    . TYR A 1 42  ? 181.188 1.776   120.249 1.00 134.31 ? 42  TYR A CE2    1 
ATOM   699   C CZ     . TYR A 1 42  ? 181.180 1.043   119.083 1.00 136.15 ? 42  TYR A CZ     1 
ATOM   700   O OH     . TYR A 1 42  ? 181.855 1.514   117.980 1.00 136.21 ? 42  TYR A OH     1 
ATOM   701   H H      . TYR A 1 42  ? 176.930 -0.252  120.723 1.00 156.79 ? 42  TYR A H      1 
ATOM   702   H HA     . TYR A 1 42  ? 177.215 -0.344  123.407 1.00 151.84 ? 42  TYR A HA     1 
ATOM   703   H HB2    . TYR A 1 42  ? 179.505 -0.032  123.327 1.00 155.01 ? 42  TYR A HB2    1 
ATOM   704   H HB3    . TYR A 1 42  ? 179.163 -1.376  122.555 1.00 155.01 ? 42  TYR A HB3    1 
ATOM   705   H HD1    . TYR A 1 42  ? 179.366 -1.427  120.088 1.00 162.91 ? 42  TYR A HD1    1 
ATOM   706   H HD2    . TYR A 1 42  ? 180.520 1.802   122.146 1.00 159.04 ? 42  TYR A HD2    1 
ATOM   707   H HE1    . TYR A 1 42  ? 180.493 -0.648  118.231 1.00 164.97 ? 42  TYR A HE1    1 
ATOM   708   H HE2    . TYR A 1 42  ? 181.649 2.583   120.290 1.00 161.17 ? 42  TYR A HE2    1 
ATOM   709   H HH     . TYR A 1 42  ? 181.770 0.976   117.340 1.00 163.45 ? 42  TYR A HH     1 
ATOM   710   N N      . VAL A 1 43  ? 177.803 2.161   123.548 1.00 112.30 ? 43  VAL A N      1 
ATOM   711   C CA     . VAL A 1 43  ? 177.752 3.618   123.581 1.00 104.39 ? 43  VAL A CA     1 
ATOM   712   C C      . VAL A 1 43  ? 178.837 4.144   124.511 1.00 98.30  ? 43  VAL A C      1 
ATOM   713   O O      . VAL A 1 43  ? 179.047 3.614   125.603 1.00 93.18  ? 43  VAL A O      1 
ATOM   714   C CB     . VAL A 1 43  ? 176.360 4.145   124.036 1.00 79.21  ? 43  VAL A CB     1 
ATOM   715   C CG1    . VAL A 1 43  ? 175.957 3.535   125.375 1.00 80.39  ? 43  VAL A CG1    1 
ATOM   716   C CG2    . VAL A 1 43  ? 176.347 5.676   124.105 1.00 75.16  ? 43  VAL A CG2    1 
ATOM   717   H H      . VAL A 1 43  ? 178.088 1.806   124.277 1.00 134.76 ? 43  VAL A H      1 
ATOM   718   H HA     . VAL A 1 43  ? 177.927 3.961   122.690 1.00 125.26 ? 43  VAL A HA     1 
ATOM   719   H HB     . VAL A 1 43  ? 175.698 3.876   123.380 1.00 95.06  ? 43  VAL A HB     1 
ATOM   720   H HG11   . VAL A 1 43  ? 175.088 3.882   125.631 1.00 96.47  ? 43  VAL A HG11   1 
ATOM   721   H HG12   . VAL A 1 43  ? 175.915 2.571   125.282 1.00 96.47  ? 43  VAL A HG12   1 
ATOM   722   H HG13   . VAL A 1 43  ? 176.619 3.775   126.043 1.00 96.47  ? 43  VAL A HG13   1 
ATOM   723   H HG21   . VAL A 1 43  ? 175.469 5.972   124.391 1.00 90.19  ? 43  VAL A HG21   1 
ATOM   724   H HG22   . VAL A 1 43  ? 177.018 5.968   124.741 1.00 90.19  ? 43  VAL A HG22   1 
ATOM   725   H HG23   . VAL A 1 43  ? 176.547 6.033   123.226 1.00 90.19  ? 43  VAL A HG23   1 
ATOM   726   N N      . PHE A 1 44  ? 179.531 5.183   124.061 1.00 100.16 ? 44  PHE A N      1 
ATOM   727   C CA     . PHE A 1 44  ? 180.551 5.831   124.868 1.00 101.42 ? 44  PHE A CA     1 
ATOM   728   C C      . PHE A 1 44  ? 179.908 6.896   125.744 1.00 95.15  ? 44  PHE A C      1 
ATOM   729   O O      . PHE A 1 44  ? 179.526 7.960   125.261 1.00 97.52  ? 44  PHE A O      1 
ATOM   730   C CB     . PHE A 1 44  ? 181.622 6.455   123.972 1.00 110.20 ? 44  PHE A CB     1 
ATOM   731   C CG     . PHE A 1 44  ? 182.669 5.481   123.508 1.00 120.66 ? 44  PHE A CG     1 
ATOM   732   C CD1    . PHE A 1 44  ? 182.353 4.474   122.611 1.00 126.36 ? 44  PHE A CD1    1 
ATOM   733   C CD2    . PHE A 1 44  ? 183.972 5.577   123.964 1.00 124.53 ? 44  PHE A CD2    1 
ATOM   734   C CE1    . PHE A 1 44  ? 183.319 3.579   122.184 1.00 130.00 ? 44  PHE A CE1    1 
ATOM   735   C CE2    . PHE A 1 44  ? 184.942 4.686   123.538 1.00 128.11 ? 44  PHE A CE2    1 
ATOM   736   C CZ     . PHE A 1 44  ? 184.614 3.687   122.649 1.00 130.31 ? 44  PHE A CZ     1 
ATOM   737   H H      . PHE A 1 44  ? 179.428 5.533   123.282 1.00 120.20 ? 44  PHE A H      1 
ATOM   738   H HA     . PHE A 1 44  ? 180.975 5.174   125.442 1.00 121.70 ? 44  PHE A HA     1 
ATOM   739   H HB2    . PHE A 1 44  ? 181.193 6.827   123.186 1.00 132.24 ? 44  PHE A HB2    1 
ATOM   740   H HB3    . PHE A 1 44  ? 182.070 7.160   124.466 1.00 132.24 ? 44  PHE A HB3    1 
ATOM   741   H HD1    . PHE A 1 44  ? 181.482 4.396   122.295 1.00 151.63 ? 44  PHE A HD1    1 
ATOM   742   H HD2    . PHE A 1 44  ? 184.200 6.250   124.565 1.00 149.43 ? 44  PHE A HD2    1 
ATOM   743   H HE1    . PHE A 1 44  ? 183.095 2.906   121.583 1.00 156.00 ? 44  PHE A HE1    1 
ATOM   744   H HE2    . PHE A 1 44  ? 185.813 4.760   123.853 1.00 153.73 ? 44  PHE A HE2    1 
ATOM   745   H HZ     . PHE A 1 44  ? 185.263 3.086   122.362 1.00 156.37 ? 44  PHE A HZ     1 
ATOM   746   N N      . VAL A 1 45  ? 179.778 6.591   127.032 1.00 87.23  ? 45  VAL A N      1 
ATOM   747   C CA     . VAL A 1 45  ? 179.269 7.541   128.012 1.00 83.31  ? 45  VAL A CA     1 
ATOM   748   C C      . VAL A 1 45  ? 180.377 7.975   128.964 1.00 90.46  ? 45  VAL A C      1 
ATOM   749   O O      . VAL A 1 45  ? 181.528 7.553   128.833 1.00 95.50  ? 45  VAL A O      1 
ATOM   750   C CB     . VAL A 1 45  ? 178.133 6.928   128.844 1.00 77.32  ? 45  VAL A CB     1 
ATOM   751   C CG1    . VAL A 1 45  ? 176.997 6.482   127.940 1.00 77.41  ? 45  VAL A CG1    1 
ATOM   752   C CG2    . VAL A 1 45  ? 178.643 5.759   129.674 1.00 75.34  ? 45  VAL A CG2    1 
ATOM   753   H H      . VAL A 1 45  ? 179.982 5.825   127.367 1.00 104.67 ? 45  VAL A H      1 
ATOM   754   H HA     . VAL A 1 45  ? 178.929 8.326   127.556 1.00 99.97  ? 45  VAL A HA     1 
ATOM   755   H HB     . VAL A 1 45  ? 177.787 7.600   129.452 1.00 92.79  ? 45  VAL A HB     1 
ATOM   756   H HG11   . VAL A 1 45  ? 176.292 6.099   128.486 1.00 92.89  ? 45  VAL A HG11   1 
ATOM   757   H HG12   . VAL A 1 45  ? 176.659 7.251   127.455 1.00 92.89  ? 45  VAL A HG12   1 
ATOM   758   H HG13   . VAL A 1 45  ? 177.331 5.818   127.317 1.00 92.89  ? 45  VAL A HG13   1 
ATOM   759   H HG21   . VAL A 1 45  ? 177.907 5.392   130.188 1.00 90.40  ? 45  VAL A HG21   1 
ATOM   760   H HG22   . VAL A 1 45  ? 179.002 5.082   129.079 1.00 90.40  ? 45  VAL A HG22   1 
ATOM   761   H HG23   . VAL A 1 45  ? 179.338 6.077   130.272 1.00 90.40  ? 45  VAL A HG23   1 
ATOM   762   N N      . GLY A 1 46  ? 180.021 8.816   129.927 1.00 91.45  ? 46  GLY A N      1 
ATOM   763   C CA     . GLY A 1 46  ? 180.956 9.236   130.950 1.00 89.02  ? 46  GLY A CA     1 
ATOM   764   C C      . GLY A 1 46  ? 181.566 10.595  130.683 1.00 83.46  ? 46  GLY A C      1 
ATOM   765   O O      . GLY A 1 46  ? 181.211 11.277  129.722 1.00 80.77  ? 46  GLY A O      1 
ATOM   766   H H      . GLY A 1 46  ? 179.236 9.157   130.008 1.00 109.73 ? 46  GLY A H      1 
ATOM   767   H HA2    . GLY A 1 46  ? 180.501 9.270   131.805 1.00 106.82 ? 46  GLY A HA2    1 
ATOM   768   H HA3    . GLY A 1 46  ? 181.675 8.588   131.012 1.00 106.82 ? 46  GLY A HA3    1 
ATOM   769   N N      . SER A 1 47  ? 182.501 10.972  131.548 1.00 81.77  ? 47  SER A N      1 
ATOM   770   C CA     . SER A 1 47  ? 183.167 12.262  131.475 1.00 82.71  ? 47  SER A CA     1 
ATOM   771   C C      . SER A 1 47  ? 184.098 12.382  130.267 1.00 87.87  ? 47  SER A C      1 
ATOM   772   O O      . SER A 1 47  ? 184.388 13.490  129.808 1.00 89.54  ? 47  SER A O      1 
ATOM   773   C CB     . SER A 1 47  ? 183.970 12.490  132.752 1.00 80.50  ? 47  SER A CB     1 
ATOM   774   O OG     . SER A 1 47  ? 184.545 13.778  132.745 1.00 81.87  ? 47  SER A OG     1 
ATOM   775   H H      . SER A 1 47  ? 182.771 10.483  132.202 1.00 98.12  ? 47  SER A H      1 
ATOM   776   H HA     . SER A 1 47  ? 182.498 12.961  131.411 1.00 99.25  ? 47  SER A HA     1 
ATOM   777   H HB2    . SER A 1 47  ? 183.379 12.410  133.517 1.00 96.60  ? 47  SER A HB2    1 
ATOM   778   H HB3    . SER A 1 47  ? 184.676 11.827  132.805 1.00 96.60  ? 47  SER A HB3    1 
ATOM   779   H HG     . SER A 1 47  ? 183.943 14.361  132.697 1.00 98.24  ? 47  SER A HG     1 
ATOM   780   N N      . TYR A 1 48  ? 184.579 11.250  129.763 1.00 90.16  ? 48  TYR A N      1 
ATOM   781   C CA     . TYR A 1 48  ? 185.411 11.260  128.566 1.00 93.85  ? 48  TYR A CA     1 
ATOM   782   C C      . TYR A 1 48  ? 184.576 11.585  127.326 1.00 92.04  ? 48  TYR A C      1 
ATOM   783   O O      . TYR A 1 48  ? 184.980 12.393  126.489 1.00 94.53  ? 48  TYR A O      1 
ATOM   784   C CB     . TYR A 1 48  ? 186.126 9.921   128.381 1.00 99.64  ? 48  TYR A CB     1 
ATOM   785   C CG     . TYR A 1 48  ? 186.980 9.889   127.135 1.00 106.88 ? 48  TYR A CG     1 
ATOM   786   C CD1    . TYR A 1 48  ? 188.251 10.451  127.126 1.00 109.12 ? 48  TYR A CD1    1 
ATOM   787   C CD2    . TYR A 1 48  ? 186.510 9.315   125.961 1.00 110.48 ? 48  TYR A CD2    1 
ATOM   788   C CE1    . TYR A 1 48  ? 189.033 10.434  125.985 1.00 111.27 ? 48  TYR A CE1    1 
ATOM   789   C CE2    . TYR A 1 48  ? 187.285 9.294   124.816 1.00 112.69 ? 48  TYR A CE2    1 
ATOM   790   C CZ     . TYR A 1 48  ? 188.544 9.855   124.835 1.00 114.59 ? 48  TYR A CZ     1 
ATOM   791   O OH     . TYR A 1 48  ? 189.319 9.838   123.699 1.00 120.10 ? 48  TYR A OH     1 
ATOM   792   H H      . TYR A 1 48  ? 184.440 10.469  130.093 1.00 108.19 ? 48  TYR A H      1 
ATOM   793   H HA     . TYR A 1 48  ? 186.088 11.949  128.659 1.00 112.62 ? 48  TYR A HA     1 
ATOM   794   H HB2    . TYR A 1 48  ? 186.702 9.761   129.145 1.00 119.57 ? 48  TYR A HB2    1 
ATOM   795   H HB3    . TYR A 1 48  ? 185.464 9.216   128.310 1.00 119.57 ? 48  TYR A HB3    1 
ATOM   796   H HD1    . TYR A 1 48  ? 188.583 10.843  127.901 1.00 130.94 ? 48  TYR A HD1    1 
ATOM   797   H HD2    . TYR A 1 48  ? 185.660 8.937   125.945 1.00 132.57 ? 48  TYR A HD2    1 
ATOM   798   H HE1    . TYR A 1 48  ? 189.883 10.812  125.995 1.00 133.53 ? 48  TYR A HE1    1 
ATOM   799   H HE2    . TYR A 1 48  ? 186.958 8.904   124.038 1.00 135.23 ? 48  TYR A HE2    1 
ATOM   800   H HH     . TYR A 1 48  ? 188.904 9.458   123.074 1.00 144.12 ? 48  TYR A HH     1 
ATOM   801   N N      . ALA A 1 49  ? 183.406 10.959  127.226 1.00 86.46  ? 49  ALA A N      1 
ATOM   802   C CA     . ALA A 1 49  ? 182.496 11.174  126.103 1.00 81.78  ? 49  ALA A CA     1 
ATOM   803   C C      . ALA A 1 49  ? 182.066 12.634  125.977 1.00 83.49  ? 49  ALA A C      1 
ATOM   804   O O      . ALA A 1 49  ? 181.729 13.098  124.886 1.00 86.91  ? 49  ALA A O      1 
ATOM   805   C CB     . ALA A 1 49  ? 181.269 10.281  126.246 1.00 77.02  ? 49  ALA A CB     1 
ATOM   806   H H      . ALA A 1 49  ? 183.112 10.396  127.805 1.00 103.75 ? 49  ALA A H      1 
ATOM   807   H HA     . ALA A 1 49  ? 182.949 10.927  125.282 1.00 98.14  ? 49  ALA A HA     1 
ATOM   808   H HB1    . ALA A 1 49  ? 180.677 10.436  125.494 1.00 92.43  ? 49  ALA A HB1    1 
ATOM   809   H HB2    . ALA A 1 49  ? 181.554 9.354   126.258 1.00 92.43  ? 49  ALA A HB2    1 
ATOM   810   H HB3    . ALA A 1 49  ? 180.816 10.499  127.076 1.00 92.43  ? 49  ALA A HB3    1 
ATOM   811   N N      . ARG A 1 50  ? 182.073 13.352  127.095 1.00 82.08  ? 50  ARG A N      1 
ATOM   812   C CA     . ARG A 1 50  ? 181.670 14.753  127.101 1.00 82.39  ? 50  ARG A CA     1 
ATOM   813   C C      . ARG A 1 50  ? 182.861 15.688  127.217 1.00 80.24  ? 50  ARG A C      1 
ATOM   814   O O      . ARG A 1 50  ? 182.697 16.910  127.251 1.00 79.82  ? 50  ARG A O      1 
ATOM   815   C CB     . ARG A 1 50  ? 180.684 15.020  128.234 1.00 84.13  ? 50  ARG A CB     1 
ATOM   816   C CG     . ARG A 1 50  ? 179.321 14.419  127.977 1.00 87.42  ? 50  ARG A CG     1 
ATOM   817   C CD     . ARG A 1 50  ? 178.329 14.822  129.041 1.00 87.21  ? 50  ARG A CD     1 
ATOM   818   N NE     . ARG A 1 50  ? 177.815 13.652  129.744 1.00 84.61  ? 50  ARG A NE     1 
ATOM   819   C CZ     . ARG A 1 50  ? 178.353 13.138  130.843 1.00 78.80  ? 50  ARG A CZ     1 
ATOM   820   N NH1    . ARG A 1 50  ? 179.427 13.692  131.389 1.00 77.68  ? 50  ARG A NH1    1 
ATOM   821   N NH2    . ARG A 1 50  ? 177.806 12.068  131.400 1.00 76.41  ? 50  ARG A NH2    1 
ATOM   822   H H      . ARG A 1 50  ? 182.308 13.051  127.865 1.00 98.49  ? 50  ARG A H      1 
ATOM   823   H HA     . ARG A 1 50  ? 181.220 14.951  126.265 1.00 98.87  ? 50  ARG A HA     1 
ATOM   824   H HB2    . ARG A 1 50  ? 181.032 14.635  129.053 1.00 100.95 ? 50  ARG A HB2    1 
ATOM   825   H HB3    . ARG A 1 50  ? 180.574 15.978  128.338 1.00 100.95 ? 50  ARG A HB3    1 
ATOM   826   H HG2    . ARG A 1 50  ? 178.990 14.731  127.120 1.00 104.90 ? 50  ARG A HG2    1 
ATOM   827   H HG3    . ARG A 1 50  ? 179.393 13.452  127.978 1.00 104.90 ? 50  ARG A HG3    1 
ATOM   828   H HD2    . ARG A 1 50  ? 178.767 15.398  129.687 1.00 104.65 ? 50  ARG A HD2    1 
ATOM   829   H HD3    . ARG A 1 50  ? 177.583 15.283  128.628 1.00 104.65 ? 50  ARG A HD3    1 
ATOM   830   H HE     . ARG A 1 50  ? 177.115 13.268  129.424 1.00 101.53 ? 50  ARG A HE     1 
ATOM   831   H HH11   . ARG A 1 50  ? 179.784 14.386  131.028 1.00 93.21  ? 50  ARG A HH11   1 
ATOM   832   H HH12   . ARG A 1 50  ? 179.770 13.355  132.102 1.00 93.21  ? 50  ARG A HH12   1 
ATOM   833   H HH21   . ARG A 1 50  ? 177.108 11.709  131.049 1.00 91.70  ? 50  ARG A HH21   1 
ATOM   834   H HH22   . ARG A 1 50  ? 178.148 11.733  132.114 1.00 91.70  ? 50  ARG A HH22   1 
ATOM   835   N N      . ASN A 1 51  ? 184.057 15.113  127.266 1.00 80.57  ? 51  ASN A N      1 
ATOM   836   C CA     . ASN A 1 51  ? 185.278 15.904  127.320 1.00 86.24  ? 51  ASN A CA     1 
ATOM   837   C C      . ASN A 1 51  ? 185.264 16.829  128.535 1.00 80.28  ? 51  ASN A C      1 
ATOM   838   O O      . ASN A 1 51  ? 185.482 18.033  128.414 1.00 81.35  ? 51  ASN A O      1 
ATOM   839   C CB     . ASN A 1 51  ? 185.442 16.709  126.023 1.00 96.42  ? 51  ASN A CB     1 
ATOM   840   C CG     . ASN A 1 51  ? 186.837 17.291  125.858 1.00 102.88 ? 51  ASN A CG     1 
ATOM   841   O OD1    . ASN A 1 51  ? 187.790 16.850  126.500 1.00 102.05 ? 51  ASN A OD1    1 
ATOM   842   N ND2    . ASN A 1 51  ? 186.962 18.283  124.983 1.00 107.22 ? 51  ASN A ND2    1 
ATOM   843   H H      . ASN A 1 51  ? 184.188 14.263  127.268 1.00 96.68  ? 51  ASN A H      1 
ATOM   844   H HA     . ASN A 1 51  ? 186.039 15.308  127.404 1.00 103.49 ? 51  ASN A HA     1 
ATOM   845   H HB2    . ASN A 1 51  ? 185.270 16.126  125.266 1.00 115.71 ? 51  ASN A HB2    1 
ATOM   846   H HB3    . ASN A 1 51  ? 184.809 17.444  126.026 1.00 115.71 ? 51  ASN A HB3    1 
ATOM   847   H HD21   . ASN A 1 51  ? 187.730 18.647  124.853 1.00 128.67 ? 51  ASN A HD21   1 
ATOM   848   H HD22   . ASN A 1 51  ? 186.274 18.561  124.548 1.00 128.67 ? 51  ASN A HD22   1 
ATOM   849   N N      . THR A 1 52  ? 184.997 16.252  129.703 1.00 74.62  ? 52  THR A N      1 
ATOM   850   C CA     . THR A 1 52  ? 184.906 17.010  130.948 1.00 72.25  ? 52  THR A CA     1 
ATOM   851   C C      . THR A 1 52  ? 185.761 16.379  132.042 1.00 76.16  ? 52  THR A C      1 
ATOM   852   O O      . THR A 1 52  ? 185.726 16.818  133.199 1.00 71.64  ? 52  THR A O      1 
ATOM   853   C CB     . THR A 1 52  ? 183.449 17.074  131.466 1.00 65.20  ? 52  THR A CB     1 
ATOM   854   O OG1    . THR A 1 52  ? 182.951 15.746  131.677 1.00 62.90  ? 52  THR A OG1    1 
ATOM   855   C CG2    . THR A 1 52  ? 182.556 17.792  130.478 1.00 61.31  ? 52  THR A CG2    1 
ATOM   856   H H      . THR A 1 52  ? 184.862 15.408  129.802 1.00 89.54  ? 52  THR A H      1 
ATOM   857   H HA     . THR A 1 52  ? 185.219 17.915  130.797 1.00 86.70  ? 52  THR A HA     1 
ATOM   858   H HB     . THR A 1 52  ? 183.428 17.561  132.305 1.00 78.24  ? 52  THR A HB     1 
ATOM   859   H HG1    . THR A 1 52  ? 182.160 15.777  131.958 1.00 75.48  ? 52  THR A HG1    1 
ATOM   860   H HG21   . THR A 1 52  ? 181.648 17.825  130.816 1.00 73.58  ? 52  THR A HG21   1 
ATOM   861   H HG22   . THR A 1 52  ? 182.875 18.698  130.342 1.00 73.58  ? 52  THR A HG22   1 
ATOM   862   H HG23   . THR A 1 52  ? 182.560 17.324  129.628 1.00 73.58  ? 52  THR A HG23   1 
ATOM   863   N N      . TRP A 1 53  ? 186.523 15.347  131.681 1.00 81.32  ? 53  TRP A N      1 
ATOM   864   C CA     . TRP A 1 53  ? 187.347 14.640  132.653 1.00 81.13  ? 53  TRP A CA     1 
ATOM   865   C C      . TRP A 1 53  ? 188.454 15.557  133.132 1.00 77.01  ? 53  TRP A C      1 
ATOM   866   O O      . TRP A 1 53  ? 188.996 16.351  132.363 1.00 75.39  ? 53  TRP A O      1 
ATOM   867   C CB     . TRP A 1 53  ? 187.915 13.336  132.073 1.00 86.92  ? 53  TRP A CB     1 
ATOM   868   C CG     . TRP A 1 53  ? 189.117 13.493  131.172 1.00 94.56  ? 53  TRP A CG     1 
ATOM   869   C CD1    . TRP A 1 53  ? 190.431 13.488  131.548 1.00 98.03  ? 53  TRP A CD1    1 
ATOM   870   C CD2    . TRP A 1 53  ? 189.113 13.653  129.748 1.00 100.56 ? 53  TRP A CD2    1 
ATOM   871   N NE1    . TRP A 1 53  ? 191.242 13.642  130.451 1.00 101.27 ? 53  TRP A NE1    1 
ATOM   872   C CE2    . TRP A 1 53  ? 190.459 13.747  129.334 1.00 104.66 ? 53  TRP A CE2    1 
ATOM   873   C CE3    . TRP A 1 53  ? 188.104 13.732  128.785 1.00 104.91 ? 53  TRP A CE3    1 
ATOM   874   C CZ2    . TRP A 1 53  ? 190.820 13.915  128.000 1.00 111.98 ? 53  TRP A CZ2    1 
ATOM   875   C CZ3    . TRP A 1 53  ? 188.464 13.899  127.460 1.00 111.66 ? 53  TRP A CZ3    1 
ATOM   876   C CH2    . TRP A 1 53  ? 189.812 13.989  127.079 1.00 115.22 ? 53  TRP A CH2    1 
ATOM   877   H H      . TRP A 1 53  ? 186.579 15.039  130.880 1.00 97.59  ? 53  TRP A H      1 
ATOM   878   H HA     . TRP A 1 53  ? 186.800 14.410  133.420 1.00 97.36  ? 53  TRP A HA     1 
ATOM   879   H HB2    . TRP A 1 53  ? 188.177 12.761  132.809 1.00 104.31 ? 53  TRP A HB2    1 
ATOM   880   H HB3    . TRP A 1 53  ? 187.219 12.902  131.556 1.00 104.31 ? 53  TRP A HB3    1 
ATOM   881   H HD1    . TRP A 1 53  ? 190.733 13.394  132.423 1.00 117.64 ? 53  TRP A HD1    1 
ATOM   882   H HE1    . TRP A 1 53  ? 192.102 13.670  130.465 1.00 121.52 ? 53  TRP A HE1    1 
ATOM   883   H HE3    . TRP A 1 53  ? 187.208 13.673  129.030 1.00 125.89 ? 53  TRP A HE3    1 
ATOM   884   H HZ2    . TRP A 1 53  ? 191.712 13.976  127.745 1.00 134.37 ? 53  TRP A HZ2    1 
ATOM   885   H HZ3    . TRP A 1 53  ? 187.801 13.953  126.809 1.00 133.99 ? 53  TRP A HZ3    1 
ATOM   886   H HH2    . TRP A 1 53  ? 190.024 14.102  126.181 1.00 138.26 ? 53  TRP A HH2    1 
ATOM   887   N N      . LEU A 1 54  ? 188.762 15.456  134.417 1.00 76.38  ? 54  LEU A N      1 
ATOM   888   C CA     . LEU A 1 54  ? 189.772 16.298  135.035 1.00 76.22  ? 54  LEU A CA     1 
ATOM   889   C C      . LEU A 1 54  ? 191.166 15.831  134.627 1.00 83.88  ? 54  LEU A C      1 
ATOM   890   O O      . LEU A 1 54  ? 191.376 14.651  134.354 1.00 82.03  ? 54  LEU A O      1 
ATOM   891   C CB     . LEU A 1 54  ? 189.611 16.247  136.554 1.00 67.65  ? 54  LEU A CB     1 
ATOM   892   C CG     . LEU A 1 54  ? 190.435 17.222  137.386 1.00 61.76  ? 54  LEU A CG     1 
ATOM   893   C CD1    . LEU A 1 54  ? 190.165 18.656  137.001 1.00 56.03  ? 54  LEU A CD1    1 
ATOM   894   C CD2    . LEU A 1 54  ? 190.121 17.007  138.853 1.00 62.97  ? 54  LEU A CD2    1 
ATOM   895   H H      . LEU A 1 54  ? 188.395 14.899  134.960 1.00 91.66  ? 54  LEU A H      1 
ATOM   896   H HA     . LEU A 1 54  ? 189.655 17.215  134.743 1.00 91.46  ? 54  LEU A HA     1 
ATOM   897   H HB2    . LEU A 1 54  ? 188.679 16.414  136.762 1.00 81.18  ? 54  LEU A HB2    1 
ATOM   898   H HB3    . LEU A 1 54  ? 189.847 15.353  136.849 1.00 81.18  ? 54  LEU A HB3    1 
ATOM   899   H HG     . LEU A 1 54  ? 191.378 17.043  137.248 1.00 74.12  ? 54  LEU A HG     1 
ATOM   900   H HD11   . LEU A 1 54  ? 190.708 19.239  137.554 1.00 67.23  ? 54  LEU A HD11   1 
ATOM   901   H HD12   . LEU A 1 54  ? 190.393 18.780  136.066 1.00 67.23  ? 54  LEU A HD12   1 
ATOM   902   H HD13   . LEU A 1 54  ? 189.224 18.849  137.141 1.00 67.23  ? 54  LEU A HD13   1 
ATOM   903   H HD21   . LEU A 1 54  ? 190.646 17.629  139.382 1.00 75.56  ? 54  LEU A HD21   1 
ATOM   904   H HD22   . LEU A 1 54  ? 189.175 17.164  138.999 1.00 75.56  ? 54  LEU A HD22   1 
ATOM   905   H HD23   . LEU A 1 54  ? 190.347 16.095  139.093 1.00 75.56  ? 54  LEU A HD23   1 
ATOM   906   N N      . LYS A 1 55  ? 192.112 16.761  134.567 1.00 94.09  ? 55  LYS A N      1 
ATOM   907   C CA     . LYS A 1 55  ? 193.491 16.425  134.236 1.00 104.37 ? 55  LYS A CA     1 
ATOM   908   C C      . LYS A 1 55  ? 194.035 15.436  135.261 1.00 110.23 ? 55  LYS A C      1 
ATOM   909   O O      . LYS A 1 55  ? 194.038 15.718  136.461 1.00 109.08 ? 55  LYS A O      1 
ATOM   910   C CB     . LYS A 1 55  ? 194.351 17.689  134.219 1.00 105.85 ? 55  LYS A CB     1 
ATOM   911   C CG     . LYS A 1 55  ? 195.823 17.448  133.937 1.00 107.04 ? 55  LYS A CG     1 
ATOM   912   C CD     . LYS A 1 55  ? 196.614 18.740  134.048 1.00 107.77 ? 55  LYS A CD     1 
ATOM   913   C CE     . LYS A 1 55  ? 198.082 18.527  133.724 1.00 110.18 ? 55  LYS A CE     1 
ATOM   914   N NZ     . LYS A 1 55  ? 198.281 18.053  132.326 1.00 113.06 ? 55  LYS A NZ     1 
ATOM   915   H H      . LYS A 1 55  ? 191.981 17.598  134.714 1.00 112.91 ? 55  LYS A H      1 
ATOM   916   H HA     . LYS A 1 55  ? 193.525 16.013  133.358 1.00 125.24 ? 55  LYS A HA     1 
ATOM   917   H HB2    . LYS A 1 55  ? 194.014 18.284  133.530 1.00 127.02 ? 55  LYS A HB2    1 
ATOM   918   H HB3    . LYS A 1 55  ? 194.284 18.121  135.085 1.00 127.02 ? 55  LYS A HB3    1 
ATOM   919   H HG2    . LYS A 1 55  ? 196.176 16.818  134.585 1.00 128.44 ? 55  LYS A HG2    1 
ATOM   920   H HG3    . LYS A 1 55  ? 195.927 17.102  133.037 1.00 128.44 ? 55  LYS A HG3    1 
ATOM   921   H HD2    . LYS A 1 55  ? 196.256 19.389  133.422 1.00 129.32 ? 55  LYS A HD2    1 
ATOM   922   H HD3    . LYS A 1 55  ? 196.549 19.078  134.955 1.00 129.32 ? 55  LYS A HD3    1 
ATOM   923   H HE2    . LYS A 1 55  ? 198.557 19.366  133.828 1.00 132.21 ? 55  LYS A HE2    1 
ATOM   924   H HE3    . LYS A 1 55  ? 198.447 17.859  134.325 1.00 132.21 ? 55  LYS A HE3    1 
ATOM   925   H HZ1    . LYS A 1 55  ? 199.148 17.936  132.165 1.00 135.67 ? 55  LYS A HZ1    1 
ATOM   926   H HZ2    . LYS A 1 55  ? 197.858 17.279  132.205 1.00 135.67 ? 55  LYS A HZ2    1 
ATOM   927   H HZ3    . LYS A 1 55  ? 197.958 18.652  131.753 1.00 135.67 ? 55  LYS A HZ3    1 
ATOM   928   N N      . GLY A 1 56  ? 194.476 14.275  134.781 1.00 116.10 ? 56  GLY A N      1 
ATOM   929   C CA     . GLY A 1 56  ? 195.047 13.248  135.636 1.00 119.35 ? 56  GLY A CA     1 
ATOM   930   C C      . GLY A 1 56  ? 194.118 12.069  135.870 1.00 120.19 ? 56  GLY A C      1 
ATOM   931   O O      . GLY A 1 56  ? 194.575 10.939  136.048 1.00 124.84 ? 56  GLY A O      1 
ATOM   932   H H      . GLY A 1 56  ? 194.453 14.059  133.948 1.00 139.32 ? 56  GLY A H      1 
ATOM   933   H HA2    . GLY A 1 56  ? 195.864 12.914  135.233 1.00 143.22 ? 56  GLY A HA2    1 
ATOM   934   H HA3    . GLY A 1 56  ? 195.268 13.635  136.497 1.00 143.22 ? 56  GLY A HA3    1 
ATOM   935   N N      . SER A 1 57  ? 192.815 12.334  135.865 1.00 115.31 ? 57  SER A N      1 
ATOM   936   C CA     . SER A 1 57  ? 191.811 11.310  136.139 1.00 112.98 ? 57  SER A CA     1 
ATOM   937   C C      . SER A 1 57  ? 191.123 10.845  134.856 1.00 112.43 ? 57  SER A C      1 
ATOM   938   O O      . SER A 1 57  ? 189.893 10.844  134.768 1.00 115.88 ? 57  SER A O      1 
ATOM   939   C CB     . SER A 1 57  ? 190.767 11.849  137.123 1.00 111.75 ? 57  SER A CB     1 
ATOM   940   O OG     . SER A 1 57  ? 191.367 12.276  138.335 1.00 110.52 ? 57  SER A OG     1 
ATOM   941   H H      . SER A 1 57  ? 192.482 13.110  135.703 1.00 138.38 ? 57  SER A H      1 
ATOM   942   H HA     . SER A 1 57  ? 192.242 10.542  136.546 1.00 135.57 ? 57  SER A HA     1 
ATOM   943   H HB2    . SER A 1 57  ? 190.312 12.603  136.715 1.00 134.10 ? 57  SER A HB2    1 
ATOM   944   H HB3    . SER A 1 57  ? 190.128 11.146  137.319 1.00 134.10 ? 57  SER A HB3    1 
ATOM   945   H HG     . SER A 1 57  ? 190.780 12.568  138.860 1.00 132.63 ? 57  SER A HG     1 
ATOM   946   N N      . LEU A 1 58  ? 191.922 10.450  133.869 1.00 108.00 ? 58  LEU A N      1 
ATOM   947   C CA     . LEU A 1 58  ? 191.403 9.988   132.581 1.00 106.25 ? 58  LEU A CA     1 
ATOM   948   C C      . LEU A 1 58  ? 190.850 8.567   132.675 1.00 109.67 ? 58  LEU A C      1 
ATOM   949   O O      . LEU A 1 58  ? 191.494 7.679   133.233 1.00 110.60 ? 58  LEU A O      1 
ATOM   950   C CB     . LEU A 1 58  ? 192.507 10.043  131.523 1.00 106.08 ? 58  LEU A CB     1 
ATOM   951   C CG     . LEU A 1 58  ? 192.176 9.437   130.157 1.00 109.55 ? 58  LEU A CG     1 
ATOM   952   C CD1    . LEU A 1 58  ? 190.971 10.124  129.533 1.00 110.39 ? 58  LEU A CD1    1 
ATOM   953   C CD2    . LEU A 1 58  ? 193.380 9.523   129.231 1.00 112.30 ? 58  LEU A CD2    1 
ATOM   954   H H      . LEU A 1 58  ? 192.781 10.439  133.920 1.00 129.61 ? 58  LEU A H      1 
ATOM   955   H HA     . LEU A 1 58  ? 190.684 10.575  132.299 1.00 127.50 ? 58  LEU A HA     1 
ATOM   956   H HB2    . LEU A 1 58  ? 192.739 10.974  131.375 1.00 127.29 ? 58  LEU A HB2    1 
ATOM   957   H HB3    . LEU A 1 58  ? 193.281 9.571   131.867 1.00 127.29 ? 58  LEU A HB3    1 
ATOM   958   H HG     . LEU A 1 58  ? 191.956 8.499   130.274 1.00 131.46 ? 58  LEU A HG     1 
ATOM   959   H HD11   . LEU A 1 58  ? 190.788 9.718   128.671 1.00 132.46 ? 58  LEU A HD11   1 
ATOM   960   H HD12   . LEU A 1 58  ? 190.207 10.015  130.120 1.00 132.46 ? 58  LEU A HD12   1 
ATOM   961   H HD13   . LEU A 1 58  ? 191.170 11.067  129.420 1.00 132.46 ? 58  LEU A HD13   1 
ATOM   962   H HD21   . LEU A 1 58  ? 193.148 9.133   128.374 1.00 134.76 ? 58  LEU A HD21   1 
ATOM   963   H HD22   . LEU A 1 58  ? 193.624 10.455  129.116 1.00 134.76 ? 58  LEU A HD22   1 
ATOM   964   H HD23   . LEU A 1 58  ? 194.118 9.034   129.628 1.00 134.76 ? 58  LEU A HD23   1 
ATOM   965   N N      . GLU A 1 59  ? 189.658 8.354   132.122 1.00 113.43 ? 59  GLU A N      1 
ATOM   966   C CA     . GLU A 1 59  ? 189.027 7.037   132.142 1.00 117.47 ? 59  GLU A CA     1 
ATOM   967   C C      . GLU A 1 59  ? 187.905 6.955   131.117 1.00 116.54 ? 59  GLU A C      1 
ATOM   968   O O      . GLU A 1 59  ? 186.886 7.624   131.256 1.00 119.54 ? 59  GLU A O      1 
ATOM   969   C CB     . GLU A 1 59  ? 188.466 6.739   133.533 1.00 121.15 ? 59  GLU A CB     1 
ATOM   970   C CG     . GLU A 1 59  ? 187.932 5.321   133.697 1.00 125.86 ? 59  GLU A CG     1 
ATOM   971   C CD     . GLU A 1 59  ? 187.329 5.066   135.074 1.00 127.94 ? 59  GLU A CD     1 
ATOM   972   O OE1    . GLU A 1 59  ? 186.668 5.975   135.627 1.00 125.00 ? 59  GLU A OE1    1 
ATOM   973   O OE2    . GLU A 1 59  ? 187.521 3.950   135.605 1.00 131.44 ? 59  GLU A OE2    1 
ATOM   974   H H      . GLU A 1 59  ? 189.192 8.960   131.727 1.00 136.12 ? 59  GLU A H      1 
ATOM   975   H HA     . GLU A 1 59  ? 189.688 6.361   131.928 1.00 140.96 ? 59  GLU A HA     1 
ATOM   976   H HB2    . GLU A 1 59  ? 189.171 6.867   134.187 1.00 145.38 ? 59  GLU A HB2    1 
ATOM   977   H HB3    . GLU A 1 59  ? 187.737 7.353   133.713 1.00 145.38 ? 59  GLU A HB3    1 
ATOM   978   H HG2    . GLU A 1 59  ? 187.240 5.166   133.035 1.00 151.04 ? 59  GLU A HG2    1 
ATOM   979   H HG3    . GLU A 1 59  ? 188.660 4.693   133.568 1.00 151.04 ? 59  GLU A HG3    1 
ATOM   980   N N      . ILE A 1 60  ? 188.094 6.128   130.093 1.00 113.10 ? 60  ILE A N      1 
ATOM   981   C CA     . ILE A 1 60  ? 187.097 5.970   129.038 1.00 112.43 ? 60  ILE A CA     1 
ATOM   982   C C      . ILE A 1 60  ? 186.109 4.869   129.402 1.00 110.67 ? 60  ILE A C      1 
ATOM   983   O O      . ILE A 1 60  ? 186.484 3.708   129.509 1.00 107.28 ? 60  ILE A O      1 
ATOM   984   C CB     . ILE A 1 60  ? 187.755 5.617   127.687 1.00 116.56 ? 60  ILE A CB     1 
ATOM   985   C CG1    . ILE A 1 60  ? 188.823 6.657   127.328 1.00 120.70 ? 60  ILE A CG1    1 
ATOM   986   C CG2    . ILE A 1 60  ? 186.697 5.531   126.587 1.00 116.32 ? 60  ILE A CG2    1 
ATOM   987   C CD1    . ILE A 1 60  ? 189.628 6.327   126.081 1.00 124.57 ? 60  ILE A CD1    1 
ATOM   988   H H      . ILE A 1 60  ? 188.797 5.644   129.985 1.00 135.72 ? 60  ILE A H      1 
ATOM   989   H HA     . ILE A 1 60  ? 186.606 6.799   128.932 1.00 134.91 ? 60  ILE A HA     1 
ATOM   990   H HB     . ILE A 1 60  ? 188.184 4.752   127.771 1.00 139.87 ? 60  ILE A HB     1 
ATOM   991   H HG12   . ILE A 1 60  ? 188.387 7.511   127.179 1.00 144.83 ? 60  ILE A HG12   1 
ATOM   992   H HG13   . ILE A 1 60  ? 189.445 6.732   128.068 1.00 144.83 ? 60  ILE A HG13   1 
ATOM   993   H HG21   . ILE A 1 60  ? 187.131 5.309   125.749 1.00 139.58 ? 60  ILE A HG21   1 
ATOM   994   H HG22   . ILE A 1 60  ? 186.055 4.842   126.820 1.00 139.58 ? 60  ILE A HG22   1 
ATOM   995   H HG23   . ILE A 1 60  ? 186.249 6.388   126.512 1.00 139.58 ? 60  ILE A HG23   1 
ATOM   996   H HD11   . ILE A 1 60  ? 190.276 7.033   125.928 1.00 149.49 ? 60  ILE A HD11   1 
ATOM   997   H HD12   . ILE A 1 60  ? 190.085 5.482   126.215 1.00 149.49 ? 60  ILE A HD12   1 
ATOM   998   H HD13   . ILE A 1 60  ? 189.025 6.262   125.324 1.00 149.49 ? 60  ILE A HD13   1 
ATOM   999   N N      . ASP A 1 61  ? 184.845 5.241   129.580 1.00 114.95 ? 61  ASP A N      1 
ATOM   1000  C CA     . ASP A 1 61  ? 183.803 4.285   129.940 1.00 119.13 ? 61  ASP A CA     1 
ATOM   1001  C C      . ASP A 1 61  ? 182.969 3.927   128.717 1.00 119.82 ? 61  ASP A C      1 
ATOM   1002  O O      . ASP A 1 61  ? 182.593 4.803   127.936 1.00 123.07 ? 61  ASP A O      1 
ATOM   1003  C CB     . ASP A 1 61  ? 182.893 4.862   131.029 1.00 121.78 ? 61  ASP A CB     1 
ATOM   1004  C CG     . ASP A 1 61  ? 183.613 5.060   132.352 1.00 123.30 ? 61  ASP A CG     1 
ATOM   1005  O OD1    . ASP A 1 61  ? 184.850 5.234   132.342 1.00 125.28 ? 61  ASP A OD1    1 
ATOM   1006  O OD2    . ASP A 1 61  ? 182.940 5.045   133.404 1.00 121.95 ? 61  ASP A OD2    1 
ATOM   1007  H H      . ASP A 1 61  ? 184.563 6.049   129.498 1.00 137.93 ? 61  ASP A H      1 
ATOM   1008  H HA     . ASP A 1 61  ? 184.212 3.474   130.280 1.00 142.95 ? 61  ASP A HA     1 
ATOM   1009  H HB2    . ASP A 1 61  ? 182.559 5.724   130.738 1.00 146.13 ? 61  ASP A HB2    1 
ATOM   1010  H HB3    . ASP A 1 61  ? 182.154 4.252   131.179 1.00 146.13 ? 61  ASP A HB3    1 
ATOM   1011  N N      . VAL A 1 62  ? 182.693 2.635   128.557 1.00 115.12 ? 62  VAL A N      1 
ATOM   1012  C CA     . VAL A 1 62  ? 181.836 2.146   127.480 1.00 108.65 ? 62  VAL A CA     1 
ATOM   1013  C C      . VAL A 1 62  ? 180.717 1.298   128.064 1.00 107.23 ? 62  VAL A C      1 
ATOM   1014  O O      . VAL A 1 62  ? 180.959 0.435   128.908 1.00 103.23 ? 62  VAL A O      1 
ATOM   1015  C CB     . VAL A 1 62  ? 182.624 1.302   126.460 1.00 104.10 ? 62  VAL A CB     1 
ATOM   1016  C CG1    . VAL A 1 62  ? 181.700 0.780   125.364 1.00 105.60 ? 62  VAL A CG1    1 
ATOM   1017  C CG2    . VAL A 1 62  ? 183.755 2.119   125.853 1.00 100.20 ? 62  VAL A CG2    1 
ATOM   1018  H H      . VAL A 1 62  ? 182.995 2.012   129.068 1.00 138.14 ? 62  VAL A H      1 
ATOM   1019  H HA     . VAL A 1 62  ? 181.440 2.900   127.015 1.00 130.38 ? 62  VAL A HA     1 
ATOM   1020  H HB     . VAL A 1 62  ? 183.014 0.538   126.914 1.00 124.92 ? 62  VAL A HB     1 
ATOM   1021  H HG11   . VAL A 1 62  ? 182.221 0.253   124.737 1.00 126.72 ? 62  VAL A HG11   1 
ATOM   1022  H HG12   . VAL A 1 62  ? 181.011 0.229   125.767 1.00 126.72 ? 62  VAL A HG12   1 
ATOM   1023  H HG13   . VAL A 1 62  ? 181.296 1.534   124.907 1.00 126.72 ? 62  VAL A HG13   1 
ATOM   1024  H HG21   . VAL A 1 62  ? 184.236 1.568   125.216 1.00 120.25 ? 62  VAL A HG21   1 
ATOM   1025  H HG22   . VAL A 1 62  ? 183.380 2.893   125.404 1.00 120.25 ? 62  VAL A HG22   1 
ATOM   1026  H HG23   . VAL A 1 62  ? 184.354 2.405   126.561 1.00 120.25 ? 62  VAL A HG23   1 
ATOM   1027  N N      . PHE A 1 63  ? 179.494 1.552   127.607 1.00 112.30 ? 63  PHE A N      1 
ATOM   1028  C CA     . PHE A 1 63  ? 178.323 0.814   128.067 1.00 116.66 ? 63  PHE A CA     1 
ATOM   1029  C C      . PHE A 1 63  ? 177.751 -0.039  126.946 1.00 121.57 ? 63  PHE A C      1 
ATOM   1030  O O      . PHE A 1 63  ? 177.414 0.469   125.877 1.00 122.74 ? 63  PHE A O      1 
ATOM   1031  C CB     . PHE A 1 63  ? 177.257 1.776   128.592 1.00 114.60 ? 63  PHE A CB     1 
ATOM   1032  C CG     . PHE A 1 63  ? 177.376 2.067   130.061 1.00 110.79 ? 63  PHE A CG     1 
ATOM   1033  C CD1    . PHE A 1 63  ? 178.522 2.650   130.575 1.00 107.63 ? 63  PHE A CD1    1 
ATOM   1034  C CD2    . PHE A 1 63  ? 176.341 1.760   130.928 1.00 109.27 ? 63  PHE A CD2    1 
ATOM   1035  C CE1    . PHE A 1 63  ? 178.635 2.919   131.925 1.00 104.83 ? 63  PHE A CE1    1 
ATOM   1036  C CE2    . PHE A 1 63  ? 176.447 2.027   132.279 1.00 106.37 ? 63  PHE A CE2    1 
ATOM   1037  C CZ     . PHE A 1 63  ? 177.596 2.607   132.778 1.00 104.39 ? 63  PHE A CZ     1 
ATOM   1038  H H      . PHE A 1 63  ? 179.315 2.156   127.022 1.00 134.76 ? 63  PHE A H      1 
ATOM   1039  H HA     . PHE A 1 63  ? 178.583 0.225   128.793 1.00 140.00 ? 63  PHE A HA     1 
ATOM   1040  H HB2    . PHE A 1 63  ? 177.333 2.618   128.115 1.00 137.52 ? 63  PHE A HB2    1 
ATOM   1041  H HB3    . PHE A 1 63  ? 176.381 1.388   128.436 1.00 137.52 ? 63  PHE A HB3    1 
ATOM   1042  H HD1    . PHE A 1 63  ? 179.225 2.862   130.004 1.00 129.16 ? 63  PHE A HD1    1 
ATOM   1043  H HD2    . PHE A 1 63  ? 175.565 1.368   130.597 1.00 131.13 ? 63  PHE A HD2    1 
ATOM   1044  H HE1    . PHE A 1 63  ? 179.409 3.311   132.259 1.00 125.79 ? 63  PHE A HE1    1 
ATOM   1045  H HE2    . PHE A 1 63  ? 175.746 1.815   132.851 1.00 127.64 ? 63  PHE A HE2    1 
ATOM   1046  H HZ     . PHE A 1 63  ? 177.669 2.788   133.687 1.00 125.27 ? 63  PHE A HZ     1 
ATOM   1047  N N      . LEU A 1 64  ? 177.648 -1.339  127.204 1.00 123.30 ? 64  LEU A N      1 
ATOM   1048  C CA     . LEU A 1 64  ? 177.108 -2.280  126.233 1.00 124.64 ? 64  LEU A CA     1 
ATOM   1049  C C      . LEU A 1 64  ? 175.589 -2.324  126.342 1.00 123.55 ? 64  LEU A C      1 
ATOM   1050  O O      . LEU A 1 64  ? 175.042 -2.786  127.343 1.00 123.24 ? 64  LEU A O      1 
ATOM   1051  C CB     . LEU A 1 64  ? 177.693 -3.674  126.469 1.00 126.42 ? 64  LEU A CB     1 
ATOM   1052  C CG     . LEU A 1 64  ? 179.221 -3.775  126.422 1.00 127.15 ? 64  LEU A CG     1 
ATOM   1053  C CD1    . LEU A 1 64  ? 179.677 -5.164  126.841 1.00 125.85 ? 64  LEU A CD1    1 
ATOM   1054  C CD2    . LEU A 1 64  ? 179.748 -3.433  125.032 1.00 129.77 ? 64  LEU A CD2    1 
ATOM   1055  H H      . LEU A 1 64  ? 177.889 -1.704  127.944 1.00 147.95 ? 64  LEU A H      1 
ATOM   1056  H HA     . LEU A 1 64  ? 177.345 -1.993  125.337 1.00 149.56 ? 64  LEU A HA     1 
ATOM   1057  H HB2    . LEU A 1 64  ? 177.409 -3.980  127.344 1.00 151.70 ? 64  LEU A HB2    1 
ATOM   1058  H HB3    . LEU A 1 64  ? 177.342 -4.271  125.789 1.00 151.70 ? 64  LEU A HB3    1 
ATOM   1059  H HG     . LEU A 1 64  ? 179.597 -3.137  127.049 1.00 152.58 ? 64  LEU A HG     1 
ATOM   1060  H HD11   . LEU A 1 64  ? 180.645 -5.203  126.803 1.00 151.02 ? 64  LEU A HD11   1 
ATOM   1061  H HD12   . LEU A 1 64  ? 179.373 -5.336  127.746 1.00 151.02 ? 64  LEU A HD12   1 
ATOM   1062  H HD13   . LEU A 1 64  ? 179.295 -5.817  126.234 1.00 151.02 ? 64  LEU A HD13   1 
ATOM   1063  H HD21   . LEU A 1 64  ? 180.715 -3.506  125.035 1.00 155.73 ? 64  LEU A HD21   1 
ATOM   1064  H HD22   . LEU A 1 64  ? 179.371 -4.054  124.390 1.00 155.73 ? 64  LEU A HD22   1 
ATOM   1065  H HD23   . LEU A 1 64  ? 179.485 -2.526  124.810 1.00 155.73 ? 64  LEU A HD23   1 
ATOM   1066  N N      . LEU A 1 65  ? 174.913 -1.827  125.312 1.00 124.03 ? 65  LEU A N      1 
ATOM   1067  C CA     . LEU A 1 65  ? 173.457 -1.830  125.272 1.00 127.35 ? 65  LEU A CA     1 
ATOM   1068  C C      . LEU A 1 65  ? 172.953 -3.164  124.743 1.00 143.82 ? 65  LEU A C      1 
ATOM   1069  O O      . LEU A 1 65  ? 173.277 -3.554  123.621 1.00 146.70 ? 65  LEU A O      1 
ATOM   1070  C CB     . LEU A 1 65  ? 172.948 -0.700  124.375 1.00 117.47 ? 65  LEU A CB     1 
ATOM   1071  C CG     . LEU A 1 65  ? 173.339 0.720   124.789 1.00 108.31 ? 65  LEU A CG     1 
ATOM   1072  C CD1    . LEU A 1 65  ? 172.946 1.713   123.712 1.00 102.87 ? 65  LEU A CD1    1 
ATOM   1073  C CD2    . LEU A 1 65  ? 172.698 1.089   126.121 1.00 106.72 ? 65  LEU A CD2    1 
ATOM   1074  H H      . LEU A 1 65  ? 175.280 -1.479  124.616 1.00 148.84 ? 65  LEU A H      1 
ATOM   1075  H HA     . LEU A 1 65  ? 173.106 -1.698  126.167 1.00 152.82 ? 65  LEU A HA     1 
ATOM   1076  H HB2    . LEU A 1 65  ? 173.291 -0.844  123.480 1.00 140.97 ? 65  LEU A HB2    1 
ATOM   1077  H HB3    . LEU A 1 65  ? 171.979 -0.738  124.358 1.00 140.97 ? 65  LEU A HB3    1 
ATOM   1078  H HG     . LEU A 1 65  ? 174.302 0.762   124.898 1.00 129.97 ? 65  LEU A HG     1 
ATOM   1079  H HD11   . LEU A 1 65  ? 173.204 2.604   123.997 1.00 123.45 ? 65  LEU A HD11   1 
ATOM   1080  H HD12   . LEU A 1 65  ? 173.404 1.483   122.889 1.00 123.45 ? 65  LEU A HD12   1 
ATOM   1081  H HD13   . LEU A 1 65  ? 171.986 1.672   123.581 1.00 123.45 ? 65  LEU A HD13   1 
ATOM   1082  H HD21   . LEU A 1 65  ? 172.963 1.991   126.358 1.00 128.07 ? 65  LEU A HD21   1 
ATOM   1083  H HD22   . LEU A 1 65  ? 171.734 1.039   126.031 1.00 128.07 ? 65  LEU A HD22   1 
ATOM   1084  H HD23   . LEU A 1 65  ? 173.001 0.466   126.800 1.00 128.07 ? 65  LEU A HD23   1 
ATOM   1085  N N      . PHE A 1 66  ? 172.167 -3.861  125.558 1.00 155.94 ? 66  PHE A N      1 
ATOM   1086  C CA     . PHE A 1 66  ? 171.568 -5.129  125.155 1.00 166.25 ? 66  PHE A CA     1 
ATOM   1087  C C      . PHE A 1 66  ? 170.047 -5.010  125.135 1.00 164.60 ? 66  PHE A C      1 
ATOM   1088  O O      . PHE A 1 66  ? 169.476 -4.217  125.885 1.00 166.95 ? 66  PHE A O      1 
ATOM   1089  C CB     . PHE A 1 66  ? 171.987 -6.249  126.108 1.00 173.77 ? 66  PHE A CB     1 
ATOM   1090  C CG     . PHE A 1 66  ? 173.459 -6.549  126.084 1.00 178.86 ? 66  PHE A CG     1 
ATOM   1091  C CD1    . PHE A 1 66  ? 174.026 -7.222  125.013 1.00 181.74 ? 66  PHE A CD1    1 
ATOM   1092  C CD2    . PHE A 1 66  ? 174.274 -6.166  127.136 1.00 179.70 ? 66  PHE A CD2    1 
ATOM   1093  C CE1    . PHE A 1 66  ? 175.378 -7.500  124.990 1.00 183.13 ? 66  PHE A CE1    1 
ATOM   1094  C CE2    . PHE A 1 66  ? 175.626 -6.442  127.119 1.00 181.10 ? 66  PHE A CE2    1 
ATOM   1095  C CZ     . PHE A 1 66  ? 176.179 -7.110  126.045 1.00 182.71 ? 66  PHE A CZ     1 
ATOM   1096  H H      . PHE A 1 66  ? 171.963 -3.619  126.357 1.00 187.13 ? 66  PHE A H      1 
ATOM   1097  H HA     . PHE A 1 66  ? 171.869 -5.358  124.261 1.00 199.51 ? 66  PHE A HA     1 
ATOM   1098  H HB2    . PHE A 1 66  ? 171.751 -5.993  127.014 1.00 208.52 ? 66  PHE A HB2    1 
ATOM   1099  H HB3    . PHE A 1 66  ? 171.515 -7.061  125.863 1.00 208.52 ? 66  PHE A HB3    1 
ATOM   1100  H HD1    . PHE A 1 66  ? 173.490 -7.486  124.301 1.00 218.08 ? 66  PHE A HD1    1 
ATOM   1101  H HD2    . PHE A 1 66  ? 173.906 -5.715  127.862 1.00 215.64 ? 66  PHE A HD2    1 
ATOM   1102  H HE1    . PHE A 1 66  ? 175.749 -7.951  124.266 1.00 219.75 ? 66  PHE A HE1    1 
ATOM   1103  H HE2    . PHE A 1 66  ? 176.164 -6.178  127.830 1.00 217.32 ? 66  PHE A HE2    1 
ATOM   1104  H HZ     . PHE A 1 66  ? 177.090 -7.297  126.031 1.00 219.25 ? 66  PHE A HZ     1 
ATOM   1105  N N      . PRO A 1 67  ? 169.383 -5.794  124.271 1.00 158.39 ? 67  PRO A N      1 
ATOM   1106  C CA     . PRO A 1 67  ? 167.917 -5.806  124.271 1.00 154.95 ? 67  PRO A CA     1 
ATOM   1107  C C      . PRO A 1 67  ? 167.359 -6.427  125.552 1.00 154.13 ? 67  PRO A C      1 
ATOM   1108  O O      . PRO A 1 67  ? 168.012 -7.278  126.158 1.00 150.32 ? 67  PRO A O      1 
ATOM   1109  C CB     . PRO A 1 67  ? 167.573 -6.666  123.050 1.00 154.67 ? 67  PRO A CB     1 
ATOM   1110  C CG     . PRO A 1 67  ? 168.771 -7.522  122.836 1.00 155.00 ? 67  PRO A CG     1 
ATOM   1111  C CD     . PRO A 1 67  ? 169.944 -6.694  123.247 1.00 155.98 ? 67  PRO A CD     1 
ATOM   1112  H HA     . PRO A 1 67  ? 167.563 -4.910  124.154 1.00 185.94 ? 67  PRO A HA     1 
ATOM   1113  H HB2    . PRO A 1 67  ? 166.792 -7.208  123.241 1.00 185.61 ? 67  PRO A HB2    1 
ATOM   1114  H HB3    . PRO A 1 67  ? 167.417 -6.095  122.281 1.00 185.61 ? 67  PRO A HB3    1 
ATOM   1115  H HG2    . PRO A 1 67  ? 168.704 -8.317  123.388 1.00 186.00 ? 67  PRO A HG2    1 
ATOM   1116  H HG3    . PRO A 1 67  ? 168.835 -7.762  121.898 1.00 186.00 ? 67  PRO A HG3    1 
ATOM   1117  H HD2    . PRO A 1 67  ? 170.636 -7.255  123.632 1.00 187.18 ? 67  PRO A HD2    1 
ATOM   1118  H HD3    . PRO A 1 67  ? 170.278 -6.183  122.494 1.00 187.18 ? 67  PRO A HD3    1 
ATOM   1119  N N      . GLU A 1 68  ? 166.165 -6.001  125.954 1.00 158.74 ? 68  GLU A N      1 
ATOM   1120  C CA     . GLU A 1 68  ? 165.569 -6.453  127.209 1.00 162.80 ? 68  GLU A CA     1 
ATOM   1121  C C      . GLU A 1 68  ? 164.824 -7.780  127.064 1.00 169.67 ? 68  GLU A C      1 
ATOM   1122  O O      . GLU A 1 68  ? 164.088 -8.186  127.964 1.00 170.16 ? 68  GLU A O      1 
ATOM   1123  C CB     . GLU A 1 68  ? 164.627 -5.379  127.766 1.00 159.59 ? 68  GLU A CB     1 
ATOM   1124  C CG     . GLU A 1 68  ? 163.487 -4.990  126.829 1.00 156.99 ? 68  GLU A CG     1 
ATOM   1125  C CD     . GLU A 1 68  ? 162.588 -3.915  127.412 1.00 153.16 ? 68  GLU A CD     1 
ATOM   1126  O OE1    . GLU A 1 68  ? 162.776 -3.557  128.594 1.00 151.71 ? 68  GLU A OE1    1 
ATOM   1127  O OE2    . GLU A 1 68  ? 161.694 -3.425  126.689 1.00 151.86 ? 68  GLU A OE2    1 
ATOM   1128  H H      . GLU A 1 68  ? 165.677 -5.445  125.516 1.00 190.49 ? 68  GLU A H      1 
ATOM   1129  H HA     . GLU A 1 68  ? 166.278 -6.586  127.858 1.00 195.35 ? 68  GLU A HA     1 
ATOM   1130  H HB2    . GLU A 1 68  ? 164.233 -5.709  128.588 1.00 191.51 ? 68  GLU A HB2    1 
ATOM   1131  H HB3    . GLU A 1 68  ? 165.143 -4.579  127.949 1.00 191.51 ? 68  GLU A HB3    1 
ATOM   1132  H HG2    . GLU A 1 68  ? 163.860 -4.652  126.000 1.00 188.39 ? 68  GLU A HG2    1 
ATOM   1133  H HG3    . GLU A 1 68  ? 162.942 -5.773  126.652 1.00 188.39 ? 68  GLU A HG3    1 
ATOM   1134  N N      . GLU A 1 69  ? 165.019 -8.455  125.936 1.00 175.16 ? 69  GLU A N      1 
ATOM   1135  C CA     . GLU A 1 69  ? 164.399 -9.757  125.709 1.00 178.65 ? 69  GLU A CA     1 
ATOM   1136  C C      . GLU A 1 69  ? 165.055 -10.819 126.589 1.00 176.65 ? 69  GLU A C      1 
ATOM   1137  O O      . GLU A 1 69  ? 164.374 -11.686 127.138 1.00 179.64 ? 69  GLU A O      1 
ATOM   1138  C CB     . GLU A 1 69  ? 164.489 -10.147 124.231 1.00 181.89 ? 69  GLU A CB     1 
ATOM   1139  C CG     . GLU A 1 69  ? 163.388 -9.549  123.360 1.00 182.93 ? 69  GLU A CG     1 
ATOM   1140  C CD     . GLU A 1 69  ? 163.332 -8.033  123.425 1.00 182.52 ? 69  GLU A CD     1 
ATOM   1141  O OE1    . GLU A 1 69  ? 162.305 -7.459  123.008 1.00 181.62 ? 69  GLU A OE1    1 
ATOM   1142  O OE2    . GLU A 1 69  ? 164.311 -7.412  123.888 1.00 183.09 ? 69  GLU A OE2    1 
ATOM   1143  H H      . GLU A 1 69  ? 165.509 -8.181  125.284 1.00 210.19 ? 69  GLU A H      1 
ATOM   1144  H HA     . GLU A 1 69  ? 163.460 -9.705  125.949 1.00 214.37 ? 69  GLU A HA     1 
ATOM   1145  H HB2    . GLU A 1 69  ? 165.341 -9.842  123.880 1.00 218.27 ? 69  GLU A HB2    1 
ATOM   1146  H HB3    . GLU A 1 69  ? 164.432 -11.112 124.160 1.00 218.27 ? 69  GLU A HB3    1 
ATOM   1147  H HG2    . GLU A 1 69  ? 163.544 -9.803  122.437 1.00 219.52 ? 69  GLU A HG2    1 
ATOM   1148  H HG3    . GLU A 1 69  ? 162.531 -9.893  123.657 1.00 219.52 ? 69  GLU A HG3    1 
ATOM   1149  N N      . PHE A 1 70  ? 166.377 -10.742 126.717 1.00 169.78 ? 70  PHE A N      1 
ATOM   1150  C CA     . PHE A 1 70  ? 167.122 -11.618 127.617 1.00 165.79 ? 70  PHE A CA     1 
ATOM   1151  C C      . PHE A 1 70  ? 167.297 -10.934 128.970 1.00 166.40 ? 70  PHE A C      1 
ATOM   1152  O O      . PHE A 1 70  ? 168.283 -10.234 129.203 1.00 160.77 ? 70  PHE A O      1 
ATOM   1153  C CB     . PHE A 1 70  ? 168.496 -11.970 127.029 1.00 163.01 ? 70  PHE A CB     1 
ATOM   1154  C CG     . PHE A 1 70  ? 168.446 -12.917 125.847 1.00 160.55 ? 70  PHE A CG     1 
ATOM   1155  C CD1    . PHE A 1 70  ? 167.335 -13.714 125.605 1.00 159.64 ? 70  PHE A CD1    1 
ATOM   1156  C CD2    . PHE A 1 70  ? 169.526 -13.014 124.983 1.00 158.68 ? 70  PHE A CD2    1 
ATOM   1157  C CE1    . PHE A 1 70  ? 167.304 -14.580 124.523 1.00 159.42 ? 70  PHE A CE1    1 
ATOM   1158  C CE2    . PHE A 1 70  ? 169.498 -13.877 123.901 1.00 158.46 ? 70  PHE A CE2    1 
ATOM   1159  C CZ     . PHE A 1 70  ? 168.387 -14.660 123.672 1.00 158.98 ? 70  PHE A CZ     1 
ATOM   1160  H H      . PHE A 1 70  ? 166.871 -10.184 126.288 1.00 203.74 ? 70  PHE A H      1 
ATOM   1161  H HA     . PHE A 1 70  ? 166.626 -12.440 127.751 1.00 198.95 ? 70  PHE A HA     1 
ATOM   1162  H HB2    . PHE A 1 70  ? 168.927 -11.153 126.734 1.00 195.61 ? 70  PHE A HB2    1 
ATOM   1163  H HB3    . PHE A 1 70  ? 169.032 -12.390 127.721 1.00 195.61 ? 70  PHE A HB3    1 
ATOM   1164  H HD1    . PHE A 1 70  ? 166.601 -13.665 126.175 1.00 191.57 ? 70  PHE A HD1    1 
ATOM   1165  H HD2    . PHE A 1 70  ? 170.280 -12.489 125.131 1.00 190.41 ? 70  PHE A HD2    1 
ATOM   1166  H HE1    . PHE A 1 70  ? 166.552 -15.106 124.370 1.00 191.31 ? 70  PHE A HE1    1 
ATOM   1167  H HE2    . PHE A 1 70  ? 170.229 -13.930 123.328 1.00 190.15 ? 70  PHE A HE2    1 
ATOM   1168  H HZ     . PHE A 1 70  ? 168.367 -15.240 122.945 1.00 190.78 ? 70  PHE A HZ     1 
ATOM   1169  N N      . SER A 1 71  ? 166.331 -11.150 129.858 1.00 175.13 ? 71  SER A N      1 
ATOM   1170  C CA     . SER A 1 71  ? 166.320 -10.499 131.162 1.00 180.82 ? 71  SER A CA     1 
ATOM   1171  C C      . SER A 1 71  ? 167.121 -11.285 132.197 1.00 183.37 ? 71  SER A C      1 
ATOM   1172  O O      . SER A 1 71  ? 167.664 -12.350 131.900 1.00 185.16 ? 71  SER A O      1 
ATOM   1173  C CB     . SER A 1 71  ? 164.880 -10.330 131.652 1.00 182.65 ? 71  SER A CB     1 
ATOM   1174  O OG     . SER A 1 71  ? 164.248 -11.586 131.822 1.00 184.24 ? 71  SER A OG     1 
ATOM   1175  H H      . SER A 1 71  ? 165.664 -11.676 129.727 1.00 210.15 ? 71  SER A H      1 
ATOM   1176  H HA     . SER A 1 71  ? 166.717 -9.618  131.080 1.00 216.98 ? 71  SER A HA     1 
ATOM   1177  H HB2    . SER A 1 71  ? 164.889 -9.864  132.502 1.00 219.18 ? 71  SER A HB2    1 
ATOM   1178  H HB3    . SER A 1 71  ? 164.384 -9.814  130.997 1.00 219.18 ? 71  SER A HB3    1 
ATOM   1179  H HG     . SER A 1 71  ? 163.459 -11.477 132.091 1.00 221.09 ? 71  SER A HG     1 
ATOM   1180  N N      . LYS A 1 72  ? 167.187 -10.739 133.409 1.00 182.63 ? 72  LYS A N      1 
ATOM   1181  C CA     . LYS A 1 72  ? 167.847 -11.387 134.542 1.00 180.53 ? 72  LYS A CA     1 
ATOM   1182  C C      . LYS A 1 72  ? 169.351 -11.605 134.311 1.00 173.95 ? 72  LYS A C      1 
ATOM   1183  O O      . LYS A 1 72  ? 170.073 -10.666 133.972 1.00 174.46 ? 72  LYS A O      1 
ATOM   1184  C CB     . LYS A 1 72  ? 167.140 -12.704 134.889 1.00 183.60 ? 72  LYS A CB     1 
ATOM   1185  C CG     . LYS A 1 72  ? 165.648 -12.558 135.156 1.00 184.31 ? 72  LYS A CG     1 
ATOM   1186  C CD     . LYS A 1 72  ? 165.040 -13.852 135.683 1.00 185.54 ? 72  LYS A CD     1 
ATOM   1187  C CE     . LYS A 1 72  ? 165.101 -14.972 134.654 1.00 187.00 ? 72  LYS A CE     1 
ATOM   1188  N NZ     . LYS A 1 72  ? 164.488 -16.229 135.163 1.00 187.83 ? 72  LYS A NZ     1 
ATOM   1189  H H      . LYS A 1 72  ? 166.848 -9.973  133.605 1.00 219.16 ? 72  LYS A H      1 
ATOM   1190  H HA     . LYS A 1 72  ? 167.760 -10.805 135.314 1.00 216.63 ? 72  LYS A HA     1 
ATOM   1191  H HB2    . LYS A 1 72  ? 167.249 -13.320 134.148 1.00 220.31 ? 72  LYS A HB2    1 
ATOM   1192  H HB3    . LYS A 1 72  ? 167.548 -13.075 135.687 1.00 220.31 ? 72  LYS A HB3    1 
ATOM   1193  H HG2    . LYS A 1 72  ? 165.509 -11.865 135.821 1.00 221.18 ? 72  LYS A HG2    1 
ATOM   1194  H HG3    . LYS A 1 72  ? 165.197 -12.325 134.330 1.00 221.18 ? 72  LYS A HG3    1 
ATOM   1195  H HD2    . LYS A 1 72  ? 165.531 -14.137 136.470 1.00 222.65 ? 72  LYS A HD2    1 
ATOM   1196  H HD3    . LYS A 1 72  ? 164.109 -13.698 135.907 1.00 222.65 ? 72  LYS A HD3    1 
ATOM   1197  H HE2    . LYS A 1 72  ? 164.617 -14.700 133.859 1.00 224.40 ? 72  LYS A HE2    1 
ATOM   1198  H HE3    . LYS A 1 72  ? 166.028 -15.154 134.436 1.00 224.40 ? 72  LYS A HE3    1 
ATOM   1199  H HZ1    . LYS A 1 72  ? 164.538 -16.864 134.542 1.00 225.39 ? 72  LYS A HZ1    1 
ATOM   1200  H HZ2    . LYS A 1 72  ? 164.918 -16.503 135.893 1.00 225.39 ? 72  LYS A HZ2    1 
ATOM   1201  H HZ3    . LYS A 1 72  ? 163.633 -16.089 135.367 1.00 225.39 ? 72  LYS A HZ3    1 
ATOM   1202  N N      . GLU A 1 73  ? 169.817 -12.838 134.502 1.00 165.86 ? 73  GLU A N      1 
ATOM   1203  C CA     . GLU A 1 73  ? 171.240 -13.155 134.424 1.00 160.67 ? 73  GLU A CA     1 
ATOM   1204  C C      . GLU A 1 73  ? 171.625 -13.622 133.019 1.00 167.27 ? 73  GLU A C      1 
ATOM   1205  O O      . GLU A 1 73  ? 172.745 -14.079 132.793 1.00 165.56 ? 73  GLU A O      1 
ATOM   1206  C CB     . GLU A 1 73  ? 171.577 -14.234 135.462 1.00 153.22 ? 73  GLU A CB     1 
ATOM   1207  C CG     . GLU A 1 73  ? 173.066 -14.442 135.727 1.00 149.18 ? 73  GLU A CG     1 
ATOM   1208  C CD     . GLU A 1 73  ? 173.337 -15.242 136.995 1.00 147.33 ? 73  GLU A CD     1 
ATOM   1209  O OE1    . GLU A 1 73  ? 172.371 -15.700 137.642 1.00 146.58 ? 73  GLU A OE1    1 
ATOM   1210  O OE2    . GLU A 1 73  ? 174.523 -15.412 137.347 1.00 147.06 ? 73  GLU A OE2    1 
ATOM   1211  H H      . GLU A 1 73  ? 169.321 -13.517 134.681 1.00 199.03 ? 73  GLU A H      1 
ATOM   1212  H HA     . GLU A 1 73  ? 171.757 -12.361 134.633 1.00 192.80 ? 73  GLU A HA     1 
ATOM   1213  H HB2    . GLU A 1 73  ? 171.162 -13.990 136.304 1.00 183.86 ? 73  GLU A HB2    1 
ATOM   1214  H HB3    . GLU A 1 73  ? 171.215 -15.079 135.155 1.00 183.86 ? 73  GLU A HB3    1 
ATOM   1215  H HG2    . GLU A 1 73  ? 173.455 -14.923 134.980 1.00 179.01 ? 73  GLU A HG2    1 
ATOM   1216  H HG3    . GLU A 1 73  ? 173.494 -13.576 135.823 1.00 179.01 ? 73  GLU A HG3    1 
ATOM   1217  N N      . GLU A 1 74  ? 170.696 -13.488 132.075 1.00 176.69 ? 74  GLU A N      1 
ATOM   1218  C CA     . GLU A 1 74  ? 170.899 -13.990 130.716 1.00 187.32 ? 74  GLU A CA     1 
ATOM   1219  C C      . GLU A 1 74  ? 171.660 -13.003 129.827 1.00 196.25 ? 74  GLU A C      1 
ATOM   1220  O O      . GLU A 1 74  ? 171.651 -13.135 128.603 1.00 195.12 ? 74  GLU A O      1 
ATOM   1221  C CB     . GLU A 1 74  ? 169.551 -14.327 130.068 1.00 189.25 ? 74  GLU A CB     1 
ATOM   1222  C CG     . GLU A 1 74  ? 168.738 -15.375 130.817 1.00 190.10 ? 74  GLU A CG     1 
ATOM   1223  C CD     . GLU A 1 74  ? 167.440 -15.727 130.109 1.00 190.13 ? 74  GLU A CD     1 
ATOM   1224  O OE1    . GLU A 1 74  ? 167.141 -15.112 129.064 1.00 188.74 ? 74  GLU A OE1    1 
ATOM   1225  O OE2    . GLU A 1 74  ? 166.717 -16.622 130.598 1.00 191.18 ? 74  GLU A OE2    1 
ATOM   1226  H H      . GLU A 1 74  ? 169.935 -13.107 132.195 1.00 212.03 ? 74  GLU A H      1 
ATOM   1227  H HA     . GLU A 1 74  ? 171.419 -14.807 130.762 1.00 224.79 ? 74  GLU A HA     1 
ATOM   1228  H HB2    . GLU A 1 74  ? 169.018 -13.518 130.022 1.00 227.10 ? 74  GLU A HB2    1 
ATOM   1229  H HB3    . GLU A 1 74  ? 169.713 -14.664 129.173 1.00 227.10 ? 74  GLU A HB3    1 
ATOM   1230  H HG2    . GLU A 1 74  ? 169.265 -16.185 130.898 1.00 228.12 ? 74  GLU A HG2    1 
ATOM   1231  H HG3    . GLU A 1 74  ? 168.517 -15.033 131.698 1.00 228.12 ? 74  GLU A HG3    1 
ATOM   1232  N N      . LEU A 1 75  ? 172.315 -12.018 130.439 1.00 206.26 ? 75  LEU A N      1 
ATOM   1233  C CA     . LEU A 1 75  ? 173.086 -11.030 129.683 1.00 209.82 ? 75  LEU A CA     1 
ATOM   1234  C C      . LEU A 1 75  ? 174.288 -10.487 130.457 1.00 198.32 ? 75  LEU A C      1 
ATOM   1235  O O      . LEU A 1 75  ? 175.079 -9.712  129.919 1.00 201.74 ? 75  LEU A O      1 
ATOM   1236  C CB     . LEU A 1 75  ? 172.186 -9.866  129.250 1.00 216.42 ? 75  LEU A CB     1 
ATOM   1237  C CG     . LEU A 1 75  ? 171.883 -8.776  130.283 1.00 218.79 ? 75  LEU A CG     1 
ATOM   1238  C CD1    . LEU A 1 75  ? 171.009 -7.696  129.664 1.00 218.89 ? 75  LEU A CD1    1 
ATOM   1239  C CD2    . LEU A 1 75  ? 171.221 -9.352  131.524 1.00 219.83 ? 75  LEU A CD2    1 
ATOM   1240  H H      . LEU A 1 75  ? 172.329 -11.899 131.290 1.00 247.51 ? 75  LEU A H      1 
ATOM   1241  H HA     . LEU A 1 75  ? 173.424 -11.453 128.878 1.00 251.79 ? 75  LEU A HA     1 
ATOM   1242  H HB2    . LEU A 1 75  ? 172.606 -9.429  128.492 1.00 259.70 ? 75  LEU A HB2    1 
ATOM   1243  H HB3    . LEU A 1 75  ? 171.334 -10.235 128.970 1.00 259.70 ? 75  LEU A HB3    1 
ATOM   1244  H HG     . LEU A 1 75  ? 172.717 -8.362  130.556 1.00 262.55 ? 75  LEU A HG     1 
ATOM   1245  H HD11   . LEU A 1 75  ? 170.828 -7.016  130.331 1.00 262.67 ? 75  LEU A HD11   1 
ATOM   1246  H HD12   . LEU A 1 75  ? 171.478 -7.305  128.910 1.00 262.67 ? 75  LEU A HD12   1 
ATOM   1247  H HD13   . LEU A 1 75  ? 170.178 -8.097  129.365 1.00 262.67 ? 75  LEU A HD13   1 
ATOM   1248  H HD21   . LEU A 1 75  ? 171.047 -8.633  132.152 1.00 263.80 ? 75  LEU A HD21   1 
ATOM   1249  H HD22   . LEU A 1 75  ? 170.388 -9.778  131.268 1.00 263.80 ? 75  LEU A HD22   1 
ATOM   1250  H HD23   . LEU A 1 75  ? 171.817 -10.004 131.926 1.00 263.80 ? 75  LEU A HD23   1 
ATOM   1251  N N      . ARG A 1 76  ? 174.425 -10.889 131.717 1.00 180.43 ? 76  ARG A N      1 
ATOM   1252  C CA     . ARG A 1 76  ? 175.535 -10.429 132.542 1.00 167.26 ? 76  ARG A CA     1 
ATOM   1253  C C      . ARG A 1 76  ? 176.861 -10.988 132.037 1.00 165.11 ? 76  ARG A C      1 
ATOM   1254  O O      . ARG A 1 76  ? 177.728 -10.238 131.590 1.00 160.01 ? 76  ARG A O      1 
ATOM   1255  C CB     . ARG A 1 76  ? 175.320 -10.835 134.001 1.00 161.22 ? 76  ARG A CB     1 
ATOM   1256  C CG     . ARG A 1 76  ? 174.067 -10.248 134.627 1.00 156.69 ? 76  ARG A CG     1 
ATOM   1257  C CD     . ARG A 1 76  ? 174.001 -10.546 136.116 1.00 153.09 ? 76  ARG A CD     1 
ATOM   1258  N NE     . ARG A 1 76  ? 172.774 -10.036 136.722 1.00 149.29 ? 76  ARG A NE     1 
ATOM   1259  C CZ     . ARG A 1 76  ? 172.617 -8.796  137.177 1.00 145.07 ? 76  ARG A CZ     1 
ATOM   1260  N NH1    . ARG A 1 76  ? 173.610 -7.917  137.098 1.00 142.31 ? 76  ARG A NH1    1 
ATOM   1261  N NH2    . ARG A 1 76  ? 171.460 -8.431  137.713 1.00 144.19 ? 76  ARG A NH2    1 
ATOM   1262  H H      . ARG A 1 76  ? 173.889 -11.429 132.117 1.00 216.51 ? 76  ARG A H      1 
ATOM   1263  H HA     . ARG A 1 76  ? 175.580 -9.461  132.502 1.00 200.71 ? 76  ARG A HA     1 
ATOM   1264  H HB2    . ARG A 1 76  ? 175.251 -11.801 134.048 1.00 193.46 ? 76  ARG A HB2    1 
ATOM   1265  H HB3    . ARG A 1 76  ? 176.081 -10.534 134.523 1.00 193.46 ? 76  ARG A HB3    1 
ATOM   1266  H HG2    . ARG A 1 76  ? 174.070 -9.286  134.509 1.00 188.03 ? 76  ARG A HG2    1 
ATOM   1267  H HG3    . ARG A 1 76  ? 173.285 -10.637 134.204 1.00 188.03 ? 76  ARG A HG3    1 
ATOM   1268  H HD2    . ARG A 1 76  ? 174.028 -11.506 136.250 1.00 183.71 ? 76  ARG A HD2    1 
ATOM   1269  H HD3    . ARG A 1 76  ? 174.755 -10.126 136.558 1.00 183.71 ? 76  ARG A HD3    1 
ATOM   1270  H HE     . ARG A 1 76  ? 172.107 -10.574 136.790 1.00 179.15 ? 76  ARG A HE     1 
ATOM   1271  H HH11   . ARG A 1 76  ? 174.362 -8.148  136.752 1.00 170.77 ? 76  ARG A HH11   1 
ATOM   1272  H HH12   . ARG A 1 76  ? 173.500 -7.117  137.394 1.00 170.77 ? 76  ARG A HH12   1 
ATOM   1273  H HH21   . ARG A 1 76  ? 170.814 -8.996  137.766 1.00 173.02 ? 76  ARG A HH21   1 
ATOM   1274  H HH22   . ARG A 1 76  ? 171.355 -7.630  138.007 1.00 173.02 ? 76  ARG A HH22   1 
ATOM   1275  N N      . GLU A 1 77  ? 177.010 -12.308 132.105 1.00 170.04 ? 77  GLU A N      1 
ATOM   1276  C CA     . GLU A 1 77  ? 178.240 -12.968 131.677 1.00 173.92 ? 77  GLU A CA     1 
ATOM   1277  C C      . GLU A 1 77  ? 178.425 -12.906 130.161 1.00 174.73 ? 77  GLU A C      1 
ATOM   1278  O O      . GLU A 1 77  ? 179.526 -13.130 129.656 1.00 174.82 ? 77  GLU A O      1 
ATOM   1279  C CB     . GLU A 1 77  ? 178.256 -14.428 132.141 1.00 176.89 ? 77  GLU A CB     1 
ATOM   1280  C CG     . GLU A 1 77  ? 177.128 -15.279 131.573 1.00 178.61 ? 77  GLU A CG     1 
ATOM   1281  C CD     . GLU A 1 77  ? 177.248 -16.741 131.962 1.00 180.14 ? 77  GLU A CD     1 
ATOM   1282  O OE1    . GLU A 1 77  ? 178.190 -17.086 132.707 1.00 181.05 ? 77  GLU A OE1    1 
ATOM   1283  O OE2    . GLU A 1 77  ? 176.401 -17.545 131.519 1.00 180.26 ? 77  GLU A OE2    1 
ATOM   1284  H H      . GLU A 1 77  ? 176.408 -12.848 132.398 1.00 204.05 ? 77  GLU A H      1 
ATOM   1285  H HA     . GLU A 1 77  ? 178.996 -12.518 132.087 1.00 208.71 ? 77  GLU A HA     1 
ATOM   1286  H HB2    . GLU A 1 77  ? 179.095 -14.831 131.870 1.00 212.27 ? 77  GLU A HB2    1 
ATOM   1287  H HB3    . GLU A 1 77  ? 178.181 -14.447 133.108 1.00 212.27 ? 77  GLU A HB3    1 
ATOM   1288  H HG2    . GLU A 1 77  ? 176.281 -14.948 131.909 1.00 214.34 ? 77  GLU A HG2    1 
ATOM   1289  H HG3    . GLU A 1 77  ? 177.147 -15.224 130.605 1.00 214.34 ? 77  GLU A HG3    1 
ATOM   1290  N N      . ARG A 1 78  ? 177.348 -12.610 129.440 1.00 174.92 ? 78  ARG A N      1 
ATOM   1291  C CA     . ARG A 1 78  ? 177.417 -12.470 127.989 1.00 174.55 ? 78  ARG A CA     1 
ATOM   1292  C C      . ARG A 1 78  ? 178.192 -11.209 127.608 1.00 167.42 ? 78  ARG A C      1 
ATOM   1293  O O      . ARG A 1 78  ? 178.708 -11.099 126.495 1.00 168.26 ? 78  ARG A O      1 
ATOM   1294  C CB     . ARG A 1 78  ? 176.012 -12.437 127.384 1.00 179.48 ? 78  ARG A CB     1 
ATOM   1295  C CG     . ARG A 1 78  ? 175.994 -12.292 125.869 1.00 185.90 ? 78  ARG A CG     1 
ATOM   1296  C CD     . ARG A 1 78  ? 174.715 -12.855 125.261 1.00 191.36 ? 78  ARG A CD     1 
ATOM   1297  N NE     . ARG A 1 78  ? 173.512 -12.190 125.761 1.00 193.66 ? 78  ARG A NE     1 
ATOM   1298  C CZ     . ARG A 1 78  ? 172.955 -11.113 125.211 1.00 194.57 ? 78  ARG A CZ     1 
ATOM   1299  N NH1    . ARG A 1 78  ? 173.486 -10.550 124.132 1.00 195.68 ? 78  ARG A NH1    1 
ATOM   1300  N NH2    . ARG A 1 78  ? 171.858 -10.591 125.747 1.00 193.39 ? 78  ARG A NH2    1 
ATOM   1301  H H      . ARG A 1 78  ? 176.562 -12.485 129.767 1.00 209.90 ? 78  ARG A H      1 
ATOM   1302  H HA     . ARG A 1 78  ? 177.886 -13.235 127.619 1.00 209.46 ? 78  ARG A HA     1 
ATOM   1303  H HB2    . ARG A 1 78  ? 175.556 -13.264 127.607 1.00 215.38 ? 78  ARG A HB2    1 
ATOM   1304  H HB3    . ARG A 1 78  ? 175.528 -11.684 127.759 1.00 215.38 ? 78  ARG A HB3    1 
ATOM   1305  H HG2    . ARG A 1 78  ? 176.051 -11.351 125.638 1.00 223.08 ? 78  ARG A HG2    1 
ATOM   1306  H HG3    . ARG A 1 78  ? 176.746 -12.775 125.493 1.00 223.08 ? 78  ARG A HG3    1 
ATOM   1307  H HD2    . ARG A 1 78  ? 174.744 -12.738 124.298 1.00 229.63 ? 78  ARG A HD2    1 
ATOM   1308  H HD3    . ARG A 1 78  ? 174.649 -13.798 125.479 1.00 229.63 ? 78  ARG A HD3    1 
ATOM   1309  H HE     . ARG A 1 78  ? 173.136 -12.520 126.461 1.00 232.39 ? 78  ARG A HE     1 
ATOM   1310  H HH11   . ARG A 1 78  ? 174.196 -10.883 123.779 1.00 234.82 ? 78  ARG A HH11   1 
ATOM   1311  H HH12   . ARG A 1 78  ? 173.119 -9.854  123.785 1.00 234.82 ? 78  ARG A HH12   1 
ATOM   1312  H HH21   . ARG A 1 78  ? 171.509 -10.950 126.447 1.00 232.07 ? 78  ARG A HH21   1 
ATOM   1313  H HH22   . ARG A 1 78  ? 171.497 -9.894  125.396 1.00 232.07 ? 78  ARG A HH22   1 
ATOM   1314  N N      . GLY A 1 79  ? 178.272 -10.266 128.543 1.00 159.43 ? 79  GLY A N      1 
ATOM   1315  C CA     . GLY A 1 79  ? 179.029 -9.041  128.349 1.00 152.96 ? 79  GLY A CA     1 
ATOM   1316  C C      . GLY A 1 79  ? 180.478 -9.185  128.778 1.00 149.06 ? 79  GLY A C      1 
ATOM   1317  O O      . GLY A 1 79  ? 181.359 -8.502  128.255 1.00 147.05 ? 79  GLY A O      1 
ATOM   1318  H H      . GLY A 1 79  ? 177.888 -10.316 129.311 1.00 191.32 ? 79  GLY A H      1 
ATOM   1319  H HA2    . GLY A 1 79  ? 179.009 -8.794  127.411 1.00 183.56 ? 79  GLY A HA2    1 
ATOM   1320  H HA3    . GLY A 1 79  ? 178.625 -8.326  128.864 1.00 183.56 ? 79  GLY A HA3    1 
ATOM   1321  N N      . LEU A 1 80  ? 180.723 -10.074 129.737 1.00 149.36 ? 80  LEU A N      1 
ATOM   1322  C CA     . LEU A 1 80  ? 182.077 -10.344 130.216 1.00 151.49 ? 80  LEU A CA     1 
ATOM   1323  C C      . LEU A 1 80  ? 182.940 -10.971 129.124 1.00 158.72 ? 80  LEU A C      1 
ATOM   1324  O O      . LEU A 1 80  ? 184.160 -10.810 129.121 1.00 159.77 ? 80  LEU A O      1 
ATOM   1325  C CB     . LEU A 1 80  ? 182.040 -11.267 131.437 1.00 149.23 ? 80  LEU A CB     1 
ATOM   1326  C CG     . LEU A 1 80  ? 181.924 -10.591 132.806 1.00 147.32 ? 80  LEU A CG     1 
ATOM   1327  C CD1    . LEU A 1 80  ? 180.663 -9.751  132.898 1.00 144.98 ? 80  LEU A CD1    1 
ATOM   1328  C CD2    . LEU A 1 80  ? 181.951 -11.630 133.917 1.00 148.51 ? 80  LEU A CD2    1 
ATOM   1329  H H      . LEU A 1 80  ? 180.116 -10.538 130.131 1.00 179.23 ? 80  LEU A H      1 
ATOM   1330  H HA     . LEU A 1 80  ? 182.490 -9.508  130.483 1.00 181.79 ? 80  LEU A HA     1 
ATOM   1331  H HB2    . LEU A 1 80  ? 181.278 -11.861 131.344 1.00 179.07 ? 80  LEU A HB2    1 
ATOM   1332  H HB3    . LEU A 1 80  ? 182.855 -11.792 131.444 1.00 179.07 ? 80  LEU A HB3    1 
ATOM   1333  H HG     . LEU A 1 80  ? 182.684 -10.002 132.930 1.00 176.79 ? 80  LEU A HG     1 
ATOM   1334  H HD11   . LEU A 1 80  ? 180.622 -9.339  133.775 1.00 173.97 ? 80  LEU A HD11   1 
ATOM   1335  H HD12   . LEU A 1 80  ? 180.690 -9.066  132.212 1.00 173.97 ? 80  LEU A HD12   1 
ATOM   1336  H HD13   . LEU A 1 80  ? 179.892 -10.324 132.765 1.00 173.97 ? 80  LEU A HD13   1 
ATOM   1337  H HD21   . LEU A 1 80  ? 181.876 -11.179 134.772 1.00 178.21 ? 80  LEU A HD21   1 
ATOM   1338  H HD22   . LEU A 1 80  ? 181.205 -12.239 133.798 1.00 178.21 ? 80  LEU A HD22   1 
ATOM   1339  H HD23   . LEU A 1 80  ? 182.788 -12.118 133.872 1.00 178.21 ? 80  LEU A HD23   1 
ATOM   1340  N N      . GLU A 1 81  ? 182.303 -11.688 128.203 1.00 165.35 ? 81  GLU A N      1 
ATOM   1341  C CA     . GLU A 1 81  ? 183.018 -12.318 127.098 1.00 173.71 ? 81  GLU A CA     1 
ATOM   1342  C C      . GLU A 1 81  ? 183.544 -11.258 126.134 1.00 186.09 ? 81  GLU A C      1 
ATOM   1343  O O      . GLU A 1 81  ? 184.657 -11.368 125.620 1.00 182.58 ? 81  GLU A O      1 
ATOM   1344  C CB     . GLU A 1 81  ? 182.106 -13.299 126.354 1.00 171.70 ? 81  GLU A CB     1 
ATOM   1345  C CG     . GLU A 1 81  ? 182.808 -14.088 125.252 1.00 171.45 ? 81  GLU A CG     1 
ATOM   1346  C CD     . GLU A 1 81  ? 181.877 -15.037 124.519 1.00 170.48 ? 81  GLU A CD     1 
ATOM   1347  O OE1    . GLU A 1 81  ? 180.680 -15.092 124.873 1.00 168.78 ? 81  GLU A OE1    1 
ATOM   1348  O OE2    . GLU A 1 81  ? 182.343 -15.727 123.587 1.00 171.46 ? 81  GLU A OE2    1 
ATOM   1349  H H      . GLU A 1 81  ? 181.454 -11.826 128.195 1.00 198.42 ? 81  GLU A H      1 
ATOM   1350  H HA     . GLU A 1 81  ? 183.775 -12.812 127.447 1.00 208.46 ? 81  GLU A HA     1 
ATOM   1351  H HB2    . GLU A 1 81  ? 181.748 -13.936 126.992 1.00 206.04 ? 81  GLU A HB2    1 
ATOM   1352  H HB3    . GLU A 1 81  ? 181.380 -12.802 125.945 1.00 206.04 ? 81  GLU A HB3    1 
ATOM   1353  H HG2    . GLU A 1 81  ? 183.173 -13.466 124.603 1.00 205.74 ? 81  GLU A HG2    1 
ATOM   1354  H HG3    . GLU A 1 81  ? 183.522 -14.613 125.646 1.00 205.74 ? 81  GLU A HG3    1 
ATOM   1355  N N      . ILE A 1 82  ? 182.736 -10.229 125.896 1.00 203.23 ? 82  ILE A N      1 
ATOM   1356  C CA     . ILE A 1 82  ? 183.110 -9.150  124.988 1.00 213.57 ? 82  ILE A CA     1 
ATOM   1357  C C      . ILE A 1 82  ? 184.159 -8.249  125.634 1.00 199.73 ? 82  ILE A C      1 
ATOM   1358  O O      . ILE A 1 82  ? 185.000 -7.668  124.948 1.00 209.29 ? 82  ILE A O      1 
ATOM   1359  C CB     . ILE A 1 82  ? 181.880 -8.304  124.587 1.00 226.80 ? 82  ILE A CB     1 
ATOM   1360  C CG1    . ILE A 1 82  ? 180.798 -9.200  123.976 1.00 234.30 ? 82  ILE A CG1    1 
ATOM   1361  C CG2    . ILE A 1 82  ? 182.279 -7.203  123.602 1.00 229.82 ? 82  ILE A CG2    1 
ATOM   1362  C CD1    . ILE A 1 82  ? 179.478 -8.501  123.720 1.00 236.61 ? 82  ILE A CD1    1 
ATOM   1363  H H      . ILE A 1 82  ? 181.959 -10.131 126.252 1.00 243.88 ? 82  ILE A H      1 
ATOM   1364  H HA     . ILE A 1 82  ? 183.492 -9.530  124.182 1.00 256.28 ? 82  ILE A HA     1 
ATOM   1365  H HB     . ILE A 1 82  ? 181.520 -7.887  125.386 1.00 272.16 ? 82  ILE A HB     1 
ATOM   1366  H HG12   . ILE A 1 82  ? 181.120 -9.542  123.127 1.00 281.16 ? 82  ILE A HG12   1 
ATOM   1367  H HG13   . ILE A 1 82  ? 180.628 -9.939  124.582 1.00 281.16 ? 82  ILE A HG13   1 
ATOM   1368  H HG21   . ILE A 1 82  ? 181.491 -6.688  123.368 1.00 275.79 ? 82  ILE A HG21   1 
ATOM   1369  H HG22   . ILE A 1 82  ? 182.937 -6.627  124.022 1.00 275.79 ? 82  ILE A HG22   1 
ATOM   1370  H HG23   . ILE A 1 82  ? 182.656 -7.612  122.808 1.00 275.79 ? 82  ILE A HG23   1 
ATOM   1371  H HD11   . ILE A 1 82  ? 178.854 -9.136  123.335 1.00 283.93 ? 82  ILE A HD11   1 
ATOM   1372  H HD12   . ILE A 1 82  ? 179.131 -8.164  124.560 1.00 283.93 ? 82  ILE A HD12   1 
ATOM   1373  H HD13   . ILE A 1 82  ? 179.625 -7.766  123.103 1.00 283.93 ? 82  ILE A HD13   1 
ATOM   1374  N N      . GLY A 1 83  ? 184.105 -8.144  126.959 1.00 171.34 ? 83  GLY A N      1 
ATOM   1375  C CA     . GLY A 1 83  ? 185.022 -7.296  127.699 1.00 152.73 ? 83  GLY A CA     1 
ATOM   1376  C C      . GLY A 1 83  ? 186.477 -7.671  127.496 1.00 146.85 ? 83  GLY A C      1 
ATOM   1377  O O      . GLY A 1 83  ? 187.273 -6.854  127.034 1.00 139.46 ? 83  GLY A O      1 
ATOM   1378  H H      . GLY A 1 83  ? 183.538 -8.560  127.454 1.00 205.61 ? 83  GLY A H      1 
ATOM   1379  H HA2    . GLY A 1 83  ? 184.902 -6.375  127.421 1.00 183.28 ? 83  GLY A HA2    1 
ATOM   1380  H HA3    . GLY A 1 83  ? 184.821 -7.358  128.646 1.00 183.28 ? 83  GLY A HA3    1 
ATOM   1381  N N      . LYS A 1 84  ? 186.822 -8.910  127.836 1.00 154.88 ? 84  LYS A N      1 
ATOM   1382  C CA     . LYS A 1 84  ? 188.201 -9.379  127.750 1.00 164.52 ? 84  LYS A CA     1 
ATOM   1383  C C      . LYS A 1 84  ? 188.725 -9.337  126.317 1.00 175.22 ? 84  LYS A C      1 
ATOM   1384  O O      . LYS A 1 84  ? 189.923 -9.163  126.091 1.00 175.94 ? 84  LYS A O      1 
ATOM   1385  C CB     . LYS A 1 84  ? 188.314 -10.808 128.288 1.00 164.92 ? 84  LYS A CB     1 
ATOM   1386  C CG     . LYS A 1 84  ? 187.832 -10.985 129.717 1.00 163.59 ? 84  LYS A CG     1 
ATOM   1387  C CD     . LYS A 1 84  ? 188.209 -12.359 130.252 1.00 164.77 ? 84  LYS A CD     1 
ATOM   1388  C CE     . LYS A 1 84  ? 187.761 -12.545 131.693 1.00 163.78 ? 84  LYS A CE     1 
ATOM   1389  N NZ     . LYS A 1 84  ? 188.131 -13.888 132.222 1.00 164.29 ? 84  LYS A NZ     1 
ATOM   1390  H H      . LYS A 1 84  ? 186.269 -9.503  128.123 1.00 185.86 ? 84  LYS A H      1 
ATOM   1391  H HA     . LYS A 1 84  ? 188.765 -8.807  128.294 1.00 197.42 ? 84  LYS A HA     1 
ATOM   1392  H HB2    . LYS A 1 84  ? 187.784 -11.394 127.724 1.00 197.90 ? 84  LYS A HB2    1 
ATOM   1393  H HB3    . LYS A 1 84  ? 189.245 -11.078 128.256 1.00 197.90 ? 84  LYS A HB3    1 
ATOM   1394  H HG2    . LYS A 1 84  ? 188.245 -10.313 130.281 1.00 196.31 ? 84  LYS A HG2    1 
ATOM   1395  H HG3    . LYS A 1 84  ? 186.866 -10.902 129.743 1.00 196.31 ? 84  LYS A HG3    1 
ATOM   1396  H HD2    . LYS A 1 84  ? 187.781 -13.041 129.711 1.00 197.72 ? 84  LYS A HD2    1 
ATOM   1397  H HD3    . LYS A 1 84  ? 189.173 -12.461 130.219 1.00 197.72 ? 84  LYS A HD3    1 
ATOM   1398  H HE2    . LYS A 1 84  ? 188.186 -11.873 132.248 1.00 196.54 ? 84  LYS A HE2    1 
ATOM   1399  H HE3    . LYS A 1 84  ? 186.796 -12.457 131.740 1.00 196.54 ? 84  LYS A HE3    1 
ATOM   1400  H HZ1    . LYS A 1 84  ? 187.857 -13.968 133.065 1.00 197.15 ? 84  LYS A HZ1    1 
ATOM   1401  H HZ2    . LYS A 1 84  ? 187.749 -14.524 131.732 1.00 197.15 ? 84  LYS A HZ2    1 
ATOM   1402  H HZ3    . LYS A 1 84  ? 189.015 -13.992 132.194 1.00 197.15 ? 84  LYS A HZ3    1 
ATOM   1403  N N      . ALA A 1 85  ? 187.823 -9.497  125.354 1.00 184.36 ? 85  ALA A N      1 
ATOM   1404  C CA     . ALA A 1 85  ? 188.203 -9.566  123.946 1.00 190.41 ? 85  ALA A CA     1 
ATOM   1405  C C      . ALA A 1 85  ? 188.824 -8.260  123.457 1.00 185.26 ? 85  ALA A C      1 
ATOM   1406  O O      . ALA A 1 85  ? 189.943 -8.252  122.942 1.00 191.77 ? 85  ALA A O      1 
ATOM   1407  C CB     . ALA A 1 85  ? 186.995 -9.925  123.093 1.00 195.15 ? 85  ALA A CB     1 
ATOM   1408  H H      . ALA A 1 85  ? 186.977 -9.568  125.490 1.00 221.24 ? 85  ALA A H      1 
ATOM   1409  H HA     . ALA A 1 85  ? 188.864 -10.267 123.835 1.00 228.49 ? 85  ALA A HA     1 
ATOM   1410  H HB1    . ALA A 1 85  ? 187.267 -9.966  122.163 1.00 234.19 ? 85  ALA A HB1    1 
ATOM   1411  H HB2    . ALA A 1 85  ? 186.654 -10.788 123.378 1.00 234.19 ? 85  ALA A HB2    1 
ATOM   1412  H HB3    . ALA A 1 85  ? 186.313 -9.245  123.210 1.00 234.19 ? 85  ALA A HB3    1 
ATOM   1413  N N      . VAL A 1 86  ? 188.094 -7.161  123.620 1.00 169.30 ? 86  VAL A N      1 
ATOM   1414  C CA     . VAL A 1 86  ? 188.544 -5.862  123.126 1.00 153.99 ? 86  VAL A CA     1 
ATOM   1415  C C      . VAL A 1 86  ? 189.552 -5.199  124.065 1.00 150.35 ? 86  VAL A C      1 
ATOM   1416  O O      . VAL A 1 86  ? 190.154 -4.183  123.715 1.00 148.69 ? 86  VAL A O      1 
ATOM   1417  C CB     . VAL A 1 86  ? 187.356 -4.903  122.896 1.00 142.32 ? 86  VAL A CB     1 
ATOM   1418  C CG1    . VAL A 1 86  ? 186.422 -5.467  121.834 1.00 142.33 ? 86  VAL A CG1    1 
ATOM   1419  C CG2    . VAL A 1 86  ? 186.601 -4.643  124.198 1.00 133.62 ? 86  VAL A CG2    1 
ATOM   1420  H H      . VAL A 1 86  ? 187.331 -7.140  124.015 1.00 203.16 ? 86  VAL A H      1 
ATOM   1421  H HA     . VAL A 1 86  ? 188.984 -5.994  122.271 1.00 184.78 ? 86  VAL A HA     1 
ATOM   1422  H HB     . VAL A 1 86  ? 187.695 -4.054  122.573 1.00 170.79 ? 86  VAL A HB     1 
ATOM   1423  H HG11   . VAL A 1 86  ? 185.683 -4.852  121.704 1.00 170.80 ? 86  VAL A HG11   1 
ATOM   1424  H HG12   . VAL A 1 86  ? 186.914 -5.573  121.005 1.00 170.80 ? 86  VAL A HG12   1 
ATOM   1425  H HG13   . VAL A 1 86  ? 186.088 -6.328  122.133 1.00 170.80 ? 86  VAL A HG13   1 
ATOM   1426  H HG21   . VAL A 1 86  ? 185.863 -4.040  124.020 1.00 160.34 ? 86  VAL A HG21   1 
ATOM   1427  H HG22   . VAL A 1 86  ? 186.264 -5.486  124.541 1.00 160.34 ? 86  VAL A HG22   1 
ATOM   1428  H HG23   . VAL A 1 86  ? 187.209 -4.244  124.840 1.00 160.34 ? 86  VAL A HG23   1 
ATOM   1429  N N      . LEU A 1 87  ? 189.733 -5.780  125.250 1.00 148.89 ? 87  LEU A N      1 
ATOM   1430  C CA     . LEU A 1 87  ? 190.669 -5.249  126.239 1.00 145.76 ? 87  LEU A CA     1 
ATOM   1431  C C      . LEU A 1 87  ? 192.001 -5.982  126.198 1.00 145.71 ? 87  LEU A C      1 
ATOM   1432  O O      . LEU A 1 87  ? 192.074 -7.141  125.788 1.00 152.47 ? 87  LEU A O      1 
ATOM   1433  C CB     . LEU A 1 87  ? 190.080 -5.352  127.648 1.00 141.43 ? 87  LEU A CB     1 
ATOM   1434  C CG     . LEU A 1 87  ? 188.958 -4.374  127.997 1.00 136.03 ? 87  LEU A CG     1 
ATOM   1435  C CD1    . LEU A 1 87  ? 188.353 -4.730  129.346 1.00 132.51 ? 87  LEU A CD1    1 
ATOM   1436  C CD2    . LEU A 1 87  ? 189.466 -2.937  127.999 1.00 134.53 ? 87  LEU A CD2    1 
ATOM   1437  H H      . LEU A 1 87  ? 189.322 -6.490  125.507 1.00 178.67 ? 87  LEU A H      1 
ATOM   1438  H HA     . LEU A 1 87  ? 190.834 -4.312  126.049 1.00 174.91 ? 87  LEU A HA     1 
ATOM   1439  H HB2    . LEU A 1 87  ? 189.726 -6.248  127.763 1.00 169.71 ? 87  LEU A HB2    1 
ATOM   1440  H HB3    . LEU A 1 87  ? 190.796 -5.207  128.286 1.00 169.71 ? 87  LEU A HB3    1 
ATOM   1441  H HG     . LEU A 1 87  ? 188.259 -4.444  127.328 1.00 163.23 ? 87  LEU A HG     1 
ATOM   1442  H HD11   . LEU A 1 87  ? 187.645 -4.099  129.550 1.00 159.01 ? 87  LEU A HD11   1 
ATOM   1443  H HD12   . LEU A 1 87  ? 187.994 -5.630  129.303 1.00 159.01 ? 87  LEU A HD12   1 
ATOM   1444  H HD13   . LEU A 1 87  ? 189.045 -4.682  130.024 1.00 159.01 ? 87  LEU A HD13   1 
ATOM   1445  H HD21   . LEU A 1 87  ? 188.732 -2.344  128.224 1.00 161.44 ? 87  LEU A HD21   1 
ATOM   1446  H HD22   . LEU A 1 87  ? 190.173 -2.853  128.658 1.00 161.44 ? 87  LEU A HD22   1 
ATOM   1447  H HD23   . LEU A 1 87  ? 189.807 -2.722  127.117 1.00 161.44 ? 87  LEU A HD23   1 
ATOM   1448  N N      . ASP A 1 88  ? 193.049 -5.294  126.638 1.00 137.38 ? 88  ASP A N      1 
ATOM   1449  C CA     . ASP A 1 88  ? 194.391 -5.858  126.673 1.00 134.62 ? 88  ASP A CA     1 
ATOM   1450  C C      . ASP A 1 88  ? 194.678 -6.484  128.034 1.00 133.28 ? 88  ASP A C      1 
ATOM   1451  O O      . ASP A 1 88  ? 195.509 -7.385  128.147 1.00 137.90 ? 88  ASP A O      1 
ATOM   1452  C CB     . ASP A 1 88  ? 195.423 -4.773  126.367 1.00 134.90 ? 88  ASP A CB     1 
ATOM   1453  C CG     . ASP A 1 88  ? 195.199 -4.120  125.016 1.00 136.72 ? 88  ASP A CG     1 
ATOM   1454  O OD1    . ASP A 1 88  ? 194.739 -4.814  124.086 1.00 138.73 ? 88  ASP A OD1    1 
ATOM   1455  O OD2    . ASP A 1 88  ? 195.479 -2.911  124.882 1.00 136.52 ? 88  ASP A OD2    1 
ATOM   1456  H H      . ASP A 1 88  ? 193.007 -4.484  126.926 1.00 164.86 ? 88  ASP A H      1 
ATOM   1457  H HA     . ASP A 1 88  ? 194.466 -6.550  125.997 1.00 161.55 ? 88  ASP A HA     1 
ATOM   1458  H HB2    . ASP A 1 88  ? 195.369 -4.083  127.046 1.00 161.88 ? 88  ASP A HB2    1 
ATOM   1459  H HB3    . ASP A 1 88  ? 196.309 -5.169  126.365 1.00 161.88 ? 88  ASP A HB3    1 
ATOM   1460  N N      . SER A 1 89  ? 193.982 -6.004  129.061 1.00 128.41 ? 89  SER A N      1 
ATOM   1461  C CA     . SER A 1 89  ? 194.182 -6.479  130.427 1.00 127.74 ? 89  SER A CA     1 
ATOM   1462  C C      . SER A 1 89  ? 192.847 -6.651  131.141 1.00 131.81 ? 89  SER A C      1 
ATOM   1463  O O      . SER A 1 89  ? 192.212 -5.673  131.523 1.00 125.46 ? 89  SER A O      1 
ATOM   1464  C CB     . SER A 1 89  ? 195.057 -5.492  131.206 1.00 122.97 ? 89  SER A CB     1 
ATOM   1465  O OG     . SER A 1 89  ? 195.224 -5.902  132.552 1.00 120.09 ? 89  SER A OG     1 
ATOM   1466  H H      . SER A 1 89  ? 193.379 -5.394  128.992 1.00 154.10 ? 89  SER A H      1 
ATOM   1467  H HA     . SER A 1 89  ? 194.632 -7.338  130.407 1.00 153.29 ? 89  SER A HA     1 
ATOM   1468  H HB2    . SER A 1 89  ? 195.928 -5.442  130.783 1.00 147.56 ? 89  SER A HB2    1 
ATOM   1469  H HB3    . SER A 1 89  ? 194.633 -4.619  131.194 1.00 147.56 ? 89  SER A HB3    1 
ATOM   1470  H HG     . SER A 1 89  ? 195.706 -5.349  132.963 1.00 144.11 ? 89  SER A HG     1 
ATOM   1471  N N      . TYR A 1 90  ? 192.431 -7.899  131.327 1.00 144.29 ? 90  TYR A N      1 
ATOM   1472  C CA     . TYR A 1 90  ? 191.161 -8.192  131.983 1.00 154.39 ? 90  TYR A CA     1 
ATOM   1473  C C      . TYR A 1 90  ? 191.346 -8.313  133.494 1.00 157.85 ? 90  TYR A C      1 
ATOM   1474  O O      . TYR A 1 90  ? 192.342 -8.860  133.966 1.00 160.31 ? 90  TYR A O      1 
ATOM   1475  C CB     . TYR A 1 90  ? 190.539 -9.475  131.411 1.00 161.22 ? 90  TYR A CB     1 
ATOM   1476  C CG     . TYR A 1 90  ? 191.306 -10.750 131.714 1.00 167.92 ? 90  TYR A CG     1 
ATOM   1477  C CD1    . TYR A 1 90  ? 192.385 -11.143 130.931 1.00 172.44 ? 90  TYR A CD1    1 
ATOM   1478  C CD2    . TYR A 1 90  ? 190.938 -11.569 132.775 1.00 168.83 ? 90  TYR A CD2    1 
ATOM   1479  C CE1    . TYR A 1 90  ? 193.083 -12.308 131.205 1.00 174.35 ? 90  TYR A CE1    1 
ATOM   1480  C CE2    . TYR A 1 90  ? 191.629 -12.735 133.054 1.00 170.62 ? 90  TYR A CE2    1 
ATOM   1481  C CZ     . TYR A 1 90  ? 192.699 -13.099 132.266 1.00 173.23 ? 90  TYR A CZ     1 
ATOM   1482  O OH     . TYR A 1 90  ? 193.387 -14.257 132.541 1.00 174.57 ? 90  TYR A OH     1 
ATOM   1483  H H      . TYR A 1 90  ? 192.868 -8.598  131.082 1.00 173.15 ? 90  TYR A H      1 
ATOM   1484  H HA     . TYR A 1 90  ? 190.545 -7.461  131.815 1.00 185.27 ? 90  TYR A HA     1 
ATOM   1485  H HB2    . TYR A 1 90  ? 189.647 -9.576  131.779 1.00 193.46 ? 90  TYR A HB2    1 
ATOM   1486  H HB3    . TYR A 1 90  ? 190.485 -9.388  130.447 1.00 193.46 ? 90  TYR A HB3    1 
ATOM   1487  H HD1    . TYR A 1 90  ? 192.648 -10.611 130.214 1.00 206.93 ? 90  TYR A HD1    1 
ATOM   1488  H HD2    . TYR A 1 90  ? 190.217 -11.327 133.310 1.00 202.60 ? 90  TYR A HD2    1 
ATOM   1489  H HE1    . TYR A 1 90  ? 193.805 -12.556 130.674 1.00 209.22 ? 90  TYR A HE1    1 
ATOM   1490  H HE2    . TYR A 1 90  ? 191.372 -13.271 133.770 1.00 204.74 ? 90  TYR A HE2    1 
ATOM   1491  H HH     . TYR A 1 90  ? 193.051 -14.640 133.209 1.00 209.48 ? 90  TYR A HH     1 
ATOM   1492  N N      . GLU A 1 91  ? 190.386 -7.786  134.248 1.00 156.92 ? 91  GLU A N      1 
ATOM   1493  C CA     . GLU A 1 91  ? 190.387 -7.915  135.703 1.00 152.62 ? 91  GLU A CA     1 
ATOM   1494  C C      . GLU A 1 91  ? 189.048 -7.480  136.284 1.00 144.38 ? 91  GLU A C      1 
ATOM   1495  O O      . GLU A 1 91  ? 188.853 -6.312  136.617 1.00 146.16 ? 91  GLU A O      1 
ATOM   1496  C CB     . GLU A 1 91  ? 191.528 -7.106  136.325 1.00 153.16 ? 91  GLU A CB     1 
ATOM   1497  C CG     . GLU A 1 91  ? 191.705 -5.708  135.756 1.00 151.45 ? 91  GLU A CG     1 
ATOM   1498  C CD     . GLU A 1 91  ? 192.911 -5.000  136.337 1.00 149.35 ? 91  GLU A CD     1 
ATOM   1499  O OE1    . GLU A 1 91  ? 193.132 -3.818  135.998 1.00 147.96 ? 91  GLU A OE1    1 
ATOM   1500  O OE2    . GLU A 1 91  ? 193.641 -5.628  137.134 1.00 149.13 ? 91  GLU A OE2    1 
ATOM   1501  H H      . GLU A 1 91  ? 189.716 -7.344  133.938 1.00 188.30 ? 91  GLU A H      1 
ATOM   1502  H HA     . GLU A 1 91  ? 190.523 -8.847  135.934 1.00 183.14 ? 91  GLU A HA     1 
ATOM   1503  H HB2    . GLU A 1 91  ? 191.360 -7.016  137.276 1.00 183.79 ? 91  GLU A HB2    1 
ATOM   1504  H HB3    . GLU A 1 91  ? 192.359 -7.586  136.186 1.00 183.79 ? 91  GLU A HB3    1 
ATOM   1505  H HG2    . GLU A 1 91  ? 191.824 -5.769  134.796 1.00 181.74 ? 91  GLU A HG2    1 
ATOM   1506  H HG3    . GLU A 1 91  ? 190.918 -5.180  135.962 1.00 181.74 ? 91  GLU A HG3    1 
ATOM   1507  N N      . ILE A 1 92  ? 188.133 -8.437  136.407 1.00 134.58 ? 92  ILE A N      1 
ATOM   1508  C CA     . ILE A 1 92  ? 186.771 -8.160  136.852 1.00 125.55 ? 92  ILE A CA     1 
ATOM   1509  C C      . ILE A 1 92  ? 186.768 -7.506  138.229 1.00 125.81 ? 92  ILE A C      1 
ATOM   1510  O O      . ILE A 1 92  ? 187.577 -7.848  139.091 1.00 121.65 ? 92  ILE A O      1 
ATOM   1511  C CB     . ILE A 1 92  ? 185.914 -9.451  136.884 1.00 120.15 ? 92  ILE A CB     1 
ATOM   1512  C CG1    . ILE A 1 92  ? 185.853 -10.077 135.487 1.00 122.56 ? 92  ILE A CG1    1 
ATOM   1513  C CG2    . ILE A 1 92  ? 184.501 -9.154  137.392 1.00 115.12 ? 92  ILE A CG2    1 
ATOM   1514  C CD1    . ILE A 1 92  ? 185.192 -11.437 135.440 1.00 124.92 ? 92  ILE A CD1    1 
ATOM   1515  H H      . ILE A 1 92  ? 188.279 -9.267  136.237 1.00 161.50 ? 92  ILE A H      1 
ATOM   1516  H HA     . ILE A 1 92  ? 186.357 -7.543  136.228 1.00 150.66 ? 92  ILE A HA     1 
ATOM   1517  H HB     . ILE A 1 92  ? 186.333 -10.084 137.488 1.00 144.18 ? 92  ILE A HB     1 
ATOM   1518  H HG12   . ILE A 1 92  ? 185.351 -9.486  134.904 1.00 147.08 ? 92  ILE A HG12   1 
ATOM   1519  H HG13   . ILE A 1 92  ? 186.757 -10.177 135.151 1.00 147.08 ? 92  ILE A HG13   1 
ATOM   1520  H HG21   . ILE A 1 92  ? 183.990 -9.979  137.401 1.00 138.14 ? 92  ILE A HG21   1 
ATOM   1521  H HG22   . ILE A 1 92  ? 184.558 -8.790  138.289 1.00 138.14 ? 92  ILE A HG22   1 
ATOM   1522  H HG23   . ILE A 1 92  ? 184.082 -8.511  136.799 1.00 138.14 ? 92  ILE A HG23   1 
ATOM   1523  H HD11   . ILE A 1 92  ? 185.196 -11.758 134.525 1.00 149.91 ? 92  ILE A HD11   1 
ATOM   1524  H HD12   . ILE A 1 92  ? 185.688 -12.048 136.007 1.00 149.91 ? 92  ILE A HD12   1 
ATOM   1525  H HD13   . ILE A 1 92  ? 184.280 -11.356 135.759 1.00 149.91 ? 92  ILE A HD13   1 
ATOM   1526  N N      . ARG A 1 93  ? 185.861 -6.551  138.410 1.00 133.34 ? 93  ARG A N      1 
ATOM   1527  C CA     . ARG A 1 93  ? 185.660 -5.888  139.692 1.00 138.52 ? 93  ARG A CA     1 
ATOM   1528  C C      . ARG A 1 93  ? 184.170 -5.878  140.012 1.00 141.76 ? 93  ARG A C      1 
ATOM   1529  O O      . ARG A 1 93  ? 183.337 -6.031  139.118 1.00 140.13 ? 93  ARG A O      1 
ATOM   1530  C CB     . ARG A 1 93  ? 186.194 -4.455  139.648 1.00 137.08 ? 93  ARG A CB     1 
ATOM   1531  C CG     . ARG A 1 93  ? 187.708 -4.327  139.670 1.00 135.87 ? 93  ARG A CG     1 
ATOM   1532  C CD     . ARG A 1 93  ? 188.112 -2.862  139.562 1.00 134.47 ? 93  ARG A CD     1 
ATOM   1533  N NE     . ARG A 1 93  ? 189.558 -2.670  139.616 1.00 134.80 ? 93  ARG A NE     1 
ATOM   1534  C CZ     . ARG A 1 93  ? 190.160 -1.485  139.550 1.00 133.55 ? 93  ARG A CZ     1 
ATOM   1535  N NH1    . ARG A 1 93  ? 189.443 -0.373  139.429 1.00 129.58 ? 93  ARG A NH1    1 
ATOM   1536  N NH2    . ARG A 1 93  ? 191.483 -1.411  139.606 1.00 135.84 ? 93  ARG A NH2    1 
ATOM   1537  H H      . ARG A 1 93  ? 185.339 -6.263  137.790 1.00 160.00 ? 93  ARG A H      1 
ATOM   1538  H HA     . ARG A 1 93  ? 186.127 -6.375  140.389 1.00 166.22 ? 93  ARG A HA     1 
ATOM   1539  H HB2    . ARG A 1 93  ? 185.877 -4.034  138.834 1.00 164.49 ? 93  ARG A HB2    1 
ATOM   1540  H HB3    . ARG A 1 93  ? 185.849 -3.975  140.417 1.00 164.49 ? 93  ARG A HB3    1 
ATOM   1541  H HG2    . ARG A 1 93  ? 188.052 -4.681  140.505 1.00 163.05 ? 93  ARG A HG2    1 
ATOM   1542  H HG3    . ARG A 1 93  ? 188.086 -4.807  138.916 1.00 163.05 ? 93  ARG A HG3    1 
ATOM   1543  H HD2    . ARG A 1 93  ? 187.793 -2.507  138.718 1.00 161.37 ? 93  ARG A HD2    1 
ATOM   1544  H HD3    . ARG A 1 93  ? 187.717 -2.370  140.299 1.00 161.37 ? 93  ARG A HD3    1 
ATOM   1545  H HE     . ARG A 1 93  ? 190.054 -3.368  139.694 1.00 161.77 ? 93  ARG A HE     1 
ATOM   1546  H HH11   . ARG A 1 93  ? 188.585 -0.416  139.392 1.00 155.50 ? 93  ARG A HH11   1 
ATOM   1547  H HH12   . ARG A 1 93  ? 189.838 0.390   139.388 1.00 155.50 ? 93  ARG A HH12   1 
ATOM   1548  H HH21   . ARG A 1 93  ? 191.951 -2.128  139.685 1.00 163.01 ? 93  ARG A HH21   1 
ATOM   1549  H HH22   . ARG A 1 93  ? 191.873 -0.645  139.565 1.00 163.01 ? 93  ARG A HH22   1 
ATOM   1550  N N      . TYR A 1 94  ? 183.845 -5.704  141.290 1.00 145.51 ? 94  TYR A N      1 
ATOM   1551  C CA     . TYR A 1 94  ? 182.458 -5.678  141.740 1.00 147.81 ? 94  TYR A CA     1 
ATOM   1552  C C      . TYR A 1 94  ? 182.084 -4.283  142.226 1.00 143.96 ? 94  TYR A C      1 
ATOM   1553  O O      . TYR A 1 94  ? 182.940 -3.529  142.689 1.00 141.71 ? 94  TYR A O      1 
ATOM   1554  C CB     . TYR A 1 94  ? 182.245 -6.697  142.861 1.00 152.73 ? 94  TYR A CB     1 
ATOM   1555  C CG     . TYR A 1 94  ? 182.479 -8.132  142.439 1.00 158.39 ? 94  TYR A CG     1 
ATOM   1556  C CD1    . TYR A 1 94  ? 181.468 -8.874  141.841 1.00 160.32 ? 94  TYR A CD1    1 
ATOM   1557  C CD2    . TYR A 1 94  ? 183.710 -8.747  142.643 1.00 161.51 ? 94  TYR A CD2    1 
ATOM   1558  C CE1    . TYR A 1 94  ? 181.676 -10.188 141.455 1.00 162.55 ? 94  TYR A CE1    1 
ATOM   1559  C CE2    . TYR A 1 94  ? 183.927 -10.061 142.259 1.00 163.75 ? 94  TYR A CE2    1 
ATOM   1560  C CZ     . TYR A 1 94  ? 182.908 -10.776 141.666 1.00 163.40 ? 94  TYR A CZ     1 
ATOM   1561  O OH     . TYR A 1 94  ? 183.120 -12.083 141.284 1.00 163.09 ? 94  TYR A OH     1 
ATOM   1562  H H      . TYR A 1 94  ? 184.417 -5.598  141.923 1.00 174.62 ? 94  TYR A H      1 
ATOM   1563  H HA     . TYR A 1 94  ? 181.875 -5.911  141.001 1.00 177.37 ? 94  TYR A HA     1 
ATOM   1564  H HB2    . TYR A 1 94  ? 182.858 -6.498  143.586 1.00 183.28 ? 94  TYR A HB2    1 
ATOM   1565  H HB3    . TYR A 1 94  ? 181.330 -6.627  143.177 1.00 183.28 ? 94  TYR A HB3    1 
ATOM   1566  H HD1    . TYR A 1 94  ? 180.637 -8.482  141.697 1.00 192.38 ? 94  TYR A HD1    1 
ATOM   1567  H HD2    . TYR A 1 94  ? 184.399 -8.268  143.042 1.00 193.81 ? 94  TYR A HD2    1 
ATOM   1568  H HE1    . TYR A 1 94  ? 180.990 -10.672 141.055 1.00 195.06 ? 94  TYR A HE1    1 
ATOM   1569  H HE2    . TYR A 1 94  ? 184.756 -10.458 142.401 1.00 196.50 ? 94  TYR A HE2    1 
ATOM   1570  H HH     . TYR A 1 94  ? 183.906 -12.313 141.469 1.00 195.71 ? 94  TYR A HH     1 
ATOM   1571  N N      . HIS A 1 97  ? 176.394 -6.730  141.156 1.00 162.68 ? 97  HIS A N      1 
ATOM   1572  C CA     . HIS A 1 97  ? 176.471 -6.228  139.789 1.00 165.05 ? 97  HIS A CA     1 
ATOM   1573  C C      . HIS A 1 97  ? 177.912 -6.271  139.269 1.00 169.63 ? 97  HIS A C      1 
ATOM   1574  O O      . HIS A 1 97  ? 178.805 -5.684  139.881 1.00 167.68 ? 97  HIS A O      1 
ATOM   1575  C CB     . HIS A 1 97  ? 175.937 -4.797  139.725 1.00 163.28 ? 97  HIS A CB     1 
ATOM   1576  C CG     . HIS A 1 97  ? 174.492 -4.708  139.339 1.00 163.02 ? 97  HIS A CG     1 
ATOM   1577  N ND1    . HIS A 1 97  ? 173.606 -5.750  139.501 1.00 163.88 ? 97  HIS A ND1    1 
ATOM   1578  C CD2    . HIS A 1 97  ? 173.784 -3.695  138.785 1.00 161.64 ? 97  HIS A CD2    1 
ATOM   1579  C CE1    . HIS A 1 97  ? 172.413 -5.383  139.071 1.00 163.06 ? 97  HIS A CE1    1 
ATOM   1580  N NE2    . HIS A 1 97  ? 172.492 -4.140  138.631 1.00 161.75 ? 97  HIS A NE2    1 
ATOM   1581  H HA     . HIS A 1 97  ? 175.923 -6.783  139.213 1.00 198.06 ? 97  HIS A HA     1 
ATOM   1582  H HB2    . HIS A 1 97  ? 176.037 -4.387  140.599 1.00 195.94 ? 97  HIS A HB2    1 
ATOM   1583  H HB3    . HIS A 1 97  ? 176.451 -4.301  139.069 1.00 195.94 ? 97  HIS A HB3    1 
ATOM   1584  H HD1    . HIS A 1 97  ? 173.799 -6.519  139.834 1.00 196.66 ? 97  HIS A HD1    1 
ATOM   1585  H HD2    . HIS A 1 97  ? 174.109 -2.854  138.556 1.00 193.97 ? 97  HIS A HD2    1 
ATOM   1586  H HE1    . HIS A 1 97  ? 171.647 -5.910  139.076 1.00 195.67 ? 97  HIS A HE1    1 
ATOM   1587  H HE2    . HIS A 1 97  ? 171.842 -3.685  138.301 1.00 194.10 ? 97  HIS A HE2    1 
ATOM   1588  N N      . PRO A 1 98  ? 178.145 -6.968  138.139 1.00 176.81 ? 98  PRO A N      1 
ATOM   1589  C CA     . PRO A 1 98  ? 179.513 -7.132  137.635 1.00 177.91 ? 98  PRO A CA     1 
ATOM   1590  C C      . PRO A 1 98  ? 179.906 -6.113  136.569 1.00 169.20 ? 98  PRO A C      1 
ATOM   1591  O O      . PRO A 1 98  ? 179.042 -5.456  135.987 1.00 167.37 ? 98  PRO A O      1 
ATOM   1592  C CB     . PRO A 1 98  ? 179.463 -8.520  137.003 1.00 183.96 ? 98  PRO A CB     1 
ATOM   1593  C CG     . PRO A 1 98  ? 178.085 -8.588  136.430 1.00 185.08 ? 98  PRO A CG     1 
ATOM   1594  C CD     . PRO A 1 98  ? 177.193 -7.782  137.358 1.00 181.76 ? 98  PRO A CD     1 
ATOM   1595  H HA     . PRO A 1 98  ? 180.156 -7.121  138.361 1.00 213.49 ? 98  PRO A HA     1 
ATOM   1596  H HB2    . PRO A 1 98  ? 180.134 -8.592  136.306 1.00 220.75 ? 98  PRO A HB2    1 
ATOM   1597  H HB3    . PRO A 1 98  ? 179.591 -9.200  137.683 1.00 220.75 ? 98  PRO A HB3    1 
ATOM   1598  H HG2    . PRO A 1 98  ? 178.086 -8.202  135.540 1.00 222.09 ? 98  PRO A HG2    1 
ATOM   1599  H HG3    . PRO A 1 98  ? 177.794 -9.513  136.398 1.00 222.09 ? 98  PRO A HG3    1 
ATOM   1600  H HD2    . PRO A 1 98  ? 176.602 -7.210  136.844 1.00 218.11 ? 98  PRO A HD2    1 
ATOM   1601  H HD3    . PRO A 1 98  ? 176.695 -8.373  137.943 1.00 218.11 ? 98  PRO A HD3    1 
ATOM   1602  N N      . TYR A 1 99  ? 181.209 -6.000  136.323 1.00 159.68 ? 99  TYR A N      1 
ATOM   1603  C CA     . TYR A 1 99  ? 181.736 -5.217  135.209 1.00 149.18 ? 99  TYR A CA     1 
ATOM   1604  C C      . TYR A 1 99  ? 183.217 -5.532  135.021 1.00 140.53 ? 99  TYR A C      1 
ATOM   1605  O O      . TYR A 1 99  ? 183.870 -6.039  135.934 1.00 135.88 ? 99  TYR A O      1 
ATOM   1606  C CB     . TYR A 1 99  ? 181.541 -3.719  135.444 1.00 147.23 ? 99  TYR A CB     1 
ATOM   1607  C CG     . TYR A 1 99  ? 182.609 -3.075  136.298 1.00 145.04 ? 99  TYR A CG     1 
ATOM   1608  C CD1    . TYR A 1 99  ? 182.672 -3.311  137.664 1.00 144.09 ? 99  TYR A CD1    1 
ATOM   1609  C CD2    . TYR A 1 99  ? 183.547 -2.216  135.738 1.00 144.41 ? 99  TYR A CD2    1 
ATOM   1610  C CE1    . TYR A 1 99  ? 183.639 -2.710  138.449 1.00 143.47 ? 99  TYR A CE1    1 
ATOM   1611  C CE2    . TYR A 1 99  ? 184.522 -1.614  136.514 1.00 143.65 ? 99  TYR A CE2    1 
ATOM   1612  C CZ     . TYR A 1 99  ? 184.564 -1.864  137.869 1.00 142.58 ? 99  TYR A CZ     1 
ATOM   1613  O OH     . TYR A 1 99  ? 185.534 -1.268  138.646 1.00 140.51 ? 99  TYR A OH     1 
ATOM   1614  H H      . TYR A 1 99  ? 181.820 -6.376  136.797 1.00 191.62 ? 99  TYR A H      1 
ATOM   1615  H HA     . TYR A 1 99  ? 181.267 -5.461  134.396 1.00 179.01 ? 99  TYR A HA     1 
ATOM   1616  H HB2    . TYR A 1 99  ? 181.538 -3.268  134.586 1.00 176.67 ? 99  TYR A HB2    1 
ATOM   1617  H HB3    . TYR A 1 99  ? 180.688 -3.583  135.887 1.00 176.67 ? 99  TYR A HB3    1 
ATOM   1618  H HD1    . TYR A 1 99  ? 182.050 -3.878  138.059 1.00 172.91 ? 99  TYR A HD1    1 
ATOM   1619  H HD2    . TYR A 1 99  ? 183.520 -2.044  134.824 1.00 173.30 ? 99  TYR A HD2    1 
ATOM   1620  H HE1    . TYR A 1 99  ? 183.671 -2.881  139.363 1.00 172.17 ? 99  TYR A HE1    1 
ATOM   1621  H HE2    . TYR A 1 99  ? 185.144 -1.043  136.124 1.00 172.38 ? 99  TYR A HE2    1 
ATOM   1622  H HH     . TYR A 1 99  ? 186.026 -0.782  138.169 1.00 168.61 ? 99  TYR A HH     1 
ATOM   1623  N N      . VAL A 1 100 ? 183.737 -5.224  133.837 1.00 138.60 ? 100 VAL A N      1 
ATOM   1624  C CA     . VAL A 1 100 ? 185.118 -5.544  133.486 1.00 136.73 ? 100 VAL A CA     1 
ATOM   1625  C C      . VAL A 1 100 ? 185.968 -4.279  133.370 1.00 131.78 ? 100 VAL A C      1 
ATOM   1626  O O      . VAL A 1 100 ? 185.658 -3.384  132.586 1.00 127.78 ? 100 VAL A O      1 
ATOM   1627  C CB     . VAL A 1 100 ? 185.183 -6.314  132.149 1.00 139.10 ? 100 VAL A CB     1 
ATOM   1628  C CG1    . VAL A 1 100 ? 186.610 -6.760  131.852 1.00 142.05 ? 100 VAL A CG1    1 
ATOM   1629  C CG2    . VAL A 1 100 ? 184.248 -7.515  132.181 1.00 138.63 ? 100 VAL A CG2    1 
ATOM   1630  H H      . VAL A 1 100 ? 183.305 -4.825  133.210 1.00 166.32 ? 100 VAL A H      1 
ATOM   1631  H HA     . VAL A 1 100 ? 185.502 -6.105  134.178 1.00 164.08 ? 100 VAL A HA     1 
ATOM   1632  H HB     . VAL A 1 100 ? 184.896 -5.727  131.432 1.00 166.93 ? 100 VAL A HB     1 
ATOM   1633  H HG11   . VAL A 1 100 ? 186.621 -7.240  131.009 1.00 170.45 ? 100 VAL A HG11   1 
ATOM   1634  H HG12   . VAL A 1 100 ? 187.180 -5.978  131.795 1.00 170.45 ? 100 VAL A HG12   1 
ATOM   1635  H HG13   . VAL A 1 100 ? 186.914 -7.341  132.567 1.00 170.45 ? 100 VAL A HG13   1 
ATOM   1636  H HG21   . VAL A 1 100 ? 184.305 -7.982  131.333 1.00 166.36 ? 100 VAL A HG21   1 
ATOM   1637  H HG22   . VAL A 1 100 ? 184.516 -8.105  132.903 1.00 166.36 ? 100 VAL A HG22   1 
ATOM   1638  H HG23   . VAL A 1 100 ? 183.340 -7.205  132.327 1.00 166.36 ? 100 VAL A HG23   1 
ATOM   1639  N N      . HIS A 1 101 ? 187.038 -4.216  134.159 1.00 131.53 ? 101 HIS A N      1 
ATOM   1640  C CA     . HIS A 1 101 ? 187.990 -3.111  134.094 1.00 131.54 ? 101 HIS A CA     1 
ATOM   1641  C C      . HIS A 1 101 ? 189.234 -3.565  133.342 1.00 131.50 ? 101 HIS A C      1 
ATOM   1642  O O      . HIS A 1 101 ? 189.625 -4.729  133.425 1.00 138.16 ? 101 HIS A O      1 
ATOM   1643  C CB     . HIS A 1 101 ? 188.370 -2.646  135.502 1.00 131.60 ? 101 HIS A CB     1 
ATOM   1644  C CG     . HIS A 1 101 ? 189.283 -1.458  135.520 1.00 133.62 ? 101 HIS A CG     1 
ATOM   1645  N ND1    . HIS A 1 101 ? 188.869 -0.195  135.155 1.00 134.75 ? 101 HIS A ND1    1 
ATOM   1646  C CD2    . HIS A 1 101 ? 190.588 -1.342  135.861 1.00 134.91 ? 101 HIS A CD2    1 
ATOM   1647  C CE1    . HIS A 1 101 ? 189.879 0.648   135.271 1.00 135.48 ? 101 HIS A CE1    1 
ATOM   1648  N NE2    . HIS A 1 101 ? 190.934 -0.022  135.697 1.00 135.59 ? 101 HIS A NE2    1 
ATOM   1649  H H      . HIS A 1 101 ? 187.237 -4.809  134.749 1.00 157.84 ? 101 HIS A H      1 
ATOM   1650  H HA     . HIS A 1 101 ? 187.593 -2.365  133.618 1.00 157.84 ? 101 HIS A HA     1 
ATOM   1651  H HB2    . HIS A 1 101 ? 187.562 -2.406  135.981 1.00 157.92 ? 101 HIS A HB2    1 
ATOM   1652  H HB3    . HIS A 1 101 ? 188.821 -3.373  135.960 1.00 157.92 ? 101 HIS A HB3    1 
ATOM   1653  H HD1    . HIS A 1 101 ? 188.076 0.011   134.894 1.00 161.70 ? 101 HIS A HD1    1 
ATOM   1654  H HD2    . HIS A 1 101 ? 191.146 -2.027  136.152 1.00 161.89 ? 101 HIS A HD2    1 
ATOM   1655  H HE1    . HIS A 1 101 ? 189.852 1.559   135.083 1.00 162.58 ? 101 HIS A HE1    1 
ATOM   1656  H HE2    . HIS A 1 101 ? 191.711 0.314   135.847 1.00 162.71 ? 101 HIS A HE2    1 
ATOM   1657  N N      . GLY A 1 102 ? 189.851 -2.647  132.606 1.00 122.49 ? 102 GLY A N      1 
ATOM   1658  C CA     . GLY A 1 102 ? 191.037 -2.970  131.835 1.00 116.70 ? 102 GLY A CA     1 
ATOM   1659  C C      . GLY A 1 102 ? 191.659 -1.751  131.187 1.00 111.98 ? 102 GLY A C      1 
ATOM   1660  O O      . GLY A 1 102 ? 191.294 -0.618  131.508 1.00 108.80 ? 102 GLY A O      1 
ATOM   1661  H H      . GLY A 1 102 ? 189.599 -1.828  132.538 1.00 146.99 ? 102 GLY A H      1 
ATOM   1662  H HA2    . GLY A 1 102 ? 191.697 -3.379  132.415 1.00 140.04 ? 102 GLY A HA2    1 
ATOM   1663  H HA3    . GLY A 1 102 ? 190.806 -3.603  131.138 1.00 140.04 ? 102 GLY A HA3    1 
ATOM   1664  N N      . VAL A 1 103 ? 192.600 -1.985  130.277 1.00 112.66 ? 103 VAL A N      1 
ATOM   1665  C CA     . VAL A 1 103 ? 193.279 -0.898  129.581 1.00 115.59 ? 103 VAL A CA     1 
ATOM   1666  C C      . VAL A 1 103 ? 193.287 -1.121  128.075 1.00 122.16 ? 103 VAL A C      1 
ATOM   1667  O O      . VAL A 1 103 ? 193.180 -2.253  127.604 1.00 128.61 ? 103 VAL A O      1 
ATOM   1668  C CB     . VAL A 1 103 ? 194.739 -0.723  130.070 1.00 114.89 ? 103 VAL A CB     1 
ATOM   1669  C CG1    . VAL A 1 103 ? 194.769 -0.330  131.541 1.00 110.14 ? 103 VAL A CG1    1 
ATOM   1670  C CG2    . VAL A 1 103 ? 195.548 -1.993  129.835 1.00 119.33 ? 103 VAL A CG2    1 
ATOM   1671  H H      . VAL A 1 103 ? 192.865 -2.769  130.044 1.00 135.19 ? 103 VAL A H      1 
ATOM   1672  H HA     . VAL A 1 103 ? 192.805 -0.070  129.757 1.00 138.71 ? 103 VAL A HA     1 
ATOM   1673  H HB     . VAL A 1 103 ? 195.155 -0.008  129.563 1.00 137.86 ? 103 VAL A HB     1 
ATOM   1674  H HG11   . VAL A 1 103 ? 195.692 -0.227  131.821 1.00 132.16 ? 103 VAL A HG11   1 
ATOM   1675  H HG12   . VAL A 1 103 ? 194.293 0.508   131.653 1.00 132.16 ? 103 VAL A HG12   1 
ATOM   1676  H HG13   . VAL A 1 103 ? 194.340 -1.027  132.062 1.00 132.16 ? 103 VAL A HG13   1 
ATOM   1677  H HG21   . VAL A 1 103 ? 196.454 -1.852  130.150 1.00 143.19 ? 103 VAL A HG21   1 
ATOM   1678  H HG22   . VAL A 1 103 ? 195.137 -2.723  130.324 1.00 143.19 ? 103 VAL A HG22   1 
ATOM   1679  H HG23   . VAL A 1 103 ? 195.554 -2.192  128.886 1.00 143.19 ? 103 VAL A HG23   1 
ATOM   1680  N N      . VAL A 1 104 ? 193.405 -0.027  127.330 1.00 121.18 ? 104 VAL A N      1 
ATOM   1681  C CA     . VAL A 1 104 ? 193.548 -0.078  125.879 1.00 121.28 ? 104 VAL A CA     1 
ATOM   1682  C C      . VAL A 1 104 ? 194.613 0.933   125.473 1.00 119.81 ? 104 VAL A C      1 
ATOM   1683  O O      . VAL A 1 104 ? 194.363 2.138   125.454 1.00 120.84 ? 104 VAL A O      1 
ATOM   1684  C CB     . VAL A 1 104 ? 192.219 0.241   125.156 1.00 120.34 ? 104 VAL A CB     1 
ATOM   1685  C CG1    . VAL A 1 104 ? 192.380 0.120   123.644 1.00 119.35 ? 104 VAL A CG1    1 
ATOM   1686  C CG2    . VAL A 1 104 ? 191.116 -0.683  125.643 1.00 121.51 ? 104 VAL A CG2    1 
ATOM   1687  H H      . VAL A 1 104 ? 193.405 0.772   127.648 1.00 145.42 ? 104 VAL A H      1 
ATOM   1688  H HA     . VAL A 1 104 ? 193.841 -0.963  125.612 1.00 145.53 ? 104 VAL A HA     1 
ATOM   1689  H HB     . VAL A 1 104 ? 191.958 1.153   125.358 1.00 144.40 ? 104 VAL A HB     1 
ATOM   1690  H HG11   . VAL A 1 104 ? 191.532 0.325   123.219 1.00 143.22 ? 104 VAL A HG11   1 
ATOM   1691  H HG12   . VAL A 1 104 ? 193.059 0.746   123.348 1.00 143.22 ? 104 VAL A HG12   1 
ATOM   1692  H HG13   . VAL A 1 104 ? 192.648 -0.787  123.428 1.00 143.22 ? 104 VAL A HG13   1 
ATOM   1693  H HG21   . VAL A 1 104 ? 190.293 -0.466  125.177 1.00 145.82 ? 104 VAL A HG21   1 
ATOM   1694  H HG22   . VAL A 1 104 ? 191.369 -1.601  125.458 1.00 145.82 ? 104 VAL A HG22   1 
ATOM   1695  H HG23   . VAL A 1 104 ? 190.998 -0.558  126.598 1.00 145.82 ? 104 VAL A HG23   1 
ATOM   1696  N N      . LYS A 1 105 ? 195.801 0.428   125.155 1.00 116.23 ? 105 LYS A N      1 
ATOM   1697  C CA     . LYS A 1 105 ? 196.947 1.272   124.838 1.00 113.41 ? 105 LYS A CA     1 
ATOM   1698  C C      . LYS A 1 105 ? 197.243 2.225   125.991 1.00 105.73 ? 105 LYS A C      1 
ATOM   1699  O O      . LYS A 1 105 ? 197.361 3.434   125.799 1.00 103.94 ? 105 LYS A O      1 
ATOM   1700  C CB     . LYS A 1 105 ? 196.726 2.044   123.529 1.00 118.07 ? 105 LYS A CB     1 
ATOM   1701  C CG     . LYS A 1 105 ? 196.692 1.155   122.290 1.00 123.31 ? 105 LYS A CG     1 
ATOM   1702  C CD     . LYS A 1 105 ? 196.768 1.964   121.001 1.00 127.41 ? 105 LYS A CD     1 
ATOM   1703  C CE     . LYS A 1 105 ? 197.012 1.061   119.799 1.00 132.36 ? 105 LYS A CE     1 
ATOM   1704  N NZ     . LYS A 1 105 ? 197.253 1.831   118.546 1.00 135.16 ? 105 LYS A NZ     1 
ATOM   1705  H H      . LYS A 1 105 ? 195.970 -0.414  125.116 1.00 139.47 ? 105 LYS A H      1 
ATOM   1706  H HA     . LYS A 1 105 ? 197.725 0.706   124.718 1.00 136.09 ? 105 LYS A HA     1 
ATOM   1707  H HB2    . LYS A 1 105 ? 195.879 2.513   123.582 1.00 141.68 ? 105 LYS A HB2    1 
ATOM   1708  H HB3    . LYS A 1 105 ? 197.448 2.682   123.416 1.00 141.68 ? 105 LYS A HB3    1 
ATOM   1709  H HG2    . LYS A 1 105 ? 197.449 0.550   122.311 1.00 147.97 ? 105 LYS A HG2    1 
ATOM   1710  H HG3    . LYS A 1 105 ? 195.862 0.653   122.282 1.00 147.97 ? 105 LYS A HG3    1 
ATOM   1711  H HD2    . LYS A 1 105 ? 195.929 2.432   120.866 1.00 152.89 ? 105 LYS A HD2    1 
ATOM   1712  H HD3    . LYS A 1 105 ? 197.501 2.597   121.062 1.00 152.89 ? 105 LYS A HD3    1 
ATOM   1713  H HE2    . LYS A 1 105 ? 197.793 0.512   119.969 1.00 158.83 ? 105 LYS A HE2    1 
ATOM   1714  H HE3    . LYS A 1 105 ? 196.233 0.500   119.661 1.00 158.83 ? 105 LYS A HE3    1 
ATOM   1715  H HZ1    . LYS A 1 105 ? 197.392 1.272   117.868 1.00 162.19 ? 105 LYS A HZ1    1 
ATOM   1716  H HZ2    . LYS A 1 105 ? 196.547 2.341   118.362 1.00 162.19 ? 105 LYS A HZ2    1 
ATOM   1717  H HZ3    . LYS A 1 105 ? 197.969 2.352   118.642 1.00 162.19 ? 105 LYS A HZ3    1 
ATOM   1718  N N      . GLY A 1 106 ? 197.345 1.667   127.194 1.00 102.71 ? 106 GLY A N      1 
ATOM   1719  C CA     . GLY A 1 106 ? 197.759 2.425   128.362 1.00 103.92 ? 106 GLY A CA     1 
ATOM   1720  C C      . GLY A 1 106 ? 196.643 3.204   129.035 1.00 108.71 ? 106 GLY A C      1 
ATOM   1721  O O      . GLY A 1 106 ? 196.771 3.597   130.198 1.00 98.49  ? 106 GLY A O      1 
ATOM   1722  H H      . GLY A 1 106 ? 197.177 0.840   127.358 1.00 123.26 ? 106 GLY A H      1 
ATOM   1723  H HA2    . GLY A 1 106 ? 198.137 1.816   129.015 1.00 124.70 ? 106 GLY A HA2    1 
ATOM   1724  H HA3    . GLY A 1 106 ? 198.449 3.054   128.101 1.00 124.70 ? 106 GLY A HA3    1 
ATOM   1725  N N      . VAL A 1 107 ? 195.550 3.426   128.307 1.00 124.72 ? 107 VAL A N      1 
ATOM   1726  C CA     . VAL A 1 107 ? 194.419 4.209   128.807 1.00 126.64 ? 107 VAL A CA     1 
ATOM   1727  C C      . VAL A 1 107 ? 193.481 3.341   129.634 1.00 120.52 ? 107 VAL A C      1 
ATOM   1728  O O      . VAL A 1 107 ? 193.126 2.242   129.220 1.00 120.41 ? 107 VAL A O      1 
ATOM   1729  C CB     . VAL A 1 107 ? 193.613 4.831   127.644 1.00 128.31 ? 107 VAL A CB     1 
ATOM   1730  C CG1    . VAL A 1 107 ? 192.450 5.660   128.171 1.00 126.15 ? 107 VAL A CG1    1 
ATOM   1731  C CG2    . VAL A 1 107 ? 194.510 5.692   126.778 1.00 129.73 ? 107 VAL A CG2    1 
ATOM   1732  H H      . VAL A 1 107 ? 195.437 3.129   127.508 1.00 149.67 ? 107 VAL A H      1 
ATOM   1733  H HA     . VAL A 1 107 ? 194.748 4.927   129.370 1.00 151.97 ? 107 VAL A HA     1 
ATOM   1734  H HB     . VAL A 1 107 ? 193.251 4.121   127.092 1.00 153.98 ? 107 VAL A HB     1 
ATOM   1735  H HG11   . VAL A 1 107 ? 191.965 6.036   127.420 1.00 151.38 ? 107 VAL A HG11   1 
ATOM   1736  H HG12   . VAL A 1 107 ? 191.864 5.087   128.691 1.00 151.38 ? 107 VAL A HG12   1 
ATOM   1737  H HG13   . VAL A 1 107 ? 192.798 6.372   128.731 1.00 151.38 ? 107 VAL A HG13   1 
ATOM   1738  H HG21   . VAL A 1 107 ? 193.984 6.071   126.056 1.00 155.67 ? 107 VAL A HG21   1 
ATOM   1739  H HG22   . VAL A 1 107 ? 194.887 6.402   127.321 1.00 155.67 ? 107 VAL A HG22   1 
ATOM   1740  H HG23   . VAL A 1 107 ? 195.221 5.140   126.414 1.00 155.67 ? 107 VAL A HG23   1 
ATOM   1741  N N      . GLU A 1 108 ? 193.078 3.846   130.795 1.00 114.72 ? 108 GLU A N      1 
ATOM   1742  C CA     . GLU A 1 108 ? 192.152 3.131   131.667 1.00 112.51 ? 108 GLU A CA     1 
ATOM   1743  C C      . GLU A 1 108 ? 190.777 3.043   131.011 1.00 108.98 ? 108 GLU A C      1 
ATOM   1744  O O      . GLU A 1 108 ? 190.331 3.997   130.373 1.00 109.22 ? 108 GLU A O      1 
ATOM   1745  C CB     . GLU A 1 108 ? 192.047 3.848   133.013 1.00 115.58 ? 108 GLU A CB     1 
ATOM   1746  C CG     . GLU A 1 108 ? 193.373 3.960   133.753 1.00 120.42 ? 108 GLU A CG     1 
ATOM   1747  C CD     . GLU A 1 108 ? 193.299 4.859   134.975 1.00 122.80 ? 108 GLU A CD     1 
ATOM   1748  O OE1    . GLU A 1 108 ? 192.321 5.627   135.100 1.00 120.82 ? 108 GLU A OE1    1 
ATOM   1749  O OE2    . GLU A 1 108 ? 194.224 4.797   135.814 1.00 125.88 ? 108 GLU A OE2    1 
ATOM   1750  H H      . GLU A 1 108 ? 193.329 4.608   131.104 1.00 137.66 ? 108 GLU A H      1 
ATOM   1751  H HA     . GLU A 1 108 ? 192.479 2.231   131.821 1.00 135.01 ? 108 GLU A HA     1 
ATOM   1752  H HB2    . GLU A 1 108 ? 191.713 4.746   132.864 1.00 138.69 ? 108 GLU A HB2    1 
ATOM   1753  H HB3    . GLU A 1 108 ? 191.431 3.358   133.580 1.00 138.69 ? 108 GLU A HB3    1 
ATOM   1754  H HG2    . GLU A 1 108 ? 193.646 3.077   134.047 1.00 144.50 ? 108 GLU A HG2    1 
ATOM   1755  H HG3    . GLU A 1 108 ? 194.039 4.329   133.151 1.00 144.50 ? 108 GLU A HG3    1 
ATOM   1756  N N      . VAL A 1 109 ? 190.110 1.900   131.164 1.00 106.78 ? 109 VAL A N      1 
ATOM   1757  C CA     . VAL A 1 109 ? 188.820 1.670   130.510 1.00 107.02 ? 109 VAL A CA     1 
ATOM   1758  C C      . VAL A 1 109 ? 187.851 0.871   131.383 1.00 110.59 ? 109 VAL A C      1 
ATOM   1759  O O      . VAL A 1 109 ? 188.263 0.006   132.156 1.00 108.86 ? 109 VAL A O      1 
ATOM   1760  C CB     . VAL A 1 109 ? 189.006 0.937   129.153 1.00 102.22 ? 109 VAL A CB     1 
ATOM   1761  C CG1    . VAL A 1 109 ? 187.664 0.651   128.483 1.00 102.98 ? 109 VAL A CG1    1 
ATOM   1762  C CG2    . VAL A 1 109 ? 189.880 1.755   128.218 1.00 102.54 ? 109 VAL A CG2    1 
ATOM   1763  H H      . VAL A 1 109 ? 190.383 1.239   131.643 1.00 128.13 ? 109 VAL A H      1 
ATOM   1764  H HA     . VAL A 1 109 ? 188.410 2.530   130.326 1.00 128.42 ? 109 VAL A HA     1 
ATOM   1765  H HB     . VAL A 1 109 ? 189.449 0.088   129.311 1.00 122.67 ? 109 VAL A HB     1 
ATOM   1766  H HG11   . VAL A 1 109 ? 187.822 0.194   127.642 1.00 123.58 ? 109 VAL A HG11   1 
ATOM   1767  H HG12   . VAL A 1 109 ? 187.131 0.091   129.069 1.00 123.58 ? 109 VAL A HG12   1 
ATOM   1768  H HG13   . VAL A 1 109 ? 187.206 1.492   128.322 1.00 123.58 ? 109 VAL A HG13   1 
ATOM   1769  H HG21   . VAL A 1 109 ? 189.980 1.276   127.380 1.00 123.05 ? 109 VAL A HG21   1 
ATOM   1770  H HG22   . VAL A 1 109 ? 189.456 2.613   128.060 1.00 123.05 ? 109 VAL A HG22   1 
ATOM   1771  H HG23   . VAL A 1 109 ? 190.748 1.885   128.630 1.00 123.05 ? 109 VAL A HG23   1 
ATOM   1772  N N      . ASP A 1 110 ? 186.562 1.182   131.252 1.00 118.54 ? 110 ASP A N      1 
ATOM   1773  C CA     . ASP A 1 110 ? 185.491 0.404   131.872 1.00 123.44 ? 110 ASP A CA     1 
ATOM   1774  C C      . ASP A 1 110 ? 184.499 -0.085  130.820 1.00 121.31 ? 110 ASP A C      1 
ATOM   1775  O O      . ASP A 1 110 ? 184.077 0.675   129.946 1.00 122.34 ? 110 ASP A O      1 
ATOM   1776  C CB     . ASP A 1 110 ? 184.741 1.234   132.916 1.00 126.47 ? 110 ASP A CB     1 
ATOM   1777  C CG     . ASP A 1 110 ? 185.528 1.421   134.198 1.00 129.36 ? 110 ASP A CG     1 
ATOM   1778  O OD1    . ASP A 1 110 ? 186.452 0.622   134.461 1.00 132.06 ? 110 ASP A OD1    1 
ATOM   1779  O OD2    . ASP A 1 110 ? 185.209 2.365   134.950 1.00 128.63 ? 110 ASP A OD2    1 
ATOM   1780  H H      . ASP A 1 110 ? 186.277 1.855   130.798 1.00 142.25 ? 110 ASP A H      1 
ATOM   1781  H HA     . ASP A 1 110 ? 185.873 -0.370  132.315 1.00 148.13 ? 110 ASP A HA     1 
ATOM   1782  H HB2    . ASP A 1 110 ? 184.557 2.113   132.547 1.00 151.77 ? 110 ASP A HB2    1 
ATOM   1783  H HB3    . ASP A 1 110 ? 183.910 0.787   133.137 1.00 151.77 ? 110 ASP A HB3    1 
ATOM   1784  N N      . VAL A 1 111 ? 184.137 -1.360  130.919 1.00 116.34 ? 111 VAL A N      1 
ATOM   1785  C CA     . VAL A 1 111 ? 183.150 -1.969  130.038 1.00 113.23 ? 111 VAL A CA     1 
ATOM   1786  C C      . VAL A 1 111 ? 182.018 -2.510  130.897 1.00 114.71 ? 111 VAL A C      1 
ATOM   1787  O O      . VAL A 1 111 ? 182.226 -3.402  131.721 1.00 111.22 ? 111 VAL A O      1 
ATOM   1788  C CB     . VAL A 1 111 ? 183.757 -3.120  129.220 1.00 112.26 ? 111 VAL A CB     1 
ATOM   1789  C CG1    . VAL A 1 111 ? 182.724 -3.690  128.252 1.00 114.67 ? 111 VAL A CG1    1 
ATOM   1790  C CG2    . VAL A 1 111 ? 184.993 -2.646  128.468 1.00 109.67 ? 111 VAL A CG2    1 
ATOM   1791  H H      . VAL A 1 111 ? 184.457 -1.904  131.503 1.00 139.61 ? 111 VAL A H      1 
ATOM   1792  H HA     . VAL A 1 111 ? 182.794 -1.303  129.429 1.00 135.87 ? 111 VAL A HA     1 
ATOM   1793  H HB     . VAL A 1 111 ? 184.026 -3.830  129.824 1.00 134.71 ? 111 VAL A HB     1 
ATOM   1794  H HG11   . VAL A 1 111 ? 183.130 -4.413  127.748 1.00 137.61 ? 111 VAL A HG11   1 
ATOM   1795  H HG12   . VAL A 1 111 ? 181.967 -4.023  128.759 1.00 137.61 ? 111 VAL A HG12   1 
ATOM   1796  H HG13   . VAL A 1 111 ? 182.436 -2.987  127.649 1.00 137.61 ? 111 VAL A HG13   1 
ATOM   1797  H HG21   . VAL A 1 111 ? 185.357 -3.388  127.960 1.00 131.61 ? 111 VAL A HG21   1 
ATOM   1798  H HG22   . VAL A 1 111 ? 184.741 -1.927  127.868 1.00 131.61 ? 111 VAL A HG22   1 
ATOM   1799  H HG23   . VAL A 1 111 ? 185.649 -2.329  129.108 1.00 131.61 ? 111 VAL A HG23   1 
ATOM   1800  N N      . VAL A 1 112 ? 180.821 -1.968  130.693 1.00 121.24 ? 112 VAL A N      1 
ATOM   1801  C CA     . VAL A 1 112 ? 179.677 -2.269  131.548 1.00 124.54 ? 112 VAL A CA     1 
ATOM   1802  C C      . VAL A 1 112 ? 178.464 -2.708  130.731 1.00 127.85 ? 112 VAL A C      1 
ATOM   1803  O O      . VAL A 1 112 ? 178.103 -2.051  129.753 1.00 127.46 ? 112 VAL A O      1 
ATOM   1804  C CB     . VAL A 1 112 ? 179.278 -1.038  132.369 1.00 121.80 ? 112 VAL A CB     1 
ATOM   1805  C CG1    . VAL A 1 112 ? 178.149 -1.385  133.340 1.00 121.15 ? 112 VAL A CG1    1 
ATOM   1806  C CG2    . VAL A 1 112 ? 180.488 -0.490  133.110 1.00 119.99 ? 112 VAL A CG2    1 
ATOM   1807  H H      . VAL A 1 112 ? 180.643 -1.416  130.059 1.00 145.49 ? 112 VAL A H      1 
ATOM   1808  H HA     . VAL A 1 112 ? 179.911 -2.984  132.160 1.00 149.45 ? 112 VAL A HA     1 
ATOM   1809  H HB     . VAL A 1 112 ? 178.956 -0.347  131.768 1.00 146.16 ? 112 VAL A HB     1 
ATOM   1810  H HG11   . VAL A 1 112 ? 177.914 -0.592  133.847 1.00 145.39 ? 112 VAL A HG11   1 
ATOM   1811  H HG12   . VAL A 1 112 ? 177.381 -1.694  132.834 1.00 145.39 ? 112 VAL A HG12   1 
ATOM   1812  H HG13   . VAL A 1 112 ? 178.453 -2.084  133.940 1.00 145.39 ? 112 VAL A HG13   1 
ATOM   1813  H HG21   . VAL A 1 112 ? 180.219 0.287   133.624 1.00 143.99 ? 112 VAL A HG21   1 
ATOM   1814  H HG22   . VAL A 1 112 ? 180.832 -1.176  133.703 1.00 143.99 ? 112 VAL A HG22   1 
ATOM   1815  H HG23   . VAL A 1 112 ? 181.168 -0.241  132.464 1.00 143.99 ? 112 VAL A HG23   1 
ATOM   1816  N N      . PRO A 1 113 ? 177.822 -3.818  131.135 1.00 130.27 ? 113 PRO A N      1 
ATOM   1817  C CA     . PRO A 1 113 ? 176.597 -4.251  130.460 1.00 132.01 ? 113 PRO A CA     1 
ATOM   1818  C C      . PRO A 1 113 ? 175.350 -3.654  131.107 1.00 130.63 ? 113 PRO A C      1 
ATOM   1819  O O      . PRO A 1 113 ? 175.306 -3.506  132.330 1.00 121.71 ? 113 PRO A O      1 
ATOM   1820  C CB     . PRO A 1 113 ? 176.621 -5.763  130.659 1.00 135.01 ? 113 PRO A CB     1 
ATOM   1821  C CG     . PRO A 1 113 ? 177.265 -5.932  131.996 1.00 133.91 ? 113 PRO A CG     1 
ATOM   1822  C CD     . PRO A 1 113 ? 178.264 -4.807  132.137 1.00 131.39 ? 113 PRO A CD     1 
ATOM   1823  H HA     . PRO A 1 113 ? 176.622 -4.036  129.514 1.00 158.41 ? 113 PRO A HA     1 
ATOM   1824  H HB2    . PRO A 1 113 ? 175.715 -6.111  130.664 1.00 162.02 ? 113 PRO A HB2    1 
ATOM   1825  H HB3    . PRO A 1 113 ? 177.151 -6.181  129.963 1.00 162.02 ? 113 PRO A HB3    1 
ATOM   1826  H HG2    . PRO A 1 113 ? 176.590 -5.874  132.690 1.00 160.69 ? 113 PRO A HG2    1 
ATOM   1827  H HG3    . PRO A 1 113 ? 177.715 -6.791  132.032 1.00 160.69 ? 113 PRO A HG3    1 
ATOM   1828  H HD2    . PRO A 1 113 ? 178.221 -4.427  133.028 1.00 157.67 ? 113 PRO A HD2    1 
ATOM   1829  H HD3    . PRO A 1 113 ? 179.158 -5.122  131.928 1.00 157.67 ? 113 PRO A HD3    1 
ATOM   1830  N N      . CYS A 1 114 ? 174.357 -3.317  130.289 1.00 140.47 ? 114 CYS A N      1 
ATOM   1831  C CA     . CYS A 1 114 ? 173.085 -2.794  130.780 1.00 143.78 ? 114 CYS A CA     1 
ATOM   1832  C C      . CYS A 1 114 ? 172.033 -2.879  129.677 1.00 147.34 ? 114 CYS A C      1 
ATOM   1833  O O      . CYS A 1 114 ? 172.367 -3.080  128.508 1.00 151.26 ? 114 CYS A O      1 
ATOM   1834  C CB     . CYS A 1 114 ? 173.240 -1.344  131.237 1.00 140.59 ? 114 CYS A CB     1 
ATOM   1835  S SG     . CYS A 1 114 ? 173.435 -0.162  129.884 1.00 122.48 ? 114 CYS A SG     1 
ATOM   1836  H H      . CYS A 1 114 ? 174.396 -3.384  129.432 1.00 168.56 ? 114 CYS A H      1 
ATOM   1837  H HA     . CYS A 1 114 ? 172.785 -3.325  131.534 1.00 172.54 ? 114 CYS A HA     1 
ATOM   1838  H HB2    . CYS A 1 114 ? 172.450 -1.090  131.739 1.00 168.71 ? 114 CYS A HB2    1 
ATOM   1839  H HB3    . CYS A 1 114 ? 174.024 -1.278  131.803 1.00 168.71 ? 114 CYS A HB3    1 
ATOM   1840  H HG     . CYS A 1 114 ? 173.548 0.941   130.342 1.00 146.98 ? 114 CYS A HG     1 
ATOM   1841  N N      . TYR A 1 115 ? 170.767 -2.719  130.051 1.00 144.10 ? 115 TYR A N      1 
ATOM   1842  C CA     . TYR A 1 115 ? 169.667 -2.803  129.092 1.00 143.30 ? 115 TYR A CA     1 
ATOM   1843  C C      . TYR A 1 115 ? 169.538 -1.530  128.262 1.00 139.99 ? 115 TYR A C      1 
ATOM   1844  O O      . TYR A 1 115 ? 169.949 -0.451  128.689 1.00 139.15 ? 115 TYR A O      1 
ATOM   1845  C CB     . TYR A 1 115 ? 168.348 -3.078  129.814 1.00 145.94 ? 115 TYR A CB     1 
ATOM   1846  C CG     . TYR A 1 115 ? 168.305 -4.416  130.506 1.00 150.08 ? 115 TYR A CG     1 
ATOM   1847  C CD1    . TYR A 1 115 ? 167.867 -5.550  129.837 1.00 153.39 ? 115 TYR A CD1    1 
ATOM   1848  C CD2    . TYR A 1 115 ? 168.704 -4.546  131.827 1.00 152.64 ? 115 TYR A CD2    1 
ATOM   1849  C CE1    . TYR A 1 115 ? 167.826 -6.777  130.465 1.00 157.62 ? 115 TYR A CE1    1 
ATOM   1850  C CE2    . TYR A 1 115 ? 168.668 -5.767  132.464 1.00 157.00 ? 115 TYR A CE2    1 
ATOM   1851  C CZ     . TYR A 1 115 ? 168.228 -6.880  131.779 1.00 160.84 ? 115 TYR A CZ     1 
ATOM   1852  O OH     . TYR A 1 115 ? 168.191 -8.100  132.415 1.00 165.66 ? 115 TYR A OH     1 
ATOM   1853  H H      . TYR A 1 115 ? 170.516 -2.561  130.858 1.00 172.92 ? 115 TYR A H      1 
ATOM   1854  H HA     . TYR A 1 115 ? 169.835 -3.540  128.484 1.00 171.96 ? 115 TYR A HA     1 
ATOM   1855  H HB2    . TYR A 1 115 ? 168.210 -2.392  130.485 1.00 175.13 ? 115 TYR A HB2    1 
ATOM   1856  H HB3    . TYR A 1 115 ? 167.626 -3.056  129.166 1.00 175.13 ? 115 TYR A HB3    1 
ATOM   1857  H HD1    . TYR A 1 115 ? 167.596 -5.481  128.951 1.00 184.07 ? 115 TYR A HD1    1 
ATOM   1858  H HD2    . TYR A 1 115 ? 169.002 -3.797  132.291 1.00 183.16 ? 115 TYR A HD2    1 
ATOM   1859  H HE1    . TYR A 1 115 ? 167.530 -7.529  130.005 1.00 189.14 ? 115 TYR A HE1    1 
ATOM   1860  H HE2    . TYR A 1 115 ? 168.938 -5.840  133.351 1.00 188.40 ? 115 TYR A HE2    1 
ATOM   1861  H HH     . TYR A 1 115 ? 168.461 -8.020  133.206 1.00 198.80 ? 115 TYR A HH     1 
ATOM   1862  N N      . LYS A 1 116 ? 168.958 -1.665  127.075 1.00 138.33 ? 116 LYS A N      1 
ATOM   1863  C CA     . LYS A 1 116 ? 168.780 -0.533  126.177 1.00 137.26 ? 116 LYS A CA     1 
ATOM   1864  C C      . LYS A 1 116 ? 167.611 0.330   126.643 1.00 137.18 ? 116 LYS A C      1 
ATOM   1865  O O      . LYS A 1 116 ? 167.745 1.545   126.786 1.00 137.70 ? 116 LYS A O      1 
ATOM   1866  C CB     . LYS A 1 116 ? 168.546 -1.026  124.750 1.00 137.26 ? 116 LYS A CB     1 
ATOM   1867  C CG     . LYS A 1 116 ? 168.708 0.044   123.684 1.00 136.33 ? 116 LYS A CG     1 
ATOM   1868  C CD     . LYS A 1 116 ? 168.751 -0.574  122.295 1.00 135.96 ? 116 LYS A CD     1 
ATOM   1869  C CE     . LYS A 1 116 ? 169.035 0.467   121.226 1.00 134.79 ? 116 LYS A CE     1 
ATOM   1870  N NZ     . LYS A 1 116 ? 169.136 -0.140  119.868 1.00 134.99 ? 116 LYS A NZ     1 
ATOM   1871  H H      . LYS A 1 116 ? 168.658 -2.409  126.764 1.00 166.00 ? 116 LYS A H      1 
ATOM   1872  H HA     . LYS A 1 116 ? 169.582 0.012   126.184 1.00 164.71 ? 116 LYS A HA     1 
ATOM   1873  H HB2    . LYS A 1 116 ? 169.181 -1.733  124.557 1.00 164.72 ? 116 LYS A HB2    1 
ATOM   1874  H HB3    . LYS A 1 116 ? 167.642 -1.372  124.685 1.00 164.72 ? 116 LYS A HB3    1 
ATOM   1875  H HG2    . LYS A 1 116 ? 167.956 0.654   123.724 1.00 163.60 ? 116 LYS A HG2    1 
ATOM   1876  H HG3    . LYS A 1 116 ? 169.539 0.521   123.832 1.00 163.60 ? 116 LYS A HG3    1 
ATOM   1877  H HD2    . LYS A 1 116 ? 169.455 -1.241  122.264 1.00 163.16 ? 116 LYS A HD2    1 
ATOM   1878  H HD3    . LYS A 1 116 ? 167.893 -0.983  122.101 1.00 163.16 ? 116 LYS A HD3    1 
ATOM   1879  H HE2    . LYS A 1 116 ? 168.314 1.116   121.214 1.00 161.75 ? 116 LYS A HE2    1 
ATOM   1880  H HE3    . LYS A 1 116 ? 169.877 0.906   121.424 1.00 161.75 ? 116 LYS A HE3    1 
ATOM   1881  H HZ1    . LYS A 1 116 ? 169.302 0.493   119.265 1.00 161.99 ? 116 LYS A HZ1    1 
ATOM   1882  H HZ2    . LYS A 1 116 ? 169.796 -0.737  119.851 1.00 161.99 ? 116 LYS A HZ2    1 
ATOM   1883  H HZ3    . LYS A 1 116 ? 168.372 -0.546  119.659 1.00 161.99 ? 116 LYS A HZ3    1 
ATOM   1884  N N      . LEU A 1 117 ? 166.469 -0.312  126.877 1.00 137.84 ? 117 LEU A N      1 
ATOM   1885  C CA     . LEU A 1 117 ? 165.281 0.352   127.420 1.00 139.52 ? 117 LEU A CA     1 
ATOM   1886  C C      . LEU A 1 117 ? 164.703 1.443   126.515 1.00 142.12 ? 117 LEU A C      1 
ATOM   1887  O O      . LEU A 1 117 ? 165.355 1.922   125.587 1.00 144.22 ? 117 LEU A O      1 
ATOM   1888  C CB     . LEU A 1 117 ? 165.573 0.939   128.802 1.00 138.62 ? 117 LEU A CB     1 
ATOM   1889  C CG     . LEU A 1 117 ? 166.129 -0.034  129.842 1.00 139.88 ? 117 LEU A CG     1 
ATOM   1890  C CD1    . LEU A 1 117 ? 166.361 0.696   131.153 1.00 139.23 ? 117 LEU A CD1    1 
ATOM   1891  C CD2    . LEU A 1 117 ? 165.198 -1.221  130.049 1.00 141.10 ? 117 LEU A CD2    1 
ATOM   1892  H H      . LEU A 1 117 ? 166.353 -1.151  126.727 1.00 165.40 ? 117 LEU A H      1 
ATOM   1893  H HA     . LEU A 1 117 ? 164.589 -0.318  127.535 1.00 167.42 ? 117 LEU A HA     1 
ATOM   1894  H HB2    . LEU A 1 117 ? 166.222 1.652   128.699 1.00 166.35 ? 117 LEU A HB2    1 
ATOM   1895  H HB3    . LEU A 1 117 ? 164.748 1.303   129.159 1.00 166.35 ? 117 LEU A HB3    1 
ATOM   1896  H HG     . LEU A 1 117 ? 166.983 -0.373  129.533 1.00 167.86 ? 117 LEU A HG     1 
ATOM   1897  H HD11   . LEU A 1 117 ? 166.713 0.069   131.804 1.00 167.08 ? 117 LEU A HD11   1 
ATOM   1898  H HD12   . LEU A 1 117 ? 166.997 1.413   131.006 1.00 167.08 ? 117 LEU A HD12   1 
ATOM   1899  H HD13   . LEU A 1 117 ? 165.517 1.060   131.465 1.00 167.08 ? 117 LEU A HD13   1 
ATOM   1900  H HD21   . LEU A 1 117 ? 165.584 -1.813  130.713 1.00 169.32 ? 117 LEU A HD21   1 
ATOM   1901  H HD22   . LEU A 1 117 ? 164.336 -0.897  130.354 1.00 169.32 ? 117 LEU A HD22   1 
ATOM   1902  H HD23   . LEU A 1 117 ? 165.095 -1.691  129.206 1.00 169.32 ? 117 LEU A HD23   1 
ATOM   1903  N N      . LYS A 1 118 ? 163.465 1.828   126.806 1.00 141.99 ? 118 LYS A N      1 
ATOM   1904  C CA     . LYS A 1 118 ? 162.736 2.785   125.984 1.00 141.36 ? 118 LYS A CA     1 
ATOM   1905  C C      . LYS A 1 118 ? 163.113 4.211   126.382 1.00 137.33 ? 118 LYS A C      1 
ATOM   1906  O O      . LYS A 1 118 ? 163.842 4.901   125.668 1.00 131.34 ? 118 LYS A O      1 
ATOM   1907  C CB     . LYS A 1 118 ? 161.224 2.577   126.149 1.00 142.67 ? 118 LYS A CB     1 
ATOM   1908  C CG     . LYS A 1 118 ? 160.752 1.133   126.000 1.00 143.20 ? 118 LYS A CG     1 
ATOM   1909  C CD     . LYS A 1 118 ? 159.357 0.960   126.587 1.00 142.36 ? 118 LYS A CD     1 
ATOM   1910  C CE     . LYS A 1 118 ? 158.929 -0.496  126.615 1.00 142.31 ? 118 LYS A CE     1 
ATOM   1911  N NZ     . LYS A 1 118 ? 157.627 -0.671  127.319 1.00 141.87 ? 118 LYS A NZ     1 
ATOM   1912  H H      . LYS A 1 118 ? 163.020 1.545   127.485 1.00 170.39 ? 118 LYS A H      1 
ATOM   1913  H HA     . LYS A 1 118 ? 162.966 2.654   125.051 1.00 169.64 ? 118 LYS A HA     1 
ATOM   1914  H HB2    . LYS A 1 118 ? 160.965 2.879   127.034 1.00 171.20 ? 118 LYS A HB2    1 
ATOM   1915  H HB3    . LYS A 1 118 ? 160.764 3.105   125.478 1.00 171.20 ? 118 LYS A HB3    1 
ATOM   1916  H HG2    . LYS A 1 118 ? 160.720 0.900   125.060 1.00 171.84 ? 118 LYS A HG2    1 
ATOM   1917  H HG3    . LYS A 1 118 ? 161.360 0.545   126.475 1.00 171.84 ? 118 LYS A HG3    1 
ATOM   1918  H HD2    . LYS A 1 118 ? 159.351 1.295   127.498 1.00 170.83 ? 118 LYS A HD2    1 
ATOM   1919  H HD3    . LYS A 1 118 ? 158.721 1.452   126.046 1.00 170.83 ? 118 LYS A HD3    1 
ATOM   1920  H HE2    . LYS A 1 118 ? 158.828 -0.817  125.705 1.00 170.78 ? 118 LYS A HE2    1 
ATOM   1921  H HE3    . LYS A 1 118 ? 159.600 -1.018  127.083 1.00 170.78 ? 118 LYS A HE3    1 
ATOM   1922  H HZ1    . LYS A 1 118 ? 157.396 -1.531  127.323 1.00 170.25 ? 118 LYS A HZ1    1 
ATOM   1923  H HZ2    . LYS A 1 118 ? 157.695 -0.386  128.159 1.00 170.25 ? 118 LYS A HZ2    1 
ATOM   1924  H HZ3    . LYS A 1 118 ? 156.992 -0.203  126.905 1.00 170.25 ? 118 LYS A HZ3    1 
ATOM   1925  N N      . GLU A 1 119 ? 162.603 4.630   127.536 1.00 140.16 ? 119 GLU A N      1 
ATOM   1926  C CA     . GLU A 1 119 ? 162.860 5.947   128.098 1.00 141.79 ? 119 GLU A CA     1 
ATOM   1927  C C      . GLU A 1 119 ? 163.037 5.742   129.602 1.00 139.11 ? 119 GLU A C      1 
ATOM   1928  O O      . GLU A 1 119 ? 162.799 4.641   130.100 1.00 140.04 ? 119 GLU A O      1 
ATOM   1929  C CB     . GLU A 1 119 ? 161.690 6.884   127.786 1.00 144.43 ? 119 GLU A CB     1 
ATOM   1930  C CG     . GLU A 1 119 ? 161.563 7.234   126.310 1.00 144.88 ? 119 GLU A CG     1 
ATOM   1931  C CD     . GLU A 1 119 ? 160.581 8.361   126.053 1.00 142.80 ? 119 GLU A CD     1 
ATOM   1932  O OE1    . GLU A 1 119 ? 159.779 8.675   126.958 1.00 141.59 ? 119 GLU A OE1    1 
ATOM   1933  O OE2    . GLU A 1 119 ? 160.618 8.934   124.943 1.00 142.08 ? 119 GLU A OE2    1 
ATOM   1934  H H      . GLU A 1 119 ? 162.087 4.149   128.027 1.00 168.19 ? 119 GLU A H      1 
ATOM   1935  H HA     . GLU A 1 119 ? 163.676 6.318   127.727 1.00 170.15 ? 119 GLU A HA     1 
ATOM   1936  H HB2    . GLU A 1 119 ? 160.864 6.456   128.061 1.00 173.32 ? 119 GLU A HB2    1 
ATOM   1937  H HB3    . GLU A 1 119 ? 161.811 7.711   128.278 1.00 173.32 ? 119 GLU A HB3    1 
ATOM   1938  H HG2    . GLU A 1 119 ? 162.431 7.510   125.976 1.00 173.85 ? 119 GLU A HG2    1 
ATOM   1939  H HG3    . GLU A 1 119 ? 161.255 6.452   125.826 1.00 173.85 ? 119 GLU A HG3    1 
ATOM   1940  N N      . PRO A 1 120 ? 163.465 6.782   130.339 1.00 134.95 ? 120 PRO A N      1 
ATOM   1941  C CA     . PRO A 1 120 ? 163.724 6.523   131.760 1.00 134.78 ? 120 PRO A CA     1 
ATOM   1942  C C      . PRO A 1 120 ? 162.449 6.348   132.602 1.00 142.21 ? 120 PRO A C      1 
ATOM   1943  O O      . PRO A 1 120 ? 162.243 7.055   133.589 1.00 139.70 ? 120 PRO A O      1 
ATOM   1944  C CB     . PRO A 1 120 ? 164.531 7.753   132.191 1.00 129.65 ? 120 PRO A CB     1 
ATOM   1945  C CG     . PRO A 1 120 ? 164.104 8.827   131.268 1.00 128.99 ? 120 PRO A CG     1 
ATOM   1946  C CD     . PRO A 1 120 ? 163.816 8.164   129.958 1.00 131.55 ? 120 PRO A CD     1 
ATOM   1947  H HA     . PRO A 1 120 ? 164.278 5.732   131.858 1.00 161.74 ? 120 PRO A HA     1 
ATOM   1948  H HB2    . PRO A 1 120 ? 164.315 7.982   133.109 1.00 155.58 ? 120 PRO A HB2    1 
ATOM   1949  H HB3    . PRO A 1 120 ? 165.479 7.573   132.095 1.00 155.58 ? 120 PRO A HB3    1 
ATOM   1950  H HG2    . PRO A 1 120 ? 163.305 9.254   131.616 1.00 154.78 ? 120 PRO A HG2    1 
ATOM   1951  H HG3    . PRO A 1 120 ? 164.820 9.474   131.171 1.00 154.78 ? 120 PRO A HG3    1 
ATOM   1952  H HD2    . PRO A 1 120 ? 163.065 8.594   129.520 1.00 157.86 ? 120 PRO A HD2    1 
ATOM   1953  H HD3    . PRO A 1 120 ? 164.606 8.169   129.396 1.00 157.86 ? 120 PRO A HD3    1 
ATOM   1954  N N      . LYS A 1 121 ? 161.605 5.399   132.201 1.00 152.70 ? 121 LYS A N      1 
ATOM   1955  C CA     . LYS A 1 121 ? 160.429 5.012   132.975 1.00 158.36 ? 121 LYS A CA     1 
ATOM   1956  C C      . LYS A 1 121 ? 160.587 3.562   133.424 1.00 159.91 ? 121 LYS A C      1 
ATOM   1957  O O      . LYS A 1 121 ? 159.996 3.136   134.418 1.00 160.76 ? 121 LYS A O      1 
ATOM   1958  C CB     . LYS A 1 121 ? 159.150 5.176   132.146 1.00 159.75 ? 121 LYS A CB     1 
ATOM   1959  C CG     . LYS A 1 121 ? 159.080 4.288   130.907 1.00 161.40 ? 121 LYS A CG     1 
ATOM   1960  C CD     . LYS A 1 121 ? 157.760 4.454   130.160 1.00 162.38 ? 121 LYS A CD     1 
ATOM   1961  C CE     . LYS A 1 121 ? 156.584 3.889   130.947 1.00 161.41 ? 121 LYS A CE     1 
ATOM   1962  N NZ     . LYS A 1 121 ? 155.302 3.981   130.194 1.00 160.22 ? 121 LYS A NZ     1 
ATOM   1963  H H      . LYS A 1 121 ? 161.695 4.956   131.469 1.00 183.24 ? 121 LYS A H      1 
ATOM   1964  H HA     . LYS A 1 121 ? 160.360 5.574   133.763 1.00 190.03 ? 121 LYS A HA     1 
ATOM   1965  H HB2    . LYS A 1 121 ? 158.388 4.961   132.706 1.00 191.70 ? 121 LYS A HB2    1 
ATOM   1966  H HB3    . LYS A 1 121 ? 159.088 6.098   131.850 1.00 191.70 ? 121 LYS A HB3    1 
ATOM   1967  H HG2    . LYS A 1 121 ? 159.801 4.525   130.304 1.00 193.67 ? 121 LYS A HG2    1 
ATOM   1968  H HG3    . LYS A 1 121 ? 159.160 3.360   131.176 1.00 193.67 ? 121 LYS A HG3    1 
ATOM   1969  H HD2    . LYS A 1 121 ? 157.596 5.398   130.008 1.00 194.86 ? 121 LYS A HD2    1 
ATOM   1970  H HD3    . LYS A 1 121 ? 157.812 3.983   129.313 1.00 194.86 ? 121 LYS A HD3    1 
ATOM   1971  H HE2    . LYS A 1 121 ? 156.752 2.953   131.141 1.00 193.70 ? 121 LYS A HE2    1 
ATOM   1972  H HE3    . LYS A 1 121 ? 156.485 4.388   131.772 1.00 193.70 ? 121 LYS A HE3    1 
ATOM   1973  H HZ1    . LYS A 1 121 ? 154.638 3.643   130.681 1.00 192.27 ? 121 LYS A HZ1    1 
ATOM   1974  H HZ2    . LYS A 1 121 ? 155.120 4.832   130.007 1.00 192.27 ? 121 LYS A HZ2    1 
ATOM   1975  H HZ3    . LYS A 1 121 ? 155.363 3.525   129.432 1.00 192.27 ? 121 LYS A HZ3    1 
ATOM   1976  N N      . ASN A 1 122 ? 161.400 2.813   132.683 1.00 159.12 ? 122 ASN A N      1 
ATOM   1977  C CA     . ASN A 1 122 ? 161.668 1.414   132.991 1.00 161.09 ? 122 ASN A CA     1 
ATOM   1978  C C      . ASN A 1 122 ? 162.854 1.270   133.938 1.00 167.70 ? 122 ASN A C      1 
ATOM   1979  O O      . ASN A 1 122 ? 163.499 0.221   133.982 1.00 163.62 ? 122 ASN A O      1 
ATOM   1980  C CB     . ASN A 1 122 ? 161.953 0.640   131.703 1.00 159.36 ? 122 ASN A CB     1 
ATOM   1981  C CG     . ASN A 1 122 ? 160.908 0.882   130.633 1.00 158.44 ? 122 ASN A CG     1 
ATOM   1982  O OD1    . ASN A 1 122 ? 161.218 1.366   129.543 1.00 157.56 ? 122 ASN A OD1    1 
ATOM   1983  N ND2    . ASN A 1 122 ? 159.661 0.547   130.938 1.00 158.99 ? 122 ASN A ND2    1 
ATOM   1984  H H      . ASN A 1 122 ? 161.814 3.098   131.986 1.00 190.95 ? 122 ASN A H      1 
ATOM   1985  H HA     . ASN A 1 122 ? 160.888 1.023   133.416 1.00 193.31 ? 122 ASN A HA     1 
ATOM   1986  H HB2    . ASN A 1 122 ? 162.813 0.918   131.351 1.00 191.23 ? 122 ASN A HB2    1 
ATOM   1987  H HB3    . ASN A 1 122 ? 161.965 -0.310  131.900 1.00 191.23 ? 122 ASN A HB3    1 
ATOM   1988  H HD21   . ASN A 1 122 ? 159.031 0.665   130.365 1.00 190.78 ? 122 ASN A HD21   1 
ATOM   1989  H HD22   . ASN A 1 122 ? 159.482 0.211   131.710 1.00 190.78 ? 122 ASN A HD22   1 
ATOM   1990  N N      . ILE A 1 123 ? 163.139 2.329   134.690 1.00 178.64 ? 123 ILE A N      1 
ATOM   1991  C CA     . ILE A 1 123 ? 164.271 2.331   135.607 1.00 182.66 ? 123 ILE A CA     1 
ATOM   1992  C C      . ILE A 1 123 ? 164.029 1.386   136.776 1.00 172.71 ? 123 ILE A C      1 
ATOM   1993  O O      . ILE A 1 123 ? 163.388 1.751   137.764 1.00 177.26 ? 123 ILE A O      1 
ATOM   1994  C CB     . ILE A 1 123 ? 164.559 3.747   136.145 1.00 189.92 ? 123 ILE A CB     1 
ATOM   1995  C CG1    . ILE A 1 123 ? 164.896 4.688   134.986 1.00 192.45 ? 123 ILE A CG1    1 
ATOM   1996  C CG2    . ILE A 1 123 ? 165.708 3.717   137.160 1.00 191.64 ? 123 ILE A CG2    1 
ATOM   1997  C CD1    . ILE A 1 123 ? 165.071 6.136   135.392 1.00 192.78 ? 123 ILE A CD1    1 
ATOM   1998  H H      . ILE A 1 123 ? 162.689 3.061   134.688 1.00 214.37 ? 123 ILE A H      1 
ATOM   1999  H HA     . ILE A 1 123 ? 165.061 2.026   135.133 1.00 219.19 ? 123 ILE A HA     1 
ATOM   2000  H HB     . ILE A 1 123 ? 163.762 4.076   136.590 1.00 227.91 ? 123 ILE A HB     1 
ATOM   2001  H HG12   . ILE A 1 123 ? 165.724 4.393   134.577 1.00 230.94 ? 123 ILE A HG12   1 
ATOM   2002  H HG13   . ILE A 1 123 ? 164.178 4.649   134.335 1.00 230.94 ? 123 ILE A HG13   1 
ATOM   2003  H HG21   . ILE A 1 123 ? 165.868 4.618   137.482 1.00 229.96 ? 123 ILE A HG21   1 
ATOM   2004  H HG22   . ILE A 1 123 ? 165.462 3.140   137.899 1.00 229.96 ? 123 ILE A HG22   1 
ATOM   2005  H HG23   . ILE A 1 123 ? 166.505 3.375   136.724 1.00 229.96 ? 123 ILE A HG23   1 
ATOM   2006  H HD11   . ILE A 1 123 ? 165.282 6.661   134.603 1.00 231.33 ? 123 ILE A HD11   1 
ATOM   2007  H HD12   . ILE A 1 123 ? 164.247 6.454   135.791 1.00 231.33 ? 123 ILE A HD12   1 
ATOM   2008  H HD13   . ILE A 1 123 ? 165.796 6.198   136.034 1.00 231.33 ? 123 ILE A HD13   1 
ATOM   2009  N N      . LYS A 1 124 ? 164.543 0.168   136.643 1.00 154.74 ? 124 LYS A N      1 
ATOM   2010  C CA     . LYS A 1 124 ? 164.565 -0.795  137.736 1.00 139.10 ? 124 LYS A CA     1 
ATOM   2011  C C      . LYS A 1 124 ? 166.000 -0.904  138.235 1.00 132.66 ? 124 LYS A C      1 
ATOM   2012  O O      . LYS A 1 124 ? 166.312 -0.513  139.363 1.00 125.67 ? 124 LYS A O      1 
ATOM   2013  C CB     . LYS A 1 124 ? 164.050 -2.160  137.267 1.00 133.99 ? 124 LYS A CB     1 
ATOM   2014  C CG     . LYS A 1 124 ? 162.538 -2.225  137.020 1.00 129.34 ? 124 LYS A CG     1 
ATOM   2015  C CD     . LYS A 1 124 ? 161.736 -2.192  138.324 1.00 123.80 ? 124 LYS A CD     1 
ATOM   2016  C CE     . LYS A 1 124 ? 161.129 -0.817  138.598 1.00 116.95 ? 124 LYS A CE     1 
ATOM   2017  N NZ     . LYS A 1 124 ? 160.429 -0.764  139.915 1.00 111.80 ? 124 LYS A NZ     1 
ATOM   2018  H H      . LYS A 1 124 ? 164.891 -0.129  135.915 1.00 185.69 ? 124 LYS A H      1 
ATOM   2019  H HA     . LYS A 1 124 ? 164.003 -0.481  138.462 1.00 166.91 ? 124 LYS A HA     1 
ATOM   2020  H HB2    . LYS A 1 124 ? 164.494 -2.389  136.435 1.00 160.78 ? 124 LYS A HB2    1 
ATOM   2021  H HB3    . LYS A 1 124 ? 164.265 -2.821  137.944 1.00 160.78 ? 124 LYS A HB3    1 
ATOM   2022  H HG2    . LYS A 1 124 ? 162.271 -1.463  136.482 1.00 155.21 ? 124 LYS A HG2    1 
ATOM   2023  H HG3    . LYS A 1 124 ? 162.327 -3.050  136.557 1.00 155.21 ? 124 LYS A HG3    1 
ATOM   2024  H HD2    . LYS A 1 124 ? 161.012 -2.835  138.267 1.00 148.55 ? 124 LYS A HD2    1 
ATOM   2025  H HD3    . LYS A 1 124 ? 162.323 -2.415  139.063 1.00 148.55 ? 124 LYS A HD3    1 
ATOM   2026  H HE2    . LYS A 1 124 ? 161.836 -0.153  138.605 1.00 140.34 ? 124 LYS A HE2    1 
ATOM   2027  H HE3    . LYS A 1 124 ? 160.483 -0.610  137.904 1.00 140.34 ? 124 LYS A HE3    1 
ATOM   2028  H HZ1    . LYS A 1 124 ? 160.087 0.047   140.045 1.00 134.16 ? 124 LYS A HZ1    1 
ATOM   2029  H HZ2    . LYS A 1 124 ? 159.770 -1.362  139.933 1.00 134.16 ? 124 LYS A HZ2    1 
ATOM   2030  H HZ3    . LYS A 1 124 ? 161.003 -0.945  140.571 1.00 134.16 ? 124 LYS A HZ3    1 
ATOM   2031  N N      . SER A 1 125 ? 166.874 -1.428  137.381 1.00 137.58 ? 125 SER A N      1 
ATOM   2032  C CA     . SER A 1 125 ? 168.296 -1.485  137.688 1.00 142.01 ? 125 SER A CA     1 
ATOM   2033  C C      . SER A 1 125 ? 168.862 -0.072  137.701 1.00 141.90 ? 125 SER A C      1 
ATOM   2034  O O      . SER A 1 125 ? 168.529 0.748   136.845 1.00 143.23 ? 125 SER A O      1 
ATOM   2035  C CB     . SER A 1 125 ? 169.032 -2.345  136.660 1.00 145.04 ? 125 SER A CB     1 
ATOM   2036  O OG     . SER A 1 125 ? 170.431 -2.338  136.890 1.00 146.26 ? 125 SER A OG     1 
ATOM   2037  H H      . SER A 1 125 ? 166.667 -1.758  136.615 1.00 165.09 ? 125 SER A H      1 
ATOM   2038  H HA     . SER A 1 125 ? 168.423 -1.877  138.566 1.00 170.41 ? 125 SER A HA     1 
ATOM   2039  H HB2    . SER A 1 125 ? 168.708 -3.257  136.723 1.00 174.05 ? 125 SER A HB2    1 
ATOM   2040  H HB3    . SER A 1 125 ? 168.858 -1.993  135.773 1.00 174.05 ? 125 SER A HB3    1 
ATOM   2041  H HG     . SER A 1 125 ? 170.819 -2.815  136.317 1.00 175.51 ? 125 SER A HG     1 
ATOM   2042  N N      . ALA A 1 126 ? 169.715 0.210   138.679 1.00 138.88 ? 126 ALA A N      1 
ATOM   2043  C CA     . ALA A 1 126 ? 170.247 1.553   138.861 1.00 134.92 ? 126 ALA A CA     1 
ATOM   2044  C C      . ALA A 1 126 ? 171.294 1.897   137.806 1.00 132.59 ? 126 ALA A C      1 
ATOM   2045  O O      . ALA A 1 126 ? 171.472 3.063   137.459 1.00 126.75 ? 126 ALA A O      1 
ATOM   2046  C CB     . ALA A 1 126 ? 170.829 1.698   140.254 1.00 134.91 ? 126 ALA A CB     1 
ATOM   2047  H H      . ALA A 1 126 ? 170.002 -0.362  139.254 1.00 166.65 ? 126 ALA A H      1 
ATOM   2048  H HA     . ALA A 1 126 ? 169.520 2.190   138.776 1.00 161.91 ? 126 ALA A HA     1 
ATOM   2049  H HB1    . ALA A 1 126 ? 171.178 2.597   140.358 1.00 161.89 ? 126 ALA A HB1    1 
ATOM   2050  H HB2    . ALA A 1 126 ? 170.130 1.537   140.907 1.00 161.89 ? 126 ALA A HB2    1 
ATOM   2051  H HB3    . ALA A 1 126 ? 171.543 1.051   140.367 1.00 161.89 ? 126 ALA A HB3    1 
ATOM   2052  N N      . VAL A 1 127 ? 171.984 0.880   137.298 1.00 138.64 ? 127 VAL A N      1 
ATOM   2053  C CA     . VAL A 1 127 ? 172.993 1.077   136.261 1.00 142.11 ? 127 VAL A CA     1 
ATOM   2054  C C      . VAL A 1 127 ? 172.349 1.594   134.979 1.00 140.41 ? 127 VAL A C      1 
ATOM   2055  O O      . VAL A 1 127 ? 172.940 2.394   134.256 1.00 138.13 ? 127 VAL A O      1 
ATOM   2056  C CB     . VAL A 1 127 ? 173.747 -0.234  135.956 1.00 146.70 ? 127 VAL A CB     1 
ATOM   2057  C CG1    . VAL A 1 127 ? 174.797 -0.019  134.870 1.00 146.21 ? 127 VAL A CG1    1 
ATOM   2058  C CG2    . VAL A 1 127 ? 174.398 -0.771  137.219 1.00 150.39 ? 127 VAL A CG2    1 
ATOM   2059  H H      . VAL A 1 127 ? 171.885 0.060   137.539 1.00 166.37 ? 127 VAL A H      1 
ATOM   2060  H HA     . VAL A 1 127 ? 173.639 1.735   136.563 1.00 170.53 ? 127 VAL A HA     1 
ATOM   2061  H HB     . VAL A 1 127 ? 173.115 -0.897  135.637 1.00 176.05 ? 127 VAL A HB     1 
ATOM   2062  H HG11   . VAL A 1 127 ? 175.252 -0.859  134.701 1.00 175.45 ? 127 VAL A HG11   1 
ATOM   2063  H HG12   . VAL A 1 127 ? 174.357 0.288   134.062 1.00 175.45 ? 127 VAL A HG12   1 
ATOM   2064  H HG13   . VAL A 1 127 ? 175.433 0.647   135.175 1.00 175.45 ? 127 VAL A HG13   1 
ATOM   2065  H HG21   . VAL A 1 127 ? 174.866 -1.594  137.007 1.00 180.47 ? 127 VAL A HG21   1 
ATOM   2066  H HG22   . VAL A 1 127 ? 175.024 -0.112  137.556 1.00 180.47 ? 127 VAL A HG22   1 
ATOM   2067  H HG23   . VAL A 1 127 ? 173.709 -0.943  137.880 1.00 180.47 ? 127 VAL A HG23   1 
ATOM   2068  N N      . ASP A 1 128 ? 171.135 1.128   134.703 1.00 141.53 ? 128 ASP A N      1 
ATOM   2069  C CA     . ASP A 1 128 ? 170.391 1.578   133.535 1.00 142.32 ? 128 ASP A CA     1 
ATOM   2070  C C      . ASP A 1 128 ? 169.874 2.994   133.758 1.00 133.26 ? 128 ASP A C      1 
ATOM   2071  O O      . ASP A 1 128 ? 168.668 3.227   133.840 1.00 137.45 ? 128 ASP A O      1 
ATOM   2072  C CB     . ASP A 1 128 ? 169.234 0.625   133.238 1.00 150.12 ? 128 ASP A CB     1 
ATOM   2073  C CG     . ASP A 1 128 ? 169.709 -0.729  132.740 1.00 157.45 ? 128 ASP A CG     1 
ATOM   2074  O OD1    . ASP A 1 128 ? 169.946 -0.862  131.521 1.00 161.29 ? 128 ASP A OD1    1 
ATOM   2075  O OD2    . ASP A 1 128 ? 169.850 -1.658  133.564 1.00 158.84 ? 128 ASP A OD2    1 
ATOM   2076  H H      . ASP A 1 128 ? 170.718 0.547   135.180 1.00 169.83 ? 128 ASP A H      1 
ATOM   2077  H HA     . ASP A 1 128 ? 170.981 1.589   132.765 1.00 170.78 ? 128 ASP A HA     1 
ATOM   2078  H HB2    . ASP A 1 128 ? 168.723 0.484   134.050 1.00 180.14 ? 128 ASP A HB2    1 
ATOM   2079  H HB3    . ASP A 1 128 ? 168.669 1.016   132.553 1.00 180.14 ? 128 ASP A HB3    1 
ATOM   2080  N N      . ARG A 1 129 ? 170.809 3.933   133.856 1.00 117.21 ? 129 ARG A N      1 
ATOM   2081  C CA     . ARG A 1 129 ? 170.492 5.336   134.095 1.00 99.83  ? 129 ARG A CA     1 
ATOM   2082  C C      . ARG A 1 129 ? 171.586 6.222   133.506 1.00 88.90  ? 129 ARG A C      1 
ATOM   2083  O O      . ARG A 1 129 ? 171.313 7.327   133.036 1.00 92.05  ? 129 ARG A O      1 
ATOM   2084  C CB     . ARG A 1 129 ? 170.348 5.604   135.598 1.00 94.48  ? 129 ARG A CB     1 
ATOM   2085  C CG     . ARG A 1 129 ? 169.182 6.518   135.953 1.00 92.97  ? 129 ARG A CG     1 
ATOM   2086  C CD     . ARG A 1 129 ? 169.138 6.873   137.435 1.00 96.33  ? 129 ARG A CD     1 
ATOM   2087  N NE     . ARG A 1 129 ? 169.272 5.701   138.305 1.00 104.06 ? 129 ARG A NE     1 
ATOM   2088  C CZ     . ARG A 1 129 ? 168.581 5.494   139.427 1.00 110.50 ? 129 ARG A CZ     1 
ATOM   2089  N NH1    . ARG A 1 129 ? 167.676 6.367   139.841 1.00 111.15 ? 129 ARG A NH1    1 
ATOM   2090  N NH2    . ARG A 1 129 ? 168.793 4.395   140.139 1.00 114.59 ? 129 ARG A NH2    1 
ATOM   2091  H H      . ARG A 1 129 ? 171.652 3.778   133.785 1.00 140.65 ? 129 ARG A H      1 
ATOM   2092  H HA     . ARG A 1 129 ? 169.652 5.556   133.662 1.00 119.80 ? 129 ARG A HA     1 
ATOM   2093  H HB2    . ARG A 1 129 ? 170.211 4.759   136.054 1.00 113.38 ? 129 ARG A HB2    1 
ATOM   2094  H HB3    . ARG A 1 129 ? 171.161 6.023   135.919 1.00 113.38 ? 129 ARG A HB3    1 
ATOM   2095  H HG2    . ARG A 1 129 ? 169.263 7.343   135.450 1.00 111.56 ? 129 ARG A HG2    1 
ATOM   2096  H HG3    . ARG A 1 129 ? 168.351 6.072   135.727 1.00 111.56 ? 129 ARG A HG3    1 
ATOM   2097  H HD2    . ARG A 1 129 ? 169.867 7.480   137.636 1.00 115.59 ? 129 ARG A HD2    1 
ATOM   2098  H HD3    . ARG A 1 129 ? 168.288 7.297   137.633 1.00 115.59 ? 129 ARG A HD3    1 
ATOM   2099  H HE     . ARG A 1 129 ? 169.841 5.100   138.074 1.00 124.87 ? 129 ARG A HE     1 
ATOM   2100  H HH11   . ARG A 1 129 ? 167.530 7.083   139.389 1.00 133.38 ? 129 ARG A HH11   1 
ATOM   2101  H HH12   . ARG A 1 129 ? 167.236 6.219   140.565 1.00 133.38 ? 129 ARG A HH12   1 
ATOM   2102  H HH21   . ARG A 1 129 ? 169.376 3.819   139.878 1.00 137.50 ? 129 ARG A HH21   1 
ATOM   2103  H HH22   . ARG A 1 129 ? 168.345 4.257   140.860 1.00 137.50 ? 129 ARG A HH22   1 
ATOM   2104  N N      . THR A 1 130 ? 172.820 5.726   133.531 1.00 78.29  ? 130 THR A N      1 
ATOM   2105  C CA     . THR A 1 130 ? 173.963 6.449   132.986 1.00 80.17  ? 130 THR A CA     1 
ATOM   2106  C C      . THR A 1 130 ? 173.768 6.890   131.529 1.00 83.86  ? 130 THR A C      1 
ATOM   2107  O O      . THR A 1 130 ? 174.104 8.025   131.184 1.00 84.53  ? 130 THR A O      1 
ATOM   2108  C CB     . THR A 1 130 ? 175.255 5.604   133.089 1.00 84.60  ? 130 THR A CB     1 
ATOM   2109  O OG1    . THR A 1 130 ? 175.472 5.231   134.454 1.00 90.31  ? 130 THR A OG1    1 
ATOM   2110  C CG2    . THR A 1 130 ? 176.468 6.385   132.576 1.00 83.11  ? 130 THR A CG2    1 
ATOM   2111  H H      . THR A 1 130 ? 173.023 4.960   133.865 1.00 93.95  ? 130 THR A H      1 
ATOM   2112  H HA     . THR A 1 130 ? 174.097 7.250   133.516 1.00 96.21  ? 130 THR A HA     1 
ATOM   2113  H HB     . THR A 1 130 ? 175.158 4.803   132.549 1.00 101.52 ? 130 THR A HB     1 
ATOM   2114  H HG1    . THR A 1 130 ? 176.172 4.772   134.519 1.00 108.37 ? 130 THR A HG1    1 
ATOM   2115  H HG21   . THR A 1 130 ? 177.267 5.840   132.648 1.00 99.73  ? 130 THR A HG21   1 
ATOM   2116  H HG22   . THR A 1 130 ? 176.336 6.630   131.646 1.00 99.73  ? 130 THR A HG22   1 
ATOM   2117  H HG23   . THR A 1 130 ? 176.588 7.192   133.100 1.00 99.73  ? 130 THR A HG23   1 
ATOM   2118  N N      . PRO A 1 131 ? 173.246 6.000   130.663 1.00 88.33  ? 131 PRO A N      1 
ATOM   2119  C CA     . PRO A 1 131 ? 173.052 6.429   129.272 1.00 90.30  ? 131 PRO A CA     1 
ATOM   2120  C C      . PRO A 1 131 ? 172.068 7.590   129.183 1.00 86.09  ? 131 PRO A C      1 
ATOM   2121  O O      . PRO A 1 131 ? 172.278 8.519   128.400 1.00 86.83  ? 131 PRO A O      1 
ATOM   2122  C CB     . PRO A 1 131 ? 172.483 5.179   128.588 1.00 92.56  ? 131 PRO A CB     1 
ATOM   2123  C CG     . PRO A 1 131 ? 172.885 4.044   129.456 1.00 92.89  ? 131 PRO A CG     1 
ATOM   2124  C CD     . PRO A 1 131 ? 172.876 4.587   130.853 1.00 91.17  ? 131 PRO A CD     1 
ATOM   2125  H HA     . PRO A 1 131 ? 173.897 6.676   128.863 1.00 108.36 ? 131 PRO A HA     1 
ATOM   2126  H HB2    . PRO A 1 131 ? 171.516 5.247   128.537 1.00 111.08 ? 131 PRO A HB2    1 
ATOM   2127  H HB3    . PRO A 1 131 ? 172.868 5.087   127.703 1.00 111.08 ? 131 PRO A HB3    1 
ATOM   2128  H HG2    . PRO A 1 131 ? 172.244 3.321   129.366 1.00 111.47 ? 131 PRO A HG2    1 
ATOM   2129  H HG3    . PRO A 1 131 ? 173.775 3.745   129.211 1.00 111.47 ? 131 PRO A HG3    1 
ATOM   2130  H HD2    . PRO A 1 131 ? 171.988 4.518   131.238 1.00 109.40 ? 131 PRO A HD2    1 
ATOM   2131  H HD3    . PRO A 1 131 ? 173.537 4.133   131.398 1.00 109.40 ? 131 PRO A HD3    1 
ATOM   2132  N N      . PHE A 1 132 ? 171.019 7.544   129.999 1.00 79.92  ? 132 PHE A N      1 
ATOM   2133  C CA     . PHE A 1 132 ? 170.040 8.622   130.035 1.00 77.32  ? 132 PHE A CA     1 
ATOM   2134  C C      . PHE A 1 132 ? 170.658 9.885   130.607 1.00 73.98  ? 132 PHE A C      1 
ATOM   2135  O O      . PHE A 1 132 ? 170.350 10.988  130.157 1.00 76.20  ? 132 PHE A O      1 
ATOM   2136  C CB     . PHE A 1 132 ? 168.818 8.219   130.854 1.00 80.39  ? 132 PHE A CB     1 
ATOM   2137  C CG     . PHE A 1 132 ? 168.019 7.120   130.230 1.00 88.29  ? 132 PHE A CG     1 
ATOM   2138  C CD1    . PHE A 1 132 ? 167.239 7.366   129.113 1.00 91.40  ? 132 PHE A CD1    1 
ATOM   2139  C CD2    . PHE A 1 132 ? 168.051 5.841   130.752 1.00 93.72  ? 132 PHE A CD2    1 
ATOM   2140  C CE1    . PHE A 1 132 ? 166.503 6.354   128.530 1.00 94.86  ? 132 PHE A CE1    1 
ATOM   2141  C CE2    . PHE A 1 132 ? 167.316 4.825   130.174 1.00 97.39  ? 132 PHE A CE2    1 
ATOM   2142  C CZ     . PHE A 1 132 ? 166.540 5.083   129.061 1.00 97.35  ? 132 PHE A CZ     1 
ATOM   2143  H H      . PHE A 1 132 ? 170.851 6.898   130.541 1.00 95.90  ? 132 PHE A H      1 
ATOM   2144  H HA     . PHE A 1 132 ? 169.747 8.813   129.131 1.00 92.79  ? 132 PHE A HA     1 
ATOM   2145  H HB2    . PHE A 1 132 ? 169.111 7.914   131.727 1.00 96.47  ? 132 PHE A HB2    1 
ATOM   2146  H HB3    . PHE A 1 132 ? 168.238 8.990   130.951 1.00 96.47  ? 132 PHE A HB3    1 
ATOM   2147  H HD1    . PHE A 1 132 ? 167.211 8.222   128.751 1.00 109.68 ? 132 PHE A HD1    1 
ATOM   2148  H HD2    . PHE A 1 132 ? 168.572 5.663   131.502 1.00 112.46 ? 132 PHE A HD2    1 
ATOM   2149  H HE1    . PHE A 1 132 ? 165.981 6.530   127.781 1.00 113.84 ? 132 PHE A HE1    1 
ATOM   2150  H HE2    . PHE A 1 132 ? 167.343 3.968   130.534 1.00 116.87 ? 132 PHE A HE2    1 
ATOM   2151  H HZ     . PHE A 1 132 ? 166.044 4.400   128.671 1.00 116.83 ? 132 PHE A HZ     1 
ATOM   2152  N N      . HIS A 1 133 ? 171.535 9.730   131.593 1.00 69.87  ? 133 HIS A N      1 
ATOM   2153  C CA     . HIS A 1 133 ? 172.228 10.887  132.142 1.00 69.96  ? 133 HIS A CA     1 
ATOM   2154  C C      . HIS A 1 133 ? 173.094 11.518  131.066 1.00 71.90  ? 133 HIS A C      1 
ATOM   2155  O O      . HIS A 1 133 ? 173.036 12.730  130.848 1.00 70.42  ? 133 HIS A O      1 
ATOM   2156  C CB     . HIS A 1 133 ? 173.066 10.515  133.367 1.00 69.13  ? 133 HIS A CB     1 
ATOM   2157  C CG     . HIS A 1 133 ? 172.244 10.219  134.581 1.00 74.60  ? 133 HIS A CG     1 
ATOM   2158  N ND1    . HIS A 1 133 ? 172.609 9.282   135.522 1.00 75.41  ? 133 HIS A ND1    1 
ATOM   2159  C CD2    . HIS A 1 133 ? 171.062 10.730  135.000 1.00 79.84  ? 133 HIS A CD2    1 
ATOM   2160  C CE1    . HIS A 1 133 ? 171.686 9.224   136.464 1.00 76.91  ? 133 HIS A CE1    1 
ATOM   2161  N NE2    . HIS A 1 133 ? 170.741 10.100  136.176 1.00 80.54  ? 133 HIS A NE2    1 
ATOM   2162  H H      . HIS A 1 133 ? 171.744 8.979   131.956 1.00 83.85  ? 133 HIS A H      1 
ATOM   2163  H HA     . HIS A 1 133 ? 171.571 11.544  132.419 1.00 83.95  ? 133 HIS A HA     1 
ATOM   2164  H HB2    . HIS A 1 133 ? 173.589 9.724   133.162 1.00 82.95  ? 133 HIS A HB2    1 
ATOM   2165  H HB3    . HIS A 1 133 ? 173.656 11.255  133.581 1.00 82.95  ? 133 HIS A HB3    1 
ATOM   2166  H HD1    . HIS A 1 133 ? 173.322 8.802   135.494 1.00 90.50  ? 133 HIS A HD1    1 
ATOM   2167  H HD2    . HIS A 1 133 ? 170.563 11.387  134.571 1.00 95.80  ? 133 HIS A HD2    1 
ATOM   2168  H HE1    . HIS A 1 133 ? 171.708 8.673   137.213 1.00 92.29  ? 133 HIS A HE1    1 
ATOM   2169  H HE2    . HIS A 1 133 ? 170.036 10.247  136.646 1.00 96.65  ? 133 HIS A HE2    1 
ATOM   2170  N N      . HIS A 1 134 ? 173.880 10.683  130.390 1.00 76.49  ? 134 HIS A N      1 
ATOM   2171  C CA     . HIS A 1 134 ? 174.745 11.138  129.308 1.00 77.61  ? 134 HIS A CA     1 
ATOM   2172  C C      . HIS A 1 134 ? 173.934 11.888  128.262 1.00 75.58  ? 134 HIS A C      1 
ATOM   2173  O O      . HIS A 1 134 ? 174.288 12.997  127.871 1.00 75.12  ? 134 HIS A O      1 
ATOM   2174  C CB     . HIS A 1 134 ? 175.460 9.953   128.659 1.00 79.14  ? 134 HIS A CB     1 
ATOM   2175  C CG     . HIS A 1 134 ? 176.332 10.337  127.505 1.00 81.25  ? 134 HIS A CG     1 
ATOM   2176  N ND1    . HIS A 1 134 ? 177.410 11.184  127.640 1.00 83.93  ? 134 HIS A ND1    1 
ATOM   2177  C CD2    . HIS A 1 134 ? 176.276 10.003  126.193 1.00 81.74  ? 134 HIS A CD2    1 
ATOM   2178  C CE1    . HIS A 1 134 ? 177.986 11.350  126.461 1.00 85.28  ? 134 HIS A CE1    1 
ATOM   2179  N NE2    . HIS A 1 134 ? 177.316 10.647  125.568 1.00 83.59  ? 134 HIS A NE2    1 
ATOM   2180  H H      . HIS A 1 134 ? 173.930 9.838   130.542 1.00 91.79  ? 134 HIS A H      1 
ATOM   2181  H HA     . HIS A 1 134 ? 175.416 11.742  129.665 1.00 93.14  ? 134 HIS A HA     1 
ATOM   2182  H HB2    . HIS A 1 134 ? 176.020 9.522   129.323 1.00 94.97  ? 134 HIS A HB2    1 
ATOM   2183  H HB3    . HIS A 1 134 ? 174.795 9.326   128.332 1.00 94.97  ? 134 HIS A HB3    1 
ATOM   2184  H HD1    . HIS A 1 134 ? 177.670 11.546  128.375 1.00 100.71 ? 134 HIS A HD1    1 
ATOM   2185  H HD2    . HIS A 1 134 ? 175.651 9.444   125.792 1.00 98.08  ? 134 HIS A HD2    1 
ATOM   2186  H HE1    . HIS A 1 134 ? 178.734 11.875  126.291 1.00 102.34 ? 134 HIS A HE1    1 
ATOM   2187  H HE2    . HIS A 1 134 ? 177.503 10.596  124.730 1.00 100.31 ? 134 HIS A HE2    1 
ATOM   2188  N N      . LYS A 1 135 ? 172.832 11.282  127.832 1.00 75.60  ? 135 LYS A N      1 
ATOM   2189  C CA     . LYS A 1 135 ? 171.971 11.879  126.823 1.00 80.93  ? 135 LYS A CA     1 
ATOM   2190  C C      . LYS A 1 135 ? 171.406 13.230  127.264 1.00 76.25  ? 135 LYS A C      1 
ATOM   2191  O O      . LYS A 1 135 ? 171.193 14.110  126.433 1.00 79.05  ? 135 LYS A O      1 
ATOM   2192  C CB     . LYS A 1 135 ? 170.820 10.930  126.478 1.00 91.35  ? 135 LYS A CB     1 
ATOM   2193  C CG     . LYS A 1 135 ? 169.883 11.460  125.397 1.00 101.67 ? 135 LYS A CG     1 
ATOM   2194  C CD     . LYS A 1 135 ? 168.789 10.458  125.058 1.00 110.31 ? 135 LYS A CD     1 
ATOM   2195  C CE     . LYS A 1 135 ? 167.870 10.979  123.954 1.00 115.50 ? 135 LYS A CE     1 
ATOM   2196  N NZ     . LYS A 1 135 ? 166.811 9.995   123.587 1.00 117.54 ? 135 LYS A NZ     1 
ATOM   2197  H H      . LYS A 1 135 ? 172.560 10.516  128.114 1.00 90.72  ? 135 LYS A H      1 
ATOM   2198  H HA     . LYS A 1 135 ? 172.489 12.023  126.015 1.00 97.11  ? 135 LYS A HA     1 
ATOM   2199  H HB2    . LYS A 1 135 ? 171.190 10.091  126.162 1.00 109.62 ? 135 LYS A HB2    1 
ATOM   2200  H HB3    . LYS A 1 135 ? 170.292 10.775  127.277 1.00 109.62 ? 135 LYS A HB3    1 
ATOM   2201  H HG2    . LYS A 1 135 ? 169.461 12.275  125.713 1.00 122.01 ? 135 LYS A HG2    1 
ATOM   2202  H HG3    . LYS A 1 135 ? 170.393 11.637  124.591 1.00 122.01 ? 135 LYS A HG3    1 
ATOM   2203  H HD2    . LYS A 1 135 ? 169.196 9.633   124.750 1.00 132.37 ? 135 LYS A HD2    1 
ATOM   2204  H HD3    . LYS A 1 135 ? 168.251 10.292  125.847 1.00 132.37 ? 135 LYS A HD3    1 
ATOM   2205  H HE2    . LYS A 1 135 ? 167.435 11.790  124.259 1.00 138.60 ? 135 LYS A HE2    1 
ATOM   2206  H HE3    . LYS A 1 135 ? 168.399 11.162  123.161 1.00 138.60 ? 135 LYS A HE3    1 
ATOM   2207  H HZ1    . LYS A 1 135 ? 166.296 10.329  122.943 1.00 141.05 ? 135 LYS A HZ1    1 
ATOM   2208  H HZ2    . LYS A 1 135 ? 167.184 9.241   123.296 1.00 141.05 ? 135 LYS A HZ2    1 
ATOM   2209  H HZ3    . LYS A 1 135 ? 166.306 9.813   124.297 1.00 141.05 ? 135 LYS A HZ3    1 
ATOM   2210  N N      . TRP A 1 136 ? 171.150 13.396  128.559 1.00 68.33  ? 136 TRP A N      1 
ATOM   2211  C CA     . TRP A 1 136 ? 170.589 14.653  129.038 1.00 64.96  ? 136 TRP A CA     1 
ATOM   2212  C C      . TRP A 1 136 ? 171.648 15.754  129.038 1.00 62.96  ? 136 TRP A C      1 
ATOM   2213  O O      . TRP A 1 136 ? 171.324 16.933  128.866 1.00 60.76  ? 136 TRP A O      1 
ATOM   2214  C CB     . TRP A 1 136 ? 169.980 14.505  130.438 1.00 66.06  ? 136 TRP A CB     1 
ATOM   2215  C CG     . TRP A 1 136 ? 169.153 15.705  130.856 1.00 64.95  ? 136 TRP A CG     1 
ATOM   2216  C CD1    . TRP A 1 136 ? 167.802 15.864  130.710 1.00 63.63  ? 136 TRP A CD1    1 
ATOM   2217  C CD2    . TRP A 1 136 ? 169.631 16.910  131.473 1.00 64.52  ? 136 TRP A CD2    1 
ATOM   2218  N NE1    . TRP A 1 136 ? 167.412 17.094  131.193 1.00 62.15  ? 136 TRP A NE1    1 
ATOM   2219  C CE2    . TRP A 1 136 ? 168.515 17.754  131.666 1.00 64.39  ? 136 TRP A CE2    1 
ATOM   2220  C CE3    . TRP A 1 136 ? 170.893 17.357  131.879 1.00 62.89  ? 136 TRP A CE3    1 
ATOM   2221  C CZ2    . TRP A 1 136 ? 168.625 19.017  132.253 1.00 64.68  ? 136 TRP A CZ2    1 
ATOM   2222  C CZ3    . TRP A 1 136 ? 171.000 18.614  132.460 1.00 61.44  ? 136 TRP A CZ3    1 
ATOM   2223  C CH2    . TRP A 1 136 ? 169.874 19.427  132.641 1.00 62.65  ? 136 TRP A CH2    1 
ATOM   2224  H H      . TRP A 1 136 ? 171.290 12.808  129.170 1.00 81.99  ? 136 TRP A H      1 
ATOM   2225  H HA     . TRP A 1 136 ? 169.879 14.926  128.436 1.00 77.95  ? 136 TRP A HA     1 
ATOM   2226  H HB2    . TRP A 1 136 ? 169.403 13.725  130.449 1.00 79.27  ? 136 TRP A HB2    1 
ATOM   2227  H HB3    . TRP A 1 136 ? 170.696 14.396  131.083 1.00 79.27  ? 136 TRP A HB3    1 
ATOM   2228  H HD1    . TRP A 1 136 ? 167.231 15.236  130.330 1.00 76.36  ? 136 TRP A HD1    1 
ATOM   2229  H HE1    . TRP A 1 136 ? 166.607 17.396  131.200 1.00 74.58  ? 136 TRP A HE1    1 
ATOM   2230  H HE3    . TRP A 1 136 ? 171.646 16.825  131.759 1.00 75.47  ? 136 TRP A HE3    1 
ATOM   2231  H HZ2    . TRP A 1 136 ? 167.879 19.558  132.378 1.00 77.61  ? 136 TRP A HZ2    1 
ATOM   2232  H HZ3    . TRP A 1 136 ? 171.834 18.921  132.732 1.00 73.73  ? 136 TRP A HZ3    1 
ATOM   2233  H HH2    . TRP A 1 136 ? 169.976 20.263  133.035 1.00 75.18  ? 136 TRP A HH2    1 
ATOM   2234  N N      . LEU A 1 137 ? 172.910 15.360  129.204 1.00 62.80  ? 137 LEU A N      1 
ATOM   2235  C CA     . LEU A 1 137 ? 174.006 16.313  129.349 1.00 66.35  ? 137 LEU A CA     1 
ATOM   2236  C C      . LEU A 1 137 ? 174.773 16.575  128.062 1.00 69.96  ? 137 LEU A C      1 
ATOM   2237  O O      . LEU A 1 137 ? 175.451 17.601  127.941 1.00 68.69  ? 137 LEU A O      1 
ATOM   2238  C CB     . LEU A 1 137 ? 174.996 15.810  130.399 1.00 67.45  ? 137 LEU A CB     1 
ATOM   2239  C CG     . LEU A 1 137 ? 174.619 16.031  131.861 1.00 67.03  ? 137 LEU A CG     1 
ATOM   2240  C CD1    . LEU A 1 137 ? 175.656 15.363  132.756 1.00 63.18  ? 137 LEU A CD1    1 
ATOM   2241  C CD2    . LEU A 1 137 ? 174.488 17.524  132.189 1.00 66.79  ? 137 LEU A CD2    1 
ATOM   2242  H H      . LEU A 1 137 ? 173.158 14.537  129.236 1.00 75.36  ? 137 LEU A H      1 
ATOM   2243  H HA     . LEU A 1 137 ? 173.647 17.159  129.659 1.00 79.62  ? 137 LEU A HA     1 
ATOM   2244  H HB2    . LEU A 1 137 ? 175.110 14.855  130.274 1.00 80.94  ? 137 LEU A HB2    1 
ATOM   2245  H HB3    . LEU A 1 137 ? 175.845 16.255  130.252 1.00 80.94  ? 137 LEU A HB3    1 
ATOM   2246  H HG     . LEU A 1 137 ? 173.761 15.611  132.033 1.00 80.44  ? 137 LEU A HG     1 
ATOM   2247  H HD11   . LEU A 1 137 ? 175.411 15.507  133.684 1.00 75.81  ? 137 LEU A HD11   1 
ATOM   2248  H HD12   . LEU A 1 137 ? 175.675 14.413  132.562 1.00 75.81  ? 137 LEU A HD12   1 
ATOM   2249  H HD13   . LEU A 1 137 ? 176.525 15.755  132.578 1.00 75.81  ? 137 LEU A HD13   1 
ATOM   2250  H HD21   . LEU A 1 137 ? 174.248 17.621  133.124 1.00 80.14  ? 137 LEU A HD21   1 
ATOM   2251  H HD22   . LEU A 1 137 ? 175.337 17.960  132.018 1.00 80.14  ? 137 LEU A HD22   1 
ATOM   2252  H HD23   . LEU A 1 137 ? 173.798 17.910  131.628 1.00 80.14  ? 137 LEU A HD23   1 
ATOM   2253  N N      . GLU A 1 138 ? 174.671 15.645  127.116 1.00 74.98  ? 138 GLU A N      1 
ATOM   2254  C CA     . GLU A 1 138 ? 175.487 15.659  125.903 1.00 81.53  ? 138 GLU A CA     1 
ATOM   2255  C C      . GLU A 1 138 ? 175.447 17.001  125.173 1.00 77.17  ? 138 GLU A C      1 
ATOM   2256  O O      . GLU A 1 138 ? 176.485 17.517  124.762 1.00 77.97  ? 138 GLU A O      1 
ATOM   2257  C CB     . GLU A 1 138 ? 175.036 14.540  124.961 1.00 94.09  ? 138 GLU A CB     1 
ATOM   2258  C CG     . GLU A 1 138 ? 175.993 14.272  123.811 1.00 106.30 ? 138 GLU A CG     1 
ATOM   2259  C CD     . GLU A 1 138 ? 175.559 13.099  122.952 1.00 114.78 ? 138 GLU A CD     1 
ATOM   2260  O OE1    . GLU A 1 138 ? 174.450 12.568  123.185 1.00 118.06 ? 138 GLU A OE1    1 
ATOM   2261  O OE2    . GLU A 1 138 ? 176.328 12.708  122.048 1.00 116.76 ? 138 GLU A OE2    1 
ATOM   2262  H H      . GLU A 1 138 ? 174.125 14.981  127.155 1.00 89.98  ? 138 GLU A H      1 
ATOM   2263  H HA     . GLU A 1 138 ? 176.409 15.485  126.148 1.00 97.84  ? 138 GLU A HA     1 
ATOM   2264  H HB2    . GLU A 1 138 ? 174.951 13.719  125.471 1.00 112.90 ? 138 GLU A HB2    1 
ATOM   2265  H HB3    . GLU A 1 138 ? 174.177 14.780  124.581 1.00 112.90 ? 138 GLU A HB3    1 
ATOM   2266  H HG2    . GLU A 1 138 ? 176.035 15.059  123.246 1.00 127.56 ? 138 GLU A HG2    1 
ATOM   2267  H HG3    . GLU A 1 138 ? 176.871 14.073  124.170 1.00 127.56 ? 138 GLU A HG3    1 
ATOM   2268  N N      . GLY A 1 139 ? 174.251 17.567  125.036 1.00 72.41  ? 139 GLY A N      1 
ATOM   2269  C CA     . GLY A 1 139 ? 174.074 18.818  124.326 1.00 73.03  ? 139 GLY A CA     1 
ATOM   2270  C C      . GLY A 1 139 ? 174.132 20.051  125.208 1.00 76.89  ? 139 GLY A C      1 
ATOM   2271  O O      . GLY A 1 139 ? 174.533 21.130  124.758 1.00 77.34  ? 139 GLY A O      1 
ATOM   2272  H H      . GLY A 1 139 ? 173.521 17.239  125.351 1.00 86.89  ? 139 GLY A H      1 
ATOM   2273  H HA2    . GLY A 1 139 ? 174.765 18.899  123.650 1.00 87.63  ? 139 GLY A HA2    1 
ATOM   2274  H HA3    . GLY A 1 139 ? 173.213 18.809  123.878 1.00 87.63  ? 139 GLY A HA3    1 
ATOM   2275  N N      . ARG A 1 140 ? 173.729 19.907  126.467 1.00 77.97  ? 140 ARG A N      1 
ATOM   2276  C CA     . ARG A 1 140 ? 173.668 21.056  127.367 1.00 75.59  ? 140 ARG A CA     1 
ATOM   2277  C C      . ARG A 1 140 ? 175.051 21.450  127.895 1.00 69.93  ? 140 ARG A C      1 
ATOM   2278  O O      . ARG A 1 140 ? 175.320 22.624  128.150 1.00 68.92  ? 140 ARG A O      1 
ATOM   2279  C CB     . ARG A 1 140 ? 172.714 20.767  128.526 1.00 76.49  ? 140 ARG A CB     1 
ATOM   2280  C CG     . ARG A 1 140 ? 171.304 20.419  128.077 1.00 76.46  ? 140 ARG A CG     1 
ATOM   2281  C CD     . ARG A 1 140 ? 170.460 19.864  129.216 1.00 72.18  ? 140 ARG A CD     1 
ATOM   2282  N NE     . ARG A 1 140 ? 169.259 19.195  128.715 1.00 67.47  ? 140 ARG A NE     1 
ATOM   2283  C CZ     . ARG A 1 140 ? 168.059 19.761  128.635 1.00 67.08  ? 140 ARG A CZ     1 
ATOM   2284  N NH1    . ARG A 1 140 ? 167.877 21.016  129.042 1.00 68.34  ? 140 ARG A NH1    1 
ATOM   2285  N NH2    . ARG A 1 140 ? 167.032 19.071  128.153 1.00 66.85  ? 140 ARG A NH2    1 
ATOM   2286  H H      . ARG A 1 140 ? 173.487 19.162  126.822 1.00 93.56  ? 140 ARG A H      1 
ATOM   2287  H HA     . ARG A 1 140 ? 173.314 21.814  126.877 1.00 90.71  ? 140 ARG A HA     1 
ATOM   2288  H HB2    . ARG A 1 140 ? 173.058 20.016  129.035 1.00 91.78  ? 140 ARG A HB2    1 
ATOM   2289  H HB3    . ARG A 1 140 ? 172.661 21.553  129.092 1.00 91.78  ? 140 ARG A HB3    1 
ATOM   2290  H HG2    . ARG A 1 140 ? 170.870 21.220  127.742 1.00 91.75  ? 140 ARG A HG2    1 
ATOM   2291  H HG3    . ARG A 1 140 ? 171.349 19.747  127.379 1.00 91.75  ? 140 ARG A HG3    1 
ATOM   2292  H HD2    . ARG A 1 140 ? 170.983 19.217  129.716 1.00 86.62  ? 140 ARG A HD2    1 
ATOM   2293  H HD3    . ARG A 1 140 ? 170.184 20.591  129.795 1.00 86.62  ? 140 ARG A HD3    1 
ATOM   2294  H HE     . ARG A 1 140 ? 169.334 18.379  128.453 1.00 80.96  ? 140 ARG A HE     1 
ATOM   2295  H HH11   . ARG A 1 140 ? 168.540 21.468  129.352 1.00 82.01  ? 140 ARG A HH11   1 
ATOM   2296  H HH12   . ARG A 1 140 ? 167.098 21.376  128.990 1.00 82.01  ? 140 ARG A HH12   1 
ATOM   2297  H HH21   . ARG A 1 140 ? 167.144 18.259  127.893 1.00 80.22  ? 140 ARG A HH21   1 
ATOM   2298  H HH22   . ARG A 1 140 ? 166.254 19.434  128.107 1.00 80.22  ? 140 ARG A HH22   1 
ATOM   2299  N N      . ILE A 1 141 ? 175.936 20.476  128.048 1.00 67.42  ? 141 ILE A N      1 
ATOM   2300  C CA     . ILE A 1 141 ? 177.242 20.759  128.619 1.00 70.44  ? 141 ILE A CA     1 
ATOM   2301  C C      . ILE A 1 141 ? 178.199 21.351  127.578 1.00 77.57  ? 141 ILE A C      1 
ATOM   2302  O O      . ILE A 1 141 ? 179.226 21.933  127.933 1.00 78.23  ? 141 ILE A O      1 
ATOM   2303  C CB     . ILE A 1 141 ? 177.842 19.493  129.297 1.00 61.32  ? 141 ILE A CB     1 
ATOM   2304  C CG1    . ILE A 1 141 ? 178.786 19.895  130.437 1.00 59.87  ? 141 ILE A CG1    1 
ATOM   2305  C CG2    . ILE A 1 141 ? 178.525 18.569  128.281 1.00 59.31  ? 141 ILE A CG2    1 
ATOM   2306  C CD1    . ILE A 1 141 ? 178.060 20.441  131.656 1.00 57.04  ? 141 ILE A CD1    1 
ATOM   2307  H H      . ILE A 1 141 ? 175.808 19.653  127.833 1.00 80.91  ? 141 ILE A H      1 
ATOM   2308  H HA     . ILE A 1 141 ? 177.128 21.427  129.313 1.00 84.53  ? 141 ILE A HA     1 
ATOM   2309  H HB     . ILE A 1 141 ? 177.106 18.998  129.690 1.00 73.58  ? 141 ILE A HB     1 
ATOM   2310  H HG12   . ILE A 1 141 ? 179.291 19.115  130.715 1.00 71.84  ? 141 ILE A HG12   1 
ATOM   2311  H HG13   . ILE A 1 141 ? 179.390 20.583  130.117 1.00 71.84  ? 141 ILE A HG13   1 
ATOM   2312  H HG21   . ILE A 1 141 ? 178.882 17.797  128.747 1.00 71.17  ? 141 ILE A HG21   1 
ATOM   2313  H HG22   . ILE A 1 141 ? 177.871 18.285  127.624 1.00 71.17  ? 141 ILE A HG22   1 
ATOM   2314  H HG23   . ILE A 1 141 ? 179.243 19.055  127.846 1.00 71.17  ? 141 ILE A HG23   1 
ATOM   2315  H HD11   . ILE A 1 141 ? 178.714 20.674  132.334 1.00 68.45  ? 141 ILE A HD11   1 
ATOM   2316  H HD12   . ILE A 1 141 ? 177.557 21.229  131.397 1.00 68.45  ? 141 ILE A HD12   1 
ATOM   2317  H HD13   . ILE A 1 141 ? 177.459 19.760  131.996 1.00 68.45  ? 141 ILE A HD13   1 
ATOM   2318  N N      . LYS A 1 142 ? 177.849 21.214  126.300 1.00 84.20  ? 142 LYS A N      1 
ATOM   2319  C CA     . LYS A 1 142 ? 178.702 21.695  125.210 1.00 86.25  ? 142 LYS A CA     1 
ATOM   2320  C C      . LYS A 1 142 ? 178.997 23.182  125.325 1.00 78.34  ? 142 LYS A C      1 
ATOM   2321  O O      . LYS A 1 142 ? 178.089 24.011  125.283 1.00 72.96  ? 142 LYS A O      1 
ATOM   2322  C CB     . LYS A 1 142 ? 178.067 21.410  123.847 1.00 92.11  ? 142 LYS A CB     1 
ATOM   2323  C CG     . LYS A 1 142 ? 178.333 20.013  123.326 1.00 96.00  ? 142 LYS A CG     1 
ATOM   2324  C CD     . LYS A 1 142 ? 177.751 19.808  121.936 1.00 100.60 ? 142 LYS A CD     1 
ATOM   2325  C CE     . LYS A 1 142 ? 177.935 18.374  121.465 1.00 105.60 ? 142 LYS A CE     1 
ATOM   2326  N NZ     . LYS A 1 142 ? 179.371 17.979  121.450 1.00 109.97 ? 142 LYS A NZ     1 
ATOM   2327  H H      . LYS A 1 142 ? 177.119 20.844  126.036 1.00 101.04 ? 142 LYS A H      1 
ATOM   2328  H HA     . LYS A 1 142 ? 179.548 21.222  125.246 1.00 103.50 ? 142 LYS A HA     1 
ATOM   2329  H HB2    . LYS A 1 142 ? 177.106 21.520  123.921 1.00 110.54 ? 142 LYS A HB2    1 
ATOM   2330  H HB3    . LYS A 1 142 ? 178.420 22.040  123.200 1.00 110.54 ? 142 LYS A HB3    1 
ATOM   2331  H HG2    . LYS A 1 142 ? 179.291 19.868  123.278 1.00 115.21 ? 142 LYS A HG2    1 
ATOM   2332  H HG3    . LYS A 1 142 ? 177.926 19.366  123.924 1.00 115.21 ? 142 LYS A HG3    1 
ATOM   2333  H HD2    . LYS A 1 142 ? 176.800 20.003  121.955 1.00 120.72 ? 142 LYS A HD2    1 
ATOM   2334  H HD3    . LYS A 1 142 ? 178.202 20.395  121.309 1.00 120.72 ? 142 LYS A HD3    1 
ATOM   2335  H HE2    . LYS A 1 142 ? 177.462 17.777  122.065 1.00 126.72 ? 142 LYS A HE2    1 
ATOM   2336  H HE3    . LYS A 1 142 ? 177.587 18.287  120.563 1.00 126.72 ? 142 LYS A HE3    1 
ATOM   2337  H HZ1    . LYS A 1 142 ? 179.452 17.137  121.171 1.00 131.96 ? 142 LYS A HZ1    1 
ATOM   2338  H HZ2    . LYS A 1 142 ? 179.827 18.511  120.901 1.00 131.96 ? 142 LYS A HZ2    1 
ATOM   2339  H HZ3    . LYS A 1 142 ? 179.713 18.046  122.269 1.00 131.96 ? 142 LYS A HZ3    1 
ATOM   2340  N N      . GLY A 1 143 ? 180.279 23.500  125.469 1.00 77.82  ? 143 GLY A N      1 
ATOM   2341  C CA     . GLY A 1 143 ? 180.727 24.873  125.585 1.00 78.82  ? 143 GLY A CA     1 
ATOM   2342  C C      . GLY A 1 143 ? 181.021 25.262  127.019 1.00 78.31  ? 143 GLY A C      1 
ATOM   2343  O O      . GLY A 1 143 ? 181.382 26.408  127.287 1.00 80.14  ? 143 GLY A O      1 
ATOM   2344  H H      . GLY A 1 143 ? 180.917 22.923  125.502 1.00 93.39  ? 143 GLY A H      1 
ATOM   2345  H HA2    . GLY A 1 143 ? 181.534 24.995  125.061 1.00 94.58  ? 143 GLY A HA2    1 
ATOM   2346  H HA3    . GLY A 1 143 ? 180.043 25.467  125.239 1.00 94.58  ? 143 GLY A HA3    1 
ATOM   2347  N N      . LYS A 1 144 ? 180.864 24.313  127.940 1.00 73.80  ? 144 LYS A N      1 
ATOM   2348  C CA     . LYS A 1 144 ? 181.062 24.583  129.362 1.00 68.40  ? 144 LYS A CA     1 
ATOM   2349  C C      . LYS A 1 144 ? 181.995 23.565  130.020 1.00 66.72  ? 144 LYS A C      1 
ATOM   2350  O O      . LYS A 1 144 ? 182.169 23.568  131.237 1.00 63.45  ? 144 LYS A O      1 
ATOM   2351  C CB     . LYS A 1 144 ? 179.707 24.612  130.076 1.00 67.47  ? 144 LYS A CB     1 
ATOM   2352  C CG     . LYS A 1 144 ? 178.759 25.674  129.540 1.00 70.62  ? 144 LYS A CG     1 
ATOM   2353  C CD     . LYS A 1 144 ? 177.428 25.652  130.267 1.00 75.43  ? 144 LYS A CD     1 
ATOM   2354  C CE     . LYS A 1 144 ? 176.520 26.781  129.796 1.00 81.13  ? 144 LYS A CE     1 
ATOM   2355  N NZ     . LYS A 1 144 ? 177.117 28.138  130.017 1.00 83.19  ? 144 LYS A NZ     1 
ATOM   2356  H H      . LYS A 1 144 ? 180.641 23.501  127.766 1.00 88.56  ? 144 LYS A H      1 
ATOM   2357  H HA     . LYS A 1 144 ? 181.465 25.460  129.459 1.00 82.07  ? 144 LYS A HA     1 
ATOM   2358  H HB2    . LYS A 1 144 ? 179.278 23.749  129.968 1.00 80.97  ? 144 LYS A HB2    1 
ATOM   2359  H HB3    . LYS A 1 144 ? 179.854 24.792  131.018 1.00 80.97  ? 144 LYS A HB3    1 
ATOM   2360  H HG2    . LYS A 1 144 ? 179.158 26.550  129.663 1.00 84.75  ? 144 LYS A HG2    1 
ATOM   2361  H HG3    . LYS A 1 144 ? 178.594 25.510  128.599 1.00 84.75  ? 144 LYS A HG3    1 
ATOM   2362  H HD2    . LYS A 1 144 ? 176.981 24.809  130.092 1.00 90.52  ? 144 LYS A HD2    1 
ATOM   2363  H HD3    . LYS A 1 144 ? 177.581 25.761  131.219 1.00 90.52  ? 144 LYS A HD3    1 
ATOM   2364  H HE2    . LYS A 1 144 ? 176.354 26.678  128.846 1.00 97.36  ? 144 LYS A HE2    1 
ATOM   2365  H HE3    . LYS A 1 144 ? 175.683 26.738  130.285 1.00 97.36  ? 144 LYS A HE3    1 
ATOM   2366  H HZ1    . LYS A 1 144 ? 176.557 28.767  129.730 1.00 99.83  ? 144 LYS A HZ1    1 
ATOM   2367  H HZ2    . LYS A 1 144 ? 177.273 28.264  130.884 1.00 99.83  ? 144 LYS A HZ2    1 
ATOM   2368  H HZ3    . LYS A 1 144 ? 177.884 28.209  129.572 1.00 99.83  ? 144 LYS A HZ3    1 
ATOM   2369  N N      . GLU A 1 145 ? 182.608 22.719  129.198 1.00 60.70  ? 145 GLU A N      1 
ATOM   2370  C CA     . GLU A 1 145 ? 183.514 21.669  129.654 1.00 65.89  ? 145 GLU A CA     1 
ATOM   2371  C C      . GLU A 1 145 ? 184.553 22.178  130.640 1.00 69.24  ? 145 GLU A C      1 
ATOM   2372  O O      . GLU A 1 145 ? 184.806 21.545  131.657 1.00 68.23  ? 145 GLU A O      1 
ATOM   2373  C CB     . GLU A 1 145 ? 184.230 21.033  128.462 1.00 75.32  ? 145 GLU A CB     1 
ATOM   2374  C CG     . GLU A 1 145 ? 183.316 20.262  127.502 1.00 81.52  ? 145 GLU A CG     1 
ATOM   2375  C CD     . GLU A 1 145 ? 182.647 21.136  126.447 1.00 82.10  ? 145 GLU A CD     1 
ATOM   2376  O OE1    . GLU A 1 145 ? 182.862 22.370  126.438 1.00 77.12  ? 145 GLU A OE1    1 
ATOM   2377  O OE2    . GLU A 1 145 ? 181.898 20.573  125.622 1.00 85.49  ? 145 GLU A OE2    1 
ATOM   2378  H H      . GLU A 1 145 ? 182.512 22.734  128.343 1.00 72.83  ? 145 GLU A H      1 
ATOM   2379  H HA     . GLU A 1 145 ? 182.996 20.978  130.096 1.00 79.06  ? 145 GLU A HA     1 
ATOM   2380  H HB2    . GLU A 1 145 ? 184.666 21.734  127.953 1.00 90.39  ? 145 GLU A HB2    1 
ATOM   2381  H HB3    . GLU A 1 145 ? 184.895 20.412  128.797 1.00 90.39  ? 145 GLU A HB3    1 
ATOM   2382  H HG2    . GLU A 1 145 ? 183.844 19.592  127.039 1.00 97.82  ? 145 GLU A HG2    1 
ATOM   2383  H HG3    . GLU A 1 145 ? 182.616 19.830  128.016 1.00 97.82  ? 145 GLU A HG3    1 
ATOM   2384  N N      . ASN A 1 146 ? 185.150 23.326  130.352 1.00 77.29  ? 146 ASN A N      1 
ATOM   2385  C CA     . ASN A 1 146 ? 186.164 23.880  131.246 1.00 83.66  ? 146 ASN A CA     1 
ATOM   2386  C C      . ASN A 1 146 ? 185.594 24.361  132.584 1.00 77.13  ? 146 ASN A C      1 
ATOM   2387  O O      . ASN A 1 146 ? 186.278 24.331  133.606 1.00 71.53  ? 146 ASN A O      1 
ATOM   2388  C CB     . ASN A 1 146 ? 186.918 25.018  130.559 1.00 92.70  ? 146 ASN A CB     1 
ATOM   2389  C CG     . ASN A 1 146 ? 187.873 24.522  129.492 1.00 96.05  ? 146 ASN A CG     1 
ATOM   2390  O OD1    . ASN A 1 146 ? 187.944 23.325  129.211 1.00 92.28  ? 146 ASN A OD1    1 
ATOM   2391  N ND2    . ASN A 1 146 ? 188.610 25.445  128.890 1.00 100.89 ? 146 ASN A ND2    1 
ATOM   2392  H H      . ASN A 1 146 ? 184.990 23.802  129.654 1.00 92.74  ? 146 ASN A H      1 
ATOM   2393  H HA     . ASN A 1 146 ? 186.809 23.183  131.442 1.00 100.39 ? 146 ASN A HA     1 
ATOM   2394  H HB2    . ASN A 1 146 ? 186.278 25.613  130.137 1.00 111.24 ? 146 ASN A HB2    1 
ATOM   2395  H HB3    . ASN A 1 146 ? 187.434 25.503  131.223 1.00 111.24 ? 146 ASN A HB3    1 
ATOM   2396  H HD21   . ASN A 1 146 ? 189.168 25.217  128.277 1.00 121.06 ? 146 ASN A HD21   1 
ATOM   2397  H HD22   . ASN A 1 146 ? 188.531 26.272  129.113 1.00 121.06 ? 146 ASN A HD22   1 
ATOM   2398  N N      . GLU A 1 147 ? 184.345 24.808  132.578 1.00 75.45  ? 147 GLU A N      1 
ATOM   2399  C CA     . GLU A 1 147 ? 183.694 25.220  133.808 1.00 72.69  ? 147 GLU A CA     1 
ATOM   2400  C C      . GLU A 1 147 ? 183.496 24.000  134.705 1.00 70.96  ? 147 GLU A C      1 
ATOM   2401  O O      . GLU A 1 147 ? 183.672 24.073  135.923 1.00 70.02  ? 147 GLU A O      1 
ATOM   2402  C CB     . GLU A 1 147 ? 182.358 25.891  133.496 1.00 71.13  ? 147 GLU A CB     1 
ATOM   2403  C CG     . GLU A 1 147 ? 182.491 27.138  132.645 1.00 72.13  ? 147 GLU A CG     1 
ATOM   2404  C CD     . GLU A 1 147 ? 183.240 28.255  133.346 1.00 79.05  ? 147 GLU A CD     1 
ATOM   2405  O OE1    . GLU A 1 147 ? 183.221 28.304  134.594 1.00 78.70  ? 147 GLU A OE1    1 
ATOM   2406  O OE2    . GLU A 1 147 ? 183.848 29.095  132.648 1.00 87.09  ? 147 GLU A OE2    1 
ATOM   2407  H H      . GLU A 1 147 ? 183.855 24.881  131.875 1.00 90.53  ? 147 GLU A H      1 
ATOM   2408  H HA     . GLU A 1 147 ? 184.257 25.858  134.274 1.00 87.22  ? 147 GLU A HA     1 
ATOM   2409  H HB2    . GLU A 1 147 ? 181.795 25.263  133.017 1.00 85.36  ? 147 GLU A HB2    1 
ATOM   2410  H HB3    . GLU A 1 147 ? 181.932 26.145  134.330 1.00 85.36  ? 147 GLU A HB3    1 
ATOM   2411  H HG2    . GLU A 1 147 ? 182.974 26.916  131.834 1.00 86.55  ? 147 GLU A HG2    1 
ATOM   2412  H HG3    . GLU A 1 147 ? 181.605 27.465  132.423 1.00 86.55  ? 147 GLU A HG3    1 
ATOM   2413  N N      . VAL A 1 148 ? 183.137 22.877  134.091 1.00 70.02  ? 148 VAL A N      1 
ATOM   2414  C CA     . VAL A 1 148 ? 183.019 21.610  134.805 1.00 64.69  ? 148 VAL A CA     1 
ATOM   2415  C C      . VAL A 1 148 ? 184.364 21.195  135.375 1.00 62.00  ? 148 VAL A C      1 
ATOM   2416  O O      . VAL A 1 148 ? 184.457 20.764  136.518 1.00 60.80  ? 148 VAL A O      1 
ATOM   2417  C CB     . VAL A 1 148 ? 182.526 20.481  133.880 1.00 60.34  ? 148 VAL A CB     1 
ATOM   2418  C CG1    . VAL A 1 148 ? 182.437 19.140  134.650 1.00 56.53  ? 148 VAL A CG1    1 
ATOM   2419  C CG2    . VAL A 1 148 ? 181.185 20.859  133.261 1.00 57.66  ? 148 VAL A CG2    1 
ATOM   2420  H H      . VAL A 1 148 ? 182.955 22.822  133.252 1.00 84.03  ? 148 VAL A H      1 
ATOM   2421  H HA     . VAL A 1 148 ? 182.390 21.707  135.537 1.00 77.63  ? 148 VAL A HA     1 
ATOM   2422  H HB     . VAL A 1 148 ? 183.164 20.367  133.158 1.00 72.40  ? 148 VAL A HB     1 
ATOM   2423  H HG11   . VAL A 1 148 ? 182.125 18.449  134.044 1.00 67.84  ? 148 VAL A HG11   1 
ATOM   2424  H HG12   . VAL A 1 148 ? 183.317 18.911  134.987 1.00 67.84  ? 148 VAL A HG12   1 
ATOM   2425  H HG13   . VAL A 1 148 ? 181.815 19.240  135.387 1.00 67.84  ? 148 VAL A HG13   1 
ATOM   2426  H HG21   . VAL A 1 148 ? 180.890 20.139  132.683 1.00 69.19  ? 148 VAL A HG21   1 
ATOM   2427  H HG22   . VAL A 1 148 ? 180.539 21.001  133.970 1.00 69.19  ? 148 VAL A HG22   1 
ATOM   2428  H HG23   . VAL A 1 148 ? 181.295 21.674  132.745 1.00 69.19  ? 148 VAL A HG23   1 
ATOM   2429  N N      . ARG A 1 149 ? 185.406 21.312  134.567 1.00 62.79  ? 149 ARG A N      1 
ATOM   2430  C CA     . ARG A 1 149 ? 186.735 20.914  134.999 1.00 63.68  ? 149 ARG A CA     1 
ATOM   2431  C C      . ARG A 1 149 ? 187.228 21.779  136.163 1.00 59.17  ? 149 ARG A C      1 
ATOM   2432  O O      . ARG A 1 149 ? 187.884 21.277  137.088 1.00 55.10  ? 149 ARG A O      1 
ATOM   2433  C CB     . ARG A 1 149 ? 187.710 20.977  133.825 1.00 69.87  ? 149 ARG A CB     1 
ATOM   2434  C CG     . ARG A 1 149 ? 187.453 19.957  132.742 1.00 75.68  ? 149 ARG A CG     1 
ATOM   2435  C CD     . ARG A 1 149 ? 188.673 19.817  131.869 1.00 82.68  ? 149 ARG A CD     1 
ATOM   2436  N NE     . ARG A 1 149 ? 188.575 18.660  130.987 1.00 88.24  ? 149 ARG A NE     1 
ATOM   2437  C CZ     . ARG A 1 149 ? 188.265 18.710  129.696 1.00 91.65  ? 149 ARG A CZ     1 
ATOM   2438  N NH1    . ARG A 1 149 ? 188.017 19.868  129.095 1.00 90.63  ? 149 ARG A NH1    1 
ATOM   2439  N NH2    . ARG A 1 149 ? 188.211 17.586  128.999 1.00 95.70  ? 149 ARG A NH2    1 
ATOM   2440  H H      . ARG A 1 149 ? 185.370 21.617  133.763 1.00 75.35  ? 149 ARG A H      1 
ATOM   2441  H HA     . ARG A 1 149 ? 186.701 19.995  135.307 1.00 76.42  ? 149 ARG A HA     1 
ATOM   2442  H HB2    . ARG A 1 149 ? 187.652 21.857  133.421 1.00 83.84  ? 149 ARG A HB2    1 
ATOM   2443  H HB3    . ARG A 1 149 ? 188.608 20.831  134.160 1.00 83.84  ? 149 ARG A HB3    1 
ATOM   2444  H HG2    . ARG A 1 149 ? 187.261 19.096  133.145 1.00 90.81  ? 149 ARG A HG2    1 
ATOM   2445  H HG3    . ARG A 1 149 ? 186.710 20.248  132.190 1.00 90.81  ? 149 ARG A HG3    1 
ATOM   2446  H HD2    . ARG A 1 149 ? 188.766 20.611  131.320 1.00 99.22  ? 149 ARG A HD2    1 
ATOM   2447  H HD3    . ARG A 1 149 ? 189.456 19.705  132.431 1.00 99.22  ? 149 ARG A HD3    1 
ATOM   2448  H HE     . ARG A 1 149 ? 188.729 17.886  131.328 1.00 105.89 ? 149 ARG A HE     1 
ATOM   2449  H HH11   . ARG A 1 149 ? 188.053 20.601  129.543 1.00 108.76 ? 149 ARG A HH11   1 
ATOM   2450  H HH12   . ARG A 1 149 ? 187.819 19.884  128.259 1.00 108.76 ? 149 ARG A HH12   1 
ATOM   2451  H HH21   . ARG A 1 149 ? 188.371 16.834  129.384 1.00 114.84 ? 149 ARG A HH21   1 
ATOM   2452  H HH22   . ARG A 1 149 ? 188.011 17.608  128.163 1.00 114.84 ? 149 ARG A HH22   1 
ATOM   2453  N N      . LEU A 1 150 ? 186.903 23.071  136.119 1.00 58.44  ? 150 LEU A N      1 
ATOM   2454  C CA     . LEU A 1 150 ? 187.278 23.993  137.183 1.00 59.73  ? 150 LEU A CA     1 
ATOM   2455  C C      . LEU A 1 150 ? 186.605 23.609  138.494 1.00 63.25  ? 150 LEU A C      1 
ATOM   2456  O O      . LEU A 1 150 ? 187.245 23.585  139.556 1.00 64.74  ? 150 LEU A O      1 
ATOM   2457  C CB     . LEU A 1 150 ? 186.901 25.427  136.815 1.00 61.31  ? 150 LEU A CB     1 
ATOM   2458  C CG     . LEU A 1 150 ? 187.841 26.184  135.867 1.00 64.50  ? 150 LEU A CG     1 
ATOM   2459  C CD1    . LEU A 1 150 ? 187.249 27.537  135.506 1.00 60.75  ? 150 LEU A CD1    1 
ATOM   2460  C CD2    . LEU A 1 150 ? 189.239 26.362  136.470 1.00 67.77  ? 150 LEU A CD2    1 
ATOM   2461  H H      . LEU A 1 150 ? 186.462 23.437  135.478 1.00 70.13  ? 150 LEU A H      1 
ATOM   2462  H HA     . LEU A 1 150 ? 188.239 23.957  137.314 1.00 71.68  ? 150 LEU A HA     1 
ATOM   2463  H HB2    . LEU A 1 150 ? 186.028 25.409  136.393 1.00 73.57  ? 150 LEU A HB2    1 
ATOM   2464  H HB3    . LEU A 1 150 ? 186.848 25.944  137.634 1.00 73.57  ? 150 LEU A HB3    1 
ATOM   2465  H HG     . LEU A 1 150 ? 187.935 25.674  135.047 1.00 77.40  ? 150 LEU A HG     1 
ATOM   2466  H HD11   . LEU A 1 150 ? 187.857 27.998  134.908 1.00 72.90  ? 150 LEU A HD11   1 
ATOM   2467  H HD12   . LEU A 1 150 ? 186.394 27.400  135.069 1.00 72.90  ? 150 LEU A HD12   1 
ATOM   2468  H HD13   . LEU A 1 150 ? 187.126 28.054  136.318 1.00 72.90  ? 150 LEU A HD13   1 
ATOM   2469  H HD21   . LEU A 1 150 ? 189.796 26.843  135.839 1.00 81.32  ? 150 LEU A HD21   1 
ATOM   2470  H HD22   . LEU A 1 150 ? 189.165 26.864  137.296 1.00 81.32  ? 150 LEU A HD22   1 
ATOM   2471  H HD23   . LEU A 1 150 ? 189.620 25.487  136.648 1.00 81.32  ? 150 LEU A HD23   1 
ATOM   2472  N N      . LEU A 1 151 ? 185.314 23.300  138.423 1.00 61.88  ? 151 LEU A N      1 
ATOM   2473  C CA     . LEU A 1 151 ? 184.577 22.923  139.621 1.00 59.62  ? 151 LEU A CA     1 
ATOM   2474  C C      . LEU A 1 151 ? 185.183 21.655  140.226 1.00 63.00  ? 151 LEU A C      1 
ATOM   2475  O O      . LEU A 1 151 ? 185.406 21.577  141.439 1.00 62.95  ? 151 LEU A O      1 
ATOM   2476  C CB     . LEU A 1 151 ? 183.090 22.726  139.303 1.00 55.25  ? 151 LEU A CB     1 
ATOM   2477  C CG     . LEU A 1 151 ? 182.166 22.372  140.472 1.00 52.88  ? 151 LEU A CG     1 
ATOM   2478  C CD1    . LEU A 1 151 ? 182.215 23.441  141.549 1.00 47.73  ? 151 LEU A CD1    1 
ATOM   2479  C CD2    . LEU A 1 151 ? 180.733 22.182  139.981 1.00 57.23  ? 151 LEU A CD2    1 
ATOM   2480  H H      . LEU A 1 151 ? 184.847 23.301  137.701 1.00 74.25  ? 151 LEU A H      1 
ATOM   2481  H HA     . LEU A 1 151 ? 184.652 23.634  140.276 1.00 71.54  ? 151 LEU A HA     1 
ATOM   2482  H HB2    . LEU A 1 151 ? 182.755 23.549  138.913 1.00 66.30  ? 151 LEU A HB2    1 
ATOM   2483  H HB3    . LEU A 1 151 ? 183.014 22.011  138.652 1.00 66.30  ? 151 LEU A HB3    1 
ATOM   2484  H HG     . LEU A 1 151 ? 182.461 21.536  140.866 1.00 63.46  ? 151 LEU A HG     1 
ATOM   2485  H HD11   . LEU A 1 151 ? 181.621 23.188  142.273 1.00 57.27  ? 151 LEU A HD11   1 
ATOM   2486  H HD12   . LEU A 1 151 ? 183.124 23.516  141.878 1.00 57.27  ? 151 LEU A HD12   1 
ATOM   2487  H HD13   . LEU A 1 151 ? 181.930 24.286  141.168 1.00 57.27  ? 151 LEU A HD13   1 
ATOM   2488  H HD21   . LEU A 1 151 ? 180.167 21.959  140.736 1.00 68.68  ? 151 LEU A HD21   1 
ATOM   2489  H HD22   . LEU A 1 151 ? 180.428 23.007  139.571 1.00 68.68  ? 151 LEU A HD22   1 
ATOM   2490  H HD23   . LEU A 1 151 ? 180.716 21.463  139.330 1.00 68.68  ? 151 LEU A HD23   1 
ATOM   2491  N N      . LYS A 1 152 ? 185.470 20.680  139.369 1.00 65.40  ? 152 LYS A N      1 
ATOM   2492  C CA     . LYS A 1 152 ? 185.997 19.392  139.805 1.00 66.65  ? 152 LYS A CA     1 
ATOM   2493  C C      . LYS A 1 152 ? 187.342 19.547  140.502 1.00 68.40  ? 152 LYS A C      1 
ATOM   2494  O O      . LYS A 1 152 ? 187.556 19.004  141.581 1.00 66.37  ? 152 LYS A O      1 
ATOM   2495  C CB     . LYS A 1 152 ? 186.141 18.447  138.608 1.00 67.76  ? 152 LYS A CB     1 
ATOM   2496  C CG     . LYS A 1 152 ? 184.827 17.875  138.111 1.00 67.19  ? 152 LYS A CG     1 
ATOM   2497  C CD     . LYS A 1 152 ? 185.043 16.940  136.940 1.00 69.04  ? 152 LYS A CD     1 
ATOM   2498  C CE     . LYS A 1 152 ? 183.753 16.219  136.584 1.00 69.85  ? 152 LYS A CE     1 
ATOM   2499  N NZ     . LYS A 1 152 ? 183.915 15.265  135.452 1.00 70.78  ? 152 LYS A NZ     1 
ATOM   2500  H H      . LYS A 1 152 ? 185.366 20.741  138.517 1.00 78.48  ? 152 LYS A H      1 
ATOM   2501  H HA     . LYS A 1 152 ? 185.376 18.991  140.433 1.00 79.99  ? 152 LYS A HA     1 
ATOM   2502  H HB2    . LYS A 1 152 ? 186.548 18.934  137.875 1.00 81.32  ? 152 LYS A HB2    1 
ATOM   2503  H HB3    . LYS A 1 152 ? 186.709 17.704  138.864 1.00 81.32  ? 152 LYS A HB3    1 
ATOM   2504  H HG2    . LYS A 1 152 ? 184.404 17.375  138.827 1.00 80.63  ? 152 LYS A HG2    1 
ATOM   2505  H HG3    . LYS A 1 152 ? 184.252 18.600  137.820 1.00 80.63  ? 152 LYS A HG3    1 
ATOM   2506  H HD2    . LYS A 1 152 ? 185.331 17.450  136.168 1.00 82.85  ? 152 LYS A HD2    1 
ATOM   2507  H HD3    . LYS A 1 152 ? 185.710 16.276  137.175 1.00 82.85  ? 152 LYS A HD3    1 
ATOM   2508  H HE2    . LYS A 1 152 ? 183.449 15.718  137.356 1.00 83.83  ? 152 LYS A HE2    1 
ATOM   2509  H HE3    . LYS A 1 152 ? 183.085 16.875  136.330 1.00 83.83  ? 152 LYS A HE3    1 
ATOM   2510  H HZ1    . LYS A 1 152 ? 183.139 14.866  135.277 1.00 84.94  ? 152 LYS A HZ1    1 
ATOM   2511  H HZ2    . LYS A 1 152 ? 184.187 15.700  134.724 1.00 84.94  ? 152 LYS A HZ2    1 
ATOM   2512  H HZ3    . LYS A 1 152 ? 184.518 14.645  135.661 1.00 84.94  ? 152 LYS A HZ3    1 
ATOM   2513  N N      . GLY A 1 153 ? 188.251 20.285  139.876 1.00 72.59  ? 153 GLY A N      1 
ATOM   2514  C CA     . GLY A 1 153 ? 189.570 20.494  140.441 1.00 72.08  ? 153 GLY A CA     1 
ATOM   2515  C C      . GLY A 1 153 ? 189.491 21.227  141.762 1.00 69.66  ? 153 GLY A C      1 
ATOM   2516  O O      . GLY A 1 153 ? 190.269 20.968  142.676 1.00 71.43  ? 153 GLY A O      1 
ATOM   2517  H H      . GLY A 1 153 ? 188.125 20.675  139.120 1.00 87.11  ? 153 GLY A H      1 
ATOM   2518  H HA2    . GLY A 1 153 ? 190.003 19.638  140.586 1.00 86.49  ? 153 GLY A HA2    1 
ATOM   2519  H HA3    . GLY A 1 153 ? 190.110 21.016  139.827 1.00 86.49  ? 153 GLY A HA3    1 
ATOM   2520  N N      . PHE A 1 154 ? 188.542 22.152  141.853 1.00 66.71  ? 154 PHE A N      1 
ATOM   2521  C CA     . PHE A 1 154 ? 188.329 22.933  143.063 1.00 60.82  ? 154 PHE A CA     1 
ATOM   2522  C C      . PHE A 1 154 ? 187.907 22.007  144.203 1.00 60.72  ? 154 PHE A C      1 
ATOM   2523  O O      . PHE A 1 154 ? 188.417 22.103  145.324 1.00 61.77  ? 154 PHE A O      1 
ATOM   2524  C CB     . PHE A 1 154 ? 187.259 23.992  142.794 1.00 56.79  ? 154 PHE A CB     1 
ATOM   2525  C CG     . PHE A 1 154 ? 186.990 24.903  143.955 1.00 57.25  ? 154 PHE A CG     1 
ATOM   2526  C CD1    . PHE A 1 154 ? 187.879 25.921  144.282 1.00 59.91  ? 154 PHE A CD1    1 
ATOM   2527  C CD2    . PHE A 1 154 ? 185.833 24.761  144.708 1.00 53.66  ? 154 PHE A CD2    1 
ATOM   2528  C CE1    . PHE A 1 154 ? 187.624 26.769  145.351 1.00 58.00  ? 154 PHE A CE1    1 
ATOM   2529  C CE2    . PHE A 1 154 ? 185.573 25.605  145.772 1.00 52.15  ? 154 PHE A CE2    1 
ATOM   2530  C CZ     . PHE A 1 154 ? 186.468 26.610  146.097 1.00 53.57  ? 154 PHE A CZ     1 
ATOM   2531  H H      . PHE A 1 154 ? 188.000 22.348  141.215 1.00 80.06  ? 154 PHE A H      1 
ATOM   2532  H HA     . PHE A 1 154 ? 189.152 23.380  143.314 1.00 72.98  ? 154 PHE A HA     1 
ATOM   2533  H HB2    . PHE A 1 154 ? 187.546 24.542  142.048 1.00 68.15  ? 154 PHE A HB2    1 
ATOM   2534  H HB3    . PHE A 1 154 ? 186.427 23.545  142.571 1.00 68.15  ? 154 PHE A HB3    1 
ATOM   2535  H HD1    . PHE A 1 154 ? 188.657 26.030  143.784 1.00 71.90  ? 154 PHE A HD1    1 
ATOM   2536  H HD2    . PHE A 1 154 ? 185.227 24.087  144.497 1.00 64.39  ? 154 PHE A HD2    1 
ATOM   2537  H HE1    . PHE A 1 154 ? 188.227 27.444  145.565 1.00 69.60  ? 154 PHE A HE1    1 
ATOM   2538  H HE2    . PHE A 1 154 ? 184.797 25.496  146.273 1.00 62.58  ? 154 PHE A HE2    1 
ATOM   2539  H HZ     . PHE A 1 154 ? 186.293 27.176  146.813 1.00 64.28  ? 154 PHE A HZ     1 
ATOM   2540  N N      . LEU A 1 155 ? 186.991 21.095  143.898 1.00 56.98  ? 155 LEU A N      1 
ATOM   2541  C CA     . LEU A 1 155 ? 186.491 20.147  144.878 1.00 55.33  ? 155 LEU A CA     1 
ATOM   2542  C C      . LEU A 1 155 ? 187.547 19.100  145.172 1.00 56.72  ? 155 LEU A C      1 
ATOM   2543  O O      . LEU A 1 155 ? 187.695 18.647  146.314 1.00 55.88  ? 155 LEU A O      1 
ATOM   2544  C CB     . LEU A 1 155 ? 185.240 19.456  144.342 1.00 56.38  ? 155 LEU A CB     1 
ATOM   2545  C CG     . LEU A 1 155 ? 183.979 20.309  144.241 1.00 56.80  ? 155 LEU A CG     1 
ATOM   2546  C CD1    . LEU A 1 155 ? 182.987 19.665  143.278 1.00 57.84  ? 155 LEU A CD1    1 
ATOM   2547  C CD2    . LEU A 1 155 ? 183.357 20.517  145.622 1.00 53.05  ? 155 LEU A CD2    1 
ATOM   2548  H H      . LEU A 1 155 ? 186.640 21.006  143.118 1.00 68.38  ? 155 LEU A H      1 
ATOM   2549  H HA     . LEU A 1 155 ? 186.268 20.609  145.701 1.00 66.39  ? 155 LEU A HA     1 
ATOM   2550  H HB2    . LEU A 1 155 ? 185.435 19.125  143.451 1.00 67.65  ? 155 LEU A HB2    1 
ATOM   2551  H HB3    . LEU A 1 155 ? 185.035 18.708  144.924 1.00 67.65  ? 155 LEU A HB3    1 
ATOM   2552  H HG     . LEU A 1 155 ? 184.217 21.180  143.887 1.00 68.17  ? 155 LEU A HG     1 
ATOM   2553  H HD11   . LEU A 1 155 ? 182.193 20.220  143.227 1.00 69.40  ? 155 LEU A HD11   1 
ATOM   2554  H HD12   . LEU A 1 155 ? 183.398 19.593  142.403 1.00 69.40  ? 155 LEU A HD12   1 
ATOM   2555  H HD13   . LEU A 1 155 ? 182.754 18.784  143.609 1.00 69.40  ? 155 LEU A HD13   1 
ATOM   2556  H HD21   . LEU A 1 155 ? 182.559 21.060  145.530 1.00 63.66  ? 155 LEU A HD21   1 
ATOM   2557  H HD22   . LEU A 1 155 ? 183.127 19.652  145.998 1.00 63.66  ? 155 LEU A HD22   1 
ATOM   2558  H HD23   . LEU A 1 155 ? 183.999 20.966  146.193 1.00 63.66  ? 155 LEU A HD23   1 
ATOM   2559  N N      . LYS A 1 156 ? 188.266 18.708  144.125 1.00 59.49  ? 156 LYS A N      1 
ATOM   2560  C CA     . LYS A 1 156 ? 189.303 17.688  144.232 1.00 63.39  ? 156 LYS A CA     1 
ATOM   2561  C C      . LYS A 1 156 ? 190.404 18.165  145.167 1.00 56.50  ? 156 LYS A C      1 
ATOM   2562  O O      . LYS A 1 156 ? 190.865 17.423  146.032 1.00 56.24  ? 156 LYS A O      1 
ATOM   2563  C CB     . LYS A 1 156 ? 189.881 17.369  142.850 1.00 73.06  ? 156 LYS A CB     1 
ATOM   2564  C CG     . LYS A 1 156 ? 190.938 16.271  142.836 1.00 81.55  ? 156 LYS A CG     1 
ATOM   2565  C CD     . LYS A 1 156 ? 190.327 14.902  143.047 1.00 88.72  ? 156 LYS A CD     1 
ATOM   2566  C CE     . LYS A 1 156 ? 191.330 13.805  142.727 1.00 97.62  ? 156 LYS A CE     1 
ATOM   2567  N NZ     . LYS A 1 156 ? 190.717 12.451  142.798 1.00 103.36 ? 156 LYS A NZ     1 
ATOM   2568  H H      . LYS A 1 156 ? 188.171 19.023  143.330 1.00 71.39  ? 156 LYS A H      1 
ATOM   2569  H HA     . LYS A 1 156 ? 188.919 16.876  144.599 1.00 76.07  ? 156 LYS A HA     1 
ATOM   2570  H HB2    . LYS A 1 156 ? 189.157 17.086  142.270 1.00 87.67  ? 156 LYS A HB2    1 
ATOM   2571  H HB3    . LYS A 1 156 ? 190.289 18.173  142.492 1.00 87.67  ? 156 LYS A HB3    1 
ATOM   2572  H HG2    . LYS A 1 156 ? 191.389 16.273  141.977 1.00 97.86  ? 156 LYS A HG2    1 
ATOM   2573  H HG3    . LYS A 1 156 ? 191.575 16.432  143.549 1.00 97.86  ? 156 LYS A HG3    1 
ATOM   2574  H HD2    . LYS A 1 156 ? 190.058 14.809  143.974 1.00 106.46 ? 156 LYS A HD2    1 
ATOM   2575  H HD3    . LYS A 1 156 ? 189.562 14.797  142.460 1.00 106.46 ? 156 LYS A HD3    1 
ATOM   2576  H HE2    . LYS A 1 156 ? 191.670 13.936  141.828 1.00 117.15 ? 156 LYS A HE2    1 
ATOM   2577  H HE3    . LYS A 1 156 ? 192.057 13.841  143.368 1.00 117.15 ? 156 LYS A HE3    1 
ATOM   2578  H HZ1    . LYS A 1 156 ? 191.326 11.831  142.607 1.00 124.04 ? 156 LYS A HZ1    1 
ATOM   2579  H HZ2    . LYS A 1 156 ? 190.401 12.303  143.617 1.00 124.04 ? 156 LYS A HZ2    1 
ATOM   2580  H HZ3    . LYS A 1 156 ? 190.048 12.389  142.214 1.00 124.04 ? 156 LYS A HZ3    1 
ATOM   2581  N N      . ALA A 1 157 ? 190.804 19.419  145.002 1.00 52.79  ? 157 ALA A N      1 
ATOM   2582  C CA     . ALA A 1 157 ? 191.892 19.981  145.788 1.00 56.89  ? 157 ALA A CA     1 
ATOM   2583  C C      . ALA A 1 157 ? 191.510 20.212  147.257 1.00 60.09  ? 157 ALA A C      1 
ATOM   2584  O O      . ALA A 1 157 ? 192.354 20.594  148.068 1.00 65.13  ? 157 ALA A O      1 
ATOM   2585  C CB     . ALA A 1 157 ? 192.374 21.281  145.148 1.00 58.25  ? 157 ALA A CB     1 
ATOM   2586  H H      . ALA A 1 157 ? 190.459 19.969  144.437 1.00 63.35  ? 157 ALA A H      1 
ATOM   2587  H HA     . ALA A 1 157 ? 192.634 19.357  145.775 1.00 68.27  ? 157 ALA A HA     1 
ATOM   2588  H HB1    . ALA A 1 157 ? 193.098 21.645  145.681 1.00 69.90  ? 157 ALA A HB1    1 
ATOM   2589  H HB2    . ALA A 1 157 ? 192.686 21.093  144.249 1.00 69.90  ? 157 ALA A HB2    1 
ATOM   2590  H HB3    . ALA A 1 157 ? 191.636 21.910  145.118 1.00 69.90  ? 157 ALA A HB3    1 
ATOM   2591  N N      . ASN A 1 158 ? 190.246 19.976  147.597 1.00 56.99  ? 158 ASN A N      1 
ATOM   2592  C CA     . ASN A 1 158 ? 189.775 20.156  148.968 1.00 53.83  ? 158 ASN A CA     1 
ATOM   2593  C C      . ASN A 1 158 ? 189.112 18.894  149.503 1.00 54.91  ? 158 ASN A C      1 
ATOM   2594  O O      . ASN A 1 158 ? 188.328 18.940  150.454 1.00 50.59  ? 158 ASN A O      1 
ATOM   2595  C CB     . ASN A 1 158 ? 188.832 21.355  149.047 1.00 52.27  ? 158 ASN A CB     1 
ATOM   2596  C CG     . ASN A 1 158 ? 189.534 22.664  148.707 1.00 53.93  ? 158 ASN A CG     1 
ATOM   2597  O OD1    . ASN A 1 158 ? 190.065 23.340  149.590 1.00 53.36  ? 158 ASN A OD1    1 
ATOM   2598  N ND2    . ASN A 1 158 ? 189.544 23.023  147.423 1.00 54.42  ? 158 ASN A ND2    1 
ATOM   2599  H H      . ASN A 1 158 ? 189.638 19.710  147.050 1.00 68.39  ? 158 ASN A H      1 
ATOM   2600  H HA     . ASN A 1 158 ? 190.539 20.347  149.534 1.00 64.60  ? 158 ASN A HA     1 
ATOM   2601  H HB2    . ASN A 1 158 ? 188.105 21.230  148.417 1.00 62.73  ? 158 ASN A HB2    1 
ATOM   2602  H HB3    . ASN A 1 158 ? 188.483 21.425  149.949 1.00 62.73  ? 158 ASN A HB3    1 
ATOM   2603  H HD21   . ASN A 1 158 ? 189.929 23.754  147.183 1.00 65.30  ? 158 ASN A HD21   1 
ATOM   2604  H HD22   . ASN A 1 158 ? 189.166 22.523  146.834 1.00 65.30  ? 158 ASN A HD22   1 
ATOM   2605  N N      . GLY A 1 159 ? 189.440 17.769  148.867 1.00 57.97  ? 159 GLY A N      1 
ATOM   2606  C CA     . GLY A 1 159 ? 189.073 16.451  149.352 1.00 53.98  ? 159 GLY A CA     1 
ATOM   2607  C C      . GLY A 1 159 ? 187.585 16.206  149.419 1.00 53.55  ? 159 GLY A C      1 
ATOM   2608  O O      . GLY A 1 159 ? 187.122 15.437  150.256 1.00 56.89  ? 159 GLY A O      1 
ATOM   2609  H H      . GLY A 1 159 ? 189.887 17.749  148.132 1.00 69.57  ? 159 GLY A H      1 
ATOM   2610  H HA2    . GLY A 1 159 ? 189.462 15.779  148.770 1.00 64.77  ? 159 GLY A HA2    1 
ATOM   2611  H HA3    . GLY A 1 159 ? 189.438 16.328  150.242 1.00 64.77  ? 159 GLY A HA3    1 
ATOM   2612  N N      . ILE A 1 160 ? 186.832 16.851  148.533 1.00 54.44  ? 160 ILE A N      1 
ATOM   2613  C CA     . ILE A 1 160 ? 185.387 16.667  148.499 1.00 54.72  ? 160 ILE A CA     1 
ATOM   2614  C C      . ILE A 1 160 ? 184.864 16.358  147.094 1.00 54.85  ? 160 ILE A C      1 
ATOM   2615  O O      . ILE A 1 160 ? 183.692 16.577  146.801 1.00 57.94  ? 160 ILE A O      1 
ATOM   2616  C CB     . ILE A 1 160 ? 184.649 17.872  149.120 1.00 54.31  ? 160 ILE A CB     1 
ATOM   2617  C CG1    . ILE A 1 160 ? 185.184 19.190  148.556 1.00 56.61  ? 160 ILE A CG1    1 
ATOM   2618  C CG2    . ILE A 1 160 ? 184.819 17.849  150.626 1.00 52.28  ? 160 ILE A CG2    1 
ATOM   2619  C CD1    . ILE A 1 160 ? 184.384 20.416  148.983 1.00 55.55  ? 160 ILE A CD1    1 
ATOM   2620  H H      . ILE A 1 160 ? 187.134 17.400  147.944 1.00 65.33  ? 160 ILE A H      1 
ATOM   2621  H HA     . ILE A 1 160 ? 185.176 15.897  149.050 1.00 65.67  ? 160 ILE A HA     1 
ATOM   2622  H HB     . ILE A 1 160 ? 183.705 17.803  148.910 1.00 65.17  ? 160 ILE A HB     1 
ATOM   2623  H HG12   . ILE A 1 160 ? 186.097 19.312  148.860 1.00 67.93  ? 160 ILE A HG12   1 
ATOM   2624  H HG13   . ILE A 1 160 ? 185.164 19.146  147.587 1.00 67.93  ? 160 ILE A HG13   1 
ATOM   2625  H HG21   . ILE A 1 160 ? 184.353 18.609  151.008 1.00 62.73  ? 160 ILE A HG21   1 
ATOM   2626  H HG22   . ILE A 1 160 ? 184.446 17.024  150.973 1.00 62.73  ? 160 ILE A HG22   1 
ATOM   2627  H HG23   . ILE A 1 160 ? 185.765 17.900  150.838 1.00 62.73  ? 160 ILE A HG23   1 
ATOM   2628  H HD11   . ILE A 1 160 ? 184.783 21.207  148.587 1.00 66.65  ? 160 ILE A HD11   1 
ATOM   2629  H HD12   . ILE A 1 160 ? 183.469 20.318  148.676 1.00 66.65  ? 160 ILE A HD12   1 
ATOM   2630  H HD13   . ILE A 1 160 ? 184.403 20.484  149.950 1.00 66.65  ? 160 ILE A HD13   1 
ATOM   2631  N N      . TYR A 1 161 ? 185.722 15.805  146.244 1.00 53.01  ? 161 TYR A N      1 
ATOM   2632  C CA     . TYR A 1 161 ? 185.285 15.359  144.927 1.00 55.84  ? 161 TYR A CA     1 
ATOM   2633  C C      . TYR A 1 161 ? 185.048 13.847  144.895 1.00 57.69  ? 161 TYR A C      1 
ATOM   2634  O O      . TYR A 1 161 ? 185.890 13.062  145.336 1.00 57.58  ? 161 TYR A O      1 
ATOM   2635  C CB     . TYR A 1 161 ? 186.297 15.750  143.858 1.00 60.26  ? 161 TYR A CB     1 
ATOM   2636  C CG     . TYR A 1 161 ? 185.942 15.200  142.502 1.00 69.93  ? 161 TYR A CG     1 
ATOM   2637  C CD1    . TYR A 1 161 ? 184.813 15.647  141.826 1.00 76.33  ? 161 TYR A CD1    1 
ATOM   2638  C CD2    . TYR A 1 161 ? 186.726 14.234  141.898 1.00 75.04  ? 161 TYR A CD2    1 
ATOM   2639  C CE1    . TYR A 1 161 ? 184.477 15.149  140.581 1.00 80.86  ? 161 TYR A CE1    1 
ATOM   2640  C CE2    . TYR A 1 161 ? 186.397 13.728  140.652 1.00 81.37  ? 161 TYR A CE2    1 
ATOM   2641  C CZ     . TYR A 1 161 ? 185.270 14.190  140.000 1.00 83.99  ? 161 TYR A CZ     1 
ATOM   2642  O OH     . TYR A 1 161 ? 184.931 13.692  138.764 1.00 87.74  ? 161 TYR A OH     1 
ATOM   2643  H H      . TYR A 1 161 ? 186.557 15.677  146.405 1.00 63.61  ? 161 TYR A H      1 
ATOM   2644  H HA     . TYR A 1 161 ? 184.446 15.795  144.713 1.00 67.00  ? 161 TYR A HA     1 
ATOM   2645  H HB2    . TYR A 1 161 ? 186.330 16.717  143.791 1.00 72.32  ? 161 TYR A HB2    1 
ATOM   2646  H HB3    . TYR A 1 161 ? 187.169 15.403  144.105 1.00 72.32  ? 161 TYR A HB3    1 
ATOM   2647  H HD1    . TYR A 1 161 ? 184.274 16.296  142.217 1.00 91.60  ? 161 TYR A HD1    1 
ATOM   2648  H HD2    . TYR A 1 161 ? 187.485 13.920  142.334 1.00 90.05  ? 161 TYR A HD2    1 
ATOM   2649  H HE1    . TYR A 1 161 ? 183.718 15.458  140.142 1.00 97.03  ? 161 TYR A HE1    1 
ATOM   2650  H HE2    . TYR A 1 161 ? 186.932 13.078  140.257 1.00 97.64  ? 161 TYR A HE2    1 
ATOM   2651  H HH     . TYR A 1 161 ? 185.493 13.117  138.522 1.00 105.28 ? 161 TYR A HH     1 
ATOM   2652  N N      . GLY A 1 162 ? 183.892 13.452  144.367 1.00 57.76  ? 162 GLY A N      1 
ATOM   2653  C CA     . GLY A 1 162 ? 183.533 12.051  144.271 1.00 59.81  ? 162 GLY A CA     1 
ATOM   2654  C C      . GLY A 1 162 ? 182.516 11.662  145.321 1.00 65.63  ? 162 GLY A C      1 
ATOM   2655  O O      . GLY A 1 162 ? 182.594 12.093  146.475 1.00 68.70  ? 162 GLY A O      1 
ATOM   2656  H H      . GLY A 1 162 ? 183.295 13.987  144.055 1.00 69.31  ? 162 GLY A H      1 
ATOM   2657  H HA2    . GLY A 1 162 ? 183.159 11.870  143.394 1.00 71.77  ? 162 GLY A HA2    1 
ATOM   2658  H HA3    . GLY A 1 162 ? 184.325 11.503  144.388 1.00 71.77  ? 162 GLY A HA3    1 
ATOM   2659  N N      . ALA A 1 163 ? 181.557 10.836  144.915 1.00 66.05  ? 163 ALA A N      1 
ATOM   2660  C CA     . ALA A 1 163 ? 180.515 10.368  145.818 1.00 61.36  ? 163 ALA A CA     1 
ATOM   2661  C C      . ALA A 1 163 ? 180.924 9.088   146.544 1.00 63.85  ? 163 ALA A C      1 
ATOM   2662  O O      . ALA A 1 163 ? 180.204 8.623   147.425 1.00 67.25  ? 163 ALA A O      1 
ATOM   2663  C CB     . ALA A 1 163 ? 179.225 10.146  145.055 1.00 54.32  ? 163 ALA A CB     1 
ATOM   2664  H H      . ALA A 1 163 ? 181.489 10.531  144.115 1.00 79.25  ? 163 ALA A H      1 
ATOM   2665  H HA     . ALA A 1 163 ? 180.350 11.050  146.488 1.00 73.63  ? 163 ALA A HA     1 
ATOM   2666  H HB1    . ALA A 1 163 ? 178.544 9.835   145.671 1.00 65.19  ? 163 ALA A HB1    1 
ATOM   2667  H HB2    . ALA A 1 163 ? 178.949 10.984  144.652 1.00 65.19  ? 163 ALA A HB2    1 
ATOM   2668  H HB3    . ALA A 1 163 ? 179.377 9.481   144.365 1.00 65.19  ? 163 ALA A HB3    1 
ATOM   2669  N N      . GLU A 1 164 ? 182.068 8.513   146.175 1.00 62.53  ? 164 GLU A N      1 
ATOM   2670  C CA     . GLU A 1 164 ? 182.538 7.282   146.822 1.00 60.65  ? 164 GLU A CA     1 
ATOM   2671  C C      . GLU A 1 164 ? 182.608 7.480   148.345 1.00 56.42  ? 164 GLU A C      1 
ATOM   2672  O O      . GLU A 1 164 ? 182.909 8.570   148.829 1.00 55.25  ? 164 GLU A O      1 
ATOM   2673  C CB     . GLU A 1 164 ? 183.891 6.808   146.247 1.00 60.58  ? 164 GLU A CB     1 
ATOM   2674  C CG     . GLU A 1 164 ? 185.049 7.803   146.336 1.00 65.28  ? 164 GLU A CG     1 
ATOM   2675  C CD     . GLU A 1 164 ? 185.091 8.789   145.180 1.00 75.89  ? 164 GLU A CD     1 
ATOM   2676  O OE1    . GLU A 1 164 ? 186.102 9.519   145.058 1.00 80.43  ? 164 GLU A OE1    1 
ATOM   2677  O OE2    . GLU A 1 164 ? 184.117 8.841   144.395 1.00 79.82  ? 164 GLU A OE2    1 
ATOM   2678  H H      . GLU A 1 164 ? 182.589 8.810   145.559 1.00 75.04  ? 164 GLU A H      1 
ATOM   2679  H HA     . GLU A 1 164 ? 181.890 6.581   146.651 1.00 72.78  ? 164 GLU A HA     1 
ATOM   2680  H HB2    . GLU A 1 164 ? 184.161 6.008   146.724 1.00 72.70  ? 164 GLU A HB2    1 
ATOM   2681  H HB3    . GLU A 1 164 ? 183.765 6.596   145.309 1.00 72.70  ? 164 GLU A HB3    1 
ATOM   2682  H HG2    . GLU A 1 164 ? 184.964 8.311   147.158 1.00 78.34  ? 164 GLU A HG2    1 
ATOM   2683  H HG3    . GLU A 1 164 ? 185.886 7.311   146.338 1.00 78.34  ? 164 GLU A HG3    1 
ATOM   2684  N N      . TYR A 1 165 ? 182.301 6.427   149.091 1.00 56.68  ? 165 TYR A N      1 
ATOM   2685  C CA     . TYR A 1 165 ? 182.180 6.530   150.540 1.00 59.24  ? 165 TYR A CA     1 
ATOM   2686  C C      . TYR A 1 165 ? 183.447 6.999   151.257 1.00 56.91  ? 165 TYR A C      1 
ATOM   2687  O O      . TYR A 1 165 ? 183.361 7.570   152.344 1.00 57.13  ? 165 TYR A O      1 
ATOM   2688  C CB     . TYR A 1 165 ? 181.709 5.198   151.118 1.00 68.78  ? 165 TYR A CB     1 
ATOM   2689  C CG     . TYR A 1 165 ? 180.210 5.019   151.082 1.00 82.25  ? 165 TYR A CG     1 
ATOM   2690  C CD1    . TYR A 1 165 ? 179.361 6.002   151.572 1.00 86.92  ? 165 TYR A CD1    1 
ATOM   2691  C CD2    . TYR A 1 165 ? 179.642 3.866   150.563 1.00 91.82  ? 165 TYR A CD2    1 
ATOM   2692  C CE1    . TYR A 1 165 ? 177.989 5.842   151.544 1.00 92.45  ? 165 TYR A CE1    1 
ATOM   2693  C CE2    . TYR A 1 165 ? 178.271 3.694   150.540 1.00 97.36  ? 165 TYR A CE2    1 
ATOM   2694  C CZ     . TYR A 1 165 ? 177.448 4.685   151.024 1.00 96.26  ? 165 TYR A CZ     1 
ATOM   2695  O OH     . TYR A 1 165 ? 176.082 4.511   150.995 1.00 95.98  ? 165 TYR A OH     1 
ATOM   2696  H H      . TYR A 1 165 ? 182.158 5.638   148.782 1.00 68.02  ? 165 TYR A H      1 
ATOM   2697  H HA     . TYR A 1 165 ? 181.490 7.182   150.735 1.00 71.09  ? 165 TYR A HA     1 
ATOM   2698  H HB2    . TYR A 1 165 ? 182.107 4.477   150.606 1.00 82.54  ? 165 TYR A HB2    1 
ATOM   2699  H HB3    . TYR A 1 165 ? 181.993 5.140   152.043 1.00 82.54  ? 165 TYR A HB3    1 
ATOM   2700  H HD1    . TYR A 1 165 ? 179.722 6.784   151.922 1.00 104.30 ? 165 TYR A HD1    1 
ATOM   2701  H HD2    . TYR A 1 165 ? 180.193 3.193   150.234 1.00 110.19 ? 165 TYR A HD2    1 
ATOM   2702  H HE1    . TYR A 1 165 ? 177.434 6.510   151.876 1.00 110.94 ? 165 TYR A HE1    1 
ATOM   2703  H HE2    . TYR A 1 165 ? 177.905 2.915   150.187 1.00 116.84 ? 165 TYR A HE2    1 
ATOM   2704  H HH     . TYR A 1 165 ? 175.895 3.766   150.654 1.00 115.18 ? 165 TYR A HH     1 
ATOM   2705  N N      . LYS A 1 166 ? 184.617 6.773   150.668 1.00 56.56  ? 166 LYS A N      1 
ATOM   2706  C CA     . LYS A 1 166 ? 185.839 7.293   151.268 1.00 59.75  ? 166 LYS A CA     1 
ATOM   2707  C C      . LYS A 1 166 ? 185.809 8.826   151.291 1.00 61.24  ? 166 LYS A C      1 
ATOM   2708  O O      . LYS A 1 166 ? 186.489 9.455   152.105 1.00 63.75  ? 166 LYS A O      1 
ATOM   2709  C CB     . LYS A 1 166 ? 187.072 6.807   150.510 1.00 62.56  ? 166 LYS A CB     1 
ATOM   2710  C CG     . LYS A 1 166 ? 188.388 7.324   151.082 1.00 62.78  ? 166 LYS A CG     1 
ATOM   2711  C CD     . LYS A 1 166 ? 189.578 6.721   150.358 1.00 66.74  ? 166 LYS A CD     1 
ATOM   2712  C CE     . LYS A 1 166 ? 190.898 7.251   150.907 1.00 68.33  ? 166 LYS A CE     1 
ATOM   2713  N NZ     . LYS A 1 166 ? 192.066 6.545   150.314 1.00 70.52  ? 166 LYS A NZ     1 
ATOM   2714  H H      . LYS A 1 166 ? 184.729 6.333   149.938 1.00 67.87  ? 166 LYS A H      1 
ATOM   2715  H HA     . LYS A 1 166 ? 185.903 6.978   152.183 1.00 71.70  ? 166 LYS A HA     1 
ATOM   2716  H HB2    . LYS A 1 166 ? 187.096 5.838   150.541 1.00 75.07  ? 166 LYS A HB2    1 
ATOM   2717  H HB3    . LYS A 1 166 ? 187.011 7.106   149.589 1.00 75.07  ? 166 LYS A HB3    1 
ATOM   2718  H HG2    . LYS A 1 166 ? 188.426 8.288   150.979 1.00 75.33  ? 166 LYS A HG2    1 
ATOM   2719  H HG3    . LYS A 1 166 ? 188.448 7.083   152.019 1.00 75.33  ? 166 LYS A HG3    1 
ATOM   2720  H HD2    . LYS A 1 166 ? 189.566 5.757   150.473 1.00 80.09  ? 166 LYS A HD2    1 
ATOM   2721  H HD3    . LYS A 1 166 ? 189.527 6.947   149.417 1.00 80.09  ? 166 LYS A HD3    1 
ATOM   2722  H HE2    . LYS A 1 166 ? 190.975 8.194   150.696 1.00 81.99  ? 166 LYS A HE2    1 
ATOM   2723  H HE3    . LYS A 1 166 ? 190.921 7.119   151.868 1.00 81.99  ? 166 LYS A HE3    1 
ATOM   2724  H HZ1    . LYS A 1 166 ? 192.822 6.873   150.651 1.00 84.62  ? 166 LYS A HZ1    1 
ATOM   2725  H HZ2    . LYS A 1 166 ? 192.021 5.676   150.498 1.00 84.62  ? 166 LYS A HZ2    1 
ATOM   2726  H HZ3    . LYS A 1 166 ? 192.072 6.654   149.431 1.00 84.62  ? 166 LYS A HZ3    1 
ATOM   2727  N N      . VAL A 1 167 ? 185.016 9.416   150.400 1.00 58.10  ? 167 VAL A N      1 
ATOM   2728  C CA     . VAL A 1 167 ? 184.954 10.868  150.271 1.00 53.92  ? 167 VAL A CA     1 
ATOM   2729  C C      . VAL A 1 167 ? 183.619 11.452  150.717 1.00 49.92  ? 167 VAL A C      1 
ATOM   2730  O O      . VAL A 1 167 ? 183.598 12.450  151.425 1.00 51.33  ? 167 VAL A O      1 
ATOM   2731  C CB     . VAL A 1 167 ? 185.213 11.319  148.822 1.00 52.49  ? 167 VAL A CB     1 
ATOM   2732  C CG1    . VAL A 1 167 ? 185.271 12.851  148.738 1.00 51.68  ? 167 VAL A CG1    1 
ATOM   2733  C CG2    . VAL A 1 167 ? 186.507 10.722  148.312 1.00 50.46  ? 167 VAL A CG2    1 
ATOM   2734  H H      . VAL A 1 167 ? 184.501 8.995   149.855 1.00 69.72  ? 167 VAL A H      1 
ATOM   2735  H HA     . VAL A 1 167 ? 185.645 11.257  150.829 1.00 64.70  ? 167 VAL A HA     1 
ATOM   2736  H HB     . VAL A 1 167 ? 184.489 11.009  148.255 1.00 62.98  ? 167 VAL A HB     1 
ATOM   2737  H HG11   . VAL A 1 167 ? 185.435 13.110  147.818 1.00 62.01  ? 167 VAL A HG11   1 
ATOM   2738  H HG12   . VAL A 1 167 ? 184.424 13.215  149.039 1.00 62.01  ? 167 VAL A HG12   1 
ATOM   2739  H HG13   . VAL A 1 167 ? 185.989 13.171  149.305 1.00 62.01  ? 167 VAL A HG13   1 
ATOM   2740  H HG21   . VAL A 1 167 ? 186.652 11.017  147.400 1.00 60.55  ? 167 VAL A HG21   1 
ATOM   2741  H HG22   . VAL A 1 167 ? 187.236 11.020  148.877 1.00 60.55  ? 167 VAL A HG22   1 
ATOM   2742  H HG23   . VAL A 1 167 ? 186.440 9.754   148.341 1.00 60.55  ? 167 VAL A HG23   1 
ATOM   2743  N N      . ARG A 1 168 ? 182.518 10.845  150.289 1.00 46.99  ? 168 ARG A N      1 
ATOM   2744  C CA     . ARG A 1 168 ? 181.184 11.397  150.533 1.00 45.22  ? 168 ARG A CA     1 
ATOM   2745  C C      . ARG A 1 168 ? 181.092 12.879  150.114 1.00 45.48  ? 168 ARG A C      1 
ATOM   2746  O O      . ARG A 1 168 ? 180.700 13.737  150.912 1.00 44.78  ? 168 ARG A O      1 
ATOM   2747  C CB     . ARG A 1 168 ? 180.796 11.243  152.005 1.00 41.39  ? 168 ARG A CB     1 
ATOM   2748  C CG     . ARG A 1 168 ? 180.579 9.817   152.477 1.00 43.78  ? 168 ARG A CG     1 
ATOM   2749  C CD     . ARG A 1 168 ? 180.168 9.815   153.947 1.00 50.79  ? 168 ARG A CD     1 
ATOM   2750  N NE     . ARG A 1 168 ? 179.976 8.467   154.474 1.00 60.80  ? 168 ARG A NE     1 
ATOM   2751  C CZ     . ARG A 1 168 ? 178.839 7.778   154.395 1.00 64.18  ? 168 ARG A CZ     1 
ATOM   2752  N NH1    . ARG A 1 168 ? 177.772 8.310   153.808 1.00 65.69  ? 168 ARG A NH1    1 
ATOM   2753  N NH2    . ARG A 1 168 ? 178.767 6.552   154.905 1.00 61.08  ? 168 ARG A NH2    1 
ATOM   2754  H H      . ARG A 1 168 ? 182.513 10.105  149.850 1.00 56.39  ? 168 ARG A H      1 
ATOM   2755  H HA     . ARG A 1 168 ? 180.541 10.901  150.004 1.00 54.26  ? 168 ARG A HA     1 
ATOM   2756  H HB2    . ARG A 1 168 ? 181.500 11.626  152.550 1.00 49.66  ? 168 ARG A HB2    1 
ATOM   2757  H HB3    . ARG A 1 168 ? 179.969 11.728  152.156 1.00 49.66  ? 168 ARG A HB3    1 
ATOM   2758  H HG2    . ARG A 1 168 ? 179.870 9.406   151.957 1.00 52.54  ? 168 ARG A HG2    1 
ATOM   2759  H HG3    . ARG A 1 168 ? 181.404 9.315   152.386 1.00 52.54  ? 168 ARG A HG3    1 
ATOM   2760  H HD2    . ARG A 1 168 ? 180.862 10.247  154.470 1.00 60.95  ? 168 ARG A HD2    1 
ATOM   2761  H HD3    . ARG A 1 168 ? 179.332 10.297  154.043 1.00 60.95  ? 168 ARG A HD3    1 
ATOM   2762  H HE     . ARG A 1 168 ? 180.645 8.091   154.863 1.00 72.97  ? 168 ARG A HE     1 
ATOM   2763  H HH11   . ARG A 1 168 ? 177.814 9.102   153.476 1.00 78.82  ? 168 ARG A HH11   1 
ATOM   2764  H HH12   . ARG A 1 168 ? 177.039 7.862   153.760 1.00 78.82  ? 168 ARG A HH12   1 
ATOM   2765  H HH21   . ARG A 1 168 ? 179.455 6.204   155.287 1.00 73.30  ? 168 ARG A HH21   1 
ATOM   2766  H HH22   . ARG A 1 168 ? 178.032 6.108   154.855 1.00 73.30  ? 168 ARG A HH22   1 
ATOM   2767  N N      . GLY A 1 169 ? 181.449 13.154  148.857 1.00 44.42  ? 169 GLY A N      1 
ATOM   2768  C CA     . GLY A 1 169 ? 181.489 14.501  148.311 1.00 40.84  ? 169 GLY A CA     1 
ATOM   2769  C C      . GLY A 1 169 ? 180.636 14.593  147.062 1.00 45.20  ? 169 GLY A C      1 
ATOM   2770  O O      . GLY A 1 169 ? 179.664 13.855  146.928 1.00 45.52  ? 169 GLY A O      1 
ATOM   2771  H H      . GLY A 1 169 ? 181.678 12.552  148.287 1.00 53.31  ? 169 GLY A H      1 
ATOM   2772  H HA2    . GLY A 1 169 ? 181.154 15.132  148.966 1.00 49.01  ? 169 GLY A HA2    1 
ATOM   2773  H HA3    . GLY A 1 169 ? 182.402 14.738  148.085 1.00 49.01  ? 169 GLY A HA3    1 
ATOM   2774  N N      . PHE A 1 170 ? 181.011 15.491  146.147 1.00 50.32  ? 170 PHE A N      1 
ATOM   2775  C CA     . PHE A 1 170 ? 180.255 15.760  144.913 1.00 51.36  ? 170 PHE A CA     1 
ATOM   2776  C C      . PHE A 1 170 ? 180.647 14.824  143.775 1.00 55.62  ? 170 PHE A C      1 
ATOM   2777  O O      . PHE A 1 170 ? 181.811 14.795  143.360 1.00 57.12  ? 170 PHE A O      1 
ATOM   2778  C CB     . PHE A 1 170 ? 180.548 17.175  144.418 1.00 54.45  ? 170 PHE A CB     1 
ATOM   2779  C CG     . PHE A 1 170 ? 180.097 18.265  145.342 1.00 56.88  ? 170 PHE A CG     1 
ATOM   2780  C CD1    . PHE A 1 170 ? 180.731 18.473  146.551 1.00 57.07  ? 170 PHE A CD1    1 
ATOM   2781  C CD2    . PHE A 1 170 ? 179.063 19.113  144.977 1.00 57.64  ? 170 PHE A CD2    1 
ATOM   2782  C CE1    . PHE A 1 170 ? 180.323 19.485  147.392 1.00 57.70  ? 170 PHE A CE1    1 
ATOM   2783  C CE2    . PHE A 1 170 ? 178.653 20.129  145.816 1.00 55.92  ? 170 PHE A CE2    1 
ATOM   2784  C CZ     . PHE A 1 170 ? 179.284 20.316  147.023 1.00 55.79  ? 170 PHE A CZ     1 
ATOM   2785  H H      . PHE A 1 170 ? 181.720 15.973  146.219 1.00 60.38  ? 170 PHE A H      1 
ATOM   2786  H HA     . PHE A 1 170 ? 179.303 15.674  145.081 1.00 61.63  ? 170 PHE A HA     1 
ATOM   2787  H HB2    . PHE A 1 170 ? 181.506 17.269  144.298 1.00 65.34  ? 170 PHE A HB2    1 
ATOM   2788  H HB3    . PHE A 1 170 ? 180.098 17.305  143.568 1.00 65.34  ? 170 PHE A HB3    1 
ATOM   2789  H HD1    . PHE A 1 170 ? 181.430 17.916  146.806 1.00 68.48  ? 170 PHE A HD1    1 
ATOM   2790  H HD2    . PHE A 1 170 ? 178.633 18.989  144.162 1.00 69.17  ? 170 PHE A HD2    1 
ATOM   2791  H HE1    . PHE A 1 170 ? 180.751 19.611  148.208 1.00 69.24  ? 170 PHE A HE1    1 
ATOM   2792  H HE2    . PHE A 1 170 ? 177.952 20.687  145.565 1.00 67.11  ? 170 PHE A HE2    1 
ATOM   2793  H HZ     . PHE A 1 170 ? 179.010 21.000  147.591 1.00 66.95  ? 170 PHE A HZ     1 
ATOM   2794  N N      . SER A 1 171 ? 179.678 14.078  143.250 1.00 57.79  ? 171 SER A N      1 
ATOM   2795  C CA     . SER A 1 171 ? 179.920 13.222  142.091 1.00 57.66  ? 171 SER A CA     1 
ATOM   2796  C C      . SER A 1 171 ? 180.124 14.068  140.845 1.00 59.61  ? 171 SER A C      1 
ATOM   2797  O O      . SER A 1 171 ? 179.680 15.218  140.777 1.00 57.81  ? 171 SER A O      1 
ATOM   2798  C CB     . SER A 1 171 ? 178.755 12.253  141.866 1.00 55.61  ? 171 SER A CB     1 
ATOM   2799  O OG     . SER A 1 171 ? 177.584 12.926  141.440 1.00 52.63  ? 171 SER A OG     1 
ATOM   2800  H H      . SER A 1 171 ? 178.871 14.051  143.546 1.00 69.35  ? 171 SER A H      1 
ATOM   2801  H HA     . SER A 1 171 ? 180.724 12.701  142.240 1.00 69.19  ? 171 SER A HA     1 
ATOM   2802  H HB2    . SER A 1 171 ? 179.011 11.610  141.185 1.00 66.73  ? 171 SER A HB2    1 
ATOM   2803  H HB3    . SER A 1 171 ? 178.566 11.792  142.698 1.00 66.73  ? 171 SER A HB3    1 
ATOM   2804  H HG     . SER A 1 171 ? 176.962 12.374  141.324 1.00 63.15  ? 171 SER A HG     1 
ATOM   2805  N N      . GLY A 1 172 ? 180.803 13.493  139.859 1.00 60.93  ? 172 GLY A N      1 
ATOM   2806  C CA     . GLY A 1 172 ? 181.075 14.196  138.625 1.00 60.08  ? 172 GLY A CA     1 
ATOM   2807  C C      . GLY A 1 172 ? 179.789 14.676  137.987 1.00 57.80  ? 172 GLY A C      1 
ATOM   2808  O O      . GLY A 1 172 ? 179.703 15.815  137.521 1.00 58.16  ? 172 GLY A O      1 
ATOM   2809  H H      . GLY A 1 172 ? 181.117 12.693  139.886 1.00 73.12  ? 172 GLY A H      1 
ATOM   2810  H HA2    . GLY A 1 172 ? 181.642 14.963  138.801 1.00 72.10  ? 172 GLY A HA2    1 
ATOM   2811  H HA3    . GLY A 1 172 ? 181.530 13.606  138.004 1.00 72.10  ? 172 GLY A HA3    1 
ATOM   2812  N N      . TYR A 1 173 ? 178.788 13.802  137.977 1.00 56.06  ? 173 TYR A N      1 
ATOM   2813  C CA     . TYR A 1 173 ? 177.500 14.113  137.374 1.00 56.91  ? 173 TYR A CA     1 
ATOM   2814  C C      . TYR A 1 173 ? 176.908 15.337  138.056 1.00 60.58  ? 173 TYR A C      1 
ATOM   2815  O O      . TYR A 1 173 ? 176.399 16.240  137.389 1.00 62.61  ? 173 TYR A O      1 
ATOM   2816  C CB     . TYR A 1 173 ? 176.556 12.916  137.500 1.00 54.70  ? 173 TYR A CB     1 
ATOM   2817  C CG     . TYR A 1 173 ? 175.175 13.128  136.922 1.00 54.95  ? 173 TYR A CG     1 
ATOM   2818  C CD1    . TYR A 1 173 ? 175.006 13.612  135.634 1.00 54.54  ? 173 TYR A CD1    1 
ATOM   2819  C CD2    . TYR A 1 173 ? 174.036 12.824  137.662 1.00 59.16  ? 173 TYR A CD2    1 
ATOM   2820  C CE1    . TYR A 1 173 ? 173.744 13.801  135.100 1.00 58.23  ? 173 TYR A CE1    1 
ATOM   2821  C CE2    . TYR A 1 173 ? 172.768 13.008  137.138 1.00 63.00  ? 173 TYR A CE2    1 
ATOM   2822  C CZ     . TYR A 1 173 ? 172.631 13.496  135.858 1.00 66.15  ? 173 TYR A CZ     1 
ATOM   2823  O OH     . TYR A 1 173 ? 171.376 13.681  135.334 1.00 74.98  ? 173 TYR A OH     1 
ATOM   2824  H H      . TYR A 1 173 ? 178.832 13.013  138.317 1.00 67.27  ? 173 TYR A H      1 
ATOM   2825  H HA     . TYR A 1 173 ? 177.622 14.313  136.433 1.00 68.29  ? 173 TYR A HA     1 
ATOM   2826  H HB2    . TYR A 1 173 ? 176.953 12.160  137.040 1.00 65.63  ? 173 TYR A HB2    1 
ATOM   2827  H HB3    . TYR A 1 173 ? 176.450 12.705  138.441 1.00 65.63  ? 173 TYR A HB3    1 
ATOM   2828  H HD1    . TYR A 1 173 ? 175.754 13.819  135.122 1.00 65.45  ? 173 TYR A HD1    1 
ATOM   2829  H HD2    . TYR A 1 173 ? 174.129 12.495  138.527 1.00 71.00  ? 173 TYR A HD2    1 
ATOM   2830  H HE1    . TYR A 1 173 ? 173.646 14.130  134.236 1.00 69.87  ? 173 TYR A HE1    1 
ATOM   2831  H HE2    . TYR A 1 173 ? 172.016 12.804  137.645 1.00 75.60  ? 173 TYR A HE2    1 
ATOM   2832  H HH     . TYR A 1 173 ? 170.794 13.457  135.897 1.00 89.97  ? 173 TYR A HH     1 
ATOM   2833  N N      . LEU A 1 174 ? 176.994 15.368  139.385 1.00 59.79  ? 174 LEU A N      1 
ATOM   2834  C CA     . LEU A 1 174 ? 176.469 16.493  140.154 1.00 57.74  ? 174 LEU A CA     1 
ATOM   2835  C C      . LEU A 1 174 ? 177.139 17.793  139.726 1.00 56.47  ? 174 LEU A C      1 
ATOM   2836  O O      . LEU A 1 174 ? 176.476 18.819  139.582 1.00 55.78  ? 174 LEU A O      1 
ATOM   2837  C CB     . LEU A 1 174 ? 176.657 16.273  141.659 1.00 53.60  ? 174 LEU A CB     1 
ATOM   2838  C CG     . LEU A 1 174 ? 176.284 17.464  142.551 1.00 52.69  ? 174 LEU A CG     1 
ATOM   2839  C CD1    . LEU A 1 174 ? 174.840 17.922  142.309 1.00 51.50  ? 174 LEU A CD1    1 
ATOM   2840  C CD2    . LEU A 1 174 ? 176.489 17.118  144.018 1.00 52.04  ? 174 LEU A CD2    1 
ATOM   2841  H H      . LEU A 1 174 ? 177.352 14.751  139.865 1.00 71.74  ? 174 LEU A H      1 
ATOM   2842  H HA     . LEU A 1 174 ? 175.518 16.576  139.981 1.00 69.29  ? 174 LEU A HA     1 
ATOM   2843  H HB2    . LEU A 1 174 ? 176.107 15.522  141.931 1.00 64.32  ? 174 LEU A HB2    1 
ATOM   2844  H HB3    . LEU A 1 174 ? 177.591 16.068  141.825 1.00 64.32  ? 174 LEU A HB3    1 
ATOM   2845  H HG     . LEU A 1 174 ? 176.869 18.207  142.339 1.00 63.23  ? 174 LEU A HG     1 
ATOM   2846  H HD11   . LEU A 1 174 ? 174.646 18.673  142.891 1.00 61.79  ? 174 LEU A HD11   1 
ATOM   2847  H HD12   . LEU A 1 174 ? 174.745 18.188  141.381 1.00 61.79  ? 174 LEU A HD12   1 
ATOM   2848  H HD13   . LEU A 1 174 ? 174.238 17.187  142.506 1.00 61.79  ? 174 LEU A HD13   1 
ATOM   2849  H HD21   . LEU A 1 174 ? 176.247 17.885  144.560 1.00 62.45  ? 174 LEU A HD21   1 
ATOM   2850  H HD22   . LEU A 1 174 ? 175.927 16.361  144.246 1.00 62.45  ? 174 LEU A HD22   1 
ATOM   2851  H HD23   . LEU A 1 174 ? 177.422 16.893  144.161 1.00 62.45  ? 174 LEU A HD23   1 
ATOM   2852  N N      . CYS A 1 175 ? 178.450 17.745  139.517 1.00 56.04  ? 175 CYS A N      1 
ATOM   2853  C CA     . CYS A 1 175 ? 179.199 18.932  139.127 1.00 55.24  ? 175 CYS A CA     1 
ATOM   2854  C C      . CYS A 1 175 ? 178.706 19.467  137.793 1.00 61.85  ? 175 CYS A C      1 
ATOM   2855  O O      . CYS A 1 175 ? 178.540 20.676  137.624 1.00 63.83  ? 175 CYS A O      1 
ATOM   2856  C CB     . CYS A 1 175 ? 180.686 18.618  139.034 1.00 50.18  ? 175 CYS A CB     1 
ATOM   2857  S SG     . CYS A 1 175 ? 181.440 18.302  140.627 1.00 66.62  ? 175 CYS A SG     1 
ATOM   2858  H H      . CYS A 1 175 ? 178.930 17.035  139.594 1.00 67.25  ? 175 CYS A H      1 
ATOM   2859  H HA     . CYS A 1 175 ? 179.075 19.622  139.797 1.00 66.29  ? 175 CYS A HA     1 
ATOM   2860  H HB2    . CYS A 1 175 ? 180.807 17.827  138.484 1.00 60.22  ? 175 CYS A HB2    1 
ATOM   2861  H HB3    . CYS A 1 175 ? 181.142 19.373  138.631 1.00 60.22  ? 175 CYS A HB3    1 
ATOM   2862  H HG     . CYS A 1 175 ? 182.606 18.064  140.467 1.00 79.95  ? 175 CYS A HG     1 
ATOM   2863  N N      . GLU A 1 176 ? 178.472 18.561  136.849 1.00 61.13  ? 176 GLU A N      1 
ATOM   2864  C CA     . GLU A 1 176 ? 178.020 18.961  135.529 1.00 58.37  ? 176 GLU A CA     1 
ATOM   2865  C C      . GLU A 1 176 ? 176.638 19.599  135.626 1.00 56.13  ? 176 GLU A C      1 
ATOM   2866  O O      . GLU A 1 176 ? 176.385 20.629  135.004 1.00 58.33  ? 176 GLU A O      1 
ATOM   2867  C CB     . GLU A 1 176 ? 178.023 17.770  134.568 1.00 61.33  ? 176 GLU A CB     1 
ATOM   2868  C CG     . GLU A 1 176 ? 179.418 17.219  134.284 1.00 69.57  ? 176 GLU A CG     1 
ATOM   2869  C CD     . GLU A 1 176 ? 179.464 16.255  133.104 1.00 84.97  ? 176 GLU A CD     1 
ATOM   2870  O OE1    . GLU A 1 176 ? 178.793 16.512  132.085 1.00 89.74  ? 176 GLU A OE1    1 
ATOM   2871  O OE2    . GLU A 1 176 ? 180.182 15.236  133.191 1.00 93.76  ? 176 GLU A OE2    1 
ATOM   2872  H H      . GLU A 1 176 ? 178.568 17.712  136.949 1.00 73.36  ? 176 GLU A H      1 
ATOM   2873  H HA     . GLU A 1 176 ? 178.631 19.628  135.177 1.00 70.04  ? 176 GLU A HA     1 
ATOM   2874  H HB2    . GLU A 1 176 ? 177.493 17.055  134.954 1.00 73.60  ? 176 GLU A HB2    1 
ATOM   2875  H HB3    . GLU A 1 176 ? 177.635 18.048  133.723 1.00 73.60  ? 176 GLU A HB3    1 
ATOM   2876  H HG2    . GLU A 1 176 ? 180.013 17.959  134.087 1.00 83.49  ? 176 GLU A HG2    1 
ATOM   2877  H HG3    . GLU A 1 176 ? 179.733 16.743  135.069 1.00 83.49  ? 176 GLU A HG3    1 
ATOM   2878  N N      . LEU A 1 177 ? 175.751 19.005  136.421 1.00 53.75  ? 177 LEU A N      1 
ATOM   2879  C CA     . LEU A 1 177 ? 174.422 19.575  136.613 1.00 54.10  ? 177 LEU A CA     1 
ATOM   2880  C C      . LEU A 1 177 ? 174.500 20.966  137.230 1.00 54.90  ? 177 LEU A C      1 
ATOM   2881  O O      . LEU A 1 177 ? 173.738 21.864  136.857 1.00 53.68  ? 177 LEU A O      1 
ATOM   2882  C CB     . LEU A 1 177 ? 173.562 18.685  137.499 1.00 53.32  ? 177 LEU A CB     1 
ATOM   2883  C CG     . LEU A 1 177 ? 173.119 17.353  136.898 1.00 55.14  ? 177 LEU A CG     1 
ATOM   2884  C CD1    . LEU A 1 177 ? 172.263 16.597  137.915 1.00 56.93  ? 177 LEU A CD1    1 
ATOM   2885  C CD2    . LEU A 1 177 ? 172.374 17.530  135.575 1.00 50.26  ? 177 LEU A CD2    1 
ATOM   2886  H H      . LEU A 1 177 ? 175.894 18.278  136.857 1.00 64.50  ? 177 LEU A H      1 
ATOM   2887  H HA     . LEU A 1 177 ? 173.985 19.653  135.751 1.00 64.93  ? 177 LEU A HA     1 
ATOM   2888  H HB2    . LEU A 1 177 ? 174.062 18.484  138.305 1.00 63.98  ? 177 LEU A HB2    1 
ATOM   2889  H HB3    . LEU A 1 177 ? 172.759 19.176  137.734 1.00 63.98  ? 177 LEU A HB3    1 
ATOM   2890  H HG     . LEU A 1 177 ? 173.907 16.817  136.721 1.00 66.17  ? 177 LEU A HG     1 
ATOM   2891  H HD11   . LEU A 1 177 ? 171.985 15.752  137.527 1.00 68.31  ? 177 LEU A HD11   1 
ATOM   2892  H HD12   . LEU A 1 177 ? 172.789 16.437  138.713 1.00 68.31  ? 177 LEU A HD12   1 
ATOM   2893  H HD13   . LEU A 1 177 ? 171.485 17.133  138.133 1.00 68.31  ? 177 LEU A HD13   1 
ATOM   2894  H HD21   . LEU A 1 177 ? 172.117 16.658  135.239 1.00 60.32  ? 177 LEU A HD21   1 
ATOM   2895  H HD22   . LEU A 1 177 ? 171.584 18.072  135.729 1.00 60.32  ? 177 LEU A HD22   1 
ATOM   2896  H HD23   . LEU A 1 177 ? 172.960 17.971  134.940 1.00 60.32  ? 177 LEU A HD23   1 
ATOM   2897  N N      . LEU A 1 178 ? 175.419 21.142  138.174 1.00 56.41  ? 178 LEU A N      1 
ATOM   2898  C CA     . LEU A 1 178 ? 175.574 22.431  138.837 1.00 57.00  ? 178 LEU A CA     1 
ATOM   2899  C C      . LEU A 1 178 ? 176.031 23.491  137.843 1.00 57.09  ? 178 LEU A C      1 
ATOM   2900  O O      . LEU A 1 178 ? 175.588 24.639  137.909 1.00 57.66  ? 178 LEU A O      1 
ATOM   2901  C CB     . LEU A 1 178 ? 176.553 22.336  140.016 1.00 52.99  ? 178 LEU A CB     1 
ATOM   2902  C CG     . LEU A 1 178 ? 176.019 21.617  141.258 1.00 50.08  ? 178 LEU A CG     1 
ATOM   2903  C CD1    . LEU A 1 178 ? 177.117 21.458  142.304 1.00 48.31  ? 178 LEU A CD1    1 
ATOM   2904  C CD2    . LEU A 1 178 ? 174.816 22.350  141.848 1.00 47.58  ? 178 LEU A CD2    1 
ATOM   2905  H H      . LEU A 1 178 ? 175.963 20.535  138.447 1.00 67.69  ? 178 LEU A H      1 
ATOM   2906  H HA     . LEU A 1 178 ? 174.713 22.706  139.189 1.00 68.40  ? 178 LEU A HA     1 
ATOM   2907  H HB2    . LEU A 1 178 ? 177.344 21.858  139.721 1.00 63.58  ? 178 LEU A HB2    1 
ATOM   2908  H HB3    . LEU A 1 178 ? 176.799 23.235  140.284 1.00 63.58  ? 178 LEU A HB3    1 
ATOM   2909  H HG     . LEU A 1 178 ? 175.725 20.729  141.001 1.00 60.10  ? 178 LEU A HG     1 
ATOM   2910  H HD11   . LEU A 1 178 ? 176.752 21.001  143.078 1.00 57.98  ? 178 LEU A HD11   1 
ATOM   2911  H HD12   . LEU A 1 178 ? 177.842 20.937  141.924 1.00 57.98  ? 178 LEU A HD12   1 
ATOM   2912  H HD13   . LEU A 1 178 ? 177.439 22.336  142.560 1.00 57.98  ? 178 LEU A HD13   1 
ATOM   2913  H HD21   . LEU A 1 178 ? 174.506 21.867  142.631 1.00 57.10  ? 178 LEU A HD21   1 
ATOM   2914  H HD22   . LEU A 1 178 ? 175.085 23.248  142.098 1.00 57.10  ? 178 LEU A HD22   1 
ATOM   2915  H HD23   . LEU A 1 178 ? 174.112 22.389  141.182 1.00 57.10  ? 178 LEU A HD23   1 
ATOM   2916  N N      . ILE A 1 179 ? 176.905 23.098  136.920 1.00 56.19  ? 179 ILE A N      1 
ATOM   2917  C CA     . ILE A 1 179 ? 177.422 24.024  135.922 1.00 60.09  ? 179 ILE A CA     1 
ATOM   2918  C C      . ILE A 1 179 ? 176.346 24.345  134.887 1.00 61.65  ? 179 ILE A C      1 
ATOM   2919  O O      . ILE A 1 179 ? 176.249 25.479  134.425 1.00 63.65  ? 179 ILE A O      1 
ATOM   2920  C CB     . ILE A 1 179 ? 178.671 23.463  135.217 1.00 62.59  ? 179 ILE A CB     1 
ATOM   2921  C CG1    . ILE A 1 179 ? 179.817 23.302  136.217 1.00 60.44  ? 179 ILE A CG1    1 
ATOM   2922  C CG2    . ILE A 1 179 ? 179.096 24.364  134.041 1.00 65.46  ? 179 ILE A CG2    1 
ATOM   2923  C CD1    . ILE A 1 179 ? 180.320 24.595  136.812 1.00 58.62  ? 179 ILE A CD1    1 
ATOM   2924  H H      . ILE A 1 179 ? 177.214 22.298  136.851 1.00 67.43  ? 179 ILE A H      1 
ATOM   2925  H HA     . ILE A 1 179 ? 177.672 24.852  136.360 1.00 72.11  ? 179 ILE A HA     1 
ATOM   2926  H HB     . ILE A 1 179 ? 178.451 22.587  134.864 1.00 75.11  ? 179 ILE A HB     1 
ATOM   2927  H HG12   . ILE A 1 179 ? 179.513 22.741  136.948 1.00 72.53  ? 179 ILE A HG12   1 
ATOM   2928  H HG13   . ILE A 1 179 ? 180.563 22.876  135.768 1.00 72.53  ? 179 ILE A HG13   1 
ATOM   2929  H HG21   . ILE A 1 179 ? 179.882 23.983  133.620 1.00 78.55  ? 179 ILE A HG21   1 
ATOM   2930  H HG22   . ILE A 1 179 ? 178.368 24.411  133.401 1.00 78.55  ? 179 ILE A HG22   1 
ATOM   2931  H HG23   . ILE A 1 179 ? 179.297 25.250  134.379 1.00 78.55  ? 179 ILE A HG23   1 
ATOM   2932  H HD11   . ILE A 1 179 ? 181.041 24.398  137.431 1.00 70.35  ? 179 ILE A HD11   1 
ATOM   2933  H HD12   . ILE A 1 179 ? 180.644 25.166  136.098 1.00 70.35  ? 179 ILE A HD12   1 
ATOM   2934  H HD13   . ILE A 1 179 ? 179.592 25.032  137.281 1.00 70.35  ? 179 ILE A HD13   1 
ATOM   2935  N N      . VAL A 1 180 ? 175.545 23.348  134.524 1.00 59.71  ? 180 VAL A N      1 
ATOM   2936  C CA     . VAL A 1 180 ? 174.445 23.574  133.597 1.00 59.65  ? 180 VAL A CA     1 
ATOM   2937  C C      . VAL A 1 180 ? 173.403 24.473  134.248 1.00 59.99  ? 180 VAL A C      1 
ATOM   2938  O O      . VAL A 1 180 ? 172.713 25.223  133.567 1.00 64.85  ? 180 VAL A O      1 
ATOM   2939  C CB     . VAL A 1 180 ? 173.782 22.248  133.161 1.00 58.18  ? 180 VAL A CB     1 
ATOM   2940  C CG1    . VAL A 1 180 ? 172.463 22.499  132.400 1.00 52.18  ? 180 VAL A CG1    1 
ATOM   2941  C CG2    . VAL A 1 180 ? 174.736 21.442  132.304 1.00 61.97  ? 180 VAL A CG2    1 
ATOM   2942  H H      . VAL A 1 180 ? 175.617 22.537  134.800 1.00 71.66  ? 180 VAL A H      1 
ATOM   2943  H HA     . VAL A 1 180 ? 174.781 24.021  132.805 1.00 71.58  ? 180 VAL A HA     1 
ATOM   2944  H HB     . VAL A 1 180 ? 173.576 21.724  133.951 1.00 69.82  ? 180 VAL A HB     1 
ATOM   2945  H HG11   . VAL A 1 180 ? 172.079 21.645  132.145 1.00 62.61  ? 180 VAL A HG11   1 
ATOM   2946  H HG12   . VAL A 1 180 ? 171.850 22.977  132.981 1.00 62.61  ? 180 VAL A HG12   1 
ATOM   2947  H HG13   . VAL A 1 180 ? 172.650 23.028  131.609 1.00 62.61  ? 180 VAL A HG13   1 
ATOM   2948  H HG21   . VAL A 1 180 ? 174.303 20.615  132.041 1.00 74.37  ? 180 VAL A HG21   1 
ATOM   2949  H HG22   . VAL A 1 180 ? 174.967 21.960  131.517 1.00 74.37  ? 180 VAL A HG22   1 
ATOM   2950  H HG23   . VAL A 1 180 ? 175.535 21.248  132.819 1.00 74.37  ? 180 VAL A HG23   1 
ATOM   2951  N N      . PHE A 1 181 ? 173.293 24.398  135.567 1.00 56.54  ? 181 PHE A N      1 
ATOM   2952  C CA     . PHE A 1 181 ? 172.266 25.148  136.274 1.00 57.30  ? 181 PHE A CA     1 
ATOM   2953  C C      . PHE A 1 181 ? 172.647 26.614  136.443 1.00 61.67  ? 181 PHE A C      1 
ATOM   2954  O O      . PHE A 1 181 ? 171.843 27.506  136.180 1.00 64.73  ? 181 PHE A O      1 
ATOM   2955  C CB     . PHE A 1 181 ? 171.994 24.520  137.639 1.00 55.12  ? 181 PHE A CB     1 
ATOM   2956  C CG     . PHE A 1 181 ? 170.856 25.155  138.374 1.00 53.25  ? 181 PHE A CG     1 
ATOM   2957  C CD1    . PHE A 1 181 ? 169.548 24.770  138.115 1.00 52.30  ? 181 PHE A CD1    1 
ATOM   2958  C CD2    . PHE A 1 181 ? 171.087 26.139  139.319 1.00 50.83  ? 181 PHE A CD2    1 
ATOM   2959  C CE1    . PHE A 1 181 ? 168.488 25.357  138.784 1.00 49.73  ? 181 PHE A CE1    1 
ATOM   2960  C CE2    . PHE A 1 181 ? 170.032 26.727  139.994 1.00 48.12  ? 181 PHE A CE2    1 
ATOM   2961  C CZ     . PHE A 1 181 ? 168.727 26.334  139.724 1.00 47.41  ? 181 PHE A CZ     1 
ATOM   2962  H H      . PHE A 1 181 ? 173.798 23.922  136.075 1.00 67.85  ? 181 PHE A H      1 
ATOM   2963  H HA     . PHE A 1 181 ? 171.444 25.112  135.761 1.00 68.76  ? 181 PHE A HA     1 
ATOM   2964  H HB2    . PHE A 1 181 ? 171.782 23.582  137.515 1.00 66.15  ? 181 PHE A HB2    1 
ATOM   2965  H HB3    . PHE A 1 181 ? 172.789 24.609  138.188 1.00 66.15  ? 181 PHE A HB3    1 
ATOM   2966  H HD1    . PHE A 1 181 ? 169.381 24.112  137.480 1.00 62.77  ? 181 PHE A HD1    1 
ATOM   2967  H HD2    . PHE A 1 181 ? 171.958 26.407  139.503 1.00 61.00  ? 181 PHE A HD2    1 
ATOM   2968  H HE1    . PHE A 1 181 ? 167.616 25.089  138.602 1.00 59.67  ? 181 PHE A HE1    1 
ATOM   2969  H HE2    . PHE A 1 181 ? 170.196 27.387  140.628 1.00 57.75  ? 181 PHE A HE2    1 
ATOM   2970  H HZ     . PHE A 1 181 ? 168.018 26.729  140.178 1.00 56.89  ? 181 PHE A HZ     1 
ATOM   2971  N N      . TYR A 1 182 ? 173.875 26.862  136.880 1.00 62.31  ? 182 TYR A N      1 
ATOM   2972  C CA     . TYR A 1 182 ? 174.320 28.222  137.138 1.00 60.41  ? 182 TYR A CA     1 
ATOM   2973  C C      . TYR A 1 182 ? 175.080 28.790  135.935 1.00 61.75  ? 182 TYR A C      1 
ATOM   2974  O O      . TYR A 1 182 ? 175.319 29.999  135.854 1.00 64.95  ? 182 TYR A O      1 
ATOM   2975  C CB     . TYR A 1 182 ? 175.179 28.264  138.401 1.00 56.13  ? 182 TYR A CB     1 
ATOM   2976  C CG     . TYR A 1 182 ? 174.422 27.944  139.675 1.00 54.28  ? 182 TYR A CG     1 
ATOM   2977  C CD1    . TYR A 1 182 ? 173.517 28.848  140.216 1.00 48.96  ? 182 TYR A CD1    1 
ATOM   2978  C CD2    . TYR A 1 182 ? 174.628 26.742  140.346 1.00 55.98  ? 182 TYR A CD2    1 
ATOM   2979  C CE1    . TYR A 1 182 ? 172.836 28.569  141.382 1.00 48.22  ? 182 TYR A CE1    1 
ATOM   2980  C CE2    . TYR A 1 182 ? 173.950 26.446  141.510 1.00 54.92  ? 182 TYR A CE2    1 
ATOM   2981  C CZ     . TYR A 1 182 ? 173.054 27.360  142.033 1.00 54.11  ? 182 TYR A CZ     1 
ATOM   2982  O OH     . TYR A 1 182 ? 172.372 27.060  143.207 1.00 53.33  ? 182 TYR A OH     1 
ATOM   2983  H H      . TYR A 1 182 ? 174.469 26.260  137.035 1.00 74.77  ? 182 TYR A H      1 
ATOM   2984  H HA     . TYR A 1 182 ? 173.542 28.782  137.289 1.00 72.49  ? 182 TYR A HA     1 
ATOM   2985  H HB2    . TYR A 1 182 ? 175.895 27.615  138.312 1.00 67.35  ? 182 TYR A HB2    1 
ATOM   2986  H HB3    . TYR A 1 182 ? 175.552 29.154  138.495 1.00 67.35  ? 182 TYR A HB3    1 
ATOM   2987  H HD1    . TYR A 1 182 ? 173.370 29.659  139.785 1.00 58.75  ? 182 TYR A HD1    1 
ATOM   2988  H HD2    . TYR A 1 182 ? 175.231 26.124  139.999 1.00 67.17  ? 182 TYR A HD2    1 
ATOM   2989  H HE1    . TYR A 1 182 ? 172.231 29.184  141.730 1.00 57.86  ? 182 TYR A HE1    1 
ATOM   2990  H HE2    . TYR A 1 182 ? 174.099 25.637  141.944 1.00 65.90  ? 182 TYR A HE2    1 
ATOM   2991  H HH     . TYR A 1 182 ? 172.602 26.302  143.488 1.00 64.00  ? 182 TYR A HH     1 
ATOM   2992  N N      . GLY A 1 183 ? 175.451 27.918  135.001 1.00 56.67  ? 183 GLY A N      1 
ATOM   2993  C CA     . GLY A 1 183 ? 176.079 28.358  133.767 1.00 59.99  ? 183 GLY A CA     1 
ATOM   2994  C C      . GLY A 1 183 ? 177.595 28.341  133.786 1.00 65.86  ? 183 GLY A C      1 
ATOM   2995  O O      . GLY A 1 183 ? 178.218 28.180  132.745 1.00 74.47  ? 183 GLY A O      1 
ATOM   2996  H H      . GLY A 1 183 ? 175.348 27.067  135.060 1.00 68.00  ? 183 GLY A H      1 
ATOM   2997  H HA2    . GLY A 1 183 ? 175.782 27.787  133.042 1.00 71.98  ? 183 GLY A HA2    1 
ATOM   2998  H HA3    . GLY A 1 183 ? 175.792 29.264  133.573 1.00 71.98  ? 183 GLY A HA3    1 
ATOM   2999  N N      . SER A 1 184 ? 178.198 28.508  134.956 1.00 63.87  ? 184 SER A N      1 
ATOM   3000  C CA     . SER A 1 184 ? 179.654 28.544  135.050 1.00 63.80  ? 184 SER A CA     1 
ATOM   3001  C C      . SER A 1 184 ? 180.131 28.237  136.459 1.00 63.36  ? 184 SER A C      1 
ATOM   3002  O O      . SER A 1 184 ? 179.356 28.260  137.415 1.00 66.78  ? 184 SER A O      1 
ATOM   3003  C CB     . SER A 1 184 ? 180.179 29.921  134.660 1.00 64.33  ? 184 SER A CB     1 
ATOM   3004  O OG     . SER A 1 184 ? 179.945 30.849  135.709 1.00 65.03  ? 184 SER A OG     1 
ATOM   3005  H H      . SER A 1 184 ? 177.791 28.603  135.708 1.00 76.64  ? 184 SER A H      1 
ATOM   3006  H HA     . SER A 1 184 ? 180.034 27.887  134.447 1.00 76.56  ? 184 SER A HA     1 
ATOM   3007  H HB2    . SER A 1 184 ? 181.133 29.862  134.495 1.00 77.20  ? 184 SER A HB2    1 
ATOM   3008  H HB3    . SER A 1 184 ? 179.720 30.221  133.861 1.00 77.20  ? 184 SER A HB3    1 
ATOM   3009  H HG     . SER A 1 184 ? 180.235 31.607  135.492 1.00 78.04  ? 184 SER A HG     1 
ATOM   3010  N N      . PHE A 1 185 ? 181.424 27.973  136.579 1.00 60.89  ? 185 PHE A N      1 
ATOM   3011  C CA     . PHE A 1 185 ? 182.025 27.671  137.867 1.00 56.06  ? 185 PHE A CA     1 
ATOM   3012  C C      . PHE A 1 185 ? 181.873 28.840  138.816 1.00 55.66  ? 185 PHE A C      1 
ATOM   3013  O O      . PHE A 1 185 ? 181.530 28.660  139.978 1.00 57.66  ? 185 PHE A O      1 
ATOM   3014  C CB     . PHE A 1 185 ? 183.514 27.337  137.712 1.00 52.94  ? 185 PHE A CB     1 
ATOM   3015  C CG     . PHE A 1 185 ? 184.272 27.394  139.003 1.00 55.45  ? 185 PHE A CG     1 
ATOM   3016  C CD1    . PHE A 1 185 ? 184.191 26.355  139.916 1.00 51.86  ? 185 PHE A CD1    1 
ATOM   3017  C CD2    . PHE A 1 185 ? 185.045 28.497  139.319 1.00 63.34  ? 185 PHE A CD2    1 
ATOM   3018  C CE1    . PHE A 1 185 ? 184.873 26.408  141.113 1.00 53.33  ? 185 PHE A CE1    1 
ATOM   3019  C CE2    . PHE A 1 185 ? 185.737 28.552  140.516 1.00 64.78  ? 185 PHE A CE2    1 
ATOM   3020  C CZ     . PHE A 1 185 ? 185.649 27.503  141.414 1.00 59.92  ? 185 PHE A CZ     1 
ATOM   3021  H H      . PHE A 1 185 ? 181.979 27.963  135.922 1.00 73.07  ? 185 PHE A H      1 
ATOM   3022  H HA     . PHE A 1 185 ? 181.579 26.902  138.257 1.00 67.28  ? 185 PHE A HA     1 
ATOM   3023  H HB2    . PHE A 1 185 ? 183.599 26.439  137.356 1.00 63.53  ? 185 PHE A HB2    1 
ATOM   3024  H HB3    . PHE A 1 185 ? 183.917 27.974  137.102 1.00 63.53  ? 185 PHE A HB3    1 
ATOM   3025  H HD1    . PHE A 1 185 ? 183.668 25.611  139.719 1.00 62.24  ? 185 PHE A HD1    1 
ATOM   3026  H HD2    . PHE A 1 185 ? 185.108 29.204  138.718 1.00 76.01  ? 185 PHE A HD2    1 
ATOM   3027  H HE1    . PHE A 1 185 ? 184.814 25.700  141.714 1.00 64.00  ? 185 PHE A HE1    1 
ATOM   3028  H HE2    . PHE A 1 185 ? 186.259 29.294  140.719 1.00 77.74  ? 185 PHE A HE2    1 
ATOM   3029  H HZ     . PHE A 1 185 ? 186.112 27.539  142.220 1.00 71.90  ? 185 PHE A HZ     1 
ATOM   3030  N N      . LEU A 1 186 ? 182.130 30.039  138.315 1.00 57.65  ? 186 LEU A N      1 
ATOM   3031  C CA     . LEU A 1 186 ? 182.120 31.227  139.153 1.00 60.42  ? 186 LEU A CA     1 
ATOM   3032  C C      . LEU A 1 186 ? 180.719 31.488  139.699 1.00 62.49  ? 186 LEU A C      1 
ATOM   3033  O O      . LEU A 1 186 ? 180.558 31.834  140.873 1.00 61.46  ? 186 LEU A O      1 
ATOM   3034  C CB     . LEU A 1 186 ? 182.641 32.437  138.372 1.00 64.50  ? 186 LEU A CB     1 
ATOM   3035  C CG     . LEU A 1 186 ? 182.875 33.733  139.154 1.00 67.83  ? 186 LEU A CG     1 
ATOM   3036  C CD1    . LEU A 1 186 ? 183.853 33.513  140.303 1.00 72.07  ? 186 LEU A CD1    1 
ATOM   3037  C CD2    . LEU A 1 186 ? 183.378 34.844  138.230 1.00 65.43  ? 186 LEU A CD2    1 
ATOM   3038  H H      . LEU A 1 186 ? 182.313 30.193  137.488 1.00 69.18  ? 186 LEU A H      1 
ATOM   3039  H HA     . LEU A 1 186 ? 182.711 31.082  139.908 1.00 72.50  ? 186 LEU A HA     1 
ATOM   3040  H HB2    . LEU A 1 186 ? 183.489 32.192  137.969 1.00 77.40  ? 186 LEU A HB2    1 
ATOM   3041  H HB3    . LEU A 1 186 ? 182.002 32.640  137.671 1.00 77.40  ? 186 LEU A HB3    1 
ATOM   3042  H HG     . LEU A 1 186 ? 182.032 34.025  139.535 1.00 81.39  ? 186 LEU A HG     1 
ATOM   3043  H HD11   . LEU A 1 186 ? 183.978 34.351  140.776 1.00 86.48  ? 186 LEU A HD11   1 
ATOM   3044  H HD12   . LEU A 1 186 ? 183.488 32.845  140.904 1.00 86.48  ? 186 LEU A HD12   1 
ATOM   3045  H HD13   . LEU A 1 186 ? 184.699 33.207  139.942 1.00 86.48  ? 186 LEU A HD13   1 
ATOM   3046  H HD21   . LEU A 1 186 ? 183.517 35.650  138.753 1.00 78.52  ? 186 LEU A HD21   1 
ATOM   3047  H HD22   . LEU A 1 186 ? 184.214 34.564  137.827 1.00 78.52  ? 186 LEU A HD22   1 
ATOM   3048  H HD23   . LEU A 1 186 ? 182.715 35.006  137.541 1.00 78.52  ? 186 LEU A HD23   1 
ATOM   3049  N N      . GLU A 1 187 ? 179.703 31.304  138.863 1.00 65.54  ? 187 GLU A N      1 
ATOM   3050  C CA     . GLU A 1 187 ? 178.332 31.517  139.315 1.00 68.57  ? 187 GLU A CA     1 
ATOM   3051  C C      . GLU A 1 187 ? 177.924 30.475  140.347 1.00 66.02  ? 187 GLU A C      1 
ATOM   3052  O O      . GLU A 1 187 ? 177.125 30.766  141.243 1.00 72.09  ? 187 GLU A O      1 
ATOM   3053  C CB     . GLU A 1 187 ? 177.354 31.505  138.140 1.00 75.12  ? 187 GLU A CB     1 
ATOM   3054  C CG     . GLU A 1 187 ? 177.359 32.788  137.326 1.00 84.16  ? 187 GLU A CG     1 
ATOM   3055  C CD     . GLU A 1 187 ? 176.913 33.997  138.127 1.00 90.29  ? 187 GLU A CD     1 
ATOM   3056  O OE1    . GLU A 1 187 ? 175.915 33.888  138.869 1.00 91.57  ? 187 GLU A OE1    1 
ATOM   3057  O OE2    . GLU A 1 187 ? 177.565 35.057  138.017 1.00 94.20  ? 187 GLU A OE2    1 
ATOM   3058  H H      . GLU A 1 187 ? 179.777 31.060  138.042 1.00 78.65  ? 187 GLU A H      1 
ATOM   3059  H HA     . GLU A 1 187 ? 178.275 32.388  139.737 1.00 82.28  ? 187 GLU A HA     1 
ATOM   3060  H HB2    . GLU A 1 187 ? 177.589 30.775  137.546 1.00 90.15  ? 187 GLU A HB2    1 
ATOM   3061  H HB3    . GLU A 1 187 ? 176.456 31.374  138.482 1.00 90.15  ? 187 GLU A HB3    1 
ATOM   3062  H HG2    . GLU A 1 187 ? 178.259 32.956  137.006 1.00 100.99 ? 187 GLU A HG2    1 
ATOM   3063  H HG3    . GLU A 1 187 ? 176.754 32.687  136.574 1.00 100.99 ? 187 GLU A HG3    1 
ATOM   3064  N N      . THR A 1 188 ? 178.470 29.266  140.225 1.00 55.33  ? 188 THR A N      1 
ATOM   3065  C CA     . THR A 1 188 ? 178.173 28.194  141.173 1.00 50.48  ? 188 THR A CA     1 
ATOM   3066  C C      . THR A 1 188 ? 178.716 28.521  142.564 1.00 52.84  ? 188 THR A C      1 
ATOM   3067  O O      . THR A 1 188 ? 178.050 28.293  143.572 1.00 49.51  ? 188 THR A O      1 
ATOM   3068  C CB     . THR A 1 188 ? 178.784 26.860  140.713 1.00 47.12  ? 188 THR A CB     1 
ATOM   3069  O OG1    . THR A 1 188 ? 178.316 26.541  139.394 1.00 51.81  ? 188 THR A OG1    1 
ATOM   3070  C CG2    . THR A 1 188 ? 178.411 25.734  141.667 1.00 39.52  ? 188 THR A CG2    1 
ATOM   3071  H H      . THR A 1 188 ? 179.017 29.041  139.600 1.00 66.40  ? 188 THR A H      1 
ATOM   3072  H HA     . THR A 1 188 ? 177.212 28.082  141.240 1.00 60.58  ? 188 THR A HA     1 
ATOM   3073  H HB     . THR A 1 188 ? 179.751 26.939  140.699 1.00 56.55  ? 188 THR A HB     1 
ATOM   3074  H HG1    . THR A 1 188 ? 178.540 27.146  138.856 1.00 62.17  ? 188 THR A HG1    1 
ATOM   3075  H HG21   . THR A 1 188 ? 178.803 24.900  141.364 1.00 47.42  ? 188 THR A HG21   1 
ATOM   3076  H HG22   . THR A 1 188 ? 178.740 25.932  142.558 1.00 47.42  ? 188 THR A HG22   1 
ATOM   3077  H HG23   . THR A 1 188 ? 177.447 25.635  141.701 1.00 47.42  ? 188 THR A HG23   1 
ATOM   3078  N N      . VAL A 1 189 ? 179.933 29.055  142.606 1.00 60.10  ? 189 VAL A N      1 
ATOM   3079  C CA     . VAL A 1 189 ? 180.580 29.424  143.863 1.00 61.05  ? 189 VAL A CA     1 
ATOM   3080  C C      . VAL A 1 189 ? 179.848 30.587  144.532 1.00 59.29  ? 189 VAL A C      1 
ATOM   3081  O O      . VAL A 1 189 ? 179.582 30.544  145.729 1.00 60.75  ? 189 VAL A O      1 
ATOM   3082  C CB     . VAL A 1 189 ? 182.070 29.811  143.637 1.00 57.53  ? 189 VAL A CB     1 
ATOM   3083  C CG1    . VAL A 1 189 ? 182.704 30.333  144.920 1.00 58.71  ? 189 VAL A CG1    1 
ATOM   3084  C CG2    . VAL A 1 189 ? 182.862 28.626  143.102 1.00 52.79  ? 189 VAL A CG2    1 
ATOM   3085  H H      . VAL A 1 189 ? 180.412 29.216  141.910 1.00 72.12  ? 189 VAL A H      1 
ATOM   3086  H HA     . VAL A 1 189 ? 180.555 28.665  144.467 1.00 73.26  ? 189 VAL A HA     1 
ATOM   3087  H HB     . VAL A 1 189 ? 182.112 30.520  142.976 1.00 69.03  ? 189 VAL A HB     1 
ATOM   3088  H HG11   . VAL A 1 189 ? 183.629 30.564  144.743 1.00 70.45  ? 189 VAL A HG11   1 
ATOM   3089  H HG12   . VAL A 1 189 ? 182.217 31.118  145.216 1.00 70.45  ? 189 VAL A HG12   1 
ATOM   3090  H HG13   . VAL A 1 189 ? 182.659 29.641  145.598 1.00 70.45  ? 189 VAL A HG13   1 
ATOM   3091  H HG21   . VAL A 1 189 ? 183.785 28.896  142.971 1.00 63.35  ? 189 VAL A HG21   1 
ATOM   3092  H HG22   . VAL A 1 189 ? 182.818 27.901  143.745 1.00 63.35  ? 189 VAL A HG22   1 
ATOM   3093  H HG23   . VAL A 1 189 ? 182.476 28.344  142.258 1.00 63.35  ? 189 VAL A HG23   1 
ATOM   3094  N N      . LYS A 1 190 ? 179.531 31.623  143.760 1.00 57.23  ? 190 LYS A N      1 
ATOM   3095  C CA     . LYS A 1 190 ? 178.823 32.793  144.289 1.00 59.97  ? 190 LYS A CA     1 
ATOM   3096  C C      . LYS A 1 190 ? 177.495 32.412  144.940 1.00 56.15  ? 190 LYS A C      1 
ATOM   3097  O O      . LYS A 1 190 ? 177.174 32.873  146.035 1.00 58.24  ? 190 LYS A O      1 
ATOM   3098  C CB     . LYS A 1 190 ? 178.569 33.827  143.183 1.00 70.88  ? 190 LYS A CB     1 
ATOM   3099  C CG     . LYS A 1 190 ? 179.821 34.558  142.694 1.00 79.91  ? 190 LYS A CG     1 
ATOM   3100  C CD     . LYS A 1 190 ? 179.494 35.879  141.994 1.00 86.94  ? 190 LYS A CD     1 
ATOM   3101  C CE     . LYS A 1 190 ? 178.703 35.678  140.704 1.00 88.21  ? 190 LYS A CE     1 
ATOM   3102  N NZ     . LYS A 1 190 ? 178.509 36.947  139.932 1.00 86.97  ? 190 LYS A NZ     1 
ATOM   3103  H H      . LYS A 1 190 ? 179.714 31.676  142.921 1.00 68.67  ? 190 LYS A H      1 
ATOM   3104  H HA     . LYS A 1 190 ? 179.376 33.213  144.966 1.00 71.96  ? 190 LYS A HA     1 
ATOM   3105  H HB2    . LYS A 1 190 ? 178.176 33.375  142.420 1.00 85.06  ? 190 LYS A HB2    1 
ATOM   3106  H HB3    . LYS A 1 190 ? 177.951 34.495  143.519 1.00 85.06  ? 190 LYS A HB3    1 
ATOM   3107  H HG2    . LYS A 1 190 ? 180.391 34.754  143.455 1.00 95.89  ? 190 LYS A HG2    1 
ATOM   3108  H HG3    . LYS A 1 190 ? 180.292 33.992  142.063 1.00 95.89  ? 190 LYS A HG3    1 
ATOM   3109  H HD2    . LYS A 1 190 ? 178.963 36.430  142.590 1.00 104.32 ? 190 LYS A HD2    1 
ATOM   3110  H HD3    . LYS A 1 190 ? 180.322 36.333  141.771 1.00 104.32 ? 190 LYS A HD3    1 
ATOM   3111  H HE2    . LYS A 1 190 ? 179.179 35.052  140.137 1.00 105.85 ? 190 LYS A HE2    1 
ATOM   3112  H HE3    . LYS A 1 190 ? 177.827 35.325  140.924 1.00 105.85 ? 190 LYS A HE3    1 
ATOM   3113  H HZ1    . LYS A 1 190 ? 178.045 36.783  139.190 1.00 104.36 ? 190 LYS A HZ1    1 
ATOM   3114  H HZ2    . LYS A 1 190 ? 178.066 37.539  140.426 1.00 104.36 ? 190 LYS A HZ2    1 
ATOM   3115  H HZ3    . LYS A 1 190 ? 179.299 37.291  139.708 1.00 104.36 ? 190 LYS A HZ3    1 
ATOM   3116  N N      . ASN A 1 191 ? 176.728 31.566  144.261 1.00 52.60  ? 191 ASN A N      1 
ATOM   3117  C CA     . ASN A 1 191 ? 175.440 31.121  144.772 1.00 52.17  ? 191 ASN A CA     1 
ATOM   3118  C C      . ASN A 1 191 ? 175.545 30.069  145.882 1.00 52.70  ? 191 ASN A C      1 
ATOM   3119  O O      . ASN A 1 191 ? 174.710 30.040  146.797 1.00 53.19  ? 191 ASN A O      1 
ATOM   3120  C CB     . ASN A 1 191 ? 174.586 30.574  143.631 1.00 53.30  ? 191 ASN A CB     1 
ATOM   3121  C CG     . ASN A 1 191 ? 173.981 31.670  142.791 1.00 57.16  ? 191 ASN A CG     1 
ATOM   3122  O OD1    . ASN A 1 191 ? 172.958 32.251  143.160 1.00 58.39  ? 191 ASN A OD1    1 
ATOM   3123  N ND2    . ASN A 1 191 ? 174.611 31.968  141.651 1.00 57.31  ? 191 ASN A ND2    1 
ATOM   3124  H H      . ASN A 1 191 ? 176.934 31.233  143.496 1.00 63.12  ? 191 ASN A H      1 
ATOM   3125  H HA     . ASN A 1 191 ? 174.975 31.888  145.142 1.00 62.60  ? 191 ASN A HA     1 
ATOM   3126  H HB2    . ASN A 1 191 ? 175.141 30.025  143.055 1.00 63.96  ? 191 ASN A HB2    1 
ATOM   3127  H HB3    . ASN A 1 191 ? 173.863 30.044  144.001 1.00 63.96  ? 191 ASN A HB3    1 
ATOM   3128  H HD21   . ASN A 1 191 ? 174.303 32.586  141.138 1.00 68.77  ? 191 ASN A HD21   1 
ATOM   3129  H HD22   . ASN A 1 191 ? 175.324 31.541  141.429 1.00 68.77  ? 191 ASN A HD22   1 
ATOM   3130  N N      . ALA A 1 192 ? 176.555 29.207  145.809 1.00 46.62  ? 192 ALA A N      1 
ATOM   3131  C CA     . ALA A 1 192 ? 176.698 28.166  146.814 1.00 44.31  ? 192 ALA A CA     1 
ATOM   3132  C C      . ALA A 1 192 ? 176.772 28.804  148.193 1.00 46.74  ? 192 ALA A C      1 
ATOM   3133  O O      . ALA A 1 192 ? 176.333 28.218  149.182 1.00 46.45  ? 192 ALA A O      1 
ATOM   3134  C CB     . ALA A 1 192 ? 177.917 27.337  146.554 1.00 41.17  ? 192 ALA A CB     1 
ATOM   3135  H H      . ALA A 1 192 ? 177.160 29.204  145.198 1.00 55.94  ? 192 ALA A H      1 
ATOM   3136  H HA     . ALA A 1 192 ? 175.922 27.584  146.788 1.00 53.17  ? 192 ALA A HA     1 
ATOM   3137  H HB1    . ALA A 1 192 ? 177.986 26.654  147.239 1.00 49.40  ? 192 ALA A HB1    1 
ATOM   3138  H HB2    . ALA A 1 192 ? 177.837 26.924  145.680 1.00 49.40  ? 192 ALA A HB2    1 
ATOM   3139  H HB3    . ALA A 1 192 ? 178.699 27.911  146.579 1.00 49.40  ? 192 ALA A HB3    1 
ATOM   3140  N N      . ARG A 1 193 ? 177.294 30.026  148.243 1.00 50.72  ? 193 ARG A N      1 
ATOM   3141  C CA     . ARG A 1 193 ? 177.482 30.741  149.505 1.00 53.56  ? 193 ARG A CA     1 
ATOM   3142  C C      . ARG A 1 193 ? 176.192 30.865  150.293 1.00 49.96  ? 193 ARG A C      1 
ATOM   3143  O O      . ARG A 1 193 ? 176.222 31.033  151.511 1.00 49.26  ? 193 ARG A O      1 
ATOM   3144  C CB     . ARG A 1 193 ? 178.058 32.138  149.261 1.00 58.00  ? 193 ARG A CB     1 
ATOM   3145  C CG     . ARG A 1 193 ? 179.516 32.143  148.854 1.00 60.06  ? 193 ARG A CG     1 
ATOM   3146  C CD     . ARG A 1 193 ? 180.007 33.550  148.669 1.00 64.42  ? 193 ARG A CD     1 
ATOM   3147  N NE     . ARG A 1 193 ? 179.353 34.203  147.537 1.00 65.73  ? 193 ARG A NE     1 
ATOM   3148  C CZ     . ARG A 1 193 ? 179.558 35.469  147.181 1.00 61.57  ? 193 ARG A CZ     1 
ATOM   3149  N NH1    . ARG A 1 193 ? 180.400 36.226  147.869 1.00 62.60  ? 193 ARG A NH1    1 
ATOM   3150  N NH2    . ARG A 1 193 ? 178.919 35.977  146.137 1.00 56.54  ? 193 ARG A NH2    1 
ATOM   3151  H H      . ARG A 1 193 ? 177.552 30.469  147.552 1.00 60.87  ? 193 ARG A H      1 
ATOM   3152  H HA     . ARG A 1 193 ? 178.116 30.249  150.051 1.00 64.28  ? 193 ARG A HA     1 
ATOM   3153  H HB2    . ARG A 1 193 ? 177.552 32.564  148.551 1.00 69.60  ? 193 ARG A HB2    1 
ATOM   3154  H HB3    . ARG A 1 193 ? 177.978 32.655  150.077 1.00 69.60  ? 193 ARG A HB3    1 
ATOM   3155  H HG2    . ARG A 1 193 ? 180.047 31.721  149.548 1.00 72.07  ? 193 ARG A HG2    1 
ATOM   3156  H HG3    . ARG A 1 193 ? 179.619 31.669  148.014 1.00 72.07  ? 193 ARG A HG3    1 
ATOM   3157  H HD2    . ARG A 1 193 ? 179.814 34.063  149.469 1.00 77.30  ? 193 ARG A HD2    1 
ATOM   3158  H HD3    . ARG A 1 193 ? 180.962 33.536  148.501 1.00 77.30  ? 193 ARG A HD3    1 
ATOM   3159  H HE     . ARG A 1 193 ? 178.799 33.739  147.071 1.00 78.88  ? 193 ARG A HE     1 
ATOM   3160  H HH11   . ARG A 1 193 ? 180.817 35.899  148.547 1.00 75.12  ? 193 ARG A HH11   1 
ATOM   3161  H HH12   . ARG A 1 193 ? 180.531 37.043  147.638 1.00 75.12  ? 193 ARG A HH12   1 
ATOM   3162  H HH21   . ARG A 1 193 ? 178.371 35.489  145.689 1.00 67.85  ? 193 ARG A HH21   1 
ATOM   3163  H HH22   . ARG A 1 193 ? 179.052 36.796  145.909 1.00 67.85  ? 193 ARG A HH22   1 
ATOM   3164  N N      . ARG A 1 194 ? 175.065 30.783  149.589 1.00 50.71  ? 194 ARG A N      1 
ATOM   3165  C CA     . ARG A 1 194 ? 173.741 30.915  150.205 1.00 49.94  ? 194 ARG A CA     1 
ATOM   3166  C C      . ARG A 1 194 ? 172.955 29.592  150.236 1.00 48.62  ? 194 ARG A C      1 
ATOM   3167  O O      . ARG A 1 194 ? 171.775 29.582  150.575 1.00 53.36  ? 194 ARG A O      1 
ATOM   3168  C CB     . ARG A 1 194 ? 172.931 32.003  149.484 1.00 55.03  ? 194 ARG A CB     1 
ATOM   3169  C CG     . ARG A 1 194 ? 173.540 33.396  149.584 1.00 68.53  ? 194 ARG A CG     1 
ATOM   3170  C CD     . ARG A 1 194 ? 172.681 34.466  148.902 1.00 86.50  ? 194 ARG A CD     1 
ATOM   3171  N NE     . ARG A 1 194 ? 172.639 34.315  147.444 1.00 99.68  ? 194 ARG A NE     1 
ATOM   3172  C CZ     . ARG A 1 194 ? 173.565 34.780  146.604 1.00 105.22 ? 194 ARG A CZ     1 
ATOM   3173  N NH1    . ARG A 1 194 ? 174.630 35.429  147.060 1.00 104.71 ? 194 ARG A NH1    1 
ATOM   3174  N NH2    . ARG A 1 194 ? 173.429 34.589  145.297 1.00 107.65 ? 194 ARG A NH2    1 
ATOM   3175  H H      . ARG A 1 194 ? 175.038 30.650  148.740 1.00 60.85  ? 194 ARG A H      1 
ATOM   3176  H HA     . ARG A 1 194 ? 173.860 31.203  151.124 1.00 59.93  ? 194 ARG A HA     1 
ATOM   3177  H HB2    . ARG A 1 194 ? 172.869 31.774  148.543 1.00 66.03  ? 194 ARG A HB2    1 
ATOM   3178  H HB3    . ARG A 1 194 ? 172.043 32.040  149.872 1.00 66.03  ? 194 ARG A HB3    1 
ATOM   3179  H HG2    . ARG A 1 194 ? 173.631 33.636  150.519 1.00 82.23  ? 194 ARG A HG2    1 
ATOM   3180  H HG3    . ARG A 1 194 ? 174.411 33.393  149.156 1.00 82.23  ? 194 ARG A HG3    1 
ATOM   3181  H HD2    . ARG A 1 194 ? 171.773 34.402  149.236 1.00 103.80 ? 194 ARG A HD2    1 
ATOM   3182  H HD3    . ARG A 1 194 ? 173.048 35.341  149.102 1.00 103.80 ? 194 ARG A HD3    1 
ATOM   3183  H HE     . ARG A 1 194 ? 171.969 33.896  147.106 1.00 119.61 ? 194 ARG A HE     1 
ATOM   3184  H HH11   . ARG A 1 194 ? 174.726 35.557  147.905 1.00 125.65 ? 194 ARG A HH11   1 
ATOM   3185  H HH12   . ARG A 1 194 ? 175.222 35.724  146.511 1.00 125.65 ? 194 ARG A HH12   1 
ATOM   3186  H HH21   . ARG A 1 194 ? 172.743 34.168  144.993 1.00 129.18 ? 194 ARG A HH21   1 
ATOM   3187  H HH22   . ARG A 1 194 ? 174.026 34.887  144.755 1.00 129.18 ? 194 ARG A HH22   1 
ATOM   3188  N N      . TRP A 1 195 ? 173.597 28.483  149.875 1.00 45.52  ? 195 TRP A N      1 
ATOM   3189  C CA     . TRP A 1 195 ? 173.002 27.161  150.085 1.00 46.48  ? 195 TRP A CA     1 
ATOM   3190  C C      . TRP A 1 195 ? 172.771 26.898  151.577 1.00 45.73  ? 195 TRP A C      1 
ATOM   3191  O O      . TRP A 1 195 ? 173.512 27.394  152.427 1.00 48.04  ? 195 TRP A O      1 
ATOM   3192  C CB     . TRP A 1 195 ? 173.910 26.060  149.538 1.00 46.30  ? 195 TRP A CB     1 
ATOM   3193  C CG     . TRP A 1 195 ? 173.975 25.991  148.043 1.00 48.90  ? 195 TRP A CG     1 
ATOM   3194  C CD1    . TRP A 1 195 ? 173.305 26.785  147.156 1.00 50.52  ? 195 TRP A CD1    1 
ATOM   3195  C CD2    . TRP A 1 195 ? 174.755 25.077  147.256 1.00 44.93  ? 195 TRP A CD2    1 
ATOM   3196  N NE1    . TRP A 1 195 ? 173.618 26.423  145.868 1.00 48.91  ? 195 TRP A NE1    1 
ATOM   3197  C CE2    . TRP A 1 195 ? 174.501 25.378  145.899 1.00 42.76  ? 195 TRP A CE2    1 
ATOM   3198  C CE3    . TRP A 1 195 ? 175.635 24.031  147.565 1.00 44.36  ? 195 TRP A CE3    1 
ATOM   3199  C CZ2    . TRP A 1 195 ? 175.095 24.680  144.855 1.00 41.89  ? 195 TRP A CZ2    1 
ATOM   3200  C CZ3    . TRP A 1 195 ? 176.232 23.333  146.523 1.00 44.29  ? 195 TRP A CZ3    1 
ATOM   3201  C CH2    . TRP A 1 195 ? 175.958 23.664  145.180 1.00 44.98  ? 195 TRP A CH2    1 
ATOM   3202  H H      . TRP A 1 195 ? 174.374 28.467  149.508 1.00 54.63  ? 195 TRP A H      1 
ATOM   3203  H HA     . TRP A 1 195 ? 172.148 27.112  149.627 1.00 55.78  ? 195 TRP A HA     1 
ATOM   3204  H HB2    . TRP A 1 195 ? 174.811 26.210  149.865 1.00 55.56  ? 195 TRP A HB2    1 
ATOM   3205  H HB3    . TRP A 1 195 ? 173.586 25.203  149.858 1.00 55.56  ? 195 TRP A HB3    1 
ATOM   3206  H HD1    . TRP A 1 195 ? 172.723 27.472  147.389 1.00 60.62  ? 195 TRP A HD1    1 
ATOM   3207  H HE1    . TRP A 1 195 ? 173.307 26.793  145.156 1.00 58.69  ? 195 TRP A HE1    1 
ATOM   3208  H HE3    . TRP A 1 195 ? 175.818 23.811  148.450 1.00 53.23  ? 195 TRP A HE3    1 
ATOM   3209  H HZ2    . TRP A 1 195 ? 174.917 24.897  143.968 1.00 50.26  ? 195 TRP A HZ2    1 
ATOM   3210  H HZ3    . TRP A 1 195 ? 176.819 22.638  146.713 1.00 53.15  ? 195 TRP A HZ3    1 
ATOM   3211  H HH2    . TRP A 1 195 ? 176.368 23.181  144.500 1.00 53.98  ? 195 TRP A HH2    1 
ATOM   3212  N N      . THR A 1 196 ? 171.733 26.132  151.891 1.00 42.79  ? 196 THR A N      1 
ATOM   3213  C CA     . THR A 1 196 ? 171.452 25.738  153.266 1.00 44.95  ? 196 THR A CA     1 
ATOM   3214  C C      . THR A 1 196 ? 171.207 24.249  153.263 1.00 48.85  ? 196 THR A C      1 
ATOM   3215  O O      . THR A 1 196 ? 171.102 23.639  152.201 1.00 50.77  ? 196 THR A O      1 
ATOM   3216  C CB     . THR A 1 196 ? 170.190 26.421  153.851 1.00 40.62  ? 196 THR A CB     1 
ATOM   3217  O OG1    . THR A 1 196 ? 169.010 25.882  153.236 1.00 46.02  ? 196 THR A OG1    1 
ATOM   3218  C CG2    . THR A 1 196 ? 170.228 27.930  153.659 1.00 33.15  ? 196 THR A CG2    1 
ATOM   3219  H H      . THR A 1 196 ? 171.170 25.823  151.318 1.00 51.35  ? 196 THR A H      1 
ATOM   3220  H HA     . THR A 1 196 ? 172.214 25.934  153.834 1.00 53.94  ? 196 THR A HA     1 
ATOM   3221  H HB     . THR A 1 196 ? 170.153 26.245  154.804 1.00 48.74  ? 196 THR A HB     1 
ATOM   3222  H HG1    . THR A 1 196 ? 169.032 26.015  152.407 1.00 55.23  ? 196 THR A HG1    1 
ATOM   3223  H HG21   . THR A 1 196 ? 169.429 28.332  154.033 1.00 39.77  ? 196 THR A HG21   1 
ATOM   3224  H HG22   . THR A 1 196 ? 171.006 28.301  154.104 1.00 39.77  ? 196 THR A HG22   1 
ATOM   3225  H HG23   . THR A 1 196 ? 170.276 28.142  152.713 1.00 39.77  ? 196 THR A HG23   1 
ATOM   3226  N N      . ARG A 1 197 ? 171.081 23.665  154.449 1.00 49.34  ? 197 ARG A N      1 
ATOM   3227  C CA     . ARG A 1 197 ? 170.862 22.233  154.554 1.00 49.09  ? 197 ARG A CA     1 
ATOM   3228  C C      . ARG A 1 197 ? 169.475 21.835  154.033 1.00 49.79  ? 197 ARG A C      1 
ATOM   3229  O O      . ARG A 1 197 ? 169.146 20.652  154.009 1.00 48.65  ? 197 ARG A O      1 
ATOM   3230  C CB     . ARG A 1 197 ? 171.034 21.766  156.001 1.00 48.74  ? 197 ARG A CB     1 
ATOM   3231  C CG     . ARG A 1 197 ? 169.923 22.207  156.948 1.00 47.30  ? 197 ARG A CG     1 
ATOM   3232  C CD     . ARG A 1 197 ? 170.366 22.121  158.401 1.00 46.54  ? 197 ARG A CD     1 
ATOM   3233  N NE     . ARG A 1 197 ? 171.542 22.952  158.649 1.00 46.52  ? 197 ARG A NE     1 
ATOM   3234  C CZ     . ARG A 1 197 ? 172.471 22.699  159.566 1.00 50.61  ? 197 ARG A CZ     1 
ATOM   3235  N NH1    . ARG A 1 197 ? 172.370 21.635  160.351 1.00 52.25  ? 197 ARG A NH1    1 
ATOM   3236  N NH2    . ARG A 1 197 ? 173.512 23.515  159.695 1.00 53.13  ? 197 ARG A NH2    1 
ATOM   3237  H H      . ARG A 1 197 ? 171.119 24.075  155.204 1.00 59.21  ? 197 ARG A H      1 
ATOM   3238  H HA     . ARG A 1 197 ? 171.524 21.775  154.013 1.00 58.91  ? 197 ARG A HA     1 
ATOM   3239  H HB2    . ARG A 1 197 ? 171.063 20.796  156.012 1.00 58.49  ? 197 ARG A HB2    1 
ATOM   3240  H HB3    . ARG A 1 197 ? 171.870 22.120  156.343 1.00 58.49  ? 197 ARG A HB3    1 
ATOM   3241  H HG2    . ARG A 1 197 ? 169.684 23.127  156.757 1.00 56.77  ? 197 ARG A HG2    1 
ATOM   3242  H HG3    . ARG A 1 197 ? 169.153 21.628  156.831 1.00 56.77  ? 197 ARG A HG3    1 
ATOM   3243  H HD2    . ARG A 1 197 ? 169.648 22.431  158.974 1.00 55.85  ? 197 ARG A HD2    1 
ATOM   3244  H HD3    . ARG A 1 197 ? 170.593 21.202  158.613 1.00 55.85  ? 197 ARG A HD3    1 
ATOM   3245  H HE     . ARG A 1 197 ? 171.641 23.657  158.167 1.00 55.82  ? 197 ARG A HE     1 
ATOM   3246  H HH11   . ARG A 1 197 ? 171.701 21.101  160.269 1.00 62.69  ? 197 ARG A HH11   1 
ATOM   3247  H HH12   . ARG A 1 197 ? 172.974 21.479  160.944 1.00 62.69  ? 197 ARG A HH12   1 
ATOM   3248  H HH21   . ARG A 1 197 ? 173.580 24.208  159.190 1.00 63.75  ? 197 ARG A HH21   1 
ATOM   3249  H HH22   . ARG A 1 197 ? 174.111 23.357  160.292 1.00 63.75  ? 197 ARG A HH22   1 
ATOM   3250  N N      . ARG A 1 198 ? 168.678 22.818  153.606 1.00 50.82  ? 198 ARG A N      1 
ATOM   3251  C CA     . ARG A 1 198 ? 167.329 22.556  153.103 1.00 53.00  ? 198 ARG A CA     1 
ATOM   3252  C C      . ARG A 1 198 ? 167.128 23.001  151.654 1.00 53.93  ? 198 ARG A C      1 
ATOM   3253  O O      . ARG A 1 198 ? 166.017 22.943  151.137 1.00 54.69  ? 198 ARG A O      1 
ATOM   3254  C CB     . ARG A 1 198 ? 166.281 23.194  154.023 1.00 55.52  ? 198 ARG A CB     1 
ATOM   3255  C CG     . ARG A 1 198 ? 166.088 22.405  155.312 1.00 64.06  ? 198 ARG A CG     1 
ATOM   3256  C CD     . ARG A 1 198 ? 164.975 22.957  156.185 1.00 74.36  ? 198 ARG A CD     1 
ATOM   3257  N NE     . ARG A 1 198 ? 165.490 23.858  157.209 1.00 79.66  ? 198 ARG A NE     1 
ATOM   3258  C CZ     . ARG A 1 198 ? 166.005 23.469  158.373 1.00 78.77  ? 198 ARG A CZ     1 
ATOM   3259  N NH1    . ARG A 1 198 ? 166.082 22.181  158.682 1.00 75.61  ? 198 ARG A NH1    1 
ATOM   3260  N NH2    . ARG A 1 198 ? 166.452 24.378  159.228 1.00 80.27  ? 198 ARG A NH2    1 
ATOM   3261  H H      . ARG A 1 198 ? 168.898 23.650  153.598 1.00 60.98  ? 198 ARG A H      1 
ATOM   3262  H HA     . ARG A 1 198 ? 167.182 21.597  153.127 1.00 63.60  ? 198 ARG A HA     1 
ATOM   3263  H HB2    . ARG A 1 198 ? 166.569 24.090  154.259 1.00 66.62  ? 198 ARG A HB2    1 
ATOM   3264  H HB3    . ARG A 1 198 ? 165.430 23.228  153.560 1.00 66.62  ? 198 ARG A HB3    1 
ATOM   3265  H HG2    . ARG A 1 198 ? 165.866 21.487  155.089 1.00 76.87  ? 198 ARG A HG2    1 
ATOM   3266  H HG3    . ARG A 1 198 ? 166.911 22.432  155.824 1.00 76.87  ? 198 ARG A HG3    1 
ATOM   3267  H HD2    . ARG A 1 198 ? 164.350 23.451  155.632 1.00 89.23  ? 198 ARG A HD2    1 
ATOM   3268  H HD3    . ARG A 1 198 ? 164.522 22.222  156.628 1.00 89.23  ? 198 ARG A HD3    1 
ATOM   3269  H HE     . ARG A 1 198 ? 165.458 24.703  157.050 1.00 95.60  ? 198 ARG A HE     1 
ATOM   3270  H HH11   . ARG A 1 198 ? 165.795 21.588  158.129 1.00 90.74  ? 198 ARG A HH11   1 
ATOM   3271  H HH12   . ARG A 1 198 ? 166.416 21.939  159.437 1.00 90.74  ? 198 ARG A HH12   1 
ATOM   3272  H HH21   . ARG A 1 198 ? 166.403 25.214  159.032 1.00 96.32  ? 198 ARG A HH21   1 
ATOM   3273  H HH22   . ARG A 1 198 ? 166.784 24.133  159.983 1.00 96.32  ? 198 ARG A HH22   1 
ATOM   3274  N N      . THR A 1 199 ? 168.206 23.416  150.994 1.00 54.31  ? 199 THR A N      1 
ATOM   3275  C CA     . THR A 1 199 ? 168.132 23.876  149.601 1.00 53.65  ? 199 THR A CA     1 
ATOM   3276  C C      . THR A 1 199 ? 167.825 22.741  148.625 1.00 52.23  ? 199 THR A C      1 
ATOM   3277  O O      . THR A 1 199 ? 168.429 21.667  148.689 1.00 54.33  ? 199 THR A O      1 
ATOM   3278  C CB     . THR A 1 199 ? 169.458 24.532  149.157 1.00 49.26  ? 199 THR A CB     1 
ATOM   3279  O OG1    . THR A 1 199 ? 169.694 25.708  149.940 1.00 55.30  ? 199 THR A OG1    1 
ATOM   3280  C CG2    . THR A 1 199 ? 169.410 24.920  147.689 1.00 42.28  ? 199 THR A CG2    1 
ATOM   3281  H H      . THR A 1 199 ? 168.997 23.444  151.329 1.00 65.17  ? 199 THR A H      1 
ATOM   3282  H HA     . THR A 1 199 ? 167.428 24.538  149.523 1.00 64.37  ? 199 THR A HA     1 
ATOM   3283  H HB     . THR A 1 199 ? 170.187 23.906  149.286 1.00 59.11  ? 199 THR A HB     1 
ATOM   3284  H HG1    . THR A 1 199 ? 170.414 26.070  149.704 1.00 66.36  ? 199 THR A HG1    1 
ATOM   3285  H HG21   . THR A 1 199 ? 170.249 25.331  147.427 1.00 50.73  ? 199 THR A HG21   1 
ATOM   3286  H HG22   . THR A 1 199 ? 169.260 24.133  147.143 1.00 50.73  ? 199 THR A HG22   1 
ATOM   3287  H HG23   . THR A 1 199 ? 168.689 25.551  147.537 1.00 50.73  ? 199 THR A HG23   1 
ATOM   3288  N N      . VAL A 1 200 ? 166.893 23.002  147.715 1.00 45.93  ? 200 VAL A N      1 
ATOM   3289  C CA     . VAL A 1 200 ? 166.527 22.045  146.683 1.00 44.16  ? 200 VAL A CA     1 
ATOM   3290  C C      . VAL A 1 200 ? 166.788 22.663  145.314 1.00 45.75  ? 200 VAL A C      1 
ATOM   3291  O O      . VAL A 1 200 ? 166.142 23.642  144.931 1.00 44.79  ? 200 VAL A O      1 
ATOM   3292  C CB     . VAL A 1 200 ? 165.046 21.637  146.779 1.00 45.47  ? 200 VAL A CB     1 
ATOM   3293  C CG1    . VAL A 1 200 ? 164.721 20.597  145.727 1.00 49.11  ? 200 VAL A CG1    1 
ATOM   3294  C CG2    . VAL A 1 200 ? 164.720 21.093  148.168 1.00 41.75  ? 200 VAL A CG2    1 
ATOM   3295  H H      . VAL A 1 200 ? 166.453 23.739  147.676 1.00 55.12  ? 200 VAL A H      1 
ATOM   3296  H HA     . VAL A 1 200 ? 167.072 21.248  146.771 1.00 52.99  ? 200 VAL A HA     1 
ATOM   3297  H HB     . VAL A 1 200 ? 164.488 22.415  146.619 1.00 54.57  ? 200 VAL A HB     1 
ATOM   3298  H HG11   . VAL A 1 200 ? 163.785 20.354  145.803 1.00 58.93  ? 200 VAL A HG11   1 
ATOM   3299  H HG12   . VAL A 1 200 ? 164.895 20.972  144.849 1.00 58.93  ? 200 VAL A HG12   1 
ATOM   3300  H HG13   . VAL A 1 200 ? 165.279 19.818  145.872 1.00 58.93  ? 200 VAL A HG13   1 
ATOM   3301  H HG21   . VAL A 1 200 ? 163.783 20.845  148.198 1.00 50.10  ? 200 VAL A HG21   1 
ATOM   3302  H HG22   . VAL A 1 200 ? 165.274 20.316  148.340 1.00 50.10  ? 200 VAL A HG22   1 
ATOM   3303  H HG23   . VAL A 1 200 ? 164.902 21.781  148.827 1.00 50.10  ? 200 VAL A HG23   1 
ATOM   3304  N N      . ILE A 1 201 ? 167.748 22.096  144.590 1.00 48.19  ? 201 ILE A N      1 
ATOM   3305  C CA     . ILE A 1 201 ? 168.096 22.572  143.252 1.00 53.75  ? 201 ILE A CA     1 
ATOM   3306  C C      . ILE A 1 201 ? 167.412 21.697  142.204 1.00 56.50  ? 201 ILE A C      1 
ATOM   3307  O O      . ILE A 1 201 ? 167.752 20.524  142.052 1.00 60.67  ? 201 ILE A O      1 
ATOM   3308  C CB     . ILE A 1 201 ? 169.628 22.555  143.037 1.00 54.07  ? 201 ILE A CB     1 
ATOM   3309  C CG1    . ILE A 1 201 ? 170.308 23.482  144.047 1.00 54.81  ? 201 ILE A CG1    1 
ATOM   3310  C CG2    . ILE A 1 201 ? 169.980 22.982  141.631 1.00 54.21  ? 201 ILE A CG2    1 
ATOM   3311  C CD1    . ILE A 1 201 ? 171.824 23.447  144.001 1.00 55.09  ? 201 ILE A CD1    1 
ATOM   3312  H H      . ILE A 1 201 ? 168.219 21.426  144.853 1.00 57.83  ? 201 ILE A H      1 
ATOM   3313  H HA     . ILE A 1 201 ? 167.781 23.483  143.142 1.00 64.50  ? 201 ILE A HA     1 
ATOM   3314  H HB     . ILE A 1 201 ? 169.951 21.652  143.177 1.00 64.88  ? 201 ILE A HB     1 
ATOM   3315  H HG12   . ILE A 1 201 ? 170.029 24.394  143.870 1.00 65.78  ? 201 ILE A HG12   1 
ATOM   3316  H HG13   . ILE A 1 201 ? 170.034 23.223  144.941 1.00 65.78  ? 201 ILE A HG13   1 
ATOM   3317  H HG21   . ILE A 1 201 ? 170.945 22.962  141.528 1.00 65.05  ? 201 ILE A HG21   1 
ATOM   3318  H HG22   . ILE A 1 201 ? 169.567 22.371  141.003 1.00 65.05  ? 201 ILE A HG22   1 
ATOM   3319  H HG23   . ILE A 1 201 ? 169.651 23.883  141.483 1.00 65.05  ? 201 ILE A HG23   1 
ATOM   3320  H HD11   . ILE A 1 201 ? 172.174 24.058  144.668 1.00 66.11  ? 201 ILE A HD11   1 
ATOM   3321  H HD12   . ILE A 1 201 ? 172.124 22.544  144.189 1.00 66.11  ? 201 ILE A HD12   1 
ATOM   3322  H HD13   . ILE A 1 201 ? 172.119 23.716  143.117 1.00 66.11  ? 201 ILE A HD13   1 
ATOM   3323  N N      . ASP A 1 202 ? 166.438 22.266  141.498 1.00 56.12  ? 202 ASP A N      1 
ATOM   3324  C CA     . ASP A 1 202 ? 165.684 21.525  140.485 1.00 59.85  ? 202 ASP A CA     1 
ATOM   3325  C C      . ASP A 1 202 ? 166.042 22.023  139.085 1.00 67.39  ? 202 ASP A C      1 
ATOM   3326  O O      . ASP A 1 202 ? 165.460 22.983  138.583 1.00 72.93  ? 202 ASP A O      1 
ATOM   3327  C CB     . ASP A 1 202 ? 164.180 21.647  140.731 1.00 60.14  ? 202 ASP A CB     1 
ATOM   3328  C CG     . ASP A 1 202 ? 163.392 20.544  140.057 1.00 68.45  ? 202 ASP A CG     1 
ATOM   3329  O OD1    . ASP A 1 202 ? 163.949 19.889  139.148 1.00 75.54  ? 202 ASP A OD1    1 
ATOM   3330  O OD2    . ASP A 1 202 ? 162.218 20.329  140.435 1.00 68.65  ? 202 ASP A OD2    1 
ATOM   3331  H H      . ASP A 1 202 ? 166.192 23.085  141.586 1.00 67.35  ? 202 ASP A H      1 
ATOM   3332  H HA     . ASP A 1 202 ? 165.921 20.586  140.539 1.00 71.82  ? 202 ASP A HA     1 
ATOM   3333  H HB2    . ASP A 1 202 ? 164.010 21.598  141.685 1.00 72.16  ? 202 ASP A HB2    1 
ATOM   3334  H HB3    . ASP A 1 202 ? 163.869 22.496  140.381 1.00 72.16  ? 202 ASP A HB3    1 
ATOM   3335  N N      . VAL A 1 203 ? 167.007 21.352  138.466 1.00 68.92  ? 203 VAL A N      1 
ATOM   3336  C CA     . VAL A 1 203 ? 167.573 21.791  137.197 1.00 69.39  ? 203 VAL A CA     1 
ATOM   3337  C C      . VAL A 1 203 ? 166.526 21.779  136.091 1.00 67.36  ? 203 VAL A C      1 
ATOM   3338  O O      . VAL A 1 203 ? 166.341 22.772  135.394 1.00 67.02  ? 203 VAL A O      1 
ATOM   3339  C CB     . VAL A 1 203 ? 168.762 20.893  136.763 1.00 78.25  ? 203 VAL A CB     1 
ATOM   3340  C CG1    . VAL A 1 203 ? 169.495 21.511  135.588 1.00 75.04  ? 203 VAL A CG1    1 
ATOM   3341  C CG2    . VAL A 1 203 ? 169.728 20.675  137.921 1.00 82.63  ? 203 VAL A CG2    1 
ATOM   3342  H H      . VAL A 1 203 ? 167.357 20.626  138.767 1.00 82.70  ? 203 VAL A H      1 
ATOM   3343  H HA     . VAL A 1 203 ? 167.900 22.699  137.292 1.00 83.27  ? 203 VAL A HA     1 
ATOM   3344  H HB     . VAL A 1 203 ? 168.422 20.027  136.486 1.00 93.89  ? 203 VAL A HB     1 
ATOM   3345  H HG11   . VAL A 1 203 ? 170.232 20.933  135.336 1.00 90.04  ? 203 VAL A HG11   1 
ATOM   3346  H HG12   . VAL A 1 203 ? 168.878 21.605  134.845 1.00 90.04  ? 203 VAL A HG12   1 
ATOM   3347  H HG13   . VAL A 1 203 ? 169.832 22.382  135.850 1.00 90.04  ? 203 VAL A HG13   1 
ATOM   3348  H HG21   . VAL A 1 203 ? 170.458 20.112  137.620 1.00 99.16  ? 203 VAL A HG21   1 
ATOM   3349  H HG22   . VAL A 1 203 ? 170.071 21.535  138.211 1.00 99.16  ? 203 VAL A HG22   1 
ATOM   3350  H HG23   . VAL A 1 203 ? 169.255 20.244  138.650 1.00 99.16  ? 203 VAL A HG23   1 
ATOM   3351  N N      . ALA A 1 204 ? 165.843 20.651  135.934 1.00 68.17  ? 204 ALA A N      1 
ATOM   3352  C CA     . ALA A 1 204 ? 164.848 20.501  134.879 1.00 72.03  ? 204 ALA A CA     1 
ATOM   3353  C C      . ALA A 1 204 ? 163.770 21.577  134.966 1.00 78.55  ? 204 ALA A C      1 
ATOM   3354  O O      . ALA A 1 204 ? 163.371 22.140  133.947 1.00 85.96  ? 204 ALA A O      1 
ATOM   3355  C CB     . ALA A 1 204 ? 164.222 19.115  134.933 1.00 70.40  ? 204 ALA A CB     1 
ATOM   3356  H H      . ALA A 1 204 ? 165.937 19.954  136.428 1.00 81.80  ? 204 ALA A H      1 
ATOM   3357  H HA     . ALA A 1 204 ? 165.288 20.593  134.020 1.00 86.43  ? 204 ALA A HA     1 
ATOM   3358  H HB1    . ALA A 1 204 ? 163.564 19.038  134.224 1.00 84.48  ? 204 ALA A HB1    1 
ATOM   3359  H HB2    . ALA A 1 204 ? 164.918 18.450  134.813 1.00 84.48  ? 204 ALA A HB2    1 
ATOM   3360  H HB3    . ALA A 1 204 ? 163.795 18.995  135.796 1.00 84.48  ? 204 ALA A HB3    1 
ATOM   3361  N N      . LYS A 1 205 ? 163.301 21.861  136.178 1.00 75.32  ? 205 LYS A N      1 
ATOM   3362  C CA     . LYS A 1 205 ? 162.298 22.905  136.383 1.00 73.60  ? 205 LYS A CA     1 
ATOM   3363  C C      . LYS A 1 205 ? 162.945 24.289  136.432 1.00 67.37  ? 205 LYS A C      1 
ATOM   3364  O O      . LYS A 1 205 ? 162.247 25.310  136.405 1.00 67.00  ? 205 LYS A O      1 
ATOM   3365  C CB     . LYS A 1 205 ? 161.508 22.651  137.668 1.00 75.66  ? 205 LYS A CB     1 
ATOM   3366  C CG     . LYS A 1 205 ? 160.587 21.439  137.603 1.00 79.14  ? 205 LYS A CG     1 
ATOM   3367  C CD     . LYS A 1 205 ? 159.639 21.409  138.789 1.00 82.93  ? 205 LYS A CD     1 
ATOM   3368  C CE     . LYS A 1 205 ? 158.742 20.184  138.760 1.00 87.21  ? 205 LYS A CE     1 
ATOM   3369  N NZ     . LYS A 1 205 ? 157.878 20.148  137.552 1.00 90.74  ? 205 LYS A NZ     1 
ATOM   3370  H H      . LYS A 1 205 ? 163.548 21.464  136.900 1.00 90.38  ? 205 LYS A H      1 
ATOM   3371  H HA     . LYS A 1 205 ? 161.674 22.892  135.640 1.00 88.32  ? 205 LYS A HA     1 
ATOM   3372  H HB2    . LYS A 1 205 ? 162.134 22.508  138.395 1.00 90.79  ? 205 LYS A HB2    1 
ATOM   3373  H HB3    . LYS A 1 205 ? 160.960 23.429  137.856 1.00 90.79  ? 205 LYS A HB3    1 
ATOM   3374  H HG2    . LYS A 1 205 ? 160.059 21.480  136.790 1.00 94.97  ? 205 LYS A HG2    1 
ATOM   3375  H HG3    . LYS A 1 205 ? 161.121 20.629  137.618 1.00 94.97  ? 205 LYS A HG3    1 
ATOM   3376  H HD2    . LYS A 1 205 ? 160.155 21.388  139.610 1.00 99.51  ? 205 LYS A HD2    1 
ATOM   3377  H HD3    . LYS A 1 205 ? 159.075 22.198  138.767 1.00 99.51  ? 205 LYS A HD3    1 
ATOM   3378  H HE2    . LYS A 1 205 ? 159.293 19.386  138.761 1.00 104.66 ? 205 LYS A HE2    1 
ATOM   3379  H HE3    . LYS A 1 205 ? 158.167 20.193  139.542 1.00 104.66 ? 205 LYS A HE3    1 
ATOM   3380  H HZ1    . LYS A 1 205 ? 157.366 19.421  137.566 1.00 108.88 ? 205 LYS A HZ1    1 
ATOM   3381  H HZ2    . LYS A 1 205 ? 157.356 20.869  137.530 1.00 108.88 ? 205 LYS A HZ2    1 
ATOM   3382  H HZ3    . LYS A 1 205 ? 158.382 20.134  136.819 1.00 108.88 ? 205 LYS A HZ3    1 
ATOM   3383  N N      . GLY A 1 206 ? 164.277 24.305  136.508 1.00 58.65  ? 206 GLY A N      1 
ATOM   3384  C CA     . GLY A 1 206 ? 165.061 25.530  136.512 1.00 55.58  ? 206 GLY A CA     1 
ATOM   3385  C C      . GLY A 1 206 ? 164.838 26.461  137.694 1.00 58.05  ? 206 GLY A C      1 
ATOM   3386  O O      . GLY A 1 206 ? 164.916 27.684  137.549 1.00 55.68  ? 206 GLY A O      1 
ATOM   3387  H H      . GLY A 1 206 ? 164.759 23.594  136.560 1.00 70.38  ? 206 GLY A H      1 
ATOM   3388  H HA2    . GLY A 1 206 ? 166.002 25.297  136.494 1.00 66.69  ? 206 GLY A HA2    1 
ATOM   3389  H HA3    . GLY A 1 206 ? 164.862 26.028  135.704 1.00 66.69  ? 206 GLY A HA3    1 
ATOM   3390  N N      . GLU A 1 207 ? 164.576 25.890  138.869 1.00 62.88  ? 207 GLU A N      1 
ATOM   3391  C CA     . GLU A 1 207 ? 164.257 26.692  140.042 1.00 65.96  ? 207 GLU A CA     1 
ATOM   3392  C C      . GLU A 1 207 ? 164.951 26.171  141.292 1.00 61.17  ? 207 GLU A C      1 
ATOM   3393  O O      . GLU A 1 207 ? 165.512 25.078  141.296 1.00 58.60  ? 207 GLU A O      1 
ATOM   3394  C CB     . GLU A 1 207 ? 162.745 26.734  140.256 1.00 76.59  ? 207 GLU A CB     1 
ATOM   3395  C CG     . GLU A 1 207 ? 162.120 25.394  140.606 1.00 85.83  ? 207 GLU A CG     1 
ATOM   3396  C CD     . GLU A 1 207 ? 160.627 25.497  140.873 1.00 92.61  ? 207 GLU A CD     1 
ATOM   3397  O OE1    . GLU A 1 207 ? 160.078 24.592  141.537 1.00 89.37  ? 207 GLU A OE1    1 
ATOM   3398  O OE2    . GLU A 1 207 ? 160.004 26.481  140.417 1.00 99.88  ? 207 GLU A OE2    1 
ATOM   3399  H H      . GLU A 1 207 ? 164.577 25.042  139.010 1.00 75.46  ? 207 GLU A H      1 
ATOM   3400  H HA     . GLU A 1 207 ? 164.561 27.601  139.891 1.00 79.15  ? 207 GLU A HA     1 
ATOM   3401  H HB2    . GLU A 1 207 ? 162.552 27.347  140.983 1.00 91.91  ? 207 GLU A HB2    1 
ATOM   3402  H HB3    . GLU A 1 207 ? 162.325 27.051  139.441 1.00 91.91  ? 207 GLU A HB3    1 
ATOM   3403  H HG2    . GLU A 1 207 ? 162.251 24.781  139.865 1.00 103.00 ? 207 GLU A HG2    1 
ATOM   3404  H HG3    . GLU A 1 207 ? 162.545 25.046  141.405 1.00 103.00 ? 207 GLU A HG3    1 
ATOM   3405  N N      . VAL A 1 208 ? 164.912 26.983  142.344 1.00 60.83  ? 208 VAL A N      1 
ATOM   3406  C CA     . VAL A 1 208 ? 165.450 26.624  143.647 1.00 58.76  ? 208 VAL A CA     1 
ATOM   3407  C C      . VAL A 1 208 ? 164.350 26.757  144.685 1.00 61.52  ? 208 VAL A C      1 
ATOM   3408  O O      . VAL A 1 208 ? 163.728 27.812  144.804 1.00 64.92  ? 208 VAL A O      1 
ATOM   3409  C CB     . VAL A 1 208 ? 166.597 27.554  144.041 1.00 56.79  ? 208 VAL A CB     1 
ATOM   3410  C CG1    . VAL A 1 208 ? 167.114 27.218  145.427 1.00 62.06  ? 208 VAL A CG1    1 
ATOM   3411  C CG2    . VAL A 1 208 ? 167.716 27.457  143.040 1.00 51.21  ? 208 VAL A CG2    1 
ATOM   3412  H H      . VAL A 1 208 ? 164.567 27.770  142.325 1.00 72.99  ? 208 VAL A H      1 
ATOM   3413  H HA     . VAL A 1 208 ? 165.771 25.708  143.636 1.00 70.51  ? 208 VAL A HA     1 
ATOM   3414  H HB     . VAL A 1 208 ? 166.276 28.470  144.050 1.00 68.15  ? 208 VAL A HB     1 
ATOM   3415  H HG11   . VAL A 1 208 ? 167.839 27.823  145.649 1.00 74.48  ? 208 VAL A HG11   1 
ATOM   3416  H HG12   . VAL A 1 208 ? 166.391 27.318  146.066 1.00 74.48  ? 208 VAL A HG12   1 
ATOM   3417  H HG13   . VAL A 1 208 ? 167.434 26.302  145.431 1.00 74.48  ? 208 VAL A HG13   1 
ATOM   3418  H HG21   . VAL A 1 208 ? 168.432 28.054  143.309 1.00 61.45  ? 208 VAL A HG21   1 
ATOM   3419  H HG22   . VAL A 1 208 ? 168.039 26.543  143.016 1.00 61.45  ? 208 VAL A HG22   1 
ATOM   3420  H HG23   . VAL A 1 208 ? 167.382 27.713  142.166 1.00 61.45  ? 208 VAL A HG23   1 
ATOM   3421  N N      . ARG A 1 209 ? 164.116 25.687  145.439 1.00 60.24  ? 209 ARG A N      1 
ATOM   3422  C CA     . ARG A 1 209 ? 163.104 25.686  146.489 1.00 57.53  ? 209 ARG A CA     1 
ATOM   3423  C C      . ARG A 1 209 ? 163.733 25.428  147.861 1.00 57.21  ? 209 ARG A C      1 
ATOM   3424  O O      . ARG A 1 209 ? 164.943 25.229  147.983 1.00 54.77  ? 209 ARG A O      1 
ATOM   3425  C CB     . ARG A 1 209 ? 162.060 24.607  146.210 1.00 58.69  ? 209 ARG A CB     1 
ATOM   3426  C CG     . ARG A 1 209 ? 161.540 24.589  144.796 1.00 65.27  ? 209 ARG A CG     1 
ATOM   3427  C CD     . ARG A 1 209 ? 160.355 23.648  144.672 1.00 73.44  ? 209 ARG A CD     1 
ATOM   3428  N NE     . ARG A 1 209 ? 160.658 22.304  145.162 1.00 76.26  ? 209 ARG A NE     1 
ATOM   3429  C CZ     . ARG A 1 209 ? 161.105 21.301  144.410 1.00 72.80  ? 209 ARG A CZ     1 
ATOM   3430  N NH1    . ARG A 1 209 ? 161.317 21.464  143.107 1.00 66.63  ? 209 ARG A NH1    1 
ATOM   3431  N NH2    . ARG A 1 209 ? 161.341 20.122  144.975 1.00 73.77  ? 209 ARG A NH2    1 
ATOM   3432  H H      . ARG A 1 209 ? 164.536 24.941  145.361 1.00 72.29  ? 209 ARG A H      1 
ATOM   3433  H HA     . ARG A 1 209 ? 162.659 26.547  146.511 1.00 69.03  ? 209 ARG A HA     1 
ATOM   3434  H HB2    . ARG A 1 209 ? 162.455 23.739  146.388 1.00 70.43  ? 209 ARG A HB2    1 
ATOM   3435  H HB3    . ARG A 1 209 ? 161.303 24.748  146.800 1.00 70.43  ? 209 ARG A HB3    1 
ATOM   3436  H HG2    . ARG A 1 209 ? 161.250 25.481  144.548 1.00 78.33  ? 209 ARG A HG2    1 
ATOM   3437  H HG3    . ARG A 1 209 ? 162.239 24.282  144.199 1.00 78.33  ? 209 ARG A HG3    1 
ATOM   3438  H HD2    . ARG A 1 209 ? 159.616 23.998  145.192 1.00 88.12  ? 209 ARG A HD2    1 
ATOM   3439  H HD3    . ARG A 1 209 ? 160.102 23.578  143.738 1.00 88.12  ? 209 ARG A HD3    1 
ATOM   3440  H HE     . ARG A 1 209 ? 160.538 22.150  145.999 1.00 91.51  ? 209 ARG A HE     1 
ATOM   3441  H HH11   . ARG A 1 209 ? 161.164 22.226  142.739 1.00 79.95  ? 209 ARG A HH11   1 
ATOM   3442  H HH12   . ARG A 1 209 ? 161.606 20.808  142.632 1.00 79.95  ? 209 ARG A HH12   1 
ATOM   3443  H HH21   . ARG A 1 209 ? 161.206 20.014  145.817 1.00 88.53  ? 209 ARG A HH21   1 
ATOM   3444  H HH22   . ARG A 1 209 ? 161.631 19.467  144.498 1.00 88.53  ? 209 ARG A HH22   1 
ATOM   3445  N N      . LYS A 1 210 ? 162.888 25.452  148.888 1.00 58.45  ? 210 LYS A N      1 
ATOM   3446  C CA     . LYS A 1 210 ? 163.257 25.019  150.226 1.00 54.06  ? 210 LYS A CA     1 
ATOM   3447  C C      . LYS A 1 210 ? 162.504 23.717  150.503 1.00 50.04  ? 210 LYS A C      1 
ATOM   3448  O O      . LYS A 1 210 ? 161.314 23.603  150.187 1.00 52.58  ? 210 LYS A O      1 
ATOM   3449  C CB     . LYS A 1 210 ? 162.895 26.097  151.248 1.00 55.01  ? 210 LYS A CB     1 
ATOM   3450  C CG     . LYS A 1 210 ? 163.240 25.745  152.685 1.00 61.56  ? 210 LYS A CG     1 
ATOM   3451  C CD     . LYS A 1 210 ? 162.744 26.809  153.666 1.00 73.69  ? 210 LYS A CD     1 
ATOM   3452  C CE     . LYS A 1 210 ? 163.050 26.434  155.112 1.00 86.49  ? 210 LYS A CE     1 
ATOM   3453  N NZ     . LYS A 1 210 ? 162.369 25.174  155.543 1.00 96.18  ? 210 LYS A NZ     1 
ATOM   3454  H H      . LYS A 1 210 ? 162.074 25.722  148.829 1.00 70.13  ? 210 LYS A H      1 
ATOM   3455  H HA     . LYS A 1 210 ? 164.211 24.849  150.269 1.00 64.88  ? 210 LYS A HA     1 
ATOM   3456  H HB2    . LYS A 1 210 ? 163.373 26.911  151.022 1.00 66.01  ? 210 LYS A HB2    1 
ATOM   3457  H HB3    . LYS A 1 210 ? 161.940 26.257  151.205 1.00 66.01  ? 210 LYS A HB3    1 
ATOM   3458  H HG2    . LYS A 1 210 ? 162.820 24.901  152.915 1.00 73.87  ? 210 LYS A HG2    1 
ATOM   3459  H HG3    . LYS A 1 210 ? 164.203 25.676  152.774 1.00 73.87  ? 210 LYS A HG3    1 
ATOM   3460  H HD2    . LYS A 1 210 ? 163.183 27.652  153.472 1.00 88.43  ? 210 LYS A HD2    1 
ATOM   3461  H HD3    . LYS A 1 210 ? 161.783 26.904  153.575 1.00 88.43  ? 210 LYS A HD3    1 
ATOM   3462  H HE2    . LYS A 1 210 ? 164.007 26.306  155.209 1.00 103.79 ? 210 LYS A HE2    1 
ATOM   3463  H HE3    . LYS A 1 210 ? 162.751 27.150  155.694 1.00 103.79 ? 210 LYS A HE3    1 
ATOM   3464  H HZ1    . LYS A 1 210 ? 162.574 24.993  156.390 1.00 115.42 ? 210 LYS A HZ1    1 
ATOM   3465  H HZ2    . LYS A 1 210 ? 161.487 25.266  155.473 1.00 115.42 ? 210 LYS A HZ2    1 
ATOM   3466  H HZ3    . LYS A 1 210 ? 162.631 24.496  155.030 1.00 115.42 ? 210 LYS A HZ3    1 
ATOM   3467  N N      . GLY A 1 211 ? 163.210 22.737  151.067 1.00 39.55  ? 211 GLY A N      1 
ATOM   3468  C CA     . GLY A 1 211 ? 162.670 21.412  151.292 1.00 40.16  ? 211 GLY A CA     1 
ATOM   3469  C C      . GLY A 1 211 ? 163.101 20.853  152.637 1.00 52.43  ? 211 GLY A C      1 
ATOM   3470  O O      . GLY A 1 211 ? 163.370 21.605  153.576 1.00 52.25  ? 211 GLY A O      1 
ATOM   3471  H H      . GLY A 1 211 ? 164.023 22.826  151.332 1.00 47.46  ? 211 GLY A H      1 
ATOM   3472  H HA2    . GLY A 1 211 ? 161.701 21.447  151.267 1.00 48.19  ? 211 GLY A HA2    1 
ATOM   3473  H HA3    . GLY A 1 211 ? 162.977 20.812  150.595 1.00 48.19  ? 211 GLY A HA3    1 
ATOM   3474  N N      . GLU A 1 212 ? 163.170 19.529  152.728 1.00 64.72  ? 212 GLU A N      1 
ATOM   3475  C CA     . GLU A 1 212 ? 163.457 18.858  153.990 1.00 73.81  ? 212 GLU A CA     1 
ATOM   3476  C C      . GLU A 1 212 ? 164.960 18.680  154.186 1.00 66.78  ? 212 GLU A C      1 
ATOM   3477  O O      . GLU A 1 212 ? 165.458 18.692  155.311 1.00 67.26  ? 212 GLU A O      1 
ATOM   3478  C CB     . GLU A 1 212 ? 162.763 17.497  154.020 1.00 88.57  ? 212 GLU A CB     1 
ATOM   3479  C CG     . GLU A 1 212 ? 162.605 16.907  155.411 1.00 101.90 ? 212 GLU A CG     1 
ATOM   3480  C CD     . GLU A 1 212 ? 161.628 17.685  156.280 1.00 109.51 ? 212 GLU A CD     1 
ATOM   3481  O OE1    . GLU A 1 212 ? 160.827 18.470  155.725 1.00 112.94 ? 212 GLU A OE1    1 
ATOM   3482  O OE2    . GLU A 1 212 ? 161.667 17.509  157.519 1.00 109.74 ? 212 GLU A OE2    1 
ATOM   3483  H H      . GLU A 1 212 ? 163.053 18.992  152.067 1.00 77.66  ? 212 GLU A H      1 
ATOM   3484  H HA     . GLU A 1 212 ? 163.114 19.393  154.724 1.00 88.57  ? 212 GLU A HA     1 
ATOM   3485  H HB2    . GLU A 1 212 ? 161.876 17.591  153.637 1.00 106.29 ? 212 GLU A HB2    1 
ATOM   3486  H HB3    . GLU A 1 212 ? 163.282 16.871  153.491 1.00 106.29 ? 212 GLU A HB3    1 
ATOM   3487  H HG2    . GLU A 1 212 ? 162.277 15.998  155.333 1.00 122.28 ? 212 GLU A HG2    1 
ATOM   3488  H HG3    . GLU A 1 212 ? 163.468 16.911  155.854 1.00 122.28 ? 212 GLU A HG3    1 
ATOM   3489  N N      . GLU A 1 213 ? 165.676 18.517  153.080 1.00 58.00  ? 213 GLU A N      1 
ATOM   3490  C CA     . GLU A 1 213 ? 167.111 18.282  153.116 1.00 48.46  ? 213 GLU A CA     1 
ATOM   3491  C C      . GLU A 1 213 ? 167.727 18.882  151.861 1.00 51.08  ? 213 GLU A C      1 
ATOM   3492  O O      . GLU A 1 213 ? 167.010 19.348  150.975 1.00 51.52  ? 213 GLU A O      1 
ATOM   3493  C CB     . GLU A 1 213 ? 167.391 16.783  153.181 1.00 48.38  ? 213 GLU A CB     1 
ATOM   3494  C CG     . GLU A 1 213 ? 167.017 16.031  151.916 1.00 59.76  ? 213 GLU A CG     1 
ATOM   3495  C CD     . GLU A 1 213 ? 166.715 14.554  152.148 1.00 72.61  ? 213 GLU A CD     1 
ATOM   3496  O OE1    . GLU A 1 213 ? 167.080 14.023  153.221 1.00 79.22  ? 213 GLU A OE1    1 
ATOM   3497  O OE2    . GLU A 1 213 ? 166.100 13.923  151.251 1.00 75.98  ? 213 GLU A OE2    1 
ATOM   3498  H H      . GLU A 1 213 ? 165.348 18.539  152.285 1.00 69.59  ? 213 GLU A H      1 
ATOM   3499  H HA     . GLU A 1 213 ? 167.499 18.711  153.895 1.00 58.15  ? 213 GLU A HA     1 
ATOM   3500  H HB2    . GLU A 1 213 ? 168.339 16.649  153.336 1.00 58.05  ? 213 GLU A HB2    1 
ATOM   3501  H HB3    . GLU A 1 213 ? 166.881 16.402  153.913 1.00 58.05  ? 213 GLU A HB3    1 
ATOM   3502  H HG2    . GLU A 1 213 ? 166.225 16.439  151.532 1.00 71.72  ? 213 GLU A HG2    1 
ATOM   3503  H HG3    . GLU A 1 213 ? 167.754 16.089  151.289 1.00 71.72  ? 213 GLU A HG3    1 
ATOM   3504  N N      . PHE A 1 214 ? 169.052 18.894  151.786 1.00 55.61  ? 214 PHE A N      1 
ATOM   3505  C CA     . PHE A 1 214 ? 169.724 19.309  150.562 1.00 53.96  ? 214 PHE A CA     1 
ATOM   3506  C C      . PHE A 1 214 ? 169.408 18.284  149.477 1.00 55.81  ? 214 PHE A C      1 
ATOM   3507  O O      . PHE A 1 214 ? 169.620 17.090  149.672 1.00 57.64  ? 214 PHE A O      1 
ATOM   3508  C CB     . PHE A 1 214 ? 171.228 19.411  150.774 1.00 47.15  ? 214 PHE A CB     1 
ATOM   3509  C CG     . PHE A 1 214 ? 171.963 19.967  149.593 1.00 50.11  ? 214 PHE A CG     1 
ATOM   3510  C CD1    . PHE A 1 214 ? 172.110 21.336  149.433 1.00 51.09  ? 214 PHE A CD1    1 
ATOM   3511  C CD2    . PHE A 1 214 ? 172.504 19.123  148.641 1.00 53.43  ? 214 PHE A CD2    1 
ATOM   3512  C CE1    . PHE A 1 214 ? 172.790 21.851  148.349 1.00 53.59  ? 214 PHE A CE1    1 
ATOM   3513  C CE2    . PHE A 1 214 ? 173.186 19.626  147.555 1.00 55.94  ? 214 PHE A CE2    1 
ATOM   3514  C CZ     . PHE A 1 214 ? 173.329 20.997  147.405 1.00 56.54  ? 214 PHE A CZ     1 
ATOM   3515  H H      . PHE A 1 214 ? 169.582 18.668  152.425 1.00 66.73  ? 214 PHE A H      1 
ATOM   3516  H HA     . PHE A 1 214 ? 169.389 20.175  150.281 1.00 64.75  ? 214 PHE A HA     1 
ATOM   3517  H HB2    . PHE A 1 214 ? 171.400 19.992  151.531 1.00 56.58  ? 214 PHE A HB2    1 
ATOM   3518  H HB3    . PHE A 1 214 ? 171.580 18.525  150.952 1.00 56.58  ? 214 PHE A HB3    1 
ATOM   3519  H HD1    . PHE A 1 214 ? 171.751 21.914  150.067 1.00 61.31  ? 214 PHE A HD1    1 
ATOM   3520  H HD2    . PHE A 1 214 ? 172.412 18.202  148.739 1.00 64.12  ? 214 PHE A HD2    1 
ATOM   3521  H HE1    . PHE A 1 214 ? 172.884 22.771  148.252 1.00 64.31  ? 214 PHE A HE1    1 
ATOM   3522  H HE2    . PHE A 1 214 ? 173.546 19.048  146.922 1.00 67.13  ? 214 PHE A HE2    1 
ATOM   3523  H HZ     . PHE A 1 214 ? 173.786 21.341  146.672 1.00 67.84  ? 214 PHE A HZ     1 
ATOM   3524  N N      . PHE A 1 215 ? 168.905 18.751  148.338 1.00 52.37  ? 215 PHE A N      1 
ATOM   3525  C CA     . PHE A 1 215 ? 168.343 17.861  147.333 1.00 48.91  ? 215 PHE A CA     1 
ATOM   3526  C C      . PHE A 1 215 ? 168.531 18.426  145.938 1.00 47.66  ? 215 PHE A C      1 
ATOM   3527  O O      . PHE A 1 215 ? 168.029 19.499  145.618 1.00 47.24  ? 215 PHE A O      1 
ATOM   3528  C CB     . PHE A 1 215 ? 166.855 17.659  147.618 1.00 53.64  ? 215 PHE A CB     1 
ATOM   3529  C CG     . PHE A 1 215 ? 166.274 16.426  146.988 1.00 57.53  ? 215 PHE A CG     1 
ATOM   3530  C CD1    . PHE A 1 215 ? 166.102 16.346  145.619 1.00 60.12  ? 215 PHE A CD1    1 
ATOM   3531  C CD2    . PHE A 1 215 ? 165.886 15.355  147.773 1.00 57.82  ? 215 PHE A CD2    1 
ATOM   3532  C CE1    . PHE A 1 215 ? 165.565 15.222  145.045 1.00 62.33  ? 215 PHE A CE1    1 
ATOM   3533  C CE2    . PHE A 1 215 ? 165.345 14.229  147.207 1.00 59.57  ? 215 PHE A CE2    1 
ATOM   3534  C CZ     . PHE A 1 215 ? 165.183 14.159  145.843 1.00 62.28  ? 215 PHE A CZ     1 
ATOM   3535  H H      . PHE A 1 215 ? 168.878 19.584  148.124 1.00 62.85  ? 215 PHE A H      1 
ATOM   3536  H HA     . PHE A 1 215 ? 168.786 16.999  147.380 1.00 58.69  ? 215 PHE A HA     1 
ATOM   3537  H HB2    . PHE A 1 215 ? 166.728 17.588  148.577 1.00 64.36  ? 215 PHE A HB2    1 
ATOM   3538  H HB3    . PHE A 1 215 ? 166.366 18.424  147.277 1.00 64.36  ? 215 PHE A HB3    1 
ATOM   3539  H HD1    . PHE A 1 215 ? 166.358 17.060  145.080 1.00 72.14  ? 215 PHE A HD1    1 
ATOM   3540  H HD2    . PHE A 1 215 ? 165.993 15.399  148.696 1.00 69.39  ? 215 PHE A HD2    1 
ATOM   3541  H HE1    . PHE A 1 215 ? 165.455 15.176  144.123 1.00 74.79  ? 215 PHE A HE1    1 
ATOM   3542  H HE2    . PHE A 1 215 ? 165.090 13.514  147.745 1.00 71.48  ? 215 PHE A HE2    1 
ATOM   3543  H HZ     . PHE A 1 215 ? 164.819 13.395  145.456 1.00 74.74  ? 215 PHE A HZ     1 
ATOM   3544  N N      . VAL A 1 216 ? 169.271 17.703  145.107 1.00 53.91  ? 216 VAL A N      1 
ATOM   3545  C CA     . VAL A 1 216 ? 169.480 18.089  143.714 1.00 55.36  ? 216 VAL A CA     1 
ATOM   3546  C C      . VAL A 1 216 ? 168.700 17.124  142.837 1.00 57.23  ? 216 VAL A C      1 
ATOM   3547  O O      . VAL A 1 216 ? 169.090 15.972  142.667 1.00 59.64  ? 216 VAL A O      1 
ATOM   3548  C CB     . VAL A 1 216 ? 170.961 18.035  143.340 1.00 55.03  ? 216 VAL A CB     1 
ATOM   3549  C CG1    . VAL A 1 216 ? 171.172 18.492  141.912 1.00 55.16  ? 216 VAL A CG1    1 
ATOM   3550  C CG2    . VAL A 1 216 ? 171.760 18.897  144.280 1.00 56.04  ? 216 VAL A CG2    1 
ATOM   3551  H H      . VAL A 1 216 ? 169.670 16.974  145.328 1.00 64.69  ? 216 VAL A H      1 
ATOM   3552  H HA     . VAL A 1 216 ? 169.149 18.989  143.565 1.00 66.43  ? 216 VAL A HA     1 
ATOM   3553  H HB     . VAL A 1 216 ? 171.279 17.122  143.419 1.00 66.03  ? 216 VAL A HB     1 
ATOM   3554  H HG11   . VAL A 1 216 ? 172.118 18.447  141.704 1.00 66.20  ? 216 VAL A HG11   1 
ATOM   3555  H HG12   . VAL A 1 216 ? 170.674 17.910  141.318 1.00 66.20  ? 216 VAL A HG12   1 
ATOM   3556  H HG13   . VAL A 1 216 ? 170.856 19.405  141.824 1.00 66.20  ? 216 VAL A HG13   1 
ATOM   3557  H HG21   . VAL A 1 216 ? 172.696 18.852  144.030 1.00 67.25  ? 216 VAL A HG21   1 
ATOM   3558  H HG22   . VAL A 1 216 ? 171.443 19.812  144.215 1.00 67.25  ? 216 VAL A HG22   1 
ATOM   3559  H HG23   . VAL A 1 216 ? 171.642 18.570  145.185 1.00 67.25  ? 216 VAL A HG23   1 
ATOM   3560  N N      . VAL A 1 217 ? 167.587 17.595  142.294 1.00 55.32  ? 217 VAL A N      1 
ATOM   3561  C CA     . VAL A 1 217 ? 166.684 16.738  141.545 1.00 55.50  ? 217 VAL A CA     1 
ATOM   3562  C C      . VAL A 1 217 ? 167.346 16.279  140.257 1.00 58.25  ? 217 VAL A C      1 
ATOM   3563  O O      . VAL A 1 217 ? 167.822 17.097  139.475 1.00 63.02  ? 217 VAL A O      1 
ATOM   3564  C CB     . VAL A 1 217 ? 165.370 17.483  141.222 1.00 52.46  ? 217 VAL A CB     1 
ATOM   3565  C CG1    . VAL A 1 217 ? 164.398 16.577  140.483 1.00 49.20  ? 217 VAL A CG1    1 
ATOM   3566  C CG2    . VAL A 1 217 ? 164.739 17.999  142.511 1.00 53.32  ? 217 VAL A CG2    1 
ATOM   3567  H H      . VAL A 1 217 ? 167.330 18.414  142.347 1.00 66.39  ? 217 VAL A H      1 
ATOM   3568  H HA     . VAL A 1 217 ? 166.470 15.955  142.075 1.00 66.60  ? 217 VAL A HA     1 
ATOM   3569  H HB     . VAL A 1 217 ? 165.565 18.245  140.654 1.00 62.95  ? 217 VAL A HB     1 
ATOM   3570  H HG11   . VAL A 1 217 ? 163.585 17.073  140.296 1.00 59.04  ? 217 VAL A HG11   1 
ATOM   3571  H HG12   . VAL A 1 217 ? 164.807 16.286  139.653 1.00 59.04  ? 217 VAL A HG12   1 
ATOM   3572  H HG13   . VAL A 1 217 ? 164.197 15.809  141.040 1.00 59.04  ? 217 VAL A HG13   1 
ATOM   3573  H HG21   . VAL A 1 217 ? 163.915 18.464  142.295 1.00 63.98  ? 217 VAL A HG21   1 
ATOM   3574  H HG22   . VAL A 1 217 ? 164.551 17.246  143.093 1.00 63.98  ? 217 VAL A HG22   1 
ATOM   3575  H HG23   . VAL A 1 217 ? 165.358 18.607  142.944 1.00 63.98  ? 217 VAL A HG23   1 
ATOM   3576  N N      . ASP A 1 218 ? 167.385 14.967  140.043 1.00 60.34  ? 218 ASP A N      1 
ATOM   3577  C CA     . ASP A 1 218 ? 167.927 14.410  138.804 1.00 65.66  ? 218 ASP A CA     1 
ATOM   3578  C C      . ASP A 1 218 ? 166.972 14.725  137.663 1.00 63.33  ? 218 ASP A C      1 
ATOM   3579  O O      . ASP A 1 218 ? 165.796 14.400  137.761 1.00 63.65  ? 218 ASP A O      1 
ATOM   3580  C CB     . ASP A 1 218 ? 168.094 12.891  138.934 1.00 73.44  ? 218 ASP A CB     1 
ATOM   3581  C CG     . ASP A 1 218 ? 168.818 12.270  137.749 1.00 80.22  ? 218 ASP A CG     1 
ATOM   3582  O OD1    . ASP A 1 218 ? 168.621 12.726  136.605 1.00 83.99  ? 218 ASP A OD1    1 
ATOM   3583  O OD2    . ASP A 1 218 ? 169.594 11.319  137.960 1.00 81.27  ? 218 ASP A OD2    1 
ATOM   3584  H H      . ASP A 1 218 ? 167.102 14.376  140.600 1.00 72.40  ? 218 ASP A H      1 
ATOM   3585  H HA     . ASP A 1 218 ? 168.791 14.807  138.612 1.00 78.79  ? 218 ASP A HA     1 
ATOM   3586  H HB2    . ASP A 1 218 ? 168.607 12.697  139.734 1.00 88.12  ? 218 ASP A HB2    1 
ATOM   3587  H HB3    . ASP A 1 218 ? 167.216 12.482  138.997 1.00 88.12  ? 218 ASP A HB3    1 
ATOM   3588  N N      . PRO A 1 219 ? 167.463 15.351  136.573 1.00 66.27  ? 219 PRO A N      1 
ATOM   3589  C CA     . PRO A 1 219 ? 166.572 15.640  135.433 1.00 64.59  ? 219 PRO A CA     1 
ATOM   3590  C C      . PRO A 1 219 ? 165.945 14.397  134.817 1.00 62.15  ? 219 PRO A C      1 
ATOM   3591  O O      . PRO A 1 219 ? 164.953 14.513  134.107 1.00 62.84  ? 219 PRO A O      1 
ATOM   3592  C CB     . PRO A 1 219 ? 167.504 16.283  134.401 1.00 66.22  ? 219 PRO A CB     1 
ATOM   3593  C CG     . PRO A 1 219 ? 168.637 16.806  135.168 1.00 69.81  ? 219 PRO A CG     1 
ATOM   3594  C CD     . PRO A 1 219 ? 168.822 15.870  136.340 1.00 69.57  ? 219 PRO A CD     1 
ATOM   3595  H HA     . PRO A 1 219 ? 165.879 16.269  135.687 1.00 77.50  ? 219 PRO A HA     1 
ATOM   3596  H HB2    . PRO A 1 219 ? 167.801 15.612  133.767 1.00 79.46  ? 219 PRO A HB2    1 
ATOM   3597  H HB3    . PRO A 1 219 ? 167.039 17.002  133.945 1.00 79.46  ? 219 PRO A HB3    1 
ATOM   3598  H HG2    . PRO A 1 219 ? 169.430 16.813  134.610 1.00 83.77  ? 219 PRO A HG2    1 
ATOM   3599  H HG3    . PRO A 1 219 ? 168.432 17.702  135.478 1.00 83.77  ? 219 PRO A HG3    1 
ATOM   3600  H HD2    . PRO A 1 219 ? 169.424 15.147  136.104 1.00 83.49  ? 219 PRO A HD2    1 
ATOM   3601  H HD3    . PRO A 1 219 ? 169.136 16.358  137.117 1.00 83.49  ? 219 PRO A HD3    1 
ATOM   3602  N N      . VAL A 1 220 ? 166.525 13.232  135.087 1.00 64.59  ? 220 VAL A N      1 
ATOM   3603  C CA     . VAL A 1 220 ? 166.051 11.970  134.532 1.00 73.17  ? 220 VAL A CA     1 
ATOM   3604  C C      . VAL A 1 220 ? 164.983 11.331  135.419 1.00 77.39  ? 220 VAL A C      1 
ATOM   3605  O O      . VAL A 1 220 ? 164.100 10.622  134.933 1.00 80.08  ? 220 VAL A O      1 
ATOM   3606  C CB     . VAL A 1 220 ? 167.230 10.983  134.357 1.00 80.53  ? 220 VAL A CB     1 
ATOM   3607  C CG1    . VAL A 1 220 ? 166.739 9.621   133.872 1.00 93.04  ? 220 VAL A CG1    1 
ATOM   3608  C CG2    . VAL A 1 220 ? 168.257 11.553  133.387 1.00 75.35  ? 220 VAL A CG2    1 
ATOM   3609  H H      . VAL A 1 220 ? 167.210 13.145  135.600 1.00 77.51  ? 220 VAL A H      1 
ATOM   3610  H HA     . VAL A 1 220 ? 165.661 12.133  133.659 1.00 87.81  ? 220 VAL A HA     1 
ATOM   3611  H HB     . VAL A 1 220 ? 167.666 10.857  135.215 1.00 96.63  ? 220 VAL A HB     1 
ATOM   3612  H HG11   . VAL A 1 220 ? 167.500 9.028   133.773 1.00 111.65 ? 220 VAL A HG11   1 
ATOM   3613  H HG12   . VAL A 1 220 ? 166.120 9.258   134.525 1.00 111.65 ? 220 VAL A HG12   1 
ATOM   3614  H HG13   . VAL A 1 220 ? 166.293 9.732   133.018 1.00 111.65 ? 220 VAL A HG13   1 
ATOM   3615  H HG21   . VAL A 1 220 ? 168.986 10.920  133.292 1.00 90.41  ? 220 VAL A HG21   1 
ATOM   3616  H HG22   . VAL A 1 220 ? 167.832 11.699  132.528 1.00 90.41  ? 220 VAL A HG22   1 
ATOM   3617  H HG23   . VAL A 1 220 ? 168.592 12.392  133.739 1.00 90.41  ? 220 VAL A HG23   1 
ATOM   3618  N N      . ASP A 1 221 ? 165.076 11.586  136.720 1.00 80.37  ? 221 ASP A N      1 
ATOM   3619  C CA     . ASP A 1 221 ? 164.179 10.992  137.705 1.00 83.40  ? 221 ASP A CA     1 
ATOM   3620  C C      . ASP A 1 221 ? 163.961 11.997  138.826 1.00 82.22  ? 221 ASP A C      1 
ATOM   3621  O O      . ASP A 1 221 ? 164.879 12.291  139.585 1.00 80.54  ? 221 ASP A O      1 
ATOM   3622  C CB     . ASP A 1 221 ? 164.808 9.713   138.262 1.00 86.72  ? 221 ASP A CB     1 
ATOM   3623  C CG     . ASP A 1 221 ? 163.835 8.872   139.067 1.00 92.47  ? 221 ASP A CG     1 
ATOM   3624  O OD1    . ASP A 1 221 ? 162.831 9.416   139.577 1.00 89.25  ? 221 ASP A OD1    1 
ATOM   3625  O OD2    . ASP A 1 221 ? 164.090 7.655   139.198 1.00 100.41 ? 221 ASP A OD2    1 
ATOM   3626  H H      . ASP A 1 221 ? 165.664 12.112  137.064 1.00 96.45  ? 221 ASP A H      1 
ATOM   3627  H HA     . ASP A 1 221 ? 163.326 10.778  137.297 1.00 100.08 ? 221 ASP A HA     1 
ATOM   3628  H HB2    . ASP A 1 221 ? 165.129 9.173   137.523 1.00 104.06 ? 221 ASP A HB2    1 
ATOM   3629  H HB3    . ASP A 1 221 ? 165.548 9.952   138.842 1.00 104.06 ? 221 ASP A HB3    1 
ATOM   3630  N N      . GLU A 1 222 ? 162.747 12.526  138.930 1.00 84.57  ? 222 GLU A N      1 
ATOM   3631  C CA     . GLU A 1 222 ? 162.453 13.569  139.911 1.00 85.92  ? 222 GLU A CA     1 
ATOM   3632  C C      . GLU A 1 222 ? 162.537 13.078  141.359 1.00 77.70  ? 222 GLU A C      1 
ATOM   3633  O O      . GLU A 1 222 ? 162.695 13.874  142.284 1.00 75.26  ? 222 GLU A O      1 
ATOM   3634  C CB     . GLU A 1 222 ? 161.069 14.162  139.652 1.00 95.88  ? 222 GLU A CB     1 
ATOM   3635  C CG     . GLU A 1 222 ? 159.929 13.175  139.830 1.00 106.77 ? 222 GLU A CG     1 
ATOM   3636  C CD     . GLU A 1 222 ? 158.568 13.823  139.659 1.00 116.14 ? 222 GLU A CD     1 
ATOM   3637  O OE1    . GLU A 1 222 ? 158.512 15.062  139.494 1.00 115.55 ? 222 GLU A OE1    1 
ATOM   3638  O OE2    . GLU A 1 222 ? 157.554 13.093  139.693 1.00 123.12 ? 222 GLU A OE2    1 
ATOM   3639  H H      . GLU A 1 222 ? 162.074 12.300  138.445 1.00 101.48 ? 222 GLU A H      1 
ATOM   3640  H HA     . GLU A 1 222 ? 163.102 14.283  139.806 1.00 103.11 ? 222 GLU A HA     1 
ATOM   3641  H HB2    . GLU A 1 222 ? 160.924 14.895  140.270 1.00 115.05 ? 222 GLU A HB2    1 
ATOM   3642  H HB3    . GLU A 1 222 ? 161.036 14.490  138.740 1.00 115.05 ? 222 GLU A HB3    1 
ATOM   3643  H HG2    . GLU A 1 222 ? 160.013 12.472  139.167 1.00 128.13 ? 222 GLU A HG2    1 
ATOM   3644  H HG3    . GLU A 1 222 ? 159.973 12.797  140.722 1.00 128.13 ? 222 GLU A HG3    1 
ATOM   3645  N N      . LYS A 1 223 ? 162.438 11.769  141.553 1.00 73.53  ? 223 LYS A N      1 
ATOM   3646  C CA     . LYS A 1 223 ? 162.371 11.210  142.898 1.00 71.65  ? 223 LYS A CA     1 
ATOM   3647  C C      . LYS A 1 223 ? 163.751 11.017  143.531 1.00 71.38  ? 223 LYS A C      1 
ATOM   3648  O O      . LYS A 1 223 ? 163.853 10.774  144.736 1.00 73.04  ? 223 LYS A O      1 
ATOM   3649  C CB     . LYS A 1 223 ? 161.598 9.885   142.884 1.00 74.56  ? 223 LYS A CB     1 
ATOM   3650  C CG     . LYS A 1 223 ? 160.119 10.048  142.545 1.00 83.12  ? 223 LYS A CG     1 
ATOM   3651  C CD     . LYS A 1 223 ? 159.361 8.736   142.675 1.00 93.82  ? 223 LYS A CD     1 
ATOM   3652  C CE     . LYS A 1 223 ? 157.848 8.930   142.555 1.00 100.79 ? 223 LYS A CE     1 
ATOM   3653  N NZ     . LYS A 1 223 ? 157.432 9.484   141.231 1.00 103.22 ? 223 LYS A NZ     1 
ATOM   3654  H H      . LYS A 1 223 ? 162.407 11.183  140.924 1.00 88.24  ? 223 LYS A H      1 
ATOM   3655  H HA     . LYS A 1 223 ? 161.878 11.827  143.461 1.00 85.97  ? 223 LYS A HA     1 
ATOM   3656  H HB2    . LYS A 1 223 ? 161.993 9.298   142.220 1.00 89.48  ? 223 LYS A HB2    1 
ATOM   3657  H HB3    . LYS A 1 223 ? 161.659 9.477   143.762 1.00 89.48  ? 223 LYS A HB3    1 
ATOM   3658  H HG2    . LYS A 1 223 ? 159.721 10.690  143.154 1.00 99.74  ? 223 LYS A HG2    1 
ATOM   3659  H HG3    . LYS A 1 223 ? 160.034 10.358  141.629 1.00 99.74  ? 223 LYS A HG3    1 
ATOM   3660  H HD2    . LYS A 1 223 ? 159.645 8.133   141.970 1.00 112.59 ? 223 LYS A HD2    1 
ATOM   3661  H HD3    . LYS A 1 223 ? 159.548 8.346   143.544 1.00 112.59 ? 223 LYS A HD3    1 
ATOM   3662  H HE2    . LYS A 1 223 ? 157.410 8.072   142.671 1.00 120.95 ? 223 LYS A HE2    1 
ATOM   3663  H HE3    . LYS A 1 223 ? 157.554 9.547   143.243 1.00 120.95 ? 223 LYS A HE3    1 
ATOM   3664  H HZ1    . LYS A 1 223 ? 156.548 9.579   141.206 1.00 123.86 ? 223 LYS A HZ1    1 
ATOM   3665  H HZ2    . LYS A 1 223 ? 157.813 10.277  141.101 1.00 123.86 ? 223 LYS A HZ2    1 
ATOM   3666  H HZ3    . LYS A 1 223 ? 157.682 8.932   140.579 1.00 123.86 ? 223 LYS A HZ3    1 
ATOM   3667  N N      . ARG A 1 224 ? 164.808 11.151  142.736 1.00 70.15  ? 224 ARG A N      1 
ATOM   3668  C CA     . ARG A 1 224 ? 166.148 10.845  143.226 1.00 70.78  ? 224 ARG A CA     1 
ATOM   3669  C C      . ARG A 1 224 ? 167.043 12.075  143.448 1.00 63.73  ? 224 ARG A C      1 
ATOM   3670  O O      . ARG A 1 224 ? 167.055 13.022  142.652 1.00 60.06  ? 224 ARG A O      1 
ATOM   3671  C CB     . ARG A 1 224 ? 166.828 9.846   142.292 1.00 80.24  ? 224 ARG A CB     1 
ATOM   3672  C CG     . ARG A 1 224 ? 167.494 10.467  141.100 1.00 90.32  ? 224 ARG A CG     1 
ATOM   3673  C CD     . ARG A 1 224 ? 168.178 9.415   140.285 1.00 101.62 ? 224 ARG A CD     1 
ATOM   3674  N NE     . ARG A 1 224 ? 169.155 8.661   141.075 1.00 108.40 ? 224 ARG A NE     1 
ATOM   3675  C CZ     . ARG A 1 224 ? 170.451 8.965   141.177 1.00 110.71 ? 224 ARG A CZ     1 
ATOM   3676  N NH1    . ARG A 1 224 ? 170.962 10.010  140.529 1.00 109.60 ? 224 ARG A NH1    1 
ATOM   3677  N NH2    . ARG A 1 224 ? 171.249 8.217   141.930 1.00 111.33 ? 224 ARG A NH2    1 
ATOM   3678  H H      . ARG A 1 224 ? 164.778 11.415  141.918 1.00 84.18  ? 224 ARG A H      1 
ATOM   3679  H HA     . ARG A 1 224 ? 166.056 10.407  144.087 1.00 84.93  ? 224 ARG A HA     1 
ATOM   3680  H HB2    . ARG A 1 224 ? 167.506 9.366   142.792 1.00 96.29  ? 224 ARG A HB2    1 
ATOM   3681  H HB3    . ARG A 1 224 ? 166.160 9.223   141.965 1.00 96.29  ? 224 ARG A HB3    1 
ATOM   3682  H HG2    . ARG A 1 224 ? 166.827 10.902  140.546 1.00 108.38 ? 224 ARG A HG2    1 
ATOM   3683  H HG3    . ARG A 1 224 ? 168.159 11.108  141.398 1.00 108.38 ? 224 ARG A HG3    1 
ATOM   3684  H HD2    . ARG A 1 224 ? 167.516 8.791   139.948 1.00 121.94 ? 224 ARG A HD2    1 
ATOM   3685  H HD3    . ARG A 1 224 ? 168.646 9.837   139.547 1.00 121.94 ? 224 ARG A HD3    1 
ATOM   3686  H HE     . ARG A 1 224 ? 168.873 7.972   141.505 1.00 130.08 ? 224 ARG A HE     1 
ATOM   3687  H HH11   . ARG A 1 224 ? 170.455 10.503  140.040 1.00 131.52 ? 224 ARG A HH11   1 
ATOM   3688  H HH12   . ARG A 1 224 ? 171.799 10.194  140.602 1.00 131.52 ? 224 ARG A HH12   1 
ATOM   3689  H HH21   . ARG A 1 224 ? 170.930 7.538   142.351 1.00 133.59 ? 224 ARG A HH21   1 
ATOM   3690  H HH22   . ARG A 1 224 ? 172.085 8.408   141.994 1.00 133.59 ? 224 ARG A HH22   1 
ATOM   3691  N N      . ASN A 1 225 ? 167.789 12.032  144.548 1.00 61.48  ? 225 ASN A N      1 
ATOM   3692  C CA     . ASN A 1 225 ? 168.719 13.091  144.915 1.00 58.89  ? 225 ASN A CA     1 
ATOM   3693  C C      . ASN A 1 225 ? 170.105 12.779  144.363 1.00 58.76  ? 225 ASN A C      1 
ATOM   3694  O O      . ASN A 1 225 ? 170.760 11.831  144.783 1.00 63.23  ? 225 ASN A O      1 
ATOM   3695  C CB     . ASN A 1 225 ? 168.764 13.234  146.444 1.00 57.09  ? 225 ASN A CB     1 
ATOM   3696  C CG     . ASN A 1 225 ? 169.676 14.365  146.917 1.00 53.56  ? 225 ASN A CG     1 
ATOM   3697  O OD1    . ASN A 1 225 ? 170.191 15.155  146.122 1.00 53.85  ? 225 ASN A OD1    1 
ATOM   3698  N ND2    . ASN A 1 225 ? 169.880 14.438  148.229 1.00 46.85  ? 225 ASN A ND2    1 
ATOM   3699  H H      . ASN A 1 225 ? 167.772 11.383  145.111 1.00 73.78  ? 225 ASN A H      1 
ATOM   3700  H HA     . ASN A 1 225 ? 168.419 13.932  144.536 1.00 70.67  ? 225 ASN A HA     1 
ATOM   3701  H HB2    . ASN A 1 225 ? 167.869 13.417  146.769 1.00 68.51  ? 225 ASN A HB2    1 
ATOM   3702  H HB3    . ASN A 1 225 ? 169.092 12.406  146.827 1.00 68.51  ? 225 ASN A HB3    1 
ATOM   3703  H HD21   . ASN A 1 225 ? 170.384 15.054  148.552 1.00 56.22  ? 225 ASN A HD21   1 
ATOM   3704  H HD22   . ASN A 1 225 ? 169.507 13.868  148.754 1.00 56.22  ? 225 ASN A HD22   1 
ATOM   3705  N N      . VAL A 1 226 ? 170.552 13.580  143.409 1.00 55.27  ? 226 VAL A N      1 
ATOM   3706  C CA     . VAL A 1 226 ? 171.870 13.383  142.827 1.00 54.07  ? 226 VAL A CA     1 
ATOM   3707  C C      . VAL A 1 226 ? 172.939 13.559  143.901 1.00 54.22  ? 226 VAL A C      1 
ATOM   3708  O O      . VAL A 1 226 ? 174.033 13.026  143.781 1.00 60.36  ? 226 VAL A O      1 
ATOM   3709  C CB     . VAL A 1 226 ? 172.106 14.364  141.671 1.00 53.93  ? 226 VAL A CB     1 
ATOM   3710  C CG1    . VAL A 1 226 ? 173.498 14.182  141.062 1.00 56.15  ? 226 VAL A CG1    1 
ATOM   3711  C CG2    . VAL A 1 226 ? 171.023 14.180  140.599 1.00 54.38  ? 226 VAL A CG2    1 
ATOM   3712  H H      . VAL A 1 226 ? 170.114 14.244  143.082 1.00 66.33  ? 226 VAL A H      1 
ATOM   3713  H HA     . VAL A 1 226 ? 171.934 12.480  142.478 1.00 64.89  ? 226 VAL A HA     1 
ATOM   3714  H HB     . VAL A 1 226 ? 172.043 15.271  142.009 1.00 64.72  ? 226 VAL A HB     1 
ATOM   3715  H HG11   . VAL A 1 226 ? 173.610 14.817  140.337 1.00 67.38  ? 226 VAL A HG11   1 
ATOM   3716  H HG12   . VAL A 1 226 ? 174.165 14.340  141.747 1.00 67.38  ? 226 VAL A HG12   1 
ATOM   3717  H HG13   . VAL A 1 226 ? 173.578 13.276  140.724 1.00 67.38  ? 226 VAL A HG13   1 
ATOM   3718  H HG21   . VAL A 1 226 ? 171.185 14.805  139.876 1.00 65.26  ? 226 VAL A HG21   1 
ATOM   3719  H HG22   . VAL A 1 226 ? 171.062 13.270  140.264 1.00 65.26  ? 226 VAL A HG22   1 
ATOM   3720  H HG23   . VAL A 1 226 ? 170.154 14.350  140.995 1.00 65.26  ? 226 VAL A HG23   1 
ATOM   3721  N N      . ALA A 1 227 ? 172.601 14.285  144.962 1.00 49.34  ? 227 ALA A N      1 
ATOM   3722  C CA     . ALA A 1 227 ? 173.538 14.568  146.035 1.00 44.72  ? 227 ALA A CA     1 
ATOM   3723  C C      . ALA A 1 227 ? 173.268 13.660  147.212 1.00 50.11  ? 227 ALA A C      1 
ATOM   3724  O O      . ALA A 1 227 ? 173.654 13.965  148.338 1.00 53.90  ? 227 ALA A O      1 
ATOM   3725  C CB     . ALA A 1 227 ? 173.424 16.016  146.460 1.00 40.11  ? 227 ALA A CB     1 
ATOM   3726  H H      . ALA A 1 227 ? 171.822 14.629  145.082 1.00 59.20  ? 227 ALA A H      1 
ATOM   3727  H HA     . ALA A 1 227 ? 174.444 14.409  145.726 1.00 53.67  ? 227 ALA A HA     1 
ATOM   3728  H HB1    . ALA A 1 227 ? 174.055 16.185  147.177 1.00 48.14  ? 227 ALA A HB1    1 
ATOM   3729  H HB2    . ALA A 1 227 ? 173.624 16.585  145.700 1.00 48.14  ? 227 ALA A HB2    1 
ATOM   3730  H HB3    . ALA A 1 227 ? 172.520 16.183  146.770 1.00 48.14  ? 227 ALA A HB3    1 
ATOM   3731  N N      . ALA A 1 228 ? 172.609 12.539  146.943 1.00 52.19  ? 228 ALA A N      1 
ATOM   3732  C CA     . ALA A 1 228 ? 172.213 11.606  147.991 1.00 52.53  ? 228 ALA A CA     1 
ATOM   3733  C C      . ALA A 1 228 ? 173.348 11.296  148.962 1.00 57.71  ? 228 ALA A C      1 
ATOM   3734  O O      . ALA A 1 228 ? 173.136 11.272  150.173 1.00 63.78  ? 228 ALA A O      1 
ATOM   3735  C CB     . ALA A 1 228 ? 171.696 10.320  147.381 1.00 47.73  ? 228 ALA A CB     1 
ATOM   3736  H H      . ALA A 1 228 ? 172.377 12.293  146.152 1.00 62.63  ? 228 ALA A H      1 
ATOM   3737  H HA     . ALA A 1 228 ? 171.490 12.002  148.501 1.00 63.03  ? 228 ALA A HA     1 
ATOM   3738  H HB1    . ALA A 1 228 ? 171.438 9.714   148.094 1.00 57.28  ? 228 ALA A HB1    1 
ATOM   3739  H HB2    . ALA A 1 228 ? 170.928 10.521  146.825 1.00 57.28  ? 228 ALA A HB2    1 
ATOM   3740  H HB3    . ALA A 1 228 ? 172.398 9.920   146.845 1.00 57.28  ? 228 ALA A HB3    1 
ATOM   3741  N N      . ASN A 1 229 ? 174.549 11.082  148.430 1.00 56.46  ? 229 ASN A N      1 
ATOM   3742  C CA     . ASN A 1 229 ? 175.682 10.676  149.252 1.00 59.87  ? 229 ASN A CA     1 
ATOM   3743  C C      . ASN A 1 229 ? 176.622 11.822  149.609 1.00 57.86  ? 229 ASN A C      1 
ATOM   3744  O O      . ASN A 1 229 ? 177.714 11.593  150.129 1.00 63.68  ? 229 ASN A O      1 
ATOM   3745  C CB     . ASN A 1 229 ? 176.467 9.551   148.568 1.00 69.83  ? 229 ASN A CB     1 
ATOM   3746  C CG     . ASN A 1 229 ? 177.253 8.699   149.559 1.00 82.51  ? 229 ASN A CG     1 
ATOM   3747  O OD1    . ASN A 1 229 ? 176.865 8.558   150.721 1.00 84.05  ? 229 ASN A OD1    1 
ATOM   3748  N ND2    . ASN A 1 229 ? 178.363 8.127   149.101 1.00 90.50  ? 229 ASN A ND2    1 
ATOM   3749  H H      . ASN A 1 229 ? 174.732 11.167  147.594 1.00 67.75  ? 229 ASN A H      1 
ATOM   3750  H HA     . ASN A 1 229 ? 175.337 10.319  150.085 1.00 71.85  ? 229 ASN A HA     1 
ATOM   3751  H HB2    . ASN A 1 229 ? 175.846 8.971   148.099 1.00 83.80  ? 229 ASN A HB2    1 
ATOM   3752  H HB3    . ASN A 1 229 ? 177.096 9.940   147.941 1.00 83.80  ? 229 ASN A HB3    1 
ATOM   3753  H HD21   . ASN A 1 229 ? 178.841 7.637   149.621 1.00 108.60 ? 229 ASN A HD21   1 
ATOM   3754  H HD22   . ASN A 1 229 ? 178.603 8.248   148.283 1.00 108.60 ? 229 ASN A HD22   1 
ATOM   3755  N N      . LEU A 1 230 ? 176.203 13.054  149.343 1.00 50.74  ? 230 LEU A N      1 
ATOM   3756  C CA     . LEU A 1 230 ? 176.942 14.216  149.823 1.00 47.07  ? 230 LEU A CA     1 
ATOM   3757  C C      . LEU A 1 230 ? 176.651 14.446  151.312 1.00 51.00  ? 230 LEU A C      1 
ATOM   3758  O O      . LEU A 1 230 ? 175.536 14.792  151.687 1.00 52.58  ? 230 LEU A O      1 
ATOM   3759  C CB     . LEU A 1 230 ? 176.550 15.451  149.024 1.00 43.79  ? 230 LEU A CB     1 
ATOM   3760  C CG     . LEU A 1 230 ? 177.147 16.766  149.525 1.00 43.70  ? 230 LEU A CG     1 
ATOM   3761  C CD1    . LEU A 1 230 ? 178.666 16.713  149.495 1.00 43.97  ? 230 LEU A CD1    1 
ATOM   3762  C CD2    . LEU A 1 230 ? 176.631 17.899  148.672 1.00 45.91  ? 230 LEU A CD2    1 
ATOM   3763  H H      . LEU A 1 230 ? 175.497 13.244  148.889 1.00 60.89  ? 230 LEU A H      1 
ATOM   3764  H HA     . LEU A 1 230 ? 177.894 14.065  149.713 1.00 56.48  ? 230 LEU A HA     1 
ATOM   3765  H HB2    . LEU A 1 230 ? 176.841 15.329  148.106 1.00 52.55  ? 230 LEU A HB2    1 
ATOM   3766  H HB3    . LEU A 1 230 ? 175.584 15.540  149.048 1.00 52.55  ? 230 LEU A HB3    1 
ATOM   3767  H HG     . LEU A 1 230 ? 176.864 16.919  150.440 1.00 52.44  ? 230 LEU A HG     1 
ATOM   3768  H HD11   . LEU A 1 230 ? 179.018 17.557  149.817 1.00 52.76  ? 230 LEU A HD11   1 
ATOM   3769  H HD12   . LEU A 1 230 ? 178.968 15.989  150.065 1.00 52.76  ? 230 LEU A HD12   1 
ATOM   3770  H HD13   . LEU A 1 230 ? 178.958 16.559  148.582 1.00 52.76  ? 230 LEU A HD13   1 
ATOM   3771  H HD21   . LEU A 1 230 ? 177.011 18.733  148.991 1.00 55.09  ? 230 LEU A HD21   1 
ATOM   3772  H HD22   . LEU A 1 230 ? 176.895 17.747  147.751 1.00 55.09  ? 230 LEU A HD22   1 
ATOM   3773  H HD23   . LEU A 1 230 ? 175.664 17.929  148.738 1.00 55.09  ? 230 LEU A HD23   1 
ATOM   3774  N N      . SER A 1 231 ? 177.645 14.242  152.168 1.00 54.44  ? 231 SER A N      1 
ATOM   3775  C CA     . SER A 1 231 ? 177.423 14.369  153.604 1.00 51.60  ? 231 SER A CA     1 
ATOM   3776  C C      . SER A 1 231 ? 177.077 15.809  153.979 1.00 51.84  ? 231 SER A C      1 
ATOM   3777  O O      . SER A 1 231 ? 177.429 16.755  153.274 1.00 52.86  ? 231 SER A O      1 
ATOM   3778  C CB     . SER A 1 231 ? 178.660 13.926  154.376 1.00 45.54  ? 231 SER A CB     1 
ATOM   3779  O OG     . SER A 1 231 ? 179.730 14.823  154.148 1.00 46.53  ? 231 SER A OG     1 
ATOM   3780  H H      . SER A 1 231 ? 178.449 14.031  151.947 1.00 65.33  ? 231 SER A H      1 
ATOM   3781  H HA     . SER A 1 231 ? 176.682 13.801  153.865 1.00 61.92  ? 231 SER A HA     1 
ATOM   3782  H HB2    . SER A 1 231 ? 178.455 13.912  155.324 1.00 54.65  ? 231 SER A HB2    1 
ATOM   3783  H HB3    . SER A 1 231 ? 178.920 13.040  154.078 1.00 54.65  ? 231 SER A HB3    1 
ATOM   3784  H HG     . SER A 1 231 ? 180.409 14.575  154.575 1.00 55.83  ? 231 SER A HG     1 
ATOM   3785  N N      . LEU A 1 232 ? 176.396 15.970  155.104 1.00 48.49  ? 232 LEU A N      1 
ATOM   3786  C CA     . LEU A 1 232 ? 176.054 17.300  155.571 1.00 40.88  ? 232 LEU A CA     1 
ATOM   3787  C C      . LEU A 1 232 ? 177.306 18.125  155.850 1.00 43.62  ? 232 LEU A C      1 
ATOM   3788  O O      . LEU A 1 232 ? 177.346 19.305  155.536 1.00 48.40  ? 232 LEU A O      1 
ATOM   3789  C CB     . LEU A 1 232 ? 175.181 17.210  156.818 1.00 32.26  ? 232 LEU A CB     1 
ATOM   3790  C CG     . LEU A 1 232 ? 174.810 18.539  157.460 1.00 31.02  ? 232 LEU A CG     1 
ATOM   3791  C CD1    . LEU A 1 232 ? 173.970 19.397  156.520 1.00 34.70  ? 232 LEU A CD1    1 
ATOM   3792  C CD2    . LEU A 1 232 ? 174.060 18.265  158.721 1.00 30.19  ? 232 LEU A CD2    1 
ATOM   3793  H H      . LEU A 1 232 ? 176.122 15.331  155.610 1.00 58.18  ? 232 LEU A H      1 
ATOM   3794  H HA     . LEU A 1 232 ? 175.545 17.754  154.881 1.00 49.05  ? 232 LEU A HA     1 
ATOM   3795  H HB2    . LEU A 1 232 ? 174.354 16.762  156.582 1.00 38.71  ? 232 LEU A HB2    1 
ATOM   3796  H HB3    . LEU A 1 232 ? 175.653 16.688  157.485 1.00 38.71  ? 232 LEU A HB3    1 
ATOM   3797  H HG     . LEU A 1 232 ? 175.618 19.028  157.683 1.00 37.23  ? 232 LEU A HG     1 
ATOM   3798  H HD11   . LEU A 1 232 ? 173.755 20.233  156.963 1.00 41.63  ? 232 LEU A HD11   1 
ATOM   3799  H HD12   . LEU A 1 232 ? 174.480 19.572  155.713 1.00 41.63  ? 232 LEU A HD12   1 
ATOM   3800  H HD13   . LEU A 1 232 ? 173.156 18.919  156.300 1.00 41.63  ? 232 LEU A HD13   1 
ATOM   3801  H HD21   . LEU A 1 232 ? 173.820 19.109  159.135 1.00 36.22  ? 232 LEU A HD21   1 
ATOM   3802  H HD22   . LEU A 1 232 ? 173.259 17.761  158.508 1.00 36.22  ? 232 LEU A HD22   1 
ATOM   3803  H HD23   . LEU A 1 232 ? 174.625 17.751  159.319 1.00 36.22  ? 232 LEU A HD23   1 
ATOM   3804  N N      . ASP A 1 233 ? 178.328 17.508  156.437 1.00 46.64  ? 233 ASP A N      1 
ATOM   3805  C CA     . ASP A 1 233 ? 179.549 18.234  156.790 1.00 47.33  ? 233 ASP A CA     1 
ATOM   3806  C C      . ASP A 1 233 ? 180.390 18.673  155.583 1.00 46.12  ? 233 ASP A C      1 
ATOM   3807  O O      . ASP A 1 233 ? 181.060 19.703  155.644 1.00 43.88  ? 233 ASP A O      1 
ATOM   3808  C CB     . ASP A 1 233 ? 180.396 17.412  157.756 1.00 53.44  ? 233 ASP A CB     1 
ATOM   3809  C CG     . ASP A 1 233 ? 179.785 17.333  159.148 1.00 62.68  ? 233 ASP A CG     1 
ATOM   3810  O OD1    . ASP A 1 233 ? 178.943 18.201  159.478 1.00 64.29  ? 233 ASP A OD1    1 
ATOM   3811  O OD2    . ASP A 1 233 ? 180.152 16.405  159.914 1.00 66.51  ? 233 ASP A OD2    1 
ATOM   3812  H H      . ASP A 1 233 ? 178.341 16.672  156.641 1.00 55.97  ? 233 ASP A H      1 
ATOM   3813  H HA     . ASP A 1 233 ? 179.288 19.041  157.260 1.00 56.80  ? 233 ASP A HA     1 
ATOM   3814  H HB2    . ASP A 1 233 ? 180.480 16.508  157.413 1.00 64.12  ? 233 ASP A HB2    1 
ATOM   3815  H HB3    . ASP A 1 233 ? 181.272 17.820  157.834 1.00 64.12  ? 233 ASP A HB3    1 
ATOM   3816  N N      . ASN A 1 234 ? 180.348 17.919  154.488 1.00 46.31  ? 234 ASN A N      1 
ATOM   3817  C CA     . ASN A 1 234 ? 181.045 18.336  153.276 1.00 47.76  ? 234 ASN A CA     1 
ATOM   3818  C C      . ASN A 1 234 ? 180.283 19.444  152.538 1.00 46.28  ? 234 ASN A C      1 
ATOM   3819  O O      . ASN A 1 234 ? 180.896 20.361  151.981 1.00 45.51  ? 234 ASN A O      1 
ATOM   3820  C CB     . ASN A 1 234 ? 181.315 17.140  152.357 1.00 52.07  ? 234 ASN A CB     1 
ATOM   3821  C CG     . ASN A 1 234 ? 182.464 16.275  152.853 1.00 52.26  ? 234 ASN A CG     1 
ATOM   3822  O OD1    . ASN A 1 234 ? 183.365 16.760  153.538 1.00 51.37  ? 234 ASN A OD1    1 
ATOM   3823  N ND2    . ASN A 1 234 ? 182.435 14.991  152.511 1.00 50.99  ? 234 ASN A ND2    1 
ATOM   3824  H H      . ASN A 1 234 ? 179.930 17.170  154.421 1.00 55.57  ? 234 ASN A H      1 
ATOM   3825  H HA     . ASN A 1 234 ? 181.906 18.702  153.532 1.00 57.31  ? 234 ASN A HA     1 
ATOM   3826  H HB2    . ASN A 1 234 ? 180.519 16.587  152.315 1.00 62.48  ? 234 ASN A HB2    1 
ATOM   3827  H HB3    . ASN A 1 234 ? 181.542 17.464  151.472 1.00 62.48  ? 234 ASN A HB3    1 
ATOM   3828  H HD21   . ASN A 1 234 ? 183.063 14.464  152.768 1.00 61.19  ? 234 ASN A HD21   1 
ATOM   3829  H HD22   . ASN A 1 234 ? 181.787 14.688  152.033 1.00 61.19  ? 234 ASN A HD22   1 
ATOM   3830  N N      . LEU A 1 235 ? 178.954 19.364  152.541 1.00 43.53  ? 235 LEU A N      1 
ATOM   3831  C CA     . LEU A 1 235 ? 178.139 20.457  152.029 1.00 41.59  ? 235 LEU A CA     1 
ATOM   3832  C C      . LEU A 1 235 ? 178.540 21.735  152.755 1.00 42.03  ? 235 LEU A C      1 
ATOM   3833  O O      . LEU A 1 235 ? 178.837 22.750  152.125 1.00 47.29  ? 235 LEU A O      1 
ATOM   3834  C CB     . LEU A 1 235 ? 176.645 20.180  152.237 1.00 39.61  ? 235 LEU A CB     1 
ATOM   3835  C CG     . LEU A 1 235 ? 175.687 21.357  151.987 1.00 35.97  ? 235 LEU A CG     1 
ATOM   3836  C CD1    . LEU A 1 235 ? 175.823 21.891  150.549 1.00 31.99  ? 235 LEU A CD1    1 
ATOM   3837  C CD2    . LEU A 1 235 ? 174.247 20.936  152.297 1.00 33.09  ? 235 LEU A CD2    1 
ATOM   3838  H H      . LEU A 1 235 ? 178.504 18.691  152.832 1.00 52.24  ? 235 LEU A H      1 
ATOM   3839  H HA     . LEU A 1 235 ? 178.305 20.573  151.080 1.00 49.91  ? 235 LEU A HA     1 
ATOM   3840  H HB2    . LEU A 1 235 ? 176.384 19.464  151.637 1.00 47.53  ? 235 LEU A HB2    1 
ATOM   3841  H HB3    . LEU A 1 235 ? 176.515 19.893  153.154 1.00 47.53  ? 235 LEU A HB3    1 
ATOM   3842  H HG     . LEU A 1 235 ? 175.918 22.079  152.592 1.00 43.16  ? 235 LEU A HG     1 
ATOM   3843  H HD11   . LEU A 1 235 ? 175.206 22.630  150.428 1.00 38.39  ? 235 LEU A HD11   1 
ATOM   3844  H HD12   . LEU A 1 235 ? 176.734 22.193  150.410 1.00 38.39  ? 235 LEU A HD12   1 
ATOM   3845  H HD13   . LEU A 1 235 ? 175.612 21.177  149.927 1.00 38.39  ? 235 LEU A HD13   1 
ATOM   3846  H HD21   . LEU A 1 235 ? 173.657 21.688  152.135 1.00 39.71  ? 235 LEU A HD21   1 
ATOM   3847  H HD22   . LEU A 1 235 ? 174.004 20.194  151.721 1.00 39.71  ? 235 LEU A HD22   1 
ATOM   3848  H HD23   . LEU A 1 235 ? 174.191 20.665  153.227 1.00 39.71  ? 235 LEU A HD23   1 
ATOM   3849  N N      . ALA A 1 236 ? 178.556 21.672  154.084 1.00 38.57  ? 236 ALA A N      1 
ATOM   3850  C CA     . ALA A 1 236 ? 178.994 22.794  154.911 1.00 40.80  ? 236 ALA A CA     1 
ATOM   3851  C C      . ALA A 1 236 ? 180.400 23.282  154.544 1.00 45.95  ? 236 ALA A C      1 
ATOM   3852  O O      . ALA A 1 236 ? 180.624 24.484  154.390 1.00 46.70  ? 236 ALA A O      1 
ATOM   3853  C CB     . ALA A 1 236 ? 178.950 22.406  156.373 1.00 38.74  ? 236 ALA A CB     1 
ATOM   3854  H H      . ALA A 1 236 ? 178.315 20.981  154.536 1.00 46.28  ? 236 ALA A H      1 
ATOM   3855  H HA     . ALA A 1 236 ? 178.380 23.534  154.782 1.00 48.96  ? 236 ALA A HA     1 
ATOM   3856  H HB1    . ALA A 1 236 ? 179.243 23.160  156.908 1.00 46.49  ? 236 ALA A HB1    1 
ATOM   3857  H HB2    . ALA A 1 236 ? 178.040 22.166  156.608 1.00 46.49  ? 236 ALA A HB2    1 
ATOM   3858  H HB3    . ALA A 1 236 ? 179.540 21.649  156.516 1.00 46.49  ? 236 ALA A HB3    1 
ATOM   3859  N N      . ARG A 1 237 ? 181.346 22.353  154.406 1.00 46.59  ? 237 ARG A N      1 
ATOM   3860  C CA     . ARG A 1 237 ? 182.714 22.714  154.058 1.00 47.51  ? 237 ARG A CA     1 
ATOM   3861  C C      . ARG A 1 237 ? 182.755 23.480  152.734 1.00 51.70  ? 237 ARG A C      1 
ATOM   3862  O O      . ARG A 1 237 ? 183.500 24.446  152.592 1.00 54.38  ? 237 ARG A O      1 
ATOM   3863  C CB     . ARG A 1 237 ? 183.599 21.466  153.995 1.00 47.02  ? 237 ARG A CB     1 
ATOM   3864  C CG     . ARG A 1 237 ? 183.982 20.921  155.373 1.00 50.13  ? 237 ARG A CG     1 
ATOM   3865  C CD     . ARG A 1 237 ? 184.775 19.627  155.286 1.00 54.41  ? 237 ARG A CD     1 
ATOM   3866  N NE     . ARG A 1 237 ? 185.098 19.103  156.616 1.00 60.04  ? 237 ARG A NE     1 
ATOM   3867  C CZ     . ARG A 1 237 ? 184.490 18.077  157.214 1.00 61.89  ? 237 ARG A CZ     1 
ATOM   3868  N NH1    . ARG A 1 237 ? 183.514 17.411  156.609 1.00 61.49  ? 237 ARG A NH1    1 
ATOM   3869  N NH2    . ARG A 1 237 ? 184.875 17.705  158.432 1.00 61.75  ? 237 ARG A NH2    1 
ATOM   3870  H H      . ARG A 1 237 ? 181.218 21.509  154.508 1.00 55.91  ? 237 ARG A H      1 
ATOM   3871  H HA     . ARG A 1 237 ? 183.069 23.296  154.748 1.00 57.01  ? 237 ARG A HA     1 
ATOM   3872  H HB2    . ARG A 1 237 ? 183.122 20.767  153.521 1.00 56.42  ? 237 ARG A HB2    1 
ATOM   3873  H HB3    . ARG A 1 237 ? 184.417 21.685  153.523 1.00 56.42  ? 237 ARG A HB3    1 
ATOM   3874  H HG2    . ARG A 1 237 ? 184.528 21.578  155.833 1.00 60.15  ? 237 ARG A HG2    1 
ATOM   3875  H HG3    . ARG A 1 237 ? 183.174 20.746  155.880 1.00 60.15  ? 237 ARG A HG3    1 
ATOM   3876  H HD2    . ARG A 1 237 ? 184.250 18.961  154.817 1.00 65.29  ? 237 ARG A HD2    1 
ATOM   3877  H HD3    . ARG A 1 237 ? 185.607 19.792  154.815 1.00 65.29  ? 237 ARG A HD3    1 
ATOM   3878  H HE     . ARG A 1 237 ? 185.733 19.490  157.048 1.00 72.04  ? 237 ARG A HE     1 
ATOM   3879  H HH11   . ARG A 1 237 ? 183.257 17.645  155.822 1.00 73.79  ? 237 ARG A HH11   1 
ATOM   3880  H HH12   . ARG A 1 237 ? 183.134 16.750  157.006 1.00 73.79  ? 237 ARG A HH12   1 
ATOM   3881  H HH21   . ARG A 1 237 ? 185.510 18.127  158.830 1.00 74.10  ? 237 ARG A HH21   1 
ATOM   3882  H HH22   . ARG A 1 237 ? 184.491 17.040  158.820 1.00 74.10  ? 237 ARG A HH22   1 
ATOM   3883  N N      . PHE A 1 238 ? 181.934 23.061  151.778 1.00 49.95  ? 238 PHE A N      1 
ATOM   3884  C CA     . PHE A 1 238 ? 181.911 23.686  150.467 1.00 47.70  ? 238 PHE A CA     1 
ATOM   3885  C C      . PHE A 1 238 ? 181.375 25.108  150.526 1.00 50.71  ? 238 PHE A C      1 
ATOM   3886  O O      . PHE A 1 238 ? 181.945 26.010  149.915 1.00 53.47  ? 238 PHE A O      1 
ATOM   3887  C CB     . PHE A 1 238 ? 181.061 22.858  149.513 1.00 48.54  ? 238 PHE A CB     1 
ATOM   3888  C CG     . PHE A 1 238 ? 181.000 23.406  148.115 1.00 47.87  ? 238 PHE A CG     1 
ATOM   3889  C CD1    . PHE A 1 238 ? 182.133 23.430  147.315 1.00 51.05  ? 238 PHE A CD1    1 
ATOM   3890  C CD2    . PHE A 1 238 ? 179.803 23.859  147.592 1.00 44.19  ? 238 PHE A CD2    1 
ATOM   3891  C CE1    . PHE A 1 238 ? 182.078 23.920  146.019 1.00 52.04  ? 238 PHE A CE1    1 
ATOM   3892  C CE2    . PHE A 1 238 ? 179.733 24.346  146.306 1.00 47.17  ? 238 PHE A CE2    1 
ATOM   3893  C CZ     . PHE A 1 238 ? 180.878 24.378  145.512 1.00 51.36  ? 238 PHE A CZ     1 
ATOM   3894  H H      . PHE A 1 238 ? 181.377 22.411  151.867 1.00 59.94  ? 238 PHE A H      1 
ATOM   3895  H HA     . PHE A 1 238 ? 182.814 23.719  150.115 1.00 57.24  ? 238 PHE A HA     1 
ATOM   3896  H HB2    . PHE A 1 238 ? 181.431 21.962  149.464 1.00 58.25  ? 238 PHE A HB2    1 
ATOM   3897  H HB3    . PHE A 1 238 ? 180.154 22.820  149.856 1.00 58.25  ? 238 PHE A HB3    1 
ATOM   3898  H HD1    . PHE A 1 238 ? 182.942 23.123  147.655 1.00 61.26  ? 238 PHE A HD1    1 
ATOM   3899  H HD2    . PHE A 1 238 ? 179.036 23.840  148.118 1.00 53.03  ? 238 PHE A HD2    1 
ATOM   3900  H HE1    . PHE A 1 238 ? 182.845 23.939  145.494 1.00 62.45  ? 238 PHE A HE1    1 
ATOM   3901  H HE2    . PHE A 1 238 ? 178.924 24.655  145.969 1.00 56.61  ? 238 PHE A HE2    1 
ATOM   3902  H HZ     . PHE A 1 238 ? 180.834 24.709  144.644 1.00 61.63  ? 238 PHE A HZ     1 
ATOM   3903  N N      . VAL A 1 239 ? 180.269 25.304  151.247 1.00 50.69  ? 239 VAL A N      1 
ATOM   3904  C CA     . VAL A 1 239 ? 179.669 26.633  151.384 1.00 47.60  ? 239 VAL A CA     1 
ATOM   3905  C C      . VAL A 1 239 ? 180.682 27.558  152.047 1.00 48.76  ? 239 VAL A C      1 
ATOM   3906  O O      . VAL A 1 239 ? 180.873 28.704  151.622 1.00 52.94  ? 239 VAL A O      1 
ATOM   3907  C CB     . VAL A 1 239 ? 178.365 26.604  152.230 1.00 38.19  ? 239 VAL A CB     1 
ATOM   3908  C CG1    . VAL A 1 239 ? 177.867 28.024  152.542 1.00 37.36  ? 239 VAL A CG1    1 
ATOM   3909  C CG2    . VAL A 1 239 ? 177.264 25.793  151.532 1.00 37.90  ? 239 VAL A CG2    1 
ATOM   3910  H H      . VAL A 1 239 ? 179.847 24.684  151.666 1.00 60.82  ? 239 VAL A H      1 
ATOM   3911  H HA     . VAL A 1 239 ? 179.458 26.985  150.506 1.00 57.12  ? 239 VAL A HA     1 
ATOM   3912  H HB     . VAL A 1 239 ? 178.556 26.169  153.076 1.00 45.83  ? 239 VAL A HB     1 
ATOM   3913  H HG11   . VAL A 1 239 ? 177.055 27.965  153.070 1.00 44.84  ? 239 VAL A HG11   1 
ATOM   3914  H HG12   . VAL A 1 239 ? 178.552 28.497  153.041 1.00 44.84  ? 239 VAL A HG12   1 
ATOM   3915  H HG13   . VAL A 1 239 ? 177.687 28.486  151.708 1.00 44.84  ? 239 VAL A HG13   1 
ATOM   3916  H HG21   . VAL A 1 239 ? 176.469 25.797  152.087 1.00 45.48  ? 239 VAL A HG21   1 
ATOM   3917  H HG22   . VAL A 1 239 ? 177.071 26.199  150.673 1.00 45.48  ? 239 VAL A HG22   1 
ATOM   3918  H HG23   . VAL A 1 239 ? 177.575 24.883  151.405 1.00 45.48  ? 239 VAL A HG23   1 
ATOM   3919  N N      . HIS A 1 240 ? 181.347 27.057  153.083 1.00 45.07  ? 240 HIS A N      1 
ATOM   3920  C CA     . HIS A 1 240 ? 182.370 27.844  153.755 1.00 47.08  ? 240 HIS A CA     1 
ATOM   3921  C C      . HIS A 1 240 ? 183.540 28.126  152.821 1.00 49.66  ? 240 HIS A C      1 
ATOM   3922  O O      . HIS A 1 240 ? 184.162 29.180  152.896 1.00 54.26  ? 240 HIS A O      1 
ATOM   3923  C CB     . HIS A 1 240 ? 182.874 27.149  155.022 1.00 48.23  ? 240 HIS A CB     1 
ATOM   3924  C CG     . HIS A 1 240 ? 183.759 28.017  155.859 1.00 49.75  ? 240 HIS A CG     1 
ATOM   3925  N ND1    . HIS A 1 240 ? 185.112 27.796  155.989 1.00 48.41  ? 240 HIS A ND1    1 
ATOM   3926  C CD2    . HIS A 1 240 ? 183.489 29.134  156.577 1.00 53.04  ? 240 HIS A CD2    1 
ATOM   3927  C CE1    . HIS A 1 240 ? 185.636 28.726  156.767 1.00 49.94  ? 240 HIS A CE1    1 
ATOM   3928  N NE2    . HIS A 1 240 ? 184.672 29.548  157.137 1.00 53.84  ? 240 HIS A NE2    1 
ATOM   3929  H H      . HIS A 1 240 ? 181.225 26.272  153.413 1.00 54.08  ? 240 HIS A H      1 
ATOM   3930  H HA     . HIS A 1 240 ? 181.987 28.696  154.016 1.00 56.50  ? 240 HIS A HA     1 
ATOM   3931  H HB2    . HIS A 1 240 ? 182.111 26.891  155.563 1.00 57.88  ? 240 HIS A HB2    1 
ATOM   3932  H HB3    . HIS A 1 240 ? 183.381 26.363  154.768 1.00 57.88  ? 240 HIS A HB3    1 
ATOM   3933  H HD1    . HIS A 1 240 ? 185.546 27.148  155.627 1.00 58.09  ? 240 HIS A HD1    1 
ATOM   3934  H HD2    . HIS A 1 240 ? 182.657 29.537  156.680 1.00 63.65  ? 240 HIS A HD2    1 
ATOM   3935  H HE1    . HIS A 1 240 ? 186.531 28.790  157.013 1.00 59.93  ? 240 HIS A HE1    1 
ATOM   3936  H HE2    . HIS A 1 240 ? 184.769 30.234  157.647 1.00 64.60  ? 240 HIS A HE2    1 
ATOM   3937  N N      . LEU A 1 241 ? 183.832 27.181  151.936 1.00 50.74  ? 241 LEU A N      1 
ATOM   3938  C CA     . LEU A 1 241 ? 184.925 27.331  150.984 1.00 57.16  ? 241 LEU A CA     1 
ATOM   3939  C C      . LEU A 1 241 ? 184.604 28.403  149.955 1.00 61.51  ? 241 LEU A C      1 
ATOM   3940  O O      . LEU A 1 241 ? 185.446 29.242  149.639 1.00 66.95  ? 241 LEU A O      1 
ATOM   3941  C CB     . LEU A 1 241 ? 185.155 26.012  150.261 1.00 64.12  ? 241 LEU A CB     1 
ATOM   3942  C CG     . LEU A 1 241 ? 186.576 25.494  150.094 1.00 71.73  ? 241 LEU A CG     1 
ATOM   3943  C CD1    . LEU A 1 241 ? 187.350 25.445  151.405 1.00 67.63  ? 241 LEU A CD1    1 
ATOM   3944  C CD2    . LEU A 1 241 ? 186.467 24.113  149.494 1.00 79.64  ? 241 LEU A CD2    1 
ATOM   3945  H H      . LEU A 1 241 ? 183.407 26.437  151.865 1.00 60.89  ? 241 LEU A H      1 
ATOM   3946  H HA     . LEU A 1 241 ? 185.738 27.579  151.452 1.00 68.59  ? 241 LEU A HA     1 
ATOM   3947  H HB2    . LEU A 1 241 ? 184.663 25.326  150.739 1.00 76.94  ? 241 LEU A HB2    1 
ATOM   3948  H HB3    . LEU A 1 241 ? 184.784 26.098  149.369 1.00 76.94  ? 241 LEU A HB3    1 
ATOM   3949  H HG     . LEU A 1 241 ? 187.057 26.063  149.473 1.00 86.08  ? 241 LEU A HG     1 
ATOM   3950  H HD11   . LEU A 1 241 ? 188.243 25.108  151.232 1.00 81.15  ? 241 LEU A HD11   1 
ATOM   3951  H HD12   . LEU A 1 241 ? 187.400 26.340  151.776 1.00 81.15  ? 241 LEU A HD12   1 
ATOM   3952  H HD13   . LEU A 1 241 ? 186.888 24.856  152.022 1.00 81.15  ? 241 LEU A HD13   1 
ATOM   3953  H HD21   . LEU A 1 241 ? 187.359 23.751  149.373 1.00 95.56  ? 241 LEU A HD21   1 
ATOM   3954  H HD22   . LEU A 1 241 ? 185.958 23.547  150.095 1.00 95.56  ? 241 LEU A HD22   1 
ATOM   3955  H HD23   . LEU A 1 241 ? 186.017 24.176  148.637 1.00 95.56  ? 241 LEU A HD23   1 
ATOM   3956  N N      . CYS A 1 242 ? 183.383 28.361  149.429 1.00 58.82  ? 242 CYS A N      1 
ATOM   3957  C CA     . CYS A 1 242 ? 182.940 29.322  148.430 1.00 56.84  ? 242 CYS A CA     1 
ATOM   3958  C C      . CYS A 1 242 ? 182.989 30.744  148.979 1.00 52.84  ? 242 CYS A C      1 
ATOM   3959  O O      . CYS A 1 242 ? 183.408 31.669  148.292 1.00 53.35  ? 242 CYS A O      1 
ATOM   3960  C CB     . CYS A 1 242 ? 181.526 28.984  147.973 1.00 57.72  ? 242 CYS A CB     1 
ATOM   3961  S SG     . CYS A 1 242 ? 181.414 27.458  147.005 1.00 59.17  ? 242 CYS A SG     1 
ATOM   3962  H H      . CYS A 1 242 ? 182.788 27.776  149.638 1.00 70.59  ? 242 CYS A H      1 
ATOM   3963  H HA     . CYS A 1 242 ? 183.527 29.275  147.659 1.00 68.21  ? 242 CYS A HA     1 
ATOM   3964  H HB2    . CYS A 1 242 ? 180.961 28.881  148.755 1.00 69.26  ? 242 CYS A HB2    1 
ATOM   3965  H HB3    . CYS A 1 242 ? 181.193 29.710  147.422 1.00 69.26  ? 242 CYS A HB3    1 
ATOM   3966  H HG     . CYS A 1 242 ? 181.807 26.542  147.674 1.00 71.01  ? 242 CYS A HG     1 
ATOM   3967  N N      . ARG A 1 243 ? 182.573 30.906  150.226 1.00 51.33  ? 243 ARG A N      1 
ATOM   3968  C CA     . ARG A 1 243 ? 182.630 32.202  150.883 1.00 50.48  ? 243 ARG A CA     1 
ATOM   3969  C C      . ARG A 1 243 ? 184.072 32.692  150.948 1.00 57.78  ? 243 ARG A C      1 
ATOM   3970  O O      . ARG A 1 243 ? 184.379 33.808  150.526 1.00 60.70  ? 243 ARG A O      1 
ATOM   3971  C CB     . ARG A 1 243 ? 182.039 32.104  152.289 1.00 43.43  ? 243 ARG A CB     1 
ATOM   3972  C CG     . ARG A 1 243 ? 180.545 31.868  152.280 1.00 43.55  ? 243 ARG A CG     1 
ATOM   3973  C CD     . ARG A 1 243 ? 179.987 31.702  153.668 1.00 45.19  ? 243 ARG A CD     1 
ATOM   3974  N NE     . ARG A 1 243 ? 178.535 31.569  153.638 1.00 48.05  ? 243 ARG A NE     1 
ATOM   3975  C CZ     . ARG A 1 243 ? 177.806 31.137  154.660 1.00 48.08  ? 243 ARG A CZ     1 
ATOM   3976  N NH1    . ARG A 1 243 ? 178.397 30.795  155.790 1.00 44.85  ? 243 ARG A NH1    1 
ATOM   3977  N NH2    . ARG A 1 243 ? 176.485 31.045  154.554 1.00 51.25  ? 243 ARG A NH2    1 
ATOM   3978  H H      . ARG A 1 243 ? 182.251 30.278  150.717 1.00 61.60  ? 243 ARG A H      1 
ATOM   3979  H HA     . ARG A 1 243 ? 182.110 32.845  150.376 1.00 60.58  ? 243 ARG A HA     1 
ATOM   3980  H HB2    . ARG A 1 243 ? 182.457 31.364  152.757 1.00 52.12  ? 243 ARG A HB2    1 
ATOM   3981  H HB3    . ARG A 1 243 ? 182.209 32.934  152.762 1.00 52.12  ? 243 ARG A HB3    1 
ATOM   3982  H HG2    . ARG A 1 243 ? 180.106 32.628  151.867 1.00 52.26  ? 243 ARG A HG2    1 
ATOM   3983  H HG3    . ARG A 1 243 ? 180.354 31.060  151.779 1.00 52.26  ? 243 ARG A HG3    1 
ATOM   3984  H HD2    . ARG A 1 243 ? 180.359 30.901  154.070 1.00 54.23  ? 243 ARG A HD2    1 
ATOM   3985  H HD3    . ARG A 1 243 ? 180.211 32.482  154.200 1.00 54.23  ? 243 ARG A HD3    1 
ATOM   3986  H HE     . ARG A 1 243 ? 178.131 31.742  152.899 1.00 57.66  ? 243 ARG A HE     1 
ATOM   3987  H HH11   . ARG A 1 243 ? 179.252 30.853  155.862 1.00 53.82  ? 243 ARG A HH11   1 
ATOM   3988  H HH12   . ARG A 1 243 ? 177.928 30.514  156.453 1.00 53.82  ? 243 ARG A HH12   1 
ATOM   3989  H HH21   . ARG A 1 243 ? 176.096 31.266  153.820 1.00 61.50  ? 243 ARG A HH21   1 
ATOM   3990  H HH22   . ARG A 1 243 ? 176.019 30.763  155.220 1.00 61.50  ? 243 ARG A HH22   1 
ATOM   3991  N N      . GLU A 1 244 ? 184.954 31.844  151.468 1.00 58.59  ? 244 GLU A N      1 
ATOM   3992  C CA     . GLU A 1 244 ? 186.365 32.184  151.591 1.00 58.56  ? 244 GLU A CA     1 
ATOM   3993  C C      . GLU A 1 244 ? 186.980 32.544  150.249 1.00 61.66  ? 244 GLU A C      1 
ATOM   3994  O O      . GLU A 1 244 ? 187.786 33.471  150.157 1.00 63.56  ? 244 GLU A O      1 
ATOM   3995  C CB     . GLU A 1 244 ? 187.135 31.022  152.213 1.00 56.74  ? 244 GLU A CB     1 
ATOM   3996  C CG     . GLU A 1 244 ? 186.927 30.908  153.708 1.00 63.31  ? 244 GLU A CG     1 
ATOM   3997  C CD     . GLU A 1 244 ? 187.784 29.832  154.326 1.00 75.83  ? 244 GLU A CD     1 
ATOM   3998  O OE1    . GLU A 1 244 ? 187.794 28.698  153.798 1.00 80.16  ? 244 GLU A OE1    1 
ATOM   3999  O OE2    . GLU A 1 244 ? 188.461 30.127  155.333 1.00 82.41  ? 244 GLU A OE2    1 
ATOM   4000  H H      . GLU A 1 244 ? 184.757 31.058  151.758 1.00 70.31  ? 244 GLU A H      1 
ATOM   4001  H HA     . GLU A 1 244 ? 186.455 32.952  152.178 1.00 70.27  ? 244 GLU A HA     1 
ATOM   4002  H HB2    . GLU A 1 244 ? 186.839 30.194  151.805 1.00 68.09  ? 244 GLU A HB2    1 
ATOM   4003  H HB3    . GLU A 1 244 ? 188.083 31.150  152.052 1.00 68.09  ? 244 GLU A HB3    1 
ATOM   4004  H HG2    . GLU A 1 244 ? 187.156 31.753  154.126 1.00 75.98  ? 244 GLU A HG2    1 
ATOM   4005  H HG3    . GLU A 1 244 ? 185.998 30.691  153.884 1.00 75.98  ? 244 GLU A HG3    1 
ATOM   4006  N N      . PHE A 1 245 ? 186.597 31.808  149.211 1.00 62.82  ? 245 PHE A N      1 
ATOM   4007  C CA     . PHE A 1 245 ? 187.172 32.004  147.888 1.00 66.23  ? 245 PHE A CA     1 
ATOM   4008  C C      . PHE A 1 245 ? 186.827 33.393  147.368 1.00 69.04  ? 245 PHE A C      1 
ATOM   4009  O O      . PHE A 1 245 ? 187.711 34.145  146.974 1.00 68.16  ? 245 PHE A O      1 
ATOM   4010  C CB     . PHE A 1 245 ? 186.682 30.926  146.917 1.00 66.27  ? 245 PHE A CB     1 
ATOM   4011  C CG     . PHE A 1 245 ? 187.241 31.064  145.536 1.00 67.56  ? 245 PHE A CG     1 
ATOM   4012  C CD1    . PHE A 1 245 ? 188.538 30.664  145.255 1.00 70.32  ? 245 PHE A CD1    1 
ATOM   4013  C CD2    . PHE A 1 245 ? 186.474 31.598  144.516 1.00 67.42  ? 245 PHE A CD2    1 
ATOM   4014  C CE1    . PHE A 1 245 ? 189.058 30.795  143.976 1.00 70.38  ? 245 PHE A CE1    1 
ATOM   4015  C CE2    . PHE A 1 245 ? 186.989 31.730  143.235 1.00 68.10  ? 245 PHE A CE2    1 
ATOM   4016  C CZ     . PHE A 1 245 ? 188.281 31.330  142.965 1.00 68.85  ? 245 PHE A CZ     1 
ATOM   4017  H H      . PHE A 1 245 ? 186.003 31.187  149.248 1.00 75.39  ? 245 PHE A H      1 
ATOM   4018  H HA     . PHE A 1 245 ? 188.137 31.937  147.950 1.00 79.48  ? 245 PHE A HA     1 
ATOM   4019  H HB2    . PHE A 1 245 ? 186.943 30.056  147.258 1.00 79.52  ? 245 PHE A HB2    1 
ATOM   4020  H HB3    . PHE A 1 245 ? 185.716 30.978  146.853 1.00 79.52  ? 245 PHE A HB3    1 
ATOM   4021  H HD1    . PHE A 1 245 ? 189.065 30.305  145.931 1.00 84.38  ? 245 PHE A HD1    1 
ATOM   4022  H HD2    . PHE A 1 245 ? 185.603 31.871  144.691 1.00 80.90  ? 245 PHE A HD2    1 
ATOM   4023  H HE1    . PHE A 1 245 ? 189.930 30.523  143.798 1.00 84.45  ? 245 PHE A HE1    1 
ATOM   4024  H HE2    . PHE A 1 245 ? 186.463 32.090  142.558 1.00 81.72  ? 245 PHE A HE2    1 
ATOM   4025  H HZ     . PHE A 1 245 ? 188.627 31.418  142.106 1.00 82.62  ? 245 PHE A HZ     1 
ATOM   4026  N N      . MET A 1 246 ? 185.541 33.735  147.384 1.00 70.70  ? 246 MET A N      1 
ATOM   4027  C CA     . MET A 1 246 ? 185.087 35.046  146.919 1.00 70.47  ? 246 MET A CA     1 
ATOM   4028  C C      . MET A 1 246 ? 185.639 36.199  147.776 1.00 68.62  ? 246 MET A C      1 
ATOM   4029  O O      . MET A 1 246 ? 185.899 37.288  147.272 1.00 69.95  ? 246 MET A O      1 
ATOM   4030  C CB     . MET A 1 246 ? 183.556 35.085  146.897 1.00 67.45  ? 246 MET A CB     1 
ATOM   4031  C CG     . MET A 1 246 ? 182.926 34.069  145.938 1.00 65.85  ? 246 MET A CG     1 
ATOM   4032  S SD     . MET A 1 246 ? 183.450 34.240  144.218 1.00 79.95  ? 246 MET A SD     1 
ATOM   4033  C CE     . MET A 1 246 ? 182.961 35.931  143.879 1.00 72.06  ? 246 MET A CE     1 
ATOM   4034  H H      . MET A 1 246 ? 184.907 33.223  147.660 1.00 84.84  ? 246 MET A H      1 
ATOM   4035  H HA     . MET A 1 246 ? 185.393 35.169  146.008 1.00 84.57  ? 246 MET A HA     1 
ATOM   4036  H HB2    . MET A 1 246 ? 183.225 34.895  147.789 1.00 80.94  ? 246 MET A HB2    1 
ATOM   4037  H HB3    . MET A 1 246 ? 183.270 35.969  146.621 1.00 80.94  ? 246 MET A HB3    1 
ATOM   4038  H HG2    . MET A 1 246 ? 183.166 33.176  146.231 1.00 79.02  ? 246 MET A HG2    1 
ATOM   4039  H HG3    . MET A 1 246 ? 181.962 34.174  145.964 1.00 79.02  ? 246 MET A HG3    1 
ATOM   4040  H HE1    . MET A 1 246 ? 183.194 36.149  142.963 1.00 86.47  ? 246 MET A HE1    1 
ATOM   4041  H HE2    . MET A 1 246 ? 182.002 36.013  144.005 1.00 86.47  ? 246 MET A HE2    1 
ATOM   4042  H HE3    . MET A 1 246 ? 183.427 36.522  144.490 1.00 86.47  ? 246 MET A HE3    1 
ATOM   4043  N N      . GLU A 1 247 ? 185.816 35.945  149.066 1.00 67.00  ? 247 GLU A N      1 
ATOM   4044  C CA     . GLU A 1 247 ? 186.350 36.930  149.995 1.00 73.51  ? 247 GLU A CA     1 
ATOM   4045  C C      . GLU A 1 247 ? 187.780 37.293  149.627 1.00 79.62  ? 247 GLU A C      1 
ATOM   4046  O O      . GLU A 1 247 ? 188.164 38.458  149.662 1.00 82.02  ? 247 GLU A O      1 
ATOM   4047  C CB     . GLU A 1 247 ? 186.319 36.354  151.414 1.00 82.36  ? 247 GLU A CB     1 
ATOM   4048  C CG     . GLU A 1 247 ? 186.574 37.356  152.534 1.00 96.57  ? 247 GLU A CG     1 
ATOM   4049  C CD     . GLU A 1 247 ? 185.396 38.290  152.782 1.00 110.60 ? 247 GLU A CD     1 
ATOM   4050  O OE1    . GLU A 1 247 ? 184.300 38.036  152.237 1.00 114.23 ? 247 GLU A OE1    1 
ATOM   4051  O OE2    . GLU A 1 247 ? 185.568 39.282  153.526 1.00 116.75 ? 247 GLU A OE2    1 
ATOM   4052  H H      . GLU A 1 247 ? 185.629 35.192  149.436 1.00 80.40  ? 247 GLU A H      1 
ATOM   4053  H HA     . GLU A 1 247 ? 185.807 37.734  149.971 1.00 88.21  ? 247 GLU A HA     1 
ATOM   4054  H HB2    . GLU A 1 247 ? 185.444 35.963  151.567 1.00 98.83  ? 247 GLU A HB2    1 
ATOM   4055  H HB3    . GLU A 1 247 ? 186.998 35.665  151.480 1.00 98.83  ? 247 GLU A HB3    1 
ATOM   4056  H HG2    . GLU A 1 247 ? 186.749 36.871  153.356 1.00 115.88 ? 247 GLU A HG2    1 
ATOM   4057  H HG3    . GLU A 1 247 ? 187.343 37.899  152.301 1.00 115.88 ? 247 GLU A HG3    1 
ATOM   4058  N N      . ALA A 1 248 ? 188.567 36.280  149.279 1.00 83.74  ? 248 ALA A N      1 
ATOM   4059  C CA     . ALA A 1 248 ? 189.985 36.463  148.986 1.00 81.34  ? 248 ALA A CA     1 
ATOM   4060  C C      . ALA A 1 248 ? 190.474 35.366  148.051 1.00 77.36  ? 248 ALA A C      1 
ATOM   4061  O O      . ALA A 1 248 ? 191.135 34.427  148.495 1.00 81.72  ? 248 ALA A O      1 
ATOM   4062  C CB     . ALA A 1 248 ? 190.792 36.441  150.272 1.00 78.85  ? 248 ALA A CB     1 
ATOM   4063  H H      . ALA A 1 248 ? 188.300 35.466  149.205 1.00 100.49 ? 248 ALA A H      1 
ATOM   4064  H HA     . ALA A 1 248 ? 190.119 37.320  148.552 1.00 97.61  ? 248 ALA A HA     1 
ATOM   4065  H HB1    . ALA A 1 248 ? 191.730 36.564  150.058 1.00 94.62  ? 248 ALA A HB1    1 
ATOM   4066  H HB2    . ALA A 1 248 ? 190.487 37.160  150.848 1.00 94.62  ? 248 ALA A HB2    1 
ATOM   4067  H HB3    . ALA A 1 248 ? 190.662 35.587  150.711 1.00 94.62  ? 248 ALA A HB3    1 
ATOM   4068  N N      . PRO A 1 249 ? 190.147 35.480  146.753 1.00 69.12  ? 249 PRO A N      1 
ATOM   4069  C CA     . PRO A 1 249 ? 190.493 34.477  145.736 1.00 66.58  ? 249 PRO A CA     1 
ATOM   4070  C C      . PRO A 1 249 ? 191.968 34.110  145.761 1.00 75.90  ? 249 PRO A C      1 
ATOM   4071  O O      . PRO A 1 249 ? 192.798 34.923  146.171 1.00 79.14  ? 249 PRO A O      1 
ATOM   4072  C CB     . PRO A 1 249 ? 190.154 35.177  144.417 1.00 65.10  ? 249 PRO A CB     1 
ATOM   4073  C CG     . PRO A 1 249 ? 189.131 36.191  144.770 1.00 66.56  ? 249 PRO A CG     1 
ATOM   4074  C CD     . PRO A 1 249 ? 189.434 36.632  146.173 1.00 68.09  ? 249 PRO A CD     1 
ATOM   4075  H HA     . PRO A 1 249 ? 189.950 33.679  145.835 1.00 79.89  ? 249 PRO A HA     1 
ATOM   4076  H HB2    . PRO A 1 249 ? 190.949 35.602  144.059 1.00 78.13  ? 249 PRO A HB2    1 
ATOM   4077  H HB3    . PRO A 1 249 ? 189.795 34.532  143.787 1.00 78.13  ? 249 PRO A HB3    1 
ATOM   4078  H HG2    . PRO A 1 249 ? 189.195 36.941  144.157 1.00 79.87  ? 249 PRO A HG2    1 
ATOM   4079  H HG3    . PRO A 1 249 ? 188.249 35.790  144.723 1.00 79.87  ? 249 PRO A HG3    1 
ATOM   4080  H HD2    . PRO A 1 249 ? 190.008 37.415  146.165 1.00 81.71  ? 249 PRO A HD2    1 
ATOM   4081  H HD3    . PRO A 1 249 ? 188.612 36.800  146.659 1.00 81.71  ? 249 PRO A HD3    1 
ATOM   4082  N N      . SER A 1 250 ? 192.286 32.897  145.324 1.00 82.76  ? 250 SER A N      1 
ATOM   4083  C CA     . SER A 1 250 ? 193.658 32.411  145.343 1.00 88.58  ? 250 SER A CA     1 
ATOM   4084  C C      . SER A 1 250 ? 193.793 31.132  144.535 1.00 88.62  ? 250 SER A C      1 
ATOM   4085  O O      . SER A 1 250 ? 192.914 30.272  144.561 1.00 87.79  ? 250 SER A O      1 
ATOM   4086  C CB     . SER A 1 250 ? 194.114 32.154  146.781 1.00 90.71  ? 250 SER A CB     1 
ATOM   4087  O OG     . SER A 1 250 ? 195.385 31.528  146.804 1.00 92.59  ? 250 SER A OG     1 
ATOM   4088  H H      . SER A 1 250 ? 191.719 32.332  145.009 1.00 99.31  ? 250 SER A H      1 
ATOM   4089  H HA     . SER A 1 250 ? 194.241 33.081  144.953 1.00 106.30 ? 250 SER A HA     1 
ATOM   4090  H HB2    . SER A 1 250 ? 194.171 33.001  147.251 1.00 108.85 ? 250 SER A HB2    1 
ATOM   4091  H HB3    . SER A 1 250 ? 193.470 31.575  147.218 1.00 108.85 ? 250 SER A HB3    1 
ATOM   4092  H HG     . SER A 1 250 ? 195.624 31.392  147.597 1.00 111.10 ? 250 SER A HG     1 
ATOM   4093  N N      . LEU A 1 251 ? 194.906 31.008  143.824 1.00 88.71  ? 251 LEU A N      1 
ATOM   4094  C CA     . LEU A 1 251 ? 195.184 29.808  143.051 1.00 85.41  ? 251 LEU A CA     1 
ATOM   4095  C C      . LEU A 1 251 ? 195.361 28.607  143.980 1.00 80.39  ? 251 LEU A C      1 
ATOM   4096  O O      . LEU A 1 251 ? 195.255 27.461  143.547 1.00 82.09  ? 251 LEU A O      1 
ATOM   4097  C CB     . LEU A 1 251 ? 196.436 30.014  142.203 1.00 89.06  ? 251 LEU A CB     1 
ATOM   4098  C CG     . LEU A 1 251 ? 196.846 28.855  141.295 1.00 95.41  ? 251 LEU A CG     1 
ATOM   4099  C CD1    . LEU A 1 251 ? 195.771 28.551  140.270 1.00 98.86  ? 251 LEU A CD1    1 
ATOM   4100  C CD2    . LEU A 1 251 ? 198.152 29.178  140.604 1.00 100.14 ? 251 LEU A CD2    1 
ATOM   4101  H H      . LEU A 1 251 ? 195.519 31.609  143.772 1.00 106.45 ? 251 LEU A H      1 
ATOM   4102  H HA     . LEU A 1 251 ? 194.438 29.628  142.458 1.00 102.49 ? 251 LEU A HA     1 
ATOM   4103  H HB2    . LEU A 1 251 ? 196.293 30.787  141.634 1.00 106.87 ? 251 LEU A HB2    1 
ATOM   4104  H HB3    . LEU A 1 251 ? 197.181 30.188  142.799 1.00 106.87 ? 251 LEU A HB3    1 
ATOM   4105  H HG     . LEU A 1 251 ? 196.980 28.061  141.835 1.00 114.50 ? 251 LEU A HG     1 
ATOM   4106  H HD11   . LEU A 1 251 ? 196.065 27.813  139.714 1.00 118.63 ? 251 LEU A HD11   1 
ATOM   4107  H HD12   . LEU A 1 251 ? 194.953 28.312  140.733 1.00 118.63 ? 251 LEU A HD12   1 
ATOM   4108  H HD13   . LEU A 1 251 ? 195.624 29.340  139.724 1.00 118.63 ? 251 LEU A HD13   1 
ATOM   4109  H HD21   . LEU A 1 251 ? 198.399 28.435  140.033 1.00 120.17 ? 251 LEU A HD21   1 
ATOM   4110  H HD22   . LEU A 1 251 ? 198.037 29.981  140.072 1.00 120.17 ? 251 LEU A HD22   1 
ATOM   4111  H HD23   . LEU A 1 251 ? 198.837 29.321  141.276 1.00 120.17 ? 251 LEU A HD23   1 
ATOM   4112  N N      . GLY A 1 252 ? 195.624 28.879  145.257 1.00 73.97  ? 252 GLY A N      1 
ATOM   4113  C CA     . GLY A 1 252 ? 195.836 27.834  146.245 1.00 71.05  ? 252 GLY A CA     1 
ATOM   4114  C C      . GLY A 1 252 ? 194.637 26.922  146.446 1.00 70.38  ? 252 GLY A C      1 
ATOM   4115  O O      . GLY A 1 252 ? 194.798 25.739  146.758 1.00 67.84  ? 252 GLY A O      1 
ATOM   4116  H H      . GLY A 1 252 ? 195.684 29.675  145.577 1.00 88.76  ? 252 GLY A H      1 
ATOM   4117  H HA2    . GLY A 1 252 ? 196.589 27.287  145.972 1.00 85.26  ? 252 GLY A HA2    1 
ATOM   4118  H HA3    . GLY A 1 252 ? 196.052 28.242  147.098 1.00 85.26  ? 252 GLY A HA3    1 
ATOM   4119  N N      . PHE A 1 253 ? 193.435 27.468  146.259 1.00 71.09  ? 253 PHE A N      1 
ATOM   4120  C CA     . PHE A 1 253 ? 192.202 26.698  146.396 1.00 68.37  ? 253 PHE A CA     1 
ATOM   4121  C C      . PHE A 1 253 ? 192.126 25.575  145.369 1.00 71.26  ? 253 PHE A C      1 
ATOM   4122  O O      . PHE A 1 253 ? 191.276 24.694  145.473 1.00 76.65  ? 253 PHE A O      1 
ATOM   4123  C CB     . PHE A 1 253 ? 190.976 27.594  146.211 1.00 66.04  ? 253 PHE A CB     1 
ATOM   4124  C CG     . PHE A 1 253 ? 190.725 28.552  147.344 1.00 64.11  ? 253 PHE A CG     1 
ATOM   4125  C CD1    . PHE A 1 253 ? 191.344 29.788  147.381 1.00 67.97  ? 253 PHE A CD1    1 
ATOM   4126  C CD2    . PHE A 1 253 ? 189.837 28.231  148.351 1.00 60.53  ? 253 PHE A CD2    1 
ATOM   4127  C CE1    . PHE A 1 253 ? 191.093 30.673  148.419 1.00 66.92  ? 253 PHE A CE1    1 
ATOM   4128  C CE2    . PHE A 1 253 ? 189.587 29.111  149.386 1.00 59.26  ? 253 PHE A CE2    1 
ATOM   4129  C CZ     . PHE A 1 253 ? 190.215 30.331  149.421 1.00 61.19  ? 253 PHE A CZ     1 
ATOM   4130  H H      . PHE A 1 253 ? 193.308 28.293  146.050 1.00 85.31  ? 253 PHE A H      1 
ATOM   4131  H HA     . PHE A 1 253 ? 192.163 26.306  147.282 1.00 82.05  ? 253 PHE A HA     1 
ATOM   4132  H HB2    . PHE A 1 253 ? 191.094 28.118  145.403 1.00 79.25  ? 253 PHE A HB2    1 
ATOM   4133  H HB3    . PHE A 1 253 ? 190.191 27.031  146.122 1.00 79.25  ? 253 PHE A HB3    1 
ATOM   4134  H HD1    . PHE A 1 253 ? 191.940 30.024  146.707 1.00 81.56  ? 253 PHE A HD1    1 
ATOM   4135  H HD2    . PHE A 1 253 ? 189.407 27.406  148.337 1.00 72.64  ? 253 PHE A HD2    1 
ATOM   4136  H HE1    . PHE A 1 253 ? 191.522 31.499  148.439 1.00 80.30  ? 253 PHE A HE1    1 
ATOM   4137  H HE2    . PHE A 1 253 ? 188.992 28.877  150.062 1.00 71.11  ? 253 PHE A HE2    1 
ATOM   4138  H HZ     . PHE A 1 253 ? 190.047 30.923  150.118 1.00 73.42  ? 253 PHE A HZ     1 
ATOM   4139  N N      . PHE A 1 254 ? 192.993 25.625  144.363 1.00 69.78  ? 254 PHE A N      1 
ATOM   4140  C CA     . PHE A 1 254 ? 193.054 24.574  143.347 1.00 69.90  ? 254 PHE A CA     1 
ATOM   4141  C C      . PHE A 1 254 ? 194.262 23.651  143.537 1.00 68.92  ? 254 PHE A C      1 
ATOM   4142  O O      . PHE A 1 254 ? 194.489 22.754  142.724 1.00 67.66  ? 254 PHE A O      1 
ATOM   4143  C CB     . PHE A 1 254 ? 193.080 25.188  141.941 1.00 69.41  ? 254 PHE A CB     1 
ATOM   4144  C CG     . PHE A 1 254 ? 191.815 25.906  141.573 1.00 66.45  ? 254 PHE A CG     1 
ATOM   4145  C CD1    . PHE A 1 254 ? 190.759 25.226  140.982 1.00 61.97  ? 254 PHE A CD1    1 
ATOM   4146  C CD2    . PHE A 1 254 ? 191.675 27.259  141.824 1.00 65.13  ? 254 PHE A CD2    1 
ATOM   4147  C CE1    . PHE A 1 254 ? 189.592 25.885  140.647 1.00 57.61  ? 254 PHE A CE1    1 
ATOM   4148  C CE2    . PHE A 1 254 ? 190.510 27.923  141.487 1.00 61.38  ? 254 PHE A CE2    1 
ATOM   4149  C CZ     . PHE A 1 254 ? 189.467 27.233  140.898 1.00 58.00  ? 254 PHE A CZ     1 
ATOM   4150  H H      . PHE A 1 254 ? 193.560 26.260  144.244 1.00 83.74  ? 254 PHE A H      1 
ATOM   4151  H HA     . PHE A 1 254 ? 192.255 24.030  143.415 1.00 83.88  ? 254 PHE A HA     1 
ATOM   4152  H HB2    . PHE A 1 254 ? 193.809 25.826  141.892 1.00 83.29  ? 254 PHE A HB2    1 
ATOM   4153  H HB3    . PHE A 1 254 ? 193.219 24.480  141.293 1.00 83.29  ? 254 PHE A HB3    1 
ATOM   4154  H HD1    . PHE A 1 254 ? 190.839 24.316  140.809 1.00 74.37  ? 254 PHE A HD1    1 
ATOM   4155  H HD2    . PHE A 1 254 ? 192.373 27.728  142.220 1.00 78.16  ? 254 PHE A HD2    1 
ATOM   4156  H HE1    . PHE A 1 254 ? 188.892 25.419  140.249 1.00 69.13  ? 254 PHE A HE1    1 
ATOM   4157  H HE2    . PHE A 1 254 ? 190.426 28.833  141.659 1.00 73.66  ? 254 PHE A HE2    1 
ATOM   4158  H HZ     . PHE A 1 254 ? 188.683 27.678  140.673 1.00 69.61  ? 254 PHE A HZ     1 
ATOM   4159  N N      . LYS A 1 255 ? 195.024 23.864  144.609 1.00 70.02  ? 255 LYS A N      1 
ATOM   4160  C CA     . LYS A 1 255 ? 196.198 23.034  144.893 1.00 75.42  ? 255 LYS A CA     1 
ATOM   4161  C C      . LYS A 1 255 ? 195.967 22.137  146.110 1.00 74.45  ? 255 LYS A C      1 
ATOM   4162  O O      . LYS A 1 255 ? 195.411 22.584  147.116 1.00 71.15  ? 255 LYS A O      1 
ATOM   4163  C CB     . LYS A 1 255 ? 197.426 23.909  145.136 1.00 80.78  ? 255 LYS A CB     1 
ATOM   4164  C CG     . LYS A 1 255 ? 197.881 24.690  143.917 1.00 84.89  ? 255 LYS A CG     1 
ATOM   4165  C CD     . LYS A 1 255 ? 199.018 25.629  144.269 1.00 88.87  ? 255 LYS A CD     1 
ATOM   4166  C CE     . LYS A 1 255 ? 199.429 26.481  143.083 1.00 94.43  ? 255 LYS A CE     1 
ATOM   4167  N NZ     . LYS A 1 255 ? 199.859 25.644  141.929 1.00 98.76  ? 255 LYS A NZ     1 
ATOM   4168  H H      . LYS A 1 255 ? 194.884 24.484  145.188 1.00 84.02  ? 255 LYS A H      1 
ATOM   4169  H HA     . LYS A 1 255 ? 196.378 22.466  144.128 1.00 90.50  ? 255 LYS A HA     1 
ATOM   4170  H HB2    . LYS A 1 255 ? 197.220 24.547  145.836 1.00 96.94  ? 255 LYS A HB2    1 
ATOM   4171  H HB3    . LYS A 1 255 ? 198.162 23.342  145.415 1.00 96.94  ? 255 LYS A HB3    1 
ATOM   4172  H HG2    . LYS A 1 255 ? 198.193 24.073  143.237 1.00 101.87 ? 255 LYS A HG2    1 
ATOM   4173  H HG3    . LYS A 1 255 ? 197.142 25.219  143.579 1.00 101.87 ? 255 LYS A HG3    1 
ATOM   4174  H HD2    . LYS A 1 255 ? 198.735 26.220  144.984 1.00 106.64 ? 255 LYS A HD2    1 
ATOM   4175  H HD3    . LYS A 1 255 ? 199.787 25.108  144.549 1.00 106.64 ? 255 LYS A HD3    1 
ATOM   4176  H HE2    . LYS A 1 255 ? 198.675 27.022  142.801 1.00 113.32 ? 255 LYS A HE2    1 
ATOM   4177  H HE3    . LYS A 1 255 ? 200.173 27.049  143.339 1.00 113.32 ? 255 LYS A HE3    1 
ATOM   4178  H HZ1    . LYS A 1 255 ? 200.095 26.164  141.247 1.00 118.51 ? 255 LYS A HZ1    1 
ATOM   4179  H HZ2    . LYS A 1 255 ? 200.554 25.139  142.162 1.00 118.51 ? 255 LYS A HZ2    1 
ATOM   4180  H HZ3    . LYS A 1 255 ? 199.191 25.115  141.672 1.00 118.51 ? 255 LYS A HZ3    1 
ATOM   4181  N N      . PRO A 1 256 ? 196.393 20.865  146.028 1.00 78.15  ? 256 PRO A N      1 
ATOM   4182  C CA     . PRO A 1 256 ? 196.244 19.979  147.191 1.00 80.09  ? 256 PRO A CA     1 
ATOM   4183  C C      . PRO A 1 256 ? 197.017 20.483  148.412 1.00 80.79  ? 256 PRO A C      1 
ATOM   4184  O O      . PRO A 1 256 ? 198.045 21.149  148.268 1.00 76.17  ? 256 PRO A O      1 
ATOM   4185  C CB     . PRO A 1 256 ? 196.841 18.649  146.707 1.00 83.24  ? 256 PRO A CB     1 
ATOM   4186  C CG     . PRO A 1 256 ? 196.859 18.733  145.223 1.00 83.86  ? 256 PRO A CG     1 
ATOM   4187  C CD     . PRO A 1 256 ? 197.027 20.177  144.889 1.00 81.69  ? 256 PRO A CD     1 
ATOM   4188  H HA     . PRO A 1 256 ? 195.309 19.858  147.417 1.00 96.11  ? 256 PRO A HA     1 
ATOM   4189  H HB2    . PRO A 1 256 ? 197.742 18.551  147.054 1.00 99.89  ? 256 PRO A HB2    1 
ATOM   4190  H HB3    . PRO A 1 256 ? 196.280 17.915  147.000 1.00 99.89  ? 256 PRO A HB3    1 
ATOM   4191  H HG2    . PRO A 1 256 ? 197.604 18.216  144.879 1.00 100.64 ? 256 PRO A HG2    1 
ATOM   4192  H HG3    . PRO A 1 256 ? 196.021 18.398  144.870 1.00 100.64 ? 256 PRO A HG3    1 
ATOM   4193  H HD2    . PRO A 1 256 ? 197.968 20.406  144.838 1.00 98.03  ? 256 PRO A HD2    1 
ATOM   4194  H HD3    . PRO A 1 256 ? 196.563 20.390  144.064 1.00 98.03  ? 256 PRO A HD3    1 
ATOM   4195  N N      . LYS A 1 257 ? 196.518 20.159  149.601 1.00 87.98  ? 257 LYS A N      1 
ATOM   4196  C CA     . LYS A 1 257 ? 197.160 20.556  150.849 1.00 93.81  ? 257 LYS A CA     1 
ATOM   4197  C C      . LYS A 1 257 ? 198.077 19.433  151.314 1.00 98.60  ? 257 LYS A C      1 
ATOM   4198  O O      . LYS A 1 257 ? 197.656 18.282  151.403 1.00 97.80  ? 257 LYS A O      1 
ATOM   4199  C CB     . LYS A 1 257 ? 196.109 20.838  151.929 1.00 93.84  ? 257 LYS A CB     1 
ATOM   4200  C CG     . LYS A 1 257 ? 194.832 21.516  151.426 1.00 97.51  ? 257 LYS A CG     1 
ATOM   4201  C CD     . LYS A 1 257 ? 195.109 22.880  150.803 1.00 103.68 ? 257 LYS A CD     1 
ATOM   4202  C CE     . LYS A 1 257 ? 193.824 23.554  150.325 1.00 105.26 ? 257 LYS A CE     1 
ATOM   4203  N NZ     . LYS A 1 257 ? 194.063 24.919  149.778 1.00 106.31 ? 257 LYS A NZ     1 
ATOM   4204  H H      . LYS A 1 257 ? 195.797 19.703  149.712 1.00 105.57 ? 257 LYS A H      1 
ATOM   4205  H HA     . LYS A 1 257 ? 197.690 21.357  150.709 1.00 112.57 ? 257 LYS A HA     1 
ATOM   4206  H HB2    . LYS A 1 257 ? 195.852 19.997  152.337 1.00 112.61 ? 257 LYS A HB2    1 
ATOM   4207  H HB3    . LYS A 1 257 ? 196.503 21.418  152.599 1.00 112.61 ? 257 LYS A HB3    1 
ATOM   4208  H HG2    . LYS A 1 257 ? 194.420 20.954  150.751 1.00 117.02 ? 257 LYS A HG2    1 
ATOM   4209  H HG3    . LYS A 1 257 ? 194.225 21.642  152.171 1.00 117.02 ? 257 LYS A HG3    1 
ATOM   4210  H HD2    . LYS A 1 257 ? 195.525 23.454  151.465 1.00 124.42 ? 257 LYS A HD2    1 
ATOM   4211  H HD3    . LYS A 1 257 ? 195.696 22.769  150.039 1.00 124.42 ? 257 LYS A HD3    1 
ATOM   4212  H HE2    . LYS A 1 257 ? 193.426 23.015  149.625 1.00 126.32 ? 257 LYS A HE2    1 
ATOM   4213  H HE3    . LYS A 1 257 ? 193.211 23.633  151.073 1.00 126.32 ? 257 LYS A HE3    1 
ATOM   4214  H HZ1    . LYS A 1 257 ? 193.294 25.278  149.511 1.00 127.58 ? 257 LYS A HZ1    1 
ATOM   4215  H HZ2    . LYS A 1 257 ? 194.423 25.439  150.404 1.00 127.58 ? 257 LYS A HZ2    1 
ATOM   4216  H HZ3    . LYS A 1 257 ? 194.619 24.875  149.084 1.00 127.58 ? 257 LYS A HZ3    1 
ATOM   4217  N N      . HIS A 1 258 ? 199.333 19.755  151.595 1.00 104.95 ? 258 HIS A N      1 
ATOM   4218  C CA     . HIS A 1 258 ? 200.251 18.759  152.132 1.00 113.06 ? 258 HIS A CA     1 
ATOM   4219  C C      . HIS A 1 258 ? 199.887 18.480  153.589 1.00 109.85 ? 258 HIS A C      1 
ATOM   4220  O O      . HIS A 1 258 ? 199.629 19.418  154.345 1.00 104.38 ? 258 HIS A O      1 
ATOM   4221  C CB     . HIS A 1 258 ? 201.700 19.238  152.032 1.00 123.13 ? 258 HIS A CB     1 
ATOM   4222  C CG     . HIS A 1 258 ? 202.314 19.032  150.681 1.00 129.63 ? 258 HIS A CG     1 
ATOM   4223  N ND1    . HIS A 1 258 ? 201.924 19.745  149.567 1.00 131.71 ? 258 HIS A ND1    1 
ATOM   4224  C CD2    . HIS A 1 258 ? 203.292 18.193  150.265 1.00 132.34 ? 258 HIS A CD2    1 
ATOM   4225  C CE1    . HIS A 1 258 ? 202.637 19.356  148.525 1.00 133.55 ? 258 HIS A CE1    1 
ATOM   4226  N NE2    . HIS A 1 258 ? 203.474 18.415  148.922 1.00 133.99 ? 258 HIS A NE2    1 
ATOM   4227  H H      . HIS A 1 258 ? 199.677 20.536  151.486 1.00 125.94 ? 258 HIS A H      1 
ATOM   4228  H HA     . HIS A 1 258 ? 200.164 17.934  151.629 1.00 135.67 ? 258 HIS A HA     1 
ATOM   4229  H HB2    . HIS A 1 258 ? 201.729 20.187  152.229 1.00 147.76 ? 258 HIS A HB2    1 
ATOM   4230  H HB3    . HIS A 1 258 ? 202.235 18.751  152.678 1.00 147.76 ? 258 HIS A HB3    1 
ATOM   4231  H HD1    . HIS A 1 258 ? 201.314 20.351  149.552 1.00 158.05 ? 258 HIS A HD1    1 
ATOM   4232  H HD2    . HIS A 1 258 ? 203.756 17.582  150.791 1.00 158.81 ? 258 HIS A HD2    1 
ATOM   4233  H HE1    . HIS A 1 258 ? 202.560 19.687  147.659 1.00 160.26 ? 258 HIS A HE1    1 
ATOM   4234  H HE2    . HIS A 1 258 ? 204.040 18.006  148.420 1.00 160.78 ? 258 HIS A HE2    1 
ATOM   4235  N N      . PRO A 1 259 ? 199.852 17.192  153.987 1.00 112.62 ? 259 PRO A N      1 
ATOM   4236  C CA     . PRO A 1 259 ? 199.473 16.865  155.370 1.00 110.95 ? 259 PRO A CA     1 
ATOM   4237  C C      . PRO A 1 259 ? 200.366 17.550  156.402 1.00 106.19 ? 259 PRO A C      1 
ATOM   4238  O O      . PRO A 1 259 ? 201.509 17.904  156.098 1.00 100.88 ? 259 PRO A O      1 
ATOM   4239  C CB     . PRO A 1 259 ? 199.656 15.343  155.438 1.00 112.63 ? 259 PRO A CB     1 
ATOM   4240  C CG     . PRO A 1 259 ? 199.558 14.877  154.030 1.00 113.05 ? 259 PRO A CG     1 
ATOM   4241  C CD     . PRO A 1 259 ? 200.138 15.978  153.197 1.00 113.94 ? 259 PRO A CD     1 
ATOM   4242  H HA     . PRO A 1 259 ? 198.545 17.091  155.535 1.00 133.14 ? 259 PRO A HA     1 
ATOM   4243  H HB2    . PRO A 1 259 ? 200.528 15.134  155.809 1.00 135.15 ? 259 PRO A HB2    1 
ATOM   4244  H HB3    . PRO A 1 259 ? 198.951 14.953  155.978 1.00 135.15 ? 259 PRO A HB3    1 
ATOM   4245  H HG2    . PRO A 1 259 ? 200.071 14.061  153.921 1.00 135.66 ? 259 PRO A HG2    1 
ATOM   4246  H HG3    . PRO A 1 259 ? 198.628 14.729  153.801 1.00 135.66 ? 259 PRO A HG3    1 
ATOM   4247  H HD2    . PRO A 1 259 ? 201.095 15.858  153.096 1.00 136.73 ? 259 PRO A HD2    1 
ATOM   4248  H HD3    . PRO A 1 259 ? 199.692 16.022  152.337 1.00 136.73 ? 259 PRO A HD3    1 
ATOM   4249  N N      . LEU A 1 260 ? 199.842 17.735  157.610 1.00 105.93 ? 260 LEU A N      1 
ATOM   4250  C CA     . LEU A 1 260 ? 200.587 18.419  158.658 1.00 106.59 ? 260 LEU A CA     1 
ATOM   4251  C C      . LEU A 1 260 ? 201.698 17.534  159.212 1.00 109.30 ? 260 LEU A C      1 
ATOM   4252  O O      . LEU A 1 260 ? 201.440 16.543  159.895 1.00 110.73 ? 260 LEU A O      1 
ATOM   4253  C CB     . LEU A 1 260 ? 199.653 18.862  159.783 1.00 104.46 ? 260 LEU A CB     1 
ATOM   4254  C CG     . LEU A 1 260 ? 200.312 19.648  160.921 1.00 107.56 ? 260 LEU A CG     1 
ATOM   4255  C CD1    . LEU A 1 260 ? 200.973 20.928  160.419 1.00 107.29 ? 260 LEU A CD1    1 
ATOM   4256  C CD2    . LEU A 1 260 ? 199.283 19.970  161.985 1.00 110.78 ? 260 LEU A CD2    1 
ATOM   4257  H H      . LEU A 1 260 ? 199.058 17.473  157.847 1.00 127.12 ? 260 LEU A H      1 
ATOM   4258  H HA     . LEU A 1 260 ? 200.998 19.213  158.283 1.00 127.91 ? 260 LEU A HA     1 
ATOM   4259  H HB2    . LEU A 1 260 ? 198.961 19.427  159.403 1.00 125.36 ? 260 LEU A HB2    1 
ATOM   4260  H HB3    . LEU A 1 260 ? 199.246 18.073  160.173 1.00 125.36 ? 260 LEU A HB3    1 
ATOM   4261  H HG     . LEU A 1 260 ? 200.999 19.097  161.327 1.00 129.07 ? 260 LEU A HG     1 
ATOM   4262  H HD11   . LEU A 1 260 ? 201.375 21.390  161.171 1.00 128.74 ? 260 LEU A HD11   1 
ATOM   4263  H HD12   . LEU A 1 260 ? 201.654 20.697  159.769 1.00 128.74 ? 260 LEU A HD12   1 
ATOM   4264  H HD13   . LEU A 1 260 ? 200.299 21.490  160.007 1.00 128.74 ? 260 LEU A HD13   1 
ATOM   4265  H HD21   . LEU A 1 260 ? 199.713 20.467  162.699 1.00 132.93 ? 260 LEU A HD21   1 
ATOM   4266  H HD22   . LEU A 1 260 ? 198.576 20.504  161.589 1.00 132.93 ? 260 LEU A HD22   1 
ATOM   4267  H HD23   . LEU A 1 260 ? 198.918 19.141  162.332 1.00 132.93 ? 260 LEU A HD23   1 
ATOM   4268  N N      . GLU A 1 261 ? 202.935 17.906  158.898 1.00 109.35 ? 261 GLU A N      1 
ATOM   4269  C CA     . GLU A 1 261 ? 204.121 17.210  159.395 1.00 107.94 ? 261 GLU A CA     1 
ATOM   4270  C C      . GLU A 1 261 ? 204.483 17.726  160.790 1.00 99.09  ? 261 GLU A C      1 
ATOM   4271  O O      . GLU A 1 261 ? 204.579 18.938  161.009 1.00 102.10 ? 261 GLU A O      1 
ATOM   4272  C CB     . GLU A 1 261 ? 205.296 17.394  158.425 1.00 113.95 ? 261 GLU A CB     1 
ATOM   4273  C CG     . GLU A 1 261 ? 205.539 18.842  157.978 1.00 118.34 ? 261 GLU A CG     1 
ATOM   4274  C CD     . GLU A 1 261 ? 206.636 18.969  156.935 1.00 124.12 ? 261 GLU A CD     1 
ATOM   4275  O OE1    . GLU A 1 261 ? 207.460 18.037  156.811 1.00 129.51 ? 261 GLU A OE1    1 
ATOM   4276  O OE2    . GLU A 1 261 ? 206.670 20.004  156.235 1.00 123.12 ? 261 GLU A OE2    1 
ATOM   4277  H H      . GLU A 1 261 ? 203.118 18.573  158.386 1.00 131.22 ? 261 GLU A H      1 
ATOM   4278  H HA     . GLU A 1 261 ? 203.929 16.262  159.463 1.00 129.53 ? 261 GLU A HA     1 
ATOM   4279  H HB2    . GLU A 1 261 ? 206.106 17.081  158.857 1.00 136.74 ? 261 GLU A HB2    1 
ATOM   4280  H HB3    . GLU A 1 261 ? 205.126 16.866  157.629 1.00 136.74 ? 261 GLU A HB3    1 
ATOM   4281  H HG2    . GLU A 1 261 ? 204.721 19.194  157.595 1.00 142.01 ? 261 GLU A HG2    1 
ATOM   4282  H HG3    . GLU A 1 261 ? 205.798 19.370  158.749 1.00 142.01 ? 261 GLU A HG3    1 
ATOM   4283  N N      . ILE A 1 262 ? 204.683 16.805  161.730 1.00 85.25  ? 262 ILE A N      1 
ATOM   4284  C CA     . ILE A 1 262 ? 204.822 17.170  163.138 1.00 73.48  ? 262 ILE A CA     1 
ATOM   4285  C C      . ILE A 1 262 ? 205.654 16.159  163.933 1.00 71.17  ? 262 ILE A C      1 
ATOM   4286  O O      . ILE A 1 262 ? 205.547 14.953  163.729 1.00 71.05  ? 262 ILE A O      1 
ATOM   4287  C CB     . ILE A 1 262 ? 203.437 17.311  163.787 1.00 65.47  ? 262 ILE A CB     1 
ATOM   4288  C CG1    . ILE A 1 262 ? 203.571 17.700  165.258 1.00 61.67  ? 262 ILE A CG1    1 
ATOM   4289  C CG2    . ILE A 1 262 ? 202.662 16.013  163.655 1.00 68.07  ? 262 ILE A CG2    1 
ATOM   4290  C CD1    . ILE A 1 262 ? 202.260 18.101  165.913 1.00 58.45  ? 262 ILE A CD1    1 
ATOM   4291  H H      . ILE A 1 262 ? 204.743 15.960  161.578 1.00 102.30 ? 262 ILE A H      1 
ATOM   4292  H HA     . ILE A 1 262 ? 205.266 18.030  163.195 1.00 88.18  ? 262 ILE A HA     1 
ATOM   4293  H HB     . ILE A 1 262 ? 202.950 18.011  163.326 1.00 78.56  ? 262 ILE A HB     1 
ATOM   4294  H HG12   . ILE A 1 262 ? 203.928 16.944  165.750 1.00 74.01  ? 262 ILE A HG12   1 
ATOM   4295  H HG13   . ILE A 1 262 ? 204.178 18.453  165.328 1.00 74.01  ? 262 ILE A HG13   1 
ATOM   4296  H HG21   . ILE A 1 262 ? 201.792 16.122  164.071 1.00 81.68  ? 262 ILE A HG21   1 
ATOM   4297  H HG22   . ILE A 1 262 ? 202.555 15.803  162.714 1.00 81.68  ? 262 ILE A HG22   1 
ATOM   4298  H HG23   . ILE A 1 262 ? 203.154 15.305  164.099 1.00 81.68  ? 262 ILE A HG23   1 
ATOM   4299  H HD11   . ILE A 1 262 ? 202.429 18.332  166.840 1.00 70.14  ? 262 ILE A HD11   1 
ATOM   4300  H HD12   . ILE A 1 262 ? 201.893 18.866  165.443 1.00 70.14  ? 262 ILE A HD12   1 
ATOM   4301  H HD13   . ILE A 1 262 ? 201.642 17.355  165.865 1.00 70.14  ? 262 ILE A HD13   1 
ATOM   4302  N N      . GLU A 1 263 ? 206.474 16.666  164.849 1.00 71.33  ? 263 GLU A N      1 
ATOM   4303  C CA     . GLU A 1 263 ? 207.364 15.829  165.648 1.00 73.29  ? 263 GLU A CA     1 
ATOM   4304  C C      . GLU A 1 263 ? 206.603 15.093  166.747 1.00 66.49  ? 263 GLU A C      1 
ATOM   4305  O O      . GLU A 1 263 ? 205.788 15.692  167.433 1.00 63.00  ? 263 GLU A O      1 
ATOM   4306  C CB     . GLU A 1 263 ? 208.446 16.692  166.291 1.00 85.18  ? 263 GLU A CB     1 
ATOM   4307  C CG     . GLU A 1 263 ? 209.553 17.118  165.345 1.00 97.32  ? 263 GLU A CG     1 
ATOM   4308  C CD     . GLU A 1 263 ? 210.535 16.001  165.046 1.00 109.86 ? 263 GLU A CD     1 
ATOM   4309  O OE1    . GLU A 1 263 ? 210.605 15.031  165.835 1.00 109.08 ? 263 GLU A OE1    1 
ATOM   4310  O OE2    . GLU A 1 263 ? 211.240 16.096  164.017 1.00 119.35 ? 263 GLU A OE2    1 
ATOM   4311  H H      . GLU A 1 263 ? 206.535 17.505  165.028 1.00 85.59  ? 263 GLU A H      1 
ATOM   4312  H HA     . GLU A 1 263 ? 207.792 15.172  165.076 1.00 87.95  ? 263 GLU A HA     1 
ATOM   4313  H HB2    . GLU A 1 263 ? 208.033 17.496  166.643 1.00 102.22 ? 263 GLU A HB2    1 
ATOM   4314  H HB3    . GLU A 1 263 ? 208.853 16.190  167.014 1.00 102.22 ? 263 GLU A HB3    1 
ATOM   4315  H HG2    . GLU A 1 263 ? 209.159 17.403  164.506 1.00 116.78 ? 263 GLU A HG2    1 
ATOM   4316  H HG3    . GLU A 1 263 ? 210.046 17.851  165.746 1.00 116.78 ? 263 GLU A HG3    1 
ATOM   4317  N N      . PRO A 1 264 ? 206.876 13.792  166.931 1.00 60.73  ? 264 PRO A N      1 
ATOM   4318  C CA     . PRO A 1 264 ? 206.166 13.026  167.963 1.00 59.79  ? 264 PRO A CA     1 
ATOM   4319  C C      . PRO A 1 264 ? 206.248 13.635  169.359 1.00 65.82  ? 264 PRO A C      1 
ATOM   4320  O O      . PRO A 1 264 ? 205.324 13.444  170.148 1.00 69.95  ? 264 PRO A O      1 
ATOM   4321  C CB     . PRO A 1 264 ? 206.894 11.679  167.959 1.00 54.01  ? 264 PRO A CB     1 
ATOM   4322  C CG     . PRO A 1 264 ? 207.468 11.568  166.613 1.00 54.04  ? 264 PRO A CG     1 
ATOM   4323  C CD     . PRO A 1 264 ? 207.834 12.948  166.194 1.00 58.16  ? 264 PRO A CD     1 
ATOM   4324  H HA     . PRO A 1 264 ? 205.238 12.895  167.716 1.00 71.74  ? 264 PRO A HA     1 
ATOM   4325  H HB2    . PRO A 1 264 ? 207.593 11.682  168.632 1.00 64.82  ? 264 PRO A HB2    1 
ATOM   4326  H HB3    . PRO A 1 264 ? 206.260 10.964  168.124 1.00 64.82  ? 264 PRO A HB3    1 
ATOM   4327  H HG2    . PRO A 1 264 ? 208.255 11.002  166.644 1.00 64.84  ? 264 PRO A HG2    1 
ATOM   4328  H HG3    . PRO A 1 264 ? 206.805 11.195  166.010 1.00 64.84  ? 264 PRO A HG3    1 
ATOM   4329  H HD2    . PRO A 1 264 ? 208.743 13.153  166.463 1.00 69.80  ? 264 PRO A HD2    1 
ATOM   4330  H HD3    . PRO A 1 264 ? 207.713 13.054  165.237 1.00 69.80  ? 264 PRO A HD3    1 
ATOM   4331  N N      . GLU A 1 265 ? 207.336 14.332  169.673 1.00 67.08  ? 265 GLU A N      1 
ATOM   4332  C CA     . GLU A 1 265 ? 207.473 14.944  170.992 1.00 68.05  ? 265 GLU A CA     1 
ATOM   4333  C C      . GLU A 1 265 ? 206.485 16.099  171.171 1.00 68.33  ? 265 GLU A C      1 
ATOM   4334  O O      . GLU A 1 265 ? 205.856 16.224  172.223 1.00 70.21  ? 265 GLU A O      1 
ATOM   4335  C CB     . GLU A 1 265 ? 208.907 15.422  171.230 1.00 71.15  ? 265 GLU A CB     1 
ATOM   4336  C CG     . GLU A 1 265 ? 209.123 16.202  172.539 1.00 74.79  ? 265 GLU A CG     1 
ATOM   4337  C CD     . GLU A 1 265 ? 208.690 15.439  173.794 1.00 77.38  ? 265 GLU A CD     1 
ATOM   4338  O OE1    . GLU A 1 265 ? 208.542 14.199  173.741 1.00 77.21  ? 265 GLU A OE1    1 
ATOM   4339  O OE2    . GLU A 1 265 ? 208.499 16.087  174.845 1.00 78.67  ? 265 GLU A OE2    1 
ATOM   4340  H H      . GLU A 1 265 ? 208.004 14.464  169.147 1.00 80.49  ? 265 GLU A H      1 
ATOM   4341  H HA     . GLU A 1 265 ? 207.270 14.276  171.666 1.00 81.66  ? 265 GLU A HA     1 
ATOM   4342  H HB2    . GLU A 1 265 ? 209.491 14.648  171.251 1.00 85.38  ? 265 GLU A HB2    1 
ATOM   4343  H HB3    . GLU A 1 265 ? 209.164 16.003  170.497 1.00 85.38  ? 265 GLU A HB3    1 
ATOM   4344  H HG2    . GLU A 1 265 ? 210.066 16.408  172.628 1.00 89.74  ? 265 GLU A HG2    1 
ATOM   4345  H HG3    . GLU A 1 265 ? 208.610 17.024  172.500 1.00 89.74  ? 265 GLU A HG3    1 
ATOM   4346  N N      . ARG A 1 266 ? 206.356 16.945  170.152 1.00 66.31  ? 266 ARG A N      1 
ATOM   4347  C CA     . ARG A 1 266 ? 205.408 18.049  170.204 1.00 67.31  ? 266 ARG A CA     1 
ATOM   4348  C C      . ARG A 1 266 ? 204.002 17.493  170.366 1.00 64.77  ? 266 ARG A C      1 
ATOM   4349  O O      . ARG A 1 266 ? 203.179 18.040  171.100 1.00 65.93  ? 266 ARG A O      1 
ATOM   4350  C CB     . ARG A 1 266 ? 205.490 18.895  168.930 1.00 72.13  ? 266 ARG A CB     1 
ATOM   4351  C CG     . ARG A 1 266 ? 204.637 20.150  168.973 1.00 80.65  ? 266 ARG A CG     1 
ATOM   4352  C CD     . ARG A 1 266 ? 204.483 20.770  167.592 1.00 92.63  ? 266 ARG A CD     1 
ATOM   4353  N NE     . ARG A 1 266 ? 203.383 21.736  167.543 1.00 98.91  ? 266 ARG A NE     1 
ATOM   4354  C CZ     . ARG A 1 266 ? 202.799 22.164  166.424 1.00 97.87  ? 266 ARG A CZ     1 
ATOM   4355  N NH1    . ARG A 1 266 ? 203.201 21.716  165.239 1.00 97.19  ? 266 ARG A NH1    1 
ATOM   4356  N NH2    . ARG A 1 266 ? 201.806 23.041  166.494 1.00 95.48  ? 266 ARG A NH2    1 
ATOM   4357  H H      . ARG A 1 266 ? 206.806 16.899  169.421 1.00 79.57  ? 266 ARG A H      1 
ATOM   4358  H HA     . ARG A 1 266 ? 205.608 18.615  170.966 1.00 80.78  ? 266 ARG A HA     1 
ATOM   4359  H HB2    . ARG A 1 266 ? 206.411 19.166  168.794 1.00 86.55  ? 266 ARG A HB2    1 
ATOM   4360  H HB3    . ARG A 1 266 ? 205.191 18.358  168.179 1.00 86.55  ? 266 ARG A HB3    1 
ATOM   4361  H HG2    . ARG A 1 266 ? 203.754 19.925  169.305 1.00 96.78  ? 266 ARG A HG2    1 
ATOM   4362  H HG3    . ARG A 1 266 ? 205.058 20.802  169.554 1.00 96.78  ? 266 ARG A HG3    1 
ATOM   4363  H HD2    . ARG A 1 266 ? 205.302 21.233  167.358 1.00 111.16 ? 266 ARG A HD2    1 
ATOM   4364  H HD3    . ARG A 1 266 ? 204.299 20.070  166.947 1.00 111.16 ? 266 ARG A HD3    1 
ATOM   4365  H HE     . ARG A 1 266 ? 203.093 22.050  168.290 1.00 118.70 ? 266 ARG A HE     1 
ATOM   4366  H HH11   . ARG A 1 266 ? 203.843 21.147  165.190 1.00 116.63 ? 266 ARG A HH11   1 
ATOM   4367  H HH12   . ARG A 1 266 ? 202.819 21.997  164.521 1.00 116.63 ? 266 ARG A HH12   1 
ATOM   4368  H HH21   . ARG A 1 266 ? 201.543 23.333  167.259 1.00 114.57 ? 266 ARG A HH21   1 
ATOM   4369  H HH22   . ARG A 1 266 ? 201.427 23.319  165.774 1.00 114.57 ? 266 ARG A HH22   1 
ATOM   4370  N N      . LEU A 1 267 ? 203.736 16.389  169.684 1.00 60.70  ? 267 LEU A N      1 
ATOM   4371  C CA     . LEU A 1 267 ? 202.421 15.789  169.715 1.00 59.84  ? 267 LEU A CA     1 
ATOM   4372  C C      . LEU A 1 267 ? 202.113 15.252  171.112 1.00 63.50  ? 267 LEU A C      1 
ATOM   4373  O O      . LEU A 1 267 ? 200.994 15.380  171.601 1.00 66.65  ? 267 LEU A O      1 
ATOM   4374  C CB     . LEU A 1 267 ? 202.341 14.690  168.664 1.00 60.83  ? 267 LEU A CB     1 
ATOM   4375  C CG     . LEU A 1 267 ? 200.963 14.120  168.348 1.00 64.95  ? 267 LEU A CG     1 
ATOM   4376  C CD1    . LEU A 1 267 ? 199.977 15.214  167.942 1.00 67.07  ? 267 LEU A CD1    1 
ATOM   4377  C CD2    . LEU A 1 267 ? 201.087 13.079  167.245 1.00 65.73  ? 267 LEU A CD2    1 
ATOM   4378  H H      . LEU A 1 267 ? 204.305 15.969  169.194 1.00 72.83  ? 267 LEU A H      1 
ATOM   4379  H HA     . LEU A 1 267 ? 201.758 16.464  169.497 1.00 71.80  ? 267 LEU A HA     1 
ATOM   4380  H HB2    . LEU A 1 267 ? 202.700 15.041  167.835 1.00 73.00  ? 267 LEU A HB2    1 
ATOM   4381  H HB3    . LEU A 1 267 ? 202.893 13.950  168.962 1.00 73.00  ? 267 LEU A HB3    1 
ATOM   4382  H HG     . LEU A 1 267 ? 200.614 13.680  169.139 1.00 77.94  ? 267 LEU A HG     1 
ATOM   4383  H HD11   . LEU A 1 267 ? 199.117 14.808  167.750 1.00 80.48  ? 267 LEU A HD11   1 
ATOM   4384  H HD12   . LEU A 1 267 ? 199.890 15.846  168.672 1.00 80.48  ? 267 LEU A HD12   1 
ATOM   4385  H HD13   . LEU A 1 267 ? 200.314 15.664  167.152 1.00 80.48  ? 267 LEU A HD13   1 
ATOM   4386  H HD21   . LEU A 1 267 ? 200.207 12.721  167.049 1.00 78.87  ? 267 LEU A HD21   1 
ATOM   4387  H HD22   . LEU A 1 267 ? 201.457 13.501  166.454 1.00 78.87  ? 267 LEU A HD22   1 
ATOM   4388  H HD23   . LEU A 1 267 ? 201.674 12.368  167.547 1.00 78.87  ? 267 LEU A HD23   1 
ATOM   4389  N N      . ARG A 1 268 ? 203.113 14.669  171.763 1.00 63.50  ? 268 ARG A N      1 
ATOM   4390  C CA     . ARG A 1 268 ? 202.948 14.184  173.131 1.00 62.83  ? 268 ARG A CA     1 
ATOM   4391  C C      . ARG A 1 268 ? 202.678 15.333  174.098 1.00 62.79  ? 268 ARG A C      1 
ATOM   4392  O O      . ARG A 1 268 ? 201.873 15.205  175.018 1.00 70.22  ? 268 ARG A O      1 
ATOM   4393  C CB     . ARG A 1 268 ? 204.202 13.436  173.593 1.00 63.23  ? 268 ARG A CB     1 
ATOM   4394  C CG     . ARG A 1 268 ? 204.062 12.801  174.981 1.00 60.81  ? 268 ARG A CG     1 
ATOM   4395  C CD     . ARG A 1 268 ? 205.393 12.490  175.606 1.00 59.99  ? 268 ARG A CD     1 
ATOM   4396  N NE     . ARG A 1 268 ? 206.174 13.702  175.812 1.00 67.90  ? 268 ARG A NE     1 
ATOM   4397  C CZ     . ARG A 1 268 ? 205.951 14.588  176.779 1.00 75.22  ? 268 ARG A CZ     1 
ATOM   4398  N NH1    . ARG A 1 268 ? 204.957 14.410  177.643 1.00 80.36  ? 268 ARG A NH1    1 
ATOM   4399  N NH2    . ARG A 1 268 ? 206.723 15.662  176.878 1.00 75.24  ? 268 ARG A NH2    1 
ATOM   4400  H H      . ARG A 1 268 ? 203.898 14.540  171.436 1.00 76.20  ? 268 ARG A H      1 
ATOM   4401  H HA     . ARG A 1 268 ? 202.196 13.572  173.167 1.00 75.40  ? 268 ARG A HA     1 
ATOM   4402  H HB2    . ARG A 1 268 ? 204.394 12.726  172.960 1.00 75.88  ? 268 ARG A HB2    1 
ATOM   4403  H HB3    . ARG A 1 268 ? 204.944 14.059  173.625 1.00 75.88  ? 268 ARG A HB3    1 
ATOM   4404  H HG2    . ARG A 1 268 ? 203.591 13.416  175.565 1.00 72.97  ? 268 ARG A HG2    1 
ATOM   4405  H HG3    . ARG A 1 268 ? 203.566 11.971  174.902 1.00 72.97  ? 268 ARG A HG3    1 
ATOM   4406  H HD2    . ARG A 1 268 ? 205.252 12.068  176.468 1.00 71.99  ? 268 ARG A HD2    1 
ATOM   4407  H HD3    . ARG A 1 268 ? 205.893 11.901  175.020 1.00 71.99  ? 268 ARG A HD3    1 
ATOM   4408  H HE     . ARG A 1 268 ? 206.824 13.856  175.270 1.00 81.47  ? 268 ARG A HE     1 
ATOM   4409  H HH11   . ARG A 1 268 ? 204.454 13.715  177.582 1.00 96.44  ? 268 ARG A HH11   1 
ATOM   4410  H HH12   . ARG A 1 268 ? 204.819 14.988  178.265 1.00 96.44  ? 268 ARG A HH12   1 
ATOM   4411  H HH21   . ARG A 1 268 ? 207.367 15.782  176.321 1.00 90.29  ? 268 ARG A HH21   1 
ATOM   4412  H HH22   . ARG A 1 268 ? 206.581 16.238  177.501 1.00 90.29  ? 268 ARG A HH22   1 
ATOM   4413  N N      . LYS A 1 269 ? 203.378 16.444  173.902 1.00 56.04  ? 269 LYS A N      1 
ATOM   4414  C CA     . LYS A 1 269 ? 203.247 17.594  174.782 1.00 55.06  ? 269 LYS A CA     1 
ATOM   4415  C C      . LYS A 1 269 ? 201.877 18.245  174.577 1.00 53.30  ? 269 LYS A C      1 
ATOM   4416  O O      . LYS A 1 269 ? 201.273 18.772  175.517 1.00 50.15  ? 269 LYS A O      1 
ATOM   4417  C CB     . LYS A 1 269 ? 204.388 18.581  174.528 1.00 62.82  ? 269 LYS A CB     1 
ATOM   4418  C CG     . LYS A 1 269 ? 204.664 19.531  175.686 1.00 78.48  ? 269 LYS A CG     1 
ATOM   4419  C CD     . LYS A 1 269 ? 205.906 20.395  175.424 1.00 93.89  ? 269 LYS A CD     1 
ATOM   4420  C CE     . LYS A 1 269 ? 206.154 21.411  176.542 1.00 101.91 ? 269 LYS A CE     1 
ATOM   4421  N NZ     . LYS A 1 269 ? 205.047 22.407  176.675 1.00 103.14 ? 269 LYS A NZ     1 
ATOM   4422  H H      . LYS A 1 269 ? 203.941 16.556  173.261 1.00 67.24  ? 269 LYS A H      1 
ATOM   4423  H HA     . LYS A 1 269 ? 203.305 17.297  175.704 1.00 66.07  ? 269 LYS A HA     1 
ATOM   4424  H HB2    . LYS A 1 269 ? 205.201 18.079  174.358 1.00 75.39  ? 269 LYS A HB2    1 
ATOM   4425  H HB3    . LYS A 1 269 ? 204.167 19.118  173.751 1.00 75.39  ? 269 LYS A HB3    1 
ATOM   4426  H HG2    . LYS A 1 269 ? 203.903 20.121  175.804 1.00 94.17  ? 269 LYS A HG2    1 
ATOM   4427  H HG3    . LYS A 1 269 ? 204.818 19.015  176.493 1.00 94.17  ? 269 LYS A HG3    1 
ATOM   4428  H HD2    . LYS A 1 269 ? 206.685 19.820  175.361 1.00 112.66 ? 269 LYS A HD2    1 
ATOM   4429  H HD3    . LYS A 1 269 ? 205.784 20.882  174.595 1.00 112.66 ? 269 LYS A HD3    1 
ATOM   4430  H HE2    . LYS A 1 269 ? 206.236 20.940  177.386 1.00 122.30 ? 269 LYS A HE2    1 
ATOM   4431  H HE3    . LYS A 1 269 ? 206.972 21.896  176.352 1.00 122.30 ? 269 LYS A HE3    1 
ATOM   4432  H HZ1    . LYS A 1 269 ? 205.229 22.978  177.333 1.00 123.77 ? 269 LYS A HZ1    1 
ATOM   4433  H HZ2    . LYS A 1 269 ? 204.954 22.861  175.915 1.00 123.77 ? 269 LYS A HZ2    1 
ATOM   4434  H HZ3    . LYS A 1 269 ? 204.283 21.989  176.857 1.00 123.77 ? 269 LYS A HZ3    1 
ATOM   4435  N N      . ILE A 1 270 ? 201.375 18.175  173.349 1.00 56.66  ? 270 ILE A N      1 
ATOM   4436  C CA     . ILE A 1 270 ? 200.040 18.671  173.037 1.00 55.18  ? 270 ILE A CA     1 
ATOM   4437  C C      . ILE A 1 270 ? 198.993 17.842  173.767 1.00 54.77  ? 270 ILE A C      1 
ATOM   4438  O O      . ILE A 1 270 ? 198.100 18.390  174.416 1.00 59.83  ? 270 ILE A O      1 
ATOM   4439  C CB     . ILE A 1 270 ? 199.787 18.643  171.520 1.00 52.85  ? 270 ILE A CB     1 
ATOM   4440  C CG1    . ILE A 1 270 ? 200.493 19.832  170.861 1.00 56.29  ? 270 ILE A CG1    1 
ATOM   4441  C CG2    . ILE A 1 270 ? 198.300 18.689  171.207 1.00 47.31  ? 270 ILE A CG2    1 
ATOM   4442  C CD1    . ILE A 1 270 ? 200.538 19.758  169.347 1.00 59.14  ? 270 ILE A CD1    1 
ATOM   4443  H H      . ILE A 1 270 ? 201.791 17.841  172.674 1.00 67.99  ? 270 ILE A H      1 
ATOM   4444  H HA     . ILE A 1 270 ? 199.963 19.590  173.339 1.00 66.21  ? 270 ILE A HA     1 
ATOM   4445  H HB     . ILE A 1 270 ? 200.155 17.823  171.158 1.00 63.42  ? 270 ILE A HB     1 
ATOM   4446  H HG12   . ILE A 1 270 ? 200.025 20.647  171.104 1.00 67.54  ? 270 ILE A HG12   1 
ATOM   4447  H HG13   . ILE A 1 270 ? 201.407 19.870  171.183 1.00 67.54  ? 270 ILE A HG13   1 
ATOM   4448  H HG21   . ILE A 1 270 ? 198.180 18.670  170.245 1.00 56.77  ? 270 ILE A HG21   1 
ATOM   4449  H HG22   . ILE A 1 270 ? 197.869 17.920  171.611 1.00 56.77  ? 270 ILE A HG22   1 
ATOM   4450  H HG23   . ILE A 1 270 ? 197.926 19.507  171.572 1.00 56.77  ? 270 ILE A HG23   1 
ATOM   4451  H HD11   . ILE A 1 270 ? 200.998 20.541  169.006 1.00 70.97  ? 270 ILE A HD11   1 
ATOM   4452  H HD12   . ILE A 1 270 ? 201.014 18.954  169.085 1.00 70.97  ? 270 ILE A HD12   1 
ATOM   4453  H HD13   . ILE A 1 270 ? 199.631 19.732  169.005 1.00 70.97  ? 270 ILE A HD13   1 
ATOM   4454  N N      . VAL A 1 271 ? 199.108 16.523  173.664 1.00 49.00  ? 271 VAL A N      1 
ATOM   4455  C CA     . VAL A 1 271 ? 198.188 15.625  174.346 1.00 47.37  ? 271 VAL A CA     1 
ATOM   4456  C C      . VAL A 1 271 ? 198.246 15.839  175.863 1.00 50.15  ? 271 VAL A C      1 
ATOM   4457  O O      . VAL A 1 271 ? 197.225 15.762  176.555 1.00 50.60  ? 271 VAL A O      1 
ATOM   4458  C CB     . VAL A 1 271 ? 198.496 14.162  174.004 1.00 44.70  ? 271 VAL A CB     1 
ATOM   4459  C CG1    . VAL A 1 271 ? 197.644 13.222  174.844 1.00 42.13  ? 271 VAL A CG1    1 
ATOM   4460  C CG2    . VAL A 1 271 ? 198.233 13.916  172.529 1.00 47.43  ? 271 VAL A CG2    1 
ATOM   4461  H H      . VAL A 1 271 ? 199.713 16.123  173.202 1.00 58.80  ? 271 VAL A H      1 
ATOM   4462  H HA     . VAL A 1 271 ? 197.284 15.817  174.052 1.00 56.84  ? 271 VAL A HA     1 
ATOM   4463  H HB     . VAL A 1 271 ? 199.430 13.976  174.186 1.00 53.64  ? 271 VAL A HB     1 
ATOM   4464  H HG11   . VAL A 1 271 ? 197.858 12.306  174.607 1.00 50.55  ? 271 VAL A HG11   1 
ATOM   4465  H HG12   . VAL A 1 271 ? 197.836 13.376  175.782 1.00 50.55  ? 271 VAL A HG12   1 
ATOM   4466  H HG13   . VAL A 1 271 ? 196.707 13.400  174.664 1.00 50.55  ? 271 VAL A HG13   1 
ATOM   4467  H HG21   . VAL A 1 271 ? 198.431 12.989  172.324 1.00 56.92  ? 271 VAL A HG21   1 
ATOM   4468  H HG22   . VAL A 1 271 ? 197.301 14.106  172.339 1.00 56.92  ? 271 VAL A HG22   1 
ATOM   4469  H HG23   . VAL A 1 271 ? 198.803 14.500  172.005 1.00 56.92  ? 271 VAL A HG23   1 
ATOM   4470  N N      . GLU A 1 272 ? 199.439 16.122  176.371 1.00 49.84  ? 272 GLU A N      1 
ATOM   4471  C CA     . GLU A 1 272 ? 199.608 16.405  177.783 1.00 51.14  ? 272 GLU A CA     1 
ATOM   4472  C C      . GLU A 1 272 ? 198.852 17.681  178.160 1.00 52.69  ? 272 GLU A C      1 
ATOM   4473  O O      . GLU A 1 272 ? 198.189 17.733  179.191 1.00 53.49  ? 272 GLU A O      1 
ATOM   4474  C CB     . GLU A 1 272 ? 201.098 16.524  178.122 1.00 52.61  ? 272 GLU A CB     1 
ATOM   4475  C CG     . GLU A 1 272 ? 201.401 16.718  179.595 1.00 63.25  ? 272 GLU A CG     1 
ATOM   4476  C CD     . GLU A 1 272 ? 202.891 16.896  179.864 1.00 86.23  ? 272 GLU A CD     1 
ATOM   4477  O OE1    . GLU A 1 272 ? 203.252 17.748  180.706 1.00 94.47  ? 272 GLU A OE1    1 
ATOM   4478  O OE2    . GLU A 1 272 ? 203.705 16.182  179.236 1.00 95.94  ? 272 GLU A OE2    1 
ATOM   4479  H H      . GLU A 1 272 ? 200.168 16.155  175.915 1.00 59.81  ? 272 GLU A H      1 
ATOM   4480  H HA     . GLU A 1 272 ? 199.239 15.672  178.301 1.00 61.37  ? 272 GLU A HA     1 
ATOM   4481  H HB2    . GLU A 1 272 ? 201.546 15.714  177.835 1.00 63.13  ? 272 GLU A HB2    1 
ATOM   4482  H HB3    . GLU A 1 272 ? 201.463 17.286  177.645 1.00 63.13  ? 272 GLU A HB3    1 
ATOM   4483  H HG2    . GLU A 1 272 ? 200.942 17.512  179.911 1.00 75.90  ? 272 GLU A HG2    1 
ATOM   4484  H HG3    . GLU A 1 272 ? 201.097 15.940  180.086 1.00 75.90  ? 272 GLU A HG3    1 
ATOM   4485  N N      . GLU A 1 273 ? 198.943 18.705  177.319 1.00 55.73  ? 273 GLU A N      1 
ATOM   4486  C CA     . GLU A 1 273 ? 198.269 19.971  177.601 1.00 57.81  ? 273 GLU A CA     1 
ATOM   4487  C C      . GLU A 1 273 ? 196.752 19.850  177.510 1.00 47.91  ? 273 GLU A C      1 
ATOM   4488  O O      . GLU A 1 273 ? 196.029 20.461  178.289 1.00 44.59  ? 273 GLU A O      1 
ATOM   4489  C CB     . GLU A 1 273 ? 198.770 21.056  176.656 1.00 70.65  ? 273 GLU A CB     1 
ATOM   4490  C CG     . GLU A 1 273 ? 200.228 21.417  176.892 1.00 85.59  ? 273 GLU A CG     1 
ATOM   4491  C CD     . GLU A 1 273 ? 200.862 22.105  175.698 1.00 97.92  ? 273 GLU A CD     1 
ATOM   4492  O OE1    . GLU A 1 273 ? 200.118 22.665  174.865 1.00 104.86 ? 273 GLU A OE1    1 
ATOM   4493  O OE2    . GLU A 1 273 ? 202.105 22.078  175.592 1.00 99.83  ? 273 GLU A OE2    1 
ATOM   4494  H H      . GLU A 1 273 ? 199.385 18.695  176.582 1.00 66.88  ? 273 GLU A H      1 
ATOM   4495  H HA     . GLU A 1 273 ? 198.489 20.244  178.505 1.00 69.37  ? 273 GLU A HA     1 
ATOM   4496  H HB2    . GLU A 1 273 ? 198.683 20.744  175.742 1.00 84.78  ? 273 GLU A HB2    1 
ATOM   4497  H HB3    . GLU A 1 273 ? 198.239 21.857  176.786 1.00 84.78  ? 273 GLU A HB3    1 
ATOM   4498  H HG2    . GLU A 1 273 ? 200.286 22.019  177.650 1.00 102.71 ? 273 GLU A HG2    1 
ATOM   4499  H HG3    . GLU A 1 273 ? 200.729 20.607  177.072 1.00 102.71 ? 273 GLU A HG3    1 
ATOM   4500  N N      . ARG A 1 274 ? 196.265 19.054  176.572 1.00 45.40  ? 274 ARG A N      1 
ATOM   4501  C CA     . ARG A 1 274 ? 194.828 18.849  176.444 1.00 45.09  ? 274 ARG A CA     1 
ATOM   4502  C C      . ARG A 1 274 ? 194.245 18.078  177.630 1.00 48.07  ? 274 ARG A C      1 
ATOM   4503  O O      . ARG A 1 274 ? 193.092 18.277  178.004 1.00 47.17  ? 274 ARG A O      1 
ATOM   4504  C CB     . ARG A 1 274 ? 194.531 18.080  175.170 1.00 45.72  ? 274 ARG A CB     1 
ATOM   4505  C CG     . ARG A 1 274 ? 194.821 18.823  173.883 1.00 42.77  ? 274 ARG A CG     1 
ATOM   4506  C CD     . ARG A 1 274 ? 194.274 18.041  172.719 1.00 42.13  ? 274 ARG A CD     1 
ATOM   4507  N NE     . ARG A 1 274 ? 193.782 18.960  171.716 1.00 50.09  ? 274 ARG A NE     1 
ATOM   4508  C CZ     . ARG A 1 274 ? 192.588 18.919  171.137 1.00 55.44  ? 274 ARG A CZ     1 
ATOM   4509  N NH1    . ARG A 1 274 ? 191.692 17.974  171.406 1.00 47.53  ? 274 ARG A NH1    1 
ATOM   4510  N NH2    . ARG A 1 274 ? 192.302 19.850  170.247 1.00 66.76  ? 274 ARG A NH2    1 
ATOM   4511  H H      . ARG A 1 274 ? 196.739 18.622  175.999 1.00 54.48  ? 274 ARG A H      1 
ATOM   4512  H HA     . ARG A 1 274 ? 194.385 19.710  176.393 1.00 54.10  ? 274 ARG A HA     1 
ATOM   4513  H HB2    . ARG A 1 274 ? 195.067 17.272  175.166 1.00 54.87  ? 274 ARG A HB2    1 
ATOM   4514  H HB3    . ARG A 1 274 ? 193.590 17.846  175.165 1.00 54.87  ? 274 ARG A HB3    1 
ATOM   4515  H HG2    . ARG A 1 274 ? 194.390 19.692  173.904 1.00 51.32  ? 274 ARG A HG2    1 
ATOM   4516  H HG3    . ARG A 1 274 ? 195.779 18.919  173.771 1.00 51.32  ? 274 ARG A HG3    1 
ATOM   4517  H HD2    . ARG A 1 274 ? 194.979 17.502  172.327 1.00 50.56  ? 274 ARG A HD2    1 
ATOM   4518  H HD3    . ARG A 1 274 ? 193.539 17.482  173.016 1.00 50.56  ? 274 ARG A HD3    1 
ATOM   4519  H HE     . ARG A 1 274 ? 194.312 19.592  171.473 1.00 60.11  ? 274 ARG A HE     1 
ATOM   4520  H HH11   . ARG A 1 274 ? 191.871 17.365  171.985 1.00 57.03  ? 274 ARG A HH11   1 
ATOM   4521  H HH12   . ARG A 1 274 ? 190.930 17.978  171.006 1.00 57.03  ? 274 ARG A HH12   1 
ATOM   4522  H HH21   . ARG A 1 274 ? 192.879 20.461  170.064 1.00 80.11  ? 274 ARG A HH21   1 
ATOM   4523  H HH22   . ARG A 1 274 ? 191.540 19.844  169.849 1.00 80.11  ? 274 ARG A HH22   1 
ATOM   4524  N N      . GLY A 1 275 ? 195.049 17.186  178.203 1.00 49.54  ? 275 GLY A N      1 
ATOM   4525  C CA     . GLY A 1 275 ? 194.652 16.410  179.364 1.00 48.03  ? 275 GLY A CA     1 
ATOM   4526  C C      . GLY A 1 275 ? 193.736 15.253  179.015 1.00 47.00  ? 275 GLY A C      1 
ATOM   4527  O O      . GLY A 1 275 ? 193.142 14.637  179.898 1.00 45.37  ? 275 GLY A O      1 
ATOM   4528  H H      . GLY A 1 275 ? 195.845 17.011  177.928 1.00 59.45  ? 275 GLY A H      1 
ATOM   4529  H HA2    . GLY A 1 275 ? 195.443 16.054  179.798 1.00 57.64  ? 275 GLY A HA2    1 
ATOM   4530  H HA3    . GLY A 1 275 ? 194.190 16.986  179.993 1.00 57.64  ? 275 GLY A HA3    1 
ATOM   4531  N N      . THR A 1 276 ? 193.629 14.950  177.725 1.00 46.52  ? 276 THR A N      1 
ATOM   4532  C CA     . THR A 1 276 ? 192.694 13.940  177.254 1.00 45.37  ? 276 THR A CA     1 
ATOM   4533  C C      . THR A 1 276 ? 193.311 12.551  177.192 1.00 46.29  ? 276 THR A C      1 
ATOM   4534  O O      . THR A 1 276 ? 194.520 12.388  177.314 1.00 49.37  ? 276 THR A O      1 
ATOM   4535  C CB     . THR A 1 276 ? 192.183 14.292  175.855 1.00 47.14  ? 276 THR A CB     1 
ATOM   4536  O OG1    . THR A 1 276 ? 193.298 14.524  174.984 1.00 49.32  ? 276 THR A OG1    1 
ATOM   4537  C CG2    . THR A 1 276 ? 191.305 15.536  175.901 1.00 46.28  ? 276 THR A CG2    1 
ATOM   4538  H H      . THR A 1 276 ? 194.090 15.320  177.100 1.00 55.82  ? 276 THR A H      1 
ATOM   4539  H HA     . THR A 1 276 ? 191.933 13.907  177.855 1.00 54.45  ? 276 THR A HA     1 
ATOM   4540  H HB     . THR A 1 276 ? 191.653 13.556  175.511 1.00 56.57  ? 276 THR A HB     1 
ATOM   4541  H HG1    . THR A 1 276 ? 193.025 14.718  174.214 1.00 59.19  ? 276 THR A HG1    1 
ATOM   4542  H HG21   . THR A 1 276 ? 190.987 15.751  175.011 1.00 55.53  ? 276 THR A HG21   1 
ATOM   4543  H HG22   . THR A 1 276 ? 190.542 15.382  176.480 1.00 55.53  ? 276 THR A HG22   1 
ATOM   4544  H HG23   . THR A 1 276 ? 191.814 16.288  176.244 1.00 55.53  ? 276 THR A HG23   1 
ATOM   4545  N N      . ALA A 1 277 ? 192.456 11.552  177.010 1.00 46.55  ? 277 ALA A N      1 
ATOM   4546  C CA     . ALA A 1 277 ? 192.887 10.194  176.730 1.00 47.12  ? 277 ALA A CA     1 
ATOM   4547  C C      . ALA A 1 277 ? 192.820 9.991   175.225 1.00 48.13  ? 277 ALA A C      1 
ATOM   4548  O O      . ALA A 1 277 ? 191.755 10.123  174.631 1.00 48.89  ? 277 ALA A O      1 
ATOM   4549  C CB     . ALA A 1 277 ? 191.986 9.207   177.429 1.00 46.92  ? 277 ALA A CB     1 
ATOM   4550  H H      . ALA A 1 277 ? 191.601 11.641  177.046 1.00 55.87  ? 277 ALA A H      1 
ATOM   4551  H HA     . ALA A 1 277 ? 193.800 10.063  177.030 1.00 56.55  ? 277 ALA A HA     1 
ATOM   4552  H HB1    . ALA A 1 277 ? 192.289 8.307   177.230 1.00 56.31  ? 277 ALA A HB1    1 
ATOM   4553  H HB2    . ALA A 1 277 ? 192.025 9.366   178.385 1.00 56.31  ? 277 ALA A HB2    1 
ATOM   4554  H HB3    . ALA A 1 277 ? 191.078 9.328   177.110 1.00 56.31  ? 277 ALA A HB3    1 
ATOM   4555  N N      . VAL A 1 278 ? 193.965 9.689   174.619 1.00 48.84  ? 278 VAL A N      1 
ATOM   4556  C CA     . VAL A 1 278 ? 194.069 9.507   173.173 1.00 48.42  ? 278 VAL A CA     1 
ATOM   4557  C C      . VAL A 1 278 ? 194.602 8.110   172.902 1.00 47.59  ? 278 VAL A C      1 
ATOM   4558  O O      . VAL A 1 278 ? 195.684 7.749   173.367 1.00 51.21  ? 278 VAL A O      1 
ATOM   4559  C CB     . VAL A 1 278 ? 195.038 10.537  172.536 1.00 44.93  ? 278 VAL A CB     1 
ATOM   4560  C CG1    . VAL A 1 278 ? 195.038 10.425  171.017 1.00 36.78  ? 278 VAL A CG1    1 
ATOM   4561  C CG2    . VAL A 1 278 ? 194.671 11.939  172.952 1.00 52.77  ? 278 VAL A CG2    1 
ATOM   4562  H H      . VAL A 1 278 ? 194.711 9.581   175.032 1.00 58.61  ? 278 VAL A H      1 
ATOM   4563  H HA     . VAL A 1 278 ? 193.195 9.598   172.762 1.00 58.10  ? 278 VAL A HA     1 
ATOM   4564  H HB     . VAL A 1 278 ? 195.939 10.358  172.849 1.00 53.91  ? 278 VAL A HB     1 
ATOM   4565  H HG11   . VAL A 1 278 ? 195.652 11.081  170.652 1.00 44.13  ? 278 VAL A HG11   1 
ATOM   4566  H HG12   . VAL A 1 278 ? 195.320 9.531   170.766 1.00 44.13  ? 278 VAL A HG12   1 
ATOM   4567  H HG13   . VAL A 1 278 ? 194.140 10.593  170.689 1.00 44.13  ? 278 VAL A HG13   1 
ATOM   4568  H HG21   . VAL A 1 278 ? 195.290 12.562  172.542 1.00 63.32  ? 278 VAL A HG21   1 
ATOM   4569  H HG22   . VAL A 1 278 ? 193.766 12.128  172.658 1.00 63.32  ? 278 VAL A HG22   1 
ATOM   4570  H HG23   . VAL A 1 278 ? 194.725 12.005  173.919 1.00 63.32  ? 278 VAL A HG23   1 
ATOM   4571  N N      . PHE A 1 279 ? 193.846 7.326   172.148 1.00 44.74  ? 279 PHE A N      1 
ATOM   4572  C CA     . PHE A 1 279 ? 194.213 5.939   171.894 1.00 46.38  ? 279 PHE A CA     1 
ATOM   4573  C C      . PHE A 1 279 ? 193.601 5.420   170.602 1.00 47.99  ? 279 PHE A C      1 
ATOM   4574  O O      . PHE A 1 279 ? 192.615 5.962   170.111 1.00 42.18  ? 279 PHE A O      1 
ATOM   4575  C CB     . PHE A 1 279 ? 193.749 5.057   173.044 1.00 42.49  ? 279 PHE A CB     1 
ATOM   4576  C CG     . PHE A 1 279 ? 192.272 5.054   173.234 1.00 41.55  ? 279 PHE A CG     1 
ATOM   4577  C CD1    . PHE A 1 279 ? 191.661 6.019   174.015 1.00 46.32  ? 279 PHE A CD1    1 
ATOM   4578  C CD2    . PHE A 1 279 ? 191.494 4.085   172.644 1.00 42.60  ? 279 PHE A CD2    1 
ATOM   4579  C CE1    . PHE A 1 279 ? 190.294 6.016   174.202 1.00 46.25  ? 279 PHE A CE1    1 
ATOM   4580  C CE2    . PHE A 1 279 ? 190.124 4.074   172.825 1.00 43.52  ? 279 PHE A CE2    1 
ATOM   4581  C CZ     . PHE A 1 279 ? 189.526 5.040   173.607 1.00 45.18  ? 279 PHE A CZ     1 
ATOM   4582  H H      . PHE A 1 279 ? 193.113 7.573   171.770 1.00 53.69  ? 279 PHE A H      1 
ATOM   4583  H HA     . PHE A 1 279 ? 195.178 5.870   171.824 1.00 55.65  ? 279 PHE A HA     1 
ATOM   4584  H HB2    . PHE A 1 279 ? 194.028 4.145   172.871 1.00 50.99  ? 279 PHE A HB2    1 
ATOM   4585  H HB3    . PHE A 1 279 ? 194.153 5.376   173.866 1.00 50.99  ? 279 PHE A HB3    1 
ATOM   4586  H HD1    . PHE A 1 279 ? 192.178 6.677   174.421 1.00 55.58  ? 279 PHE A HD1    1 
ATOM   4587  H HD2    . PHE A 1 279 ? 191.894 3.431   172.119 1.00 51.12  ? 279 PHE A HD2    1 
ATOM   4588  H HE1    . PHE A 1 279 ? 189.893 6.669   174.728 1.00 55.50  ? 279 PHE A HE1    1 
ATOM   4589  H HE2    . PHE A 1 279 ? 189.607 3.415   172.421 1.00 52.22  ? 279 PHE A HE2    1 
ATOM   4590  H HZ     . PHE A 1 279 ? 188.604 5.036   173.727 1.00 54.22  ? 279 PHE A HZ     1 
ATOM   4591  N N      . ALA A 1 280 ? 194.184 4.345   170.080 1.00 54.07  ? 280 ALA A N      1 
ATOM   4592  C CA     . ALA A 1 280 ? 193.738 3.767   168.820 1.00 54.97  ? 280 ALA A CA     1 
ATOM   4593  C C      . ALA A 1 280 ? 193.464 2.274   168.943 1.00 54.83  ? 280 ALA A C      1 
ATOM   4594  O O      . ALA A 1 280 ? 194.085 1.573   169.751 1.00 57.11  ? 280 ALA A O      1 
ATOM   4595  C CB     . ALA A 1 280 ? 194.774 4.017   167.736 1.00 53.53  ? 280 ALA A CB     1 
ATOM   4596  H H      . ALA A 1 280 ? 194.845 3.929   170.440 1.00 64.89  ? 280 ALA A H      1 
ATOM   4597  H HA     . ALA A 1 280 ? 192.914 4.200   168.550 1.00 65.97  ? 280 ALA A HA     1 
ATOM   4598  H HB1    . ALA A 1 280 ? 194.462 3.627   166.905 1.00 64.24  ? 280 ALA A HB1    1 
ATOM   4599  H HB2    . ALA A 1 280 ? 194.892 4.974   167.629 1.00 64.24  ? 280 ALA A HB2    1 
ATOM   4600  H HB3    . ALA A 1 280 ? 195.612 3.608   168.001 1.00 64.24  ? 280 ALA A HB3    1 
ATOM   4601  N N      . VAL A 1 281 ? 192.524 1.803   168.133 1.00 49.89  ? 281 VAL A N      1 
ATOM   4602  C CA     . VAL A 1 281 ? 192.308 0.379   167.941 1.00 48.79  ? 281 VAL A CA     1 
ATOM   4603  C C      . VAL A 1 281 ? 192.959 0.002   166.617 1.00 50.97  ? 281 VAL A C      1 
ATOM   4604  O O      . VAL A 1 281 ? 192.595 0.532   165.571 1.00 49.56  ? 281 VAL A O      1 
ATOM   4605  C CB     . VAL A 1 281 ? 190.806 0.035   167.914 1.00 48.44  ? 281 VAL A CB     1 
ATOM   4606  C CG1    . VAL A 1 281 ? 190.601 -1.453  167.710 1.00 47.88  ? 281 VAL A CG1    1 
ATOM   4607  C CG2    . VAL A 1 281 ? 190.131 0.485   169.211 1.00 51.55  ? 281 VAL A CG2    1 
ATOM   4608  H H      . VAL A 1 281 ? 191.989 2.299   167.676 1.00 59.87  ? 281 VAL A H      1 
ATOM   4609  H HA     . VAL A 1 281 ? 192.734 -0.120  168.655 1.00 58.54  ? 281 VAL A HA     1 
ATOM   4610  H HB     . VAL A 1 281 ? 190.385 0.502   167.176 1.00 58.13  ? 281 VAL A HB     1 
ATOM   4611  H HG11   . VAL A 1 281 ? 189.650 -1.641  167.698 1.00 57.46  ? 281 VAL A HG11   1 
ATOM   4612  H HG12   . VAL A 1 281 ? 191.002 -1.714  166.866 1.00 57.46  ? 281 VAL A HG12   1 
ATOM   4613  H HG13   . VAL A 1 281 ? 191.024 -1.932  168.440 1.00 57.46  ? 281 VAL A HG13   1 
ATOM   4614  H HG21   . VAL A 1 281 ? 189.189 0.258   169.171 1.00 61.86  ? 281 VAL A HG21   1 
ATOM   4615  H HG22   . VAL A 1 281 ? 190.550 0.030   169.959 1.00 61.86  ? 281 VAL A HG22   1 
ATOM   4616  H HG23   . VAL A 1 281 ? 190.237 1.444   169.306 1.00 61.86  ? 281 VAL A HG23   1 
ATOM   4617  N N      . LYS A 1 282 ? 193.939 -0.892  166.671 1.00 55.53  ? 282 LYS A N      1 
ATOM   4618  C CA     . LYS A 1 282 ? 194.653 -1.333  165.476 1.00 60.85  ? 282 LYS A CA     1 
ATOM   4619  C C      . LYS A 1 282 ? 194.342 -2.797  165.170 1.00 64.28  ? 282 LYS A C      1 
ATOM   4620  O O      . LYS A 1 282 ? 194.464 -3.664  166.034 1.00 67.83  ? 282 LYS A O      1 
ATOM   4621  C CB     . LYS A 1 282 ? 196.159 -1.152  165.663 1.00 60.78  ? 282 LYS A CB     1 
ATOM   4622  C CG     . LYS A 1 282 ? 196.997 -1.613  164.483 1.00 61.07  ? 282 LYS A CG     1 
ATOM   4623  C CD     . LYS A 1 282 ? 198.469 -1.507  164.818 1.00 63.71  ? 282 LYS A CD     1 
ATOM   4624  C CE     . LYS A 1 282 ? 199.333 -2.017  163.692 1.00 70.20  ? 282 LYS A CE     1 
ATOM   4625  N NZ     . LYS A 1 282 ? 200.774 -2.025  164.067 1.00 76.56  ? 282 LYS A NZ     1 
ATOM   4626  H H      . LYS A 1 282 ? 194.214 -1.262  167.397 1.00 66.63  ? 282 LYS A H      1 
ATOM   4627  H HA     . LYS A 1 282 ? 194.373 -0.797  164.718 1.00 73.02  ? 282 LYS A HA     1 
ATOM   4628  H HB2    . LYS A 1 282 ? 196.343 -0.210  165.805 1.00 72.94  ? 282 LYS A HB2    1 
ATOM   4629  H HB3    . LYS A 1 282 ? 196.439 -1.661  166.440 1.00 72.94  ? 282 LYS A HB3    1 
ATOM   4630  H HG2    . LYS A 1 282 ? 196.793 -2.540  164.283 1.00 73.28  ? 282 LYS A HG2    1 
ATOM   4631  H HG3    . LYS A 1 282 ? 196.814 -1.050  163.715 1.00 73.28  ? 282 LYS A HG3    1 
ATOM   4632  H HD2    . LYS A 1 282 ? 198.695 -0.577  164.976 1.00 76.46  ? 282 LYS A HD2    1 
ATOM   4633  H HD3    . LYS A 1 282 ? 198.657 -2.037  165.609 1.00 76.46  ? 282 LYS A HD3    1 
ATOM   4634  H HE2    . LYS A 1 282 ? 199.071 -2.925  163.474 1.00 84.24  ? 282 LYS A HE2    1 
ATOM   4635  H HE3    . LYS A 1 282 ? 199.224 -1.442  162.919 1.00 84.24  ? 282 LYS A HE3    1 
ATOM   4636  H HZ1    . LYS A 1 282 ? 201.263 -2.329  163.389 1.00 91.88  ? 282 LYS A HZ1    1 
ATOM   4637  H HZ2    . LYS A 1 282 ? 201.040 -1.199  164.269 1.00 91.88  ? 282 LYS A HZ2    1 
ATOM   4638  H HZ3    . LYS A 1 282 ? 200.901 -2.550  164.774 1.00 91.88  ? 282 LYS A HZ3    1 
ATOM   4639  N N      . PHE A 1 283 ? 193.942 -3.069  163.934 1.00 62.36  ? 283 PHE A N      1 
ATOM   4640  C CA     . PHE A 1 283 ? 193.620 -4.430  163.522 1.00 60.81  ? 283 PHE A CA     1 
ATOM   4641  C C      . PHE A 1 283 ? 193.970 -4.604  162.052 1.00 59.83  ? 283 PHE A C      1 
ATOM   4642  O O      . PHE A 1 283 ? 194.165 -3.624  161.345 1.00 61.34  ? 283 PHE A O      1 
ATOM   4643  C CB     . PHE A 1 283 ? 192.136 -4.744  163.777 1.00 57.67  ? 283 PHE A CB     1 
ATOM   4644  C CG     . PHE A 1 283 ? 191.180 -3.820  163.066 1.00 55.28  ? 283 PHE A CG     1 
ATOM   4645  C CD1    . PHE A 1 283 ? 190.789 -2.624  163.648 1.00 53.81  ? 283 PHE A CD1    1 
ATOM   4646  C CD2    . PHE A 1 283 ? 190.665 -4.152  161.821 1.00 54.15  ? 283 PHE A CD2    1 
ATOM   4647  C CE1    . PHE A 1 283 ? 189.903 -1.771  162.997 1.00 52.94  ? 283 PHE A CE1    1 
ATOM   4648  C CE2    . PHE A 1 283 ? 189.780 -3.303  161.169 1.00 52.25  ? 283 PHE A CE2    1 
ATOM   4649  C CZ     . PHE A 1 283 ? 189.401 -2.112  161.760 1.00 50.82  ? 283 PHE A CZ     1 
ATOM   4650  H H      . PHE A 1 283 ? 193.849 -2.482  163.313 1.00 74.84  ? 283 PHE A H      1 
ATOM   4651  H HA     . PHE A 1 283 ? 194.154 -5.054  164.037 1.00 72.97  ? 283 PHE A HA     1 
ATOM   4652  H HB2    . PHE A 1 283 ? 191.952 -5.647  163.476 1.00 69.21  ? 283 PHE A HB2    1 
ATOM   4653  H HB3    . PHE A 1 283 ? 191.962 -4.674  164.728 1.00 69.21  ? 283 PHE A HB3    1 
ATOM   4654  H HD1    . PHE A 1 283 ? 191.124 -2.388  164.482 1.00 64.57  ? 283 PHE A HD1    1 
ATOM   4655  H HD2    . PHE A 1 283 ? 190.916 -4.952  161.418 1.00 64.98  ? 283 PHE A HD2    1 
ATOM   4656  H HE1    . PHE A 1 283 ? 189.650 -0.971  163.397 1.00 63.52  ? 283 PHE A HE1    1 
ATOM   4657  H HE2    . PHE A 1 283 ? 189.443 -3.535  160.334 1.00 62.70  ? 283 PHE A HE2    1 
ATOM   4658  H HZ     . PHE A 1 283 ? 188.809 -1.542  161.323 1.00 60.98  ? 283 PHE A HZ     1 
ATOM   4659  N N      . ARG A 1 284 ? 194.060 -5.850  161.596 1.00 60.09  ? 284 ARG A N      1 
ATOM   4660  C CA     . ARG A 1 284 ? 194.429 -6.124  160.210 1.00 61.37  ? 284 ARG A CA     1 
ATOM   4661  C C      . ARG A 1 284 ? 193.325 -5.725  159.220 1.00 61.04  ? 284 ARG A C      1 
ATOM   4662  O O      . ARG A 1 284 ? 192.143 -5.978  159.448 1.00 59.15  ? 284 ARG A O      1 
ATOM   4663  C CB     . ARG A 1 284 ? 194.801 -7.592  160.045 1.00 66.12  ? 284 ARG A CB     1 
ATOM   4664  C CG     . ARG A 1 284 ? 196.011 -7.999  160.869 1.00 72.56  ? 284 ARG A CG     1 
ATOM   4665  C CD     . ARG A 1 284 ? 196.577 -9.343  160.434 1.00 80.02  ? 284 ARG A CD     1 
ATOM   4666  N NE     . ARG A 1 284 ? 196.246 -10.427 161.360 1.00 85.80  ? 284 ARG A NE     1 
ATOM   4667  C CZ     . ARG A 1 284 ? 196.900 -10.682 162.493 1.00 86.89  ? 284 ARG A CZ     1 
ATOM   4668  N NH1    . ARG A 1 284 ? 197.923 -9.922  162.869 1.00 91.67  ? 284 ARG A NH1    1 
ATOM   4669  N NH2    . ARG A 1 284 ? 196.527 -11.699 163.260 1.00 81.44  ? 284 ARG A NH2    1 
ATOM   4670  H H      . ARG A 1 284 ? 193.911 -6.554  162.067 1.00 72.11  ? 284 ARG A H      1 
ATOM   4671  H HA     . ARG A 1 284 ? 195.216 -5.599  159.994 1.00 73.64  ? 284 ARG A HA     1 
ATOM   4672  H HB2    . ARG A 1 284 ? 194.051 -8.140  160.324 1.00 79.34  ? 284 ARG A HB2    1 
ATOM   4673  H HB3    . ARG A 1 284 ? 195.005 -7.761  159.112 1.00 79.34  ? 284 ARG A HB3    1 
ATOM   4674  H HG2    . ARG A 1 284 ? 196.706 -7.330  160.765 1.00 87.07  ? 284 ARG A HG2    1 
ATOM   4675  H HG3    . ARG A 1 284 ? 195.751 -8.068  161.801 1.00 87.07  ? 284 ARG A HG3    1 
ATOM   4676  H HD2    . ARG A 1 284 ? 196.214 -9.571  159.564 1.00 96.02  ? 284 ARG A HD2    1 
ATOM   4677  H HD3    . ARG A 1 284 ? 197.543 -9.277  160.384 1.00 96.02  ? 284 ARG A HD3    1 
ATOM   4678  H HE     . ARG A 1 284 ? 195.582 -10.935 161.159 1.00 102.96 ? 284 ARG A HE     1 
ATOM   4679  H HH11   . ARG A 1 284 ? 198.172 -9.263  162.376 1.00 110.01 ? 284 ARG A HH11   1 
ATOM   4680  H HH12   . ARG A 1 284 ? 198.338 -10.091 163.602 1.00 110.01 ? 284 ARG A HH12   1 
ATOM   4681  H HH21   . ARG A 1 284 ? 195.863 -12.193 163.025 1.00 97.73  ? 284 ARG A HH21   1 
ATOM   4682  H HH22   . ARG A 1 284 ? 196.945 -11.860 163.994 1.00 97.73  ? 284 ARG A HH22   1 
ATOM   4683  N N      . LYS A 1 285 ? 193.733 -5.088  158.125 1.00 61.75  ? 285 LYS A N      1 
ATOM   4684  C CA     . LYS A 1 285 ? 192.807 -4.596  157.111 1.00 63.97  ? 285 LYS A CA     1 
ATOM   4685  C C      . LYS A 1 285 ? 192.165 -5.742  156.327 1.00 70.56  ? 285 LYS A C      1 
ATOM   4686  O O      . LYS A 1 285 ? 192.869 -6.597  155.788 1.00 74.79  ? 285 LYS A O      1 
ATOM   4687  C CB     . LYS A 1 285 ? 193.555 -3.663  156.160 1.00 64.63  ? 285 LYS A CB     1 
ATOM   4688  C CG     . LYS A 1 285 ? 192.738 -3.158  154.993 1.00 72.56  ? 285 LYS A CG     1 
ATOM   4689  C CD     . LYS A 1 285 ? 193.517 -2.117  154.195 1.00 83.75  ? 285 LYS A CD     1 
ATOM   4690  C CE     . LYS A 1 285 ? 192.997 -1.996  152.770 1.00 93.56  ? 285 LYS A CE     1 
ATOM   4691  N NZ     . LYS A 1 285 ? 193.232 -3.240  151.968 1.00 99.40  ? 285 LYS A NZ     1 
ATOM   4692  H H      . LYS A 1 285 ? 194.558 -4.925  157.944 1.00 74.10  ? 285 LYS A H      1 
ATOM   4693  H HA     . LYS A 1 285 ? 192.101 -4.089  157.542 1.00 76.76  ? 285 LYS A HA     1 
ATOM   4694  H HB2    . LYS A 1 285 ? 193.859 -2.890  156.661 1.00 77.55  ? 285 LYS A HB2    1 
ATOM   4695  H HB3    . LYS A 1 285 ? 194.319 -4.138  155.798 1.00 77.55  ? 285 LYS A HB3    1 
ATOM   4696  H HG2    . LYS A 1 285 ? 192.524 -3.898  154.404 1.00 87.07  ? 285 LYS A HG2    1 
ATOM   4697  H HG3    . LYS A 1 285 ? 191.925 -2.744  155.324 1.00 87.07  ? 285 LYS A HG3    1 
ATOM   4698  H HD2    . LYS A 1 285 ? 193.428 -1.252  154.625 1.00 100.50 ? 285 LYS A HD2    1 
ATOM   4699  H HD3    . LYS A 1 285 ? 194.451 -2.377  154.156 1.00 100.50 ? 285 LYS A HD3    1 
ATOM   4700  H HE2    . LYS A 1 285 ? 192.042 -1.828  152.794 1.00 112.27 ? 285 LYS A HE2    1 
ATOM   4701  H HE3    . LYS A 1 285 ? 193.453 -1.262  152.328 1.00 112.27 ? 285 LYS A HE3    1 
ATOM   4702  H HZ1    . LYS A 1 285 ? 192.916 -3.134  151.143 1.00 119.29 ? 285 LYS A HZ1    1 
ATOM   4703  H HZ2    . LYS A 1 285 ? 194.103 -3.414  151.925 1.00 119.29 ? 285 LYS A HZ2    1 
ATOM   4704  H HZ3    . LYS A 1 285 ? 192.818 -3.930  152.350 1.00 119.29 ? 285 LYS A HZ3    1 
ATOM   4705  N N      . PRO A 1 286 ? 190.823 -5.774  156.263 1.00 72.45  ? 286 PRO A N      1 
ATOM   4706  C CA     . PRO A 1 286 ? 190.196 -6.847  155.483 1.00 73.47  ? 286 PRO A CA     1 
ATOM   4707  C C      . PRO A 1 286 ? 190.524 -6.709  154.007 1.00 72.95  ? 286 PRO A C      1 
ATOM   4708  O O      . PRO A 1 286 ? 190.796 -5.595  153.562 1.00 73.36  ? 286 PRO A O      1 
ATOM   4709  C CB     . PRO A 1 286 ? 188.698 -6.625  155.710 1.00 74.80  ? 286 PRO A CB     1 
ATOM   4710  C CG     . PRO A 1 286 ? 188.605 -5.797  156.944 1.00 74.82  ? 286 PRO A CG     1 
ATOM   4711  C CD     . PRO A 1 286 ? 189.823 -4.937  156.946 1.00 73.49  ? 286 PRO A CD     1 
ATOM   4712  H HA     . PRO A 1 286 ? 190.460 -7.722  155.808 1.00 88.17  ? 286 PRO A HA     1 
ATOM   4713  H HB2    . PRO A 1 286 ? 188.319 -6.153  154.952 1.00 89.76  ? 286 PRO A HB2    1 
ATOM   4714  H HB3    . PRO A 1 286 ? 188.256 -7.479  155.837 1.00 89.76  ? 286 PRO A HB3    1 
ATOM   4715  H HG2    . PRO A 1 286 ? 187.803 -5.252  156.911 1.00 89.79  ? 286 PRO A HG2    1 
ATOM   4716  H HG3    . PRO A 1 286 ? 188.594 -6.375  157.723 1.00 89.79  ? 286 PRO A HG3    1 
ATOM   4717  H HD2    . PRO A 1 286 ? 189.663 -4.122  156.445 1.00 88.19  ? 286 PRO A HD2    1 
ATOM   4718  H HD3    . PRO A 1 286 ? 190.103 -4.748  157.856 1.00 88.19  ? 286 PRO A HD3    1 
ATOM   4719  N N      . ASP A 1 287 ? 190.500 -7.812  153.263 1.00 72.72  ? 287 ASP A N      1 
ATOM   4720  C CA     . ASP A 1 287 ? 190.782 -7.769  151.831 1.00 76.94  ? 287 ASP A CA     1 
ATOM   4721  C C      . ASP A 1 287 ? 189.519 -7.451  151.008 1.00 79.18  ? 287 ASP A C      1 
ATOM   4722  O O      . ASP A 1 287 ? 189.035 -8.287  150.245 1.00 85.35  ? 287 ASP A O      1 
ATOM   4723  C CB     . ASP A 1 287 ? 191.401 -9.094  151.384 1.00 81.83  ? 287 ASP A CB     1 
ATOM   4724  C CG     . ASP A 1 287 ? 192.022 -9.014  150.003 1.00 89.22  ? 287 ASP A CG     1 
ATOM   4725  O OD1    . ASP A 1 287 ? 192.318 -7.890  149.543 1.00 91.30  ? 287 ASP A OD1    1 
ATOM   4726  O OD2    . ASP A 1 287 ? 192.223 -10.078 149.380 1.00 93.81  ? 287 ASP A OD2    1 
ATOM   4727  H H      . ASP A 1 287 ? 190.323 -8.598  153.564 1.00 87.27  ? 287 ASP A H      1 
ATOM   4728  H HA     . ASP A 1 287 ? 191.429 -7.067  151.661 1.00 92.33  ? 287 ASP A HA     1 
ATOM   4729  H HB2    . ASP A 1 287 ? 192.097 -9.345  152.011 1.00 98.19  ? 287 ASP A HB2    1 
ATOM   4730  H HB3    . ASP A 1 287 ? 190.711 -9.775  151.363 1.00 98.19  ? 287 ASP A HB3    1 
ATOM   4731  N N      . ILE A 1 288 ? 189.005 -6.232  151.168 1.00 73.78  ? 288 ILE A N      1 
ATOM   4732  C CA     . ILE A 1 288 ? 187.775 -5.801  150.510 1.00 70.71  ? 288 ILE A CA     1 
ATOM   4733  C C      . ILE A 1 288 ? 187.947 -4.418  149.892 1.00 72.54  ? 288 ILE A C      1 
ATOM   4734  O O      . ILE A 1 288 ? 188.850 -3.670  150.272 1.00 77.00  ? 288 ILE A O      1 
ATOM   4735  C CB     . ILE A 1 288 ? 186.591 -5.766  151.498 1.00 67.34  ? 288 ILE A CB     1 
ATOM   4736  C CG1    . ILE A 1 288 ? 186.843 -4.744  152.613 1.00 70.18  ? 288 ILE A CG1    1 
ATOM   4737  C CG2    . ILE A 1 288 ? 186.365 -7.152  152.085 1.00 62.70  ? 288 ILE A CG2    1 
ATOM   4738  C CD1    . ILE A 1 288 ? 185.673 -4.558  153.567 1.00 70.91  ? 288 ILE A CD1    1 
ATOM   4739  H H      . ILE A 1 288 ? 189.360 -5.625  151.663 1.00 88.54  ? 288 ILE A H      1 
ATOM   4740  H HA     . ILE A 1 288 ? 187.558 -6.425  149.800 1.00 84.86  ? 288 ILE A HA     1 
ATOM   4741  H HB     . ILE A 1 288 ? 185.793 -5.502  151.013 1.00 80.81  ? 288 ILE A HB     1 
ATOM   4742  H HG12   . ILE A 1 288 ? 187.606 -5.035  153.136 1.00 84.21  ? 288 ILE A HG12   1 
ATOM   4743  H HG13   . ILE A 1 288 ? 187.033 -3.883  152.208 1.00 84.21  ? 288 ILE A HG13   1 
ATOM   4744  H HG21   . ILE A 1 288 ? 185.618 -7.114  152.703 1.00 75.24  ? 288 ILE A HG21   1 
ATOM   4745  H HG22   . ILE A 1 288 ? 186.167 -7.771  151.364 1.00 75.24  ? 288 ILE A HG22   1 
ATOM   4746  H HG23   . ILE A 1 288 ? 187.168 -7.432  152.551 1.00 75.24  ? 288 ILE A HG23   1 
ATOM   4747  H HD11   . ILE A 1 288 ? 185.914 -3.899  154.237 1.00 85.10  ? 288 ILE A HD11   1 
ATOM   4748  H HD12   . ILE A 1 288 ? 184.902 -4.252  153.064 1.00 85.10  ? 288 ILE A HD12   1 
ATOM   4749  H HD13   . ILE A 1 288 ? 185.476 -5.407  153.993 1.00 85.10  ? 288 ILE A HD13   1 
ATOM   4750  N N      . VAL A 1 289 ? 187.075 -4.081  148.945 1.00 70.97  ? 289 VAL A N      1 
ATOM   4751  C CA     . VAL A 1 289 ? 187.145 -2.792  148.254 1.00 72.32  ? 289 VAL A CA     1 
ATOM   4752  C C      . VAL A 1 289 ? 186.763 -1.619  149.159 1.00 73.31  ? 289 VAL A C      1 
ATOM   4753  O O      . VAL A 1 289 ? 186.057 -1.789  150.155 1.00 74.35  ? 289 VAL A O      1 
ATOM   4754  C CB     . VAL A 1 289 ? 186.224 -2.760  147.011 1.00 72.23  ? 289 VAL A CB     1 
ATOM   4755  C CG1    . VAL A 1 289 ? 186.653 -3.819  146.002 1.00 74.16  ? 289 VAL A CG1    1 
ATOM   4756  C CG2    . VAL A 1 289 ? 184.760 -2.946  147.414 1.00 71.63  ? 289 VAL A CG2    1 
ATOM   4757  H H      . VAL A 1 289 ? 186.428 -4.583  148.682 1.00 85.17  ? 289 VAL A H      1 
ATOM   4758  H HA     . VAL A 1 289 ? 188.055 -2.650  147.953 1.00 86.78  ? 289 VAL A HA     1 
ATOM   4759  H HB     . VAL A 1 289 ? 186.306 -1.892  146.584 1.00 86.67  ? 289 VAL A HB     1 
ATOM   4760  H HG11   . VAL A 1 289 ? 186.063 -3.779  145.234 1.00 88.99  ? 289 VAL A HG11   1 
ATOM   4761  H HG12   . VAL A 1 289 ? 187.566 -3.641  145.728 1.00 88.99  ? 289 VAL A HG12   1 
ATOM   4762  H HG13   . VAL A 1 289 ? 186.596 -4.693  146.419 1.00 88.99  ? 289 VAL A HG13   1 
ATOM   4763  H HG21   . VAL A 1 289 ? 184.208 -2.922  146.617 1.00 85.95  ? 289 VAL A HG21   1 
ATOM   4764  H HG22   . VAL A 1 289 ? 184.663 -3.803  147.859 1.00 85.95  ? 289 VAL A HG22   1 
ATOM   4765  H HG23   . VAL A 1 289 ? 184.505 -2.230  148.016 1.00 85.95  ? 289 VAL A HG23   1 
ATOM   4766  N N      . ASP A 1 290 ? 187.211 -0.425  148.777 1.00 70.77  ? 290 ASP A N      1 
ATOM   4767  C CA     . ASP A 1 290 ? 186.997 0.781   149.573 1.00 64.19  ? 290 ASP A CA     1 
ATOM   4768  C C      . ASP A 1 290 ? 185.531 1.083   149.827 1.00 62.50  ? 290 ASP A C      1 
ATOM   4769  O O      . ASP A 1 290 ? 185.185 1.627   150.875 1.00 62.27  ? 290 ASP A O      1 
ATOM   4770  C CB     . ASP A 1 290 ? 187.664 1.985   148.910 1.00 62.64  ? 290 ASP A CB     1 
ATOM   4771  C CG     . ASP A 1 290 ? 189.165 1.983   149.089 1.00 71.45  ? 290 ASP A CG     1 
ATOM   4772  O OD1    . ASP A 1 290 ? 189.717 0.926   149.460 1.00 74.28  ? 290 ASP A OD1    1 
ATOM   4773  O OD2    . ASP A 1 290 ? 189.794 3.037   148.861 1.00 78.45  ? 290 ASP A OD2    1 
ATOM   4774  H H      . ASP A 1 290 ? 187.647 -0.286  148.049 1.00 84.92  ? 290 ASP A H      1 
ATOM   4775  H HA     . ASP A 1 290 ? 187.420 0.654   150.437 1.00 77.02  ? 290 ASP A HA     1 
ATOM   4776  H HB2    . ASP A 1 290 ? 187.475 1.968   147.959 1.00 75.17  ? 290 ASP A HB2    1 
ATOM   4777  H HB3    . ASP A 1 290 ? 187.314 2.798   149.305 1.00 75.17  ? 290 ASP A HB3    1 
ATOM   4778  N N      . ASP A 1 291 ? 184.669 0.732   148.882 1.00 64.13  ? 291 ASP A N      1 
ATOM   4779  C CA     . ASP A 1 291 ? 183.251 1.014   149.040 1.00 69.75  ? 291 ASP A CA     1 
ATOM   4780  C C      . ASP A 1 291 ? 182.609 0.157   150.118 1.00 67.17  ? 291 ASP A C      1 
ATOM   4781  O O      . ASP A 1 291 ? 181.533 0.486   150.616 1.00 63.76  ? 291 ASP A O      1 
ATOM   4782  C CB     . ASP A 1 291 ? 182.522 0.822   147.720 1.00 83.20  ? 291 ASP A CB     1 
ATOM   4783  C CG     . ASP A 1 291 ? 182.683 2.007   146.794 1.00 93.72  ? 291 ASP A CG     1 
ATOM   4784  O OD1    . ASP A 1 291 ? 182.528 3.159   147.265 1.00 85.60  ? 291 ASP A OD1    1 
ATOM   4785  O OD2    . ASP A 1 291 ? 182.973 1.782   145.598 1.00 107.74 ? 291 ASP A OD2    1 
ATOM   4786  H H      . ASP A 1 291 ? 184.877 0.334   148.149 1.00 76.96  ? 291 ASP A H      1 
ATOM   4787  H HA     . ASP A 1 291 ? 183.147 1.943   149.301 1.00 83.70  ? 291 ASP A HA     1 
ATOM   4788  H HB2    . ASP A 1 291 ? 182.878 0.039   147.272 1.00 99.84  ? 291 ASP A HB2    1 
ATOM   4789  H HB3    . ASP A 1 291 ? 181.575 0.703   147.895 1.00 99.84  ? 291 ASP A HB3    1 
ATOM   4790  N N      . ASN A 1 292 ? 183.265 -0.940  150.479 1.00 71.01  ? 292 ASN A N      1 
ATOM   4791  C CA     . ASN A 1 292 ? 182.800 -1.768  151.583 1.00 74.52  ? 292 ASN A CA     1 
ATOM   4792  C C      . ASN A 1 292 ? 183.496 -1.400  152.892 1.00 68.83  ? 292 ASN A C      1 
ATOM   4793  O O      . ASN A 1 292 ? 182.871 -1.351  153.950 1.00 67.75  ? 292 ASN A O      1 
ATOM   4794  C CB     . ASN A 1 292 ? 183.035 -3.238  151.266 1.00 83.86  ? 292 ASN A CB     1 
ATOM   4795  C CG     . ASN A 1 292 ? 182.295 -3.686  150.028 1.00 91.49  ? 292 ASN A CG     1 
ATOM   4796  O OD1    . ASN A 1 292 ? 181.260 -3.124  149.670 1.00 87.64  ? 292 ASN A OD1    1 
ATOM   4797  N ND2    . ASN A 1 292 ? 182.821 -4.707  149.366 1.00 100.80 ? 292 ASN A ND2    1 
ATOM   4798  H H      . ASN A 1 292 ? 183.982 -1.227  150.100 1.00 85.22  ? 292 ASN A H      1 
ATOM   4799  H HA     . ASN A 1 292 ? 181.846 -1.633  151.700 1.00 89.42  ? 292 ASN A HA     1 
ATOM   4800  H HB2    . ASN A 1 292 ? 183.982 -3.383  151.119 1.00 100.63 ? 292 ASN A HB2    1 
ATOM   4801  H HB3    . ASN A 1 292 ? 182.727 -3.776  152.012 1.00 100.63 ? 292 ASN A HB3    1 
ATOM   4802  H HD21   . ASN A 1 292 ? 182.438 -5.002  148.654 1.00 120.95 ? 292 ASN A HD21   1 
ATOM   4803  H HD22   . ASN A 1 292 ? 183.545 -5.076  149.649 1.00 120.95 ? 292 ASN A HD22   1 
ATOM   4804  N N      . LEU A 1 293 ? 184.789 -1.118  152.797 1.00 64.64  ? 293 LEU A N      1 
ATOM   4805  C CA     . LEU A 1 293 ? 185.633 -0.897  153.962 1.00 61.51  ? 293 LEU A CA     1 
ATOM   4806  C C      . LEU A 1 293 ? 185.273 0.362   154.744 1.00 59.21  ? 293 LEU A C      1 
ATOM   4807  O O      . LEU A 1 293 ? 185.091 0.305   155.957 1.00 57.04  ? 293 LEU A O      1 
ATOM   4808  C CB     . LEU A 1 293 ? 187.101 -0.832  153.523 1.00 60.21  ? 293 LEU A CB     1 
ATOM   4809  C CG     . LEU A 1 293 ? 188.150 -0.593  154.610 1.00 55.08  ? 293 LEU A CG     1 
ATOM   4810  C CD1    . LEU A 1 293 ? 188.048 -1.644  155.701 1.00 54.44  ? 293 LEU A CD1    1 
ATOM   4811  C CD2    . LEU A 1 293 ? 189.550 -0.579  154.014 1.00 52.69  ? 293 LEU A CD2    1 
ATOM   4812  H H      . LEU A 1 293 ? 185.210 -1.047  152.050 1.00 77.57  ? 293 LEU A H      1 
ATOM   4813  H HA     . LEU A 1 293 ? 185.538 -1.654  154.562 1.00 73.81  ? 293 LEU A HA     1 
ATOM   4814  H HB2    . LEU A 1 293 ? 187.323 -1.672  153.093 1.00 72.25  ? 293 LEU A HB2    1 
ATOM   4815  H HB3    . LEU A 1 293 ? 187.190 -0.112  152.879 1.00 72.25  ? 293 LEU A HB3    1 
ATOM   4816  H HG     . LEU A 1 293 ? 187.990 0.274   155.016 1.00 66.10  ? 293 LEU A HG     1 
ATOM   4817  H HD11   . LEU A 1 293 ? 188.723 -1.467  156.374 1.00 65.33  ? 293 LEU A HD11   1 
ATOM   4818  H HD12   . LEU A 1 293 ? 187.164 -1.601  156.099 1.00 65.33  ? 293 LEU A HD12   1 
ATOM   4819  H HD13   . LEU A 1 293 ? 188.192 -2.520  155.310 1.00 65.33  ? 293 LEU A HD13   1 
ATOM   4820  H HD21   . LEU A 1 293 ? 190.194 -0.426  154.724 1.00 63.23  ? 293 LEU A HD21   1 
ATOM   4821  H HD22   . LEU A 1 293 ? 189.721 -1.435  153.591 1.00 63.23  ? 293 LEU A HD22   1 
ATOM   4822  H HD23   . LEU A 1 293 ? 189.606 0.133   153.357 1.00 63.23  ? 293 LEU A HD23   1 
ATOM   4823  N N      . TYR A 1 294 ? 185.169 1.495   154.056 1.00 58.77  ? 294 TYR A N      1 
ATOM   4824  C CA     . TYR A 1 294 ? 184.992 2.780   154.738 1.00 53.59  ? 294 TYR A CA     1 
ATOM   4825  C C      . TYR A 1 294 ? 183.677 2.896   155.500 1.00 56.82  ? 294 TYR A C      1 
ATOM   4826  O O      . TYR A 1 294 ? 183.660 3.400   156.623 1.00 55.91  ? 294 TYR A O      1 
ATOM   4827  C CB     . TYR A 1 294 ? 185.207 3.949   153.769 1.00 50.02  ? 294 TYR A CB     1 
ATOM   4828  C CG     . TYR A 1 294 ? 186.681 4.194   153.569 1.00 58.08  ? 294 TYR A CG     1 
ATOM   4829  C CD1    . TYR A 1 294 ? 187.378 5.059   154.403 1.00 62.29  ? 294 TYR A CD1    1 
ATOM   4830  C CD2    . TYR A 1 294 ? 187.397 3.504   152.597 1.00 62.33  ? 294 TYR A CD2    1 
ATOM   4831  C CE1    . TYR A 1 294 ? 188.737 5.262   154.252 1.00 66.22  ? 294 TYR A CE1    1 
ATOM   4832  C CE2    . TYR A 1 294 ? 188.763 3.701   152.440 1.00 66.67  ? 294 TYR A CE2    1 
ATOM   4833  C CZ     . TYR A 1 294 ? 189.425 4.580   153.272 1.00 69.10  ? 294 TYR A CZ     1 
ATOM   4834  O OH     . TYR A 1 294 ? 190.776 4.785   153.127 1.00 72.14  ? 294 TYR A OH     1 
ATOM   4835  H H      . TYR A 1 294 ? 185.197 1.550   153.198 1.00 70.53  ? 294 TYR A H      1 
ATOM   4836  H HA     . TYR A 1 294 ? 185.695 2.848   155.403 1.00 64.31  ? 294 TYR A HA     1 
ATOM   4837  H HB2    . TYR A 1 294 ? 184.811 3.736   152.910 1.00 60.03  ? 294 TYR A HB2    1 
ATOM   4838  H HB3    . TYR A 1 294 ? 184.808 4.753   154.137 1.00 60.03  ? 294 TYR A HB3    1 
ATOM   4839  H HD1    . TYR A 1 294 ? 186.919 5.521   155.068 1.00 74.75  ? 294 TYR A HD1    1 
ATOM   4840  H HD2    . TYR A 1 294 ? 186.953 2.909   152.037 1.00 74.79  ? 294 TYR A HD2    1 
ATOM   4841  H HE1    . TYR A 1 294 ? 189.186 5.854   154.811 1.00 79.46  ? 294 TYR A HE1    1 
ATOM   4842  H HE2    . TYR A 1 294 ? 189.228 3.243   151.778 1.00 80.01  ? 294 TYR A HE2    1 
ATOM   4843  H HH     . TYR A 1 294 ? 191.073 4.313   152.499 1.00 86.57  ? 294 TYR A HH     1 
ATOM   4844  N N      . PRO A 1 295 ? 182.573 2.417   154.910 1.00 61.36  ? 295 PRO A N      1 
ATOM   4845  C CA     . PRO A 1 295 ? 181.320 2.427   155.678 1.00 63.49  ? 295 PRO A CA     1 
ATOM   4846  C C      . PRO A 1 295 ? 181.371 1.536   156.925 1.00 61.05  ? 295 PRO A C      1 
ATOM   4847  O O      . PRO A 1 295 ? 180.715 1.846   157.923 1.00 57.15  ? 295 PRO A O      1 
ATOM   4848  C CB     . PRO A 1 295 ? 180.289 1.911   154.671 1.00 62.09  ? 295 PRO A CB     1 
ATOM   4849  C CG     . PRO A 1 295 ? 180.859 2.249   153.350 1.00 60.59  ? 295 PRO A CG     1 
ATOM   4850  C CD     . PRO A 1 295 ? 182.345 2.096   153.493 1.00 59.94  ? 295 PRO A CD     1 
ATOM   4851  H HA     . PRO A 1 295 ? 181.090 3.333   155.938 1.00 76.19  ? 295 PRO A HA     1 
ATOM   4852  H HB2    . PRO A 1 295 ? 180.189 0.951   154.767 1.00 74.50  ? 295 PRO A HB2    1 
ATOM   4853  H HB3    . PRO A 1 295 ? 179.442 2.363   154.807 1.00 74.50  ? 295 PRO A HB3    1 
ATOM   4854  H HG2    . PRO A 1 295 ? 180.516 1.636   152.681 1.00 72.71  ? 295 PRO A HG2    1 
ATOM   4855  H HG3    . PRO A 1 295 ? 180.631 3.164   153.123 1.00 72.71  ? 295 PRO A HG3    1 
ATOM   4856  H HD2    . PRO A 1 295 ? 182.612 1.183   153.304 1.00 71.93  ? 295 PRO A HD2    1 
ATOM   4857  H HD3    . PRO A 1 295 ? 182.808 2.730   152.922 1.00 71.93  ? 295 PRO A HD3    1 
ATOM   4858  N N      . GLN A 1 296 ? 182.147 0.456   156.867 1.00 61.03  ? 296 GLN A N      1 
ATOM   4859  C CA     . GLN A 1 296 ? 182.336 -0.416  158.022 1.00 60.74  ? 296 GLN A CA     1 
ATOM   4860  C C      . GLN A 1 296 ? 183.224 0.273   159.053 1.00 57.43  ? 296 GLN A C      1 
ATOM   4861  O O      . GLN A 1 296 ? 182.964 0.214   160.259 1.00 54.63  ? 296 GLN A O      1 
ATOM   4862  C CB     . GLN A 1 296 ? 182.956 -1.755  157.601 1.00 65.48  ? 296 GLN A CB     1 
ATOM   4863  C CG     . GLN A 1 296 ? 182.018 -2.681  156.821 1.00 68.92  ? 296 GLN A CG     1 
ATOM   4864  C CD     . GLN A 1 296 ? 182.645 -4.039  156.505 1.00 73.81  ? 296 GLN A CD     1 
ATOM   4865  O OE1    . GLN A 1 296 ? 183.252 -4.680  157.369 1.00 77.54  ? 296 GLN A OE1    1 
ATOM   4866  N NE2    . GLN A 1 296 ? 182.493 -4.484  155.265 1.00 73.33  ? 296 GLN A NE2    1 
ATOM   4867  H H      . GLN A 1 296 ? 182.578 0.206   156.165 1.00 73.24  ? 296 GLN A H      1 
ATOM   4868  H HA     . GLN A 1 296 ? 181.476 -0.595  158.433 1.00 72.89  ? 296 GLN A HA     1 
ATOM   4869  H HB2    . GLN A 1 296 ? 183.726 -1.576  157.038 1.00 78.58  ? 296 GLN A HB2    1 
ATOM   4870  H HB3    . GLN A 1 296 ? 183.239 -2.230  158.398 1.00 78.58  ? 296 GLN A HB3    1 
ATOM   4871  H HG2    . GLN A 1 296 ? 181.219 -2.836  157.348 1.00 82.71  ? 296 GLN A HG2    1 
ATOM   4872  H HG3    . GLN A 1 296 ? 181.784 -2.257  155.981 1.00 82.71  ? 296 GLN A HG3    1 
ATOM   4873  H HE21   . GLN A 1 296 ? 182.061 -4.013  154.689 1.00 88.00  ? 296 GLN A HE21   1 
ATOM   4874  H HE22   . GLN A 1 296 ? 182.827 -5.243  155.036 1.00 88.00  ? 296 GLN A HE22   1 
ATOM   4875  N N      . LEU A 1 297 ? 184.278 0.924   158.573 1.00 58.02  ? 297 LEU A N      1 
ATOM   4876  C CA     . LEU A 1 297 ? 185.143 1.704   159.448 1.00 56.90  ? 297 LEU A CA     1 
ATOM   4877  C C      . LEU A 1 297 ? 184.342 2.809   160.142 1.00 51.98  ? 297 LEU A C      1 
ATOM   4878  O O      . LEU A 1 297 ? 184.575 3.109   161.307 1.00 50.03  ? 297 LEU A O      1 
ATOM   4879  C CB     . LEU A 1 297 ? 186.322 2.295   158.665 1.00 55.50  ? 297 LEU A CB     1 
ATOM   4880  C CG     . LEU A 1 297 ? 187.391 1.285   158.223 1.00 52.77  ? 297 LEU A CG     1 
ATOM   4881  C CD1    . LEU A 1 297 ? 188.352 1.910   157.222 1.00 51.21  ? 297 LEU A CD1    1 
ATOM   4882  C CD2    . LEU A 1 297 ? 188.165 0.752   159.414 1.00 51.48  ? 297 LEU A CD2    1 
ATOM   4883  H H      . LEU A 1 297 ? 184.513 0.931   157.746 1.00 69.63  ? 297 LEU A H      1 
ATOM   4884  H HA     . LEU A 1 297 ? 185.503 1.121   160.134 1.00 68.28  ? 297 LEU A HA     1 
ATOM   4885  H HB2    . LEU A 1 297 ? 185.977 2.722   157.865 1.00 66.60  ? 297 LEU A HB2    1 
ATOM   4886  H HB3    . LEU A 1 297 ? 186.760 2.957   159.223 1.00 66.60  ? 297 LEU A HB3    1 
ATOM   4887  H HG     . LEU A 1 297 ? 186.954 0.534   157.790 1.00 63.33  ? 297 LEU A HG     1 
ATOM   4888  H HD11   . LEU A 1 297 ? 189.012 1.248   156.964 1.00 61.45  ? 297 LEU A HD11   1 
ATOM   4889  H HD12   . LEU A 1 297 ? 187.852 2.200   156.443 1.00 61.45  ? 297 LEU A HD12   1 
ATOM   4890  H HD13   . LEU A 1 297 ? 188.789 2.669   157.637 1.00 61.45  ? 297 LEU A HD13   1 
ATOM   4891  H HD21   . LEU A 1 297 ? 188.829 0.119   159.101 1.00 61.78  ? 297 LEU A HD21   1 
ATOM   4892  H HD22   . LEU A 1 297 ? 188.600 1.493   159.864 1.00 61.78  ? 297 LEU A HD22   1 
ATOM   4893  H HD23   . LEU A 1 297 ? 187.548 0.313   160.020 1.00 61.78  ? 297 LEU A HD23   1 
ATOM   4894  N N      . GLU A 1 298 ? 183.392 3.402   159.431 1.00 49.95  ? 298 GLU A N      1 
ATOM   4895  C CA     . GLU A 1 298 ? 182.539 4.413   160.033 1.00 51.81  ? 298 GLU A CA     1 
ATOM   4896  C C      . GLU A 1 298 ? 181.673 3.763   161.095 1.00 50.13  ? 298 GLU A C      1 
ATOM   4897  O O      . GLU A 1 298 ? 181.462 4.324   162.170 1.00 51.08  ? 298 GLU A O      1 
ATOM   4898  C CB     . GLU A 1 298 ? 181.649 5.074   158.980 1.00 58.25  ? 298 GLU A CB     1 
ATOM   4899  C CG     . GLU A 1 298 ? 182.352 6.098   158.115 1.00 67.92  ? 298 GLU A CG     1 
ATOM   4900  C CD     . GLU A 1 298 ? 181.479 6.592   156.967 1.00 79.66  ? 298 GLU A CD     1 
ATOM   4901  O OE1    . GLU A 1 298 ? 181.805 7.647   156.377 1.00 87.61  ? 298 GLU A OE1    1 
ATOM   4902  O OE2    . GLU A 1 298 ? 180.469 5.923   156.649 1.00 80.28  ? 298 GLU A OE2    1 
ATOM   4903  H H      . GLU A 1 298 ? 183.223 3.239   158.604 1.00 59.94  ? 298 GLU A H      1 
ATOM   4904  H HA     . GLU A 1 298 ? 183.086 5.095   160.452 1.00 62.18  ? 298 GLU A HA     1 
ATOM   4905  H HB2    . GLU A 1 298 ? 181.298 4.386   158.394 1.00 69.90  ? 298 GLU A HB2    1 
ATOM   4906  H HB3    . GLU A 1 298 ? 180.917 5.523   159.430 1.00 69.90  ? 298 GLU A HB3    1 
ATOM   4907  H HG2    . GLU A 1 298 ? 182.592 6.864   158.661 1.00 81.50  ? 298 GLU A HG2    1 
ATOM   4908  H HG3    . GLU A 1 298 ? 183.150 5.698   157.735 1.00 81.50  ? 298 GLU A HG3    1 
ATOM   4909  N N      . ARG A 1 299 ? 181.160 2.579   160.790 1.00 50.14  ? 299 ARG A N      1 
ATOM   4910  C CA     . ARG A 1 299 ? 180.271 1.892   161.716 1.00 51.46  ? 299 ARG A CA     1 
ATOM   4911  C C      . ARG A 1 299 ? 180.999 1.526   163.012 1.00 51.48  ? 299 ARG A C      1 
ATOM   4912  O O      . ARG A 1 299 ? 180.542 1.878   164.100 1.00 53.32  ? 299 ARG A O      1 
ATOM   4913  C CB     . ARG A 1 299 ? 179.675 0.645   161.070 1.00 52.25  ? 299 ARG A CB     1 
ATOM   4914  C CG     . ARG A 1 299 ? 178.707 -0.091  161.971 1.00 53.69  ? 299 ARG A CG     1 
ATOM   4915  C CD     . ARG A 1 299 ? 178.152 -1.316  161.288 1.00 58.49  ? 299 ARG A CD     1 
ATOM   4916  N NE     . ARG A 1 299 ? 177.535 -2.224  162.248 1.00 62.49  ? 299 ARG A NE     1 
ATOM   4917  C CZ     . ARG A 1 299 ? 176.292 -2.113  162.704 1.00 61.34  ? 299 ARG A CZ     1 
ATOM   4918  N NH1    . ARG A 1 299 ? 175.506 -1.127  162.290 1.00 59.82  ? 299 ARG A NH1    1 
ATOM   4919  N NH2    . ARG A 1 299 ? 175.836 -2.998  163.579 1.00 60.90  ? 299 ARG A NH2    1 
ATOM   4920  H H      . ARG A 1 299 ? 181.308 2.154   160.057 1.00 60.17  ? 299 ARG A H      1 
ATOM   4921  H HA     . ARG A 1 299 ? 179.539 2.486   161.945 1.00 61.76  ? 299 ARG A HA     1 
ATOM   4922  H HB2    . ARG A 1 299 ? 179.197 0.905   160.267 1.00 62.70  ? 299 ARG A HB2    1 
ATOM   4923  H HB3    . ARG A 1 299 ? 180.394 0.034   160.843 1.00 62.70  ? 299 ARG A HB3    1 
ATOM   4924  H HG2    . ARG A 1 299 ? 179.169 -0.373  162.776 1.00 64.42  ? 299 ARG A HG2    1 
ATOM   4925  H HG3    . ARG A 1 299 ? 177.967 0.496   162.194 1.00 64.42  ? 299 ARG A HG3    1 
ATOM   4926  H HD2    . ARG A 1 299 ? 177.476 -1.047  160.646 1.00 70.19  ? 299 ARG A HD2    1 
ATOM   4927  H HD3    . ARG A 1 299 ? 178.872 -1.788  160.841 1.00 70.19  ? 299 ARG A HD3    1 
ATOM   4928  H HE     . ARG A 1 299 ? 178.010 -2.878  162.540 1.00 74.99  ? 299 ARG A HE     1 
ATOM   4929  H HH11   . ARG A 1 299 ? 175.800 -0.552  161.723 1.00 71.78  ? 299 ARG A HH11   1 
ATOM   4930  H HH12   . ARG A 1 299 ? 174.702 -1.063  162.590 1.00 71.78  ? 299 ARG A HH12   1 
ATOM   4931  H HH21   . ARG A 1 299 ? 176.343 -3.638  163.848 1.00 73.08  ? 299 ARG A HH21   1 
ATOM   4932  H HH22   . ARG A 1 299 ? 175.032 -2.932  163.877 1.00 73.08  ? 299 ARG A HH22   1 
ATOM   4933  N N      . ALA A 1 300 ? 182.131 0.836   162.885 1.00 47.66  ? 300 ALA A N      1 
ATOM   4934  C CA     . ALA A 1 300 ? 182.928 0.435   164.038 1.00 50.87  ? 300 ALA A CA     1 
ATOM   4935  C C      . ALA A 1 300 ? 183.289 1.643   164.887 1.00 55.38  ? 300 ALA A C      1 
ATOM   4936  O O      . ALA A 1 300 ? 183.172 1.631   166.116 1.00 55.54  ? 300 ALA A O      1 
ATOM   4937  C CB     . ALA A 1 300 ? 184.192 -0.270  163.571 1.00 51.28  ? 300 ALA A CB     1 
ATOM   4938  H H      . ALA A 1 300 ? 182.460 0.585   162.132 1.00 57.19  ? 300 ALA A H      1 
ATOM   4939  H HA     . ALA A 1 300 ? 182.417 -0.182  164.585 1.00 61.04  ? 300 ALA A HA     1 
ATOM   4940  H HB1    . ALA A 1 300 ? 184.713 -0.531  164.346 1.00 61.54  ? 300 ALA A HB1    1 
ATOM   4941  H HB2    . ALA A 1 300 ? 183.944 -1.056  163.058 1.00 61.54  ? 300 ALA A HB2    1 
ATOM   4942  H HB3    . ALA A 1 300 ? 184.706 0.338   163.017 1.00 61.54  ? 300 ALA A HB3    1 
ATOM   4943  N N      . SER A 1 301 ? 183.736 2.688   164.208 1.00 56.73  ? 301 SER A N      1 
ATOM   4944  C CA     . SER A 1 301 ? 184.061 3.941   164.851 1.00 50.18  ? 301 SER A CA     1 
ATOM   4945  C C      . SER A 1 301 ? 182.854 4.464   165.625 1.00 45.97  ? 301 SER A C      1 
ATOM   4946  O O      . SER A 1 301 ? 182.970 4.871   166.778 1.00 47.13  ? 301 SER A O      1 
ATOM   4947  C CB     . SER A 1 301 ? 184.495 4.940   163.792 1.00 53.70  ? 301 SER A CB     1 
ATOM   4948  O OG     . SER A 1 301 ? 184.743 6.201   164.375 1.00 65.44  ? 301 SER A OG     1 
ATOM   4949  H H      . SER A 1 301 ? 183.861 2.693   163.357 1.00 68.07  ? 301 SER A H      1 
ATOM   4950  H HA     . SER A 1 301 ? 184.794 3.808   165.471 1.00 60.22  ? 301 SER A HA     1 
ATOM   4951  H HB2    . SER A 1 301 ? 185.307 4.621   163.369 1.00 64.44  ? 301 SER A HB2    1 
ATOM   4952  H HB3    . SER A 1 301 ? 183.789 5.030   163.132 1.00 64.44  ? 301 SER A HB3    1 
ATOM   4953  H HG     . SER A 1 301 ? 184.982 6.749   163.785 1.00 78.53  ? 301 SER A HG     1 
ATOM   4954  N N      . ARG A 1 302 ? 181.682 4.431   165.007 1.00 45.40  ? 302 ARG A N      1 
ATOM   4955  C CA     . ARG A 1 302 ? 180.511 5.003   165.644 1.00 48.38  ? 302 ARG A CA     1 
ATOM   4956  C C      . ARG A 1 302 ? 180.094 4.173   166.846 1.00 51.52  ? 302 ARG A C      1 
ATOM   4957  O O      . ARG A 1 302 ? 179.780 4.712   167.898 1.00 54.67  ? 302 ARG A O      1 
ATOM   4958  C CB     . ARG A 1 302 ? 179.359 5.127   164.651 1.00 48.65  ? 302 ARG A CB     1 
ATOM   4959  C CG     . ARG A 1 302 ? 178.174 5.905   165.194 1.00 51.79  ? 302 ARG A CG     1 
ATOM   4960  C CD     . ARG A 1 302 ? 177.052 6.015   164.163 1.00 60.70  ? 302 ARG A CD     1 
ATOM   4961  N NE     . ARG A 1 302 ? 176.373 4.739   163.923 1.00 71.14  ? 302 ARG A NE     1 
ATOM   4962  C CZ     . ARG A 1 302 ? 176.571 3.952   162.866 1.00 85.14  ? 302 ARG A CZ     1 
ATOM   4963  N NH1    . ARG A 1 302 ? 177.437 4.284   161.907 1.00 85.80  ? 302 ARG A NH1    1 
ATOM   4964  N NH2    . ARG A 1 302 ? 175.886 2.818   162.762 1.00 94.56  ? 302 ARG A NH2    1 
ATOM   4965  H H      . ARG A 1 302 ? 181.541 4.088   164.231 1.00 54.48  ? 302 ARG A H      1 
ATOM   4966  H HA     . ARG A 1 302 ? 180.730 5.894   165.959 1.00 58.05  ? 302 ARG A HA     1 
ATOM   4967  H HB2    . ARG A 1 302 ? 179.677 5.585   163.857 1.00 58.38  ? 302 ARG A HB2    1 
ATOM   4968  H HB3    . ARG A 1 302 ? 179.049 4.238   164.417 1.00 58.38  ? 302 ARG A HB3    1 
ATOM   4969  H HG2    . ARG A 1 302 ? 177.824 5.451   165.976 1.00 62.15  ? 302 ARG A HG2    1 
ATOM   4970  H HG3    . ARG A 1 302 ? 178.460 6.802   165.428 1.00 62.15  ? 302 ARG A HG3    1 
ATOM   4971  H HD2    . ARG A 1 302 ? 176.392 6.651   164.481 1.00 72.84  ? 302 ARG A HD2    1 
ATOM   4972  H HD3    . ARG A 1 302 ? 177.426 6.319   163.321 1.00 72.84  ? 302 ARG A HD3    1 
ATOM   4973  H HE     . ARG A 1 302 ? 175.802 4.478   164.510 1.00 85.37  ? 302 ARG A HE     1 
ATOM   4974  H HH11   . ARG A 1 302 ? 177.883 5.017   161.965 1.00 102.96 ? 302 ARG A HH11   1 
ATOM   4975  H HH12   . ARG A 1 302 ? 177.552 3.763   161.232 1.00 102.96 ? 302 ARG A HH12   1 
ATOM   4976  H HH21   . ARG A 1 302 ? 175.326 2.597   163.375 1.00 113.47 ? 302 ARG A HH21   1 
ATOM   4977  H HH22   . ARG A 1 302 ? 176.007 2.303   162.084 1.00 113.47 ? 302 ARG A HH22   1 
ATOM   4978  N N      . LYS A 1 303 ? 180.095 2.857   166.690 1.00 52.05  ? 303 LYS A N      1 
ATOM   4979  C CA     . LYS A 1 303 ? 179.690 1.975   167.774 1.00 51.30  ? 303 LYS A CA     1 
ATOM   4980  C C      . LYS A 1 303 ? 180.560 2.186   169.017 1.00 52.05  ? 303 LYS A C      1 
ATOM   4981  O O      . LYS A 1 303 ? 180.044 2.368   170.118 1.00 56.59  ? 303 LYS A O      1 
ATOM   4982  C CB     . LYS A 1 303 ? 179.742 0.516   167.314 1.00 47.82  ? 303 LYS A CB     1 
ATOM   4983  C CG     . LYS A 1 303 ? 178.603 0.117   166.391 1.00 53.72  ? 303 LYS A CG     1 
ATOM   4984  C CD     . LYS A 1 303 ? 177.267 0.169   167.112 1.00 65.03  ? 303 LYS A CD     1 
ATOM   4985  C CE     . LYS A 1 303 ? 176.163 -0.519  166.318 1.00 75.21  ? 303 LYS A CE     1 
ATOM   4986  N NZ     . LYS A 1 303 ? 174.849 -0.445  167.024 1.00 78.53  ? 303 LYS A NZ     1 
ATOM   4987  H H      . LYS A 1 303 ? 180.325 2.451   165.968 1.00 62.46  ? 303 LYS A H      1 
ATOM   4988  H HA     . LYS A 1 303 ? 178.773 2.177   168.016 1.00 61.56  ? 303 LYS A HA     1 
ATOM   4989  H HB2    . LYS A 1 303 ? 180.574 0.369   166.837 1.00 57.39  ? 303 LYS A HB2    1 
ATOM   4990  H HB3    . LYS A 1 303 ? 179.705 -0.059  168.095 1.00 57.39  ? 303 LYS A HB3    1 
ATOM   4991  H HG2    . LYS A 1 303 ? 178.569 0.730   165.640 1.00 64.46  ? 303 LYS A HG2    1 
ATOM   4992  H HG3    . LYS A 1 303 ? 178.746 -0.791  166.078 1.00 64.46  ? 303 LYS A HG3    1 
ATOM   4993  H HD2    . LYS A 1 303 ? 177.349 -0.281  167.967 1.00 78.04  ? 303 LYS A HD2    1 
ATOM   4994  H HD3    . LYS A 1 303 ? 177.012 1.095   167.244 1.00 78.04  ? 303 LYS A HD3    1 
ATOM   4995  H HE2    . LYS A 1 303 ? 176.069 -0.082  165.456 1.00 90.25  ? 303 LYS A HE2    1 
ATOM   4996  H HE3    . LYS A 1 303 ? 176.391 -1.454  166.197 1.00 90.25  ? 303 LYS A HE3    1 
ATOM   4997  H HZ1    . LYS A 1 303 ? 174.222 -0.853  166.543 1.00 94.23  ? 303 LYS A HZ1    1 
ATOM   4998  H HZ2    . LYS A 1 303 ? 174.909 -0.844  167.818 1.00 94.23  ? 303 LYS A HZ2    1 
ATOM   4999  H HZ3    . LYS A 1 303 ? 174.616 0.405   167.144 1.00 94.23  ? 303 LYS A HZ3    1 
ATOM   5000  N N      . ILE A 1 304 ? 181.875 2.188   168.828 1.00 47.43  ? 304 ILE A N      1 
ATOM   5001  C CA     . ILE A 1 304 ? 182.804 2.342   169.933 1.00 42.80  ? 304 ILE A CA     1 
ATOM   5002  C C      . ILE A 1 304 ? 182.619 3.714   170.569 1.00 50.24  ? 304 ILE A C      1 
ATOM   5003  O O      . ILE A 1 304 ? 182.641 3.833   171.792 1.00 53.90  ? 304 ILE A O      1 
ATOM   5004  C CB     . ILE A 1 304 ? 184.261 2.121   169.455 1.00 38.48  ? 304 ILE A CB     1 
ATOM   5005  C CG1    . ILE A 1 304 ? 184.458 0.655   169.055 1.00 39.84  ? 304 ILE A CG1    1 
ATOM   5006  C CG2    . ILE A 1 304 ? 185.280 2.500   170.531 1.00 34.01  ? 304 ILE A CG2    1 
ATOM   5007  C CD1    . ILE A 1 304 ? 185.758 0.386   168.327 1.00 43.10  ? 304 ILE A CD1    1 
ATOM   5008  H H      . ILE A 1 304 ? 182.254 2.101   168.062 1.00 56.91  ? 304 ILE A H      1 
ATOM   5009  H HA     . ILE A 1 304 ? 182.607 1.673   170.606 1.00 51.36  ? 304 ILE A HA     1 
ATOM   5010  H HB     . ILE A 1 304 ? 184.416 2.677   168.675 1.00 46.18  ? 304 ILE A HB     1 
ATOM   5011  H HG12   . ILE A 1 304 ? 184.449 0.109   169.856 1.00 47.81  ? 304 ILE A HG12   1 
ATOM   5012  H HG13   . ILE A 1 304 ? 183.731 0.391   168.470 1.00 47.81  ? 304 ILE A HG13   1 
ATOM   5013  H HG21   . ILE A 1 304 ? 186.173 2.345   170.187 1.00 40.82  ? 304 ILE A HG21   1 
ATOM   5014  H HG22   . ILE A 1 304 ? 185.168 3.438   170.754 1.00 40.82  ? 304 ILE A HG22   1 
ATOM   5015  H HG23   . ILE A 1 304 ? 185.127 1.952   171.316 1.00 40.82  ? 304 ILE A HG23   1 
ATOM   5016  H HD11   . ILE A 1 304 ? 185.808 -0.558  168.109 1.00 51.71  ? 304 ILE A HD11   1 
ATOM   5017  H HD12   . ILE A 1 304 ? 185.779 0.915   167.514 1.00 51.71  ? 304 ILE A HD12   1 
ATOM   5018  H HD13   . ILE A 1 304 ? 186.499 0.633   168.902 1.00 51.71  ? 304 ILE A HD13   1 
ATOM   5019  N N      . PHE A 1 305 ? 182.418 4.740   169.736 1.00 51.69  ? 305 PHE A N      1 
ATOM   5020  C CA     . PHE A 1 305 ? 182.203 6.111   170.214 1.00 46.77  ? 305 PHE A CA     1 
ATOM   5021  C C      . PHE A 1 305 ? 180.953 6.196   171.089 1.00 48.53  ? 305 PHE A C      1 
ATOM   5022  O O      . PHE A 1 305 ? 180.925 6.927   172.085 1.00 44.45  ? 305 PHE A O      1 
ATOM   5023  C CB     . PHE A 1 305 ? 182.075 7.081   169.033 1.00 40.95  ? 305 PHE A CB     1 
ATOM   5024  C CG     . PHE A 1 305 ? 181.978 8.537   169.438 1.00 31.56  ? 305 PHE A CG     1 
ATOM   5025  C CD1    . PHE A 1 305 ? 180.760 9.092   169.811 1.00 30.20  ? 305 PHE A CD1    1 
ATOM   5026  C CD2    . PHE A 1 305 ? 183.097 9.349   169.435 1.00 31.40  ? 305 PHE A CD2    1 
ATOM   5027  C CE1    . PHE A 1 305 ? 180.661 10.439  170.190 1.00 30.41  ? 305 PHE A CE1    1 
ATOM   5028  C CE2    . PHE A 1 305 ? 183.007 10.701  169.820 1.00 35.89  ? 305 PHE A CE2    1 
ATOM   5029  C CZ     . PHE A 1 305 ? 181.787 11.236  170.200 1.00 32.81  ? 305 PHE A CZ     1 
ATOM   5030  H H      . PHE A 1 305 ? 182.400 4.666   168.879 1.00 62.03  ? 305 PHE A H      1 
ATOM   5031  H HA     . PHE A 1 305 ? 182.965 6.384   170.749 1.00 56.13  ? 305 PHE A HA     1 
ATOM   5032  H HB2    . PHE A 1 305 ? 182.855 6.984   168.464 1.00 49.14  ? 305 PHE A HB2    1 
ATOM   5033  H HB3    . PHE A 1 305 ? 181.274 6.859   168.533 1.00 49.14  ? 305 PHE A HB3    1 
ATOM   5034  H HD1    . PHE A 1 305 ? 179.997 8.559   169.817 1.00 36.24  ? 305 PHE A HD1    1 
ATOM   5035  H HD2    . PHE A 1 305 ? 183.922 8.994   169.191 1.00 37.68  ? 305 PHE A HD2    1 
ATOM   5036  H HE1    . PHE A 1 305 ? 179.838 10.792  170.442 1.00 36.50  ? 305 PHE A HE1    1 
ATOM   5037  H HE2    . PHE A 1 305 ? 183.767 11.236  169.819 1.00 43.07  ? 305 PHE A HE2    1 
ATOM   5038  H HZ     . PHE A 1 305 ? 181.724 12.131  170.445 1.00 39.38  ? 305 PHE A HZ     1 
ATOM   5039  N N      . GLU A 1 306 ? 179.917 5.454   170.703 1.00 54.15  ? 306 GLU A N      1 
ATOM   5040  C CA     . GLU A 1 306 ? 178.670 5.400   171.469 1.00 55.59  ? 306 GLU A CA     1 
ATOM   5041  C C      . GLU A 1 306 ? 178.866 4.652   172.794 1.00 54.28  ? 306 GLU A C      1 
ATOM   5042  O O      . GLU A 1 306 ? 178.327 5.051   173.830 1.00 57.75  ? 306 GLU A O      1 
ATOM   5043  C CB     . GLU A 1 306 ? 177.550 4.752   170.639 1.00 54.48  ? 306 GLU A CB     1 
ATOM   5044  C CG     . GLU A 1 306 ? 176.960 5.671   169.563 1.00 57.39  ? 306 GLU A CG     1 
ATOM   5045  C CD     . GLU A 1 306 ? 176.082 4.935   168.547 1.00 65.88  ? 306 GLU A CD     1 
ATOM   5046  O OE1    . GLU A 1 306 ? 175.933 3.700   168.654 1.00 69.77  ? 306 GLU A OE1    1 
ATOM   5047  O OE2    . GLU A 1 306 ? 175.540 5.595   167.632 1.00 68.85  ? 306 GLU A OE2    1 
ATOM   5048  H H      . GLU A 1 306 ? 179.910 4.967   169.994 1.00 64.98  ? 306 GLU A H      1 
ATOM   5049  H HA     . GLU A 1 306 ? 178.395 6.306   171.680 1.00 66.71  ? 306 GLU A HA     1 
ATOM   5050  H HB2    . GLU A 1 306 ? 177.906 3.966   170.195 1.00 65.38  ? 306 GLU A HB2    1 
ATOM   5051  H HB3    . GLU A 1 306 ? 176.829 4.494   171.235 1.00 65.38  ? 306 GLU A HB3    1 
ATOM   5052  H HG2    . GLU A 1 306 ? 176.415 6.347   169.993 1.00 68.87  ? 306 GLU A HG2    1 
ATOM   5053  H HG3    . GLU A 1 306 ? 177.687 6.092   169.078 1.00 68.87  ? 306 GLU A HG3    1 
ATOM   5054  N N      . PHE A 1 307 ? 179.638 3.570   172.753 1.00 45.33  ? 307 PHE A N      1 
ATOM   5055  C CA     . PHE A 1 307 ? 179.997 2.846   173.960 1.00 41.74  ? 307 PHE A CA     1 
ATOM   5056  C C      . PHE A 1 307 ? 180.663 3.783   174.953 1.00 43.19  ? 307 PHE A C      1 
ATOM   5057  O O      . PHE A 1 307 ? 180.299 3.817   176.133 1.00 43.86  ? 307 PHE A O      1 
ATOM   5058  C CB     . PHE A 1 307 ? 180.946 1.703   173.613 1.00 44.06  ? 307 PHE A CB     1 
ATOM   5059  C CG     . PHE A 1 307 ? 181.666 1.128   174.798 1.00 48.33  ? 307 PHE A CG     1 
ATOM   5060  C CD1    . PHE A 1 307 ? 181.022 0.262   175.666 1.00 49.36  ? 307 PHE A CD1    1 
ATOM   5061  C CD2    . PHE A 1 307 ? 182.998 1.435   175.033 1.00 48.71  ? 307 PHE A CD2    1 
ATOM   5062  C CE1    . PHE A 1 307 ? 181.688 -0.271  176.753 1.00 48.58  ? 307 PHE A CE1    1 
ATOM   5063  C CE2    . PHE A 1 307 ? 183.672 0.897   176.124 1.00 46.51  ? 307 PHE A CE2    1 
ATOM   5064  C CZ     . PHE A 1 307 ? 183.017 0.047   176.982 1.00 46.49  ? 307 PHE A CZ     1 
ATOM   5065  H H      . PHE A 1 307 ? 179.968 3.236   172.033 1.00 54.39  ? 307 PHE A H      1 
ATOM   5066  H HA     . PHE A 1 307 ? 179.199 2.476   174.368 1.00 50.09  ? 307 PHE A HA     1 
ATOM   5067  H HB2    . PHE A 1 307 ? 180.435 0.988   173.202 1.00 52.87  ? 307 PHE A HB2    1 
ATOM   5068  H HB3    . PHE A 1 307 ? 181.614 2.030   172.990 1.00 52.87  ? 307 PHE A HB3    1 
ATOM   5069  H HD1    . PHE A 1 307 ? 180.130 0.045   175.521 1.00 59.23  ? 307 PHE A HD1    1 
ATOM   5070  H HD2    . PHE A 1 307 ? 183.445 2.011   174.456 1.00 58.45  ? 307 PHE A HD2    1 
ATOM   5071  H HE1    . PHE A 1 307 ? 181.244 -0.848  177.332 1.00 58.30  ? 307 PHE A HE1    1 
ATOM   5072  H HE2    . PHE A 1 307 ? 184.564 1.114   176.275 1.00 55.81  ? 307 PHE A HE2    1 
ATOM   5073  H HZ     . PHE A 1 307 ? 183.464 -0.314  177.713 1.00 55.79  ? 307 PHE A HZ     1 
ATOM   5074  N N      . LEU A 1 308 ? 181.626 4.559   174.459 1.00 43.39  ? 308 LEU A N      1 
ATOM   5075  C CA     . LEU A 1 308 ? 182.352 5.517   175.286 1.00 42.31  ? 308 LEU A CA     1 
ATOM   5076  C C      . LEU A 1 308 ? 181.400 6.521   175.950 1.00 43.91  ? 308 LEU A C      1 
ATOM   5077  O O      . LEU A 1 308 ? 181.577 6.869   177.122 1.00 43.05  ? 308 LEU A O      1 
ATOM   5078  C CB     . LEU A 1 308 ? 183.433 6.236   174.464 1.00 38.33  ? 308 LEU A CB     1 
ATOM   5079  C CG     . LEU A 1 308 ? 184.611 5.337   174.050 1.00 38.78  ? 308 LEU A CG     1 
ATOM   5080  C CD1    . LEU A 1 308 ? 185.507 5.986   172.996 1.00 36.86  ? 308 LEU A CD1    1 
ATOM   5081  C CD2    . LEU A 1 308 ? 185.457 4.894   175.257 1.00 38.44  ? 308 LEU A CD2    1 
ATOM   5082  H H      . LEU A 1 308 ? 181.881 4.547   173.638 1.00 52.06  ? 308 LEU A H      1 
ATOM   5083  H HA     . LEU A 1 308 ? 182.802 5.032   175.995 1.00 50.77  ? 308 LEU A HA     1 
ATOM   5084  H HB2    . LEU A 1 308 ? 183.028 6.585   173.654 1.00 46.00  ? 308 LEU A HB2    1 
ATOM   5085  H HB3    . LEU A 1 308 ? 183.791 6.967   174.992 1.00 46.00  ? 308 LEU A HB3    1 
ATOM   5086  H HG     . LEU A 1 308 ? 184.245 4.532   173.651 1.00 46.54  ? 308 LEU A HG     1 
ATOM   5087  H HD11   . LEU A 1 308 ? 186.228 5.376   172.776 1.00 44.23  ? 308 LEU A HD11   1 
ATOM   5088  H HD12   . LEU A 1 308 ? 184.978 6.174   172.205 1.00 44.23  ? 308 LEU A HD12   1 
ATOM   5089  H HD13   . LEU A 1 308 ? 185.869 6.811   173.356 1.00 44.23  ? 308 LEU A HD13   1 
ATOM   5090  H HD21   . LEU A 1 308 ? 186.183 4.332   174.944 1.00 46.12  ? 308 LEU A HD21   1 
ATOM   5091  H HD22   . LEU A 1 308 ? 185.813 5.682   175.697 1.00 46.12  ? 308 LEU A HD22   1 
ATOM   5092  H HD23   . LEU A 1 308 ? 184.894 4.397   175.871 1.00 46.12  ? 308 LEU A HD23   1 
ATOM   5093  N N      . GLU A 1 309 ? 180.385 6.969   175.214 1.00 46.21  ? 309 GLU A N      1 
ATOM   5094  C CA     . GLU A 1 309 ? 179.412 7.902   175.768 1.00 47.49  ? 309 GLU A CA     1 
ATOM   5095  C C      . GLU A 1 309 ? 178.630 7.217   176.880 1.00 40.81  ? 309 GLU A C      1 
ATOM   5096  O O      . GLU A 1 309 ? 178.517 7.742   177.987 1.00 40.75  ? 309 GLU A O      1 
ATOM   5097  C CB     . GLU A 1 309 ? 178.452 8.401   174.689 1.00 55.32  ? 309 GLU A CB     1 
ATOM   5098  C CG     . GLU A 1 309 ? 179.044 9.421   173.746 1.00 64.40  ? 309 GLU A CG     1 
ATOM   5099  C CD     . GLU A 1 309 ? 178.065 9.875   172.668 1.00 72.55  ? 309 GLU A CD     1 
ATOM   5100  O OE1    . GLU A 1 309 ? 177.357 9.013   172.098 1.00 75.18  ? 309 GLU A OE1    1 
ATOM   5101  O OE2    . GLU A 1 309 ? 178.005 11.097  172.388 1.00 75.09  ? 309 GLU A OE2    1 
ATOM   5102  H H      . GLU A 1 309 ? 180.240 6.748   174.396 1.00 55.45  ? 309 GLU A H      1 
ATOM   5103  H HA     . GLU A 1 309 ? 179.876 8.666   176.144 1.00 56.99  ? 309 GLU A HA     1 
ATOM   5104  H HB2    . GLU A 1 309 ? 178.161 7.644   174.158 1.00 66.38  ? 309 GLU A HB2    1 
ATOM   5105  H HB3    . GLU A 1 309 ? 177.686 8.810   175.121 1.00 66.38  ? 309 GLU A HB3    1 
ATOM   5106  H HG2    . GLU A 1 309 ? 179.313 10.202  174.255 1.00 77.28  ? 309 GLU A HG2    1 
ATOM   5107  H HG3    . GLU A 1 309 ? 179.815 9.031   173.305 1.00 77.28  ? 309 GLU A HG3    1 
ATOM   5108  N N      . ARG A 1 310 ? 178.086 6.049   176.571 1.00 40.53  ? 310 ARG A N      1 
ATOM   5109  C CA     . ARG A 1 310 ? 177.333 5.269   177.537 1.00 45.19  ? 310 ARG A CA     1 
ATOM   5110  C C      . ARG A 1 310 ? 178.119 5.095   178.828 1.00 46.39  ? 310 ARG A C      1 
ATOM   5111  O O      . ARG A 1 310 ? 177.574 5.247   179.912 1.00 49.32  ? 310 ARG A O      1 
ATOM   5112  C CB     . ARG A 1 310 ? 177.029 3.880   176.977 1.00 48.60  ? 310 ARG A CB     1 
ATOM   5113  C CG     . ARG A 1 310 ? 175.738 3.762   176.236 1.00 49.78  ? 310 ARG A CG     1 
ATOM   5114  C CD     . ARG A 1 310 ? 175.327 2.296   176.104 1.00 51.52  ? 310 ARG A CD     1 
ATOM   5115  N NE     . ARG A 1 310 ? 176.318 1.450   175.437 1.00 50.52  ? 310 ARG A NE     1 
ATOM   5116  C CZ     . ARG A 1 310 ? 176.526 1.446   174.123 1.00 55.05  ? 310 ARG A CZ     1 
ATOM   5117  N NH1    . ARG A 1 310 ? 175.840 2.270   173.335 1.00 53.70  ? 310 ARG A NH1    1 
ATOM   5118  N NH2    . ARG A 1 310 ? 177.428 0.632   173.588 1.00 59.59  ? 310 ARG A NH2    1 
ATOM   5119  H H      . ARG A 1 310 ? 178.140 5.683   175.795 1.00 48.64  ? 310 ARG A H      1 
ATOM   5120  H HA     . ARG A 1 310 ? 176.496 5.715   177.739 1.00 54.23  ? 310 ARG A HA     1 
ATOM   5121  H HB2    . ARG A 1 310 ? 177.740 3.633   176.366 1.00 58.32  ? 310 ARG A HB2    1 
ATOM   5122  H HB3    . ARG A 1 310 ? 177.001 3.251   177.715 1.00 58.32  ? 310 ARG A HB3    1 
ATOM   5123  H HG2    . ARG A 1 310 ? 175.042 4.233   176.721 1.00 59.73  ? 310 ARG A HG2    1 
ATOM   5124  H HG3    . ARG A 1 310 ? 175.841 4.133   175.346 1.00 59.73  ? 310 ARG A HG3    1 
ATOM   5125  H HD2    . ARG A 1 310 ? 175.180 1.934   176.992 1.00 61.82  ? 310 ARG A HD2    1 
ATOM   5126  H HD3    . ARG A 1 310 ? 174.505 2.249   175.591 1.00 61.82  ? 310 ARG A HD3    1 
ATOM   5127  H HE     . ARG A 1 310 ? 176.852 0.990   175.930 1.00 60.63  ? 310 ARG A HE     1 
ATOM   5128  H HH11   . ARG A 1 310 ? 175.250 2.797   173.673 1.00 64.45  ? 310 ARG A HH11   1 
ATOM   5129  H HH12   . ARG A 1 310 ? 175.980 2.270   172.487 1.00 64.45  ? 310 ARG A HH12   1 
ATOM   5130  H HH21   . ARG A 1 310 ? 177.882 0.102   174.092 1.00 71.51  ? 310 ARG A HH21   1 
ATOM   5131  H HH22   . ARG A 1 310 ? 177.569 0.643   172.740 1.00 71.51  ? 310 ARG A HH22   1 
ATOM   5132  N N      . GLU A 1 311 ? 179.402 4.765   178.700 1.00 43.88  ? 311 GLU A N      1 
ATOM   5133  C CA     . GLU A 1 311 ? 180.243 4.477   179.858 1.00 42.52  ? 311 GLU A CA     1 
ATOM   5134  C C      . GLU A 1 311 ? 180.843 5.741   180.464 1.00 41.21  ? 311 GLU A C      1 
ATOM   5135  O O      . GLU A 1 311 ? 181.730 5.672   181.297 1.00 40.69  ? 311 GLU A O      1 
ATOM   5136  C CB     . GLU A 1 311 ? 181.356 3.507   179.467 1.00 47.90  ? 311 GLU A CB     1 
ATOM   5137  C CG     . GLU A 1 311 ? 180.845 2.150   179.003 1.00 56.94  ? 311 GLU A CG     1 
ATOM   5138  C CD     . GLU A 1 311 ? 180.078 1.412   180.090 1.00 67.54  ? 311 GLU A CD     1 
ATOM   5139  O OE1    . GLU A 1 311 ? 179.226 0.569   179.748 1.00 73.59  ? 311 GLU A OE1    1 
ATOM   5140  O OE2    . GLU A 1 311 ? 180.331 1.670   181.287 1.00 70.24  ? 311 GLU A OE2    1 
ATOM   5141  H H      . GLU A 1 311 ? 179.811 4.701   177.947 1.00 52.65  ? 311 GLU A H      1 
ATOM   5142  H HA     . GLU A 1 311 ? 179.701 4.049   180.540 1.00 51.02  ? 311 GLU A HA     1 
ATOM   5143  H HB2    . GLU A 1 311 ? 181.869 3.896   178.741 1.00 57.48  ? 311 GLU A HB2    1 
ATOM   5144  H HB3    . GLU A 1 311 ? 181.930 3.362   180.236 1.00 57.48  ? 311 GLU A HB3    1 
ATOM   5145  H HG2    . GLU A 1 311 ? 180.249 2.277   178.249 1.00 68.33  ? 311 GLU A HG2    1 
ATOM   5146  H HG3    . GLU A 1 311 ? 181.600 1.600   178.742 1.00 68.33  ? 311 GLU A HG3    1 
ATOM   5147  N N      . ASN A 1 312 ? 180.352 6.897   180.036 1.00 44.00  ? 312 ASN A N      1 
ATOM   5148  C CA     . ASN A 1 312 ? 180.730 8.168   180.636 1.00 43.45  ? 312 ASN A CA     1 
ATOM   5149  C C      . ASN A 1 312 ? 182.225 8.503   180.574 1.00 44.14  ? 312 ASN A C      1 
ATOM   5150  O O      . ASN A 1 312 ? 182.753 9.162   181.465 1.00 42.75  ? 312 ASN A O      1 
ATOM   5151  C CB     . ASN A 1 312 ? 180.214 8.225   182.074 1.00 42.62  ? 312 ASN A CB     1 
ATOM   5152  C CG     . ASN A 1 312 ? 178.699 8.281   182.137 1.00 47.56  ? 312 ASN A CG     1 
ATOM   5153  O OD1    . ASN A 1 312 ? 178.029 7.262   182.316 1.00 50.74  ? 312 ASN A OD1    1 
ATOM   5154  N ND2    . ASN A 1 312 ? 178.149 9.483   181.977 1.00 47.95  ? 312 ASN A ND2    1 
ATOM   5155  H H      . ASN A 1 312 ? 179.791 6.972   179.389 1.00 52.80  ? 312 ASN A H      1 
ATOM   5156  H HA     . ASN A 1 312 ? 180.270 8.869   180.148 1.00 52.14  ? 312 ASN A HA     1 
ATOM   5157  H HB2    . ASN A 1 312 ? 180.507 7.431   182.549 1.00 51.15  ? 312 ASN A HB2    1 
ATOM   5158  H HB3    . ASN A 1 312 ? 180.564 9.020   182.506 1.00 51.15  ? 312 ASN A HB3    1 
ATOM   5159  H HD21   . ASN A 1 312 ? 177.294 9.572   182.003 1.00 57.54  ? 312 ASN A HD21   1 
ATOM   5160  H HD22   . ASN A 1 312 ? 178.649 10.171  181.847 1.00 57.54  ? 312 ASN A HD22   1 
ATOM   5161  N N      . PHE A 1 313 ? 182.897 8.070   179.508 1.00 45.08  ? 313 PHE A N      1 
ATOM   5162  C CA     . PHE A 1 313 ? 184.280 8.487   179.263 1.00 43.92  ? 313 PHE A CA     1 
ATOM   5163  C C      . PHE A 1 313 ? 184.362 9.797   178.446 1.00 39.65  ? 313 PHE A C      1 
ATOM   5164  O O      . PHE A 1 313 ? 185.453 10.347  178.247 1.00 37.11  ? 313 PHE A O      1 
ATOM   5165  C CB     . PHE A 1 313 ? 185.072 7.361   178.590 1.00 44.27  ? 313 PHE A CB     1 
ATOM   5166  C CG     . PHE A 1 313 ? 185.397 6.226   179.511 1.00 47.44  ? 313 PHE A CG     1 
ATOM   5167  C CD1    . PHE A 1 313 ? 186.224 6.424   180.602 1.00 47.88  ? 313 PHE A CD1    1 
ATOM   5168  C CD2    . PHE A 1 313 ? 184.876 4.956   179.290 1.00 51.18  ? 313 PHE A CD2    1 
ATOM   5169  C CE1    . PHE A 1 313 ? 186.526 5.386   181.458 1.00 49.95  ? 313 PHE A CE1    1 
ATOM   5170  C CE2    . PHE A 1 313 ? 185.173 3.910   180.137 1.00 50.33  ? 313 PHE A CE2    1 
ATOM   5171  C CZ     . PHE A 1 313 ? 185.999 4.124   181.222 1.00 52.66  ? 313 PHE A CZ     1 
ATOM   5172  H H      . PHE A 1 313 ? 182.578 7.536   178.914 1.00 54.09  ? 313 PHE A H      1 
ATOM   5173  H HA     . PHE A 1 313 ? 184.700 8.658   180.121 1.00 52.70  ? 313 PHE A HA     1 
ATOM   5174  H HB2    . PHE A 1 313 ? 184.549 7.006   177.854 1.00 53.12  ? 313 PHE A HB2    1 
ATOM   5175  H HB3    . PHE A 1 313 ? 185.908 7.722   178.256 1.00 53.12  ? 313 PHE A HB3    1 
ATOM   5176  H HD1    . PHE A 1 313 ? 186.577 7.270   180.762 1.00 57.46  ? 313 PHE A HD1    1 
ATOM   5177  H HD2    . PHE A 1 313 ? 184.319 4.810   178.559 1.00 61.41  ? 313 PHE A HD2    1 
ATOM   5178  H HE1    . PHE A 1 313 ? 187.083 5.530   182.188 1.00 59.95  ? 313 PHE A HE1    1 
ATOM   5179  H HE2    . PHE A 1 313 ? 184.819 3.065   179.979 1.00 60.40  ? 313 PHE A HE2    1 
ATOM   5180  H HZ     . PHE A 1 313 ? 186.202 3.421   181.796 1.00 63.20  ? 313 PHE A HZ     1 
ATOM   5181  N N      . MET A 1 314 ? 183.204 10.285  177.995 1.00 35.97  ? 314 MET A N      1 
ATOM   5182  C CA     . MET A 1 314 ? 183.072 11.603  177.365 1.00 33.91  ? 314 MET A CA     1 
ATOM   5183  C C      . MET A 1 314 ? 183.995 11.808  176.172 1.00 38.05  ? 314 MET A C      1 
ATOM   5184  O O      . MET A 1 314 ? 184.850 12.692  176.188 1.00 42.61  ? 314 MET A O      1 
ATOM   5185  C CB     . MET A 1 314 ? 183.283 12.719  178.391 1.00 29.67  ? 314 MET A CB     1 
ATOM   5186  C CG     . MET A 1 314 ? 182.229 12.707  179.476 1.00 29.10  ? 314 MET A CG     1 
ATOM   5187  S SD     . MET A 1 314 ? 182.537 13.825  180.836 1.00 57.51  ? 314 MET A SD     1 
ATOM   5188  C CE     . MET A 1 314 ? 182.427 15.390  179.974 1.00 76.59  ? 314 MET A CE     1 
ATOM   5189  H H      . MET A 1 314 ? 182.459 9.858   178.044 1.00 43.16  ? 314 MET A H      1 
ATOM   5190  H HA     . MET A 1 314 ? 182.160 11.685  177.047 1.00 40.69  ? 314 MET A HA     1 
ATOM   5191  H HB2    . MET A 1 314 ? 184.150 12.604  178.812 1.00 35.60  ? 314 MET A HB2    1 
ATOM   5192  H HB3    . MET A 1 314 ? 183.242 13.576  177.940 1.00 35.60  ? 314 MET A HB3    1 
ATOM   5193  H HG2    . MET A 1 314 ? 181.378 12.953  179.082 1.00 34.92  ? 314 MET A HG2    1 
ATOM   5194  H HG3    . MET A 1 314 ? 182.172 11.810  179.841 1.00 34.92  ? 314 MET A HG3    1 
ATOM   5195  H HE1    . MET A 1 314 ? 182.578 16.110  180.607 1.00 91.91  ? 314 MET A HE1    1 
ATOM   5196  H HE2    . MET A 1 314 ? 183.102 15.415  179.278 1.00 91.91  ? 314 MET A HE2    1 
ATOM   5197  H HE3    . MET A 1 314 ? 181.544 15.473  179.582 1.00 91.91  ? 314 MET A HE3    1 
ATOM   5198  N N      . PRO A 1 315 ? 183.793 11.016  175.114 1.00 37.88  ? 315 PRO A N      1 
ATOM   5199  C CA     . PRO A 1 315 ? 184.636 11.162  173.930 1.00 42.72  ? 315 PRO A CA     1 
ATOM   5200  C C      . PRO A 1 315 ? 184.397 12.505  173.258 1.00 47.40  ? 315 PRO A C      1 
ATOM   5201  O O      . PRO A 1 315 ? 183.273 12.988  173.327 1.00 50.89  ? 315 PRO A O      1 
ATOM   5202  C CB     . PRO A 1 315 ? 184.157 10.027  173.031 1.00 44.23  ? 315 PRO A CB     1 
ATOM   5203  C CG     . PRO A 1 315 ? 182.712 9.842   173.412 1.00 40.52  ? 315 PRO A CG     1 
ATOM   5204  C CD     . PRO A 1 315 ? 182.666 10.089  174.888 1.00 36.71  ? 315 PRO A CD     1 
ATOM   5205  H HA     . PRO A 1 315 ? 185.575 11.051  174.146 1.00 51.27  ? 315 PRO A HA     1 
ATOM   5206  H HB2    . PRO A 1 315 ? 184.238 10.286  172.100 1.00 53.08  ? 315 PRO A HB2    1 
ATOM   5207  H HB3    . PRO A 1 315 ? 184.668 9.223   173.213 1.00 53.08  ? 315 PRO A HB3    1 
ATOM   5208  H HG2    . PRO A 1 315 ? 182.164 10.488  172.939 1.00 48.62  ? 315 PRO A HG2    1 
ATOM   5209  H HG3    . PRO A 1 315 ? 182.432 8.937   173.207 1.00 48.62  ? 315 PRO A HG3    1 
ATOM   5210  H HD2    . PRO A 1 315 ? 181.827 10.510  175.135 1.00 44.05  ? 315 PRO A HD2    1 
ATOM   5211  H HD3    . PRO A 1 315 ? 182.805 9.261   175.374 1.00 44.05  ? 315 PRO A HD3    1 
ATOM   5212  N N      . LEU A 1 316 ? 185.423 13.093  172.641 1.00 51.12  ? 316 LEU A N      1 
ATOM   5213  C CA     . LEU A 1 316 ? 185.286 14.376  171.943 1.00 54.65  ? 316 LEU A CA     1 
ATOM   5214  C C      . LEU A 1 316 ? 184.988 14.158  170.462 1.00 57.93  ? 316 LEU A C      1 
ATOM   5215  O O      . LEU A 1 316 ? 183.922 14.535  169.973 1.00 65.56  ? 316 LEU A O      1 
ATOM   5216  C CB     . LEU A 1 316 ? 186.561 15.205  172.077 1.00 55.49  ? 316 LEU A CB     1 
ATOM   5217  C CG     . LEU A 1 316 ? 186.944 15.689  173.475 1.00 55.68  ? 316 LEU A CG     1 
ATOM   5218  C CD1    . LEU A 1 316 ? 188.377 16.173  173.476 1.00 56.10  ? 316 LEU A CD1    1 
ATOM   5219  C CD2    . LEU A 1 316 ? 186.014 16.798  173.928 1.00 57.02  ? 316 LEU A CD2    1 
ATOM   5220  H H      . LEU A 1 316 ? 186.218 12.767  172.611 1.00 61.35  ? 316 LEU A H      1 
ATOM   5221  H HA     . LEU A 1 316 ? 184.552 14.877  172.332 1.00 65.58  ? 316 LEU A HA     1 
ATOM   5222  H HB2    . LEU A 1 316 ? 187.301 14.671  171.749 1.00 66.59  ? 316 LEU A HB2    1 
ATOM   5223  H HB3    . LEU A 1 316 ? 186.466 15.993  171.520 1.00 66.59  ? 316 LEU A HB3    1 
ATOM   5224  H HG     . LEU A 1 316 ? 186.870 14.953  174.102 1.00 66.81  ? 316 LEU A HG     1 
ATOM   5225  H HD11   . LEU A 1 316 ? 188.607 16.477  174.368 1.00 67.32  ? 316 LEU A HD11   1 
ATOM   5226  H HD12   . LEU A 1 316 ? 188.957 15.441  173.216 1.00 67.32  ? 316 LEU A HD12   1 
ATOM   5227  H HD13   . LEU A 1 316 ? 188.463 16.904  172.844 1.00 67.32  ? 316 LEU A HD13   1 
ATOM   5228  H HD21   . LEU A 1 316 ? 186.277 17.088  174.815 1.00 68.42  ? 316 LEU A HD21   1 
ATOM   5229  H HD22   . LEU A 1 316 ? 186.079 17.539  173.305 1.00 68.42  ? 316 LEU A HD22   1 
ATOM   5230  H HD23   . LEU A 1 316 ? 185.105 16.459  173.946 1.00 68.42  ? 316 LEU A HD23   1 
ATOM   5231  N N      . ARG A 1 317 ? 185.947 13.567  169.753 1.00 51.36  ? 317 ARG A N      1 
ATOM   5232  C CA     . ARG A 1 317 ? 185.775 13.204  168.343 1.00 48.60  ? 317 ARG A CA     1 
ATOM   5233  C C      . ARG A 1 317 ? 186.433 11.861  168.078 1.00 49.57  ? 317 ARG A C      1 
ATOM   5234  O O      . ARG A 1 317 ? 187.246 11.401  168.881 1.00 50.08  ? 317 ARG A O      1 
ATOM   5235  C CB     . ARG A 1 317 ? 186.437 14.221  167.414 1.00 43.97  ? 317 ARG A CB     1 
ATOM   5236  C CG     . ARG A 1 317 ? 186.199 15.659  167.749 1.00 44.89  ? 317 ARG A CG     1 
ATOM   5237  C CD     . ARG A 1 317 ? 186.905 16.545  166.730 1.00 48.86  ? 317 ARG A CD     1 
ATOM   5238  N NE     . ARG A 1 317 ? 186.301 16.474  165.401 1.00 49.97  ? 317 ARG A NE     1 
ATOM   5239  C CZ     . ARG A 1 317 ? 186.864 16.942  164.290 1.00 47.99  ? 317 ARG A CZ     1 
ATOM   5240  N NH1    . ARG A 1 317 ? 188.066 17.503  164.334 1.00 46.69  ? 317 ARG A NH1    1 
ATOM   5241  N NH2    . ARG A 1 317 ? 186.226 16.842  163.129 1.00 46.21  ? 317 ARG A NH2    1 
ATOM   5242  H H      . ARG A 1 317 ? 186.720 13.361  170.069 1.00 61.63  ? 317 ARG A H      1 
ATOM   5243  H HA     . ARG A 1 317 ? 184.831 13.144  168.127 1.00 58.32  ? 317 ARG A HA     1 
ATOM   5244  H HB2    . ARG A 1 317 ? 187.395 14.074  167.432 1.00 52.76  ? 317 ARG A HB2    1 
ATOM   5245  H HB3    . ARG A 1 317 ? 186.104 14.075  166.514 1.00 52.76  ? 317 ARG A HB3    1 
ATOM   5246  H HG2    . ARG A 1 317 ? 185.248 15.848  167.719 1.00 53.87  ? 317 ARG A HG2    1 
ATOM   5247  H HG3    . ARG A 1 317 ? 186.558 15.852  168.629 1.00 53.87  ? 317 ARG A HG3    1 
ATOM   5248  H HD2    . ARG A 1 317 ? 186.862 17.466  167.030 1.00 58.63  ? 317 ARG A HD2    1 
ATOM   5249  H HD3    . ARG A 1 317 ? 187.830 16.263  166.654 1.00 58.63  ? 317 ARG A HD3    1 
ATOM   5250  H HE     . ARG A 1 317 ? 185.527 16.104  165.332 1.00 59.96  ? 317 ARG A HE     1 
ATOM   5251  H HH11   . ARG A 1 317 ? 188.481 17.573  165.084 1.00 56.03  ? 317 ARG A HH11   1 
ATOM   5252  H HH12   . ARG A 1 317 ? 188.428 17.801  163.613 1.00 56.03  ? 317 ARG A HH12   1 
ATOM   5253  H HH21   . ARG A 1 317 ? 185.449 16.475  163.095 1.00 55.46  ? 317 ARG A HH21   1 
ATOM   5254  H HH22   . ARG A 1 317 ? 186.593 17.137  162.409 1.00 55.46  ? 317 ARG A HH22   1 
ATOM   5255  N N      . SER A 1 318 ? 186.097 11.249  166.942 1.00 48.96  ? 318 SER A N      1 
ATOM   5256  C CA     . SER A 1 318 ? 186.769 10.032  166.495 1.00 49.05  ? 318 SER A CA     1 
ATOM   5257  C C      . SER A 1 318 ? 187.287 10.211  165.073 1.00 47.68  ? 318 SER A C      1 
ATOM   5258  O O      . SER A 1 318 ? 186.991 11.193  164.408 1.00 43.49  ? 318 SER A O      1 
ATOM   5259  C CB     . SER A 1 318 ? 185.841 8.814   166.571 1.00 53.58  ? 318 SER A CB     1 
ATOM   5260  O OG     . SER A 1 318 ? 184.887 8.813   165.523 1.00 59.49  ? 318 SER A OG     1 
ATOM   5261  H H      . SER A 1 318 ? 185.479 11.522  166.410 1.00 58.75  ? 318 SER A H      1 
ATOM   5262  H HA     . SER A 1 318 ? 187.531 9.863   167.071 1.00 58.86  ? 318 SER A HA     1 
ATOM   5263  H HB2    . SER A 1 318 ? 186.377 8.008   166.507 1.00 64.29  ? 318 SER A HB2    1 
ATOM   5264  H HB3    . SER A 1 318 ? 185.373 8.830   167.421 1.00 64.29  ? 318 SER A HB3    1 
ATOM   5265  H HG     . SER A 1 318 ? 184.391 8.138   165.587 1.00 71.39  ? 318 SER A HG     1 
ATOM   5266  N N      . ALA A 1 319 ? 188.071 9.251   164.613 1.00 55.76  ? 319 ALA A N      1 
ATOM   5267  C CA     . ALA A 1 319 ? 188.622 9.293   163.271 1.00 59.95  ? 319 ALA A CA     1 
ATOM   5268  C C      . ALA A 1 319 ? 189.125 7.904   162.940 1.00 62.08  ? 319 ALA A C      1 
ATOM   5269  O O      . ALA A 1 319 ? 189.278 7.067   163.834 1.00 63.32  ? 319 ALA A O      1 
ATOM   5270  C CB     . ALA A 1 319 ? 189.753 10.299  163.190 1.00 58.83  ? 319 ALA A CB     1 
ATOM   5271  H H      . ALA A 1 319 ? 188.302 8.556   165.064 1.00 66.91  ? 319 ALA A H      1 
ATOM   5272  H HA     . ALA A 1 319 ? 187.932 9.540   162.636 1.00 71.94  ? 319 ALA A HA     1 
ATOM   5273  H HB1    . ALA A 1 319 ? 190.103 10.308  162.285 1.00 70.59  ? 319 ALA A HB1    1 
ATOM   5274  H HB2    . ALA A 1 319 ? 189.411 11.177  163.422 1.00 70.59  ? 319 ALA A HB2    1 
ATOM   5275  H HB3    . ALA A 1 319 ? 190.450 10.040  163.812 1.00 70.59  ? 319 ALA A HB3    1 
ATOM   5276  N N      . PHE A 1 320 ? 189.375 7.652   161.660 1.00 61.35  ? 320 PHE A N      1 
ATOM   5277  C CA     . PHE A 1 320 ? 189.929 6.370   161.256 1.00 62.67  ? 320 PHE A CA     1 
ATOM   5278  C C      . PHE A 1 320 ? 190.834 6.513   160.049 1.00 62.43  ? 320 PHE A C      1 
ATOM   5279  O O      . PHE A 1 320 ? 190.651 7.405   159.228 1.00 63.98  ? 320 PHE A O      1 
ATOM   5280  C CB     . PHE A 1 320 ? 188.816 5.351   160.976 1.00 62.50  ? 320 PHE A CB     1 
ATOM   5281  C CG     . PHE A 1 320 ? 187.782 5.835   160.010 1.00 62.20  ? 320 PHE A CG     1 
ATOM   5282  C CD1    . PHE A 1 320 ? 187.975 5.711   158.644 1.00 61.70  ? 320 PHE A CD1    1 
ATOM   5283  C CD2    . PHE A 1 320 ? 186.613 6.414   160.467 1.00 62.40  ? 320 PHE A CD2    1 
ATOM   5284  C CE1    . PHE A 1 320 ? 187.018 6.156   157.752 1.00 60.94  ? 320 PHE A CE1    1 
ATOM   5285  C CE2    . PHE A 1 320 ? 185.648 6.861   159.577 1.00 62.96  ? 320 PHE A CE2    1 
ATOM   5286  C CZ     . PHE A 1 320 ? 185.850 6.731   158.220 1.00 61.48  ? 320 PHE A CZ     1 
ATOM   5287  H H      . PHE A 1 320 ? 189.234 8.201   161.014 1.00 73.62  ? 320 PHE A H      1 
ATOM   5288  H HA     . PHE A 1 320 ? 190.467 6.022   161.985 1.00 75.20  ? 320 PHE A HA     1 
ATOM   5289  H HB2    . PHE A 1 320 ? 189.214 4.547   160.607 1.00 75.00  ? 320 PHE A HB2    1 
ATOM   5290  H HB3    . PHE A 1 320 ? 188.367 5.143   161.811 1.00 75.00  ? 320 PHE A HB3    1 
ATOM   5291  H HD1    . PHE A 1 320 ? 188.758 5.323   158.324 1.00 74.04  ? 320 PHE A HD1    1 
ATOM   5292  H HD2    . PHE A 1 320 ? 186.471 6.501   161.382 1.00 74.88  ? 320 PHE A HD2    1 
ATOM   5293  H HE1    . PHE A 1 320 ? 187.159 6.067   156.837 1.00 73.13  ? 320 PHE A HE1    1 
ATOM   5294  H HE2    . PHE A 1 320 ? 184.865 7.248   159.896 1.00 75.55  ? 320 PHE A HE2    1 
ATOM   5295  H HZ     . PHE A 1 320 ? 185.206 7.032   157.621 1.00 73.78  ? 320 PHE A HZ     1 
ATOM   5296  N N      . LYS A 1 321 ? 191.825 5.630   159.966 1.00 62.67  ? 321 LYS A N      1 
ATOM   5297  C CA     . LYS A 1 321 ? 192.705 5.566   158.813 1.00 64.31  ? 321 LYS A CA     1 
ATOM   5298  C C      . LYS A 1 321 ? 192.841 4.120   158.385 1.00 69.73  ? 321 LYS A C      1 
ATOM   5299  O O      . LYS A 1 321 ? 192.816 3.211   159.214 1.00 69.56  ? 321 LYS A O      1 
ATOM   5300  C CB     . LYS A 1 321 ? 194.083 6.148   159.135 1.00 64.41  ? 321 LYS A CB     1 
ATOM   5301  C CG     . LYS A 1 321 ? 194.994 6.243   157.922 1.00 70.17  ? 321 LYS A CG     1 
ATOM   5302  C CD     . LYS A 1 321 ? 196.404 6.653   158.298 1.00 75.69  ? 321 LYS A CD     1 
ATOM   5303  C CE     . LYS A 1 321 ? 197.310 6.760   157.069 1.00 77.15  ? 321 LYS A CE     1 
ATOM   5304  N NZ     . LYS A 1 321 ? 196.874 7.822   156.116 1.00 75.07  ? 321 LYS A NZ     1 
ATOM   5305  H H      . LYS A 1 321 ? 192.008 5.051   160.575 1.00 75.20  ? 321 LYS A H      1 
ATOM   5306  H HA     . LYS A 1 321 ? 192.318 6.070   158.081 1.00 77.17  ? 321 LYS A HA     1 
ATOM   5307  H HB2    . LYS A 1 321 ? 193.970 7.043   159.493 1.00 77.29  ? 321 LYS A HB2    1 
ATOM   5308  H HB3    . LYS A 1 321 ? 194.518 5.582   159.791 1.00 77.29  ? 321 LYS A HB3    1 
ATOM   5309  H HG2    . LYS A 1 321 ? 195.037 5.377   157.487 1.00 84.21  ? 321 LYS A HG2    1 
ATOM   5310  H HG3    . LYS A 1 321 ? 194.640 6.907   157.309 1.00 84.21  ? 321 LYS A HG3    1 
ATOM   5311  H HD2    . LYS A 1 321 ? 196.379 7.520   158.733 1.00 90.82  ? 321 LYS A HD2    1 
ATOM   5312  H HD3    . LYS A 1 321 ? 196.781 5.989   158.896 1.00 90.82  ? 321 LYS A HD3    1 
ATOM   5313  H HE2    . LYS A 1 321 ? 198.211 6.970   157.359 1.00 92.58  ? 321 LYS A HE2    1 
ATOM   5314  H HE3    . LYS A 1 321 ? 197.303 5.913   156.597 1.00 92.58  ? 321 LYS A HE3    1 
ATOM   5315  H HZ1    . LYS A 1 321 ? 197.426 7.850   155.418 1.00 90.09  ? 321 LYS A HZ1    1 
ATOM   5316  H HZ2    . LYS A 1 321 ? 196.050 7.650   155.826 1.00 90.09  ? 321 LYS A HZ2    1 
ATOM   5317  H HZ3    . LYS A 1 321 ? 196.879 8.614   156.520 1.00 90.09  ? 321 LYS A HZ3    1 
ATOM   5318  N N      . ALA A 1 322 ? 192.964 3.921   157.079 1.00 75.64  ? 322 ALA A N      1 
ATOM   5319  C CA     . ALA A 1 322 ? 193.272 2.619   156.515 1.00 76.79  ? 322 ALA A CA     1 
ATOM   5320  C C      . ALA A 1 322 ? 194.614 2.724   155.804 1.00 70.27  ? 322 ALA A C      1 
ATOM   5321  O O      . ALA A 1 322 ? 194.793 3.572   154.930 1.00 67.44  ? 322 ALA A O      1 
ATOM   5322  C CB     . ALA A 1 322 ? 192.184 2.192   155.548 1.00 80.59  ? 322 ALA A CB     1 
ATOM   5323  H H      . ALA A 1 322 ? 192.871 4.540   156.489 1.00 90.77  ? 322 ALA A H      1 
ATOM   5324  H HA     . ALA A 1 322 ? 193.341 1.959   157.223 1.00 92.14  ? 322 ALA A HA     1 
ATOM   5325  H HB1    . ALA A 1 322 ? 192.410 1.322   155.184 1.00 96.71  ? 322 ALA A HB1    1 
ATOM   5326  H HB2    . ALA A 1 322 ? 191.340 2.144   156.024 1.00 96.71  ? 322 ALA A HB2    1 
ATOM   5327  H HB3    . ALA A 1 322 ? 192.124 2.845   154.833 1.00 96.71  ? 322 ALA A HB3    1 
ATOM   5328  N N      . SER A 1 323 ? 195.560 1.884   156.212 1.00 66.36  ? 323 SER A N      1 
ATOM   5329  C CA     . SER A 1 323 ? 196.861 1.802   155.560 1.00 64.92  ? 323 SER A CA     1 
ATOM   5330  C C      . SER A 1 323 ? 196.865 0.586   154.641 1.00 69.67  ? 323 SER A C      1 
ATOM   5331  O O      . SER A 1 323 ? 195.811 0.124   154.207 1.00 62.08  ? 323 SER A O      1 
ATOM   5332  C CB     . SER A 1 323 ? 197.974 1.707   156.602 1.00 67.57  ? 323 SER A CB     1 
ATOM   5333  O OG     . SER A 1 323 ? 197.912 0.480   157.309 1.00 74.11  ? 323 SER A OG     1 
ATOM   5334  H H      . SER A 1 323 ? 195.471 1.342   156.874 1.00 79.63  ? 323 SER A H      1 
ATOM   5335  H HA     . SER A 1 323 ? 197.006 2.597   155.023 1.00 77.90  ? 323 SER A HA     1 
ATOM   5336  H HB2    . SER A 1 323 ? 198.832 1.767   156.152 1.00 81.09  ? 323 SER A HB2    1 
ATOM   5337  H HB3    . SER A 1 323 ? 197.879 2.438   157.232 1.00 81.09  ? 323 SER A HB3    1 
ATOM   5338  H HG     . SER A 1 323 ? 197.175 0.413   157.705 1.00 88.93  ? 323 SER A HG     1 
ATOM   5339  N N      . GLU A 1 324 ? 198.046 0.058   154.347 1.00 87.06  ? 324 GLU A N      1 
ATOM   5340  C CA     . GLU A 1 324 ? 198.154 -1.048  153.408 1.00 101.93 ? 324 GLU A CA     1 
ATOM   5341  C C      . GLU A 1 324 ? 197.729 -2.367  154.050 1.00 97.90  ? 324 GLU A C      1 
ATOM   5342  O O      . GLU A 1 324 ? 197.063 -3.186  153.413 1.00 97.94  ? 324 GLU A O      1 
ATOM   5343  C CB     . GLU A 1 324 ? 199.584 -1.151  152.876 1.00 118.68 ? 324 GLU A CB     1 
ATOM   5344  C CG     . GLU A 1 324 ? 199.772 -2.179  151.762 1.00 131.40 ? 324 GLU A CG     1 
ATOM   5345  C CD     . GLU A 1 324 ? 199.002 -1.842  150.490 1.00 137.74 ? 324 GLU A CD     1 
ATOM   5346  O OE1    . GLU A 1 324 ? 198.503 -0.701  150.364 1.00 136.56 ? 324 GLU A OE1    1 
ATOM   5347  O OE2    . GLU A 1 324 ? 198.901 -2.726  149.610 1.00 142.01 ? 324 GLU A OE2    1 
ATOM   5348  H H      . GLU A 1 324 ? 198.796 0.321   154.675 1.00 104.47 ? 324 GLU A H      1 
ATOM   5349  H HA     . GLU A 1 324 ? 197.566 -0.880  152.655 1.00 122.32 ? 324 GLU A HA     1 
ATOM   5350  H HB2    . GLU A 1 324 ? 199.848 -0.286  152.526 1.00 142.41 ? 324 GLU A HB2    1 
ATOM   5351  H HB3    . GLU A 1 324 ? 200.170 -1.400  153.608 1.00 142.41 ? 324 GLU A HB3    1 
ATOM   5352  H HG2    . GLU A 1 324 ? 200.714 -2.228  151.536 1.00 157.68 ? 324 GLU A HG2    1 
ATOM   5353  H HG3    . GLU A 1 324 ? 199.464 -3.043  152.077 1.00 157.68 ? 324 GLU A HG3    1 
ATOM   5354  N N      . GLU A 1 325 ? 198.102 -2.559  155.314 1.00 92.64  ? 325 GLU A N      1 
ATOM   5355  C CA     . GLU A 1 325 ? 197.881 -3.832  155.998 1.00 88.51  ? 325 GLU A CA     1 
ATOM   5356  C C      . GLU A 1 325 ? 196.959 -3.718  157.218 1.00 79.28  ? 325 GLU A C      1 
ATOM   5357  O O      . GLU A 1 325 ? 196.338 -4.699  157.626 1.00 80.33  ? 325 GLU A O      1 
ATOM   5358  C CB     . GLU A 1 325 ? 199.227 -4.441  156.407 1.00 95.27  ? 325 GLU A CB     1 
ATOM   5359  C CG     . GLU A 1 325 ? 199.121 -5.830  157.034 1.00 105.81 ? 325 GLU A CG     1 
ATOM   5360  C CD     . GLU A 1 325 ? 200.476 -6.482  157.271 1.00 116.07 ? 325 GLU A CD     1 
ATOM   5361  O OE1    . GLU A 1 325 ? 201.359 -6.361  156.394 1.00 119.68 ? 325 GLU A OE1    1 
ATOM   5362  O OE2    . GLU A 1 325 ? 200.659 -7.114  158.335 1.00 119.44 ? 325 GLU A OE2    1 
ATOM   5363  H H      . GLU A 1 325 ? 198.489 -1.964  155.800 1.00 111.17 ? 325 GLU A H      1 
ATOM   5364  H HA     . GLU A 1 325 ? 197.462 -4.446  155.374 1.00 106.22 ? 325 GLU A HA     1 
ATOM   5365  H HB2    . GLU A 1 325 ? 199.787 -4.516  155.618 1.00 114.32 ? 325 GLU A HB2    1 
ATOM   5366  H HB3    . GLU A 1 325 ? 199.650 -3.856  157.054 1.00 114.32 ? 325 GLU A HB3    1 
ATOM   5367  H HG2    . GLU A 1 325 ? 198.672 -5.755  157.891 1.00 126.97 ? 325 GLU A HG2    1 
ATOM   5368  H HG3    . GLU A 1 325 ? 198.611 -6.405  156.443 1.00 126.97 ? 325 GLU A HG3    1 
ATOM   5369  N N      . PHE A 1 326 ? 196.856 -2.522  157.787 1.00 71.10  ? 326 PHE A N      1 
ATOM   5370  C CA     . PHE A 1 326 ? 196.104 -2.332  159.021 1.00 64.99  ? 326 PHE A CA     1 
ATOM   5371  C C      . PHE A 1 326 ? 195.139 -1.157  158.943 1.00 66.23  ? 326 PHE A C      1 
ATOM   5372  O O      . PHE A 1 326 ? 195.269 -0.284  158.085 1.00 66.24  ? 326 PHE A O      1 
ATOM   5373  C CB     . PHE A 1 326 ? 197.072 -2.110  160.178 1.00 63.37  ? 326 PHE A CB     1 
ATOM   5374  C CG     . PHE A 1 326 ? 198.077 -3.210  160.348 1.00 65.85  ? 326 PHE A CG     1 
ATOM   5375  C CD1    . PHE A 1 326 ? 197.744 -4.370  161.030 1.00 71.04  ? 326 PHE A CD1    1 
ATOM   5376  C CD2    . PHE A 1 326 ? 199.357 -3.082  159.837 1.00 65.21  ? 326 PHE A CD2    1 
ATOM   5377  C CE1    . PHE A 1 326 ? 198.672 -5.388  161.197 1.00 72.73  ? 326 PHE A CE1    1 
ATOM   5378  C CE2    . PHE A 1 326 ? 200.288 -4.094  159.999 1.00 68.56  ? 326 PHE A CE2    1 
ATOM   5379  C CZ     . PHE A 1 326 ? 199.943 -5.251  160.680 1.00 71.25  ? 326 PHE A CZ     1 
ATOM   5380  H H      . PHE A 1 326 ? 197.212 -1.803  157.477 1.00 85.32  ? 326 PHE A H      1 
ATOM   5381  H HA     . PHE A 1 326 ? 195.590 -3.133  159.206 1.00 77.99  ? 326 PHE A HA     1 
ATOM   5382  H HB2    . PHE A 1 326 ? 197.559 -1.285  160.025 1.00 76.04  ? 326 PHE A HB2    1 
ATOM   5383  H HB3    . PHE A 1 326 ? 196.564 -2.043  161.002 1.00 76.04  ? 326 PHE A HB3    1 
ATOM   5384  H HD1    . PHE A 1 326 ? 196.888 -4.467  161.381 1.00 85.25  ? 326 PHE A HD1    1 
ATOM   5385  H HD2    . PHE A 1 326 ? 199.594 -2.308  159.379 1.00 78.25  ? 326 PHE A HD2    1 
ATOM   5386  H HE1    . PHE A 1 326 ? 198.436 -6.163  161.654 1.00 87.28  ? 326 PHE A HE1    1 
ATOM   5387  H HE2    . PHE A 1 326 ? 201.145 -3.998  159.649 1.00 82.27  ? 326 PHE A HE2    1 
ATOM   5388  H HZ     . PHE A 1 326 ? 200.567 -5.932  160.789 1.00 85.50  ? 326 PHE A HZ     1 
ATOM   5389  N N      . CYS A 1 327 ? 194.164 -1.158  159.849 1.00 68.48  ? 327 CYS A N      1 
ATOM   5390  C CA     . CYS A 1 327 ? 193.230 -0.048  160.014 1.00 67.20  ? 327 CYS A CA     1 
ATOM   5391  C C      . CYS A 1 327 ? 193.310 0.470   161.435 1.00 62.87  ? 327 CYS A C      1 
ATOM   5392  O O      . CYS A 1 327 ? 193.481 -0.308  162.372 1.00 61.94  ? 327 CYS A O      1 
ATOM   5393  C CB     . CYS A 1 327 ? 191.799 -0.498  159.734 1.00 67.45  ? 327 CYS A CB     1 
ATOM   5394  S SG     . CYS A 1 327 ? 191.510 -0.945  158.035 1.00 67.70  ? 327 CYS A SG     1 
ATOM   5395  H H      . CYS A 1 327 ? 194.021 -1.808  160.394 1.00 82.18  ? 327 CYS A H      1 
ATOM   5396  H HA     . CYS A 1 327 ? 193.459 0.670   159.404 1.00 80.63  ? 327 CYS A HA     1 
ATOM   5397  H HB2    . CYS A 1 327 ? 191.602 -1.274  160.283 1.00 80.95  ? 327 CYS A HB2    1 
ATOM   5398  H HB3    . CYS A 1 327 ? 191.194 0.226   159.958 1.00 80.95  ? 327 CYS A HB3    1 
ATOM   5399  H HG     . CYS A 1 327 ? 190.366 -1.284  157.910 1.00 81.24  ? 327 CYS A HG     1 
ATOM   5400  N N      . TYR A 1 328 ? 193.180 1.783   161.587 1.00 60.35  ? 328 TYR A N      1 
ATOM   5401  C CA     . TYR A 1 328 ? 193.200 2.415   162.900 1.00 57.75  ? 328 TYR A CA     1 
ATOM   5402  C C      . TYR A 1 328 ? 191.876 3.121   163.179 1.00 59.54  ? 328 TYR A C      1 
ATOM   5403  O O      . TYR A 1 328 ? 191.350 3.822   162.317 1.00 61.68  ? 328 TYR A O      1 
ATOM   5404  C CB     . TYR A 1 328 ? 194.351 3.410   162.983 1.00 55.37  ? 328 TYR A CB     1 
ATOM   5405  C CG     . TYR A 1 328 ? 195.700 2.797   162.698 1.00 61.56  ? 328 TYR A CG     1 
ATOM   5406  C CD1    . TYR A 1 328 ? 196.149 2.629   161.396 1.00 65.00  ? 328 TYR A CD1    1 
ATOM   5407  C CD2    . TYR A 1 328 ? 196.531 2.387   163.736 1.00 66.85  ? 328 TYR A CD2    1 
ATOM   5408  C CE1    . TYR A 1 328 ? 197.391 2.068   161.133 1.00 70.41  ? 328 TYR A CE1    1 
ATOM   5409  C CE2    . TYR A 1 328 ? 197.774 1.823   163.483 1.00 70.99  ? 328 TYR A CE2    1 
ATOM   5410  C CZ     . TYR A 1 328 ? 198.199 1.666   162.182 1.00 72.85  ? 328 TYR A CZ     1 
ATOM   5411  O OH     . TYR A 1 328 ? 199.430 1.104   161.924 1.00 74.57  ? 328 TYR A OH     1 
ATOM   5412  H H      . TYR A 1 328 ? 193.077 2.336   160.936 1.00 72.42  ? 328 TYR A H      1 
ATOM   5413  H HA     . TYR A 1 328 ? 193.334 1.737   163.580 1.00 69.30  ? 328 TYR A HA     1 
ATOM   5414  H HB2    . TYR A 1 328 ? 194.202 4.116   162.334 1.00 66.44  ? 328 TYR A HB2    1 
ATOM   5415  H HB3    . TYR A 1 328 ? 194.377 3.785   163.877 1.00 66.44  ? 328 TYR A HB3    1 
ATOM   5416  H HD1    . TYR A 1 328 ? 195.609 2.898   160.687 1.00 77.99  ? 328 TYR A HD1    1 
ATOM   5417  H HD2    . TYR A 1 328 ? 196.248 2.491   164.616 1.00 80.22  ? 328 TYR A HD2    1 
ATOM   5418  H HE1    . TYR A 1 328 ? 197.678 1.960   160.255 1.00 84.49  ? 328 TYR A HE1    1 
ATOM   5419  H HE2    . TYR A 1 328 ? 198.317 1.552   164.188 1.00 85.19  ? 328 TYR A HE2    1 
ATOM   5420  H HH     . TYR A 1 328 ? 199.813 0.907   162.645 1.00 89.49  ? 328 TYR A HH     1 
ATOM   5421  N N      . LEU A 1 329 ? 191.336 2.905   164.376 1.00 57.98  ? 329 LEU A N      1 
ATOM   5422  C CA     . LEU A 1 329 ? 190.176 3.641   164.857 1.00 54.82  ? 329 LEU A CA     1 
ATOM   5423  C C      . LEU A 1 329 ? 190.671 4.507   166.002 1.00 58.77  ? 329 LEU A C      1 
ATOM   5424  O O      . LEU A 1 329 ? 191.099 3.986   167.025 1.00 63.06  ? 329 LEU A O      1 
ATOM   5425  C CB     . LEU A 1 329 ? 189.076 2.695   165.339 1.00 49.81  ? 329 LEU A CB     1 
ATOM   5426  C CG     . LEU A 1 329 ? 188.564 1.660   164.329 1.00 52.30  ? 329 LEU A CG     1 
ATOM   5427  C CD1    . LEU A 1 329 ? 187.507 0.747   164.956 1.00 51.91  ? 329 LEU A CD1    1 
ATOM   5428  C CD2    . LEU A 1 329 ? 188.003 2.330   163.098 1.00 52.74  ? 329 LEU A CD2    1 
ATOM   5429  H H      . LEU A 1 329 ? 191.632 2.324   164.938 1.00 69.57  ? 329 LEU A H      1 
ATOM   5430  H HA     . LEU A 1 329 ? 189.825 4.209   164.154 1.00 65.79  ? 329 LEU A HA     1 
ATOM   5431  H HB2    . LEU A 1 329 ? 189.413 2.205   166.106 1.00 59.77  ? 329 LEU A HB2    1 
ATOM   5432  H HB3    . LEU A 1 329 ? 188.315 3.231   165.611 1.00 59.77  ? 329 LEU A HB3    1 
ATOM   5433  H HG     . LEU A 1 329 ? 189.308 1.103   164.049 1.00 62.76  ? 329 LEU A HG     1 
ATOM   5434  H HD11   . LEU A 1 329 ? 187.208 0.108   164.290 1.00 62.29  ? 329 LEU A HD11   1 
ATOM   5435  H HD12   . LEU A 1 329 ? 187.901 0.281   165.709 1.00 62.29  ? 329 LEU A HD12   1 
ATOM   5436  H HD13   . LEU A 1 329 ? 186.760 1.289   165.255 1.00 62.29  ? 329 LEU A HD13   1 
ATOM   5437  H HD21   . LEU A 1 329 ? 187.690 1.648   162.483 1.00 63.29  ? 329 LEU A HD21   1 
ATOM   5438  H HD22   . LEU A 1 329 ? 187.266 2.904   163.359 1.00 63.29  ? 329 LEU A HD22   1 
ATOM   5439  H HD23   . LEU A 1 329 ? 188.702 2.857   162.680 1.00 63.29  ? 329 LEU A HD23   1 
ATOM   5440  N N      . LEU A 1 330 ? 190.626 5.824   165.813 1.00 56.01  ? 330 LEU A N      1 
ATOM   5441  C CA     . LEU A 1 330 ? 191.204 6.771   166.757 1.00 50.65  ? 330 LEU A CA     1 
ATOM   5442  C C      . LEU A 1 330 ? 190.120 7.418   167.604 1.00 47.60  ? 330 LEU A C      1 
ATOM   5443  O O      . LEU A 1 330 ? 189.036 7.691   167.106 1.00 50.22  ? 330 LEU A O      1 
ATOM   5444  C CB     . LEU A 1 330 ? 191.952 7.861   165.990 1.00 49.07  ? 330 LEU A CB     1 
ATOM   5445  C CG     . LEU A 1 330 ? 192.962 7.380   164.957 1.00 51.99  ? 330 LEU A CG     1 
ATOM   5446  C CD1    . LEU A 1 330 ? 193.530 8.546   164.198 1.00 57.60  ? 330 LEU A CD1    1 
ATOM   5447  C CD2    . LEU A 1 330 ? 194.058 6.622   165.643 1.00 52.38  ? 330 LEU A CD2    1 
ATOM   5448  H H      . LEU A 1 330 ? 190.258 6.198   165.132 1.00 67.22  ? 330 LEU A H      1 
ATOM   5449  H HA     . LEU A 1 330 ? 191.829 6.314   167.342 1.00 60.78  ? 330 LEU A HA     1 
ATOM   5450  H HB2    . LEU A 1 330 ? 191.300 8.407   165.524 1.00 58.89  ? 330 LEU A HB2    1 
ATOM   5451  H HB3    . LEU A 1 330 ? 192.432 8.409   166.630 1.00 58.89  ? 330 LEU A HB3    1 
ATOM   5452  H HG     . LEU A 1 330 ? 192.524 6.787   164.327 1.00 62.39  ? 330 LEU A HG     1 
ATOM   5453  H HD11   . LEU A 1 330 ? 194.170 8.217   163.547 1.00 69.12  ? 330 LEU A HD11   1 
ATOM   5454  H HD12   . LEU A 1 330 ? 192.808 9.011   163.747 1.00 69.12  ? 330 LEU A HD12   1 
ATOM   5455  H HD13   . LEU A 1 330 ? 193.971 9.144   164.822 1.00 69.12  ? 330 LEU A HD13   1 
ATOM   5456  H HD21   . LEU A 1 330 ? 194.696 6.320   164.978 1.00 62.86  ? 330 LEU A HD21   1 
ATOM   5457  H HD22   . LEU A 1 330 ? 194.495 7.208   166.280 1.00 62.86  ? 330 LEU A HD22   1 
ATOM   5458  H HD23   . LEU A 1 330 ? 193.673 5.860   166.104 1.00 62.86  ? 330 LEU A HD23   1 
ATOM   5459  N N      . PHE A 1 331 ? 190.425 7.682   168.876 1.00 41.16  ? 331 PHE A N      1 
ATOM   5460  C CA     . PHE A 1 331 ? 189.468 8.291   169.797 1.00 38.39  ? 331 PHE A CA     1 
ATOM   5461  C C      . PHE A 1 331 ? 190.169 9.238   170.756 1.00 41.70  ? 331 PHE A C      1 
ATOM   5462  O O      . PHE A 1 331 ? 191.281 8.958   171.205 1.00 45.04  ? 331 PHE A O      1 
ATOM   5463  C CB     . PHE A 1 331 ? 188.744 7.215   170.608 1.00 35.35  ? 331 PHE A CB     1 
ATOM   5464  C CG     . PHE A 1 331 ? 188.015 6.218   169.766 1.00 39.83  ? 331 PHE A CG     1 
ATOM   5465  C CD1    . PHE A 1 331 ? 186.725 6.471   169.333 1.00 41.71  ? 331 PHE A CD1    1 
ATOM   5466  C CD2    . PHE A 1 331 ? 188.625 5.034   169.389 1.00 38.46  ? 331 PHE A CD2    1 
ATOM   5467  C CE1    . PHE A 1 331 ? 186.054 5.560   168.548 1.00 43.66  ? 331 PHE A CE1    1 
ATOM   5468  C CE2    . PHE A 1 331 ? 187.959 4.122   168.607 1.00 42.05  ? 331 PHE A CE2    1 
ATOM   5469  C CZ     . PHE A 1 331 ? 186.670 4.384   168.184 1.00 44.16  ? 331 PHE A CZ     1 
ATOM   5470  H H      . PHE A 1 331 ? 191.190 7.514   169.232 1.00 49.39  ? 331 PHE A H      1 
ATOM   5471  H HA     . PHE A 1 331 ? 188.809 8.794   169.293 1.00 46.06  ? 331 PHE A HA     1 
ATOM   5472  H HB2    . PHE A 1 331 ? 189.395 6.734   171.142 1.00 42.42  ? 331 PHE A HB2    1 
ATOM   5473  H HB3    . PHE A 1 331 ? 188.095 7.645   171.188 1.00 42.42  ? 331 PHE A HB3    1 
ATOM   5474  H HD1    . PHE A 1 331 ? 186.305 7.265   169.576 1.00 50.06  ? 331 PHE A HD1    1 
ATOM   5475  H HD2    . PHE A 1 331 ? 189.492 4.853   169.670 1.00 46.15  ? 331 PHE A HD2    1 
ATOM   5476  H HE1    . PHE A 1 331 ? 185.187 5.738   168.266 1.00 52.40  ? 331 PHE A HE1    1 
ATOM   5477  H HE2    . PHE A 1 331 ? 188.377 3.328   168.362 1.00 50.46  ? 331 PHE A HE2    1 
ATOM   5478  H HZ     . PHE A 1 331 ? 186.219 3.766   167.656 1.00 53.00  ? 331 PHE A HZ     1 
ATOM   5479  N N      . GLU A 1 332 ? 189.517 10.354  171.076 1.00 39.55  ? 332 GLU A N      1 
ATOM   5480  C CA     . GLU A 1 332 ? 190.001 11.239  172.122 1.00 40.02  ? 332 GLU A CA     1 
ATOM   5481  C C      . GLU A 1 332 ? 188.906 11.390  173.161 1.00 42.50  ? 332 GLU A C      1 
ATOM   5482  O O      . GLU A 1 332 ? 187.748 11.623  172.810 1.00 42.13  ? 332 GLU A O      1 
ATOM   5483  C CB     . GLU A 1 332 ? 190.387 12.597  171.563 1.00 43.32  ? 332 GLU A CB     1 
ATOM   5484  C CG     . GLU A 1 332 ? 190.978 13.515  172.627 1.00 49.08  ? 332 GLU A CG     1 
ATOM   5485  C CD     . GLU A 1 332 ? 191.464 14.852  172.082 1.00 51.08  ? 332 GLU A CD     1 
ATOM   5486  O OE1    . GLU A 1 332 ? 190.815 15.409  171.170 1.00 56.83  ? 332 GLU A OE1    1 
ATOM   5487  O OE2    . GLU A 1 332 ? 192.502 15.344  172.575 1.00 45.34  ? 332 GLU A OE2    1 
ATOM   5488  H H      . GLU A 1 332 ? 188.791 10.618  170.699 1.00 47.46  ? 332 GLU A H      1 
ATOM   5489  H HA     . GLU A 1 332 ? 190.780 10.846  172.547 1.00 48.02  ? 332 GLU A HA     1 
ATOM   5490  H HB2    . GLU A 1 332 ? 191.051 12.477  170.867 1.00 51.98  ? 332 GLU A HB2    1 
ATOM   5491  H HB3    . GLU A 1 332 ? 189.597 13.027  171.200 1.00 51.98  ? 332 GLU A HB3    1 
ATOM   5492  H HG2    . GLU A 1 332 ? 190.300 13.696  173.296 1.00 58.90  ? 332 GLU A HG2    1 
ATOM   5493  H HG3    . GLU A 1 332 ? 191.735 13.069  173.039 1.00 58.90  ? 332 GLU A HG3    1 
ATOM   5494  N N      . CYS A 1 333 ? 189.270 11.248  174.435 1.00 43.23  ? 333 CYS A N      1 
ATOM   5495  C CA     . CYS A 1 333 ? 188.292 11.282  175.524 1.00 42.84  ? 333 CYS A CA     1 
ATOM   5496  C C      . CYS A 1 333 ? 188.698 12.204  176.662 1.00 42.33  ? 333 CYS A C      1 
ATOM   5497  O O      . CYS A 1 333 ? 189.875 12.308  177.004 1.00 41.94  ? 333 CYS A O      1 
ATOM   5498  C CB     . CYS A 1 333 ? 188.091 9.878   176.087 1.00 44.43  ? 333 CYS A CB     1 
ATOM   5499  S SG     . CYS A 1 333 ? 187.272 8.726   174.977 1.00 55.11  ? 333 CYS A SG     1 
ATOM   5500  H H      . CYS A 1 333 ? 190.080 11.129  174.697 1.00 51.88  ? 333 CYS A H      1 
ATOM   5501  H HA     . CYS A 1 333 ? 187.442 11.592  175.175 1.00 51.40  ? 333 CYS A HA     1 
ATOM   5502  H HB2    . CYS A 1 333 ? 188.960 9.506   176.306 1.00 53.31  ? 333 CYS A HB2    1 
ATOM   5503  H HB3    . CYS A 1 333 ? 187.553 9.943   176.891 1.00 53.31  ? 333 CYS A HB3    1 
ATOM   5504  H HG     . CYS A 1 333 ? 187.170 7.663   175.523 1.00 66.14  ? 333 CYS A HG     1 
ATOM   5505  N N      . GLN A 1 334 ? 187.706 12.847  177.271 1.00 41.13  ? 334 GLN A N      1 
ATOM   5506  C CA     . GLN A 1 334 ? 187.955 13.794  178.354 1.00 40.76  ? 334 GLN A CA     1 
ATOM   5507  C C      . GLN A 1 334 ? 188.226 13.112  179.708 1.00 41.71  ? 334 GLN A C      1 
ATOM   5508  O O      . GLN A 1 334 ? 188.772 13.727  180.619 1.00 42.19  ? 334 GLN A O      1 
ATOM   5509  C CB     . GLN A 1 334 ? 186.779 14.755  178.464 1.00 40.92  ? 334 GLN A CB     1 
ATOM   5510  C CG     . GLN A 1 334 ? 186.603 15.633  177.221 1.00 46.16  ? 334 GLN A CG     1 
ATOM   5511  C CD     . GLN A 1 334 ? 185.240 16.298  177.156 1.00 48.23  ? 334 GLN A CD     1 
ATOM   5512  O OE1    . GLN A 1 334 ? 184.238 15.638  176.895 1.00 52.73  ? 334 GLN A OE1    1 
ATOM   5513  N NE2    . GLN A 1 334 ? 185.196 17.605  177.399 1.00 42.67  ? 334 GLN A NE2    1 
ATOM   5514  H H      . GLN A 1 334 ? 186.874 12.752  177.074 1.00 49.36  ? 334 GLN A H      1 
ATOM   5515  H HA     . GLN A 1 334 ? 188.740 14.317  178.130 1.00 48.92  ? 334 GLN A HA     1 
ATOM   5516  H HB2    . GLN A 1 334 ? 185.964 14.243  178.586 1.00 49.11  ? 334 GLN A HB2    1 
ATOM   5517  H HB3    . GLN A 1 334 ? 186.920 15.340  179.225 1.00 49.11  ? 334 GLN A HB3    1 
ATOM   5518  H HG2    . GLN A 1 334 ? 187.277 16.331  177.229 1.00 55.39  ? 334 GLN A HG2    1 
ATOM   5519  H HG3    . GLN A 1 334 ? 186.706 15.082  176.429 1.00 55.39  ? 334 GLN A HG3    1 
ATOM   5520  H HE21   . GLN A 1 334 ? 185.919 18.033  177.582 1.00 51.20  ? 334 GLN A HE21   1 
ATOM   5521  H HE22   . GLN A 1 334 ? 184.444 18.022  177.373 1.00 51.20  ? 334 GLN A HE22   1 
ATOM   5522  N N      . ILE A 1 335 ? 187.859 11.842  179.831 1.00 40.85  ? 335 ILE A N      1 
ATOM   5523  C CA     . ILE A 1 335 ? 188.087 11.092  181.057 1.00 41.82  ? 335 ILE A CA     1 
ATOM   5524  C C      . ILE A 1 335 ? 189.145 10.025  180.832 1.00 41.27  ? 335 ILE A C      1 
ATOM   5525  O O      . ILE A 1 335 ? 188.895 9.050   180.129 1.00 47.06  ? 335 ILE A O      1 
ATOM   5526  C CB     . ILE A 1 335 ? 186.804 10.381  181.512 1.00 47.48  ? 335 ILE A CB     1 
ATOM   5527  C CG1    . ILE A 1 335 ? 185.628 11.369  181.582 1.00 47.68  ? 335 ILE A CG1    1 
ATOM   5528  C CG2    . ILE A 1 335 ? 187.022 9.675   182.841 1.00 49.16  ? 335 ILE A CG2    1 
ATOM   5529  C CD1    . ILE A 1 335 ? 185.821 12.511  182.536 1.00 44.01  ? 335 ILE A CD1    1 
ATOM   5530  H H      . ILE A 1 335 ? 187.474 11.387  179.211 1.00 49.02  ? 335 ILE A H      1 
ATOM   5531  H HA     . ILE A 1 335 ? 188.384 11.689  181.762 1.00 50.19  ? 335 ILE A HA     1 
ATOM   5532  H HB     . ILE A 1 335 ? 186.587 9.707   180.849 1.00 56.98  ? 335 ILE A HB     1 
ATOM   5533  H HG12   . ILE A 1 335 ? 185.488 11.745  180.699 1.00 57.21  ? 335 ILE A HG12   1 
ATOM   5534  H HG13   . ILE A 1 335 ? 184.834 10.886  181.860 1.00 57.21  ? 335 ILE A HG13   1 
ATOM   5535  H HG21   . ILE A 1 335 ? 186.198 9.236   183.104 1.00 58.99  ? 335 ILE A HG21   1 
ATOM   5536  H HG22   . ILE A 1 335 ? 187.729 9.019   182.738 1.00 58.99  ? 335 ILE A HG22   1 
ATOM   5537  H HG23   . ILE A 1 335 ? 187.275 10.332  183.509 1.00 58.99  ? 335 ILE A HG23   1 
ATOM   5538  H HD11   . ILE A 1 335 ? 185.034 13.078  182.513 1.00 52.81  ? 335 ILE A HD11   1 
ATOM   5539  H HD12   . ILE A 1 335 ? 185.948 12.157  183.430 1.00 52.81  ? 335 ILE A HD12   1 
ATOM   5540  H HD13   . ILE A 1 335 ? 186.603 13.018  182.267 1.00 52.81  ? 335 ILE A HD13   1 
ATOM   5541  N N      . LYS A 1 336 ? 190.325 10.226  181.416 1.00 37.20  ? 336 LYS A N      1 
ATOM   5542  C CA     . LYS A 1 336 ? 191.377 9.225   181.442 1.00 39.02  ? 336 LYS A CA     1 
ATOM   5543  C C      . LYS A 1 336 ? 191.083 8.110   182.445 1.00 46.60  ? 336 LYS A C      1 
ATOM   5544  O O      . LYS A 1 336 ? 191.541 6.973   182.277 1.00 52.97  ? 336 LYS A O      1 
ATOM   5545  C CB     . LYS A 1 336 ? 192.698 9.855   181.861 1.00 37.45  ? 336 LYS A CB     1 
ATOM   5546  C CG     . LYS A 1 336 ? 193.243 10.928  180.951 1.00 37.66  ? 336 LYS A CG     1 
ATOM   5547  C CD     . LYS A 1 336 ? 194.546 11.451  181.543 1.00 42.12  ? 336 LYS A CD     1 
ATOM   5548  C CE     . LYS A 1 336 ? 195.382 12.188  180.515 1.00 50.21  ? 336 LYS A CE     1 
ATOM   5549  N NZ     . LYS A 1 336 ? 196.747 12.506  181.015 1.00 55.14  ? 336 LYS A NZ     1 
ATOM   5550  H H      . LYS A 1 336 ? 190.540 10.957  181.814 1.00 44.63  ? 336 LYS A H      1 
ATOM   5551  H HA     . LYS A 1 336 ? 191.482 8.834   180.560 1.00 46.82  ? 336 LYS A HA     1 
ATOM   5552  H HB2    . LYS A 1 336 ? 192.579 10.254  182.738 1.00 44.94  ? 336 LYS A HB2    1 
ATOM   5553  H HB3    . LYS A 1 336 ? 193.366 9.155   181.914 1.00 44.94  ? 336 LYS A HB3    1 
ATOM   5554  H HG2    . LYS A 1 336 ? 193.425 10.555  180.075 1.00 45.19  ? 336 LYS A HG2    1 
ATOM   5555  H HG3    . LYS A 1 336 ? 192.611 11.661  180.890 1.00 45.19  ? 336 LYS A HG3    1 
ATOM   5556  H HD2    . LYS A 1 336 ? 194.343 12.066  182.265 1.00 50.55  ? 336 LYS A HD2    1 
ATOM   5557  H HD3    . LYS A 1 336 ? 195.067 10.704  181.877 1.00 50.55  ? 336 LYS A HD3    1 
ATOM   5558  H HE2    . LYS A 1 336 ? 195.473 11.633  179.724 1.00 60.25  ? 336 LYS A HE2    1 
ATOM   5559  H HE3    . LYS A 1 336 ? 194.943 13.022  180.288 1.00 60.25  ? 336 LYS A HE3    1 
ATOM   5560  H HZ1    . LYS A 1 336 ? 197.208 12.937  180.386 1.00 66.17  ? 336 LYS A HZ1    1 
ATOM   5561  H HZ2    . LYS A 1 336 ? 196.693 13.021  181.738 1.00 66.17  ? 336 LYS A HZ2    1 
ATOM   5562  H HZ3    . LYS A 1 336 ? 197.177 11.756  181.225 1.00 66.17  ? 336 LYS A HZ3    1 
ATOM   5563  N N      . GLU A 1 337 ? 190.349 8.448   183.501 1.00 43.74  ? 337 GLU A N      1 
ATOM   5564  C CA     . GLU A 1 337 ? 190.077 7.506   184.578 1.00 42.76  ? 337 GLU A CA     1 
ATOM   5565  C C      . GLU A 1 337 ? 188.760 7.801   185.294 1.00 39.70  ? 337 GLU A C      1 
ATOM   5566  O O      . GLU A 1 337 ? 188.464 8.945   185.620 1.00 45.83  ? 337 GLU A O      1 
ATOM   5567  C CB     . GLU A 1 337 ? 191.226 7.523   185.581 1.00 48.08  ? 337 GLU A CB     1 
ATOM   5568  C CG     . GLU A 1 337 ? 191.178 6.403   186.588 1.00 61.57  ? 337 GLU A CG     1 
ATOM   5569  C CD     . GLU A 1 337 ? 192.555 6.037   187.104 1.00 77.20  ? 337 GLU A CD     1 
ATOM   5570  O OE1    . GLU A 1 337 ? 193.353 6.966   187.374 1.00 76.62  ? 337 GLU A OE1    1 
ATOM   5571  O OE2    . GLU A 1 337 ? 192.843 4.819   187.219 1.00 88.15  ? 337 GLU A OE2    1 
ATOM   5572  H H      . GLU A 1 337 ? 189.995 9.223   183.617 1.00 52.48  ? 337 GLU A H      1 
ATOM   5573  H HA     . GLU A 1 337 ? 190.020 6.612   184.206 1.00 51.32  ? 337 GLU A HA     1 
ATOM   5574  H HB2    . GLU A 1 337 ? 192.064 7.450   185.097 1.00 57.70  ? 337 GLU A HB2    1 
ATOM   5575  H HB3    . GLU A 1 337 ? 191.202 8.361   186.069 1.00 57.70  ? 337 GLU A HB3    1 
ATOM   5576  H HG2    . GLU A 1 337 ? 190.636 6.679   187.344 1.00 73.89  ? 337 GLU A HG2    1 
ATOM   5577  H HG3    . GLU A 1 337 ? 190.793 5.617   186.171 1.00 73.89  ? 337 GLU A HG3    1 
ATOM   5578  N N      . ILE A 1 338 ? 187.975 6.757   185.532 1.00 34.62  ? 338 ILE A N      1 
ATOM   5579  C CA     . ILE A 1 338 ? 186.728 6.869   186.279 1.00 34.49  ? 338 ILE A CA     1 
ATOM   5580  C C      . ILE A 1 338 ? 186.769 5.944   187.500 1.00 39.11  ? 338 ILE A C      1 
ATOM   5581  O O      . ILE A 1 338 ? 187.526 4.965   187.534 1.00 34.36  ? 338 ILE A O      1 
ATOM   5582  C CB     . ILE A 1 338 ? 185.533 6.505   185.392 1.00 33.84  ? 338 ILE A CB     1 
ATOM   5583  C CG1    . ILE A 1 338 ? 184.225 6.925   186.045 1.00 31.63  ? 338 ILE A CG1    1 
ATOM   5584  C CG2    . ILE A 1 338 ? 185.543 4.999   185.039 1.00 31.29  ? 338 ILE A CG2    1 
ATOM   5585  C CD1    . ILE A 1 338 ? 183.063 6.912   185.073 1.00 30.21  ? 338 ILE A CD1    1 
ATOM   5586  H H      . ILE A 1 338 ? 188.147 5.957   185.266 1.00 41.55  ? 338 ILE A H      1 
ATOM   5587  H HA     . ILE A 1 338 ? 186.616 7.781   186.587 1.00 41.39  ? 338 ILE A HA     1 
ATOM   5588  H HB     . ILE A 1 338 ? 185.620 7.001   184.563 1.00 40.60  ? 338 ILE A HB     1 
ATOM   5589  H HG12   . ILE A 1 338 ? 184.020 6.312   186.768 1.00 37.96  ? 338 ILE A HG12   1 
ATOM   5590  H HG13   . ILE A 1 338 ? 184.319 7.827   186.390 1.00 37.96  ? 338 ILE A HG13   1 
ATOM   5591  H HG21   . ILE A 1 338 ? 184.776 4.801   184.478 1.00 37.55  ? 338 ILE A HG21   1 
ATOM   5592  H HG22   . ILE A 1 338 ? 186.363 4.792   184.563 1.00 37.55  ? 338 ILE A HG22   1 
ATOM   5593  H HG23   . ILE A 1 338 ? 185.496 4.483   185.858 1.00 37.55  ? 338 ILE A HG23   1 
ATOM   5594  H HD11   . ILE A 1 338 ? 182.258 7.187   185.540 1.00 36.25  ? 338 ILE A HD11   1 
ATOM   5595  H HD12   . ILE A 1 338 ? 183.252 7.528   184.347 1.00 36.25  ? 338 ILE A HD12   1 
ATOM   5596  H HD13   . ILE A 1 338 ? 182.953 6.014   184.725 1.00 36.25  ? 338 ILE A HD13   1 
ATOM   5597  N N      . SER A 1 339 ? 185.956 6.271   188.502 1.00 41.64  ? 339 SER A N      1 
ATOM   5598  C CA     . SER A 1 339 ? 185.948 5.536   189.760 1.00 40.37  ? 339 SER A CA     1 
ATOM   5599  C C      . SER A 1 339 ? 185.438 4.120   189.563 1.00 45.66  ? 339 SER A C      1 
ATOM   5600  O O      . SER A 1 339 ? 184.689 3.827   188.626 1.00 45.33  ? 339 SER A O      1 
ATOM   5601  C CB     . SER A 1 339 ? 185.066 6.243   190.780 1.00 39.26  ? 339 SER A CB     1 
ATOM   5602  O OG     . SER A 1 339 ? 183.744 6.371   190.286 1.00 39.33  ? 339 SER A OG     1 
ATOM   5603  H H      . SER A 1 339 ? 185.394 6.921   188.476 1.00 49.96  ? 339 SER A H      1 
ATOM   5604  H HA     . SER A 1 339 ? 186.851 5.490   190.113 1.00 48.44  ? 339 SER A HA     1 
ATOM   5605  H HB2    . SER A 1 339 ? 185.050 5.724   191.599 1.00 47.11  ? 339 SER A HB2    1 
ATOM   5606  H HB3    . SER A 1 339 ? 185.427 7.127   190.953 1.00 47.11  ? 339 SER A HB3    1 
ATOM   5607  H HG     . SER A 1 339 ? 183.421 5.611   190.130 1.00 47.20  ? 339 SER A HG     1 
ATOM   5608  N N      . ARG A 1 340 ? 185.849 3.242   190.464 1.00 47.42  ? 340 ARG A N      1 
ATOM   5609  C CA     . ARG A 1 340 ? 185.438 1.863   190.399 1.00 46.07  ? 340 ARG A CA     1 
ATOM   5610  C C      . ARG A 1 340 ? 183.952 1.775   190.751 1.00 44.43  ? 340 ARG A C      1 
ATOM   5611  O O      . ARG A 1 340 ? 183.200 1.057   190.084 1.00 47.60  ? 340 ARG A O      1 
ATOM   5612  C CB     . ARG A 1 340 ? 186.296 1.016   191.342 1.00 46.07  ? 340 ARG A CB     1 
ATOM   5613  C CG     . ARG A 1 340 ? 185.957 -0.456  191.352 1.00 46.21  ? 340 ARG A CG     1 
ATOM   5614  C CD     . ARG A 1 340 ? 186.245 -1.114  190.017 1.00 47.77  ? 340 ARG A CD     1 
ATOM   5615  N NE     . ARG A 1 340 ? 187.677 -1.267  189.764 1.00 50.01  ? 340 ARG A NE     1 
ATOM   5616  C CZ     . ARG A 1 340 ? 188.189 -1.825  188.670 1.00 49.71  ? 340 ARG A CZ     1 
ATOM   5617  N NH1    . ARG A 1 340 ? 187.395 -2.274  187.708 1.00 49.13  ? 340 ARG A NH1    1 
ATOM   5618  N NH2    . ARG A 1 340 ? 189.500 -1.933  188.531 1.00 51.87  ? 340 ARG A NH2    1 
ATOM   5619  H H      . ARG A 1 340 ? 186.369 3.426   191.124 1.00 56.91  ? 340 ARG A H      1 
ATOM   5620  H HA     . ARG A 1 340 ? 185.558 1.533   189.495 1.00 55.28  ? 340 ARG A HA     1 
ATOM   5621  H HB2    . ARG A 1 340 ? 187.225 1.101   191.076 1.00 55.29  ? 340 ARG A HB2    1 
ATOM   5622  H HB3    . ARG A 1 340 ? 186.183 1.349   192.246 1.00 55.29  ? 340 ARG A HB3    1 
ATOM   5623  H HG2    . ARG A 1 340 ? 186.489 -0.901  192.030 1.00 55.45  ? 340 ARG A HG2    1 
ATOM   5624  H HG3    . ARG A 1 340 ? 185.012 -0.563  191.544 1.00 55.45  ? 340 ARG A HG3    1 
ATOM   5625  H HD2    . ARG A 1 340 ? 185.842 -1.996  190.005 1.00 57.33  ? 340 ARG A HD2    1 
ATOM   5626  H HD3    . ARG A 1 340 ? 185.871 -0.569  189.307 1.00 57.33  ? 340 ARG A HD3    1 
ATOM   5627  H HE     . ARG A 1 340 ? 188.224 -0.977  190.361 1.00 60.01  ? 340 ARG A HE     1 
ATOM   5628  H HH11   . ARG A 1 340 ? 186.542 -2.211  187.791 1.00 58.96  ? 340 ARG A HH11   1 
ATOM   5629  H HH12   . ARG A 1 340 ? 187.734 -2.631  187.003 1.00 58.96  ? 340 ARG A HH12   1 
ATOM   5630  H HH21   . ARG A 1 340 ? 190.023 -1.641  189.148 1.00 62.24  ? 340 ARG A HH21   1 
ATOM   5631  H HH22   . ARG A 1 340 ? 189.830 -2.288  187.820 1.00 62.24  ? 340 ARG A HH22   1 
ATOM   5632  N N      . VAL A 1 341 ? 183.521 2.522   191.771 1.00 37.21  ? 341 VAL A N      1 
ATOM   5633  C CA     . VAL A 1 341 ? 182.113 2.487   192.181 1.00 40.71  ? 341 VAL A CA     1 
ATOM   5634  C C      . VAL A 1 341 ? 181.228 3.284   191.237 1.00 39.51  ? 341 VAL A C      1 
ATOM   5635  O O      . VAL A 1 341 ? 181.644 4.295   190.662 1.00 42.64  ? 341 VAL A O      1 
ATOM   5636  C CB     . VAL A 1 341 ? 181.863 3.006   193.619 1.00 49.42  ? 341 VAL A CB     1 
ATOM   5637  C CG1    . VAL A 1 341 ? 182.499 2.095   194.619 1.00 56.25  ? 341 VAL A CG1    1 
ATOM   5638  C CG2    . VAL A 1 341 ? 182.407 4.394   193.792 1.00 54.55  ? 341 VAL A CG2    1 
ATOM   5639  H H      . VAL A 1 341 ? 184.015 3.050   192.236 1.00 44.65  ? 341 VAL A H      1 
ATOM   5640  H HA     . VAL A 1 341 ? 181.811 1.565   192.151 1.00 48.85  ? 341 VAL A HA     1 
ATOM   5641  H HB     . VAL A 1 341 ? 180.909 3.029   193.791 1.00 59.30  ? 341 VAL A HB     1 
ATOM   5642  H HG11   . VAL A 1 341 ? 182.331 2.439   195.511 1.00 67.50  ? 341 VAL A HG11   1 
ATOM   5643  H HG12   . VAL A 1 341 ? 182.115 1.209   194.528 1.00 67.50  ? 341 VAL A HG12   1 
ATOM   5644  H HG13   . VAL A 1 341 ? 183.454 2.061   194.453 1.00 67.50  ? 341 VAL A HG13   1 
ATOM   5645  H HG21   . VAL A 1 341 ? 182.235 4.689   194.700 1.00 65.46  ? 341 VAL A HG21   1 
ATOM   5646  H HG22   . VAL A 1 341 ? 183.362 4.381   193.623 1.00 65.46  ? 341 VAL A HG22   1 
ATOM   5647  H HG23   . VAL A 1 341 ? 181.967 4.986   193.162 1.00 65.46  ? 341 VAL A HG23   1 
ATOM   5648  N N      . PHE A 1 342 ? 180.008 2.796   191.069 1.00 38.13  ? 342 PHE A N      1 
ATOM   5649  C CA     . PHE A 1 342 ? 178.966 3.528   190.374 1.00 40.07  ? 342 PHE A CA     1 
ATOM   5650  C C      . PHE A 1 342 ? 177.629 3.199   191.028 1.00 42.78  ? 342 PHE A C      1 
ATOM   5651  O O      . PHE A 1 342 ? 177.563 2.347   191.914 1.00 42.91  ? 342 PHE A O      1 
ATOM   5652  C CB     . PHE A 1 342 ? 178.960 3.181   188.884 1.00 41.43  ? 342 PHE A CB     1 
ATOM   5653  C CG     . PHE A 1 342 ? 178.340 1.857   188.560 1.00 41.84  ? 342 PHE A CG     1 
ATOM   5654  C CD1    . PHE A 1 342 ? 179.074 0.675   188.678 1.00 49.91  ? 342 PHE A CD1    1 
ATOM   5655  C CD2    . PHE A 1 342 ? 177.038 1.783   188.111 1.00 36.09  ? 342 PHE A CD2    1 
ATOM   5656  C CE1    . PHE A 1 342 ? 178.509 -0.556  188.364 1.00 44.58  ? 342 PHE A CE1    1 
ATOM   5657  C CE2    . PHE A 1 342 ? 176.470 0.555   187.792 1.00 39.42  ? 342 PHE A CE2    1 
ATOM   5658  C CZ     . PHE A 1 342 ? 177.209 -0.613  187.920 1.00 40.13  ? 342 PHE A CZ     1 
ATOM   5659  H H      . PHE A 1 342 ? 179.755 2.026   191.355 1.00 45.76  ? 342 PHE A H      1 
ATOM   5660  H HA     . PHE A 1 342 ? 179.125 4.480   190.466 1.00 48.09  ? 342 PHE A HA     1 
ATOM   5661  H HB2    . PHE A 1 342 ? 178.462 3.864   188.408 1.00 49.71  ? 342 PHE A HB2    1 
ATOM   5662  H HB3    . PHE A 1 342 ? 179.876 3.163   188.566 1.00 49.71  ? 342 PHE A HB3    1 
ATOM   5663  H HD1    . PHE A 1 342 ? 179.955 0.712   188.975 1.00 59.89  ? 342 PHE A HD1    1 
ATOM   5664  H HD2    . PHE A 1 342 ? 176.537 2.561   188.020 1.00 43.31  ? 342 PHE A HD2    1 
ATOM   5665  H HE1    . PHE A 1 342 ? 179.009 -1.335  188.451 1.00 53.50  ? 342 PHE A HE1    1 
ATOM   5666  H HE2    . PHE A 1 342 ? 175.589 0.516   187.495 1.00 47.30  ? 342 PHE A HE2    1 
ATOM   5667  H HZ     . PHE A 1 342 ? 176.824 -1.434  187.711 1.00 48.15  ? 342 PHE A HZ     1 
ATOM   5668  N N      . ARG A 1 343 ? 176.581 3.899   190.607 1.00 44.82  ? 343 ARG A N      1 
ATOM   5669  C CA     . ARG A 1 343 ? 175.233 3.693   191.130 1.00 45.00  ? 343 ARG A CA     1 
ATOM   5670  C C      . ARG A 1 343 ? 174.395 2.879   190.160 1.00 48.48  ? 343 ARG A C      1 
ATOM   5671  O O      . ARG A 1 343 ? 174.355 3.185   188.964 1.00 49.64  ? 343 ARG A O      1 
ATOM   5672  C CB     . ARG A 1 343 ? 174.546 5.036   191.329 1.00 44.65  ? 343 ARG A CB     1 
ATOM   5673  C CG     . ARG A 1 343 ? 174.899 5.705   192.610 1.00 49.77  ? 343 ARG A CG     1 
ATOM   5674  C CD     . ARG A 1 343 ? 174.439 7.147   192.628 1.00 52.30  ? 343 ARG A CD     1 
ATOM   5675  N NE     . ARG A 1 343 ? 173.024 7.266   192.289 1.00 54.46  ? 343 ARG A NE     1 
ATOM   5676  C CZ     . ARG A 1 343 ? 172.132 7.976   192.975 1.00 54.79  ? 343 ARG A CZ     1 
ATOM   5677  N NH1    . ARG A 1 343 ? 172.485 8.657   194.059 1.00 55.66  ? 343 ARG A NH1    1 
ATOM   5678  N NH2    . ARG A 1 343 ? 170.871 8.006   192.572 1.00 53.60  ? 343 ARG A NH2    1 
ATOM   5679  H H      . ARG A 1 343 ? 176.625 4.513   190.006 1.00 53.78  ? 343 ARG A H      1 
ATOM   5680  H HA     . ARG A 1 343 ? 175.273 3.228   191.980 1.00 54.00  ? 343 ARG A HA     1 
ATOM   5681  H HB2    . ARG A 1 343 ? 174.802 5.628   190.605 1.00 53.58  ? 343 ARG A HB2    1 
ATOM   5682  H HB3    . ARG A 1 343 ? 173.586 4.900   191.320 1.00 53.58  ? 343 ARG A HB3    1 
ATOM   5683  H HG2    . ARG A 1 343 ? 174.467 5.239   193.344 1.00 59.73  ? 343 ARG A HG2    1 
ATOM   5684  H HG3    . ARG A 1 343 ? 175.862 5.692   192.724 1.00 59.73  ? 343 ARG A HG3    1 
ATOM   5685  H HD2    . ARG A 1 343 ? 174.570 7.512   193.517 1.00 62.76  ? 343 ARG A HD2    1 
ATOM   5686  H HD3    . ARG A 1 343 ? 174.951 7.653   191.978 1.00 62.76  ? 343 ARG A HD3    1 
ATOM   5687  H HE     . ARG A 1 343 ? 172.745 6.845   191.592 1.00 65.35  ? 343 ARG A HE     1 
ATOM   5688  H HH11   . ARG A 1 343 ? 173.301 8.643   194.329 1.00 66.80  ? 343 ARG A HH11   1 
ATOM   5689  H HH12   . ARG A 1 343 ? 171.896 9.112   194.491 1.00 66.80  ? 343 ARG A HH12   1 
ATOM   5690  H HH21   . ARG A 1 343 ? 170.634 7.568   191.870 1.00 64.32  ? 343 ARG A HH21   1 
ATOM   5691  H HH22   . ARG A 1 343 ? 170.290 8.464   193.010 1.00 64.32  ? 343 ARG A HH22   1 
ATOM   5692  N N      . ARG A 1 344 ? 173.716 1.857   190.675 1.00 49.50  ? 344 ARG A N      1 
ATOM   5693  C CA     . ARG A 1 344 ? 172.732 1.128   189.885 1.00 54.35  ? 344 ARG A CA     1 
ATOM   5694  C C      . ARG A 1 344 ? 171.345 1.398   190.450 1.00 53.32  ? 344 ARG A C      1 
ATOM   5695  O O      . ARG A 1 344 ? 171.155 1.413   191.670 1.00 50.41  ? 344 ARG A O      1 
ATOM   5696  C CB     . ARG A 1 344 ? 173.018 -0.374  189.877 1.00 63.11  ? 344 ARG A CB     1 
ATOM   5697  C CG     . ARG A 1 344 ? 171.920 -1.180  189.194 1.00 74.70  ? 344 ARG A CG     1 
ATOM   5698  C CD     . ARG A 1 344 ? 172.434 -2.492  188.650 1.00 85.17  ? 344 ARG A CD     1 
ATOM   5699  N NE     . ARG A 1 344 ? 173.412 -2.292  187.587 1.00 91.20  ? 344 ARG A NE     1 
ATOM   5700  C CZ     . ARG A 1 344 ? 174.172 -3.257  187.084 1.00 96.63  ? 344 ARG A CZ     1 
ATOM   5701  N NH1    . ARG A 1 344 ? 174.070 -4.499  187.552 1.00 99.00  ? 344 ARG A NH1    1 
ATOM   5702  N NH2    . ARG A 1 344 ? 175.038 -2.981  186.119 1.00 97.78  ? 344 ARG A NH2    1 
ATOM   5703  H H      . ARG A 1 344 ? 173.808 1.567   191.479 1.00 59.40  ? 344 ARG A H      1 
ATOM   5704  H HA     . ARG A 1 344 ? 172.755 1.448   188.970 1.00 65.22  ? 344 ARG A HA     1 
ATOM   5705  H HB2    . ARG A 1 344 ? 173.848 -0.535  189.401 1.00 75.73  ? 344 ARG A HB2    1 
ATOM   5706  H HB3    . ARG A 1 344 ? 173.094 -0.686  190.792 1.00 75.73  ? 344 ARG A HB3    1 
ATOM   5707  H HG2    . ARG A 1 344 ? 171.220 -1.373  189.837 1.00 89.64  ? 344 ARG A HG2    1 
ATOM   5708  H HG3    . ARG A 1 344 ? 171.562 -0.666  188.454 1.00 89.64  ? 344 ARG A HG3    1 
ATOM   5709  H HD2    . ARG A 1 344 ? 172.861 -2.989  189.366 1.00 102.20 ? 344 ARG A HD2    1 
ATOM   5710  H HD3    . ARG A 1 344 ? 171.691 -3.000  188.288 1.00 102.20 ? 344 ARG A HD3    1 
ATOM   5711  H HE     . ARG A 1 344 ? 173.540 -1.490  187.304 1.00 109.44 ? 344 ARG A HE     1 
ATOM   5712  H HH11   . ARG A 1 344 ? 173.509 -4.677  188.179 1.00 118.80 ? 344 ARG A HH11   1 
ATOM   5713  H HH12   . ARG A 1 344 ? 174.563 -5.123  187.225 1.00 118.80 ? 344 ARG A HH12   1 
ATOM   5714  H HH21   . ARG A 1 344 ? 175.104 -2.178  185.817 1.00 117.34 ? 344 ARG A HH21   1 
ATOM   5715  H HH22   . ARG A 1 344 ? 175.531 -3.605  185.792 1.00 117.34 ? 344 ARG A HH22   1 
ATOM   5716  N N      . MET A 1 345 ? 170.382 1.606   189.554 1.00 55.77  ? 345 MET A N      1 
ATOM   5717  C CA     . MET A 1 345 ? 169.020 1.966   189.941 1.00 55.88  ? 345 MET A CA     1 
ATOM   5718  C C      . MET A 1 345 ? 168.169 0.747   190.309 1.00 56.50  ? 345 MET A C      1 
ATOM   5719  O O      . MET A 1 345 ? 167.923 -0.124  189.474 1.00 58.94  ? 345 MET A O      1 
ATOM   5720  C CB     . MET A 1 345 ? 168.354 2.723   188.799 1.00 55.43  ? 345 MET A CB     1 
ATOM   5721  C CG     . MET A 1 345 ? 167.014 3.333   189.153 1.00 59.07  ? 345 MET A CG     1 
ATOM   5722  S SD     . MET A 1 345 ? 166.116 3.876   187.690 1.00 65.69  ? 345 MET A SD     1 
ATOM   5723  C CE     . MET A 1 345 ? 167.275 5.070   187.023 1.00 82.34  ? 345 MET A CE     1 
ATOM   5724  H H      . MET A 1 345 ? 170.495 1.543   188.704 1.00 66.93  ? 345 MET A H      1 
ATOM   5725  H HA     . MET A 1 345 ? 169.060 2.560   190.706 1.00 67.06  ? 345 MET A HA     1 
ATOM   5726  H HB2    . MET A 1 345 ? 168.941 3.443   188.519 1.00 66.52  ? 345 MET A HB2    1 
ATOM   5727  H HB3    . MET A 1 345 ? 168.213 2.110   188.060 1.00 66.52  ? 345 MET A HB3    1 
ATOM   5728  H HG2    . MET A 1 345 ? 166.473 2.671   189.611 1.00 70.89  ? 345 MET A HG2    1 
ATOM   5729  H HG3    . MET A 1 345 ? 167.155 4.103   189.724 1.00 70.89  ? 345 MET A HG3    1 
ATOM   5730  H HE1    . MET A 1 345 ? 166.905 5.450   186.211 1.00 98.81  ? 345 MET A HE1    1 
ATOM   5731  H HE2    . MET A 1 345 ? 167.420 5.770   187.679 1.00 98.81  ? 345 MET A HE2    1 
ATOM   5732  H HE3    . MET A 1 345 ? 168.113 4.622   186.827 1.00 98.81  ? 345 MET A HE3    1 
ATOM   5733  N N      . GLY A 1 346 ? 167.713 0.708   191.560 1.00 52.09  ? 346 GLY A N      1 
ATOM   5734  C CA     . GLY A 1 346 ? 166.832 -0.347  192.034 1.00 50.62  ? 346 GLY A CA     1 
ATOM   5735  C C      . GLY A 1 346 ? 165.380 0.048   191.847 1.00 50.36  ? 346 GLY A C      1 
ATOM   5736  O O      . GLY A 1 346 ? 165.097 1.132   191.331 1.00 51.49  ? 346 GLY A O      1 
ATOM   5737  H H      . GLY A 1 346 ? 167.904 1.294   192.160 1.00 62.51  ? 346 GLY A H      1 
ATOM   5738  H HA2    . GLY A 1 346 ? 167.001 -1.164  191.539 1.00 60.75  ? 346 GLY A HA2    1 
ATOM   5739  H HA3    . GLY A 1 346 ? 166.993 -0.512  192.976 1.00 60.75  ? 346 GLY A HA3    1 
ATOM   5740  N N      . PRO A 1 347 ? 164.446 -0.825  192.258 1.00 49.91  ? 347 PRO A N      1 
ATOM   5741  C CA     . PRO A 1 347 ? 163.005 -0.565  192.099 1.00 54.60  ? 347 PRO A CA     1 
ATOM   5742  C C      . PRO A 1 347 ? 162.436 0.463   193.096 1.00 57.77  ? 347 PRO A C      1 
ATOM   5743  O O      . PRO A 1 347 ? 163.121 0.849   194.045 1.00 56.59  ? 347 PRO A O      1 
ATOM   5744  C CB     . PRO A 1 347 ? 162.375 -1.942  192.331 1.00 53.80  ? 347 PRO A CB     1 
ATOM   5745  C CG     . PRO A 1 347 ? 163.334 -2.642  193.257 1.00 52.89  ? 347 PRO A CG     1 
ATOM   5746  C CD     . PRO A 1 347 ? 164.712 -2.136  192.879 1.00 50.25  ? 347 PRO A CD     1 
ATOM   5747  H HA     . PRO A 1 347 ? 162.814 -0.274  191.193 1.00 65.52  ? 347 PRO A HA     1 
ATOM   5748  H HB2    . PRO A 1 347 ? 161.505 -1.839  192.748 1.00 64.56  ? 347 PRO A HB2    1 
ATOM   5749  H HB3    . PRO A 1 347 ? 162.301 -2.416  191.488 1.00 64.56  ? 347 PRO A HB3    1 
ATOM   5750  H HG2    . PRO A 1 347 ? 163.126 -2.411  194.176 1.00 63.47  ? 347 PRO A HG2    1 
ATOM   5751  H HG3    . PRO A 1 347 ? 163.274 -3.601  193.123 1.00 63.47  ? 347 PRO A HG3    1 
ATOM   5752  H HD2    . PRO A 1 347 ? 165.261 -2.028  193.672 1.00 60.31  ? 347 PRO A HD2    1 
ATOM   5753  H HD3    . PRO A 1 347 ? 165.128 -2.734  192.239 1.00 60.31  ? 347 PRO A HD3    1 
ATOM   5754  N N      . GLN A 1 348 ? 161.199 0.900   192.855 1.00 58.60  ? 348 GLN A N      1 
ATOM   5755  C CA     . GLN A 1 348 ? 160.468 1.769   193.777 1.00 55.25  ? 348 GLN A CA     1 
ATOM   5756  C C      . GLN A 1 348 ? 160.218 1.030   195.082 1.00 54.04  ? 348 GLN A C      1 
ATOM   5757  O O      . GLN A 1 348 ? 160.058 -0.190  195.082 1.00 51.88  ? 348 GLN A O      1 
ATOM   5758  C CB     . GLN A 1 348 ? 159.122 2.171   193.178 1.00 56.77  ? 348 GLN A CB     1 
ATOM   5759  C CG     . GLN A 1 348 ? 159.195 2.883   191.847 1.00 64.12  ? 348 GLN A CG     1 
ATOM   5760  C CD     . GLN A 1 348 ? 159.576 4.331   191.995 1.00 78.87  ? 348 GLN A CD     1 
ATOM   5761  O OE1    . GLN A 1 348 ? 160.183 4.726   192.989 1.00 88.12  ? 348 GLN A OE1    1 
ATOM   5762  N NE2    . GLN A 1 348 ? 159.210 5.140   191.012 1.00 82.51  ? 348 GLN A NE2    1 
ATOM   5763  H H      . GLN A 1 348 ? 160.752 0.702   192.147 1.00 70.33  ? 348 GLN A H      1 
ATOM   5764  H HA     . GLN A 1 348 ? 160.985 2.569   193.960 1.00 66.29  ? 348 GLN A HA     1 
ATOM   5765  H HB2    . GLN A 1 348 ? 158.590 1.369   193.052 1.00 68.12  ? 348 GLN A HB2    1 
ATOM   5766  H HB3    . GLN A 1 348 ? 158.673 2.763   193.801 1.00 68.12  ? 348 GLN A HB3    1 
ATOM   5767  H HG2    . GLN A 1 348 ? 159.862 2.450   191.292 1.00 76.94  ? 348 GLN A HG2    1 
ATOM   5768  H HG3    . GLN A 1 348 ? 158.326 2.842   191.417 1.00 76.94  ? 348 GLN A HG3    1 
ATOM   5769  H HE21   . GLN A 1 348 ? 158.777 4.829   190.337 1.00 99.01  ? 348 GLN A HE21   1 
ATOM   5770  H HE22   . GLN A 1 348 ? 159.404 5.977   191.050 1.00 99.01  ? 348 GLN A HE22   1 
ATOM   5771  N N      . PHE A 1 349 ? 160.148 1.773   196.186 1.00 55.61  ? 349 PHE A N      1 
ATOM   5772  C CA     . PHE A 1 349 ? 160.142 1.169   197.517 1.00 55.94  ? 349 PHE A CA     1 
ATOM   5773  C C      . PHE A 1 349 ? 158.898 0.329   197.798 1.00 58.26  ? 349 PHE A C      1 
ATOM   5774  O O      . PHE A 1 349 ? 158.972 -0.641  198.546 1.00 59.82  ? 349 PHE A O      1 
ATOM   5775  C CB     . PHE A 1 349 ? 160.325 2.232   198.612 1.00 56.34  ? 349 PHE A CB     1 
ATOM   5776  C CG     . PHE A 1 349 ? 159.042 2.924   199.032 1.00 58.13  ? 349 PHE A CG     1 
ATOM   5777  C CD1    . PHE A 1 349 ? 158.223 2.376   200.013 1.00 56.74  ? 349 PHE A CD1    1 
ATOM   5778  C CD2    . PHE A 1 349 ? 158.673 4.138   198.467 1.00 57.98  ? 349 PHE A CD2    1 
ATOM   5779  C CE1    . PHE A 1 349 ? 157.054 3.012   200.402 1.00 54.18  ? 349 PHE A CE1    1 
ATOM   5780  C CE2    . PHE A 1 349 ? 157.501 4.778   198.851 1.00 55.16  ? 349 PHE A CE2    1 
ATOM   5781  C CZ     . PHE A 1 349 ? 156.693 4.216   199.818 1.00 53.24  ? 349 PHE A CZ     1 
ATOM   5782  H H      . PHE A 1 349 ? 160.103 2.632   196.190 1.00 66.73  ? 349 PHE A H      1 
ATOM   5783  H HA     . PHE A 1 349 ? 160.904 0.571   197.575 1.00 67.12  ? 349 PHE A HA     1 
ATOM   5784  H HB2    . PHE A 1 349 ? 160.701 1.807   199.399 1.00 67.60  ? 349 PHE A HB2    1 
ATOM   5785  H HB3    . PHE A 1 349 ? 160.934 2.913   198.286 1.00 67.60  ? 349 PHE A HB3    1 
ATOM   5786  H HD1    . PHE A 1 349 ? 158.457 1.566   200.406 1.00 68.09  ? 349 PHE A HD1    1 
ATOM   5787  H HD2    . PHE A 1 349 ? 159.211 4.520   197.811 1.00 69.58  ? 349 PHE A HD2    1 
ATOM   5788  H HE1    . PHE A 1 349 ? 156.512 2.631   201.055 1.00 65.02  ? 349 PHE A HE1    1 
ATOM   5789  H HE2    . PHE A 1 349 ? 157.263 5.587   198.459 1.00 66.19  ? 349 PHE A HE2    1 
ATOM   5790  H HZ     . PHE A 1 349 ? 155.911 4.646   200.079 1.00 63.89  ? 349 PHE A HZ     1 
ATOM   5791  N N      . GLU A 1 350 ? 157.760 0.679   197.208 1.00 60.46  ? 350 GLU A N      1 
ATOM   5792  C CA     . GLU A 1 350 ? 156.531 -0.061  197.513 1.00 66.57  ? 350 GLU A CA     1 
ATOM   5793  C C      . GLU A 1 350 ? 156.414 -1.405  196.770 1.00 70.45  ? 350 GLU A C      1 
ATOM   5794  O O      . GLU A 1 350 ? 155.493 -2.175  197.024 1.00 74.31  ? 350 GLU A O      1 
ATOM   5795  C CB     . GLU A 1 350 ? 155.272 0.806   197.317 1.00 63.51  ? 350 GLU A CB     1 
ATOM   5796  C CG     . GLU A 1 350 ? 155.236 1.627   196.066 1.00 62.30  ? 350 GLU A CG     1 
ATOM   5797  C CD     . GLU A 1 350 ? 155.883 2.991   196.239 1.00 65.01  ? 350 GLU A CD     1 
ATOM   5798  O OE1    . GLU A 1 350 ? 157.093 3.092   195.972 1.00 69.67  ? 350 GLU A OE1    1 
ATOM   5799  O OE2    . GLU A 1 350 ? 155.193 3.962   196.630 1.00 62.60  ? 350 GLU A OE2    1 
ATOM   5800  H H      . GLU A 1 350 ? 157.668 1.322   196.644 1.00 72.55  ? 350 GLU A H      1 
ATOM   5801  H HA     . GLU A 1 350 ? 156.561 -0.281  198.458 1.00 79.88  ? 350 GLU A HA     1 
ATOM   5802  H HB2    . GLU A 1 350 ? 154.498 0.221   197.302 1.00 76.21  ? 350 GLU A HB2    1 
ATOM   5803  H HB3    . GLU A 1 350 ? 155.201 1.416   198.067 1.00 76.21  ? 350 GLU A HB3    1 
ATOM   5804  H HG2    . GLU A 1 350 ? 155.713 1.156   195.365 1.00 74.76  ? 350 GLU A HG2    1 
ATOM   5805  H HG3    . GLU A 1 350 ? 154.313 1.764   195.805 1.00 74.76  ? 350 GLU A HG3    1 
ATOM   5806  N N      . ASP A 1 351 ? 157.374 -1.696  195.897 1.00 69.70  ? 351 ASP A N      1 
ATOM   5807  C CA     . ASP A 1 351 ? 157.357 -2.914  195.087 1.00 71.44  ? 351 ASP A CA     1 
ATOM   5808  C C      . ASP A 1 351 ? 158.051 -4.074  195.816 1.00 67.73  ? 351 ASP A C      1 
ATOM   5809  O O      . ASP A 1 351 ? 159.151 -4.487  195.444 1.00 69.30  ? 351 ASP A O      1 
ATOM   5810  C CB     . ASP A 1 351 ? 158.046 -2.627  193.747 1.00 75.81  ? 351 ASP A CB     1 
ATOM   5811  C CG     . ASP A 1 351 ? 157.715 -3.652  192.677 1.00 80.52  ? 351 ASP A CG     1 
ATOM   5812  O OD1    . ASP A 1 351 ? 157.226 -4.752  193.014 1.00 85.34  ? 351 ASP A OD1    1 
ATOM   5813  O OD2    . ASP A 1 351 ? 157.950 -3.351  191.487 1.00 78.69  ? 351 ASP A OD2    1 
ATOM   5814  H H      . ASP A 1 351 ? 158.058 -1.195  195.752 1.00 83.63  ? 351 ASP A H      1 
ATOM   5815  H HA     . ASP A 1 351 ? 156.439 -3.170  194.910 1.00 85.73  ? 351 ASP A HA     1 
ATOM   5816  H HB2    . ASP A 1 351 ? 157.761 -1.757  193.426 1.00 90.97  ? 351 ASP A HB2    1 
ATOM   5817  H HB3    . ASP A 1 351 ? 159.007 -2.633  193.879 1.00 90.97  ? 351 ASP A HB3    1 
ATOM   5818  N N      . GLU A 1 352 ? 157.387 -4.611  196.837 1.00 63.88  ? 352 GLU A N      1 
ATOM   5819  C CA     . GLU A 1 352 ? 158.013 -5.549  197.772 1.00 66.07  ? 352 GLU A CA     1 
ATOM   5820  C C      . GLU A 1 352 ? 158.753 -6.716  197.112 1.00 69.72  ? 352 GLU A C      1 
ATOM   5821  O O      . GLU A 1 352 ? 159.840 -7.098  197.553 1.00 68.99  ? 352 GLU A O      1 
ATOM   5822  C CB     . GLU A 1 352 ? 156.981 -6.088  198.775 1.00 68.91  ? 352 GLU A CB     1 
ATOM   5823  C CG     . GLU A 1 352 ? 157.607 -6.914  199.893 1.00 79.13  ? 352 GLU A CG     1 
ATOM   5824  C CD     . GLU A 1 352 ? 156.644 -7.234  201.022 1.00 94.48  ? 352 GLU A CD     1 
ATOM   5825  O OE1    . GLU A 1 352 ? 157.064 -7.930  201.975 1.00 94.78  ? 352 GLU A OE1    1 
ATOM   5826  O OE2    . GLU A 1 352 ? 155.475 -6.790  200.963 1.00 105.24 ? 352 GLU A OE2    1 
ATOM   5827  H H      . GLU A 1 352 ? 156.562 -4.446  197.013 1.00 76.65  ? 352 GLU A H      1 
ATOM   5828  H HA     . GLU A 1 352 ? 158.672 -5.056  198.286 1.00 79.28  ? 352 GLU A HA     1 
ATOM   5829  H HB2    . GLU A 1 352 ? 156.516 -5.339  199.180 1.00 82.69  ? 352 GLU A HB2    1 
ATOM   5830  H HB3    . GLU A 1 352 ? 156.349 -6.653  198.303 1.00 82.69  ? 352 GLU A HB3    1 
ATOM   5831  H HG2    . GLU A 1 352 ? 157.922 -7.754  199.524 1.00 94.96  ? 352 GLU A HG2    1 
ATOM   5832  H HG3    . GLU A 1 352 ? 158.352 -6.419  200.269 1.00 94.96  ? 352 GLU A HG3    1 
ATOM   5833  N N      . ARG A 1 353 ? 158.180 -7.275  196.056 1.00 75.46  ? 353 ARG A N      1 
ATOM   5834  C CA     . ARG A 1 353 ? 158.769 -8.455  195.445 1.00 82.56  ? 353 ARG A CA     1 
ATOM   5835  C C      . ARG A 1 353 ? 160.103 -8.100  194.801 1.00 72.03  ? 353 ARG A C      1 
ATOM   5836  O O      . ARG A 1 353 ? 161.129 -8.707  195.100 1.00 70.77  ? 353 ARG A O      1 
ATOM   5837  C CB     . ARG A 1 353 ? 157.809 -9.063  194.423 1.00 99.88  ? 353 ARG A CB     1 
ATOM   5838  C CG     . ARG A 1 353 ? 156.368 -9.124  194.913 1.00 113.96 ? 353 ARG A CG     1 
ATOM   5839  C CD     . ARG A 1 353 ? 155.629 -10.333 194.372 1.00 124.79 ? 353 ARG A CD     1 
ATOM   5840  N NE     . ARG A 1 353 ? 155.979 -11.547 195.103 1.00 133.55 ? 353 ARG A NE     1 
ATOM   5841  C CZ     . ARG A 1 353 ? 155.479 -11.880 196.291 1.00 140.64 ? 353 ARG A CZ     1 
ATOM   5842  N NH1    . ARG A 1 353 ? 154.603 -11.087 196.897 1.00 143.58 ? 353 ARG A NH1    1 
ATOM   5843  N NH2    . ARG A 1 353 ? 155.858 -13.009 196.880 1.00 142.67 ? 353 ARG A NH2    1 
ATOM   5844  H H      . ARG A 1 353 ? 157.460 -6.996  195.679 1.00 90.55  ? 353 ARG A H      1 
ATOM   5845  H HA     . ARG A 1 353 ? 158.934 -9.119  196.133 1.00 99.07  ? 353 ARG A HA     1 
ATOM   5846  H HB2    . ARG A 1 353 ? 157.828 -8.525  193.616 1.00 119.85 ? 353 ARG A HB2    1 
ATOM   5847  H HB3    . ARG A 1 353 ? 158.095 -9.968  194.223 1.00 119.85 ? 353 ARG A HB3    1 
ATOM   5848  H HG2    . ARG A 1 353 ? 156.363 -9.175  195.881 1.00 136.75 ? 353 ARG A HG2    1 
ATOM   5849  H HG3    . ARG A 1 353 ? 155.898 -8.327  194.618 1.00 136.75 ? 353 ARG A HG3    1 
ATOM   5850  H HD2    . ARG A 1 353 ? 154.674 -10.190 194.461 1.00 149.74 ? 353 ARG A HD2    1 
ATOM   5851  H HD3    . ARG A 1 353 ? 155.864 -10.462 193.440 1.00 149.74 ? 353 ARG A HD3    1 
ATOM   5852  H HE     . ARG A 1 353 ? 156.546 -12.084 194.742 1.00 160.26 ? 353 ARG A HE     1 
ATOM   5853  H HH11   . ARG A 1 353 ? 154.354 -10.355 196.521 1.00 172.29 ? 353 ARG A HH11   1 
ATOM   5854  H HH12   . ARG A 1 353 ? 154.284 -11.307 197.665 1.00 172.29 ? 353 ARG A HH12   1 
ATOM   5855  H HH21   . ARG A 1 353 ? 156.426 -13.526 196.493 1.00 171.21 ? 353 ARG A HH21   1 
ATOM   5856  H HH22   . ARG A 1 353 ? 155.535 -13.223 197.648 1.00 171.21 ? 353 ARG A HH22   1 
ATOM   5857  N N      . ASN A 1 354 ? 160.089 -7.100  193.932 1.00 66.64  ? 354 ASN A N      1 
ATOM   5858  C CA     . ASN A 1 354 ? 161.300 -6.666  193.248 1.00 66.10  ? 354 ASN A CA     1 
ATOM   5859  C C      . ASN A 1 354 ? 162.370 -6.107  194.186 1.00 63.38  ? 354 ASN A C      1 
ATOM   5860  O O      . ASN A 1 354 ? 163.564 -6.270  193.935 1.00 63.07  ? 354 ASN A O      1 
ATOM   5861  C CB     . ASN A 1 354 ? 160.952 -5.615  192.198 1.00 67.92  ? 354 ASN A CB     1 
ATOM   5862  C CG     . ASN A 1 354 ? 160.329 -6.219  190.965 1.00 71.20  ? 354 ASN A CG     1 
ATOM   5863  O OD1    . ASN A 1 354 ? 160.862 -7.164  190.391 1.00 71.21  ? 354 ASN A OD1    1 
ATOM   5864  N ND2    . ASN A 1 354 ? 159.191 -5.684  190.553 1.00 74.89  ? 354 ASN A ND2    1 
ATOM   5865  H H      . ASN A 1 354 ? 159.386 -6.653  193.718 1.00 79.97  ? 354 ASN A H      1 
ATOM   5866  H HA     . ASN A 1 354 ? 161.684 -7.428  192.786 1.00 79.32  ? 354 ASN A HA     1 
ATOM   5867  H HB2    . ASN A 1 354 ? 160.319 -4.985  192.577 1.00 81.51  ? 354 ASN A HB2    1 
ATOM   5868  H HB3    . ASN A 1 354 ? 161.762 -5.153  191.931 1.00 81.51  ? 354 ASN A HB3    1 
ATOM   5869  H HD21   . ASN A 1 354 ? 158.797 -5.994  189.854 1.00 89.86  ? 354 ASN A HD21   1 
ATOM   5870  H HD22   . ASN A 1 354 ? 158.844 -5.025  190.985 1.00 89.86  ? 354 ASN A HD22   1 
ATOM   5871  N N      . VAL A 1 355 ? 161.945 -5.438  195.255 1.00 60.51  ? 355 VAL A N      1 
ATOM   5872  C CA     . VAL A 1 355 ? 162.891 -4.881  196.213 1.00 58.05  ? 355 VAL A CA     1 
ATOM   5873  C C      . VAL A 1 355 ? 163.678 -6.011  196.849 1.00 57.23  ? 355 VAL A C      1 
ATOM   5874  O O      . VAL A 1 355 ? 164.883 -5.905  197.035 1.00 57.55  ? 355 VAL A O      1 
ATOM   5875  C CB     . VAL A 1 355 ? 162.192 -4.032  197.319 1.00 45.80  ? 355 VAL A CB     1 
ATOM   5876  C CG1    . VAL A 1 355 ? 163.161 -3.711  198.463 1.00 42.72  ? 355 VAL A CG1    1 
ATOM   5877  C CG2    . VAL A 1 355 ? 161.634 -2.737  196.736 1.00 43.95  ? 355 VAL A CG2    1 
ATOM   5878  H H      . VAL A 1 355 ? 161.119 -5.295  195.446 1.00 72.61  ? 355 VAL A H      1 
ATOM   5879  H HA     . VAL A 1 355 ? 163.516 -4.307  195.743 1.00 69.66  ? 355 VAL A HA     1 
ATOM   5880  H HB     . VAL A 1 355 ? 161.451 -4.540  197.686 1.00 54.96  ? 355 VAL A HB     1 
ATOM   5881  H HG11   . VAL A 1 355 ? 162.696 -3.183  199.132 1.00 51.26  ? 355 VAL A HG11   1 
ATOM   5882  H HG12   . VAL A 1 355 ? 163.473 -4.541  198.855 1.00 51.26  ? 355 VAL A HG12   1 
ATOM   5883  H HG13   . VAL A 1 355 ? 163.912 -3.209  198.109 1.00 51.26  ? 355 VAL A HG13   1 
ATOM   5884  H HG21   . VAL A 1 355 ? 161.207 -2.231  197.445 1.00 52.74  ? 355 VAL A HG21   1 
ATOM   5885  H HG22   . VAL A 1 355 ? 162.364 -2.223  196.356 1.00 52.74  ? 355 VAL A HG22   1 
ATOM   5886  H HG23   . VAL A 1 355 ? 160.987 -2.954  196.047 1.00 52.74  ? 355 VAL A HG23   1 
ATOM   5887  N N      . LYS A 1 356 ? 162.986 -7.090  197.188 1.00 60.30  ? 356 LYS A N      1 
ATOM   5888  C CA     . LYS A 1 356 ? 163.622 -8.229  197.834 1.00 64.47  ? 356 LYS A CA     1 
ATOM   5889  C C      . LYS A 1 356 ? 164.645 -8.874  196.912 1.00 65.29  ? 356 LYS A C      1 
ATOM   5890  O O      . LYS A 1 356 ? 165.718 -9.275  197.358 1.00 70.77  ? 356 LYS A O      1 
ATOM   5891  C CB     . LYS A 1 356 ? 162.575 -9.260  198.254 1.00 69.37  ? 356 LYS A CB     1 
ATOM   5892  C CG     . LYS A 1 356 ? 163.058 -10.226 199.319 1.00 76.09  ? 356 LYS A CG     1 
ATOM   5893  C CD     . LYS A 1 356 ? 161.902 -10.892 200.029 1.00 87.14  ? 356 LYS A CD     1 
ATOM   5894  C CE     . LYS A 1 356 ? 162.312 -11.377 201.414 1.00 95.32  ? 356 LYS A CE     1 
ATOM   5895  N NZ     . LYS A 1 356 ? 162.589 -10.254 202.358 1.00 95.10  ? 356 LYS A NZ     1 
ATOM   5896  H H      . LYS A 1 356 ? 162.142 -7.188  197.055 1.00 72.36  ? 356 LYS A H      1 
ATOM   5897  H HA     . LYS A 1 356 ? 164.084 -7.925  198.631 1.00 77.36  ? 356 LYS A HA     1 
ATOM   5898  H HB2    . LYS A 1 356 ? 161.801 -8.794  198.607 1.00 83.24  ? 356 LYS A HB2    1 
ATOM   5899  H HB3    . LYS A 1 356 ? 162.319 -9.780  197.477 1.00 83.24  ? 356 LYS A HB3    1 
ATOM   5900  H HG2    . LYS A 1 356 ? 163.598 -10.917 198.904 1.00 91.31  ? 356 LYS A HG2    1 
ATOM   5901  H HG3    . LYS A 1 356 ? 163.580 -9.742  199.977 1.00 91.31  ? 356 LYS A HG3    1 
ATOM   5902  H HD2    . LYS A 1 356 ? 161.178 -10.254 200.131 1.00 104.56 ? 356 LYS A HD2    1 
ATOM   5903  H HD3    . LYS A 1 356 ? 161.606 -11.658 199.512 1.00 104.56 ? 356 LYS A HD3    1 
ATOM   5904  H HE2    . LYS A 1 356 ? 161.594 -11.913 201.787 1.00 114.38 ? 356 LYS A HE2    1 
ATOM   5905  H HE3    . LYS A 1 356 ? 163.119 -11.910 201.336 1.00 114.38 ? 356 LYS A HE3    1 
ATOM   5906  H HZ1    . LYS A 1 356 ? 162.825 -10.577 203.154 1.00 114.12 ? 356 LYS A HZ1    1 
ATOM   5907  H HZ2    . LYS A 1 356 ? 163.251 -9.749  202.043 1.00 114.12 ? 356 LYS A HZ2    1 
ATOM   5908  H HZ3    . LYS A 1 356 ? 161.862 -9.751  202.454 1.00 114.12 ? 356 LYS A HZ3    1 
ATOM   5909  N N      . LYS A 1 357 ? 164.319 -8.969  195.628 1.00 61.65  ? 357 LYS A N      1 
ATOM   5910  C CA     . LYS A 1 357 ? 165.253 -9.527  194.659 1.00 66.57  ? 357 LYS A CA     1 
ATOM   5911  C C      . LYS A 1 357 ? 166.462 -8.619  194.491 1.00 66.56  ? 357 LYS A C      1 
ATOM   5912  O O      . LYS A 1 357 ? 167.598 -9.088  194.437 1.00 66.32  ? 357 LYS A O      1 
ATOM   5913  C CB     . LYS A 1 357 ? 164.564 -9.752  193.316 1.00 75.24  ? 357 LYS A CB     1 
ATOM   5914  C CG     . LYS A 1 357 ? 163.512 -10.861 193.362 1.00 84.53  ? 357 LYS A CG     1 
ATOM   5915  C CD     . LYS A 1 357 ? 162.713 -10.965 192.071 1.00 87.78  ? 357 LYS A CD     1 
ATOM   5916  C CE     . LYS A 1 357 ? 163.588 -11.358 190.892 1.00 88.90  ? 357 LYS A CE     1 
ATOM   5917  N NZ     . LYS A 1 357 ? 162.799 -11.483 189.636 1.00 90.38  ? 357 LYS A NZ     1 
ATOM   5918  H H      . LYS A 1 357 ? 163.567 -8.720  195.294 1.00 73.98  ? 357 LYS A H      1 
ATOM   5919  H HA     . LYS A 1 357 ? 165.567 -10.386 194.982 1.00 79.88  ? 357 LYS A HA     1 
ATOM   5920  H HB2    . LYS A 1 357 ? 164.122 -8.931  193.047 1.00 90.29  ? 357 LYS A HB2    1 
ATOM   5921  H HB3    . LYS A 1 357 ? 165.231 -9.999  192.657 1.00 90.29  ? 357 LYS A HB3    1 
ATOM   5922  H HG2    . LYS A 1 357 ? 163.956 -11.711 193.509 1.00 101.43 ? 357 LYS A HG2    1 
ATOM   5923  H HG3    . LYS A 1 357 ? 162.893 -10.680 194.085 1.00 101.43 ? 357 LYS A HG3    1 
ATOM   5924  H HD2    . LYS A 1 357 ? 162.024 -11.640 192.175 1.00 105.34 ? 357 LYS A HD2    1 
ATOM   5925  H HD3    . LYS A 1 357 ? 162.310 -10.104 191.875 1.00 105.34 ? 357 LYS A HD3    1 
ATOM   5926  H HE2    . LYS A 1 357 ? 164.267 -10.679 190.758 1.00 106.68 ? 357 LYS A HE2    1 
ATOM   5927  H HE3    . LYS A 1 357 ? 164.004 -12.215 191.076 1.00 106.68 ? 357 LYS A HE3    1 
ATOM   5928  H HZ1    . LYS A 1 357 ? 163.333 -11.713 188.963 1.00 108.45 ? 357 LYS A HZ1    1 
ATOM   5929  H HZ2    . LYS A 1 357 ? 162.170 -12.105 189.732 1.00 108.45 ? 357 LYS A HZ2    1 
ATOM   5930  H HZ3    . LYS A 1 357 ? 162.410 -10.706 189.443 1.00 108.45 ? 357 LYS A HZ3    1 
ATOM   5931  N N      . PHE A 1 358 ? 166.214 -7.314  194.429 1.00 67.06  ? 358 PHE A N      1 
ATOM   5932  C CA     . PHE A 1 358 ? 167.292 -6.338  194.282 1.00 63.15  ? 358 PHE A CA     1 
ATOM   5933  C C      . PHE A 1 358 ? 168.234 -6.318  195.481 1.00 60.84  ? 358 PHE A C      1 
ATOM   5934  O O      . PHE A 1 358 ? 169.439 -6.160  195.317 1.00 61.18  ? 358 PHE A O      1 
ATOM   5935  C CB     . PHE A 1 358 ? 166.719 -4.945  194.069 1.00 58.96  ? 358 PHE A CB     1 
ATOM   5936  C CG     . PHE A 1 358 ? 167.763 -3.894  193.834 1.00 55.16  ? 358 PHE A CG     1 
ATOM   5937  C CD1    . PHE A 1 358 ? 168.383 -3.782  192.606 1.00 54.73  ? 358 PHE A CD1    1 
ATOM   5938  C CD2    . PHE A 1 358 ? 168.120 -3.011  194.848 1.00 50.63  ? 358 PHE A CD2    1 
ATOM   5939  C CE1    . PHE A 1 358 ? 169.330 -2.817  192.392 1.00 55.54  ? 358 PHE A CE1    1 
ATOM   5940  C CE2    . PHE A 1 358 ? 169.066 -2.043  194.640 1.00 47.74  ? 358 PHE A CE2    1 
ATOM   5941  C CZ     . PHE A 1 358 ? 169.673 -1.941  193.420 1.00 52.40  ? 358 PHE A CZ     1 
ATOM   5942  H H      . PHE A 1 358 ? 165.429 -6.966  194.469 1.00 80.47  ? 358 PHE A H      1 
ATOM   5943  H HA     . PHE A 1 358 ? 167.815 -6.567  193.498 1.00 75.78  ? 358 PHE A HA     1 
ATOM   5944  H HB2    . PHE A 1 358 ? 166.136 -4.962  193.294 1.00 70.76  ? 358 PHE A HB2    1 
ATOM   5945  H HB3    . PHE A 1 358 ? 166.213 -4.691  194.856 1.00 70.76  ? 358 PHE A HB3    1 
ATOM   5946  H HD1    . PHE A 1 358 ? 168.153 -4.364  191.918 1.00 65.68  ? 358 PHE A HD1    1 
ATOM   5947  H HD2    . PHE A 1 358 ? 167.707 -3.076  195.679 1.00 60.76  ? 358 PHE A HD2    1 
ATOM   5948  H HE1    . PHE A 1 358 ? 169.745 -2.747  191.562 1.00 66.65  ? 358 PHE A HE1    1 
ATOM   5949  H HE2    . PHE A 1 358 ? 169.296 -1.459  195.327 1.00 57.28  ? 358 PHE A HE2    1 
ATOM   5950  H HZ     . PHE A 1 358 ? 170.319 -1.287  193.276 1.00 62.88  ? 358 PHE A HZ     1 
ATOM   5951  N N      . LEU A 1 359 ? 167.687 -6.479  196.681 1.00 59.30  ? 359 LEU A N      1 
ATOM   5952  C CA     . LEU A 1 359 ? 168.504 -6.510  197.888 1.00 58.89  ? 359 LEU A CA     1 
ATOM   5953  C C      . LEU A 1 359 ? 169.097 -7.882  198.199 1.00 66.84  ? 359 LEU A C      1 
ATOM   5954  O O      . LEU A 1 359 ? 169.887 -8.010  199.132 1.00 70.25  ? 359 LEU A O      1 
ATOM   5955  C CB     . LEU A 1 359 ? 167.692 -6.044  199.091 1.00 51.99  ? 359 LEU A CB     1 
ATOM   5956  C CG     . LEU A 1 359 ? 167.161 -4.618  199.042 1.00 49.36  ? 359 LEU A CG     1 
ATOM   5957  C CD1    . LEU A 1 359 ? 166.507 -4.284  200.365 1.00 47.72  ? 359 LEU A CD1    1 
ATOM   5958  C CD2    . LEU A 1 359 ? 168.264 -3.622  198.735 1.00 50.15  ? 359 LEU A CD2    1 
ATOM   5959  H H      . LEU A 1 359 ? 166.845 -6.573  196.824 1.00 71.16  ? 359 LEU A H      1 
ATOM   5960  H HA     . LEU A 1 359 ? 169.243 -5.892  197.776 1.00 70.67  ? 359 LEU A HA     1 
ATOM   5961  H HB2    . LEU A 1 359 ? 166.927 -6.633  199.187 1.00 62.39  ? 359 LEU A HB2    1 
ATOM   5962  H HB3    . LEU A 1 359 ? 168.252 -6.115  199.880 1.00 62.39  ? 359 LEU A HB3    1 
ATOM   5963  H HG     . LEU A 1 359 ? 166.488 -4.551  198.346 1.00 59.24  ? 359 LEU A HG     1 
ATOM   5964  H HD11   . LEU A 1 359 ? 166.170 -3.375  200.329 1.00 57.27  ? 359 LEU A HD11   1 
ATOM   5965  H HD12   . LEU A 1 359 ? 165.776 -4.903  200.521 1.00 57.27  ? 359 LEU A HD12   1 
ATOM   5966  H HD13   . LEU A 1 359 ? 167.166 -4.365  201.072 1.00 57.27  ? 359 LEU A HD13   1 
ATOM   5967  H HD21   . LEU A 1 359 ? 167.885 -2.729  198.713 1.00 60.18  ? 359 LEU A HD21   1 
ATOM   5968  H HD22   . LEU A 1 359 ? 168.940 -3.678  199.428 1.00 60.18  ? 359 LEU A HD22   1 
ATOM   5969  H HD23   . LEU A 1 359 ? 168.654 -3.839  197.874 1.00 60.18  ? 359 LEU A HD23   1 
ATOM   5970  N N      . SER A 1 360 ? 168.723 -8.906  197.434 1.00 68.02  ? 360 SER A N      1 
ATOM   5971  C CA     . SER A 1 360 ? 169.231 -10.257 197.690 1.00 65.71  ? 360 SER A CA     1 
ATOM   5972  C C      . SER A 1 360 ? 170.669 -10.436 197.189 1.00 58.14  ? 360 SER A C      1 
ATOM   5973  O O      . SER A 1 360 ? 171.379 -11.338 197.634 1.00 53.99  ? 360 SER A O      1 
ATOM   5974  C CB     . SER A 1 360 ? 168.333 -11.305 197.041 1.00 70.65  ? 360 SER A CB     1 
ATOM   5975  O OG     . SER A 1 360 ? 168.484 -11.291 195.633 1.00 75.80  ? 360 SER A OG     1 
ATOM   5976  H H      . SER A 1 360 ? 168.183 -8.849  196.767 1.00 81.62  ? 360 SER A H      1 
ATOM   5977  H HA     . SER A 1 360 ? 169.229 -10.415 198.647 1.00 78.85  ? 360 SER A HA     1 
ATOM   5978  H HB2    . SER A 1 360 ? 168.578 -12.182 197.377 1.00 84.78  ? 360 SER A HB2    1 
ATOM   5979  H HB3    . SER A 1 360 ? 167.409 -11.111 197.263 1.00 84.78  ? 360 SER A HB3    1 
ATOM   5980  H HG     . SER A 1 360 ? 168.276 -10.536 195.330 1.00 90.96  ? 360 SER A HG     1 
ATOM   5981  N N      . ARG A 1 361 ? 171.093 -9.582  196.261 1.00 56.03  ? 361 ARG A N      1 
ATOM   5982  C CA     . ARG A 1 361 ? 172.435 -9.679  195.698 1.00 62.12  ? 361 ARG A CA     1 
ATOM   5983  C C      . ARG A 1 361 ? 173.465 -9.321  196.758 1.00 72.98  ? 361 ARG A C      1 
ATOM   5984  O O      . ARG A 1 361 ? 173.173 -8.547  197.665 1.00 73.70  ? 361 ARG A O      1 
ATOM   5985  C CB     . ARG A 1 361 ? 172.569 -8.747  194.499 1.00 62.62  ? 361 ARG A CB     1 
ATOM   5986  C CG     . ARG A 1 361 ? 173.842 -8.922  193.689 1.00 71.12  ? 361 ARG A CG     1 
ATOM   5987  C CD     . ARG A 1 361 ? 173.844 -7.964  192.493 1.00 80.63  ? 361 ARG A CD     1 
ATOM   5988  N NE     . ARG A 1 361 ? 174.872 -8.283  191.504 1.00 87.18  ? 361 ARG A NE     1 
ATOM   5989  C CZ     . ARG A 1 361 ? 176.134 -7.868  191.566 1.00 89.21  ? 361 ARG A CZ     1 
ATOM   5990  N NH1    . ARG A 1 361 ? 176.541 -7.112  192.576 1.00 94.70  ? 361 ARG A NH1    1 
ATOM   5991  N NH2    . ARG A 1 361 ? 176.994 -8.212  190.617 1.00 85.39  ? 361 ARG A NH2    1 
ATOM   5992  H H      . ARG A 1 361 ? 170.622 -8.937  195.942 1.00 67.24  ? 361 ARG A H      1 
ATOM   5993  H HA     . ARG A 1 361 ? 172.598 -10.589 195.403 1.00 74.55  ? 361 ARG A HA     1 
ATOM   5994  H HB2    . ARG A 1 361 ? 171.820 -8.902  193.903 1.00 75.14  ? 361 ARG A HB2    1 
ATOM   5995  H HB3    . ARG A 1 361 ? 172.548 -7.831  194.816 1.00 75.14  ? 361 ARG A HB3    1 
ATOM   5996  H HG2    . ARG A 1 361 ? 174.611 -8.722  194.246 1.00 85.34  ? 361 ARG A HG2    1 
ATOM   5997  H HG3    . ARG A 1 361 ? 173.892 -9.832  193.356 1.00 85.34  ? 361 ARG A HG3    1 
ATOM   5998  H HD2    . ARG A 1 361 ? 172.981 -8.009  192.052 1.00 96.76  ? 361 ARG A HD2    1 
ATOM   5999  H HD3    . ARG A 1 361 ? 174.006 -7.062  192.811 1.00 96.76  ? 361 ARG A HD3    1 
ATOM   6000  H HE     . ARG A 1 361 ? 174.645 -8.774  190.835 1.00 104.61 ? 361 ARG A HE     1 
ATOM   6001  H HH11   . ARG A 1 361 ? 175.988 -6.886  193.194 1.00 113.63 ? 361 ARG A HH11   1 
ATOM   6002  H HH12   . ARG A 1 361 ? 177.358 -6.846  192.611 1.00 113.63 ? 361 ARG A HH12   1 
ATOM   6003  H HH21   . ARG A 1 361 ? 176.736 -8.703  189.960 1.00 102.46 ? 361 ARG A HH21   1 
ATOM   6004  H HH22   . ARG A 1 361 ? 177.810 -7.943  190.659 1.00 102.46 ? 361 ARG A HH22   1 
ATOM   6005  N N      . ASN A 1 362 ? 174.662 -9.891  196.655 1.00 84.37  ? 362 ASN A N      1 
ATOM   6006  C CA     . ASN A 1 362 ? 175.731 -9.575  197.601 1.00 90.41  ? 362 ASN A CA     1 
ATOM   6007  C C      . ASN A 1 362 ? 176.480 -8.357  197.087 1.00 79.82  ? 362 ASN A C      1 
ATOM   6008  O O      . ASN A 1 362 ? 176.751 -8.249  195.889 1.00 82.66  ? 362 ASN A O      1 
ATOM   6009  C CB     . ASN A 1 362 ? 176.709 -10.746 197.807 1.00 101.58 ? 362 ASN A CB     1 
ATOM   6010  C CG     . ASN A 1 362 ? 176.256 -12.029 197.126 1.00 108.78 ? 362 ASN A CG     1 
ATOM   6011  O OD1    . ASN A 1 362 ? 175.264 -12.640 197.525 1.00 116.01 ? 362 ASN A OD1    1 
ATOM   6012  N ND2    . ASN A 1 362 ? 176.987 -12.445 196.095 1.00 105.52 ? 362 ASN A ND2    1 
ATOM   6013  H H      . ASN A 1 362 ? 174.882 -10.461 196.050 1.00 101.24 ? 362 ASN A H      1 
ATOM   6014  H HA     . ASN A 1 362 ? 175.341 -9.351  198.461 1.00 108.49 ? 362 ASN A HA     1 
ATOM   6015  H HB2    . ASN A 1 362 ? 177.574 -10.503 197.440 1.00 121.90 ? 362 ASN A HB2    1 
ATOM   6016  H HB3    . ASN A 1 362 ? 176.792 -10.925 198.756 1.00 121.90 ? 362 ASN A HB3    1 
ATOM   6017  H HD21   . ASN A 1 362 ? 176.771 -13.165 195.677 1.00 126.63 ? 362 ASN A HD21   1 
ATOM   6018  H HD22   . ASN A 1 362 ? 177.676 -11.994 195.846 1.00 126.63 ? 362 ASN A HD22   1 
ATOM   6019  N N      . ARG A 1 363 ? 176.789 -7.432  197.990 1.00 63.22  ? 363 ARG A N      1 
ATOM   6020  C CA     . ARG A 1 363 ? 177.492 -6.211  197.621 1.00 52.16  ? 363 ARG A CA     1 
ATOM   6021  C C      . ARG A 1 363 ? 178.433 -5.805  198.748 1.00 52.30  ? 363 ARG A C      1 
ATOM   6022  O O      . ARG A 1 363 ? 178.218 -6.164  199.904 1.00 56.31  ? 363 ARG A O      1 
ATOM   6023  C CB     . ARG A 1 363 ? 176.489 -5.093  197.323 1.00 43.33  ? 363 ARG A CB     1 
ATOM   6024  C CG     . ARG A 1 363 ? 175.521 -5.424  196.195 1.00 44.64  ? 363 ARG A CG     1 
ATOM   6025  C CD     . ARG A 1 363 ? 174.639 -4.228  195.856 1.00 46.00  ? 363 ARG A CD     1 
ATOM   6026  N NE     . ARG A 1 363 ? 173.236 -4.592  195.627 1.00 47.20  ? 363 ARG A NE     1 
ATOM   6027  C CZ     . ARG A 1 363 ? 172.693 -4.771  194.432 1.00 50.55  ? 363 ARG A CZ     1 
ATOM   6028  N NH1    . ARG A 1 363 ? 173.429 -4.627  193.339 1.00 57.13  ? 363 ARG A NH1    1 
ATOM   6029  N NH2    . ARG A 1 363 ? 171.414 -5.094  194.328 1.00 49.77  ? 363 ARG A NH2    1 
ATOM   6030  H H      . ARG A 1 363 ? 176.601 -7.489  198.827 1.00 75.86  ? 363 ARG A H      1 
ATOM   6031  H HA     . ARG A 1 363 ? 178.020 -6.371  196.823 1.00 62.59  ? 363 ARG A HA     1 
ATOM   6032  H HB2    . ARG A 1 363 ? 175.966 -4.921  198.121 1.00 52.00  ? 363 ARG A HB2    1 
ATOM   6033  H HB3    . ARG A 1 363 ? 176.977 -4.294  197.070 1.00 52.00  ? 363 ARG A HB3    1 
ATOM   6034  H HG2    . ARG A 1 363 ? 176.024 -5.666  195.402 1.00 53.57  ? 363 ARG A HG2    1 
ATOM   6035  H HG3    . ARG A 1 363 ? 174.949 -6.158  196.468 1.00 53.57  ? 363 ARG A HG3    1 
ATOM   6036  H HD2    . ARG A 1 363 ? 174.667 -3.598  196.593 1.00 55.20  ? 363 ARG A HD2    1 
ATOM   6037  H HD3    . ARG A 1 363 ? 174.975 -3.808  195.049 1.00 55.20  ? 363 ARG A HD3    1 
ATOM   6038  H HE     . ARG A 1 363 ? 172.732 -4.696  196.315 1.00 56.64  ? 363 ARG A HE     1 
ATOM   6039  H HH11   . ARG A 1 363 ? 174.260 -4.415  193.404 1.00 68.55  ? 363 ARG A HH11   1 
ATOM   6040  H HH12   . ARG A 1 363 ? 173.075 -4.744  192.564 1.00 68.55  ? 363 ARG A HH12   1 
ATOM   6041  H HH21   . ARG A 1 363 ? 170.935 -5.189  195.036 1.00 59.72  ? 363 ARG A HH21   1 
ATOM   6042  H HH22   . ARG A 1 363 ? 171.062 -5.212  193.552 1.00 59.72  ? 363 ARG A HH22   1 
ATOM   6043  N N      . ALA A 1 364 ? 179.483 -5.065  198.414 1.00 48.63  ? 364 ALA A N      1 
ATOM   6044  C CA     . ALA A 1 364 ? 180.413 -4.596  199.429 1.00 44.40  ? 364 ALA A CA     1 
ATOM   6045  C C      . ALA A 1 364 ? 179.743 -3.576  200.349 1.00 47.67  ? 364 ALA A C      1 
ATOM   6046  O O      . ALA A 1 364 ? 179.936 -3.606  201.568 1.00 47.86  ? 364 ALA A O      1 
ATOM   6047  C CB     . ALA A 1 364 ? 181.650 -3.993  198.779 1.00 35.68  ? 364 ALA A CB     1 
ATOM   6048  H H      . ALA A 1 364 ? 179.677 -4.823  197.612 1.00 58.35  ? 364 ALA A H      1 
ATOM   6049  H HA     . ALA A 1 364 ? 180.696 -5.350  199.971 1.00 53.27  ? 364 ALA A HA     1 
ATOM   6050  H HB1    . ALA A 1 364 ? 182.254 -3.688  199.474 1.00 42.81  ? 364 ALA A HB1    1 
ATOM   6051  H HB2    . ALA A 1 364 ? 182.083 -4.670  198.237 1.00 42.81  ? 364 ALA A HB2    1 
ATOM   6052  H HB3    . ALA A 1 364 ? 181.380 -3.245  198.223 1.00 42.81  ? 364 ALA A HB3    1 
ATOM   6053  N N      . PHE A 1 365 ? 178.958 -2.674  199.764 1.00 46.60  ? 365 PHE A N      1 
ATOM   6054  C CA     . PHE A 1 365 ? 178.350 -1.572  200.515 1.00 46.56  ? 365 PHE A CA     1 
ATOM   6055  C C      . PHE A 1 365 ? 176.835 -1.687  200.562 1.00 46.75  ? 365 PHE A C      1 
ATOM   6056  O O      . PHE A 1 365 ? 176.234 -2.358  199.731 1.00 50.73  ? 365 PHE A O      1 
ATOM   6057  C CB     . PHE A 1 365 ? 178.741 -0.242  199.885 1.00 45.20  ? 365 PHE A CB     1 
ATOM   6058  C CG     . PHE A 1 365 ? 180.210 -0.030  199.827 1.00 44.47  ? 365 PHE A CG     1 
ATOM   6059  C CD1    . PHE A 1 365 ? 180.902 0.404   200.946 1.00 43.44  ? 365 PHE A CD1    1 
ATOM   6060  C CD2    . PHE A 1 365 ? 180.906 -0.272  198.663 1.00 41.91  ? 365 PHE A CD2    1 
ATOM   6061  C CE1    . PHE A 1 365 ? 182.257 0.591   200.894 1.00 40.77  ? 365 PHE A CE1    1 
ATOM   6062  C CE2    . PHE A 1 365 ? 182.254 -0.088  198.611 1.00 39.60  ? 365 PHE A CE2    1 
ATOM   6063  C CZ     . PHE A 1 365 ? 182.932 0.342   199.724 1.00 39.10  ? 365 PHE A CZ     1 
ATOM   6064  H H      . PHE A 1 365 ? 178.759 -2.677  198.927 1.00 55.92  ? 365 PHE A H      1 
ATOM   6065  H HA     . PHE A 1 365 ? 178.683 -1.586  201.425 1.00 55.87  ? 365 PHE A HA     1 
ATOM   6066  H HB2    . PHE A 1 365 ? 178.399 -0.211  198.978 1.00 54.24  ? 365 PHE A HB2    1 
ATOM   6067  H HB3    . PHE A 1 365 ? 178.355 0.479   200.408 1.00 54.24  ? 365 PHE A HB3    1 
ATOM   6068  H HD1    . PHE A 1 365 ? 180.444 0.569   201.738 1.00 52.12  ? 365 PHE A HD1    1 
ATOM   6069  H HD2    . PHE A 1 365 ? 180.451 -0.566  197.907 1.00 50.30  ? 365 PHE A HD2    1 
ATOM   6070  H HE1    . PHE A 1 365 ? 182.718 0.883   201.647 1.00 48.92  ? 365 PHE A HE1    1 
ATOM   6071  H HE2    . PHE A 1 365 ? 182.715 -0.252  197.820 1.00 47.53  ? 365 PHE A HE2    1 
ATOM   6072  H HZ     . PHE A 1 365 ? 183.852 0.471   199.684 1.00 46.92  ? 365 PHE A HZ     1 
ATOM   6073  N N      . ARG A 1 366 ? 176.222 -1.016  201.529 1.00 43.33  ? 366 ARG A N      1 
ATOM   6074  C CA     . ARG A 1 366 ? 174.790 -1.143  201.742 1.00 45.79  ? 366 ARG A CA     1 
ATOM   6075  C C      . ARG A 1 366 ? 174.004 -0.366  200.688 1.00 51.03  ? 366 ARG A C      1 
ATOM   6076  O O      . ARG A 1 366 ? 174.362 0.756   200.341 1.00 52.33  ? 366 ARG A O      1 
ATOM   6077  C CB     . ARG A 1 366 ? 174.416 -0.662  203.143 1.00 47.87  ? 366 ARG A CB     1 
ATOM   6078  C CG     . ARG A 1 366 ? 175.152 -1.413  204.248 1.00 59.26  ? 366 ARG A CG     1 
ATOM   6079  C CD     . ARG A 1 366 ? 174.877 -0.836  205.624 1.00 73.80  ? 366 ARG A CD     1 
ATOM   6080  N NE     . ARG A 1 366 ? 175.292 0.559   205.713 1.00 89.41  ? 366 ARG A NE     1 
ATOM   6081  C CZ     . ARG A 1 366 ? 175.389 1.248   206.846 1.00 102.59 ? 366 ARG A CZ     1 
ATOM   6082  N NH1    . ARG A 1 366 ? 175.110 0.671   208.010 1.00 107.31 ? 366 ARG A NH1    1 
ATOM   6083  N NH2    . ARG A 1 366 ? 175.773 2.520   206.815 1.00 105.66 ? 366 ARG A NH2    1 
ATOM   6084  H H      . ARG A 1 366 ? 176.614 -0.480  202.076 1.00 51.99  ? 366 ARG A H      1 
ATOM   6085  H HA     . ARG A 1 366 ? 174.542 -2.078  201.670 1.00 54.95  ? 366 ARG A HA     1 
ATOM   6086  H HB2    . ARG A 1 366 ? 174.637 0.280   203.223 1.00 57.44  ? 366 ARG A HB2    1 
ATOM   6087  H HB3    . ARG A 1 366 ? 173.464 -0.791  203.277 1.00 57.44  ? 366 ARG A HB3    1 
ATOM   6088  H HG2    . ARG A 1 366 ? 174.865 -2.339  204.247 1.00 71.11  ? 366 ARG A HG2    1 
ATOM   6089  H HG3    . ARG A 1 366 ? 176.107 -1.360  204.085 1.00 71.11  ? 366 ARG A HG3    1 
ATOM   6090  H HD2    . ARG A 1 366 ? 173.926 -0.882  205.806 1.00 88.56  ? 366 ARG A HD2    1 
ATOM   6091  H HD3    . ARG A 1 366 ? 175.371 -1.342  206.287 1.00 88.56  ? 366 ARG A HD3    1 
ATOM   6092  H HE     . ARG A 1 366 ? 175.487 0.966   204.980 1.00 107.30 ? 366 ARG A HE     1 
ATOM   6093  H HH11   . ARG A 1 366 ? 174.861 -0.152  208.033 1.00 128.77 ? 366 ARG A HH11   1 
ATOM   6094  H HH12   . ARG A 1 366 ? 175.176 1.121   208.740 1.00 128.77 ? 366 ARG A HH12   1 
ATOM   6095  H HH21   . ARG A 1 366 ? 175.956 2.896   206.063 1.00 126.79 ? 366 ARG A HH21   1 
ATOM   6096  H HH22   . ARG A 1 366 ? 175.840 2.967   207.546 1.00 126.79 ? 366 ARG A HH22   1 
ATOM   6097  N N      . PRO A 1 367 ? 172.939 -0.978  200.148 1.00 52.54  ? 367 PRO A N      1 
ATOM   6098  C CA     . PRO A 1 367 ? 172.002 -0.217  199.312 1.00 51.31  ? 367 PRO A CA     1 
ATOM   6099  C C      . PRO A 1 367 ? 171.372 0.911   200.097 1.00 48.74  ? 367 PRO A C      1 
ATOM   6100  O O      . PRO A 1 367 ? 171.427 0.887   201.322 1.00 53.17  ? 367 PRO A O      1 
ATOM   6101  C CB     . PRO A 1 367 ? 170.944 -1.255  198.955 1.00 51.59  ? 367 PRO A CB     1 
ATOM   6102  C CG     . PRO A 1 367 ? 171.696 -2.546  198.971 1.00 48.61  ? 367 PRO A CG     1 
ATOM   6103  C CD     . PRO A 1 367 ? 172.677 -2.427  200.085 1.00 45.67  ? 367 PRO A CD     1 
ATOM   6104  H HA     . PRO A 1 367 ? 172.432 0.121   198.511 1.00 61.57  ? 367 PRO A HA     1 
ATOM   6105  H HB2    . PRO A 1 367 ? 170.241 -1.254  199.624 1.00 61.91  ? 367 PRO A HB2    1 
ATOM   6106  H HB3    . PRO A 1 367 ? 170.586 -1.072  198.073 1.00 61.91  ? 367 PRO A HB3    1 
ATOM   6107  H HG2    . PRO A 1 367 ? 171.081 -3.278  199.135 1.00 58.34  ? 367 PRO A HG2    1 
ATOM   6108  H HG3    . PRO A 1 367 ? 172.153 -2.667  198.124 1.00 58.34  ? 367 PRO A HG3    1 
ATOM   6109  H HD2    . PRO A 1 367 ? 172.286 -2.737  200.916 1.00 54.80  ? 367 PRO A HD2    1 
ATOM   6110  H HD3    . PRO A 1 367 ? 173.491 -2.909  199.872 1.00 54.80  ? 367 PRO A HD3    1 
ATOM   6111  N N      . PHE A 1 368 ? 170.773 1.878   199.409 1.00 43.51  ? 368 PHE A N      1 
ATOM   6112  C CA     . PHE A 1 368 ? 170.165 3.011   200.084 1.00 39.99  ? 368 PHE A CA     1 
ATOM   6113  C C      . PHE A 1 368 ? 168.933 3.514   199.328 1.00 47.44  ? 368 PHE A C      1 
ATOM   6114  O O      . PHE A 1 368 ? 168.747 3.199   198.155 1.00 49.72  ? 368 PHE A O      1 
ATOM   6115  C CB     . PHE A 1 368 ? 171.198 4.132   200.234 1.00 37.39  ? 368 PHE A CB     1 
ATOM   6116  C CG     . PHE A 1 368 ? 171.718 4.655   198.926 1.00 41.61  ? 368 PHE A CG     1 
ATOM   6117  C CD1    . PHE A 1 368 ? 172.757 4.013   198.269 1.00 45.37  ? 368 PHE A CD1    1 
ATOM   6118  C CD2    . PHE A 1 368 ? 171.167 5.789   198.349 1.00 41.95  ? 368 PHE A CD2    1 
ATOM   6119  C CE1    . PHE A 1 368 ? 173.240 4.495   197.066 1.00 47.72  ? 368 PHE A CE1    1 
ATOM   6120  C CE2    . PHE A 1 368 ? 171.645 6.271   197.141 1.00 44.68  ? 368 PHE A CE2    1 
ATOM   6121  C CZ     . PHE A 1 368 ? 172.683 5.624   196.502 1.00 47.10  ? 368 PHE A CZ     1 
ATOM   6122  H H      . PHE A 1 368 ? 170.707 1.898   198.552 1.00 52.22  ? 368 PHE A H      1 
ATOM   6123  H HA     . PHE A 1 368 ? 169.884 2.739   200.971 1.00 47.99  ? 368 PHE A HA     1 
ATOM   6124  H HB2    . PHE A 1 368 ? 170.789 4.872   200.708 1.00 44.87  ? 368 PHE A HB2    1 
ATOM   6125  H HB3    . PHE A 1 368 ? 171.954 3.795   200.740 1.00 44.87  ? 368 PHE A HB3    1 
ATOM   6126  H HD1    . PHE A 1 368 ? 173.138 3.252   198.645 1.00 54.44  ? 368 PHE A HD1    1 
ATOM   6127  H HD2    . PHE A 1 368 ? 170.468 6.230   198.777 1.00 50.34  ? 368 PHE A HD2    1 
ATOM   6128  H HE1    . PHE A 1 368 ? 173.937 4.056   196.635 1.00 57.26  ? 368 PHE A HE1    1 
ATOM   6129  H HE2    . PHE A 1 368 ? 171.269 7.034   196.764 1.00 53.61  ? 368 PHE A HE2    1 
ATOM   6130  H HZ     . PHE A 1 368 ? 173.006 5.947   195.692 1.00 56.52  ? 368 PHE A HZ     1 
ATOM   6131  N N      . ILE A 1 369 ? 168.101 4.302   200.008 1.00 50.81  ? 369 ILE A N      1 
ATOM   6132  C CA     . ILE A 1 369 ? 166.898 4.869   199.405 1.00 49.85  ? 369 ILE A CA     1 
ATOM   6133  C C      . ILE A 1 369 ? 167.090 6.349   199.072 1.00 46.54  ? 369 ILE A C      1 
ATOM   6134  O O      . ILE A 1 369 ? 167.596 7.121   199.888 1.00 47.17  ? 369 ILE A O      1 
ATOM   6135  C CB     . ILE A 1 369 ? 165.685 4.739   200.349 1.00 52.62  ? 369 ILE A CB     1 
ATOM   6136  C CG1    . ILE A 1 369 ? 165.424 3.278   200.685 1.00 54.23  ? 369 ILE A CG1    1 
ATOM   6137  C CG2    . ILE A 1 369 ? 164.436 5.353   199.714 1.00 54.99  ? 369 ILE A CG2    1 
ATOM   6138  C CD1    . ILE A 1 369 ? 164.411 3.098   201.772 1.00 59.23  ? 369 ILE A CD1    1 
ATOM   6139  H H      . ILE A 1 369 ? 168.214 4.526   200.830 1.00 60.97  ? 369 ILE A H      1 
ATOM   6140  H HA     . ILE A 1 369 ? 166.696 4.395   198.583 1.00 59.82  ? 369 ILE A HA     1 
ATOM   6141  H HB     . ILE A 1 369 ? 165.881 5.215   201.171 1.00 63.14  ? 369 ILE A HB     1 
ATOM   6142  H HG12   . ILE A 1 369 ? 165.095 2.826   199.892 1.00 65.08  ? 369 ILE A HG12   1 
ATOM   6143  H HG13   . ILE A 1 369 ? 166.253 2.869   200.978 1.00 65.08  ? 369 ILE A HG13   1 
ATOM   6144  H HG21   . ILE A 1 369 ? 163.691 5.258   200.328 1.00 65.98  ? 369 ILE A HG21   1 
ATOM   6145  H HG22   . ILE A 1 369 ? 164.601 6.293   199.537 1.00 65.98  ? 369 ILE A HG22   1 
ATOM   6146  H HG23   . ILE A 1 369 ? 164.243 4.889   198.885 1.00 65.98  ? 369 ILE A HG23   1 
ATOM   6147  H HD11   . ILE A 1 369 ? 164.290 2.150   201.937 1.00 71.08  ? 369 ILE A HD11   1 
ATOM   6148  H HD12   . ILE A 1 369 ? 164.729 3.537   202.576 1.00 71.08  ? 369 ILE A HD12   1 
ATOM   6149  H HD13   . ILE A 1 369 ? 163.571 3.494   201.489 1.00 71.08  ? 369 ILE A HD13   1 
ATOM   6150  N N      . GLU A 1 370 ? 166.651 6.739   197.880 1.00 44.04  ? 370 GLU A N      1 
ATOM   6151  C CA     . GLU A 1 370 ? 166.738 8.116   197.425 1.00 43.94  ? 370 GLU A CA     1 
ATOM   6152  C C      . GLU A 1 370 ? 165.544 8.429   196.538 1.00 49.95  ? 370 GLU A C      1 
ATOM   6153  O O      . GLU A 1 370 ? 165.302 7.730   195.549 1.00 55.21  ? 370 GLU A O      1 
ATOM   6154  C CB     . GLU A 1 370 ? 168.018 8.310   196.630 1.00 44.03  ? 370 GLU A CB     1 
ATOM   6155  C CG     . GLU A 1 370 ? 168.249 9.721   196.144 1.00 46.49  ? 370 GLU A CG     1 
ATOM   6156  C CD     . GLU A 1 370 ? 169.472 9.811   195.271 1.00 49.55  ? 370 GLU A CD     1 
ATOM   6157  O OE1    . GLU A 1 370 ? 170.592 9.633   195.806 1.00 50.65  ? 370 GLU A OE1    1 
ATOM   6158  O OE2    . GLU A 1 370 ? 169.306 10.027  194.047 1.00 49.34  ? 370 GLU A OE2    1 
ATOM   6159  H H      . GLU A 1 370 ? 166.290 6.209   197.306 1.00 52.85  ? 370 GLU A H      1 
ATOM   6160  H HA     . GLU A 1 370 ? 166.740 8.720   198.184 1.00 52.73  ? 370 GLU A HA     1 
ATOM   6161  H HB2    . GLU A 1 370 ? 168.771 8.065   197.191 1.00 52.84  ? 370 GLU A HB2    1 
ATOM   6162  H HB3    . GLU A 1 370 ? 167.990 7.732   195.852 1.00 52.84  ? 370 GLU A HB3    1 
ATOM   6163  H HG2    . GLU A 1 370 ? 167.483 10.010  195.625 1.00 55.79  ? 370 GLU A HG2    1 
ATOM   6164  H HG3    . GLU A 1 370 ? 168.377 10.305  196.907 1.00 55.79  ? 370 GLU A HG3    1 
ATOM   6165  N N      . ASN A 1 371 ? 164.805 9.479   196.893 1.00 47.36  ? 371 ASN A N      1 
ATOM   6166  C CA     . ASN A 1 371 ? 163.602 9.864   196.159 1.00 49.08  ? 371 ASN A CA     1 
ATOM   6167  C C      . ASN A 1 371 ? 162.698 8.673   195.826 1.00 47.81  ? 371 ASN A C      1 
ATOM   6168  O O      . ASN A 1 371 ? 162.239 8.532   194.693 1.00 49.23  ? 371 ASN A O      1 
ATOM   6169  C CB     . ASN A 1 371 ? 163.973 10.607  194.875 1.00 58.06  ? 371 ASN A CB     1 
ATOM   6170  C CG     . ASN A 1 371 ? 164.870 11.804  195.133 1.00 73.24  ? 371 ASN A CG     1 
ATOM   6171  O OD1    . ASN A 1 371 ? 164.754 12.471  196.162 1.00 82.44  ? 371 ASN A OD1    1 
ATOM   6172  N ND2    . ASN A 1 371 ? 165.775 12.082  194.197 1.00 75.65  ? 371 ASN A ND2    1 
ATOM   6173  H H      . ASN A 1 371 ? 164.982 9.990   197.562 1.00 56.83  ? 371 ASN A H      1 
ATOM   6174  H HA     . ASN A 1 371 ? 163.088 10.473  196.711 1.00 58.90  ? 371 ASN A HA     1 
ATOM   6175  H HB2    . ASN A 1 371 ? 164.445 10.001  194.283 1.00 69.67  ? 371 ASN A HB2    1 
ATOM   6176  H HB3    . ASN A 1 371 ? 163.162 10.926  194.448 1.00 69.67  ? 371 ASN A HB3    1 
ATOM   6177  H HD21   . ASN A 1 371 ? 166.306 12.751  194.298 1.00 90.78  ? 371 ASN A HD21   1 
ATOM   6178  H HD22   . ASN A 1 371 ? 165.829 11.592  193.492 1.00 90.78  ? 371 ASN A HD22   1 
ATOM   6179  N N      . GLY A 1 372 ? 162.457 7.815   196.809 1.00 48.14  ? 372 GLY A N      1 
ATOM   6180  C CA     . GLY A 1 372 ? 161.490 6.743   196.662 1.00 53.34  ? 372 GLY A CA     1 
ATOM   6181  C C      . GLY A 1 372 ? 162.041 5.439   196.116 1.00 59.25  ? 372 GLY A C      1 
ATOM   6182  O O      . GLY A 1 372 ? 161.418 4.388   196.286 1.00 63.78  ? 372 GLY A O      1 
ATOM   6183  H H      . GLY A 1 372 ? 162.844 7.834   197.576 1.00 57.76  ? 372 GLY A H      1 
ATOM   6184  H HA2    . GLY A 1 372 ? 161.094 6.558   197.527 1.00 64.01  ? 372 GLY A HA2    1 
ATOM   6185  H HA3    . GLY A 1 372 ? 160.784 7.039   196.067 1.00 64.01  ? 372 GLY A HA3    1 
ATOM   6186  N N      . ARG A 1 373 ? 163.194 5.496   195.453 1.00 56.24  ? 373 ARG A N      1 
ATOM   6187  C CA     . ARG A 1 373 ? 163.776 4.308   194.834 1.00 53.31  ? 373 ARG A CA     1 
ATOM   6188  C C      . ARG A 1 373 ? 164.909 3.771   195.656 1.00 51.22  ? 373 ARG A C      1 
ATOM   6189  O O      . ARG A 1 373 ? 165.529 4.502   196.420 1.00 49.12  ? 373 ARG A O      1 
ATOM   6190  C CB     . ARG A 1 373 ? 164.353 4.626   193.466 1.00 53.67  ? 373 ARG A CB     1 
ATOM   6191  C CG     . ARG A 1 373 ? 163.385 4.539   192.340 1.00 55.59  ? 373 ARG A CG     1 
ATOM   6192  C CD     . ARG A 1 373 ? 164.122 4.751   191.049 1.00 56.20  ? 373 ARG A CD     1 
ATOM   6193  N NE     . ARG A 1 373 ? 163.204 5.104   189.979 1.00 56.51  ? 373 ARG A NE     1 
ATOM   6194  C CZ     . ARG A 1 373 ? 162.556 4.222   189.233 1.00 56.15  ? 373 ARG A CZ     1 
ATOM   6195  N NH1    . ARG A 1 373 ? 162.721 2.923   189.442 1.00 53.08  ? 373 ARG A NH1    1 
ATOM   6196  N NH2    . ARG A 1 373 ? 161.742 4.648   188.282 1.00 62.45  ? 373 ARG A NH2    1 
ATOM   6197  H H      . ARG A 1 373 ? 163.659 6.212   195.346 1.00 67.49  ? 373 ARG A H      1 
ATOM   6198  H HA     . ARG A 1 373 ? 163.100 3.619   194.739 1.00 63.97  ? 373 ARG A HA     1 
ATOM   6199  H HB2    . ARG A 1 373 ? 164.703 5.530   193.481 1.00 64.41  ? 373 ARG A HB2    1 
ATOM   6200  H HB3    . ARG A 1 373 ? 165.072 4.002   193.282 1.00 64.41  ? 373 ARG A HB3    1 
ATOM   6201  H HG2    . ARG A 1 373 ? 162.976 3.659   192.325 1.00 66.71  ? 373 ARG A HG2    1 
ATOM   6202  H HG3    . ARG A 1 373 ? 162.711 5.231   192.432 1.00 66.71  ? 373 ARG A HG3    1 
ATOM   6203  H HD2    . ARG A 1 373 ? 164.758 5.475   191.157 1.00 67.44  ? 373 ARG A HD2    1 
ATOM   6204  H HD3    . ARG A 1 373 ? 164.580 3.933   190.802 1.00 67.44  ? 373 ARG A HD3    1 
ATOM   6205  H HE     . ARG A 1 373 ? 163.091 5.938   189.804 1.00 67.81  ? 373 ARG A HE     1 
ATOM   6206  H HH11   . ARG A 1 373 ? 163.251 2.650   190.062 1.00 63.69  ? 373 ARG A HH11   1 
ATOM   6207  H HH12   . ARG A 1 373 ? 162.298 2.352   188.957 1.00 63.69  ? 373 ARG A HH12   1 
ATOM   6208  H HH21   . ARG A 1 373 ? 161.638 5.491   188.151 1.00 74.95  ? 373 ARG A HH21   1 
ATOM   6209  H HH22   . ARG A 1 373 ? 161.316 4.081   187.795 1.00 74.95  ? 373 ARG A HH22   1 
ATOM   6210  N N      . TRP A 1 374 ? 165.186 2.487   195.463 1.00 51.45  ? 374 TRP A N      1 
ATOM   6211  C CA     . TRP A 1 374 ? 166.384 1.868   195.995 1.00 48.49  ? 374 TRP A CA     1 
ATOM   6212  C C      . TRP A 1 374 ? 167.525 2.043   194.995 1.00 43.77  ? 374 TRP A C      1 
ATOM   6213  O O      . TRP A 1 374 ? 167.314 2.057   193.780 1.00 42.40  ? 374 TRP A O      1 
ATOM   6214  C CB     . TRP A 1 374 ? 166.141 0.386   196.268 1.00 50.72  ? 374 TRP A CB     1 
ATOM   6215  C CG     . TRP A 1 374 ? 165.418 0.112   197.558 1.00 52.48  ? 374 TRP A CG     1 
ATOM   6216  C CD1    . TRP A 1 374 ? 164.076 -0.073  197.727 1.00 50.48  ? 374 TRP A CD1    1 
ATOM   6217  C CD2    . TRP A 1 374 ? 166.007 -0.015  198.859 1.00 54.99  ? 374 TRP A CD2    1 
ATOM   6218  N NE1    . TRP A 1 374 ? 163.793 -0.307  199.054 1.00 51.22  ? 374 TRP A NE1    1 
ATOM   6219  C CE2    . TRP A 1 374 ? 164.959 -0.274  199.769 1.00 54.69  ? 374 TRP A CE2    1 
ATOM   6220  C CE3    . TRP A 1 374 ? 167.317 0.070   199.342 1.00 56.50  ? 374 TRP A CE3    1 
ATOM   6221  C CZ2    . TRP A 1 374 ? 165.180 -0.452  201.133 1.00 60.04  ? 374 TRP A CZ2    1 
ATOM   6222  C CZ3    . TRP A 1 374 ? 167.536 -0.103  200.700 1.00 59.02  ? 374 TRP A CZ3    1 
ATOM   6223  C CH2    . TRP A 1 374 ? 166.473 -0.364  201.579 1.00 61.64  ? 374 TRP A CH2    1 
ATOM   6224  H H      . TRP A 1 374 ? 164.685 1.947   195.019 1.00 61.74  ? 374 TRP A H      1 
ATOM   6225  H HA     . TRP A 1 374 ? 166.633 2.300   196.827 1.00 58.19  ? 374 TRP A HA     1 
ATOM   6226  H HB2    . TRP A 1 374 ? 165.606 0.020   195.546 1.00 60.86  ? 374 TRP A HB2    1 
ATOM   6227  H HB3    . TRP A 1 374 ? 166.997 -0.069  196.306 1.00 60.86  ? 374 TRP A HB3    1 
ATOM   6228  H HD1    . TRP A 1 374 ? 163.445 -0.049  197.044 1.00 60.58  ? 374 TRP A HD1    1 
ATOM   6229  H HE1    . TRP A 1 374 ? 163.010 -0.448  199.380 1.00 61.46  ? 374 TRP A HE1    1 
ATOM   6230  H HE3    . TRP A 1 374 ? 168.026 0.241   198.765 1.00 67.80  ? 374 TRP A HE3    1 
ATOM   6231  H HZ2    . TRP A 1 374 ? 164.478 -0.621  201.718 1.00 72.05  ? 374 TRP A HZ2    1 
ATOM   6232  H HZ3    . TRP A 1 374 ? 168.403 -0.052  201.034 1.00 70.83  ? 374 TRP A HZ3    1 
ATOM   6233  H HH2    . TRP A 1 374 ? 166.649 -0.477  202.485 1.00 73.97  ? 374 TRP A HH2    1 
ATOM   6234  N N      . TRP A 1 375 ? 168.727 2.210   195.522 1.00 42.06  ? 375 TRP A N      1 
ATOM   6235  C CA     . TRP A 1 375 ? 169.928 2.278   194.712 1.00 44.72  ? 375 TRP A CA     1 
ATOM   6236  C C      . TRP A 1 375 ? 170.948 1.398   195.376 1.00 44.99  ? 375 TRP A C      1 
ATOM   6237  O O      . TRP A 1 375 ? 170.846 1.094   196.564 1.00 47.88  ? 375 TRP A O      1 
ATOM   6238  C CB     . TRP A 1 375 ? 170.464 3.709   194.640 1.00 46.95  ? 375 TRP A CB     1 
ATOM   6239  C CG     . TRP A 1 375 ? 169.541 4.653   193.959 1.00 46.83  ? 375 TRP A CG     1 
ATOM   6240  C CD1    . TRP A 1 375 ? 168.459 5.273   194.507 1.00 47.54  ? 375 TRP A CD1    1 
ATOM   6241  C CD2    . TRP A 1 375 ? 169.611 5.092   192.597 1.00 44.29  ? 375 TRP A CD2    1 
ATOM   6242  N NE1    . TRP A 1 375 ? 167.847 6.069   193.573 1.00 48.49  ? 375 TRP A NE1    1 
ATOM   6243  C CE2    . TRP A 1 375 ? 168.533 5.979   192.390 1.00 45.79  ? 375 TRP A CE2    1 
ATOM   6244  C CE3    . TRP A 1 375 ? 170.479 4.822   191.535 1.00 41.59  ? 375 TRP A CE3    1 
ATOM   6245  C CZ2    . TRP A 1 375 ? 168.297 6.604   191.163 1.00 42.88  ? 375 TRP A CZ2    1 
ATOM   6246  C CZ3    . TRP A 1 375 ? 170.243 5.437   190.314 1.00 43.66  ? 375 TRP A CZ3    1 
ATOM   6247  C CH2    . TRP A 1 375 ? 169.159 6.321   190.138 1.00 42.77  ? 375 TRP A CH2    1 
ATOM   6248  H H      . TRP A 1 375 ? 168.876 2.288   196.366 1.00 50.48  ? 375 TRP A H      1 
ATOM   6249  H HA     . TRP A 1 375 ? 169.753 1.952   193.815 1.00 53.67  ? 375 TRP A HA     1 
ATOM   6250  H HB2    . TRP A 1 375 ? 170.611 4.034   195.542 1.00 56.34  ? 375 TRP A HB2    1 
ATOM   6251  H HB3    . TRP A 1 375 ? 171.301 3.706   194.150 1.00 56.34  ? 375 TRP A HB3    1 
ATOM   6252  H HD1    . TRP A 1 375 ? 168.174 5.169   195.386 1.00 57.05  ? 375 TRP A HD1    1 
ATOM   6253  H HE1    . TRP A 1 375 ? 167.147 6.550   193.709 1.00 58.19  ? 375 TRP A HE1    1 
ATOM   6254  H HE3    . TRP A 1 375 ? 171.196 4.240   191.643 1.00 49.90  ? 375 TRP A HE3    1 
ATOM   6255  H HZ2    . TRP A 1 375 ? 167.580 7.185   191.046 1.00 51.46  ? 375 TRP A HZ2    1 
ATOM   6256  H HZ3    . TRP A 1 375 ? 170.813 5.267   189.599 1.00 52.39  ? 375 TRP A HZ3    1 
ATOM   6257  H HH2    . TRP A 1 375 ? 169.026 6.720   189.308 1.00 51.33  ? 375 TRP A HH2    1 
ATOM   6258  N N      . ALA A 1 376 ? 171.945 0.990   194.614 1.00 44.06  ? 376 ALA A N      1 
ATOM   6259  C CA     . ALA A 1 376 ? 173.062 0.269   195.196 1.00 42.30  ? 376 ALA A CA     1 
ATOM   6260  C C      . ALA A 1 376 ? 174.355 0.669   194.507 1.00 43.61  ? 376 ALA A C      1 
ATOM   6261  O O      . ALA A 1 376 ? 174.369 0.952   193.307 1.00 43.49  ? 376 ALA A O      1 
ATOM   6262  C CB     . ALA A 1 376 ? 172.839 -1.201  195.083 1.00 36.10  ? 376 ALA A CB     1 
ATOM   6263  H H      . ALA A 1 376 ? 172.001 1.116   193.765 1.00 52.87  ? 376 ALA A H      1 
ATOM   6264  H HA     . ALA A 1 376 ? 173.135 0.495   196.137 1.00 50.76  ? 376 ALA A HA     1 
ATOM   6265  H HB1    . ALA A 1 376 ? 173.594 -1.666  195.476 1.00 43.32  ? 376 ALA A HB1    1 
ATOM   6266  H HB2    . ALA A 1 376 ? 172.024 -1.434  195.555 1.00 43.32  ? 376 ALA A HB2    1 
ATOM   6267  H HB3    . ALA A 1 376 ? 172.757 -1.436  194.145 1.00 43.32  ? 376 ALA A HB3    1 
ATOM   6268  N N      . PHE A 1 377 ? 175.427 0.720   195.289 1.00 44.03  ? 377 PHE A N      1 
ATOM   6269  C CA     . PHE A 1 377 ? 176.769 0.875   194.752 1.00 42.44  ? 377 PHE A CA     1 
ATOM   6270  C C      . PHE A 1 377 ? 177.289 -0.478  194.238 1.00 49.24  ? 377 PHE A C      1 
ATOM   6271  O O      . PHE A 1 377 ? 177.241 -1.493  194.950 1.00 47.96  ? 377 PHE A O      1 
ATOM   6272  C CB     . PHE A 1 377 ? 177.718 1.421   195.821 1.00 36.55  ? 377 PHE A CB     1 
ATOM   6273  C CG     . PHE A 1 377 ? 177.353 2.792   196.331 1.00 38.88  ? 377 PHE A CG     1 
ATOM   6274  C CD1    . PHE A 1 377 ? 177.323 3.884   195.483 1.00 39.84  ? 377 PHE A CD1    1 
ATOM   6275  C CD2    . PHE A 1 377 ? 177.081 2.997   197.673 1.00 42.08  ? 377 PHE A CD2    1 
ATOM   6276  C CE1    . PHE A 1 377 ? 177.009 5.152   195.965 1.00 39.79  ? 377 PHE A CE1    1 
ATOM   6277  C CE2    . PHE A 1 377 ? 176.768 4.261   198.156 1.00 42.51  ? 377 PHE A CE2    1 
ATOM   6278  C CZ     . PHE A 1 377 ? 176.730 5.334   197.300 1.00 40.22  ? 377 PHE A CZ     1 
ATOM   6279  H H      . PHE A 1 377 ? 175.400 0.666   196.147 1.00 52.83  ? 377 PHE A H      1 
ATOM   6280  H HA     . PHE A 1 377 ? 176.750 1.499   194.010 1.00 50.93  ? 377 PHE A HA     1 
ATOM   6281  H HB2    . PHE A 1 377 ? 177.717 0.815   196.578 1.00 43.86  ? 377 PHE A HB2    1 
ATOM   6282  H HB3    . PHE A 1 377 ? 178.611 1.474   195.446 1.00 43.86  ? 377 PHE A HB3    1 
ATOM   6283  H HD1    . PHE A 1 377 ? 177.511 3.769   194.580 1.00 47.81  ? 377 PHE A HD1    1 
ATOM   6284  H HD2    . PHE A 1 377 ? 177.105 2.276   198.260 1.00 50.49  ? 377 PHE A HD2    1 
ATOM   6285  H HE1    . PHE A 1 377 ? 176.984 5.876   195.383 1.00 47.75  ? 377 PHE A HE1    1 
ATOM   6286  H HE2    . PHE A 1 377 ? 176.579 4.380   199.059 1.00 51.01  ? 377 PHE A HE2    1 
ATOM   6287  H HZ     . PHE A 1 377 ? 176.517 6.180   197.621 1.00 48.26  ? 377 PHE A HZ     1 
ATOM   6288  N N      . GLU A 1 378 ? 177.788 -0.475  193.002 1.00 52.49  ? 378 GLU A N      1 
ATOM   6289  C CA     . GLU A 1 378 ? 178.416 -1.645  192.395 1.00 51.33  ? 378 GLU A CA     1 
ATOM   6290  C C      . GLU A 1 378 ? 179.740 -1.237  191.745 1.00 46.53  ? 378 GLU A C      1 
ATOM   6291  O O      . GLU A 1 378 ? 180.090 -0.053  191.726 1.00 42.39  ? 378 GLU A O      1 
ATOM   6292  C CB     . GLU A 1 378 ? 177.470 -2.277  191.377 1.00 58.13  ? 378 GLU A CB     1 
ATOM   6293  C CG     . GLU A 1 378 ? 176.214 -2.860  192.024 1.00 69.77  ? 378 GLU A CG     1 
ATOM   6294  C CD     . GLU A 1 378 ? 175.283 -3.550  191.038 1.00 81.05  ? 378 GLU A CD     1 
ATOM   6295  O OE1    . GLU A 1 378 ? 175.693 -3.798  189.884 1.00 88.83  ? 378 GLU A OE1    1 
ATOM   6296  O OE2    . GLU A 1 378 ? 174.132 -3.847  191.420 1.00 82.35  ? 378 GLU A OE2    1 
ATOM   6297  H H      . GLU A 1 378 ? 177.772 0.211   192.484 1.00 62.99  ? 378 GLU A H      1 
ATOM   6298  H HA     . GLU A 1 378 ? 178.605 -2.302  193.084 1.00 61.60  ? 378 GLU A HA     1 
ATOM   6299  H HB2    . GLU A 1 378 ? 177.193 -1.600  190.740 1.00 69.76  ? 378 GLU A HB2    1 
ATOM   6300  H HB3    . GLU A 1 378 ? 177.932 -2.996  190.918 1.00 69.76  ? 378 GLU A HB3    1 
ATOM   6301  H HG2    . GLU A 1 378 ? 176.480 -3.515  192.688 1.00 83.72  ? 378 GLU A HG2    1 
ATOM   6302  H HG3    . GLU A 1 378 ? 175.719 -2.143  192.448 1.00 83.72  ? 378 GLU A HG3    1 
ATOM   6303  N N      . MET A 1 379 ? 180.473 -2.215  191.217 1.00 44.50  ? 379 MET A N      1 
ATOM   6304  C CA     . MET A 1 379 ? 181.828 -1.988  190.714 1.00 39.14  ? 379 MET A CA     1 
ATOM   6305  C C      . MET A 1 379 ? 181.917 -2.176  189.207 1.00 39.68  ? 379 MET A C      1 
ATOM   6306  O O      . MET A 1 379 ? 181.554 -3.221  188.690 1.00 45.67  ? 379 MET A O      1 
ATOM   6307  C CB     . MET A 1 379 ? 182.796 -2.965  191.386 1.00 39.22  ? 379 MET A CB     1 
ATOM   6308  C CG     . MET A 1 379 ? 182.681 -3.040  192.910 1.00 35.71  ? 379 MET A CG     1 
ATOM   6309  S SD     . MET A 1 379 ? 183.049 -1.461  193.693 1.00 45.93  ? 379 MET A SD     1 
ATOM   6310  C CE     . MET A 1 379 ? 182.979 -1.881  195.434 1.00 96.90  ? 379 MET A CE     1 
ATOM   6311  H H      . MET A 1 379 ? 180.206 -3.028  191.139 1.00 53.40  ? 379 MET A H      1 
ATOM   6312  H HA     . MET A 1 379 ? 182.104 -1.086  190.938 1.00 46.97  ? 379 MET A HA     1 
ATOM   6313  H HB2    . MET A 1 379 ? 182.630 -3.854  191.035 1.00 47.07  ? 379 MET A HB2    1 
ATOM   6314  H HB3    . MET A 1 379 ? 183.703 -2.695  191.173 1.00 47.07  ? 379 MET A HB3    1 
ATOM   6315  H HG2    . MET A 1 379 ? 181.776 -3.293  193.149 1.00 42.86  ? 379 MET A HG2    1 
ATOM   6316  H HG3    . MET A 1 379 ? 183.311 -3.698  193.244 1.00 42.86  ? 379 MET A HG3    1 
ATOM   6317  H HE1    . MET A 1 379 ? 183.166 -1.086  195.958 1.00 116.28 ? 379 MET A HE1    1 
ATOM   6318  H HE2    . MET A 1 379 ? 182.093 -2.215  195.643 1.00 116.28 ? 379 MET A HE2    1 
ATOM   6319  H HE3    . MET A 1 379 ? 183.643 -2.564  195.620 1.00 116.28 ? 379 MET A HE3    1 
ATOM   6320  N N      . ARG A 1 380 ? 182.424 -1.160  188.515 1.00 42.04  ? 380 ARG A N      1 
ATOM   6321  C CA     . ARG A 1 380 ? 182.681 -1.224  187.086 1.00 42.19  ? 380 ARG A CA     1 
ATOM   6322  C C      . ARG A 1 380 ? 183.659 -2.335  186.791 1.00 46.39  ? 380 ARG A C      1 
ATOM   6323  O O      . ARG A 1 380 ? 184.413 -2.754  187.662 1.00 47.34  ? 380 ARG A O      1 
ATOM   6324  C CB     . ARG A 1 380 ? 183.300 0.083   186.604 1.00 47.30  ? 380 ARG A CB     1 
ATOM   6325  C CG     . ARG A 1 380 ? 182.345 1.261   186.555 1.00 49.92  ? 380 ARG A CG     1 
ATOM   6326  C CD     . ARG A 1 380 ? 182.997 2.513   185.978 1.00 49.10  ? 380 ARG A CD     1 
ATOM   6327  N NE     . ARG A 1 380 ? 181.995 3.544   185.742 1.00 50.19  ? 380 ARG A NE     1 
ATOM   6328  C CZ     . ARG A 1 380 ? 181.552 4.394   186.661 1.00 53.48  ? 380 ARG A CZ     1 
ATOM   6329  N NH1    . ARG A 1 380 ? 182.032 4.376   187.901 1.00 53.35  ? 380 ARG A NH1    1 
ATOM   6330  N NH2    . ARG A 1 380 ? 180.624 5.278   186.330 1.00 56.11  ? 380 ARG A NH2    1 
ATOM   6331  H H      . ARG A 1 380 ? 182.633 -0.402  188.865 1.00 50.45  ? 380 ARG A H      1 
ATOM   6332  H HA     . ARG A 1 380 ? 181.856 -1.386  186.603 1.00 50.63  ? 380 ARG A HA     1 
ATOM   6333  H HB2    . ARG A 1 380 ? 184.027 0.320   187.201 1.00 56.76  ? 380 ARG A HB2    1 
ATOM   6334  H HB3    . ARG A 1 380 ? 183.646 -0.051  185.708 1.00 56.76  ? 380 ARG A HB3    1 
ATOM   6335  H HG2    . ARG A 1 380 ? 181.586 1.031   185.995 1.00 59.91  ? 380 ARG A HG2    1 
ATOM   6336  H HG3    . ARG A 1 380 ? 182.045 1.464   187.455 1.00 59.91  ? 380 ARG A HG3    1 
ATOM   6337  H HD2    . ARG A 1 380 ? 183.650 2.858   186.608 1.00 58.92  ? 380 ARG A HD2    1 
ATOM   6338  H HD3    . ARG A 1 380 ? 183.422 2.297   185.133 1.00 58.92  ? 380 ARG A HD3    1 
ATOM   6339  H HE     . ARG A 1 380 ? 181.667 3.606   184.949 1.00 60.22  ? 380 ARG A HE     1 
ATOM   6340  H HH11   . ARG A 1 380 ? 182.632 3.801   188.121 1.00 64.02  ? 380 ARG A HH11   1 
ATOM   6341  H HH12   . ARG A 1 380 ? 181.738 4.936   188.484 1.00 64.02  ? 380 ARG A HH12   1 
ATOM   6342  H HH21   . ARG A 1 380 ? 180.315 5.297   185.527 1.00 67.33  ? 380 ARG A HH21   1 
ATOM   6343  H HH22   . ARG A 1 380 ? 180.337 5.839   186.914 1.00 67.33  ? 380 ARG A HH22   1 
ATOM   6344  N N      . LYS A 1 381 ? 183.661 -2.794  185.547 1.00 49.61  ? 381 LYS A N      1 
ATOM   6345  C CA     . LYS A 1 381 ? 184.593 -3.819  185.133 1.00 50.93  ? 381 LYS A CA     1 
ATOM   6346  C C      . LYS A 1 381 ? 185.826 -3.206  184.475 1.00 51.80  ? 381 LYS A C      1 
ATOM   6347  O O      . LYS A 1 381 ? 186.683 -3.926  183.975 1.00 57.81  ? 381 LYS A O      1 
ATOM   6348  C CB     . LYS A 1 381 ? 183.892 -4.800  184.199 1.00 50.47  ? 381 LYS A CB     1 
ATOM   6349  C CG     . LYS A 1 381 ? 182.666 -5.417  184.832 1.00 49.21  ? 381 LYS A CG     1 
ATOM   6350  C CD     . LYS A 1 381 ? 181.977 -6.381  183.905 1.00 54.46  ? 381 LYS A CD     1 
ATOM   6351  C CE     . LYS A 1 381 ? 180.734 -6.975  184.564 1.00 66.86  ? 381 LYS A CE     1 
ATOM   6352  N NZ     . LYS A 1 381 ? 181.048 -7.816  185.774 1.00 75.20  ? 381 LYS A NZ     1 
ATOM   6353  H H      . LYS A 1 381 ? 183.130 -2.526  184.926 1.00 59.53  ? 381 LYS A H      1 
ATOM   6354  H HA     . LYS A 1 381 ? 184.887 -4.311  185.915 1.00 61.12  ? 381 LYS A HA     1 
ATOM   6355  H HB2    . LYS A 1 381 ? 183.613 -4.331  183.397 1.00 60.57  ? 381 LYS A HB2    1 
ATOM   6356  H HB3    . LYS A 1 381 ? 184.506 -5.515  183.971 1.00 60.57  ? 381 LYS A HB3    1 
ATOM   6357  H HG2    . LYS A 1 381 ? 182.930 -5.902  185.630 1.00 59.06  ? 381 LYS A HG2    1 
ATOM   6358  H HG3    . LYS A 1 381 ? 182.038 -4.715  185.061 1.00 59.06  ? 381 LYS A HG3    1 
ATOM   6359  H HD2    . LYS A 1 381 ? 181.703 -5.913  183.100 1.00 65.35  ? 381 LYS A HD2    1 
ATOM   6360  H HD3    . LYS A 1 381 ? 182.583 -7.106  183.685 1.00 65.35  ? 381 LYS A HD3    1 
ATOM   6361  H HE2    . LYS A 1 381 ? 180.151 -6.252  184.846 1.00 80.23  ? 381 LYS A HE2    1 
ATOM   6362  H HE3    . LYS A 1 381 ? 180.275 -7.537  183.920 1.00 80.23  ? 381 LYS A HE3    1 
ATOM   6363  H HZ1    . LYS A 1 381 ? 180.297 -8.140  186.123 1.00 90.24  ? 381 LYS A HZ1    1 
ATOM   6364  H HZ2    . LYS A 1 381 ? 181.576 -8.495  185.543 1.00 90.24  ? 381 LYS A HZ2    1 
ATOM   6365  H HZ3    . LYS A 1 381 ? 181.463 -7.323  186.388 1.00 90.24  ? 381 LYS A HZ3    1 
ATOM   6366  N N      . PHE A 1 382 ? 185.918 -1.879  184.493 1.00 48.35  ? 382 PHE A N      1 
ATOM   6367  C CA     . PHE A 1 382 ? 187.065 -1.162  183.926 1.00 49.83  ? 382 PHE A CA     1 
ATOM   6368  C C      . PHE A 1 382 ? 186.999 0.290   184.373 1.00 49.34  ? 382 PHE A C      1 
ATOM   6369  O O      . PHE A 1 382 ? 185.910 0.797   184.626 1.00 53.99  ? 382 PHE A O      1 
ATOM   6370  C CB     . PHE A 1 382 ? 187.054 -1.237  182.396 1.00 49.73  ? 382 PHE A CB     1 
ATOM   6371  C CG     . PHE A 1 382 ? 185.684 -1.081  181.798 1.00 50.11  ? 382 PHE A CG     1 
ATOM   6372  C CD1    . PHE A 1 382 ? 185.070 0.168   181.760 1.00 45.11  ? 382 PHE A CD1    1 
ATOM   6373  C CD2    . PHE A 1 382 ? 185.001 -2.178  181.288 1.00 48.92  ? 382 PHE A CD2    1 
ATOM   6374  C CE1    . PHE A 1 382 ? 183.809 0.324   181.222 1.00 41.61  ? 382 PHE A CE1    1 
ATOM   6375  C CE2    . PHE A 1 382 ? 183.736 -2.024  180.746 1.00 48.71  ? 382 PHE A CE2    1 
ATOM   6376  C CZ     . PHE A 1 382 ? 183.139 -0.765  180.716 1.00 44.67  ? 382 PHE A CZ     1 
ATOM   6377  H H      . PHE A 1 382 ? 185.321 -1.361  184.832 1.00 58.01  ? 382 PHE A H      1 
ATOM   6378  H HA     . PHE A 1 382 ? 187.890 -1.553  184.252 1.00 59.79  ? 382 PHE A HA     1 
ATOM   6379  H HB2    . PHE A 1 382 ? 187.615 -0.529  182.044 1.00 59.68  ? 382 PHE A HB2    1 
ATOM   6380  H HB3    . PHE A 1 382 ? 187.401 -2.100  182.122 1.00 59.68  ? 382 PHE A HB3    1 
ATOM   6381  H HD1    . PHE A 1 382 ? 185.517 0.909   182.101 1.00 54.13  ? 382 PHE A HD1    1 
ATOM   6382  H HD2    . PHE A 1 382 ? 185.396 -3.019  181.309 1.00 58.70  ? 382 PHE A HD2    1 
ATOM   6383  H HE1    . PHE A 1 382 ? 183.413 1.165   181.201 1.00 49.94  ? 382 PHE A HE1    1 
ATOM   6384  H HE2    . PHE A 1 382 ? 183.284 -2.761  180.404 1.00 58.45  ? 382 PHE A HE2    1 
ATOM   6385  H HZ     . PHE A 1 382 ? 182.290 -0.660  180.351 1.00 53.60  ? 382 PHE A HZ     1 
ATOM   6386  N N      . THR A 1 383 ? 188.153 0.950   184.474 1.00 44.38  ? 383 THR A N      1 
ATOM   6387  C CA     . THR A 1 383 ? 188.214 2.331   184.952 1.00 42.00  ? 383 THR A CA     1 
ATOM   6388  C C      . THR A 1 383 ? 188.841 3.327   183.960 1.00 45.72  ? 383 THR A C      1 
ATOM   6389  O O      . THR A 1 383 ? 188.891 4.529   184.234 1.00 43.94  ? 383 THR A O      1 
ATOM   6390  C CB     . THR A 1 383 ? 189.012 2.423   186.251 1.00 40.82  ? 383 THR A CB     1 
ATOM   6391  O OG1    . THR A 1 383 ? 190.333 1.927   186.023 1.00 44.51  ? 383 THR A OG1    1 
ATOM   6392  C CG2    . THR A 1 383 ? 188.332 1.630   187.369 1.00 38.92  ? 383 THR A CG2    1 
ATOM   6393  H H      . THR A 1 383 ? 188.920 0.618   184.271 1.00 53.26  ? 383 THR A H      1 
ATOM   6394  H HA     . THR A 1 383 ? 187.311 2.632   185.139 1.00 50.40  ? 383 THR A HA     1 
ATOM   6395  H HB     . THR A 1 383 ? 189.064 3.351   186.528 1.00 48.98  ? 383 THR A HB     1 
ATOM   6396  H HG1    . THR A 1 383 ? 190.783 1.972   186.731 1.00 53.41  ? 383 THR A HG1    1 
ATOM   6397  H HG21   . THR A 1 383 ? 188.850 1.698   188.186 1.00 46.70  ? 383 THR A HG21   1 
ATOM   6398  H HG22   . THR A 1 383 ? 187.442 1.980   187.530 1.00 46.70  ? 383 THR A HG22   1 
ATOM   6399  H HG23   . THR A 1 383 ? 188.262 0.696   187.117 1.00 46.70  ? 383 THR A HG23   1 
ATOM   6400  N N      . THR A 1 384 ? 189.328 2.832   182.826 1.00 45.35  ? 384 THR A N      1 
ATOM   6401  C CA     . THR A 1 384 ? 189.869 3.690   181.781 1.00 40.39  ? 384 THR A CA     1 
ATOM   6402  C C      . THR A 1 384 ? 189.237 3.313   180.453 1.00 43.52  ? 384 THR A C      1 
ATOM   6403  O O      . THR A 1 384 ? 188.883 2.151   180.247 1.00 44.82  ? 384 THR A O      1 
ATOM   6404  C CB     . THR A 1 384 ? 191.376 3.521   181.640 1.00 37.01  ? 384 THR A CB     1 
ATOM   6405  O OG1    . THR A 1 384 ? 191.673 2.225   181.110 1.00 38.24  ? 384 THR A OG1    1 
ATOM   6406  C CG2    . THR A 1 384 ? 192.045 3.670   182.961 1.00 34.99  ? 384 THR A CG2    1 
ATOM   6407  H H      . THR A 1 384 ? 189.356 1.993   182.637 1.00 54.43  ? 384 THR A H      1 
ATOM   6408  H HA     . THR A 1 384 ? 189.670 4.619   181.976 1.00 48.47  ? 384 THR A HA     1 
ATOM   6409  H HB     . THR A 1 384 ? 191.723 4.202   181.042 1.00 44.42  ? 384 THR A HB     1 
ATOM   6410  H HG1    . THR A 1 384 ? 192.504 2.130   181.031 1.00 45.89  ? 384 THR A HG1    1 
ATOM   6411  H HG21   . THR A 1 384 ? 193.003 3.561   182.862 1.00 41.99  ? 384 THR A HG21   1 
ATOM   6412  H HG22   . THR A 1 384 ? 191.864 4.549   183.327 1.00 41.99  ? 384 THR A HG22   1 
ATOM   6413  H HG23   . THR A 1 384 ? 191.713 2.998   183.577 1.00 41.99  ? 384 THR A HG23   1 
ATOM   6414  N N      . PRO A 1 385 ? 189.103 4.289   179.538 1.00 41.93  ? 385 PRO A N      1 
ATOM   6415  C CA     . PRO A 1 385 ? 188.485 4.039   178.232 1.00 41.34  ? 385 PRO A CA     1 
ATOM   6416  C C      . PRO A 1 385 ? 189.226 2.995   177.403 1.00 44.58  ? 385 PRO A C      1 
ATOM   6417  O O      . PRO A 1 385 ? 188.592 2.282   176.634 1.00 45.82  ? 385 PRO A O      1 
ATOM   6418  C CB     . PRO A 1 385 ? 188.556 5.399   177.546 1.00 42.82  ? 385 PRO A CB     1 
ATOM   6419  C CG     . PRO A 1 385 ? 189.639 6.128   178.254 1.00 44.23  ? 385 PRO A CG     1 
ATOM   6420  C CD     . PRO A 1 385 ? 189.575 5.675   179.664 1.00 42.04  ? 385 PRO A CD     1 
ATOM   6421  H HA     . PRO A 1 385 ? 187.557 3.776   178.336 1.00 49.61  ? 385 PRO A HA     1 
ATOM   6422  H HB2    . PRO A 1 385 ? 188.777 5.282   176.609 1.00 51.38  ? 385 PRO A HB2    1 
ATOM   6423  H HB3    . PRO A 1 385 ? 187.709 5.860   177.645 1.00 51.38  ? 385 PRO A HB3    1 
ATOM   6424  H HG2    . PRO A 1 385 ? 190.496 5.900   177.861 1.00 53.08  ? 385 PRO A HG2    1 
ATOM   6425  H HG3    . PRO A 1 385 ? 189.479 7.083   178.196 1.00 53.08  ? 385 PRO A HG3    1 
ATOM   6426  H HD2    . PRO A 1 385 ? 190.456 5.698   180.069 1.00 50.45  ? 385 PRO A HD2    1 
ATOM   6427  H HD3    . PRO A 1 385 ? 188.936 6.207   180.164 1.00 50.45  ? 385 PRO A HD3    1 
ATOM   6428  N N      . GLU A 1 386 ? 190.544 2.906   177.547 1.00 47.81  ? 386 GLU A N      1 
ATOM   6429  C CA     . GLU A 1 386 ? 191.307 1.877   176.837 1.00 47.56  ? 386 GLU A CA     1 
ATOM   6430  C C      . GLU A 1 386 ? 190.822 0.486   177.241 1.00 51.35  ? 386 GLU A C      1 
ATOM   6431  O O      . GLU A 1 386 ? 190.547 -0.361  176.386 1.00 54.79  ? 386 GLU A O      1 
ATOM   6432  C CB     . GLU A 1 386 ? 192.806 2.000   177.106 1.00 43.26  ? 386 GLU A CB     1 
ATOM   6433  C CG     . GLU A 1 386 ? 193.464 3.178   176.426 1.00 50.94  ? 386 GLU A CG     1 
ATOM   6434  C CD     . GLU A 1 386 ? 193.521 4.438   177.292 1.00 62.13  ? 386 GLU A CD     1 
ATOM   6435  O OE1    . GLU A 1 386 ? 192.793 4.522   178.312 1.00 60.38  ? 386 GLU A OE1    1 
ATOM   6436  O OE2    . GLU A 1 386 ? 194.310 5.350   176.944 1.00 69.81  ? 386 GLU A OE2    1 
ATOM   6437  H H      . GLU A 1 386 ? 191.019 3.422   178.044 1.00 57.38  ? 386 GLU A H      1 
ATOM   6438  H HA     . GLU A 1 386 ? 191.164 1.980   175.883 1.00 57.07  ? 386 GLU A HA     1 
ATOM   6439  H HB2    . GLU A 1 386 ? 192.944 2.096   178.062 1.00 51.91  ? 386 GLU A HB2    1 
ATOM   6440  H HB3    . GLU A 1 386 ? 193.245 1.194   176.791 1.00 51.91  ? 386 GLU A HB3    1 
ATOM   6441  H HG2    . GLU A 1 386 ? 194.374 2.936   176.194 1.00 61.12  ? 386 GLU A HG2    1 
ATOM   6442  H HG3    . GLU A 1 386 ? 192.965 3.393   175.622 1.00 61.12  ? 386 GLU A HG3    1 
ATOM   6443  N N      . GLU A 1 387 ? 190.694 0.255   178.542 1.00 49.75  ? 387 GLU A N      1 
ATOM   6444  C CA     . GLU A 1 387 ? 190.263 -1.051  179.018 1.00 54.42  ? 387 GLU A CA     1 
ATOM   6445  C C      . GLU A 1 387 ? 188.793 -1.275  178.712 1.00 54.51  ? 387 GLU A C      1 
ATOM   6446  O O      . GLU A 1 387 ? 188.357 -2.406  178.492 1.00 59.09  ? 387 GLU A O      1 
ATOM   6447  C CB     . GLU A 1 387 ? 190.546 -1.207  180.512 1.00 61.18  ? 387 GLU A CB     1 
ATOM   6448  C CG     . GLU A 1 387 ? 192.027 -1.360  180.816 1.00 74.55  ? 387 GLU A CG     1 
ATOM   6449  C CD     . GLU A 1 387 ? 192.676 -2.515  180.043 1.00 88.00  ? 387 GLU A CD     1 
ATOM   6450  O OE1    . GLU A 1 387 ? 191.998 -3.543  179.807 1.00 90.72  ? 387 GLU A OE1    1 
ATOM   6451  O OE2    . GLU A 1 387 ? 193.861 -2.388  179.657 1.00 94.13  ? 387 GLU A OE2    1 
ATOM   6452  H H      . GLU A 1 387 ? 190.850 0.830   179.163 1.00 59.70  ? 387 GLU A H      1 
ATOM   6453  H HA     . GLU A 1 387 ? 190.769 -1.734  178.550 1.00 65.31  ? 387 GLU A HA     1 
ATOM   6454  H HB2    . GLU A 1 387 ? 190.223 -0.420  180.978 1.00 73.41  ? 387 GLU A HB2    1 
ATOM   6455  H HB3    . GLU A 1 387 ? 190.089 -1.997  180.839 1.00 73.41  ? 387 GLU A HB3    1 
ATOM   6456  H HG2    . GLU A 1 387 ? 192.486 -0.540  180.572 1.00 89.46  ? 387 GLU A HG2    1 
ATOM   6457  H HG3    . GLU A 1 387 ? 192.138 -1.533  181.764 1.00 89.46  ? 387 GLU A HG3    1 
ATOM   6458  N N      . GLY A 1 388 ? 188.034 -0.188  178.687 1.00 50.45  ? 388 GLY A N      1 
ATOM   6459  C CA     . GLY A 1 388 ? 186.640 -0.256  178.314 1.00 46.07  ? 388 GLY A CA     1 
ATOM   6460  C C      . GLY A 1 388 ? 186.529 -0.752  176.889 1.00 47.39  ? 388 GLY A C      1 
ATOM   6461  O O      . GLY A 1 388 ? 185.839 -1.732  176.630 1.00 51.97  ? 388 GLY A O      1 
ATOM   6462  H H      . GLY A 1 388 ? 188.309 0.603   178.882 1.00 60.54  ? 388 GLY A H      1 
ATOM   6463  H HA2    . GLY A 1 388 ? 186.167 -0.867  178.901 1.00 55.28  ? 388 GLY A HA2    1 
ATOM   6464  H HA3    . GLY A 1 388 ? 186.235 0.623   178.377 1.00 55.28  ? 388 GLY A HA3    1 
ATOM   6465  N N      . VAL A 1 389 ? 187.225 -0.097  175.963 1.00 44.41  ? 389 VAL A N      1 
ATOM   6466  C CA     . VAL A 1 389 ? 187.114 -0.447  174.545 1.00 44.66  ? 389 VAL A CA     1 
ATOM   6467  C C      . VAL A 1 389 ? 187.657 -1.843  174.302 1.00 45.28  ? 389 VAL A C      1 
ATOM   6468  O O      . VAL A 1 389 ? 187.165 -2.551  173.429 1.00 46.50  ? 389 VAL A O      1 
ATOM   6469  C CB     . VAL A 1 389 ? 187.830 0.583   173.613 1.00 42.37  ? 389 VAL A CB     1 
ATOM   6470  C CG1    . VAL A 1 389 ? 187.844 0.106   172.165 1.00 44.93  ? 389 VAL A CG1    1 
ATOM   6471  C CG2    . VAL A 1 389 ? 187.146 1.932   173.690 1.00 38.83  ? 389 VAL A CG2    1 
ATOM   6472  H H      . VAL A 1 389 ? 187.767 0.551   176.126 1.00 53.29  ? 389 VAL A H      1 
ATOM   6473  H HA     . VAL A 1 389 ? 186.174 -0.453  174.304 1.00 53.59  ? 389 VAL A HA     1 
ATOM   6474  H HB     . VAL A 1 389 ? 188.749 0.692   173.905 1.00 50.84  ? 389 VAL A HB     1 
ATOM   6475  H HG11   . VAL A 1 389 ? 188.295 0.769   171.619 1.00 53.91  ? 389 VAL A HG11   1 
ATOM   6476  H HG12   . VAL A 1 389 ? 188.315 -0.740  172.116 1.00 53.91  ? 389 VAL A HG12   1 
ATOM   6477  H HG13   . VAL A 1 389 ? 186.929 -0.006  171.862 1.00 53.91  ? 389 VAL A HG13   1 
ATOM   6478  H HG21   . VAL A 1 389 ? 187.607 2.553   173.105 1.00 46.60  ? 389 VAL A HG21   1 
ATOM   6479  H HG22   . VAL A 1 389 ? 186.223 1.834   173.408 1.00 46.60  ? 389 VAL A HG22   1 
ATOM   6480  H HG23   . VAL A 1 389 ? 187.180 2.252   174.605 1.00 46.60  ? 389 VAL A HG23   1 
ATOM   6481  N N      . ARG A 1 390 ? 188.670 -2.241  175.070 1.00 47.12  ? 390 ARG A N      1 
ATOM   6482  C CA     . ARG A 1 390 ? 189.209 -3.596  174.950 1.00 48.89  ? 390 ARG A CA     1 
ATOM   6483  C C      . ARG A 1 390 ? 188.127 -4.629  175.268 1.00 52.05  ? 390 ARG A C      1 
ATOM   6484  O O      . ARG A 1 390 ? 187.972 -5.624  174.555 1.00 52.92  ? 390 ARG A O      1 
ATOM   6485  C CB     . ARG A 1 390 ? 190.426 -3.800  175.858 1.00 45.60  ? 390 ARG A CB     1 
ATOM   6486  C CG     . ARG A 1 390 ? 191.037 -5.195  175.755 1.00 52.12  ? 390 ARG A CG     1 
ATOM   6487  C CD     . ARG A 1 390 ? 192.269 -5.360  176.642 1.00 63.50  ? 390 ARG A CD     1 
ATOM   6488  N NE     . ARG A 1 390 ? 193.516 -4.947  175.987 1.00 73.39  ? 390 ARG A NE     1 
ATOM   6489  C CZ     . ARG A 1 390 ? 194.137 -3.781  176.177 1.00 78.38  ? 390 ARG A CZ     1 
ATOM   6490  N NH1    . ARG A 1 390 ? 193.645 -2.861  177.008 1.00 79.82  ? 390 ARG A NH1    1 
ATOM   6491  N NH2    . ARG A 1 390 ? 195.266 -3.528  175.530 1.00 78.20  ? 390 ARG A NH2    1 
ATOM   6492  H H      . ARG A 1 390 ? 189.058 -1.754  175.662 1.00 56.55  ? 390 ARG A H      1 
ATOM   6493  H HA     . ARG A 1 390 ? 189.495 -3.739  174.034 1.00 58.67  ? 390 ARG A HA     1 
ATOM   6494  H HB2    . ARG A 1 390 ? 191.110 -3.157  175.614 1.00 54.72  ? 390 ARG A HB2    1 
ATOM   6495  H HB3    . ARG A 1 390 ? 190.156 -3.661  176.779 1.00 54.72  ? 390 ARG A HB3    1 
ATOM   6496  H HG2    . ARG A 1 390 ? 190.378 -5.851  176.029 1.00 62.55  ? 390 ARG A HG2    1 
ATOM   6497  H HG3    . ARG A 1 390 ? 191.305 -5.357  174.836 1.00 62.55  ? 390 ARG A HG3    1 
ATOM   6498  H HD2    . ARG A 1 390 ? 192.157 -4.819  177.439 1.00 76.20  ? 390 ARG A HD2    1 
ATOM   6499  H HD3    . ARG A 1 390 ? 192.356 -6.295  176.888 1.00 76.20  ? 390 ARG A HD3    1 
ATOM   6500  H HE     . ARG A 1 390 ? 193.875 -5.501  175.436 1.00 88.07  ? 390 ARG A HE     1 
ATOM   6501  H HH11   . ARG A 1 390 ? 192.915 -3.014  177.436 1.00 95.78  ? 390 ARG A HH11   1 
ATOM   6502  H HH12   . ARG A 1 390 ? 194.059 -2.115  177.117 1.00 95.78  ? 390 ARG A HH12   1 
ATOM   6503  H HH21   . ARG A 1 390 ? 195.592 -4.113  174.990 1.00 93.84  ? 390 ARG A HH21   1 
ATOM   6504  H HH22   . ARG A 1 390 ? 195.669 -2.778  175.645 1.00 93.84  ? 390 ARG A HH22   1 
ATOM   6505  N N      . SER A 1 391 ? 187.376 -4.371  176.333 1.00 54.25  ? 391 SER A N      1 
ATOM   6506  C CA     . SER A 1 391 ? 186.284 -5.238  176.752 1.00 59.31  ? 391 SER A CA     1 
ATOM   6507  C C      . SER A 1 391 ? 185.180 -5.302  175.690 1.00 59.62  ? 391 SER A C      1 
ATOM   6508  O O      . SER A 1 391 ? 184.639 -6.378  175.402 1.00 63.97  ? 391 SER A O      1 
ATOM   6509  C CB     . SER A 1 391 ? 185.713 -4.727  178.078 1.00 62.71  ? 391 SER A CB     1 
ATOM   6510  O OG     . SER A 1 391 ? 184.560 -5.450  178.464 1.00 66.97  ? 391 SER A OG     1 
ATOM   6511  H H      . SER A 1 391 ? 187.483 -3.684  176.840 1.00 65.11  ? 391 SER A H      1 
ATOM   6512  H HA     . SER A 1 391 ? 186.623 -6.136  176.892 1.00 71.18  ? 391 SER A HA     1 
ATOM   6513  H HB2    . SER A 1 391 ? 186.388 -4.824  178.768 1.00 75.25  ? 391 SER A HB2    1 
ATOM   6514  H HB3    . SER A 1 391 ? 185.477 -3.792  177.978 1.00 75.25  ? 391 SER A HB3    1 
ATOM   6515  H HG     . SER A 1 391 ? 184.265 -5.154  179.192 1.00 80.37  ? 391 SER A HG     1 
ATOM   6516  N N      . TYR A 1 392 ? 184.864 -4.143  175.114 1.00 52.98  ? 392 TYR A N      1 
ATOM   6517  C CA     . TYR A 1 392 ? 183.787 -4.015  174.139 1.00 53.17  ? 392 TYR A CA     1 
ATOM   6518  C C      . TYR A 1 392 ? 184.140 -4.671  172.804 1.00 58.11  ? 392 TYR A C      1 
ATOM   6519  O O      . TYR A 1 392 ? 183.312 -5.361  172.210 1.00 64.52  ? 392 TYR A O      1 
ATOM   6520  C CB     . TYR A 1 392 ? 183.447 -2.535  173.922 1.00 52.44  ? 392 TYR A CB     1 
ATOM   6521  C CG     . TYR A 1 392 ? 182.298 -2.315  172.966 1.00 55.31  ? 392 TYR A CG     1 
ATOM   6522  C CD1    . TYR A 1 392 ? 180.984 -2.315  173.414 1.00 56.22  ? 392 TYR A CD1    1 
ATOM   6523  C CD2    . TYR A 1 392 ? 182.526 -2.103  171.615 1.00 57.20  ? 392 TYR A CD2    1 
ATOM   6524  C CE1    . TYR A 1 392 ? 179.932 -2.117  172.542 1.00 57.72  ? 392 TYR A CE1    1 
ATOM   6525  C CE2    . TYR A 1 392 ? 181.480 -1.908  170.733 1.00 58.22  ? 392 TYR A CE2    1 
ATOM   6526  C CZ     . TYR A 1 392 ? 180.185 -1.916  171.197 1.00 58.82  ? 392 TYR A CZ     1 
ATOM   6527  O OH     . TYR A 1 392 ? 179.140 -1.718  170.315 1.00 59.63  ? 392 TYR A OH     1 
ATOM   6528  H H      . TYR A 1 392 ? 185.269 -3.402  175.277 1.00 63.58  ? 392 TYR A H      1 
ATOM   6529  H HA     . TYR A 1 392 ? 182.996 -4.455  174.487 1.00 63.80  ? 392 TYR A HA     1 
ATOM   6530  H HB2    . TYR A 1 392 ? 183.204 -2.141  174.775 1.00 62.93  ? 392 TYR A HB2    1 
ATOM   6531  H HB3    . TYR A 1 392 ? 184.226 -2.084  173.561 1.00 62.93  ? 392 TYR A HB3    1 
ATOM   6532  H HD1    . TYR A 1 392 ? 180.809 -2.454  174.317 1.00 67.47  ? 392 TYR A HD1    1 
ATOM   6533  H HD2    . TYR A 1 392 ? 183.399 -2.102  171.294 1.00 68.65  ? 392 TYR A HD2    1 
ATOM   6534  H HE1    . TYR A 1 392 ? 179.057 -2.123  172.856 1.00 69.27  ? 392 TYR A HE1    1 
ATOM   6535  H HE2    . TYR A 1 392 ? 181.651 -1.770  169.829 1.00 69.86  ? 392 TYR A HE2    1 
ATOM   6536  H HH     . TYR A 1 392 ? 178.408 -1.744  170.727 1.00 71.56  ? 392 TYR A HH     1 
ATOM   6537  N N      . ALA A 1 393 ? 185.367 -4.456  172.335 1.00 56.21  ? 393 ALA A N      1 
ATOM   6538  C CA     . ALA A 1 393 ? 185.798 -4.991  171.046 1.00 56.06  ? 393 ALA A CA     1 
ATOM   6539  C C      . ALA A 1 393 ? 185.925 -6.506  171.080 1.00 59.13  ? 393 ALA A C      1 
ATOM   6540  O O      . ALA A 1 393 ? 185.910 -7.154  170.034 1.00 61.65  ? 393 ALA A O      1 
ATOM   6541  C CB     . ALA A 1 393 ? 187.124 -4.377  170.630 1.00 54.27  ? 393 ALA A CB     1 
ATOM   6542  H H      . ALA A 1 393 ? 185.970 -4.002  172.745 1.00 67.45  ? 393 ALA A H      1 
ATOM   6543  H HA     . ALA A 1 393 ? 185.138 -4.762  170.373 1.00 67.27  ? 393 ALA A HA     1 
ATOM   6544  H HB1    . ALA A 1 393 ? 187.388 -4.748  169.773 1.00 65.12  ? 393 ALA A HB1    1 
ATOM   6545  H HB2    . ALA A 1 393 ? 187.016 -3.416  170.556 1.00 65.12  ? 393 ALA A HB2    1 
ATOM   6546  H HB3    . ALA A 1 393 ? 187.792 -4.585  171.302 1.00 65.12  ? 393 ALA A HB3    1 
ATOM   6547  N N      . SER A 1 394 ? 186.071 -7.066  172.278 1.00 58.89  ? 394 SER A N      1 
ATOM   6548  C CA     . SER A 1 394 ? 186.207 -8.509  172.432 1.00 61.82  ? 394 SER A CA     1 
ATOM   6549  C C      . SER A 1 394 ? 184.852 -9.190  172.401 1.00 63.07  ? 394 SER A C      1 
ATOM   6550  O O      . SER A 1 394 ? 184.711 -10.270 171.837 1.00 67.11  ? 394 SER A O      1 
ATOM   6551  C CB     . SER A 1 394 ? 186.920 -8.851  173.741 1.00 63.44  ? 394 SER A CB     1 
ATOM   6552  O OG     . SER A 1 394 ? 188.309 -8.607  173.641 1.00 66.09  ? 394 SER A OG     1 
ATOM   6553  H H      . SER A 1 394 ? 186.093 -6.629  173.018 1.00 70.67  ? 394 SER A H      1 
ATOM   6554  H HA     . SER A 1 394 ? 186.738 -8.858  171.699 1.00 74.19  ? 394 SER A HA     1 
ATOM   6555  H HB2    . SER A 1 394 ? 186.554 -8.303  174.452 1.00 76.13  ? 394 SER A HB2    1 
ATOM   6556  H HB3    . SER A 1 394 ? 186.778 -9.790  173.940 1.00 76.13  ? 394 SER A HB3    1 
ATOM   6557  H HG     . SER A 1 394 ? 188.446 -7.797  173.468 1.00 79.31  ? 394 SER A HG     1 
ATOM   6558  N N      . THR A 1 395 ? 183.859 -8.559  173.015 1.00 62.33  ? 395 THR A N      1 
ATOM   6559  C CA     . THR A 1 395 ? 182.541 -9.159  173.141 1.00 64.53  ? 395 THR A CA     1 
ATOM   6560  C C      . THR A 1 395 ? 181.619 -8.745  171.997 1.00 65.90  ? 395 THR A C      1 
ATOM   6561  O O      . THR A 1 395 ? 180.834 -9.561  171.511 1.00 71.32  ? 395 THR A O      1 
ATOM   6562  C CB     . THR A 1 395 ? 181.883 -8.780  174.473 1.00 64.09  ? 395 THR A CB     1 
ATOM   6563  O OG1    . THR A 1 395 ? 181.831 -7.361  174.585 1.00 72.77  ? 395 THR A OG1    1 
ATOM   6564  C CG2    . THR A 1 395 ? 182.678 -9.309  175.627 1.00 59.47  ? 395 THR A CG2    1 
ATOM   6565  H H      . THR A 1 395 ? 183.925 -7.777  173.368 1.00 74.80  ? 395 THR A H      1 
ATOM   6566  H HA     . THR A 1 395 ? 182.633 -10.125 173.117 1.00 77.44  ? 395 THR A HA     1 
ATOM   6567  H HB     . THR A 1 395 ? 180.986 -9.147  174.515 1.00 76.91  ? 395 THR A HB     1 
ATOM   6568  H HG1    . THR A 1 395 ? 181.382 -7.039  173.952 1.00 87.32  ? 395 THR A HG1    1 
ATOM   6569  H HG21   . THR A 1 395 ? 182.252 -9.063  176.463 1.00 71.36  ? 395 THR A HG21   1 
ATOM   6570  H HG22   . THR A 1 395 ? 182.734 -10.276 175.574 1.00 71.36  ? 395 THR A HG22   1 
ATOM   6571  H HG23   . THR A 1 395 ? 183.574 -8.939  175.608 1.00 71.36  ? 395 THR A HG23   1 
ATOM   6572  N N      . HIS A 1 396 ? 181.721 -7.488  171.560 1.00 59.15  ? 396 HIS A N      1 
ATOM   6573  C CA     . HIS A 1 396 ? 180.805 -6.955  170.552 1.00 56.70  ? 396 HIS A CA     1 
ATOM   6574  C C      . HIS A 1 396 ? 181.435 -6.804  169.160 1.00 59.16  ? 396 HIS A C      1 
ATOM   6575  O O      . HIS A 1 396 ? 180.996 -5.984  168.364 1.00 64.84  ? 396 HIS A O      1 
ATOM   6576  C CB     . HIS A 1 396 ? 180.201 -5.632  171.029 1.00 56.31  ? 396 HIS A CB     1 
ATOM   6577  C CG     . HIS A 1 396 ? 179.382 -5.767  172.276 1.00 65.22  ? 396 HIS A CG     1 
ATOM   6578  N ND1    . HIS A 1 396 ? 179.865 -5.445  173.527 1.00 67.40  ? 396 HIS A ND1    1 
ATOM   6579  C CD2    . HIS A 1 396 ? 178.121 -6.218  172.467 1.00 71.89  ? 396 HIS A CD2    1 
ATOM   6580  C CE1    . HIS A 1 396 ? 178.933 -5.680  174.432 1.00 70.32  ? 396 HIS A CE1    1 
ATOM   6581  N NE2    . HIS A 1 396 ? 177.863 -6.151  173.815 1.00 73.25  ? 396 HIS A NE2    1 
ATOM   6582  H H      . HIS A 1 396 ? 182.311 -6.925  171.832 1.00 70.98  ? 396 HIS A H      1 
ATOM   6583  H HA     . HIS A 1 396 ? 180.070 -7.582  170.459 1.00 68.04  ? 396 HIS A HA     1 
ATOM   6584  H HB2    . HIS A 1 396 ? 180.920 -5.007  171.211 1.00 67.58  ? 396 HIS A HB2    1 
ATOM   6585  H HB3    . HIS A 1 396 ? 179.626 -5.280  170.332 1.00 67.58  ? 396 HIS A HB3    1 
ATOM   6586  H HD1    . HIS A 1 396 ? 180.651 -5.135  173.692 1.00 80.89  ? 396 HIS A HD1    1 
ATOM   6587  H HD2    . HIS A 1 396 ? 177.536 -6.514  171.808 1.00 86.26  ? 396 HIS A HD2    1 
ATOM   6588  H HE1    . HIS A 1 396 ? 179.015 -5.538  175.348 1.00 84.38  ? 396 HIS A HE1    1 
ATOM   6589  H HE2    . HIS A 1 396 ? 177.125 -6.376  174.195 1.00 87.89  ? 396 HIS A HE2    1 
ATOM   6590  N N      . TRP A 1 397 ? 182.438 -7.625  168.866 1.00 54.24  ? 397 TRP A N      1 
ATOM   6591  C CA     . TRP A 1 397 ? 183.107 -7.610  167.572 1.00 53.20  ? 397 TRP A CA     1 
ATOM   6592  C C      . TRP A 1 397 ? 182.126 -7.773  166.425 1.00 58.28  ? 397 TRP A C      1 
ATOM   6593  O O      . TRP A 1 397 ? 182.325 -7.215  165.344 1.00 55.89  ? 397 TRP A O      1 
ATOM   6594  C CB     . TRP A 1 397 ? 184.131 -8.750  167.495 1.00 59.20  ? 397 TRP A CB     1 
ATOM   6595  C CG     . TRP A 1 397 ? 183.520 -10.110 167.725 1.00 62.75  ? 397 TRP A CG     1 
ATOM   6596  C CD1    . TRP A 1 397 ? 183.399 -10.757 168.917 1.00 62.42  ? 397 TRP A CD1    1 
ATOM   6597  C CD2    . TRP A 1 397 ? 182.934 -10.973 166.741 1.00 67.06  ? 397 TRP A CD2    1 
ATOM   6598  N NE1    . TRP A 1 397 ? 182.781 -11.968 168.740 1.00 66.24  ? 397 TRP A NE1    1 
ATOM   6599  C CE2    . TRP A 1 397 ? 182.483 -12.127 167.413 1.00 67.69  ? 397 TRP A CE2    1 
ATOM   6600  C CE3    . TRP A 1 397 ? 182.747 -10.882 165.358 1.00 68.73  ? 397 TRP A CE3    1 
ATOM   6601  C CZ2    . TRP A 1 397 ? 181.858 -13.183 166.753 1.00 67.26  ? 397 TRP A CZ2    1 
ATOM   6602  C CZ3    . TRP A 1 397 ? 182.124 -11.932 164.702 1.00 68.50  ? 397 TRP A CZ3    1 
ATOM   6603  C CH2    . TRP A 1 397 ? 181.687 -13.067 165.402 1.00 67.90  ? 397 TRP A CH2    1 
ATOM   6604  H H      . TRP A 1 397 ? 182.754 -8.211  169.410 1.00 65.09  ? 397 TRP A H      1 
ATOM   6605  H HA     . TRP A 1 397 ? 183.575 -6.768  167.459 1.00 63.85  ? 397 TRP A HA     1 
ATOM   6606  H HB2    . TRP A 1 397 ? 184.537 -8.750  166.614 1.00 71.05  ? 397 TRP A HB2    1 
ATOM   6607  H HB3    . TRP A 1 397 ? 184.810 -8.609  168.173 1.00 71.05  ? 397 TRP A HB3    1 
ATOM   6608  H HD1    . TRP A 1 397 ? 183.695 -10.426 169.734 1.00 74.90  ? 397 TRP A HD1    1 
ATOM   6609  H HE1    . TRP A 1 397 ? 182.608 -12.536 169.362 1.00 79.49  ? 397 TRP A HE1    1 
ATOM   6610  H HE3    . TRP A 1 397 ? 183.031 -10.131 164.888 1.00 82.48  ? 397 TRP A HE3    1 
ATOM   6611  H HZ2    . TRP A 1 397 ? 181.569 -13.938 167.214 1.00 80.72  ? 397 TRP A HZ2    1 
ATOM   6612  H HZ3    . TRP A 1 397 ? 181.994 -11.884 163.783 1.00 82.20  ? 397 TRP A HZ3    1 
ATOM   6613  H HH2    . TRP A 1 397 ? 181.276 -13.758 164.935 1.00 81.47  ? 397 TRP A HH2    1 
ATOM   6614  N N      . HIS A 1 398 ? 181.073 -8.552  166.653 1.00 67.13  ? 398 HIS A N      1 
ATOM   6615  C CA     . HIS A 1 398 ? 180.169 -8.918  165.569 1.00 76.60  ? 398 HIS A CA     1 
ATOM   6616  C C      . HIS A 1 398 ? 179.471 -7.705  164.980 1.00 74.16  ? 398 HIS A C      1 
ATOM   6617  O O      . HIS A 1 398 ? 179.147 -7.693  163.788 1.00 75.73  ? 398 HIS A O      1 
ATOM   6618  C CB     . HIS A 1 398 ? 179.124 -9.928  166.038 1.00 89.44  ? 398 HIS A CB     1 
ATOM   6619  C CG     . HIS A 1 398 ? 178.425 -10.644 164.918 1.00 103.56 ? 398 HIS A CG     1 
ATOM   6620  N ND1    . HIS A 1 398 ? 178.436 -10.188 163.615 1.00 106.59 ? 398 HIS A ND1    1 
ATOM   6621  C CD2    . HIS A 1 398 ? 177.706 -11.789 164.906 1.00 111.04 ? 398 HIS A CD2    1 
ATOM   6622  C CE1    . HIS A 1 398 ? 177.746 -11.021 162.853 1.00 109.33 ? 398 HIS A CE1    1 
ATOM   6623  N NE2    . HIS A 1 398 ? 177.293 -11.999 163.614 1.00 112.45 ? 398 HIS A NE2    1 
ATOM   6624  H H      . HIS A 1 398 ? 180.861 -8.879  167.419 1.00 80.56  ? 398 HIS A H      1 
ATOM   6625  H HA     . HIS A 1 398 ? 180.685 -9.334  164.861 1.00 91.93  ? 398 HIS A HA     1 
ATOM   6626  H HB2    . HIS A 1 398 ? 179.562 -10.596 166.589 1.00 107.32 ? 398 HIS A HB2    1 
ATOM   6627  H HB3    . HIS A 1 398 ? 178.451 -9.463  166.558 1.00 107.32 ? 398 HIS A HB3    1 
ATOM   6628  H HD1    . HIS A 1 398 ? 178.828 -9.472  163.342 1.00 127.91 ? 398 HIS A HD1    1 
ATOM   6629  H HD2    . HIS A 1 398 ? 177.521 -12.332 165.639 1.00 133.24 ? 398 HIS A HD2    1 
ATOM   6630  H HE1    . HIS A 1 398 ? 177.605 -10.932 161.938 1.00 131.19 ? 398 HIS A HE1    1 
ATOM   6631  H HE2    . HIS A 1 398 ? 176.817 -12.662 163.344 1.00 134.94 ? 398 HIS A HE2    1 
ATOM   6632  N N      . THR A 1 399 ? 179.254 -6.683  165.805 1.00 68.67  ? 399 THR A N      1 
ATOM   6633  C CA     . THR A 1 399 ? 178.462 -5.537  165.389 1.00 65.41  ? 399 THR A CA     1 
ATOM   6634  C C      . THR A 1 399 ? 179.326 -4.412  164.818 1.00 61.74  ? 399 THR A C      1 
ATOM   6635  O O      . THR A 1 399 ? 178.804 -3.381  164.389 1.00 62.98  ? 399 THR A O      1 
ATOM   6636  C CB     . THR A 1 399 ? 177.569 -5.028  166.548 1.00 70.07  ? 399 THR A CB     1 
ATOM   6637  O OG1    . THR A 1 399 ? 176.535 -4.183  166.026 1.00 75.79  ? 399 THR A OG1    1 
ATOM   6638  C CG2    . THR A 1 399 ? 178.383 -4.277  167.592 1.00 67.90  ? 399 THR A CG2    1 
ATOM   6639  H H      . THR A 1 399 ? 179.556 -6.632  166.609 1.00 82.41  ? 399 THR A H      1 
ATOM   6640  H HA     . THR A 1 399 ? 177.867 -5.826  164.679 1.00 78.49  ? 399 THR A HA     1 
ATOM   6641  H HB     . THR A 1 399 ? 177.159 -5.791  166.984 1.00 84.08  ? 399 THR A HB     1 
ATOM   6642  H HG1    . THR A 1 399 ? 176.049 -3.905  166.652 1.00 90.94  ? 399 THR A HG1    1 
ATOM   6643  H HG21   . THR A 1 399 ? 177.802 -3.969  168.305 1.00 81.48  ? 399 THR A HG21   1 
ATOM   6644  H HG22   . THR A 1 399 ? 179.060 -4.861  167.967 1.00 81.48  ? 399 THR A HG22   1 
ATOM   6645  H HG23   . THR A 1 399 ? 178.817 -3.510  167.186 1.00 81.48  ? 399 THR A HG23   1 
ATOM   6646  N N      . LEU A 1 400 ? 180.641 -4.616  164.794 1.00 60.19  ? 400 LEU A N      1 
ATOM   6647  C CA     . LEU A 1 400 ? 181.560 -3.605  164.264 1.00 60.15  ? 400 LEU A CA     1 
ATOM   6648  C C      . LEU A 1 400 ? 181.776 -3.714  162.750 1.00 63.59  ? 400 LEU A C      1 
ATOM   6649  O O      . LEU A 1 400 ? 182.865 -3.427  162.251 1.00 64.54  ? 400 LEU A O      1 
ATOM   6650  C CB     . LEU A 1 400 ? 182.905 -3.704  164.972 1.00 57.29  ? 400 LEU A CB     1 
ATOM   6651  C CG     . LEU A 1 400 ? 182.828 -3.735  166.498 1.00 56.27  ? 400 LEU A CG     1 
ATOM   6652  C CD1    . LEU A 1 400 ? 184.232 -3.687  167.079 1.00 52.02  ? 400 LEU A CD1    1 
ATOM   6653  C CD2    . LEU A 1 400 ? 181.972 -2.593  167.044 1.00 57.81  ? 400 LEU A CD2    1 
ATOM   6654  H H      . LEU A 1 400 ? 181.028 -5.329  165.078 1.00 72.23  ? 400 LEU A H      1 
ATOM   6655  H HA     . LEU A 1 400 ? 181.193 -2.726  164.447 1.00 72.17  ? 400 LEU A HA     1 
ATOM   6656  H HB2    . LEU A 1 400 ? 183.346 -4.519  164.685 1.00 68.75  ? 400 LEU A HB2    1 
ATOM   6657  H HB3    . LEU A 1 400 ? 183.443 -2.937  164.722 1.00 68.75  ? 400 LEU A HB3    1 
ATOM   6658  H HG     . LEU A 1 400 ? 182.421 -4.570  166.775 1.00 67.52  ? 400 LEU A HG     1 
ATOM   6659  H HD11   . LEU A 1 400 ? 184.173 -3.707  168.047 1.00 62.42  ? 400 LEU A HD11   1 
ATOM   6660  H HD12   . LEU A 1 400 ? 184.731 -4.456  166.762 1.00 62.42  ? 400 LEU A HD12   1 
ATOM   6661  H HD13   . LEU A 1 400 ? 184.665 -2.869  166.790 1.00 62.42  ? 400 LEU A HD13   1 
ATOM   6662  H HD21   . LEU A 1 400 ? 181.950 -2.650  168.012 1.00 69.37  ? 400 LEU A HD21   1 
ATOM   6663  H HD22   . LEU A 1 400 ? 182.361 -1.748  166.771 1.00 69.37  ? 400 LEU A HD22   1 
ATOM   6664  H HD23   . LEU A 1 400 ? 181.073 -2.675  166.687 1.00 69.37  ? 400 LEU A HD23   1 
ATOM   6665  N N      . GLY A 1 401 ? 180.737 -4.114  162.023 1.00 62.96  ? 401 GLY A N      1 
ATOM   6666  C CA     . GLY A 1 401 ? 180.851 -4.331  160.595 1.00 63.54  ? 401 GLY A CA     1 
ATOM   6667  C C      . GLY A 1 401 ? 181.149 -5.783  160.298 1.00 68.25  ? 401 GLY A C      1 
ATOM   6668  O O      . GLY A 1 401 ? 181.730 -6.488  161.122 1.00 67.84  ? 401 GLY A O      1 
ATOM   6669  H H      . GLY A 1 401 ? 179.952 -4.267  162.340 1.00 75.55  ? 401 GLY A H      1 
ATOM   6670  H HA2    . GLY A 1 401 ? 180.020 -4.087  160.158 1.00 76.25  ? 401 GLY A HA2    1 
ATOM   6671  H HA3    . GLY A 1 401 ? 181.567 -3.785  160.235 1.00 76.25  ? 401 GLY A HA3    1 
ATOM   6672  N N      . LYS A 1 402 ? 180.747 -6.235  159.114 1.00 72.22  ? 402 LYS A N      1 
ATOM   6673  C CA     . LYS A 1 402 ? 180.909 -7.632  158.738 1.00 74.12  ? 402 LYS A CA     1 
ATOM   6674  C C      . LYS A 1 402 ? 182.389 -8.001  158.700 1.00 69.07  ? 402 LYS A C      1 
ATOM   6675  O O      . LYS A 1 402 ? 182.868 -8.736  159.557 1.00 69.52  ? 402 LYS A O      1 
ATOM   6676  C CB     . LYS A 1 402 ? 180.245 -7.900  157.384 1.00 78.72  ? 402 LYS A CB     1 
ATOM   6677  C CG     . LYS A 1 402 ? 180.300 -9.340  156.931 1.00 85.15  ? 402 LYS A CG     1 
ATOM   6678  C CD     . LYS A 1 402 ? 179.571 -10.253 157.894 1.00 94.22  ? 402 LYS A CD     1 
ATOM   6679  C CE     . LYS A 1 402 ? 179.526 -11.682 157.369 1.00 103.96 ? 402 LYS A CE     1 
ATOM   6680  N NZ     . LYS A 1 402 ? 178.744 -11.800 156.104 1.00 108.63 ? 402 LYS A NZ     1 
ATOM   6681  H H      . LYS A 1 402 ? 180.376 -5.749  158.509 1.00 86.66  ? 402 LYS A H      1 
ATOM   6682  H HA     . LYS A 1 402 ? 180.476 -8.191  159.401 1.00 88.94  ? 402 LYS A HA     1 
ATOM   6683  H HB2    . LYS A 1 402 ? 179.311 -7.646  157.442 1.00 94.46  ? 402 LYS A HB2    1 
ATOM   6684  H HB3    . LYS A 1 402 ? 180.689 -7.362  156.710 1.00 94.46  ? 402 LYS A HB3    1 
ATOM   6685  H HG2    . LYS A 1 402 ? 179.880 -9.418  156.061 1.00 102.17 ? 402 LYS A HG2    1 
ATOM   6686  H HG3    . LYS A 1 402 ? 181.226 -9.625  156.884 1.00 102.17 ? 402 LYS A HG3    1 
ATOM   6687  H HD2    . LYS A 1 402 ? 180.034 -10.256 158.747 1.00 113.06 ? 402 LYS A HD2    1 
ATOM   6688  H HD3    . LYS A 1 402 ? 178.660 -9.940  158.007 1.00 113.06 ? 402 LYS A HD3    1 
ATOM   6689  H HE2    . LYS A 1 402 ? 180.430 -11.984 157.192 1.00 124.75 ? 402 LYS A HE2    1 
ATOM   6690  H HE3    . LYS A 1 402 ? 179.109 -12.252 158.034 1.00 124.75 ? 402 LYS A HE3    1 
ATOM   6691  H HZ1    . LYS A 1 402 ? 178.739 -12.646 155.827 1.00 130.35 ? 402 LYS A HZ1    1 
ATOM   6692  H HZ2    . LYS A 1 402 ? 177.905 -11.535 156.239 1.00 130.35 ? 402 LYS A HZ2    1 
ATOM   6693  H HZ3    . LYS A 1 402 ? 179.110 -11.291 155.472 1.00 130.35 ? 402 LYS A HZ3    1 
ATOM   6694  N N      . ASN A 1 403 ? 183.114 -7.460  157.730 1.00 64.90  ? 403 ASN A N      1 
ATOM   6695  C CA     . ASN A 1 403 ? 184.518 -7.799  157.553 1.00 67.77  ? 403 ASN A CA     1 
ATOM   6696  C C      . ASN A 1 403 ? 185.394 -7.223  158.657 1.00 71.79  ? 403 ASN A C      1 
ATOM   6697  O O      . ASN A 1 403 ? 186.221 -7.935  159.240 1.00 72.76  ? 403 ASN A O      1 
ATOM   6698  C CB     . ASN A 1 403 ? 185.002 -7.315  156.190 1.00 70.24  ? 403 ASN A CB     1 
ATOM   6699  C CG     . ASN A 1 403 ? 184.120 -7.804  155.061 1.00 74.70  ? 403 ASN A CG     1 
ATOM   6700  O OD1    . ASN A 1 403 ? 183.509 -7.010  154.351 1.00 79.05  ? 403 ASN A OD1    1 
ATOM   6701  N ND2    . ASN A 1 403 ? 184.033 -9.117  154.902 1.00 75.13  ? 403 ASN A ND2    1 
ATOM   6702  H H      . ASN A 1 403 ? 182.815 -6.892  157.158 1.00 77.88  ? 403 ASN A H      1 
ATOM   6703  H HA     . ASN A 1 403 ? 184.611 -8.764  157.574 1.00 81.32  ? 403 ASN A HA     1 
ATOM   6704  H HB2    . ASN A 1 403 ? 184.998 -6.345  156.178 1.00 84.28  ? 403 ASN A HB2    1 
ATOM   6705  H HB3    . ASN A 1 403 ? 185.901 -7.646  156.036 1.00 84.28  ? 403 ASN A HB3    1 
ATOM   6706  H HD21   . ASN A 1 403 ? 183.545 -9.443  154.274 1.00 90.15  ? 403 ASN A HD21   1 
ATOM   6707  H HD22   . ASN A 1 403 ? 184.466 -9.643  155.428 1.00 90.15  ? 403 ASN A HD22   1 
ATOM   6708  N N      . VAL A 1 404 ? 185.207 -5.934  158.936 1.00 71.78  ? 404 VAL A N      1 
ATOM   6709  C CA     . VAL A 1 404 ? 185.924 -5.258  160.015 1.00 68.13  ? 404 VAL A CA     1 
ATOM   6710  C C      . VAL A 1 404 ? 185.766 -6.024  161.339 1.00 65.06  ? 404 VAL A C      1 
ATOM   6711  O O      . VAL A 1 404 ? 186.756 -6.395  161.974 1.00 65.16  ? 404 VAL A O      1 
ATOM   6712  C CB     . VAL A 1 404 ? 185.435 -3.788  160.171 1.00 62.87  ? 404 VAL A CB     1 
ATOM   6713  C CG1    . VAL A 1 404 ? 185.980 -3.143  161.437 1.00 66.85  ? 404 VAL A CG1    1 
ATOM   6714  C CG2    . VAL A 1 404 ? 185.846 -2.963  158.967 1.00 58.38  ? 404 VAL A CG2    1 
ATOM   6715  H H      . VAL A 1 404 ? 184.664 -5.423  158.508 1.00 86.13  ? 404 VAL A H      1 
ATOM   6716  H HA     . VAL A 1 404 ? 186.868 -5.235  159.797 1.00 81.76  ? 404 VAL A HA     1 
ATOM   6717  H HB     . VAL A 1 404 ? 184.467 -3.780  160.223 1.00 75.45  ? 404 VAL A HB     1 
ATOM   6718  H HG11   . VAL A 1 404 ? 185.652 -2.232  161.494 1.00 80.22  ? 404 VAL A HG11   1 
ATOM   6719  H HG12   . VAL A 1 404 ? 185.678 -3.652  162.206 1.00 80.22  ? 404 VAL A HG12   1 
ATOM   6720  H HG13   . VAL A 1 404 ? 186.950 -3.144  161.400 1.00 80.22  ? 404 VAL A HG13   1 
ATOM   6721  H HG21   . VAL A 1 404 ? 185.531 -2.053  159.086 1.00 70.06  ? 404 VAL A HG21   1 
ATOM   6722  H HG22   . VAL A 1 404 ? 186.813 -2.972  158.893 1.00 70.06  ? 404 VAL A HG22   1 
ATOM   6723  H HG23   . VAL A 1 404 ? 185.449 -3.349  158.170 1.00 70.06  ? 404 VAL A HG23   1 
ATOM   6724  N N      . GLY A 1 405 ? 184.524 -6.273  161.744 1.00 63.10  ? 405 GLY A N      1 
ATOM   6725  C CA     . GLY A 1 405 ? 184.252 -6.946  163.003 1.00 66.38  ? 405 GLY A CA     1 
ATOM   6726  C C      . GLY A 1 405 ? 184.888 -8.320  163.103 1.00 72.89  ? 405 GLY A C      1 
ATOM   6727  O O      . GLY A 1 405 ? 185.366 -8.722  164.166 1.00 72.99  ? 405 GLY A O      1 
ATOM   6728  H H      . GLY A 1 405 ? 183.818 -6.059  161.301 1.00 75.73  ? 405 GLY A H      1 
ATOM   6729  H HA2    . GLY A 1 405 ? 184.585 -6.403  163.734 1.00 79.66  ? 405 GLY A HA2    1 
ATOM   6730  H HA3    . GLY A 1 405 ? 183.293 -7.047  163.111 1.00 79.66  ? 405 GLY A HA3    1 
ATOM   6731  N N      . GLU A 1 406 ? 184.892 -9.040  161.987 1.00 76.80  ? 406 GLU A N      1 
ATOM   6732  C CA     . GLU A 1 406 ? 185.491 -10.363 161.928 1.00 77.28  ? 406 GLU A CA     1 
ATOM   6733  C C      . GLU A 1 406 ? 187.003 -10.287 162.109 1.00 71.96  ? 406 GLU A C      1 
ATOM   6734  O O      . GLU A 1 406 ? 187.598 -11.155 162.746 1.00 70.80  ? 406 GLU A O      1 
ATOM   6735  C CB     . GLU A 1 406 ? 185.153 -11.043 160.597 1.00 82.74  ? 406 GLU A CB     1 
ATOM   6736  C CG     . GLU A 1 406 ? 183.760 -11.661 160.557 1.00 87.76  ? 406 GLU A CG     1 
ATOM   6737  C CD     . GLU A 1 406 ? 183.392 -12.215 159.188 1.00 93.35  ? 406 GLU A CD     1 
ATOM   6738  O OE1    . GLU A 1 406 ? 182.317 -12.841 159.073 1.00 93.67  ? 406 GLU A OE1    1 
ATOM   6739  O OE2    . GLU A 1 406 ? 184.172 -12.020 158.227 1.00 96.58  ? 406 GLU A OE2    1 
ATOM   6740  H H      . GLU A 1 406 ? 184.549 -8.779  161.242 1.00 92.16  ? 406 GLU A H      1 
ATOM   6741  H HA     . GLU A 1 406 ? 185.129 -10.908 162.645 1.00 92.74  ? 406 GLU A HA     1 
ATOM   6742  H HB2    . GLU A 1 406 ? 185.205 -10.383 159.888 1.00 99.29  ? 406 GLU A HB2    1 
ATOM   6743  H HB3    . GLU A 1 406 ? 185.796 -11.751 160.436 1.00 99.29  ? 406 GLU A HB3    1 
ATOM   6744  H HG2    . GLU A 1 406 ? 183.721 -12.391 161.195 1.00 105.32 ? 406 GLU A HG2    1 
ATOM   6745  H HG3    . GLU A 1 406 ? 183.108 -10.982 160.790 1.00 105.32 ? 406 GLU A HG3    1 
ATOM   6746  N N      . SER A 1 407 ? 187.622 -9.253  161.547 1.00 68.61  ? 407 SER A N      1 
ATOM   6747  C CA     . SER A 1 407 ? 189.064 -9.074  161.675 1.00 67.59  ? 407 SER A CA     1 
ATOM   6748  C C      . SER A 1 407 ? 189.447 -8.698  163.106 1.00 68.11  ? 407 SER A C      1 
ATOM   6749  O O      . SER A 1 407 ? 190.501 -9.101  163.609 1.00 69.92  ? 407 SER A O      1 
ATOM   6750  C CB     . SER A 1 407 ? 189.560 -7.999  160.717 1.00 67.15  ? 407 SER A CB     1 
ATOM   6751  O OG     . SER A 1 407 ? 190.964 -7.850  160.832 1.00 69.62  ? 407 SER A OG     1 
ATOM   6752  H H      . SER A 1 407 ? 187.229 -8.641  161.088 1.00 82.33  ? 407 SER A H      1 
ATOM   6753  H HA     . SER A 1 407 ? 189.509 -9.907  161.452 1.00 81.11  ? 407 SER A HA     1 
ATOM   6754  H HB2    . SER A 1 407 ? 189.342 -8.258  159.808 1.00 80.58  ? 407 SER A HB2    1 
ATOM   6755  H HB3    . SER A 1 407 ? 189.132 -7.157  160.936 1.00 80.58  ? 407 SER A HB3    1 
ATOM   6756  H HG     . SER A 1 407 ? 191.234 -7.257  160.303 1.00 83.55  ? 407 SER A HG     1 
ATOM   6757  N N      . ILE A 1 408 ? 188.585 -7.924  163.755 1.00 63.85  ? 408 ILE A N      1 
ATOM   6758  C CA     . ILE A 1 408 ? 188.808 -7.534  165.137 1.00 63.36  ? 408 ILE A CA     1 
ATOM   6759  C C      . ILE A 1 408 ? 188.682 -8.754  166.056 1.00 67.59  ? 408 ILE A C      1 
ATOM   6760  O O      . ILE A 1 408 ? 189.365 -8.843  167.081 1.00 68.19  ? 408 ILE A O      1 
ATOM   6761  C CB     . ILE A 1 408 ? 187.835 -6.402  165.556 1.00 50.92  ? 408 ILE A CB     1 
ATOM   6762  C CG1    . ILE A 1 408 ? 188.253 -5.088  164.893 1.00 57.20  ? 408 ILE A CG1    1 
ATOM   6763  C CG2    . ILE A 1 408 ? 187.814 -6.219  167.055 1.00 42.71  ? 408 ILE A CG2    1 
ATOM   6764  C CD1    . ILE A 1 408 ? 187.223 -3.963  165.009 1.00 59.82  ? 408 ILE A CD1    1 
ATOM   6765  H H      . ILE A 1 408 ? 187.860 -7.611  163.415 1.00 76.62  ? 408 ILE A H      1 
ATOM   6766  H HA     . ILE A 1 408 ? 189.712 -7.192  165.222 1.00 76.04  ? 408 ILE A HA     1 
ATOM   6767  H HB     . ILE A 1 408 ? 186.941 -6.632  165.257 1.00 61.10  ? 408 ILE A HB     1 
ATOM   6768  H HG12   . ILE A 1 408 ? 189.074 -4.779  165.307 1.00 68.63  ? 408 ILE A HG12   1 
ATOM   6769  H HG13   . ILE A 1 408 ? 188.405 -5.252  163.949 1.00 68.63  ? 408 ILE A HG13   1 
ATOM   6770  H HG21   . ILE A 1 408 ? 187.195 -5.505  167.277 1.00 51.26  ? 408 ILE A HG21   1 
ATOM   6771  H HG22   . ILE A 1 408 ? 187.526 -7.048  167.470 1.00 51.26  ? 408 ILE A HG22   1 
ATOM   6772  H HG23   . ILE A 1 408 ? 188.706 -5.990  167.357 1.00 51.26  ? 408 ILE A HG23   1 
ATOM   6773  H HD11   . ILE A 1 408 ? 187.568 -3.173  164.564 1.00 71.79  ? 408 ILE A HD11   1 
ATOM   6774  H HD12   . ILE A 1 408 ? 186.397 -4.247  164.587 1.00 71.79  ? 408 ILE A HD12   1 
ATOM   6775  H HD13   . ILE A 1 408 ? 187.068 -3.773  165.947 1.00 71.79  ? 408 ILE A HD13   1 
ATOM   6776  N N      . ARG A 1 409 ? 187.817 -9.692  165.681 1.00 69.78  ? 409 ARG A N      1 
ATOM   6777  C CA     . ARG A 1 409 ? 187.598 -10.891 166.484 1.00 72.65  ? 409 ARG A CA     1 
ATOM   6778  C C      . ARG A 1 409 ? 188.843 -11.769 166.481 1.00 76.12  ? 409 ARG A C      1 
ATOM   6779  O O      . ARG A 1 409 ? 189.161 -12.408 167.487 1.00 79.97  ? 409 ARG A O      1 
ATOM   6780  C CB     . ARG A 1 409 ? 186.404 -11.682 165.949 1.00 72.76  ? 409 ARG A CB     1 
ATOM   6781  C CG     . ARG A 1 409 ? 185.989 -12.859 166.804 1.00 73.52  ? 409 ARG A CG     1 
ATOM   6782  C CD     . ARG A 1 409 ? 185.104 -13.792 166.008 1.00 83.14  ? 409 ARG A CD     1 
ATOM   6783  N NE     . ARG A 1 409 ? 184.556 -14.875 166.823 1.00 95.57  ? 409 ARG A NE     1 
ATOM   6784  C CZ     . ARG A 1 409 ? 183.804 -15.868 166.353 1.00 104.40 ? 409 ARG A CZ     1 
ATOM   6785  N NH1    . ARG A 1 409 ? 183.497 -15.927 165.062 1.00 108.84 ? 409 ARG A NH1    1 
ATOM   6786  N NH2    . ARG A 1 409 ? 183.357 -16.807 167.175 1.00 105.50 ? 409 ARG A NH2    1 
ATOM   6787  H H      . ARG A 1 409 ? 187.343 -9.657  164.964 1.00 83.74  ? 409 ARG A H      1 
ATOM   6788  H HA     . ARG A 1 409 ? 187.407 -10.634 167.399 1.00 87.18  ? 409 ARG A HA     1 
ATOM   6789  H HB2    . ARG A 1 409 ? 185.643 -11.085 165.881 1.00 87.31  ? 409 ARG A HB2    1 
ATOM   6790  H HB3    . ARG A 1 409 ? 186.629 -12.024 165.069 1.00 87.31  ? 409 ARG A HB3    1 
ATOM   6791  H HG2    . ARG A 1 409 ? 186.777 -13.348 167.088 1.00 88.23  ? 409 ARG A HG2    1 
ATOM   6792  H HG3    . ARG A 1 409 ? 185.490 -12.541 167.573 1.00 88.23  ? 409 ARG A HG3    1 
ATOM   6793  H HD2    . ARG A 1 409 ? 184.361 -13.288 165.640 1.00 99.77  ? 409 ARG A HD2    1 
ATOM   6794  H HD3    . ARG A 1 409 ? 185.624 -14.189 165.292 1.00 99.77  ? 409 ARG A HD3    1 
ATOM   6795  H HE     . ARG A 1 409 ? 184.732 -14.870 167.665 1.00 114.68 ? 409 ARG A HE     1 
ATOM   6796  H HH11   . ARG A 1 409 ? 183.785 -15.321 164.524 1.00 130.61 ? 409 ARG A HH11   1 
ATOM   6797  H HH12   . ARG A 1 409 ? 183.010 -16.571 164.765 1.00 130.61 ? 409 ARG A HH12   1 
ATOM   6798  H HH21   . ARG A 1 409 ? 183.552 -16.775 168.012 1.00 126.60 ? 409 ARG A HH21   1 
ATOM   6799  H HH22   . ARG A 1 409 ? 182.870 -17.448 166.872 1.00 126.60 ? 409 ARG A HH22   1 
ATOM   6800  N N      . GLU A 1 410 ? 189.547 -11.798 165.353 1.00 74.76  ? 410 GLU A N      1 
ATOM   6801  C CA     . GLU A 1 410 ? 190.769 -12.583 165.250 1.00 77.88  ? 410 GLU A CA     1 
ATOM   6802  C C      . GLU A 1 410 ? 191.916 -11.898 165.978 1.00 76.68  ? 410 GLU A C      1 
ATOM   6803  O O      . GLU A 1 410 ? 192.648 -12.537 166.735 1.00 82.68  ? 410 GLU A O      1 
ATOM   6804  C CB     . GLU A 1 410 ? 191.136 -12.818 163.791 1.00 86.23  ? 410 GLU A CB     1 
ATOM   6805  C CG     . GLU A 1 410 ? 190.250 -13.830 163.110 1.00 99.87  ? 410 GLU A CG     1 
ATOM   6806  C CD     . GLU A 1 410 ? 190.545 -13.943 161.636 1.00 114.83 ? 410 GLU A CD     1 
ATOM   6807  O OE1    . GLU A 1 410 ? 190.789 -12.897 160.998 1.00 115.98 ? 410 GLU A OE1    1 
ATOM   6808  O OE2    . GLU A 1 410 ? 190.541 -15.078 161.115 1.00 125.34 ? 410 GLU A OE2    1 
ATOM   6809  H H      . GLU A 1 410 ? 189.338 -11.373 164.636 1.00 89.71  ? 410 GLU A H      1 
ATOM   6810  H HA     . GLU A 1 410 ? 190.624 -13.448 165.665 1.00 93.46  ? 410 GLU A HA     1 
ATOM   6811  H HB2    . GLU A 1 410 ? 191.057 -11.980 163.309 1.00 103.48 ? 410 GLU A HB2    1 
ATOM   6812  H HB3    . GLU A 1 410 ? 192.049 -13.141 163.745 1.00 103.48 ? 410 GLU A HB3    1 
ATOM   6813  H HG2    . GLU A 1 410 ? 190.392 -14.700 163.515 1.00 119.85 ? 410 GLU A HG2    1 
ATOM   6814  H HG3    . GLU A 1 410 ? 189.323 -13.562 163.213 1.00 119.85 ? 410 GLU A HG3    1 
ATOM   6815  N N      . TYR A 1 411 ? 192.069 -10.598 165.762 1.00 70.29  ? 411 TYR A N      1 
ATOM   6816  C CA     . TYR A 1 411 ? 193.123 -9.850  166.440 1.00 67.73  ? 411 TYR A CA     1 
ATOM   6817  C C      . TYR A 1 411 ? 192.885 -8.355  166.432 1.00 64.13  ? 411 TYR A C      1 
ATOM   6818  O O      . TYR A 1 411 ? 192.506 -7.777  165.417 1.00 66.10  ? 411 TYR A O      1 
ATOM   6819  C CB     . TYR A 1 411 ? 194.467 -10.128 165.779 1.00 72.35  ? 411 TYR A CB     1 
ATOM   6820  C CG     . TYR A 1 411 ? 195.648 -9.524  166.505 1.00 81.04  ? 411 TYR A CG     1 
ATOM   6821  C CD1    . TYR A 1 411 ? 196.090 -10.061 167.710 1.00 87.98  ? 411 TYR A CD1    1 
ATOM   6822  C CD2    . TYR A 1 411 ? 196.339 -8.437  165.980 1.00 81.51  ? 411 TYR A CD2    1 
ATOM   6823  C CE1    . TYR A 1 411 ? 197.175 -9.532  168.380 1.00 89.89  ? 411 TYR A CE1    1 
ATOM   6824  C CE2    . TYR A 1 411 ? 197.432 -7.898  166.644 1.00 83.68  ? 411 TYR A CE2    1 
ATOM   6825  C CZ     . TYR A 1 411 ? 197.846 -8.454  167.849 1.00 89.02  ? 411 TYR A CZ     1 
ATOM   6826  O OH     . TYR A 1 411 ? 198.929 -7.944  168.542 1.00 91.35  ? 411 TYR A OH     1 
ATOM   6827  H H      . TYR A 1 411 ? 191.582 -10.127 165.233 1.00 84.35  ? 411 TYR A H      1 
ATOM   6828  H HA     . TYR A 1 411 ? 193.174 -10.142 167.364 1.00 81.28  ? 411 TYR A HA     1 
ATOM   6829  H HB2    . TYR A 1 411 ? 194.602 -11.088 165.740 1.00 86.82  ? 411 TYR A HB2    1 
ATOM   6830  H HB3    . TYR A 1 411 ? 194.453 -9.762  164.880 1.00 86.82  ? 411 TYR A HB3    1 
ATOM   6831  H HD1    . TYR A 1 411 ? 195.643 -10.791 168.074 1.00 105.57 ? 411 TYR A HD1    1 
ATOM   6832  H HD2    . TYR A 1 411 ? 196.064 -8.066  165.173 1.00 97.81  ? 411 TYR A HD2    1 
ATOM   6833  H HE1    . TYR A 1 411 ? 197.452 -9.903  169.186 1.00 107.87 ? 411 TYR A HE1    1 
ATOM   6834  H HE2    . TYR A 1 411 ? 197.884 -7.169  166.285 1.00 100.42 ? 411 TYR A HE2    1 
ATOM   6835  H HH     . TYR A 1 411 ? 199.256 -7.293  168.124 1.00 109.61 ? 411 TYR A HH     1 
ATOM   6836  N N      . PHE A 1 412 ? 193.122 -7.733  167.576 1.00 63.20  ? 412 PHE A N      1 
ATOM   6837  C CA     . PHE A 1 412 ? 193.190 -6.286  167.657 1.00 63.67  ? 412 PHE A CA     1 
ATOM   6838  C C      . PHE A 1 412 ? 194.087 -5.930  168.826 1.00 71.34  ? 412 PHE A C      1 
ATOM   6839  O O      . PHE A 1 412 ? 194.470 -6.798  169.609 1.00 81.25  ? 412 PHE A O      1 
ATOM   6840  C CB     . PHE A 1 412 ? 191.789 -5.672  167.800 1.00 60.57  ? 412 PHE A CB     1 
ATOM   6841  C CG     . PHE A 1 412 ? 191.177 -5.822  169.171 1.00 59.60  ? 412 PHE A CG     1 
ATOM   6842  C CD1    . PHE A 1 412 ? 190.438 -6.948  169.498 1.00 55.35  ? 412 PHE A CD1    1 
ATOM   6843  C CD2    . PHE A 1 412 ? 191.313 -4.817  170.121 1.00 62.28  ? 412 PHE A CD2    1 
ATOM   6844  C CE1    . PHE A 1 412 ? 189.865 -7.082  170.749 1.00 53.84  ? 412 PHE A CE1    1 
ATOM   6845  C CE2    . PHE A 1 412 ? 190.745 -4.943  171.375 1.00 60.28  ? 412 PHE A CE2    1 
ATOM   6846  C CZ     . PHE A 1 412 ? 190.018 -6.079  171.690 1.00 57.61  ? 412 PHE A CZ     1 
ATOM   6847  H H      . PHE A 1 412 ? 193.249 -8.132  168.327 1.00 75.84  ? 412 PHE A H      1 
ATOM   6848  H HA     . PHE A 1 412 ? 193.593 -5.938  166.846 1.00 76.40  ? 412 PHE A HA     1 
ATOM   6849  H HB2    . PHE A 1 412 ? 191.846 -4.723  167.605 1.00 72.69  ? 412 PHE A HB2    1 
ATOM   6850  H HB3    . PHE A 1 412 ? 191.196 -6.101  167.164 1.00 72.69  ? 412 PHE A HB3    1 
ATOM   6851  H HD1    . PHE A 1 412 ? 190.333 -7.626  168.870 1.00 66.42  ? 412 PHE A HD1    1 
ATOM   6852  H HD2    . PHE A 1 412 ? 191.803 -4.053  169.914 1.00 74.73  ? 412 PHE A HD2    1 
ATOM   6853  H HE1    . PHE A 1 412 ? 189.377 -7.846  170.958 1.00 64.61  ? 412 PHE A HE1    1 
ATOM   6854  H HE2    . PHE A 1 412 ? 190.850 -4.266  172.005 1.00 72.33  ? 412 PHE A HE2    1 
ATOM   6855  H HZ     . PHE A 1 412 ? 189.634 -6.167  172.532 1.00 69.14  ? 412 PHE A HZ     1 
ATOM   6856  N N      . GLU A 1 413 ? 194.456 -4.663  168.925 1.00 68.90  ? 413 GLU A N      1 
ATOM   6857  C CA     . GLU A 1 413 ? 195.216 -4.188  170.068 1.00 66.62  ? 413 GLU A CA     1 
ATOM   6858  C C      . GLU A 1 413 ? 194.913 -2.725  170.285 1.00 59.13  ? 413 GLU A C      1 
ATOM   6859  O O      . GLU A 1 413 ? 194.666 -1.994  169.336 1.00 60.92  ? 413 GLU A O      1 
ATOM   6860  C CB     . GLU A 1 413 ? 196.719 -4.411  169.869 1.00 74.05  ? 413 GLU A CB     1 
ATOM   6861  C CG     . GLU A 1 413 ? 197.243 -4.038  168.496 1.00 79.06  ? 413 GLU A CG     1 
ATOM   6862  C CD     . GLU A 1 413 ? 198.730 -4.322  168.338 1.00 79.01  ? 413 GLU A CD     1 
ATOM   6863  O OE1    . GLU A 1 413 ? 199.510 -3.970  169.249 1.00 74.76  ? 413 GLU A OE1    1 
ATOM   6864  O OE2    . GLU A 1 413 ? 199.116 -4.900  167.301 1.00 81.10  ? 413 GLU A OE2    1 
ATOM   6865  H H      . GLU A 1 413 ? 194.279 -4.056  168.342 1.00 82.68  ? 413 GLU A H      1 
ATOM   6866  H HA     . GLU A 1 413 ? 194.940 -4.676  170.860 1.00 79.94  ? 413 GLU A HA     1 
ATOM   6867  H HB2    . GLU A 1 413 ? 197.199 -3.876  170.521 1.00 88.86  ? 413 GLU A HB2    1 
ATOM   6868  H HB3    . GLU A 1 413 ? 196.913 -5.350  170.012 1.00 88.86  ? 413 GLU A HB3    1 
ATOM   6869  H HG2    . GLU A 1 413 ? 196.766 -4.552  167.826 1.00 94.87  ? 413 GLU A HG2    1 
ATOM   6870  H HG3    . GLU A 1 413 ? 197.101 -3.090  168.350 1.00 94.87  ? 413 GLU A HG3    1 
ATOM   6871  N N      . ILE A 1 414 ? 194.894 -2.319  171.548 1.00 53.51  ? 414 ILE A N      1 
ATOM   6872  C CA     . ILE A 1 414 ? 194.718 -0.922  171.922 1.00 47.09  ? 414 ILE A CA     1 
ATOM   6873  C C      . ILE A 1 414 ? 196.080 -0.249  172.075 1.00 46.87  ? 414 ILE A C      1 
ATOM   6874  O O      . ILE A 1 414 ? 196.878 -0.647  172.910 1.00 48.94  ? 414 ILE A O      1 
ATOM   6875  C CB     . ILE A 1 414 ? 193.963 -0.806  173.255 1.00 44.62  ? 414 ILE A CB     1 
ATOM   6876  C CG1    . ILE A 1 414 ? 192.669 -1.628  173.210 1.00 44.97  ? 414 ILE A CG1    1 
ATOM   6877  C CG2    . ILE A 1 414 ? 193.650 0.652   173.582 1.00 43.80  ? 414 ILE A CG2    1 
ATOM   6878  C CD1    . ILE A 1 414 ? 191.704 -1.239  172.086 1.00 42.66  ? 414 ILE A CD1    1 
ATOM   6879  H H      . ILE A 1 414 ? 194.982 -2.846  172.222 1.00 64.21  ? 414 ILE A H      1 
ATOM   6880  H HA     . ILE A 1 414 ? 194.214 -0.458  171.235 1.00 56.51  ? 414 ILE A HA     1 
ATOM   6881  H HB     . ILE A 1 414 ? 194.528 -1.162  173.958 1.00 53.55  ? 414 ILE A HB     1 
ATOM   6882  H HG12   . ILE A 1 414 ? 192.900 -2.562  173.088 1.00 53.96  ? 414 ILE A HG12   1 
ATOM   6883  H HG13   . ILE A 1 414 ? 192.201 -1.515  174.052 1.00 53.96  ? 414 ILE A HG13   1 
ATOM   6884  H HG21   . ILE A 1 414 ? 193.175 0.690   174.426 1.00 52.56  ? 414 ILE A HG21   1 
ATOM   6885  H HG22   . ILE A 1 414 ? 194.482 1.146   173.647 1.00 52.56  ? 414 ILE A HG22   1 
ATOM   6886  H HG23   . ILE A 1 414 ? 193.099 1.022   172.874 1.00 52.56  ? 414 ILE A HG23   1 
ATOM   6887  H HD11   . ILE A 1 414 ? 190.919 -1.806  172.134 1.00 51.19  ? 414 ILE A HD11   1 
ATOM   6888  H HD12   . ILE A 1 414 ? 191.448 -0.310  172.198 1.00 51.19  ? 414 ILE A HD12   1 
ATOM   6889  H HD13   . ILE A 1 414 ? 192.148 -1.359  171.232 1.00 51.19  ? 414 ILE A HD13   1 
ATOM   6890  N N      . ILE A 1 415 ? 196.338 0.762   171.256 1.00 50.92  ? 415 ILE A N      1 
ATOM   6891  C CA     . ILE A 1 415 ? 197.578 1.522   171.314 1.00 56.85  ? 415 ILE A CA     1 
ATOM   6892  C C      . ILE A 1 415 ? 197.300 2.958   171.775 1.00 60.07  ? 415 ILE A C      1 
ATOM   6893  O O      . ILE A 1 415 ? 196.428 3.647   171.226 1.00 62.08  ? 415 ILE A O      1 
ATOM   6894  C CB     . ILE A 1 415 ? 198.250 1.555   169.939 1.00 61.96  ? 415 ILE A CB     1 
ATOM   6895  C CG1    . ILE A 1 415 ? 198.470 0.129   169.432 1.00 64.26  ? 415 ILE A CG1    1 
ATOM   6896  C CG2    . ILE A 1 415 ? 199.572 2.303   170.009 1.00 65.70  ? 415 ILE A CG2    1 
ATOM   6897  C CD1    . ILE A 1 415 ? 198.939 0.061   167.998 1.00 68.41  ? 415 ILE A CD1    1 
ATOM   6898  H H      . ILE A 1 415 ? 195.797 1.033   170.644 1.00 61.11  ? 415 ILE A H      1 
ATOM   6899  H HA     . ILE A 1 415 ? 198.186 1.106   171.945 1.00 68.22  ? 415 ILE A HA     1 
ATOM   6900  H HB     . ILE A 1 415 ? 197.665 2.018   169.319 1.00 74.36  ? 415 ILE A HB     1 
ATOM   6901  H HG12   . ILE A 1 415 ? 199.142 -0.300  169.985 1.00 77.12  ? 415 ILE A HG12   1 
ATOM   6902  H HG13   . ILE A 1 415 ? 197.633 -0.358  169.494 1.00 77.12  ? 415 ILE A HG13   1 
ATOM   6903  H HG21   . ILE A 1 415 ? 199.978 2.310   169.128 1.00 78.83  ? 415 ILE A HG21   1 
ATOM   6904  H HG22   . ILE A 1 415 ? 199.405 3.212   170.305 1.00 78.83  ? 415 ILE A HG22   1 
ATOM   6905  H HG23   . ILE A 1 415 ? 200.156 1.852   170.639 1.00 78.83  ? 415 ILE A HG23   1 
ATOM   6906  H HD11   . ILE A 1 415 ? 199.056 -0.869  167.748 1.00 82.09  ? 415 ILE A HD11   1 
ATOM   6907  H HD12   . ILE A 1 415 ? 198.272 0.476   167.428 1.00 82.09  ? 415 ILE A HD12   1 
ATOM   6908  H HD13   . ILE A 1 415 ? 199.782 0.534   167.920 1.00 82.09  ? 415 ILE A HD13   1 
ATOM   6909  N N      . SER A 1 416 ? 198.041 3.395   172.788 1.00 58.76  ? 416 SER A N      1 
ATOM   6910  C CA     . SER A 1 416 ? 197.903 4.736   173.331 1.00 60.41  ? 416 SER A CA     1 
ATOM   6911  C C      . SER A 1 416 ? 199.282 5.297   173.624 1.00 65.21  ? 416 SER A C      1 
ATOM   6912  O O      . SER A 1 416 ? 200.283 4.775   173.138 1.00 68.87  ? 416 SER A O      1 
ATOM   6913  C CB     . SER A 1 416 ? 197.043 4.715   174.602 1.00 62.90  ? 416 SER A CB     1 
ATOM   6914  O OG     . SER A 1 416 ? 197.636 3.932   175.621 1.00 65.95  ? 416 SER A OG     1 
ATOM   6915  H H      . SER A 1 416 ? 198.641 2.923   173.184 1.00 70.51  ? 416 SER A H      1 
ATOM   6916  H HA     . SER A 1 416 ? 197.471 5.308   172.676 1.00 72.50  ? 416 SER A HA     1 
ATOM   6917  H HB2    . SER A 1 416 ? 196.940 5.624   174.925 1.00 75.48  ? 416 SER A HB2    1 
ATOM   6918  H HB3    . SER A 1 416 ? 196.175 4.342   174.386 1.00 75.48  ? 416 SER A HB3    1 
ATOM   6919  H HG     . SER A 1 416 ? 197.149 3.935   176.305 1.00 79.14  ? 416 SER A HG     1 
ATOM   6920  N N      . GLY A 1 417 ? 199.331 6.373   174.401 1.00 68.40  ? 417 GLY A N      1 
ATOM   6921  C CA     . GLY A 1 417 ? 200.593 6.950   174.829 1.00 72.19  ? 417 GLY A CA     1 
ATOM   6922  C C      . GLY A 1 417 ? 201.523 7.299   173.682 1.00 75.64  ? 417 GLY A C      1 
ATOM   6923  O O      . GLY A 1 417 ? 201.079 7.642   172.587 1.00 72.39  ? 417 GLY A O      1 
ATOM   6924  H H      . GLY A 1 417 ? 198.639 6.790   174.696 1.00 82.07  ? 417 GLY A H      1 
ATOM   6925  H HA2    . GLY A 1 417 ? 200.419 7.759   175.335 1.00 86.63  ? 417 GLY A HA2    1 
ATOM   6926  H HA3    . GLY A 1 417 ? 201.050 6.321   175.409 1.00 86.63  ? 417 GLY A HA3    1 
ATOM   6927  N N      . GLU A 1 418 ? 202.823 7.193   173.938 1.00 82.95  ? 418 GLU A N      1 
ATOM   6928  C CA     . GLU A 1 418 ? 203.834 7.572   172.961 1.00 88.46  ? 418 GLU A CA     1 
ATOM   6929  C C      . GLU A 1 418 ? 203.978 6.525   171.865 1.00 83.59  ? 418 GLU A C      1 
ATOM   6930  O O      . GLU A 1 418 ? 204.508 6.814   170.792 1.00 81.50  ? 418 GLU A O      1 
ATOM   6931  C CB     . GLU A 1 418 ? 205.178 7.801   173.656 1.00 99.91  ? 418 GLU A CB     1 
ATOM   6932  C CG     . GLU A 1 418 ? 205.127 8.858   174.756 1.00 107.44 ? 418 GLU A CG     1 
ATOM   6933  C CD     . GLU A 1 418 ? 206.463 9.064   175.441 1.00 114.84 ? 418 GLU A CD     1 
ATOM   6934  O OE1    . GLU A 1 418 ? 207.504 8.741   174.829 1.00 117.63 ? 418 GLU A OE1    1 
ATOM   6935  O OE2    . GLU A 1 418 ? 206.470 9.548   176.594 1.00 117.11 ? 418 GLU A OE2    1 
ATOM   6936  H H      . GLU A 1 418 ? 203.147 6.900   174.679 1.00 99.54  ? 418 GLU A H      1 
ATOM   6937  H HA     . GLU A 1 418 ? 203.569 8.406   172.543 1.00 106.16 ? 418 GLU A HA     1 
ATOM   6938  H HB2    . GLU A 1 418 ? 205.468 6.968   174.059 1.00 119.90 ? 418 GLU A HB2    1 
ATOM   6939  H HB3    . GLU A 1 418 ? 205.826 8.091   172.996 1.00 119.90 ? 418 GLU A HB3    1 
ATOM   6940  H HG2    . GLU A 1 418 ? 204.856 9.705   174.367 1.00 128.92 ? 418 GLU A HG2    1 
ATOM   6941  H HG3    . GLU A 1 418 ? 204.485 8.583   175.429 1.00 128.92 ? 418 GLU A HG3    1 
ATOM   6942  N N      . LYS A 1 419 ? 203.501 5.313   172.132 1.00 82.12  ? 419 LYS A N      1 
ATOM   6943  C CA     . LYS A 1 419 ? 203.556 4.242   171.142 1.00 83.25  ? 419 LYS A CA     1 
ATOM   6944  C C      . LYS A 1 419 ? 202.662 4.575   169.949 1.00 78.67  ? 419 LYS A C      1 
ATOM   6945  O O      . LYS A 1 419 ? 202.951 4.190   168.814 1.00 78.17  ? 419 LYS A O      1 
ATOM   6946  C CB     . LYS A 1 419 ? 203.131 2.906   171.762 1.00 88.54  ? 419 LYS A CB     1 
ATOM   6947  C CG     . LYS A 1 419 ? 203.940 2.483   172.986 1.00 95.75  ? 419 LYS A CG     1 
ATOM   6948  C CD     . LYS A 1 419 ? 205.404 2.199   172.658 1.00 103.20 ? 419 LYS A CD     1 
ATOM   6949  C CE     . LYS A 1 419 ? 205.574 0.964   171.783 1.00 106.68 ? 419 LYS A CE     1 
ATOM   6950  N NZ     . LYS A 1 419 ? 207.012 0.640   171.545 1.00 107.40 ? 419 LYS A NZ     1 
ATOM   6951  H H      . LYS A 1 419 ? 203.140 5.085   172.879 1.00 98.54  ? 419 LYS A H      1 
ATOM   6952  H HA     . LYS A 1 419 ? 204.467 4.151   170.822 1.00 99.90  ? 419 LYS A HA     1 
ATOM   6953  H HB2    . LYS A 1 419 ? 202.202 2.973   172.033 1.00 106.25 ? 419 LYS A HB2    1 
ATOM   6954  H HB3    . LYS A 1 419 ? 203.226 2.211   171.092 1.00 106.25 ? 419 LYS A HB3    1 
ATOM   6955  H HG2    . LYS A 1 419 ? 203.913 3.195   173.645 1.00 114.90 ? 419 LYS A HG2    1 
ATOM   6956  H HG3    . LYS A 1 419 ? 203.554 1.674   173.356 1.00 114.90 ? 419 LYS A HG3    1 
ATOM   6957  H HD2    . LYS A 1 419 ? 205.775 2.959   172.182 1.00 123.83 ? 419 LYS A HD2    1 
ATOM   6958  H HD3    . LYS A 1 419 ? 205.891 2.053   173.483 1.00 123.83 ? 419 LYS A HD3    1 
ATOM   6959  H HE2    . LYS A 1 419 ? 205.162 0.204   172.222 1.00 128.02 ? 419 LYS A HE2    1 
ATOM   6960  H HE3    . LYS A 1 419 ? 205.154 1.122   170.923 1.00 128.02 ? 419 LYS A HE3    1 
ATOM   6961  H HZ1    . LYS A 1 419 ? 207.080 -0.084  171.032 1.00 128.88 ? 419 LYS A HZ1    1 
ATOM   6962  H HZ2    . LYS A 1 419 ? 207.414 1.322   171.137 1.00 128.88 ? 419 LYS A HZ2    1 
ATOM   6963  H HZ3    . LYS A 1 419 ? 207.421 0.485   172.320 1.00 128.88 ? 419 LYS A HZ3    1 
ATOM   6964  N N      . LEU A 1 420 ? 201.582 5.303   170.213 1.00 74.79  ? 420 LEU A N      1 
ATOM   6965  C CA     . LEU A 1 420 ? 200.618 5.660   169.178 1.00 68.15  ? 420 LEU A CA     1 
ATOM   6966  C C      . LEU A 1 420 ? 201.212 6.638   168.163 1.00 68.64  ? 420 LEU A C      1 
ATOM   6967  O O      . LEU A 1 420 ? 200.855 6.613   166.984 1.00 67.52  ? 420 LEU A O      1 
ATOM   6968  C CB     . LEU A 1 420 ? 199.361 6.256   169.821 1.00 59.98  ? 420 LEU A CB     1 
ATOM   6969  C CG     . LEU A 1 420 ? 198.308 6.868   168.892 1.00 57.56  ? 420 LEU A CG     1 
ATOM   6970  C CD1    . LEU A 1 420 ? 197.770 5.870   167.878 1.00 54.09  ? 420 LEU A CD1    1 
ATOM   6971  C CD2    . LEU A 1 420 ? 197.173 7.440   169.718 1.00 60.24  ? 420 LEU A CD2    1 
ATOM   6972  H H      . LEU A 1 420 ? 201.383 5.606   170.993 1.00 89.75  ? 420 LEU A H      1 
ATOM   6973  H HA     . LEU A 1 420 ? 200.357 4.857   168.700 1.00 81.79  ? 420 LEU A HA     1 
ATOM   6974  H HB2    . LEU A 1 420 ? 198.921 5.553   170.324 1.00 71.97  ? 420 LEU A HB2    1 
ATOM   6975  H HB3    . LEU A 1 420 ? 199.641 6.956   170.431 1.00 71.97  ? 420 LEU A HB3    1 
ATOM   6976  H HG     . LEU A 1 420 ? 198.713 7.599   168.400 1.00 69.08  ? 420 LEU A HG     1 
ATOM   6977  H HD11   . LEU A 1 420 ? 197.110 6.312   167.320 1.00 64.91  ? 420 LEU A HD11   1 
ATOM   6978  H HD12   . LEU A 1 420 ? 198.504 5.550   167.331 1.00 64.91  ? 420 LEU A HD12   1 
ATOM   6979  H HD13   . LEU A 1 420 ? 197.361 5.129   168.351 1.00 64.91  ? 420 LEU A HD13   1 
ATOM   6980  H HD21   . LEU A 1 420 ? 196.512 7.825   169.121 1.00 72.28  ? 420 LEU A HD21   1 
ATOM   6981  H HD22   . LEU A 1 420 ? 196.773 6.728   170.241 1.00 72.28  ? 420 LEU A HD22   1 
ATOM   6982  H HD23   . LEU A 1 420 ? 197.526 8.125   170.306 1.00 72.28  ? 420 LEU A HD23   1 
ATOM   6983  N N      . PHE A 1 421 ? 202.128 7.487   168.624 1.00 68.85  ? 421 PHE A N      1 
ATOM   6984  C CA     . PHE A 1 421 ? 202.724 8.524   167.781 1.00 65.28  ? 421 PHE A CA     1 
ATOM   6985  C C      . PHE A 1 421 ? 203.733 7.940   166.789 1.00 72.80  ? 421 PHE A C      1 
ATOM   6986  O O      . PHE A 1 421 ? 204.209 8.642   165.895 1.00 73.16  ? 421 PHE A O      1 
ATOM   6987  C CB     . PHE A 1 421 ? 203.400 9.588   168.652 1.00 58.22  ? 421 PHE A CB     1 
ATOM   6988  C CG     . PHE A 1 421 ? 202.499 10.180  169.705 1.00 57.22  ? 421 PHE A CG     1 
ATOM   6989  C CD1    . PHE A 1 421 ? 201.159 10.425  169.442 1.00 57.63  ? 421 PHE A CD1    1 
ATOM   6990  C CD2    . PHE A 1 421 ? 202.987 10.487  170.959 1.00 56.71  ? 421 PHE A CD2    1 
ATOM   6991  C CE1    . PHE A 1 421 ? 200.327 10.968  170.413 1.00 52.80  ? 421 PHE A CE1    1 
ATOM   6992  C CE2    . PHE A 1 421 ? 202.158 11.030  171.928 1.00 54.60  ? 421 PHE A CE2    1 
ATOM   6993  C CZ     . PHE A 1 421 ? 200.824 11.268  171.649 1.00 50.71  ? 421 PHE A CZ     1 
ATOM   6994  H H      . PHE A 1 421 ? 202.424 7.484   169.432 1.00 82.62  ? 421 PHE A H      1 
ATOM   6995  H HA     . PHE A 1 421 ? 202.021 8.957   167.272 1.00 78.34  ? 421 PHE A HA     1 
ATOM   6996  H HB2    . PHE A 1 421 ? 204.158 9.186   169.104 1.00 69.86  ? 421 PHE A HB2    1 
ATOM   6997  H HB3    . PHE A 1 421 ? 203.704 10.311  168.082 1.00 69.86  ? 421 PHE A HB3    1 
ATOM   6998  H HD1    . PHE A 1 421 ? 200.812 10.223  168.603 1.00 69.16  ? 421 PHE A HD1    1 
ATOM   6999  H HD2    . PHE A 1 421 ? 203.883 10.330  171.155 1.00 68.06  ? 421 PHE A HD2    1 
ATOM   7000  H HE1    . PHE A 1 421 ? 199.431 11.127  170.221 1.00 63.36  ? 421 PHE A HE1    1 
ATOM   7001  H HE2    . PHE A 1 421 ? 202.499 11.233  172.769 1.00 65.52  ? 421 PHE A HE2    1 
ATOM   7002  H HZ     . PHE A 1 421 ? 200.268 11.632  172.300 1.00 60.85  ? 421 PHE A HZ     1 
ATOM   7003  N N      . LYS A 1 422 ? 204.061 6.660   166.953 1.00 81.54  ? 422 LYS A N      1 
ATOM   7004  C CA     . LYS A 1 422 ? 204.939 5.966   166.014 1.00 89.99  ? 422 LYS A CA     1 
ATOM   7005  C C      . LYS A 1 422 ? 204.134 5.392   164.854 1.00 85.16  ? 422 LYS A C      1 
ATOM   7006  O O      . LYS A 1 422 ? 204.635 5.282   163.737 1.00 88.32  ? 422 LYS A O      1 
ATOM   7007  C CB     . LYS A 1 422 ? 205.720 4.850   166.716 1.00 99.78  ? 422 LYS A CB     1 
ATOM   7008  C CG     . LYS A 1 422 ? 206.665 5.351   167.794 1.00 106.44 ? 422 LYS A CG     1 
ATOM   7009  C CD     . LYS A 1 422 ? 207.639 4.274   168.243 1.00 109.97 ? 422 LYS A CD     1 
ATOM   7010  C CE     . LYS A 1 422 ? 208.578 4.796   169.327 1.00 109.81 ? 422 LYS A CE     1 
ATOM   7011  N NZ     . LYS A 1 422 ? 209.362 5.994   168.892 1.00 107.88 ? 422 LYS A NZ     1 
ATOM   7012  H H      . LYS A 1 422 ? 203.787 6.169   167.604 1.00 97.85  ? 422 LYS A H      1 
ATOM   7013  H HA     . LYS A 1 422 ? 205.579 6.599   165.652 1.00 107.99 ? 422 LYS A HA     1 
ATOM   7014  H HB2    . LYS A 1 422 ? 205.090 4.241   167.132 1.00 119.73 ? 422 LYS A HB2    1 
ATOM   7015  H HB3    . LYS A 1 422 ? 206.249 4.375   166.055 1.00 119.73 ? 422 LYS A HB3    1 
ATOM   7016  H HG2    . LYS A 1 422 ? 207.178 6.097   167.446 1.00 127.73 ? 422 LYS A HG2    1 
ATOM   7017  H HG3    . LYS A 1 422 ? 206.147 5.632   168.565 1.00 127.73 ? 422 LYS A HG3    1 
ATOM   7018  H HD2    . LYS A 1 422 ? 207.143 3.524   168.606 1.00 131.96 ? 422 LYS A HD2    1 
ATOM   7019  H HD3    . LYS A 1 422 ? 208.174 3.990   167.486 1.00 131.96 ? 422 LYS A HD3    1 
ATOM   7020  H HE2    . LYS A 1 422 ? 208.055 5.047   170.104 1.00 131.78 ? 422 LYS A HE2    1 
ATOM   7021  H HE3    . LYS A 1 422 ? 209.208 4.097   169.562 1.00 131.78 ? 422 LYS A HE3    1 
ATOM   7022  H HZ1    . LYS A 1 422 ? 209.895 6.265   169.552 1.00 129.45 ? 422 LYS A HZ1    1 
ATOM   7023  H HZ2    . LYS A 1 422 ? 209.860 5.791   168.183 1.00 129.45 ? 422 LYS A HZ2    1 
ATOM   7024  H HZ3    . LYS A 1 422 ? 208.809 6.658   168.677 1.00 129.45 ? 422 LYS A HZ3    1 
ATOM   7025  N N      . GLU A 1 423 ? 202.885 5.028   165.126 1.00 78.03  ? 423 GLU A N      1 
ATOM   7026  C CA     . GLU A 1 423 ? 201.988 4.509   164.098 1.00 75.44  ? 423 GLU A CA     1 
ATOM   7027  C C      . GLU A 1 423 ? 201.681 5.608   163.074 1.00 69.38  ? 423 GLU A C      1 
ATOM   7028  O O      . GLU A 1 423 ? 201.746 6.790   163.399 1.00 69.12  ? 423 GLU A O      1 
ATOM   7029  C CB     . GLU A 1 423 ? 200.691 4.007   164.736 1.00 79.87  ? 423 GLU A CB     1 
ATOM   7030  C CG     . GLU A 1 423 ? 200.879 2.989   165.869 1.00 82.04  ? 423 GLU A CG     1 
ATOM   7031  C CD     . GLU A 1 423 ? 201.525 1.683   165.417 1.00 80.79  ? 423 GLU A CD     1 
ATOM   7032  O OE1    . GLU A 1 423 ? 201.295 1.268   164.261 1.00 79.11  ? 423 GLU A OE1    1 
ATOM   7033  O OE2    . GLU A 1 423 ? 202.265 1.074   166.226 1.00 79.30  ? 423 GLU A OE2    1 
ATOM   7034  H H      . GLU A 1 423 ? 202.529 5.072   165.908 1.00 93.64  ? 423 GLU A H      1 
ATOM   7035  H HA     . GLU A 1 423 ? 202.414 3.769   163.639 1.00 90.53  ? 423 GLU A HA     1 
ATOM   7036  H HB2    . GLU A 1 423 ? 200.212 4.767   165.101 1.00 95.85  ? 423 GLU A HB2    1 
ATOM   7037  H HB3    . GLU A 1 423 ? 200.153 3.583   164.048 1.00 95.85  ? 423 GLU A HB3    1 
ATOM   7038  H HG2    . GLU A 1 423 ? 201.446 3.381   166.551 1.00 98.45  ? 423 GLU A HG2    1 
ATOM   7039  H HG3    . GLU A 1 423 ? 200.010 2.776   166.246 1.00 98.45  ? 423 GLU A HG3    1 
ATOM   7040  N N      . PRO A 1 424 ? 201.349 5.221   161.830 1.00 66.57  ? 424 PRO A N      1 
ATOM   7041  C CA     . PRO A 1 424 ? 201.156 6.183   160.736 1.00 67.58  ? 424 PRO A CA     1 
ATOM   7042  C C      . PRO A 1 424 ? 199.791 6.883   160.757 1.00 69.41  ? 424 PRO A C      1 
ATOM   7043  O O      . PRO A 1 424 ? 199.028 6.800   159.793 1.00 71.71  ? 424 PRO A O      1 
ATOM   7044  C CB     . PRO A 1 424 ? 201.289 5.302   159.492 1.00 68.10  ? 424 PRO A CB     1 
ATOM   7045  C CG     . PRO A 1 424 ? 200.745 3.987   159.928 1.00 67.23  ? 424 PRO A CG     1 
ATOM   7046  C CD     . PRO A 1 424 ? 201.177 3.831   161.367 1.00 65.63  ? 424 PRO A CD     1 
ATOM   7047  H HA     . PRO A 1 424 ? 201.862 6.848   160.739 1.00 81.10  ? 424 PRO A HA     1 
ATOM   7048  H HB2    . PRO A 1 424 ? 200.762 5.672   158.767 1.00 81.71  ? 424 PRO A HB2    1 
ATOM   7049  H HB3    . PRO A 1 424 ? 202.222 5.225   159.240 1.00 81.71  ? 424 PRO A HB3    1 
ATOM   7050  H HG2    . PRO A 1 424 ? 199.778 3.996   159.861 1.00 80.67  ? 424 PRO A HG2    1 
ATOM   7051  H HG3    . PRO A 1 424 ? 201.121 3.281   159.380 1.00 80.67  ? 424 PRO A HG3    1 
ATOM   7052  H HD2    . PRO A 1 424 ? 200.484 3.387   161.881 1.00 78.75  ? 424 PRO A HD2    1 
ATOM   7053  H HD3    . PRO A 1 424 ? 202.019 3.351   161.416 1.00 78.75  ? 424 PRO A HD3    1 
ATOM   7054  N N      . VAL A 1 425 ? 199.502 7.590   161.843 1.00 66.88  ? 425 VAL A N      1 
ATOM   7055  C CA     . VAL A 1 425 ? 198.197 8.202   162.024 1.00 63.46  ? 425 VAL A CA     1 
ATOM   7056  C C      . VAL A 1 425 ? 198.320 9.648   162.472 1.00 68.64  ? 425 VAL A C      1 
ATOM   7057  O O      . VAL A 1 425 ? 197.336 10.254  162.892 1.00 70.14  ? 425 VAL A O      1 
ATOM   7058  C CB     . VAL A 1 425 ? 197.353 7.412   163.051 1.00 55.90  ? 425 VAL A CB     1 
ATOM   7059  C CG1    . VAL A 1 425 ? 197.143 5.993   162.571 1.00 56.31  ? 425 VAL A CG1    1 
ATOM   7060  C CG2    . VAL A 1 425 ? 198.018 7.404   164.414 1.00 52.59  ? 425 VAL A CG2    1 
ATOM   7061  H H      . VAL A 1 425 ? 200.049 7.729   162.493 1.00 80.25  ? 425 VAL A H      1 
ATOM   7062  H HA     . VAL A 1 425 ? 197.724 8.191   161.177 1.00 76.15  ? 425 VAL A HA     1 
ATOM   7063  H HB     . VAL A 1 425 ? 196.484 7.833   163.140 1.00 67.08  ? 425 VAL A HB     1 
ATOM   7064  H HG11   . VAL A 1 425 ? 196.613 5.514   163.227 1.00 67.57  ? 425 VAL A HG11   1 
ATOM   7065  H HG12   . VAL A 1 425 ? 196.678 6.014   161.720 1.00 67.57  ? 425 VAL A HG12   1 
ATOM   7066  H HG13   . VAL A 1 425 ? 198.007 5.565   162.467 1.00 67.57  ? 425 VAL A HG13   1 
ATOM   7067  H HG21   . VAL A 1 425 ? 197.465 6.902   165.032 1.00 63.10  ? 425 VAL A HG21   1 
ATOM   7068  H HG22   . VAL A 1 425 ? 198.891 6.987   164.337 1.00 63.10  ? 425 VAL A HG22   1 
ATOM   7069  H HG23   . VAL A 1 425 ? 198.114 8.319   164.724 1.00 63.10  ? 425 VAL A HG23   1 
ATOM   7070  N N      . THR A 1 426 ? 199.523 10.202  162.372 1.00 71.91  ? 426 THR A N      1 
ATOM   7071  C CA     . THR A 1 426 ? 199.767 11.561  162.843 1.00 73.18  ? 426 THR A CA     1 
ATOM   7072  C C      . THR A 1 426 ? 198.848 12.562  162.149 1.00 68.30  ? 426 THR A C      1 
ATOM   7073  O O      . THR A 1 426 ? 198.291 13.448  162.799 1.00 65.51  ? 426 THR A O      1 
ATOM   7074  C CB     . THR A 1 426 ? 201.239 11.990  162.647 1.00 75.35  ? 426 THR A CB     1 
ATOM   7075  O OG1    . THR A 1 426 ? 201.583 11.918  161.259 1.00 90.77  ? 426 THR A OG1    1 
ATOM   7076  C CG2    . THR A 1 426 ? 202.168 11.096  163.449 1.00 60.97  ? 426 THR A CG2    1 
ATOM   7077  H H      . THR A 1 426 ? 200.213 9.814   162.036 1.00 86.29  ? 426 THR A H      1 
ATOM   7078  H HA     . THR A 1 426 ? 199.576 11.596  163.793 1.00 87.82  ? 426 THR A HA     1 
ATOM   7079  H HB     . THR A 1 426 ? 201.351 12.902  162.958 1.00 90.42  ? 426 THR A HB     1 
ATOM   7080  H HG1    . THR A 1 426 ? 202.383 12.151  161.148 1.00 108.93 ? 426 THR A HG1    1 
ATOM   7081  H HG21   . THR A 1 426 ? 203.089 11.374  163.319 1.00 73.17  ? 426 THR A HG21   1 
ATOM   7082  H HG22   . THR A 1 426 ? 201.951 11.155  164.392 1.00 73.17  ? 426 THR A HG22   1 
ATOM   7083  H HG23   . THR A 1 426 ? 202.073 10.175  163.160 1.00 73.17  ? 426 THR A HG23   1 
ATOM   7084  N N      . ALA A 1 427 ? 198.674 12.414  160.841 1.00 67.29  ? 427 ALA A N      1 
ATOM   7085  C CA     . ALA A 1 427 ? 197.814 13.326  160.096 1.00 66.29  ? 427 ALA A CA     1 
ATOM   7086  C C      . ALA A 1 427 ? 196.394 13.368  160.674 1.00 63.11  ? 427 ALA A C      1 
ATOM   7087  O O      . ALA A 1 427 ? 195.813 14.443  160.853 1.00 66.09  ? 427 ALA A O      1 
ATOM   7088  C CB     . ALA A 1 427 ? 197.777 12.935  158.639 1.00 66.19  ? 427 ALA A CB     1 
ATOM   7089  H H      . ALA A 1 427 ? 199.039 11.798  160.365 1.00 80.75  ? 427 ALA A H      1 
ATOM   7090  H HA     . ALA A 1 427 ? 198.184 14.221  160.153 1.00 79.55  ? 427 ALA A HA     1 
ATOM   7091  H HB1    . ALA A 1 427 ? 197.201 13.553  158.161 1.00 79.42  ? 427 ALA A HB1    1 
ATOM   7092  H HB2    . ALA A 1 427 ? 198.676 12.975  158.279 1.00 79.42  ? 427 ALA A HB2    1 
ATOM   7093  H HB3    . ALA A 1 427 ? 197.429 12.033  158.564 1.00 79.42  ? 427 ALA A HB3    1 
ATOM   7094  N N      . GLU A 1 428 ? 195.853 12.192  160.974 1.00 54.17  ? 428 GLU A N      1 
ATOM   7095  C CA     . GLU A 1 428 ? 194.499 12.070  161.480 1.00 48.72  ? 428 GLU A CA     1 
ATOM   7096  C C      . GLU A 1 428 ? 194.376 12.616  162.905 1.00 49.52  ? 428 GLU A C      1 
ATOM   7097  O O      . GLU A 1 428 ? 193.417 13.331  163.223 1.00 49.48  ? 428 GLU A O      1 
ATOM   7098  C CB     . GLU A 1 428 ? 194.067 10.611  161.426 1.00 51.41  ? 428 GLU A CB     1 
ATOM   7099  C CG     . GLU A 1 428 ? 193.828 10.072  160.009 1.00 61.57  ? 428 GLU A CG     1 
ATOM   7100  C CD     . GLU A 1 428 ? 195.104 9.869   159.178 1.00 71.77  ? 428 GLU A CD     1 
ATOM   7101  O OE1    . GLU A 1 428 ? 196.226 9.996   159.718 1.00 73.09  ? 428 GLU A OE1    1 
ATOM   7102  O OE2    . GLU A 1 428 ? 194.972 9.573   157.968 1.00 76.80  ? 428 GLU A OE2    1 
ATOM   7103  H H      . GLU A 1 428 ? 196.260 11.439  160.891 1.00 65.01  ? 428 GLU A H      1 
ATOM   7104  H HA     . GLU A 1 428 ? 193.902 12.581  160.911 1.00 58.47  ? 428 GLU A HA     1 
ATOM   7105  H HB2    . GLU A 1 428 ? 194.758 10.067  161.835 1.00 61.69  ? 428 GLU A HB2    1 
ATOM   7106  H HB3    . GLU A 1 428 ? 193.238 10.514  161.921 1.00 61.69  ? 428 GLU A HB3    1 
ATOM   7107  H HG2    . GLU A 1 428 ? 193.381 9.214   160.075 1.00 73.88  ? 428 GLU A HG2    1 
ATOM   7108  H HG3    . GLU A 1 428 ? 193.263 10.698  159.531 1.00 73.88  ? 428 GLU A HG3    1 
ATOM   7109  N N      . LEU A 1 429 ? 195.344 12.276  163.757 1.00 48.89  ? 429 LEU A N      1 
ATOM   7110  C CA     . LEU A 1 429 ? 195.401 12.809  165.115 1.00 49.60  ? 429 LEU A CA     1 
ATOM   7111  C C      . LEU A 1 429 ? 195.472 14.330  165.082 1.00 57.12  ? 429 LEU A C      1 
ATOM   7112  O O      . LEU A 1 429 ? 194.815 15.008  165.872 1.00 62.98  ? 429 LEU A O      1 
ATOM   7113  C CB     . LEU A 1 429 ? 196.609 12.256  165.872 1.00 49.84  ? 429 LEU A CB     1 
ATOM   7114  C CG     . LEU A 1 429 ? 196.509 10.800  166.332 1.00 62.14  ? 429 LEU A CG     1 
ATOM   7115  C CD1    . LEU A 1 429 ? 197.834 10.311  166.908 1.00 68.48  ? 429 LEU A CD1    1 
ATOM   7116  C CD2    . LEU A 1 429 ? 195.402 10.614  167.357 1.00 66.82  ? 429 LEU A CD2    1 
ATOM   7117  H H      . LEU A 1 429 ? 195.985 11.734  163.569 1.00 58.67  ? 429 LEU A H      1 
ATOM   7118  H HA     . LEU A 1 429 ? 194.598 12.552  165.593 1.00 59.53  ? 429 LEU A HA     1 
ATOM   7119  H HB2    . LEU A 1 429 ? 197.387 12.324  165.297 1.00 59.81  ? 429 LEU A HB2    1 
ATOM   7120  H HB3    . LEU A 1 429 ? 196.747 12.800  166.664 1.00 59.81  ? 429 LEU A HB3    1 
ATOM   7121  H HG     . LEU A 1 429 ? 196.297 10.245  165.565 1.00 74.56  ? 429 LEU A HG     1 
ATOM   7122  H HD11   . LEU A 1 429 ? 197.734 9.388   167.188 1.00 82.17  ? 429 LEU A HD11   1 
ATOM   7123  H HD12   . LEU A 1 429 ? 198.518 10.377  166.223 1.00 82.17  ? 429 LEU A HD12   1 
ATOM   7124  H HD13   . LEU A 1 429 ? 198.071 10.864  167.668 1.00 82.17  ? 429 LEU A HD13   1 
ATOM   7125  H HD21   . LEU A 1 429 ? 195.371 9.681   167.623 1.00 80.18  ? 429 LEU A HD21   1 
ATOM   7126  H HD22   . LEU A 1 429 ? 195.589 11.171  168.129 1.00 80.18  ? 429 LEU A HD22   1 
ATOM   7127  H HD23   . LEU A 1 429 ? 194.556 10.873  166.959 1.00 80.18  ? 429 LEU A HD23   1 
ATOM   7128  N N      . CYS A 1 430 ? 196.265 14.869  164.166 1.00 57.72  ? 430 CYS A N      1 
ATOM   7129  C CA     . CYS A 1 430 ? 196.395 16.316  164.056 1.00 57.30  ? 430 CYS A CA     1 
ATOM   7130  C C      . CYS A 1 430 ? 195.062 16.950  163.682 1.00 56.21  ? 430 CYS A C      1 
ATOM   7131  O O      . CYS A 1 430 ? 194.623 17.918  164.309 1.00 55.60  ? 430 CYS A O      1 
ATOM   7132  C CB     . CYS A 1 430 ? 197.472 16.682  163.037 1.00 54.83  ? 430 CYS A CB     1 
ATOM   7133  S SG     . CYS A 1 430 ? 199.118 16.558  163.724 1.00 65.54  ? 430 CYS A SG     1 
ATOM   7134  H H      . CYS A 1 430 ? 196.736 14.424  163.600 1.00 69.27  ? 430 CYS A H      1 
ATOM   7135  H HA     . CYS A 1 430 ? 196.665 16.674  164.916 1.00 68.76  ? 430 CYS A HA     1 
ATOM   7136  H HB2    . CYS A 1 430 ? 197.413 16.077  162.281 1.00 65.79  ? 430 CYS A HB2    1 
ATOM   7137  H HB3    . CYS A 1 430 ? 197.335 17.597  162.744 1.00 65.79  ? 430 CYS A HB3    1 
ATOM   7138  H HG     . CYS A 1 430 ? 199.307 15.429  164.085 1.00 78.65  ? 430 CYS A HG     1 
ATOM   7139  N N      . GLU A 1 431 ? 194.423 16.378  162.669 1.00 52.35  ? 431 GLU A N      1 
ATOM   7140  C CA     . GLU A 1 431 ? 193.125 16.833  162.217 1.00 49.83  ? 431 GLU A CA     1 
ATOM   7141  C C      . GLU A 1 431 ? 192.089 16.819  163.350 1.00 47.89  ? 431 GLU A C      1 
ATOM   7142  O O      . GLU A 1 431 ? 191.479 17.845  163.628 1.00 48.85  ? 431 GLU A O      1 
ATOM   7143  C CB     . GLU A 1 431 ? 192.670 15.968  161.041 1.00 55.06  ? 431 GLU A CB     1 
ATOM   7144  C CG     . GLU A 1 431 ? 191.252 16.223  160.565 1.00 68.48  ? 431 GLU A CG     1 
ATOM   7145  C CD     . GLU A 1 431 ? 191.052 17.624  160.020 1.00 83.99  ? 431 GLU A CD     1 
ATOM   7146  O OE1    . GLU A 1 431 ? 189.878 18.039  159.862 1.00 89.52  ? 431 GLU A OE1    1 
ATOM   7147  O OE2    . GLU A 1 431 ? 192.065 18.307  159.746 1.00 89.56  ? 431 GLU A OE2    1 
ATOM   7148  H H      . GLU A 1 431 ? 194.731 15.711  162.222 1.00 62.82  ? 431 GLU A H      1 
ATOM   7149  H HA     . GLU A 1 431 ? 193.207 17.746  161.900 1.00 59.79  ? 431 GLU A HA     1 
ATOM   7150  H HB2    . GLU A 1 431 ? 193.263 16.132  160.291 1.00 66.08  ? 431 GLU A HB2    1 
ATOM   7151  H HB3    . GLU A 1 431 ? 192.727 15.036  161.303 1.00 66.08  ? 431 GLU A HB3    1 
ATOM   7152  H HG2    . GLU A 1 431 ? 191.038 15.593  159.859 1.00 82.18  ? 431 GLU A HG2    1 
ATOM   7153  H HG3    . GLU A 1 431 ? 190.643 16.102  161.311 1.00 82.18  ? 431 GLU A HG3    1 
ATOM   7154  N N      . MET A 1 432 ? 191.895 15.681  164.015 1.00 49.65  ? 432 MET A N      1 
ATOM   7155  C CA     . MET A 1 432 ? 190.807 15.578  164.989 1.00 54.72  ? 432 MET A CA     1 
ATOM   7156  C C      . MET A 1 432 ? 191.039 16.478  166.210 1.00 60.24  ? 432 MET A C      1 
ATOM   7157  O O      . MET A 1 432 ? 190.088 16.963  166.815 1.00 66.32  ? 432 MET A O      1 
ATOM   7158  C CB     . MET A 1 432 ? 190.528 14.119  165.399 1.00 55.10  ? 432 MET A CB     1 
ATOM   7159  C CG     . MET A 1 432 ? 191.659 13.416  166.108 1.00 59.67  ? 432 MET A CG     1 
ATOM   7160  S SD     . MET A 1 432 ? 191.399 11.629  166.296 1.00 74.78  ? 432 MET A SD     1 
ATOM   7161  C CE     . MET A 1 432 ? 190.392 11.546  167.766 1.00 43.96  ? 432 MET A CE     1 
ATOM   7162  H H      . MET A 1 432 ? 192.368 14.969  163.925 1.00 59.58  ? 432 MET A H      1 
ATOM   7163  H HA     . MET A 1 432 ? 190.001 15.893  164.550 1.00 65.66  ? 432 MET A HA     1 
ATOM   7164  H HB2    . MET A 1 432 ? 189.762 14.109  165.994 1.00 66.12  ? 432 MET A HB2    1 
ATOM   7165  H HB3    . MET A 1 432 ? 190.325 13.609  164.600 1.00 66.12  ? 432 MET A HB3    1 
ATOM   7166  H HG2    . MET A 1 432 ? 192.476 13.546  165.601 1.00 71.61  ? 432 MET A HG2    1 
ATOM   7167  H HG3    . MET A 1 432 ? 191.758 13.797  166.995 1.00 71.61  ? 432 MET A HG3    1 
ATOM   7168  H HE1    . MET A 1 432 ? 190.192 10.617  167.959 1.00 52.76  ? 432 MET A HE1    1 
ATOM   7169  H HE2    . MET A 1 432 ? 190.880 11.940  168.505 1.00 52.76  ? 432 MET A HE2    1 
ATOM   7170  H HE3    . MET A 1 432 ? 189.570 12.037  167.612 1.00 52.76  ? 432 MET A HE3    1 
ATOM   7171  N N      . MET A 1 433 ? 192.296 16.735  166.551 1.00 57.21  ? 433 MET A N      1 
ATOM   7172  C CA     . MET A 1 433 ? 192.601 17.626  167.665 1.00 52.43  ? 433 MET A CA     1 
ATOM   7173  C C      . MET A 1 433 ? 192.653 19.095  167.211 1.00 50.14  ? 433 MET A C      1 
ATOM   7174  O O      . MET A 1 433 ? 192.743 20.007  168.030 1.00 47.56  ? 433 MET A O      1 
ATOM   7175  C CB     . MET A 1 433 ? 193.907 17.193  168.344 1.00 52.60  ? 433 MET A CB     1 
ATOM   7176  C CG     . MET A 1 433 ? 193.777 15.850  169.061 1.00 55.77  ? 433 MET A CG     1 
ATOM   7177  S SD     . MET A 1 433 ? 195.180 15.377  170.094 1.00 59.79  ? 433 MET A SD     1 
ATOM   7178  C CE     . MET A 1 433 ? 196.505 15.392  168.885 1.00 59.77  ? 433 MET A CE     1 
ATOM   7179  H H      . MET A 1 433 ? 192.987 16.409  166.157 1.00 68.66  ? 433 MET A H      1 
ATOM   7180  H HA     . MET A 1 433 ? 191.894 17.539  168.324 1.00 62.92  ? 433 MET A HA     1 
ATOM   7181  H HB2    . MET A 1 433 ? 194.601 17.109  167.672 1.00 63.12  ? 433 MET A HB2    1 
ATOM   7182  H HB3    . MET A 1 433 ? 194.159 17.861  169.001 1.00 63.12  ? 433 MET A HB3    1 
ATOM   7183  H HG2    . MET A 1 433 ? 192.994 15.882  169.632 1.00 66.92  ? 433 MET A HG2    1 
ATOM   7184  H HG3    . MET A 1 433 ? 193.661 15.156  168.393 1.00 66.92  ? 433 MET A HG3    1 
ATOM   7185  H HE1    . MET A 1 433 ? 197.335 15.148  169.325 1.00 71.73  ? 433 MET A HE1    1 
ATOM   7186  H HE2    . MET A 1 433 ? 196.301 14.752  168.185 1.00 71.73  ? 433 MET A HE2    1 
ATOM   7187  H HE3    . MET A 1 433 ? 196.579 16.283  168.509 1.00 71.73  ? 433 MET A HE3    1 
ATOM   7188  N N      . GLY A 1 434 ? 192.573 19.323  165.906 1.00 49.94  ? 434 GLY A N      1 
ATOM   7189  C CA     . GLY A 1 434 ? 192.631 20.673  165.374 1.00 49.37  ? 434 GLY A CA     1 
ATOM   7190  C C      . GLY A 1 434 ? 193.967 21.337  165.646 1.00 51.93  ? 434 GLY A C      1 
ATOM   7191  O O      . GLY A 1 434 ? 194.013 22.509  166.005 1.00 49.55  ? 434 GLY A O      1 
ATOM   7192  H H      . GLY A 1 434 ? 192.485 18.711  165.308 1.00 59.93  ? 434 GLY A H      1 
ATOM   7193  H HA2    . GLY A 1 434 ? 192.487 20.650  164.415 1.00 59.24  ? 434 GLY A HA2    1 
ATOM   7194  H HA3    . GLY A 1 434 ? 191.931 21.210  165.778 1.00 59.24  ? 434 GLY A HA3    1 
ATOM   7195  N N      . VAL A 1 435 ? 195.052 20.577  165.492 1.00 57.84  ? 435 VAL A N      1 
ATOM   7196  C CA     . VAL A 1 435 ? 196.408 21.102  165.643 1.00 61.09  ? 435 VAL A CA     1 
ATOM   7197  C C      . VAL A 1 435 ? 196.788 21.947  164.434 1.00 69.21  ? 435 VAL A C      1 
ATOM   7198  O O      . VAL A 1 435 ? 196.430 21.622  163.306 1.00 70.63  ? 435 VAL A O      1 
ATOM   7199  C CB     . VAL A 1 435 ? 197.432 19.959  165.777 1.00 57.11  ? 435 VAL A CB     1 
ATOM   7200  C CG1    . VAL A 1 435 ? 198.862 20.501  165.835 1.00 52.04  ? 435 VAL A CG1    1 
ATOM   7201  C CG2    . VAL A 1 435 ? 197.139 19.139  167.013 1.00 59.15  ? 435 VAL A CG2    1 
ATOM   7202  H H      . VAL A 1 435 ? 195.027 19.740  165.297 1.00 69.41  ? 435 VAL A H      1 
ATOM   7203  H HA     . VAL A 1 435 ? 196.457 21.656  166.437 1.00 73.30  ? 435 VAL A HA     1 
ATOM   7204  H HB     . VAL A 1 435 ? 197.362 19.376  165.004 1.00 68.53  ? 435 VAL A HB     1 
ATOM   7205  H HG11   . VAL A 1 435 ? 199.479 19.757  165.919 1.00 62.45  ? 435 VAL A HG11   1 
ATOM   7206  H HG12   . VAL A 1 435 ? 199.047 20.993  165.020 1.00 62.45  ? 435 VAL A HG12   1 
ATOM   7207  H HG13   . VAL A 1 435 ? 198.946 21.088  166.603 1.00 62.45  ? 435 VAL A HG13   1 
ATOM   7208  H HG21   . VAL A 1 435 ? 197.792 18.425  167.081 1.00 70.98  ? 435 VAL A HG21   1 
ATOM   7209  H HG22   . VAL A 1 435 ? 197.193 19.713  167.793 1.00 70.98  ? 435 VAL A HG22   1 
ATOM   7210  H HG23   . VAL A 1 435 ? 196.247 18.765  166.939 1.00 70.98  ? 435 VAL A HG23   1 
ATOM   7211  N N      . LYS A 1 436 ? 197.528 23.023  164.671 1.00 77.15  ? 436 LYS A N      1 
ATOM   7212  C CA     . LYS A 1 436 ? 197.907 23.927  163.597 1.00 86.20  ? 436 LYS A CA     1 
ATOM   7213  C C      . LYS A 1 436 ? 199.371 24.307  163.693 1.00 97.91  ? 436 LYS A C      1 
ATOM   7214  O O      . LYS A 1 436 ? 199.925 24.392  164.788 1.00 103.51 ? 436 LYS A O      1 
ATOM   7215  C CB     . LYS A 1 436 ? 197.041 25.186  163.648 1.00 80.70  ? 436 LYS A CB     1 
ATOM   7216  C CG     . LYS A 1 436 ? 197.125 25.945  164.956 1.00 71.56  ? 436 LYS A CG     1 
ATOM   7217  C CD     . LYS A 1 436 ? 196.178 27.131  164.962 1.00 64.32  ? 436 LYS A CD     1 
ATOM   7218  C CE     . LYS A 1 436 ? 196.322 27.927  166.237 1.00 63.95  ? 436 LYS A CE     1 
ATOM   7219  N NZ     . LYS A 1 436 ? 195.464 29.131  166.264 1.00 66.57  ? 436 LYS A NZ     1 
ATOM   7220  H H      . LYS A 1 436 ? 197.824 23.250  165.446 1.00 92.57  ? 436 LYS A H      1 
ATOM   7221  H HA     . LYS A 1 436 ? 197.761 23.490  162.744 1.00 103.44 ? 436 LYS A HA     1 
ATOM   7222  H HB2    . LYS A 1 436 ? 197.322 25.786  162.939 1.00 96.84  ? 436 LYS A HB2    1 
ATOM   7223  H HB3    . LYS A 1 436 ? 196.114 24.932  163.513 1.00 96.84  ? 436 LYS A HB3    1 
ATOM   7224  H HG2    . LYS A 1 436 ? 196.881 25.355  165.686 1.00 85.87  ? 436 LYS A HG2    1 
ATOM   7225  H HG3    . LYS A 1 436 ? 198.029 26.276  165.077 1.00 85.87  ? 436 LYS A HG3    1 
ATOM   7226  H HD2    . LYS A 1 436 ? 196.384 27.712  164.213 1.00 77.18  ? 436 LYS A HD2    1 
ATOM   7227  H HD3    . LYS A 1 436 ? 195.263 26.812  164.902 1.00 77.18  ? 436 LYS A HD3    1 
ATOM   7228  H HE2    . LYS A 1 436 ? 196.075 27.367  166.989 1.00 76.75  ? 436 LYS A HE2    1 
ATOM   7229  H HE3    . LYS A 1 436 ? 197.244 28.215  166.327 1.00 76.75  ? 436 LYS A HE3    1 
ATOM   7230  H HZ1    . LYS A 1 436 ? 195.579 29.570  167.030 1.00 79.88  ? 436 LYS A HZ1    1 
ATOM   7231  H HZ2    . LYS A 1 436 ? 195.674 29.670  165.587 1.00 79.88  ? 436 LYS A HZ2    1 
ATOM   7232  H HZ3    . LYS A 1 436 ? 194.608 28.896  166.191 1.00 79.88  ? 436 LYS A HZ3    1 
ATOM   7233  N N      . ASP A 1 437 ? 199.991 24.524  162.537 1.00 103.22 ? 437 ASP A N      1 
ATOM   7234  C CA     . ASP A 1 437 ? 201.331 25.098  162.473 1.00 113.12 ? 437 ASP A CA     1 
ATOM   7235  C C      . ASP A 1 437 ? 201.674 25.442  161.030 1.00 117.80 ? 437 ASP A C      1 
ATOM   7236  O O      . ASP A 1 437 ? 202.157 26.537  160.740 1.00 120.76 ? 437 ASP A O      1 
ATOM   7237  C CB     . ASP A 1 437 ? 202.376 24.134  163.040 1.00 118.12 ? 437 ASP A CB     1 
ATOM   7238  C CG     . ASP A 1 437 ? 203.734 24.790  163.230 1.00 120.73 ? 437 ASP A CG     1 
ATOM   7239  O OD1    . ASP A 1 437 ? 203.778 25.992  163.571 1.00 117.85 ? 437 ASP A OD1    1 
ATOM   7240  O OD2    . ASP A 1 437 ? 204.758 24.101  163.039 1.00 124.51 ? 437 ASP A OD2    1 
ATOM   7241  H H      . ASP A 1 437 ? 199.652 24.346  161.767 1.00 123.86 ? 437 ASP A H      1 
ATOM   7242  H HA     . ASP A 1 437 ? 201.355 25.915  162.995 1.00 135.74 ? 437 ASP A HA     1 
ATOM   7243  H HB2    . ASP A 1 437 ? 202.075 23.812  163.904 1.00 141.75 ? 437 ASP A HB2    1 
ATOM   7244  H HB3    . ASP A 1 437 ? 202.485 23.390  162.428 1.00 141.75 ? 437 ASP A HB3    1 
ATOM   7245  O OP3    . G   B 2 1   ? 175.475 -12.982 146.524 1.00 192.11 ? 1   G   B OP3    1 
ATOM   7246  P P      . G   B 2 1   ? 175.429 -11.721 147.298 1.00 187.59 ? 1   G   B P      1 
ATOM   7247  O OP1    . G   B 2 1   ? 174.347 -11.840 148.305 1.00 187.26 ? 1   G   B OP1    1 
ATOM   7248  O OP2    . G   B 2 1   ? 175.389 -10.593 146.336 1.00 185.51 ? 1   G   B OP2    1 
ATOM   7249  O "O5'"  . G   B 2 1   ? 176.796 -11.598 148.102 1.00 165.90 ? 1   G   B "O5'"  1 
ATOM   7250  C "C5'"  . G   B 2 1   ? 176.860 -10.853 149.307 1.00 161.60 ? 1   G   B "C5'"  1 
ATOM   7251  C "C4'"  . G   B 2 1   ? 178.009 -9.880  149.291 1.00 151.98 ? 1   G   B "C4'"  1 
ATOM   7252  O "O4'"  . G   B 2 1   ? 178.026 -9.163  148.029 1.00 148.61 ? 1   G   B "O4'"  1 
ATOM   7253  C "C3'"  . G   B 2 1   ? 177.961 -8.782  150.345 1.00 144.68 ? 1   G   B "C3'"  1 
ATOM   7254  O "O3'"  . G   B 2 1   ? 178.434 -9.214  151.629 1.00 141.68 ? 1   G   B "O3'"  1 
ATOM   7255  C "C2'"  . G   B 2 1   ? 178.802 -7.682  149.712 1.00 139.57 ? 1   G   B "C2'"  1 
ATOM   7256  O "O2'"  . G   B 2 1   ? 180.188 -7.953  149.853 1.00 133.36 ? 1   G   B "O2'"  1 
ATOM   7257  C "C1'"  . G   B 2 1   ? 178.425 -7.825  148.238 1.00 144.22 ? 1   G   B "C1'"  1 
ATOM   7258  N N9     . G   B 2 1   ? 177.307 -6.945  147.854 1.00 148.09 ? 1   G   B N9     1 
ATOM   7259  C C8     . G   B 2 1   ? 176.035 -7.347  147.531 1.00 153.13 ? 1   G   B C8     1 
ATOM   7260  N N7     . G   B 2 1   ? 175.244 -6.358  147.222 1.00 155.88 ? 1   G   B N7     1 
ATOM   7261  C C5     . G   B 2 1   ? 176.044 -5.230  147.344 1.00 154.13 ? 1   G   B C5     1 
ATOM   7262  C C6     . G   B 2 1   ? 175.734 -3.859  147.133 1.00 155.39 ? 1   G   B C6     1 
ATOM   7263  O O6     . G   B 2 1   ? 174.657 -3.355  146.788 1.00 159.28 ? 1   G   B O6     1 
ATOM   7264  N N1     . G   B 2 1   ? 176.837 -3.042  147.369 1.00 149.45 ? 1   G   B N1     1 
ATOM   7265  C C2     . G   B 2 1   ? 178.078 -3.485  147.756 1.00 142.94 ? 1   G   B C2     1 
ATOM   7266  N N2     . G   B 2 1   ? 179.011 -2.536  147.934 1.00 136.17 ? 1   G   B N2     1 
ATOM   7267  N N3     . G   B 2 1   ? 178.381 -4.762  147.955 1.00 144.66 ? 1   G   B N3     1 
ATOM   7268  C C4     . G   B 2 1   ? 177.324 -5.575  147.732 1.00 148.73 ? 1   G   B C4     1 
ATOM   7269  H "H5'"  . G   B 2 1   ? 176.972 -11.465 150.051 1.00 193.92 ? 1   G   B "H5'"  1 
ATOM   7270  H "H5''" . G   B 2 1   ? 176.031 -10.363 149.421 1.00 193.92 ? 1   G   B "H5''" 1 
ATOM   7271  H "H4'"  . G   B 2 1   ? 178.840 -10.372 149.386 1.00 182.38 ? 1   G   B "H4'"  1 
ATOM   7272  H "H3'"  . G   B 2 1   ? 177.047 -8.469  150.434 1.00 173.62 ? 1   G   B "H3'"  1 
ATOM   7273  H "H2'"  . G   B 2 1   ? 178.567 -6.807  150.057 1.00 167.48 ? 1   G   B "H2'"  1 
ATOM   7274  H "HO2'" . G   B 2 1   ? 180.307 -8.418  150.542 1.00 160.03 ? 1   G   B "HO2'" 1 
ATOM   7275  H "H1'"  . G   B 2 1   ? 179.198 -7.628  147.686 1.00 173.07 ? 1   G   B "H1'"  1 
ATOM   7276  H H8     . G   B 2 1   ? 175.764 -8.237  147.534 1.00 183.76 ? 1   G   B H8     1 
ATOM   7277  H H1     . G   B 2 1   ? 176.732 -2.195  147.265 1.00 179.34 ? 1   G   B H1     1 
ATOM   7278  H H21    . G   B 2 1   ? 178.812 -1.709  147.805 1.00 163.40 ? 1   G   B H21    1 
ATOM   7279  H H22    . G   B 2 1   ? 179.806 -2.754  148.178 1.00 163.40 ? 1   G   B H22    1 
ATOM   7280  P P      . G   B 2 2   ? 177.692 -8.750  152.990 1.00 139.17 ? 2   G   B P      1 
ATOM   7281  O OP1    . G   B 2 2   ? 178.103 -9.444  154.233 1.00 139.59 ? 2   G   B OP1    1 
ATOM   7282  O OP2    . G   B 2 2   ? 176.251 -8.791  152.631 1.00 139.34 ? 2   G   B OP2    1 
ATOM   7283  O "O5'"  . G   B 2 2   ? 178.140 -7.230  153.153 1.00 128.99 ? 2   G   B "O5'"  1 
ATOM   7284  C "C5'"  . G   B 2 2   ? 179.496 -6.896  153.415 1.00 121.26 ? 2   G   B "C5'"  1 
ATOM   7285  C "C4'"  . G   B 2 2   ? 179.734 -5.408  153.334 1.00 112.11 ? 2   G   B "C4'"  1 
ATOM   7286  O "O4'"  . G   B 2 2   ? 179.533 -4.947  151.971 1.00 110.30 ? 2   G   B "O4'"  1 
ATOM   7287  C "C3'"  . G   B 2 2   ? 178.804 -4.532  154.156 1.00 107.21 ? 2   G   B "C3'"  1 
ATOM   7288  O "O3'"  . G   B 2 2   ? 179.155 -4.471  155.526 1.00 103.77 ? 2   G   B "O3'"  1 
ATOM   7289  C "C2'"  . G   B 2 2   ? 178.903 -3.196  153.439 1.00 106.58 ? 2   G   B "C2'"  1 
ATOM   7290  O "O2'"  . G   B 2 2   ? 180.107 -2.523  153.775 1.00 103.32 ? 2   G   B "O2'"  1 
ATOM   7291  C "C1'"  . G   B 2 2   ? 178.980 -3.647  151.983 1.00 110.54 ? 2   G   B "C1'"  1 
ATOM   7292  N N9     . G   B 2 2   ? 177.645 -3.692  151.355 1.00 116.53 ? 2   G   B N9     1 
ATOM   7293  C C8     . G   B 2 2   ? 176.863 -4.796  151.113 1.00 119.86 ? 2   G   B C8     1 
ATOM   7294  N N7     . G   B 2 2   ? 175.722 -4.501  150.552 1.00 121.21 ? 2   G   B N7     1 
ATOM   7295  C C5     . G   B 2 2   ? 175.747 -3.119  150.418 1.00 119.79 ? 2   G   B C5     1 
ATOM   7296  C C6     . G   B 2 2   ? 174.786 -2.225  149.877 1.00 120.19 ? 2   G   B C6     1 
ATOM   7297  O O6     . G   B 2 2   ? 173.679 -2.481  149.389 1.00 124.97 ? 2   G   B O6     1 
ATOM   7298  N N1     . G   B 2 2   ? 175.223 -0.907  149.943 1.00 114.85 ? 2   G   B N1     1 
ATOM   7299  C C2     . G   B 2 2   ? 176.427 -0.498  150.460 1.00 110.68 ? 2   G   B C2     1 
ATOM   7300  N N2     . G   B 2 2   ? 176.666 0.819   150.436 1.00 108.18 ? 2   G   B N2     1 
ATOM   7301  N N3     . G   B 2 2   ? 177.331 -1.317  150.966 1.00 112.02 ? 2   G   B N3     1 
ATOM   7302  C C4     . G   B 2 2   ? 176.927 -2.605  150.912 1.00 116.60 ? 2   G   B C4     1 
ATOM   7303  H "H5'"  . G   B 2 2   ? 180.062 -7.342  152.766 1.00 145.51 ? 2   G   B "H5'"  1 
ATOM   7304  H "H5''" . G   B 2 2   ? 179.731 -7.205  154.304 1.00 145.51 ? 2   G   B "H5''" 1 
ATOM   7305  H "H4'"  . G   B 2 2   ? 180.650 -5.223  153.595 1.00 134.53 ? 2   G   B "H4'"  1 
ATOM   7306  H "H3'"  . G   B 2 2   ? 177.898 -4.868  154.075 1.00 128.65 ? 2   G   B "H3'"  1 
ATOM   7307  H "H2'"  . G   B 2 2   ? 178.122 -2.643  153.601 1.00 127.90 ? 2   G   B "H2'"  1 
ATOM   7308  H "HO2'" . G   B 2 2   ? 180.121 -1.778  153.388 1.00 123.98 ? 2   G   B "HO2'" 1 
ATOM   7309  H "H1'"  . G   B 2 2   ? 179.554 -3.045  151.485 1.00 132.65 ? 2   G   B "H1'"  1 
ATOM   7310  H H8     . G   B 2 2   ? 177.122 -5.664  151.324 1.00 143.84 ? 2   G   B H8     1 
ATOM   7311  H H1     . G   B 2 2   ? 174.698 -0.300  149.635 1.00 137.82 ? 2   G   B H1     1 
ATOM   7312  H H21    . G   B 2 2   ? 176.081 1.356   150.107 1.00 129.81 ? 2   G   B H21    1 
ATOM   7313  H H22    . G   B 2 2   ? 177.406 1.127   150.749 1.00 129.81 ? 2   G   B H22    1 
ATOM   7314  P P      . C   B 2 3   ? 178.014 -4.323  156.648 1.00 111.42 ? 3   C   B P      1 
ATOM   7315  O OP1    . C   B 2 3   ? 178.648 -4.585  157.963 1.00 110.76 ? 3   C   B OP1    1 
ATOM   7316  O OP2    . C   B 2 3   ? 176.837 -5.130  156.245 1.00 114.93 ? 3   C   B OP2    1 
ATOM   7317  O "O5'"  . C   B 2 3   ? 177.588 -2.787  156.572 1.00 105.41 ? 3   C   B "O5'"  1 
ATOM   7318  C "C5'"  . C   B 2 3   ? 178.523 -1.752  156.839 1.00 103.43 ? 3   C   B "C5'"  1 
ATOM   7319  C "C4'"  . C   B 2 3   ? 178.020 -0.403  156.387 1.00 104.03 ? 3   C   B "C4'"  1 
ATOM   7320  O "O4'"  . C   B 2 3   ? 177.784 -0.412  154.953 1.00 106.07 ? 3   C   B "O4'"  1 
ATOM   7321  C "C3'"  . C   B 2 3   ? 176.692 0.057   156.967 1.00 105.94 ? 3   C   B "C3'"  1 
ATOM   7322  O "O3'"  . C   B 2 3   ? 176.793 0.564   158.285 1.00 108.02 ? 3   C   B "O3'"  1 
ATOM   7323  C "C2'"  . C   B 2 3   ? 176.238 1.091   155.947 1.00 104.88 ? 3   C   B "C2'"  1 
ATOM   7324  O "O2'"  . C   B 2 3   ? 176.930 2.322   156.118 1.00 99.31  ? 3   C   B "O2'"  1 
ATOM   7325  C "C1'"  . C   B 2 3   ? 176.692 0.434   154.643 1.00 108.39 ? 3   C   B "C1'"  1 
ATOM   7326  N N1     . C   B 2 3   ? 175.609 -0.377  154.039 1.00 115.36 ? 3   C   B N1     1 
ATOM   7327  C C2     . C   B 2 3   ? 174.603 0.275   153.322 1.00 119.53 ? 3   C   B C2     1 
ATOM   7328  O O2     . C   B 2 3   ? 174.650 1.509   153.203 1.00 119.21 ? 3   C   B O2     1 
ATOM   7329  N N3     . C   B 2 3   ? 173.605 -0.455  152.774 1.00 123.50 ? 3   C   B N3     1 
ATOM   7330  C C4     . C   B 2 3   ? 173.581 -1.779  152.921 1.00 125.38 ? 3   C   B C4     1 
ATOM   7331  N N4     . C   B 2 3   ? 172.579 -2.457  152.359 1.00 130.17 ? 3   C   B N4     1 
ATOM   7332  C C5     . C   B 2 3   ? 174.588 -2.470  153.649 1.00 121.55 ? 3   C   B C5     1 
ATOM   7333  C C6     . C   B 2 3   ? 175.570 -1.737  154.187 1.00 117.96 ? 3   C   B C6     1 
ATOM   7334  H "H5'"  . C   B 2 3   ? 179.353 -1.950  156.377 1.00 124.12 ? 3   C   B "H5'"  1 
ATOM   7335  H "H5''" . C   B 2 3   ? 178.694 -1.721  157.794 1.00 124.12 ? 3   C   B "H5''" 1 
ATOM   7336  H "H4'"  . C   B 2 3   ? 178.695 0.264   156.588 1.00 124.83 ? 3   C   B "H4'"  1 
ATOM   7337  H "H3'"  . C   B 2 3   ? 176.070 -0.687  156.961 1.00 127.12 ? 3   C   B "H3'"  1 
ATOM   7338  H "H2'"  . C   B 2 3   ? 175.276 1.212   155.967 1.00 125.86 ? 3   C   B "H2'"  1 
ATOM   7339  H "HO2'" . C   B 2 3   ? 177.448 2.438   155.467 1.00 119.18 ? 3   C   B "HO2'" 1 
ATOM   7340  H "H1'"  . C   B 2 3   ? 176.977 1.118   154.016 1.00 130.07 ? 3   C   B "H1'"  1 
ATOM   7341  H H41    . C   B 2 3   ? 172.540 -3.313  152.440 1.00 156.20 ? 3   C   B H41    1 
ATOM   7342  H H42    . C   B 2 3   ? 171.971 -2.039  151.917 1.00 156.20 ? 3   C   B H42    1 
ATOM   7343  H H5     . C   B 2 3   ? 174.566 -3.394  153.746 1.00 145.86 ? 3   C   B H5     1 
ATOM   7344  H H6     . C   B 2 3   ? 176.243 -2.161  154.669 1.00 141.56 ? 3   C   B H6     1 
ATOM   7345  P P      . G   B 2 4   ? 175.487 0.627   159.220 1.00 98.81  ? 4   G   B P      1 
ATOM   7346  O OP1    . G   B 2 4   ? 175.867 1.275   160.503 1.00 98.33  ? 4   G   B OP1    1 
ATOM   7347  O OP2    . G   B 2 4   ? 174.840 -0.707  159.214 1.00 100.63 ? 4   G   B OP2    1 
ATOM   7348  O "O5'"  . G   B 2 4   ? 174.518 1.627   158.452 1.00 123.10 ? 4   G   B "O5'"  1 
ATOM   7349  C "C5'"  . G   B 2 4   ? 174.785 3.020   158.424 1.00 119.30 ? 4   G   B "C5'"  1 
ATOM   7350  C "C4'"  . G   B 2 4   ? 173.669 3.779   157.755 1.00 116.61 ? 4   G   B "C4'"  1 
ATOM   7351  O "O4'"  . G   B 2 4   ? 173.554 3.369   156.367 1.00 114.80 ? 4   G   B "O4'"  1 
ATOM   7352  C "C3'"  . G   B 2 4   ? 172.279 3.548   158.323 1.00 118.63 ? 4   G   B "C3'"  1 
ATOM   7353  O "O3'"  . G   B 2 4   ? 172.032 4.298   159.499 1.00 121.12 ? 4   G   B "O3'"  1 
ATOM   7354  C "C2'"  . G   B 2 4   ? 171.384 3.924   157.153 1.00 118.13 ? 4   G   B "C2'"  1 
ATOM   7355  O "O2'"  . G   B 2 4   ? 171.267 5.333   157.035 1.00 115.53 ? 4   G   B "O2'"  1 
ATOM   7356  C "C1'"  . G   B 2 4   ? 172.198 3.395   155.971 1.00 119.20 ? 4   G   B "C1'"  1 
ATOM   7357  N N9     . G   B 2 4   ? 171.791 2.030   155.585 1.00 126.08 ? 4   G   B N9     1 
ATOM   7358  C C8     . G   B 2 4   ? 172.472 0.857   155.811 1.00 125.50 ? 4   G   B C8     1 
ATOM   7359  N N7     . G   B 2 4   ? 171.852 -0.196  155.353 1.00 128.54 ? 4   G   B N7     1 
ATOM   7360  C C5     . G   B 2 4   ? 170.689 0.309   154.790 1.00 134.97 ? 4   G   B C5     1 
ATOM   7361  C C6     . G   B 2 4   ? 169.619 -0.357  154.137 1.00 143.12 ? 4   G   B C6     1 
ATOM   7362  O O6     . G   B 2 4   ? 169.481 -1.568  153.919 1.00 145.52 ? 4   G   B O6     1 
ATOM   7363  N N1     . G   B 2 4   ? 168.640 0.540   153.719 1.00 146.52 ? 4   G   B N1     1 
ATOM   7364  C C2     . G   B 2 4   ? 168.679 1.902   153.903 1.00 144.49 ? 4   G   B C2     1 
ATOM   7365  N N2     . G   B 2 4   ? 167.635 2.598   153.428 1.00 146.51 ? 4   G   B N2     1 
ATOM   7366  N N3     . G   B 2 4   ? 169.671 2.533   154.510 1.00 138.96 ? 4   G   B N3     1 
ATOM   7367  C C4     . G   B 2 4   ? 170.636 1.682   154.924 1.00 133.51 ? 4   G   B C4     1 
ATOM   7368  H "H5'"  . G   B 2 4   ? 175.610 3.175   157.938 1.00 143.16 ? 4   G   B "H5'"  1 
ATOM   7369  H "H5''" . G   B 2 4   ? 174.887 3.342   159.333 1.00 143.16 ? 4   G   B "H5''" 1 
ATOM   7370  H "H4'"  . G   B 2 4   ? 173.870 4.728   157.788 1.00 139.93 ? 4   G   B "H4'"  1 
ATOM   7371  H "H3'"  . G   B 2 4   ? 172.168 2.604   158.518 1.00 142.35 ? 4   G   B "H3'"  1 
ATOM   7372  H "H2'"  . G   B 2 4   ? 170.518 3.492   157.211 1.00 141.76 ? 4   G   B "H2'"  1 
ATOM   7373  H "HO2'" . G   B 2 4   ? 170.740 5.512   156.407 1.00 138.64 ? 4   G   B "HO2'" 1 
ATOM   7374  H "H1'"  . G   B 2 4   ? 172.094 3.991   155.213 1.00 143.04 ? 4   G   B "H1'"  1 
ATOM   7375  H H8     . G   B 2 4   ? 173.293 0.818   156.246 1.00 150.60 ? 4   G   B H8     1 
ATOM   7376  H H1     . G   B 2 4   ? 167.954 0.216   153.313 1.00 175.83 ? 4   G   B H1     1 
ATOM   7377  H H21    . G   B 2 4   ? 166.989 2.189   153.033 1.00 175.81 ? 4   G   B H21    1 
ATOM   7378  H H22    . G   B 2 4   ? 167.611 3.453   153.518 1.00 175.81 ? 4   G   B H22    1 
ATOM   7379  P P      . C   B 2 5   ? 171.062 3.729   160.647 1.00 111.22 ? 5   C   B P      1 
ATOM   7380  O OP1    . C   B 2 5   ? 171.334 4.520   161.874 1.00 111.07 ? 5   C   B OP1    1 
ATOM   7381  O OP2    . C   B 2 5   ? 171.174 2.249   160.702 1.00 111.87 ? 5   C   B OP2    1 
ATOM   7382  O "O5'"  . C   B 2 5   ? 169.604 4.098   160.127 1.00 131.00 ? 5   C   B "O5'"  1 
ATOM   7383  C "C5'"  . C   B 2 5   ? 169.260 5.441   159.824 1.00 136.07 ? 5   C   B "C5'"  1 
ATOM   7384  C "C4'"  . C   B 2 5   ? 167.921 5.530   159.136 1.00 146.35 ? 5   C   B "C4'"  1 
ATOM   7385  O "O4'"  . C   B 2 5   ? 167.997 4.909   157.827 1.00 147.88 ? 5   C   B "O4'"  1 
ATOM   7386  C "C3'"  . C   B 2 5   ? 166.769 4.809   159.820 1.00 156.46 ? 5   C   B "C3'"  1 
ATOM   7387  O "O3'"  . C   B 2 5   ? 166.211 5.542   160.898 1.00 160.92 ? 5   C   B "O3'"  1 
ATOM   7388  C "C2'"  . C   B 2 5   ? 165.802 4.569   158.668 1.00 160.45 ? 5   C   B "C2'"  1 
ATOM   7389  O "O2'"  . C   B 2 5   ? 165.055 5.740   158.369 1.00 165.68 ? 5   C   B "O2'"  1 
ATOM   7390  C "C1'"  . C   B 2 5   ? 166.767 4.288   157.515 1.00 154.27 ? 5   C   B "C1'"  1 
ATOM   7391  N N1     . C   B 2 5   ? 167.004 2.839   157.320 1.00 154.54 ? 5   C   B N1     1 
ATOM   7392  C C2     . C   B 2 5   ? 166.089 2.089   156.573 1.00 160.36 ? 5   C   B C2     1 
ATOM   7393  O O2     . C   B 2 5   ? 165.096 2.653   156.090 1.00 164.40 ? 5   C   B O2     1 
ATOM   7394  N N3     . C   B 2 5   ? 166.307 0.766   156.392 1.00 160.39 ? 5   C   B N3     1 
ATOM   7395  C C4     . C   B 2 5   ? 167.384 0.186   156.923 1.00 156.50 ? 5   C   B C4     1 
ATOM   7396  N N4     . C   B 2 5   ? 167.562 -1.121  156.720 1.00 157.30 ? 5   C   B N4     1 
ATOM   7397  C C5     . C   B 2 5   ? 168.332 0.924   157.688 1.00 151.31 ? 5   C   B C5     1 
ATOM   7398  C C6     . C   B 2 5   ? 168.105 2.233   157.860 1.00 150.45 ? 5   C   B C6     1 
ATOM   7399  H "H5'"  . C   B 2 5   ? 169.939 5.819   159.243 1.00 163.29 ? 5   C   B "H5'"  1 
ATOM   7400  H "H5''" . C   B 2 5   ? 169.228 5.954   160.647 1.00 163.29 ? 5   C   B "H5''" 1 
ATOM   7401  H "H4'"  . C   B 2 5   ? 167.685 6.465   159.028 1.00 175.62 ? 5   C   B "H4'"  1 
ATOM   7402  H "H3'"  . C   B 2 5   ? 167.085 3.953   160.150 1.00 187.75 ? 5   C   B "H3'"  1 
ATOM   7403  H "H2'"  . C   B 2 5   ? 165.224 3.808   158.840 1.00 192.55 ? 5   C   B "H2'"  1 
ATOM   7404  H "HO2'" . C   B 2 5   ? 164.524 5.895   159.002 1.00 198.82 ? 5   C   B "HO2'" 1 
ATOM   7405  H "H1'"  . C   B 2 5   ? 166.411 4.669   156.697 1.00 185.12 ? 5   C   B "H1'"  1 
ATOM   7406  H H41    . C   B 2 5   ? 168.248 -1.519  157.052 1.00 188.76 ? 5   C   B H41    1 
ATOM   7407  H H42    . C   B 2 5   ? 166.989 -1.566  156.258 1.00 188.76 ? 5   C   B H42    1 
ATOM   7408  H H5     . C   B 2 5   ? 169.081 0.513   158.055 1.00 181.57 ? 5   C   B H5     1 
ATOM   7409  H H6     . C   B 2 5   ? 168.708 2.740   158.354 1.00 180.54 ? 5   C   B H6     1 
ATOM   7410  P P      . U   B 2 6   ? 165.281 4.802   161.981 1.00 146.70 ? 6   U   B P      1 
ATOM   7411  O OP1    . U   B 2 6   ? 164.831 5.817   162.966 1.00 150.38 ? 6   U   B OP1    1 
ATOM   7412  O OP2    . U   B 2 6   ? 165.977 3.578   162.459 1.00 142.97 ? 6   U   B OP2    1 
ATOM   7413  O "O5'"  . U   B 2 6   ? 164.017 4.342   161.131 1.00 162.42 ? 6   U   B "O5'"  1 
ATOM   7414  C "C5'"  . U   B 2 6   ? 163.214 3.251   161.550 1.00 166.73 ? 6   U   B "C5'"  1 
ATOM   7415  C "C4'"  . U   B 2 6   ? 162.210 2.875   160.492 1.00 172.30 ? 6   U   B "C4'"  1 
ATOM   7416  O "O4'"  . U   B 2 6   ? 162.901 2.467   159.280 1.00 171.11 ? 6   U   B "O4'"  1 
ATOM   7417  C "C3'"  . U   B 2 6   ? 161.316 1.691   160.822 1.00 177.72 ? 6   U   B "C3'"  1 
ATOM   7418  O "O3'"  . U   B 2 6   ? 160.228 2.035   161.663 1.00 180.89 ? 6   U   B "O3'"  1 
ATOM   7419  C "C2'"  . U   B 2 6   ? 160.902 1.197   159.444 1.00 179.43 ? 6   U   B "C2'"  1 
ATOM   7420  O "O2'"  . U   B 2 6   ? 159.868 2.004   158.898 1.00 183.77 ? 6   U   B "O2'"  1 
ATOM   7421  C "C1'"  . U   B 2 6   ? 162.186 1.426   158.646 1.00 173.33 ? 6   U   B "C1'"  1 
ATOM   7422  N N1     . U   B 2 6   ? 163.041 0.215   158.608 1.00 169.14 ? 6   U   B N1     1 
ATOM   7423  C C2     . U   B 2 6   ? 162.648 -0.820  157.781 1.00 172.31 ? 6   U   B C2     1 
ATOM   7424  O O2     . U   B 2 6   ? 161.642 -0.773  157.096 1.00 177.77 ? 6   U   B O2     1 
ATOM   7425  N N3     . U   B 2 6   ? 163.473 -1.916  157.787 1.00 168.29 ? 6   U   B N3     1 
ATOM   7426  C C4     . U   B 2 6   ? 164.630 -2.082  158.519 1.00 162.65 ? 6   U   B C4     1 
ATOM   7427  O O4     . U   B 2 6   ? 165.264 -3.133  158.413 1.00 160.66 ? 6   U   B O4     1 
ATOM   7428  C C5     . U   B 2 6   ? 164.975 -0.969  159.351 1.00 160.35 ? 6   U   B C5     1 
ATOM   7429  C C6     . U   B 2 6   ? 164.186 0.113   159.364 1.00 162.88 ? 6   U   B C6     1 
ATOM   7430  H "H5'"  . U   B 2 6   ? 162.743 3.496   162.362 1.00 200.07 ? 6   U   B "H5'"  1 
ATOM   7431  H "H5''" . U   B 2 6   ? 163.785 2.488   161.732 1.00 200.07 ? 6   U   B "H5''" 1 
ATOM   7432  H "H4'"  . U   B 2 6   ? 161.654 3.645   160.295 1.00 206.76 ? 6   U   B "H4'"  1 
ATOM   7433  H "H3'"  . U   B 2 6   ? 161.847 1.006   161.257 1.00 213.26 ? 6   U   B "H3'"  1 
ATOM   7434  H "H2'"  . U   B 2 6   ? 160.656 0.258   159.460 1.00 215.32 ? 6   U   B "H2'"  1 
ATOM   7435  H "HO2'" . U   B 2 6   ? 159.163 1.878   159.337 1.00 220.52 ? 6   U   B "HO2'" 1 
ATOM   7436  H "H1'"  . U   B 2 6   ? 161.961 1.693   157.740 1.00 207.99 ? 6   U   B "H1'"  1 
ATOM   7437  H H3     . U   B 2 6   ? 163.244 -2.571  157.279 1.00 201.94 ? 6   U   B H3     1 
ATOM   7438  H H5     . U   B 2 6   ? 165.741 -0.998  159.878 1.00 192.42 ? 6   U   B H5     1 
ATOM   7439  H H6     . U   B 2 6   ? 164.423 0.827   159.910 1.00 195.45 ? 6   U   B H6     1 
ATOM   7440  P P      . G   B 2 7   ? 159.860 1.108   162.923 1.00 206.70 ? 7   G   B P      1 
ATOM   7441  O OP1    . G   B 2 7   ? 158.761 1.767   163.672 1.00 212.22 ? 7   G   B OP1    1 
ATOM   7442  O OP2    . G   B 2 7   ? 161.118 0.759   163.632 1.00 201.42 ? 7   G   B OP2    1 
ATOM   7443  O "O5'"  . G   B 2 7   ? 159.277 -0.218  162.261 1.00 216.58 ? 7   G   B "O5'"  1 
ATOM   7444  C "C5'"  . G   B 2 7   ? 158.133 -0.166  161.422 1.00 221.37 ? 7   G   B "C5'"  1 
ATOM   7445  C "C4'"  . G   B 2 7   ? 157.857 -1.496  160.765 1.00 226.00 ? 7   G   B "C4'"  1 
ATOM   7446  O "O4'"  . G   B 2 7   ? 158.880 -1.786  159.776 1.00 224.59 ? 7   G   B "O4'"  1 
ATOM   7447  C "C3'"  . G   B 2 7   ? 157.871 -2.713  161.677 1.00 229.17 ? 7   G   B "C3'"  1 
ATOM   7448  O "O3'"  . G   B 2 7   ? 156.667 -2.866  162.409 1.00 232.29 ? 7   G   B "O3'"  1 
ATOM   7449  C "C2'"  . G   B 2 7   ? 158.150 -3.851  160.702 1.00 230.45 ? 7   G   B "C2'"  1 
ATOM   7450  O "O2'"  . G   B 2 7   ? 156.971 -4.238  160.011 1.00 236.06 ? 7   G   B "O2'"  1 
ATOM   7451  C "C1'"  . G   B 2 7   ? 159.106 -3.180  159.712 1.00 224.86 ? 7   G   B "C1'"  1 
ATOM   7452  N N9     . G   B 2 7   ? 160.525 -3.448  160.024 1.00 217.98 ? 7   G   B N9     1 
ATOM   7453  C C8     . G   B 2 7   ? 161.406 -2.606  160.660 1.00 212.64 ? 7   G   B C8     1 
ATOM   7454  N N7     . G   B 2 7   ? 162.601 -3.115  160.794 1.00 208.12 ? 7   G   B N7     1 
ATOM   7455  C C5     . G   B 2 7   ? 162.509 -4.369  160.208 1.00 208.53 ? 7   G   B C5     1 
ATOM   7456  C C6     . G   B 2 7   ? 163.491 -5.382  160.052 1.00 204.15 ? 7   G   B C6     1 
ATOM   7457  O O6     . G   B 2 7   ? 164.674 -5.373  160.412 1.00 196.78 ? 7   G   B O6     1 
ATOM   7458  N N1     . G   B 2 7   ? 162.975 -6.498  159.400 1.00 210.61 ? 7   G   B N1     1 
ATOM   7459  C C2     . G   B 2 7   ? 161.681 -6.623  158.956 1.00 218.10 ? 7   G   B C2     1 
ATOM   7460  N N2     . G   B 2 7   ? 161.373 -7.778  158.349 1.00 222.05 ? 7   G   B N2     1 
ATOM   7461  N N3     . G   B 2 7   ? 160.757 -5.685  159.095 1.00 219.56 ? 7   G   B N3     1 
ATOM   7462  C C4     . G   B 2 7   ? 161.235 -4.591  159.726 1.00 215.65 ? 7   G   B C4     1 
ATOM   7463  H "H5'"  . G   B 2 7   ? 158.277 0.502   160.733 1.00 265.64 ? 7   G   B "H5'"  1 
ATOM   7464  H "H5''" . G   B 2 7   ? 157.363 0.089   161.953 1.00 265.64 ? 7   G   B "H5''" 1 
ATOM   7465  H "H4'"  . G   B 2 7   ? 156.997 -1.451  160.319 1.00 271.20 ? 7   G   B "H4'"  1 
ATOM   7466  H "H3'"  . G   B 2 7   ? 158.613 -2.637  162.297 1.00 275.01 ? 7   G   B "H3'"  1 
ATOM   7467  H "H2'"  . G   B 2 7   ? 158.571 -4.605  161.146 1.00 276.54 ? 7   G   B "H2'"  1 
ATOM   7468  H "HO2'" . G   B 2 7   ? 157.159 -4.858  159.476 1.00 283.28 ? 7   G   B "HO2'" 1 
ATOM   7469  H "H1'"  . G   B 2 7   ? 158.910 -3.494  158.816 1.00 269.83 ? 7   G   B "H1'"  1 
ATOM   7470  H H8     . G   B 2 7   ? 161.173 -1.760  160.967 1.00 255.17 ? 7   G   B H8     1 
ATOM   7471  H H1     . G   B 2 7   ? 163.506 -7.160  159.266 1.00 252.74 ? 7   G   B H1     1 
ATOM   7472  H H21    . G   B 2 7   ? 161.971 -8.389  158.257 1.00 266.46 ? 7   G   B H21    1 
ATOM   7473  H H22    . G   B 2 7   ? 160.576 -7.908  158.052 1.00 266.46 ? 7   G   B H22    1 
ATOM   7474  P P      . C   B 2 8   ? 156.679 -3.533  163.873 1.00 207.42 ? 8   C   B P      1 
ATOM   7475  O OP1    . C   B 2 8   ? 155.318 -3.388  164.447 1.00 213.39 ? 8   C   B OP1    1 
ATOM   7476  O OP2    . C   B 2 8   ? 157.847 -3.020  164.632 1.00 202.15 ? 8   C   B OP2    1 
ATOM   7477  O "O5'"  . C   B 2 8   ? 156.915 -5.080  163.580 1.00 220.18 ? 8   C   B "O5'"  1 
ATOM   7478  C "C5'"  . C   B 2 8   ? 155.983 -5.818  162.805 1.00 223.63 ? 8   C   B "C5'"  1 
ATOM   7479  C "C4'"  . C   B 2 8   ? 156.462 -7.224  162.547 1.00 223.95 ? 8   C   B "C4'"  1 
ATOM   7480  O "O4'"  . C   B 2 8   ? 157.644 -7.202  161.704 1.00 220.06 ? 8   C   B "O4'"  1 
ATOM   7481  C "C3'"  . C   B 2 8   ? 156.899 -8.015  163.769 1.00 224.09 ? 8   C   B "C3'"  1 
ATOM   7482  O "O3'"  . C   B 2 8   ? 155.808 -8.550  164.498 1.00 227.22 ? 8   C   B "O3'"  1 
ATOM   7483  C "C2'"  . C   B 2 8   ? 157.819 -9.068  163.165 1.00 221.83 ? 8   C   B "C2'"  1 
ATOM   7484  O "O2'"  . C   B 2 8   ? 157.076 -10.132 162.588 1.00 225.10 ? 8   C   B "O2'"  1 
ATOM   7485  C "C1'"  . C   B 2 8   ? 158.500 -8.272  162.049 1.00 216.90 ? 8   C   B "C1'"  1 
ATOM   7486  N N1     . C   B 2 8   ? 159.809 -7.721  162.472 1.00 208.10 ? 8   C   B N1     1 
ATOM   7487  C C2     . C   B 2 8   ? 160.953 -8.523  162.376 1.00 204.34 ? 8   C   B C2     1 
ATOM   7488  O O2     . C   B 2 8   ? 160.850 -9.678  161.936 1.00 207.68 ? 8   C   B O2     1 
ATOM   7489  N N3     . C   B 2 8   ? 162.149 -8.021  162.764 1.00 196.49 ? 8   C   B N3     1 
ATOM   7490  C C4     . C   B 2 8   ? 162.233 -6.776  163.234 1.00 191.34 ? 8   C   B C4     1 
ATOM   7491  N N4     . C   B 2 8   ? 163.434 -6.326  163.604 1.00 184.40 ? 8   C   B N4     1 
ATOM   7492  C C5     . C   B 2 8   ? 161.086 -5.938  163.344 1.00 195.85 ? 8   C   B C5     1 
ATOM   7493  C C6     . C   B 2 8   ? 159.908 -6.445  162.957 1.00 202.72 ? 8   C   B C6     1 
ATOM   7494  H "H5'"  . C   B 2 8   ? 155.852 -5.368  161.955 1.00 268.35 ? 8   C   B "H5'"  1 
ATOM   7495  H "H5''" . C   B 2 8   ? 155.137 -5.854  163.277 1.00 268.35 ? 8   C   B "H5''" 1 
ATOM   7496  H "H4'"  . C   B 2 8   ? 155.761 -7.714  162.090 1.00 268.74 ? 8   C   B "H4'"  1 
ATOM   7497  H "H3'"  . C   B 2 8   ? 157.417 -7.437  164.351 1.00 268.91 ? 8   C   B "H3'"  1 
ATOM   7498  H "H2'"  . C   B 2 8   ? 158.464 -9.391  163.814 1.00 266.20 ? 8   C   B "H2'"  1 
ATOM   7499  H "HO2'" . C   B 2 8   ? 156.702 -10.569 163.200 1.00 270.12 ? 8   C   B "HO2'" 1 
ATOM   7500  H "H1'"  . C   B 2 8   ? 158.626 -8.845  161.276 1.00 260.28 ? 8   C   B "H1'"  1 
ATOM   7501  H H41    . C   B 2 8   ? 163.518 -5.526  163.910 1.00 221.28 ? 8   C   B H41    1 
ATOM   7502  H H42    . C   B 2 8   ? 164.124 -6.835  163.536 1.00 221.28 ? 8   C   B H42    1 
ATOM   7503  H H5     . C   B 2 8   ? 161.153 -5.071  163.672 1.00 235.02 ? 8   C   B H5     1 
ATOM   7504  H H6     . C   B 2 8   ? 159.143 -5.920  163.018 1.00 243.26 ? 8   C   B H6     1 
ATOM   7505  P P      . G   B 2 9   ? 156.018 -9.066  166.005 1.00 210.17 ? 9   G   B P      1 
ATOM   7506  O OP1    . G   B 2 9   ? 154.686 -9.435  166.548 1.00 216.86 ? 9   G   B OP1    1 
ATOM   7507  O OP2    . G   B 2 9   ? 156.854 -8.078  166.733 1.00 204.51 ? 9   G   B OP2    1 
ATOM   7508  O "O5'"  . G   B 2 9   ? 156.862 -10.403 165.826 1.00 204.59 ? 9   G   B "O5'"  1 
ATOM   7509  C "C5'"  . G   B 2 9   ? 157.527 -11.005 166.924 1.00 201.25 ? 9   G   B "C5'"  1 
ATOM   7510  C "C4'"  . G   B 2 9   ? 158.580 -11.976 166.456 1.00 196.15 ? 9   G   B "C4'"  1 
ATOM   7511  O "O4'"  . G   B 2 9   ? 159.420 -11.343 165.455 1.00 192.22 ? 9   G   B "O4'"  1 
ATOM   7512  C "C3'"  . G   B 2 9   ? 159.557 -12.451 167.518 1.00 192.32 ? 9   G   B "C3'"  1 
ATOM   7513  O "O3'"  . G   B 2 9   ? 159.035 -13.507 168.305 1.00 192.69 ? 9   G   B "O3'"  1 
ATOM   7514  C "C2'"  . G   B 2 9   ? 160.780 -12.842 166.698 1.00 189.65 ? 9   G   B "C2'"  1 
ATOM   7515  O "O2'"  . G   B 2 9   ? 160.621 -14.128 166.116 1.00 191.23 ? 9   G   B "O2'"  1 
ATOM   7516  C "C1'"  . G   B 2 9   ? 160.753 -11.788 165.590 1.00 187.53 ? 9   G   B "C1'"  1 
ATOM   7517  N N9     . G   B 2 9   ? 161.603 -10.621 165.903 1.00 180.36 ? 9   G   B N9     1 
ATOM   7518  C C8     . G   B 2 9   ? 161.176 -9.342  166.167 1.00 178.48 ? 9   G   B C8     1 
ATOM   7519  N N7     . G   B 2 9   ? 162.152 -8.510  166.408 1.00 172.86 ? 9   G   B N7     1 
ATOM   7520  C C5     . G   B 2 9   ? 163.296 -9.285  166.293 1.00 168.15 ? 9   G   B C5     1 
ATOM   7521  C C6     . G   B 2 9   ? 164.660 -8.930  166.446 1.00 159.86 ? 9   G   B C6     1 
ATOM   7522  O O6     . G   B 2 9   ? 165.139 -7.822  166.722 1.00 154.66 ? 9   G   B O6     1 
ATOM   7523  N N1     . G   B 2 9   ? 165.499 -10.022 166.243 1.00 159.48 ? 9   G   B N1     1 
ATOM   7524  C C2     . G   B 2 9   ? 165.079 -11.294 165.933 1.00 163.02 ? 9   G   B C2     1 
ATOM   7525  N N2     . G   B 2 9   ? 166.039 -12.217 165.775 1.00 160.66 ? 9   G   B N2     1 
ATOM   7526  N N3     . G   B 2 9   ? 163.809 -11.637 165.787 1.00 169.38 ? 9   G   B N3     1 
ATOM   7527  C C4     . G   B 2 9   ? 162.977 -10.591 165.979 1.00 172.89 ? 9   G   B C4     1 
ATOM   7528  H "H5'"  . G   B 2 9   ? 156.879 -11.477 167.469 1.00 241.49 ? 9   G   B "H5'"  1 
ATOM   7529  H "H5''" . G   B 2 9   ? 157.948 -10.313 167.458 1.00 241.49 ? 9   G   B "H5''" 1 
ATOM   7530  H "H4'"  . G   B 2 9   ? 158.144 -12.747 166.060 1.00 235.37 ? 9   G   B "H4'"  1 
ATOM   7531  H "H3'"  . G   B 2 9   ? 159.786 -11.707 168.095 1.00 230.79 ? 9   G   B "H3'"  1 
ATOM   7532  H "H2'"  . G   B 2 9   ? 161.593 -12.783 167.223 1.00 227.58 ? 9   G   B "H2'"  1 
ATOM   7533  H "HO2'" . G   B 2 9   ? 160.020 -14.543 166.531 1.00 229.48 ? 9   G   B "HO2'" 1 
ATOM   7534  H "H1'"  . G   B 2 9   ? 161.047 -12.187 164.757 1.00 225.04 ? 9   G   B "H1'"  1 
ATOM   7535  H H8     . G   B 2 9   ? 160.279 -9.094  166.176 1.00 214.17 ? 9   G   B H8     1 
ATOM   7536  H H1     . G   B 2 9   ? 166.345 -9.892  166.318 1.00 191.37 ? 9   G   B H1     1 
ATOM   7537  H H21    . G   B 2 9   ? 166.865 -11.998 165.869 1.00 192.79 ? 9   G   B H21    1 
ATOM   7538  H H22    . G   B 2 9   ? 165.828 -13.028 165.580 1.00 192.79 ? 9   G   B H22    1 
ATOM   7539  P P      . G   B 2 10  ? 159.350 -13.578 169.879 1.00 214.67 ? 10  G   B P      1 
ATOM   7540  O OP1    . G   B 2 10  ? 158.443 -14.591 170.477 1.00 219.44 ? 10  G   B OP1    1 
ATOM   7541  O OP2    . G   B 2 10  ? 159.357 -12.195 170.423 1.00 211.65 ? 10  G   B OP2    1 
ATOM   7542  O "O5'"  . G   B 2 10  ? 160.833 -14.154 169.946 1.00 196.42 ? 10  G   B "O5'"  1 
ATOM   7543  C "C5'"  . G   B 2 10  ? 161.126 -15.465 169.483 1.00 194.22 ? 10  G   B "C5'"  1 
ATOM   7544  C "C4'"  . G   B 2 10  ? 162.613 -15.715 169.428 1.00 186.56 ? 10  G   B "C4'"  1 
ATOM   7545  O "O4'"  . G   B 2 10  ? 163.231 -14.791 168.492 1.00 182.22 ? 10  G   B "O4'"  1 
ATOM   7546  C "C3'"  . G   B 2 10  ? 163.375 -15.491 170.726 1.00 180.84 ? 10  G   B "C3'"  1 
ATOM   7547  O "O3'"  . G   B 2 10  ? 163.289 -16.586 171.622 1.00 181.28 ? 10  G   B "O3'"  1 
ATOM   7548  C "C2'"  . G   B 2 10  ? 164.787 -15.210 170.233 1.00 174.76 ? 10  G   B "C2'"  1 
ATOM   7549  O "O2'"  . G   B 2 10  ? 165.460 -16.410 169.882 1.00 171.44 ? 10  G   B "O2'"  1 
ATOM   7550  C "C1'"  . G   B 2 10  ? 164.506 -14.408 168.964 1.00 175.72 ? 10  G   B "C1'"  1 
ATOM   7551  N N9     . G   B 2 10  ? 164.492 -12.956 169.225 1.00 171.65 ? 10  G   B N9     1 
ATOM   7552  C C8     . G   B 2 10  ? 163.392 -12.136 169.299 1.00 172.50 ? 10  G   B C8     1 
ATOM   7553  N N7     . G   B 2 10  ? 163.693 -10.892 169.550 1.00 169.86 ? 10  G   B N7     1 
ATOM   7554  C C5     . G   B 2 10  ? 165.078 -10.891 169.650 1.00 165.31 ? 10  G   B C5     1 
ATOM   7555  C C6     . G   B 2 10  ? 165.980 -9.827  169.911 1.00 159.48 ? 10  G   B C6     1 
ATOM   7556  O O6     . G   B 2 10  ? 165.725 -8.632  170.112 1.00 158.16 ? 10  G   B O6     1 
ATOM   7557  N N1     . G   B 2 10  ? 167.301 -10.268 169.925 1.00 155.14 ? 10  G   B N1     1 
ATOM   7558  C C2     . G   B 2 10  ? 167.706 -11.564 169.717 1.00 153.65 ? 10  G   B C2     1 
ATOM   7559  N N2     . G   B 2 10  ? 169.027 -11.791 169.771 1.00 147.87 ? 10  G   B N2     1 
ATOM   7560  N N3     . G   B 2 10  ? 166.875 -12.564 169.472 1.00 159.75 ? 10  G   B N3     1 
ATOM   7561  C C4     . G   B 2 10  ? 165.587 -12.158 169.453 1.00 165.70 ? 10  G   B C4     1 
ATOM   7562  H "H5'"  . G   B 2 10  ? 160.753 -15.578 168.595 1.00 233.07 ? 10  G   B "H5'"  1 
ATOM   7563  H "H5''" . G   B 2 10  ? 160.719 -16.110 170.082 1.00 233.07 ? 10  G   B "H5''" 1 
ATOM   7564  H "H4'"  . G   B 2 10  ? 162.768 -16.623 169.124 1.00 223.87 ? 10  G   B "H4'"  1 
ATOM   7565  H "H3'"  . G   B 2 10  ? 163.029 -14.697 171.162 1.00 217.01 ? 10  G   B "H3'"  1 
ATOM   7566  H "H2'"  . G   B 2 10  ? 165.293 -14.689 170.877 1.00 209.72 ? 10  G   B "H2'"  1 
ATOM   7567  H "HO2'" . G   B 2 10  ? 165.095 -17.054 170.279 1.00 205.73 ? 10  G   B "HO2'" 1 
ATOM   7568  H "H1'"  . G   B 2 10  ? 165.177 -14.613 168.293 1.00 210.86 ? 10  G   B "H1'"  1 
ATOM   7569  H H8     . G   B 2 10  ? 162.520 -12.438 169.180 1.00 207.00 ? 10  G   B H8     1 
ATOM   7570  H H1     . G   B 2 10  ? 167.913 -9.683  170.077 1.00 186.16 ? 10  G   B H1     1 
ATOM   7571  H H21    . G   B 2 10  ? 169.569 -11.142 169.930 1.00 177.45 ? 10  G   B H21    1 
ATOM   7572  H H22    . G   B 2 10  ? 169.333 -12.585 169.646 1.00 177.45 ? 10  G   B H22    1 
ATOM   7573  P P      . G   B 2 11  ? 163.695 -16.399 173.166 1.00 184.64 ? 11  G   B P      1 
ATOM   7574  O OP1    . G   B 2 11  ? 163.376 -17.660 173.883 1.00 188.17 ? 11  G   B OP1    1 
ATOM   7575  O OP2    . G   B 2 11  ? 163.128 -15.115 173.654 1.00 182.35 ? 11  G   B OP2    1 
ATOM   7576  O "O5'"  . G   B 2 11  ? 165.280 -16.247 173.124 1.00 169.47 ? 11  G   B "O5'"  1 
ATOM   7577  C "C5'"  . G   B 2 11  ? 166.006 -15.813 174.264 1.00 163.99 ? 11  G   B "C5'"  1 
ATOM   7578  C "C4'"  . G   B 2 11  ? 167.404 -15.393 173.891 1.00 156.26 ? 11  G   B "C4'"  1 
ATOM   7579  O "O4'"  . G   B 2 11  ? 167.360 -14.523 172.729 1.00 152.90 ? 11  G   B "O4'"  1 
ATOM   7580  C "C3'"  . G   B 2 11  ? 168.150 -14.579 174.937 1.00 152.03 ? 11  G   B "C3'"  1 
ATOM   7581  O "O3'"  . G   B 2 11  ? 168.738 -15.381 175.945 1.00 152.99 ? 11  G   B "O3'"  1 
ATOM   7582  C "C2'"  . G   B 2 11  ? 169.157 -13.805 174.100 1.00 145.81 ? 11  G   B "C2'"  1 
ATOM   7583  O "O2'"  . G   B 2 11  ? 170.269 -14.617 173.751 1.00 140.80 ? 11  G   B "O2'"  1 
ATOM   7584  C "C1'"  . G   B 2 11  ? 168.341 -13.515 172.841 1.00 147.13 ? 11  G   B "C1'"  1 
ATOM   7585  N N9     . G   B 2 11  ? 167.656 -12.209 172.904 1.00 144.01 ? 11  G   B N9     1 
ATOM   7586  C C8     . G   B 2 11  ? 166.300 -11.988 172.838 1.00 145.29 ? 11  G   B C8     1 
ATOM   7587  N N7     . G   B 2 11  ? 165.979 -10.725 172.914 1.00 143.17 ? 11  G   B N7     1 
ATOM   7588  C C5     . G   B 2 11  ? 167.198 -10.072 173.035 1.00 137.95 ? 11  G   B C5     1 
ATOM   7589  C C6     . G   B 2 11  ? 167.488 -8.689  173.155 1.00 131.80 ? 11  G   B C6     1 
ATOM   7590  O O6     . G   B 2 11  ? 166.697 -7.739  173.179 1.00 130.93 ? 11  G   B O6     1 
ATOM   7591  N N1     . G   B 2 11  ? 168.859 -8.461  173.252 1.00 127.45 ? 11  G   B N1     1 
ATOM   7592  C C2     . G   B 2 11  ? 169.826 -9.437  173.237 1.00 126.15 ? 11  G   B C2     1 
ATOM   7593  N N2     . G   B 2 11  ? 171.098 -9.023  173.341 1.00 120.42 ? 11  G   B N2     1 
ATOM   7594  N N3     . G   B 2 11  ? 169.568 -10.729 173.125 1.00 131.89 ? 11  G   B N3     1 
ATOM   7595  C C4     . G   B 2 11  ? 168.244 -10.972 173.027 1.00 138.18 ? 11  G   B C4     1 
ATOM   7596  H "H5'"  . G   B 2 11  ? 166.052 -16.539 174.906 1.00 196.79 ? 11  G   B "H5'"  1 
ATOM   7597  H "H5''" . G   B 2 11  ? 165.544 -15.061 174.668 1.00 196.79 ? 11  G   B "H5''" 1 
ATOM   7598  H "H4'"  . G   B 2 11  ? 167.924 -16.182 173.676 1.00 187.51 ? 11  G   B "H4'"  1 
ATOM   7599  H "H3'"  . G   B 2 11  ? 167.534 -13.954 175.349 1.00 182.44 ? 11  G   B "H3'"  1 
ATOM   7600  H "H2'"  . G   B 2 11  ? 169.433 -12.986 174.540 1.00 174.97 ? 11  G   B "H2'"  1 
ATOM   7601  H "HO2'" . G   B 2 11  ? 170.329 -15.249 174.301 1.00 168.97 ? 11  G   B "HO2'" 1 
ATOM   7602  H "H1'"  . G   B 2 11  ? 168.922 -13.540 172.064 1.00 176.56 ? 11  G   B "H1'"  1 
ATOM   7603  H H8     . G   B 2 11  ? 165.674 -12.670 172.750 1.00 174.34 ? 11  G   B H8     1 
ATOM   7604  H H1     . G   B 2 11  ? 169.120 -7.646  173.329 1.00 152.94 ? 11  G   B H1     1 
ATOM   7605  H H21    . G   B 2 11  ? 171.272 -8.184  173.415 1.00 144.50 ? 11  G   B H21    1 
ATOM   7606  H H22    . G   B 2 11  ? 171.739 -9.597  173.335 1.00 144.50 ? 11  G   B H22    1 
ATOM   7607  P P      . G   B 2 12  ? 168.768 -14.860 177.462 1.00 149.13 ? 12  G   B P      1 
ATOM   7608  O OP1    . G   B 2 12  ? 169.362 -15.910 178.328 1.00 151.52 ? 12  G   B OP1    1 
ATOM   7609  O OP2    . G   B 2 12  ? 167.414 -14.338 177.775 1.00 148.95 ? 12  G   B OP2    1 
ATOM   7610  O "O5'"  . G   B 2 12  ? 169.799 -13.649 177.420 1.00 145.03 ? 12  G   B "O5'"  1 
ATOM   7611  C "C5'"  . G   B 2 12  ? 171.156 -13.865 177.061 1.00 142.65 ? 12  G   B "C5'"  1 
ATOM   7612  C "C4'"  . G   B 2 12  ? 171.930 -12.571 177.011 1.00 139.18 ? 12  G   B "C4'"  1 
ATOM   7613  O "O4'"  . G   B 2 12  ? 171.385 -11.713 175.974 1.00 137.40 ? 12  G   B "O4'"  1 
ATOM   7614  C "C3'"  . G   B 2 12  ? 171.876 -11.715 178.266 1.00 138.23 ? 12  G   B "C3'"  1 
ATOM   7615  O "O3'"  . G   B 2 12  ? 172.782 -12.142 179.269 1.00 138.06 ? 12  G   B "O3'"  1 
ATOM   7616  C "C2'"  . G   B 2 12  ? 172.171 -10.323 177.730 1.00 135.53 ? 12  G   B "C2'"  1 
ATOM   7617  O "O2'"  . G   B 2 12  ? 173.564 -10.149 177.514 1.00 133.00 ? 12  G   B "O2'"  1 
ATOM   7618  C "C1'"  . G   B 2 12  ? 171.460 -10.362 176.378 1.00 135.60 ? 12  G   B "C1'"  1 
ATOM   7619  N N9     . G   B 2 12  ? 170.090 -9.814  176.444 1.00 136.54 ? 12  G   B N9     1 
ATOM   7620  C C8     . G   B 2 12  ? 168.914 -10.520 176.352 1.00 137.04 ? 12  G   B C8     1 
ATOM   7621  N N7     . G   B 2 12  ? 167.851 -9.768  176.437 1.00 138.75 ? 12  G   B N7     1 
ATOM   7622  C C5     . G   B 2 12  ? 168.352 -8.481  176.592 1.00 139.21 ? 12  G   B C5     1 
ATOM   7623  C C6     . G   B 2 12  ? 167.674 -7.240  176.735 1.00 139.82 ? 12  G   B C6     1 
ATOM   7624  O O6     . G   B 2 12  ? 166.456 -7.024  176.755 1.00 143.24 ? 12  G   B O6     1 
ATOM   7625  N N1     . G   B 2 12  ? 168.566 -6.180  176.866 1.00 136.01 ? 12  G   B N1     1 
ATOM   7626  C C2     . G   B 2 12  ? 169.935 -6.296  176.859 1.00 133.32 ? 12  G   B C2     1 
ATOM   7627  N N2     . G   B 2 12  ? 170.629 -5.158  176.997 1.00 129.56 ? 12  G   B N2     1 
ATOM   7628  N N3     . G   B 2 12  ? 170.579 -7.446  176.725 1.00 135.35 ? 12  G   B N3     1 
ATOM   7629  C C4     . G   B 2 12  ? 169.732 -8.492  176.597 1.00 137.55 ? 12  G   B C4     1 
ATOM   7630  H "H5'"  . G   B 2 12  ? 171.189 -14.287 176.188 1.00 171.18 ? 12  G   B "H5'"  1 
ATOM   7631  H "H5''" . G   B 2 12  ? 171.567 -14.454 177.714 1.00 171.18 ? 12  G   B "H5''" 1 
ATOM   7632  H "H4'"  . G   B 2 12  ? 172.857 -12.767 176.803 1.00 167.01 ? 12  G   B "H4'"  1 
ATOM   7633  H "H3'"  . G   B 2 12  ? 170.974 -11.733 178.624 1.00 165.88 ? 12  G   B "H3'"  1 
ATOM   7634  H "H2'"  . G   B 2 12  ? 171.806 -9.633  178.305 1.00 162.64 ? 12  G   B "H2'"  1 
ATOM   7635  H "HO2'" . G   B 2 12  ? 173.985 -10.699 177.988 1.00 159.60 ? 12  G   B "HO2'" 1 
ATOM   7636  H "H1'"  . G   B 2 12  ? 171.976 -9.860  175.728 1.00 162.71 ? 12  G   B "H1'"  1 
ATOM   7637  H H8     . G   B 2 12  ? 168.880 -11.443 176.242 1.00 164.44 ? 12  G   B H8     1 
ATOM   7638  H H1     . G   B 2 12  ? 168.235 -5.392  176.958 1.00 163.21 ? 12  G   B H1     1 
ATOM   7639  H H21    . G   B 2 12  ? 170.215 -4.409  177.084 1.00 155.47 ? 12  G   B H21    1 
ATOM   7640  H H22    . G   B 2 12  ? 171.489 -5.176  176.998 1.00 155.47 ? 12  G   B H22    1 
ATOM   7641  P P      . U   B 2 13  ? 172.416 -11.952 180.824 1.00 132.60 ? 13  U   B P      1 
ATOM   7642  O OP1    . U   B 2 13  ? 173.487 -12.567 181.648 1.00 132.15 ? 13  U   B OP1    1 
ATOM   7643  O OP2    . U   B 2 13  ? 171.007 -12.385 181.007 1.00 133.98 ? 13  U   B OP2    1 
ATOM   7644  O "O5'"  . U   B 2 13  ? 172.500 -10.379 181.055 1.00 135.07 ? 13  U   B "O5'"  1 
ATOM   7645  C "C5'"  . U   B 2 13  ? 173.738 -9.690  180.954 1.00 133.35 ? 13  U   B "C5'"  1 
ATOM   7646  C "C4'"  . U   B 2 13  ? 173.562 -8.203  181.141 1.00 133.26 ? 13  U   B "C4'"  1 
ATOM   7647  O "O4'"  . U   B 2 13  ? 172.773 -7.657  180.049 1.00 132.52 ? 13  U   B "O4'"  1 
ATOM   7648  C "C3'"  . U   B 2 13  ? 172.809 -7.769  182.389 1.00 135.12 ? 13  U   B "C3'"  1 
ATOM   7649  O "O3'"  . U   B 2 13  ? 173.615 -7.775  183.555 1.00 137.30 ? 13  U   B "O3'"  1 
ATOM   7650  C "C2'"  . U   B 2 13  ? 172.302 -6.387  181.998 1.00 132.67 ? 13  U   B "C2'"  1 
ATOM   7651  O "O2'"  . U   B 2 13  ? 173.330 -5.413  182.100 1.00 130.43 ? 13  U   B "O2'"  1 
ATOM   7652  C "C1'"  . U   B 2 13  ? 171.964 -6.599  180.522 1.00 132.08 ? 13  U   B "C1'"  1 
ATOM   7653  N N1     . U   B 2 13  ? 170.540 -6.961  180.326 1.00 133.14 ? 13  U   B N1     1 
ATOM   7654  C C2     . U   B 2 13  ? 169.600 -5.945  180.313 1.00 135.56 ? 13  U   B C2     1 
ATOM   7655  O O2     . U   B 2 13  ? 169.888 -4.767  180.448 1.00 136.69 ? 13  U   B O2     1 
ATOM   7656  N N3     . U   B 2 13  ? 168.303 -6.358  180.134 1.00 136.86 ? 13  U   B N3     1 
ATOM   7657  C C4     . U   B 2 13  ? 167.854 -7.652  179.973 1.00 136.82 ? 13  U   B C4     1 
ATOM   7658  O O4     . U   B 2 13  ? 166.651 -7.866  179.821 1.00 138.75 ? 13  U   B O4     1 
ATOM   7659  C C5     . U   B 2 13  ? 168.881 -8.646  179.999 1.00 134.58 ? 13  U   B C5     1 
ATOM   7660  C C6     . U   B 2 13  ? 170.153 -8.272  180.172 1.00 132.71 ? 13  U   B C6     1 
ATOM   7661  H "H5'"  . U   B 2 13  ? 174.122 -9.856  180.079 1.00 160.01 ? 13  U   B "H5'"  1 
ATOM   7662  H "H5''" . U   B 2 13  ? 174.343 -10.025 181.634 1.00 160.01 ? 13  U   B "H5''" 1 
ATOM   7663  H "H4'"  . U   B 2 13  ? 174.435 -7.781  181.138 1.00 159.91 ? 13  U   B "H4'"  1 
ATOM   7664  H "H3'"  . U   B 2 13  ? 172.051 -8.359  182.524 1.00 162.14 ? 13  U   B "H3'"  1 
ATOM   7665  H "H2'"  . U   B 2 13  ? 171.516 -6.138  182.510 1.00 159.21 ? 13  U   B "H2'"  1 
ATOM   7666  H "HO2'" . U   B 2 13  ? 173.517 -5.296  182.910 1.00 156.51 ? 13  U   B "HO2'" 1 
ATOM   7667  H "H1'"  . U   B 2 13  ? 172.165 -5.791  180.024 1.00 158.49 ? 13  U   B "H1'"  1 
ATOM   7668  H H3     . U   B 2 13  ? 167.703 -5.741  180.121 1.00 164.23 ? 13  U   B H3     1 
ATOM   7669  H H5     . U   B 2 13  ? 168.666 -9.545  179.897 1.00 161.50 ? 13  U   B H5     1 
ATOM   7670  H H6     . U   B 2 13  ? 170.809 -8.931  180.188 1.00 159.25 ? 13  U   B H6     1 
ATOM   7671  P P      . U   B 2 14  ? 173.133 -8.555  184.876 1.00 127.10 ? 14  U   B P      1 
ATOM   7672  O OP1    . U   B 2 14  ? 174.153 -8.304  185.927 1.00 126.68 ? 14  U   B OP1    1 
ATOM   7673  O OP2    . U   B 2 14  ? 172.744 -9.943  184.503 1.00 125.55 ? 14  U   B OP2    1 
ATOM   7674  O "O5'"  . U   B 2 14  ? 171.829 -7.771  185.333 1.00 129.68 ? 14  U   B "O5'"  1 
ATOM   7675  C "C5'"  . U   B 2 14  ? 171.921 -6.410  185.712 1.00 131.07 ? 14  U   B "C5'"  1 
ATOM   7676  C "C4'"  . U   B 2 14  ? 170.573 -5.739  185.727 1.00 134.49 ? 14  U   B "C4'"  1 
ATOM   7677  O "O4'"  . U   B 2 14  ? 169.921 -5.878  184.439 1.00 135.10 ? 14  U   B "O4'"  1 
ATOM   7678  C "C3'"  . U   B 2 14  ? 169.561 -6.294  186.708 1.00 137.10 ? 14  U   B "C3'"  1 
ATOM   7679  O "O3'"  . U   B 2 14  ? 169.777 -5.825  188.020 1.00 137.97 ? 14  U   B "O3'"  1 
ATOM   7680  C "C2'"  . U   B 2 14  ? 168.237 -5.834  186.118 1.00 139.31 ? 14  U   B "C2'"  1 
ATOM   7681  O "O2'"  . U   B 2 14  ? 167.962 -4.486  186.473 1.00 140.33 ? 14  U   B "O2'"  1 
ATOM   7682  C "C1'"  . U   B 2 14  ? 168.520 -5.921  184.616 1.00 138.50 ? 14  U   B "C1'"  1 
ATOM   7683  N N1     . U   B 2 14  ? 167.989 -7.170  184.022 1.00 142.03 ? 14  U   B N1     1 
ATOM   7684  C C2     . U   B 2 14  ? 166.642 -7.190  183.719 1.00 146.49 ? 14  U   B C2     1 
ATOM   7685  O O2     . U   B 2 14  ? 165.907 -6.238  183.918 1.00 147.81 ? 14  U   B O2     1 
ATOM   7686  N N3     . U   B 2 14  ? 166.182 -8.364  183.176 1.00 149.09 ? 14  U   B N3     1 
ATOM   7687  C C4     . U   B 2 14  ? 166.917 -9.500  182.910 1.00 148.42 ? 14  U   B C4     1 
ATOM   7688  O O4     . U   B 2 14  ? 166.354 -10.480 182.414 1.00 150.28 ? 14  U   B O4     1 
ATOM   7689  C C5     . U   B 2 14  ? 168.305 -9.406  183.253 1.00 144.75 ? 14  U   B C5     1 
ATOM   7690  C C6     . U   B 2 14  ? 168.779 -8.272  183.785 1.00 142.07 ? 14  U   B C6     1 
ATOM   7691  H "H5'"  . U   B 2 14  ? 172.497 -5.946  185.085 1.00 157.28 ? 14  U   B "H5'"  1 
ATOM   7692  H "H5''" . U   B 2 14  ? 172.310 -6.355  186.599 1.00 157.28 ? 14  U   B "H5''" 1 
ATOM   7693  H "H4'"  . U   B 2 14  ? 170.698 -4.795  185.912 1.00 161.38 ? 14  U   B "H4'"  1 
ATOM   7694  H "H3'"  . U   B 2 14  ? 169.600 -7.263  186.699 1.00 164.52 ? 14  U   B "H3'"  1 
ATOM   7695  H "H2'"  . U   B 2 14  ? 167.512 -6.425  186.375 1.00 167.17 ? 14  U   B "H2'"  1 
ATOM   7696  H "HO2'" . U   B 2 14  ? 168.010 -4.007  185.785 1.00 168.39 ? 14  U   B "HO2'" 1 
ATOM   7697  H "H1'"  . U   B 2 14  ? 168.117 -5.159  184.170 1.00 166.20 ? 14  U   B "H1'"  1 
ATOM   7698  H H3     . U   B 2 14  ? 165.346 -8.393  182.979 1.00 178.90 ? 14  U   B H3     1 
ATOM   7699  H H5     . U   B 2 14  ? 168.873 -10.127 183.105 1.00 173.70 ? 14  U   B H5     1 
ATOM   7700  H H6     . U   B 2 14  ? 169.683 -8.226  184.001 1.00 170.49 ? 14  U   B H6     1 
ATOM   7701  P P      . C   B 2 15  ? 169.607 -6.824  189.256 1.00 109.22 ? 15  C   B P      1 
ATOM   7702  O OP1    . C   B 2 15  ? 170.015 -6.078  190.474 1.00 111.40 ? 15  C   B OP1    1 
ATOM   7703  O OP2    . C   B 2 15  ? 170.284 -8.100  188.897 1.00 108.07 ? 15  C   B OP2    1 
ATOM   7704  O "O5'"  . C   B 2 15  ? 168.039 -7.092  189.318 1.00 118.21 ? 15  C   B "O5'"  1 
ATOM   7705  C "C5'"  . C   B 2 15  ? 167.502 -8.125  190.131 1.00 121.32 ? 15  C   B "C5'"  1 
ATOM   7706  C "C4'"  . C   B 2 15  ? 166.006 -7.998  190.264 1.00 125.37 ? 15  C   B "C4'"  1 
ATOM   7707  O "O4'"  . C   B 2 15  ? 165.688 -6.798  191.018 1.00 127.00 ? 15  C   B "O4'"  1 
ATOM   7708  C "C3'"  . C   B 2 15  ? 165.232 -7.842  188.960 1.00 126.31 ? 15  C   B "C3'"  1 
ATOM   7709  O "O3'"  . C   B 2 15  ? 164.978 -9.081  188.312 1.00 124.44 ? 15  C   B "O3'"  1 
ATOM   7710  C "C2'"  . C   B 2 15  ? 163.971 -7.116  189.408 1.00 130.99 ? 15  C   B "C2'"  1 
ATOM   7711  O "O2'"  . C   B 2 15  ? 163.039 -8.018  189.989 1.00 134.68 ? 15  C   B "O2'"  1 
ATOM   7712  C "C1'"  . C   B 2 15  ? 164.520 -6.197  190.501 1.00 129.82 ? 15  C   B "C1'"  1 
ATOM   7713  N N1     . C   B 2 15  ? 164.868 -4.848  189.991 1.00 128.69 ? 15  C   B N1     1 
ATOM   7714  C C2     . C   B 2 15  ? 163.841 -3.973  189.628 1.00 131.74 ? 15  C   B C2     1 
ATOM   7715  O O2     . C   B 2 15  ? 162.664 -4.344  189.725 1.00 135.41 ? 15  C   B O2     1 
ATOM   7716  N N3     . C   B 2 15  ? 164.149 -2.742  189.169 1.00 130.95 ? 15  C   B N3     1 
ATOM   7717  C C4     . C   B 2 15  ? 165.419 -2.359  189.071 1.00 129.15 ? 15  C   B C4     1 
ATOM   7718  N N4     . C   B 2 15  ? 165.663 -1.130  188.612 1.00 129.51 ? 15  C   B N4     1 
ATOM   7719  C C5     . C   B 2 15  ? 166.489 -3.224  189.439 1.00 126.40 ? 15  C   B C5     1 
ATOM   7720  C C6     . C   B 2 15  ? 166.171 -4.444  189.891 1.00 125.99 ? 15  C   B C6     1 
ATOM   7721  H "H5'"  . C   B 2 15  ? 167.904 -8.077  191.012 1.00 145.59 ? 15  C   B "H5'"  1 
ATOM   7722  H "H5''" . C   B 2 15  ? 167.713 -8.984  189.733 1.00 145.59 ? 15  C   B "H5''" 1 
ATOM   7723  H "H4'"  . C   B 2 15  ? 165.665 -8.770  190.742 1.00 150.44 ? 15  C   B "H4'"  1 
ATOM   7724  H "H3'"  . C   B 2 15  ? 165.733 -7.267  188.360 1.00 151.57 ? 15  C   B "H3'"  1 
ATOM   7725  H "H2'"  . C   B 2 15  ? 163.576 -6.607  188.683 1.00 157.19 ? 15  C   B "H2'"  1 
ATOM   7726  H "HO2'" . C   B 2 15  ? 162.982 -7.860  190.812 1.00 161.62 ? 15  C   B "HO2'" 1 
ATOM   7727  H "H1'"  . C   B 2 15  ? 163.863 -6.112  191.210 1.00 155.79 ? 15  C   B "H1'"  1 
ATOM   7728  H H41    . C   B 2 15  ? 166.474 -0.852  188.537 1.00 155.41 ? 15  C   B H41    1 
ATOM   7729  H H42    . C   B 2 15  ? 165.010 -0.615  188.392 1.00 155.41 ? 15  C   B H42    1 
ATOM   7730  H H5     . C   B 2 15  ? 167.375 -2.952  189.367 1.00 151.68 ? 15  C   B H5     1 
ATOM   7731  H H6     . C   B 2 15  ? 166.851 -5.029  190.138 1.00 151.19 ? 15  C   B H6     1 
ATOM   7732  P P      . G   B 2 16  ? 165.143 -9.233  186.716 1.00 119.99 ? 16  G   B P      1 
ATOM   7733  O OP1    . G   B 2 16  ? 164.778 -10.623 186.353 1.00 123.64 ? 16  G   B OP1    1 
ATOM   7734  O OP2    . G   B 2 16  ? 166.481 -8.728  186.327 1.00 115.90 ? 16  G   B OP2    1 
ATOM   7735  O "O5'"  . G   B 2 16  ? 164.023 -8.278  186.106 1.00 132.61 ? 16  G   B "O5'"  1 
ATOM   7736  C "C5'"  . G   B 2 16  ? 162.644 -8.585  186.253 1.00 137.34 ? 16  G   B "C5'"  1 
ATOM   7737  C "C4'"  . G   B 2 16  ? 161.762 -7.472  185.743 1.00 141.62 ? 16  G   B "C4'"  1 
ATOM   7738  O "O4'"  . G   B 2 16  ? 161.936 -6.285  186.560 1.00 142.69 ? 16  G   B "O4'"  1 
ATOM   7739  C "C3'"  . G   B 2 16  ? 162.038 -6.990  184.328 1.00 142.27 ? 16  G   B "C3'"  1 
ATOM   7740  O "O3'"  . G   B 2 16  ? 161.467 -7.835  183.343 1.00 144.78 ? 16  G   B "O3'"  1 
ATOM   7741  C "C2'"  . G   B 2 16  ? 161.457 -5.580  184.341 1.00 142.56 ? 16  G   B "C2'"  1 
ATOM   7742  O "O2'"  . G   B 2 16  ? 160.046 -5.603  184.177 1.00 144.54 ? 16  G   B "O2'"  1 
ATOM   7743  C "C1'"  . G   B 2 16  ? 161.779 -5.127  185.767 1.00 142.51 ? 16  G   B "C1'"  1 
ATOM   7744  N N9     . G   B 2 16  ? 163.019 -4.330  185.841 1.00 139.63 ? 16  G   B N9     1 
ATOM   7745  C C8     . G   B 2 16  ? 164.272 -4.784  186.173 1.00 136.55 ? 16  G   B C8     1 
ATOM   7746  N N7     . G   B 2 16  ? 165.180 -3.849  186.158 1.00 135.50 ? 16  G   B N7     1 
ATOM   7747  C C5     . G   B 2 16  ? 164.484 -2.704  185.797 1.00 137.77 ? 16  G   B C5     1 
ATOM   7748  C C6     . G   B 2 16  ? 164.946 -1.374  185.618 1.00 137.32 ? 16  G   B C6     1 
ATOM   7749  O O6     . G   B 2 16  ? 166.098 -0.940  185.751 1.00 133.84 ? 16  G   B O6     1 
ATOM   7750  N N1     . G   B 2 16  ? 163.911 -0.519  185.251 1.00 141.08 ? 16  G   B N1     1 
ATOM   7751  C C2     . G   B 2 16  ? 162.600 -0.896  185.077 1.00 144.99 ? 16  G   B C2     1 
ATOM   7752  N N2     . G   B 2 16  ? 161.746 0.074   184.719 1.00 148.71 ? 16  G   B N2     1 
ATOM   7753  N N3     . G   B 2 16  ? 162.159 -2.134  185.240 1.00 144.31 ? 16  G   B N3     1 
ATOM   7754  C C4     . G   B 2 16  ? 163.148 -2.982  185.598 1.00 140.72 ? 16  G   B C4     1 
ATOM   7755  H "H5'"  . G   B 2 16  ? 162.452 -8.735  187.193 1.00 164.81 ? 16  G   B "H5'"  1 
ATOM   7756  H "H5''" . G   B 2 16  ? 162.447 -9.396  185.759 1.00 164.81 ? 16  G   B "H5''" 1 
ATOM   7757  H "H4'"  . G   B 2 16  ? 160.836 -7.757  185.800 1.00 169.95 ? 16  G   B "H4'"  1 
ATOM   7758  H "H3'"  . G   B 2 16  ? 162.996 -6.939  184.189 1.00 170.73 ? 16  G   B "H3'"  1 
ATOM   7759  H "H2'"  . G   B 2 16  ? 161.886 -5.012  183.683 1.00 171.07 ? 16  G   B "H2'"  1 
ATOM   7760  H "HO2'" . G   B 2 16  ? 159.835 -6.276  183.720 1.00 173.45 ? 16  G   B "HO2'" 1 
ATOM   7761  H "H1'"  . G   B 2 16  ? 161.040 -4.602  186.111 1.00 171.01 ? 16  G   B "H1'"  1 
ATOM   7762  H H8     . G   B 2 16  ? 164.455 -5.671  186.384 1.00 163.86 ? 16  G   B H8     1 
ATOM   7763  H H1     . G   B 2 16  ? 164.106 0.309   185.122 1.00 169.29 ? 16  G   B H1     1 
ATOM   7764  H H21    . G   B 2 16  ? 162.029 0.879   184.613 1.00 178.45 ? 16  G   B H21    1 
ATOM   7765  H H22    . G   B 2 16  ? 160.914 -0.109  184.597 1.00 178.45 ? 16  G   B H22    1 
ATOM   7766  P P      . A   B 2 17  ? 162.224 -8.116  181.952 1.00 147.19 ? 17  A   B P      1 
ATOM   7767  O OP1    . A   B 2 17  ? 161.543 -9.264  181.307 1.00 149.55 ? 17  A   B OP1    1 
ATOM   7768  O OP2    . A   B 2 17  ? 163.688 -8.180  182.178 1.00 144.79 ? 17  A   B OP2    1 
ATOM   7769  O "O5'"  . A   B 2 17  ? 161.924 -6.820  181.083 1.00 152.11 ? 17  A   B "O5'"  1 
ATOM   7770  C "C5'"  . A   B 2 17  ? 161.865 -6.899  179.665 1.00 154.80 ? 17  A   B "C5'"  1 
ATOM   7771  C "C4'"  . A   B 2 17  ? 161.476 -5.579  179.053 1.00 159.06 ? 17  A   B "C4'"  1 
ATOM   7772  O "O4'"  . A   B 2 17  ? 162.420 -4.564  179.497 1.00 156.88 ? 17  A   B "O4'"  1 
ATOM   7773  C "C3'"  . A   B 2 17  ? 161.504 -5.549  177.528 1.00 161.71 ? 17  A   B "C3'"  1 
ATOM   7774  O "O3'"  . A   B 2 17  ? 160.489 -4.672  177.037 1.00 166.07 ? 17  A   B "O3'"  1 
ATOM   7775  C "C2'"  . A   B 2 17  ? 162.887 -4.981  177.229 1.00 157.23 ? 17  A   B "C2'"  1 
ATOM   7776  O "O2'"  . A   B 2 17  ? 163.015 -4.359  175.967 1.00 156.75 ? 17  A   B "O2'"  1 
ATOM   7777  C "C1'"  . A   B 2 17  ? 163.070 -3.990  178.378 1.00 153.34 ? 17  A   B "C1'"  1 
ATOM   7778  N N9     . A   B 2 17  ? 164.472 -3.746  178.732 1.00 143.68 ? 17  A   B N9     1 
ATOM   7779  C C8     . A   B 2 17  ? 165.414 -4.679  179.090 1.00 139.70 ? 17  A   B C8     1 
ATOM   7780  N N7     . A   B 2 17  ? 166.594 -4.172  179.348 1.00 135.85 ? 17  A   B N7     1 
ATOM   7781  C C5     . A   B 2 17  ? 166.419 -2.810  179.148 1.00 135.05 ? 17  A   B C5     1 
ATOM   7782  C C6     . A   B 2 17  ? 167.302 -1.721  179.260 1.00 132.33 ? 17  A   B C6     1 
ATOM   7783  N N6     . A   B 2 17  ? 168.583 -1.844  179.618 1.00 131.01 ? 17  A   B N6     1 
ATOM   7784  N N1     . A   B 2 17  ? 166.817 -0.488  178.994 1.00 131.89 ? 17  A   B N1     1 
ATOM   7785  C C2     . A   B 2 17  ? 165.531 -0.372  178.637 1.00 133.85 ? 17  A   B C2     1 
ATOM   7786  N N3     . A   B 2 17  ? 164.605 -1.319  178.496 1.00 136.30 ? 17  A   B N3     1 
ATOM   7787  C C4     . A   B 2 17  ? 165.117 -2.531  178.770 1.00 138.10 ? 17  A   B C4     1 
ATOM   7788  H "H5'"  . A   B 2 17  ? 161.212 -7.570  179.412 1.00 185.76 ? 17  A   B "H5'"  1 
ATOM   7789  H "H5''" . A   B 2 17  ? 162.735 -7.161  179.326 1.00 185.76 ? 17  A   B "H5''" 1 
ATOM   7790  H "H4'"  . A   B 2 17  ? 160.588 -5.339  179.358 1.00 190.88 ? 17  A   B "H4'"  1 
ATOM   7791  H "H3'"  . A   B 2 17  ? 161.406 -6.441  177.160 1.00 194.06 ? 17  A   B "H3'"  1 
ATOM   7792  H "H2'"  . A   B 2 17  ? 163.548 -5.687  177.307 1.00 188.67 ? 17  A   B "H2'"  1 
ATOM   7793  H "HO2'" . A   B 2 17  ? 162.909 -4.936  175.366 1.00 188.10 ? 17  A   B "HO2'" 1 
ATOM   7794  H "H1'"  . A   B 2 17  ? 162.642 -3.149  178.152 1.00 184.01 ? 17  A   B "H1'"  1 
ATOM   7795  H H8     . A   B 2 17  ? 165.231 -5.590  179.141 1.00 167.64 ? 17  A   B H8     1 
ATOM   7796  H H61    . A   B 2 17  ? 169.083 -1.146  179.676 1.00 157.21 ? 17  A   B H61    1 
ATOM   7797  H H62    . A   B 2 17  ? 168.909 -2.621  179.791 1.00 157.21 ? 17  A   B H62    1 
ATOM   7798  H H2     . A   B 2 17  ? 165.244 0.495   178.462 1.00 160.62 ? 17  A   B H2     1 
ATOM   7799  P P      . G   B 2 18  ? 158.988 -5.207  176.820 1.00 283.90 ? 18  G   B P      1 
ATOM   7800  O OP1    . G   B 2 18  ? 158.238 -4.994  178.083 1.00 286.34 ? 18  G   B OP1    1 
ATOM   7801  O OP2    . G   B 2 18  ? 159.052 -6.565  176.225 1.00 283.54 ? 18  G   B OP2    1 
ATOM   7802  O "O5'"  . G   B 2 18  ? 158.386 -4.223  175.723 1.00 294.70 ? 18  G   B "O5'"  1 
ATOM   7803  C "C5'"  . G   B 2 18  ? 158.510 -4.507  174.337 1.00 293.76 ? 18  G   B "C5'"  1 
ATOM   7804  C "C4'"  . G   B 2 18  ? 158.222 -3.286  173.501 1.00 290.20 ? 18  G   B "C4'"  1 
ATOM   7805  O "O4'"  . G   B 2 18  ? 156.993 -2.670  173.962 1.00 280.17 ? 18  G   B "O4'"  1 
ATOM   7806  C "C3'"  . G   B 2 18  ? 159.257 -2.171  173.577 1.00 287.78 ? 18  G   B "C3'"  1 
ATOM   7807  O "O3'"  . G   B 2 18  ? 160.344 -2.378  172.689 1.00 288.51 ? 18  G   B "O3'"  1 
ATOM   7808  C "C2'"  . G   B 2 18  ? 158.442 -0.923  173.251 1.00 278.64 ? 18  G   B "C2'"  1 
ATOM   7809  O "O2'"  . G   B 2 18  ? 158.290 -0.762  171.848 1.00 287.11 ? 18  G   B "O2'"  1 
ATOM   7810  C "C1'"  . G   B 2 18  ? 157.081 -1.266  173.858 1.00 255.05 ? 18  G   B "C1'"  1 
ATOM   7811  N N9     . G   B 2 18  ? 156.870 -0.675  175.196 1.00 198.49 ? 18  G   B N9     1 
ATOM   7812  C C8     . G   B 2 18  ? 156.647 -1.362  176.371 1.00 173.91 ? 18  G   B C8     1 
ATOM   7813  N N7     . G   B 2 18  ? 156.468 -0.581  177.403 1.00 159.92 ? 18  G   B N7     1 
ATOM   7814  C C5     . G   B 2 18  ? 156.570 0.701   176.878 1.00 158.80 ? 18  G   B C5     1 
ATOM   7815  C C6     . G   B 2 18  ? 156.464 1.962   177.520 1.00 155.18 ? 18  G   B C6     1 
ATOM   7816  O O6     . G   B 2 18  ? 156.253 2.194   178.718 1.00 157.63 ? 18  G   B O6     1 
ATOM   7817  N N1     . G   B 2 18  ? 156.629 3.017   176.625 1.00 154.22 ? 18  G   B N1     1 
ATOM   7818  C C2     . G   B 2 18  ? 156.867 2.882   175.276 1.00 157.11 ? 18  G   B C2     1 
ATOM   7819  N N2     . G   B 2 18  ? 156.999 4.020   174.570 1.00 156.66 ? 18  G   B N2     1 
ATOM   7820  N N3     . G   B 2 18  ? 156.968 1.708   174.666 1.00 161.91 ? 18  G   B N3     1 
ATOM   7821  C C4     . G   B 2 18  ? 156.810 0.666   175.518 1.00 170.90 ? 18  G   B C4     1 
ATOM   7822  H "H5'"  . G   B 2 18  ? 157.885 -5.209  174.099 1.00 352.51 ? 18  G   B "H5'"  1 
ATOM   7823  H "H5''" . G   B 2 18  ? 159.413 -4.811  174.154 1.00 352.51 ? 18  G   B "H5''" 1 
ATOM   7824  H "H4'"  . G   B 2 18  ? 158.113 -3.554  172.575 1.00 348.24 ? 18  G   B "H4'"  1 
ATOM   7825  H "H3'"  . G   B 2 18  ? 159.592 -2.106  174.485 1.00 345.34 ? 18  G   B "H3'"  1 
ATOM   7826  H "H2'"  . G   B 2 18  ? 158.824 -0.133  173.663 1.00 334.37 ? 18  G   B "H2'"  1 
ATOM   7827  H "HO2'" . G   B 2 18  ? 158.849 -1.250  171.454 1.00 344.53 ? 18  G   B "HO2'" 1 
ATOM   7828  H "H1'"  . G   B 2 18  ? 156.383 -0.951  173.262 1.00 306.06 ? 18  G   B "H1'"  1 
ATOM   7829  H H8     . G   B 2 18  ? 156.631 -2.291  176.424 1.00 208.70 ? 18  G   B H8     1 
ATOM   7830  H H1     . G   B 2 18  ? 156.579 3.816   176.940 1.00 185.06 ? 18  G   B H1     1 
ATOM   7831  H H21    . G   B 2 18  ? 156.933 4.781   174.965 1.00 187.99 ? 18  G   B H21    1 
ATOM   7832  H H22    . G   B 2 18  ? 157.149 3.986   173.724 1.00 187.99 ? 18  G   B H22    1 
ATOM   7833  P P      . U   B 2 19  ? 161.844 -2.544  173.247 1.00 165.82 ? 19  U   B P      1 
ATOM   7834  O OP1    . U   B 2 19  ? 162.715 -2.958  172.117 1.00 162.83 ? 19  U   B OP1    1 
ATOM   7835  O OP2    . U   B 2 19  ? 161.790 -3.381  174.471 1.00 166.61 ? 19  U   B OP2    1 
ATOM   7836  O "O5'"  . U   B 2 19  ? 162.267 -1.068  173.669 1.00 152.71 ? 19  U   B "O5'"  1 
ATOM   7837  C "C5'"  . U   B 2 19  ? 162.221 0.005   172.734 1.00 150.49 ? 19  U   B "C5'"  1 
ATOM   7838  C "C4'"  . U   B 2 19  ? 162.572 1.323   173.382 1.00 147.02 ? 19  U   B "C4'"  1 
ATOM   7839  O "O4'"  . U   B 2 19  ? 161.554 1.645   174.368 1.00 149.73 ? 19  U   B "O4'"  1 
ATOM   7840  C "C3'"  . U   B 2 19  ? 163.909 1.346   174.119 1.00 140.60 ? 19  U   B "C3'"  1 
ATOM   7841  O "O3'"  . U   B 2 19  ? 164.543 2.613   173.960 1.00 137.41 ? 19  U   B "O3'"  1 
ATOM   7842  C "C2'"  . U   B 2 19  ? 163.511 1.129   175.576 1.00 140.39 ? 19  U   B "C2'"  1 
ATOM   7843  O "O2'"  . U   B 2 19  ? 164.412 1.678   176.514 1.00 135.24 ? 19  U   B "O2'"  1 
ATOM   7844  C "C1'"  . U   B 2 19  ? 162.143 1.808   175.645 1.00 147.43 ? 19  U   B "C1'"  1 
ATOM   7845  N N1     . U   B 2 19  ? 161.237 1.204   176.638 1.00 152.57 ? 19  U   B N1     1 
ATOM   7846  C C2     . U   B 2 19  ? 160.662 1.984   177.629 1.00 156.88 ? 19  U   B C2     1 
ATOM   7847  O O2     . U   B 2 19  ? 160.853 3.183   177.743 1.00 157.86 ? 19  U   B O2     1 
ATOM   7848  N N3     . U   B 2 19  ? 159.837 1.302   178.495 1.00 159.41 ? 19  U   B N3     1 
ATOM   7849  C C4     . U   B 2 19  ? 159.535 -0.046  178.478 1.00 159.57 ? 19  U   B C4     1 
ATOM   7850  O O4     . U   B 2 19  ? 158.775 -0.520  179.323 1.00 161.85 ? 19  U   B O4     1 
ATOM   7851  C C5     . U   B 2 19  ? 160.167 -0.782  177.431 1.00 156.88 ? 19  U   B C5     1 
ATOM   7852  C C6     . U   B 2 19  ? 160.970 -0.144  176.576 1.00 153.78 ? 19  U   B C6     1 
ATOM   7853  H "H5'"  . U   B 2 19  ? 161.327 0.064   172.363 1.00 180.59 ? 19  U   B "H5'"  1 
ATOM   7854  H "H5''" . U   B 2 19  ? 162.850 -0.172  172.018 1.00 180.59 ? 19  U   B "H5''" 1 
ATOM   7855  H "H4'"  . U   B 2 19  ? 162.578 2.014   172.702 1.00 176.43 ? 19  U   B "H4'"  1 
ATOM   7856  H "H3'"  . U   B 2 19  ? 164.484 0.629   173.809 1.00 168.72 ? 19  U   B "H3'"  1 
ATOM   7857  H "H2'"  . U   B 2 19  ? 163.408 0.179   175.745 1.00 168.47 ? 19  U   B "H2'"  1 
ATOM   7858  H "HO2'" . U   B 2 19  ? 164.022 2.286   176.943 1.00 162.28 ? 19  U   B "HO2'" 1 
ATOM   7859  H "H1'"  . U   B 2 19  ? 162.255 2.752   175.835 1.00 176.92 ? 19  U   B "H1'"  1 
ATOM   7860  H H3     . U   B 2 19  ? 159.468 1.767   179.117 1.00 191.29 ? 19  U   B H3     1 
ATOM   7861  H H5     . U   B 2 19  ? 160.019 -1.696  177.344 1.00 188.26 ? 19  U   B H5     1 
ATOM   7862  H H6     . U   B 2 19  ? 161.374 -0.640  175.900 1.00 184.54 ? 19  U   B H6     1 
ATOM   7863  P P      . C   B 2 20  ? 165.789 2.755   172.956 1.00 140.38 ? 20  C   B P      1 
ATOM   7864  O OP1    . C   B 2 20  ? 166.077 4.200   172.774 1.00 140.16 ? 20  C   B OP1    1 
ATOM   7865  O OP2    . C   B 2 20  ? 165.506 1.912   171.767 1.00 140.23 ? 20  C   B OP2    1 
ATOM   7866  O "O5'"  . C   B 2 20  ? 167.003 2.086   173.743 1.00 135.20 ? 20  C   B "O5'"  1 
ATOM   7867  C "C5'"  . C   B 2 20  ? 167.878 2.866   174.548 1.00 133.03 ? 20  C   B "C5'"  1 
ATOM   7868  C "C4'"  . C   B 2 20  ? 168.923 2.017   175.235 1.00 129.77 ? 20  C   B "C4'"  1 
ATOM   7869  O "O4'"  . C   B 2 20  ? 168.299 1.185   176.250 1.00 132.22 ? 20  C   B "O4'"  1 
ATOM   7870  C "C3'"  . C   B 2 20  ? 169.678 1.025   174.358 1.00 123.89 ? 20  C   B "C3'"  1 
ATOM   7871  O "O3'"  . C   B 2 20  ? 170.728 1.619   173.613 1.00 118.72 ? 20  C   B "O3'"  1 
ATOM   7872  C "C2'"  . C   B 2 20  ? 170.157 -0.010  175.368 1.00 123.81 ? 20  C   B "C2'"  1 
ATOM   7873  O "O2'"  . C   B 2 20  ? 171.317 0.439   176.056 1.00 119.03 ? 20  C   B "O2'"  1 
ATOM   7874  C "C1'"  . C   B 2 20  ? 168.981 -0.050  176.346 1.00 130.43 ? 20  C   B "C1'"  1 
ATOM   7875  N N1     . C   B 2 20  ? 168.032 -1.152  176.048 1.00 134.10 ? 20  C   B N1     1 
ATOM   7876  C C2     . C   B 2 20  ? 168.411 -2.465  176.347 1.00 132.87 ? 20  C   B C2     1 
ATOM   7877  O O2     . C   B 2 20  ? 169.528 -2.668  176.846 1.00 129.53 ? 20  C   B O2     1 
ATOM   7878  N N3     . C   B 2 20  ? 167.557 -3.482  176.089 1.00 136.27 ? 20  C   B N3     1 
ATOM   7879  C C4     . C   B 2 20  ? 166.363 -3.234  175.555 1.00 140.35 ? 20  C   B C4     1 
ATOM   7880  N N4     . C   B 2 20  ? 165.558 -4.272  175.318 1.00 143.57 ? 20  C   B N4     1 
ATOM   7881  C C5     . C   B 2 20  ? 165.946 -1.910  175.239 1.00 140.67 ? 20  C   B C5     1 
ATOM   7882  C C6     . C   B 2 20  ? 166.800 -0.910  175.500 1.00 138.06 ? 20  C   B C6     1 
ATOM   7883  H "H5'"  . C   B 2 20  ? 167.356 3.330   175.221 1.00 159.63 ? 20  C   B "H5'"  1 
ATOM   7884  H "H5''" . C   B 2 20  ? 168.322 3.520   173.986 1.00 159.63 ? 20  C   B "H5''" 1 
ATOM   7885  H "H4'"  . C   B 2 20  ? 169.565 2.603   175.665 1.00 155.73 ? 20  C   B "H4'"  1 
ATOM   7886  H "H3'"  . C   B 2 20  ? 169.054 0.605   173.746 1.00 148.67 ? 20  C   B "H3'"  1 
ATOM   7887  H "H2'"  . C   B 2 20  ? 170.300 -0.874  174.951 1.00 148.57 ? 20  C   B "H2'"  1 
ATOM   7888  H "HO2'" . C   B 2 20  ? 171.962 0.461   175.518 1.00 142.83 ? 20  C   B "HO2'" 1 
ATOM   7889  H "H1'"  . C   B 2 20  ? 169.320 -0.157  177.249 1.00 156.52 ? 20  C   B "H1'"  1 
ATOM   7890  H H41    . C   B 2 20  ? 164.781 -4.143  174.973 1.00 172.28 ? 20  C   B H41    1 
ATOM   7891  H H42    . C   B 2 20  ? 165.817 -5.069  175.510 1.00 172.28 ? 20  C   B H42    1 
ATOM   7892  H H5     . C   B 2 20  ? 165.111 -1.744  174.866 1.00 168.81 ? 20  C   B H5     1 
ATOM   7893  H H6     . C   B 2 20  ? 166.552 -0.035  175.305 1.00 165.68 ? 20  C   B H6     1 
ATOM   7894  P P      . C   B 2 21  ? 171.110 1.055   172.156 1.00 113.86 ? 21  C   B P      1 
ATOM   7895  O OP1    . C   B 2 21  ? 172.127 1.949   171.553 1.00 112.04 ? 21  C   B OP1    1 
ATOM   7896  O OP2    . C   B 2 21  ? 169.853 0.775   171.418 1.00 117.10 ? 21  C   B OP2    1 
ATOM   7897  O "O5'"  . C   B 2 21  ? 171.820 -0.336  172.456 1.00 129.38 ? 21  C   B "O5'"  1 
ATOM   7898  C "C5'"  . C   B 2 21  ? 173.141 -0.389  172.974 1.00 126.13 ? 21  C   B "C5'"  1 
ATOM   7899  C "C4'"  . C   B 2 21  ? 173.602 -1.814  173.158 1.00 124.77 ? 21  C   B "C4'"  1 
ATOM   7900  O "O4'"  . C   B 2 21  ? 172.802 -2.463  174.184 1.00 127.69 ? 21  C   B "O4'"  1 
ATOM   7901  C "C3'"  . C   B 2 21  ? 173.449 -2.729  171.954 1.00 123.44 ? 21  C   B "C3'"  1 
ATOM   7902  O "O3'"  . C   B 2 21  ? 174.449 -2.555  170.966 1.00 119.99 ? 21  C   B "O3'"  1 
ATOM   7903  C "C2'"  . C   B 2 21  ? 173.439 -4.107  172.599 1.00 125.27 ? 21  C   B "C2'"  1 
ATOM   7904  O "O2'"  . C   B 2 21  ? 174.748 -4.509  172.983 1.00 122.55 ? 21  C   B "O2'"  1 
ATOM   7905  C "C1'"  . C   B 2 21  ? 172.620 -3.828  173.856 1.00 129.30 ? 21  C   B "C1'"  1 
ATOM   7906  N N1     . C   B 2 21  ? 171.177 -4.083  173.632 1.00 133.97 ? 21  C   B N1     1 
ATOM   7907  C C2     . C   B 2 21  ? 170.716 -5.399  173.702 1.00 134.15 ? 21  C   B C2     1 
ATOM   7908  O O2     . C   B 2 21  ? 171.523 -6.303  173.953 1.00 130.36 ? 21  C   B O2     1 
ATOM   7909  N N3     . C   B 2 21  ? 169.405 -5.656  173.500 1.00 140.08 ? 21  C   B N3     1 
ATOM   7910  C C4     . C   B 2 21  ? 168.561 -4.661  173.231 1.00 145.27 ? 21  C   B C4     1 
ATOM   7911  N N4     . C   B 2 21  ? 167.275 -4.966  173.039 1.00 151.57 ? 21  C   B N4     1 
ATOM   7912  C C5     . C   B 2 21  ? 169.000 -3.309  173.148 1.00 142.55 ? 21  C   B C5     1 
ATOM   7913  C C6     . C   B 2 21  ? 170.303 -3.068  173.351 1.00 137.89 ? 21  C   B C6     1 
ATOM   7914  H "H5'"  . C   B 2 21  ? 173.164 0.065   173.831 1.00 151.35 ? 21  C   B "H5'"  1 
ATOM   7915  H "H5''" . C   B 2 21  ? 173.741 0.062   172.360 1.00 151.35 ? 21  C   B "H5''" 1 
ATOM   7916  H "H4'"  . C   B 2 21  ? 174.532 -1.811  173.437 1.00 149.72 ? 21  C   B "H4'"  1 
ATOM   7917  H "H3'"  . C   B 2 21  ? 172.582 -2.569  171.550 1.00 148.12 ? 21  C   B "H3'"  1 
ATOM   7918  H "H2'"  . C   B 2 21  ? 173.010 -4.766  172.032 1.00 150.32 ? 21  C   B "H2'"  1 
ATOM   7919  H "HO2'" . C   B 2 21  ? 174.799 -4.509  173.822 1.00 147.06 ? 21  C   B "HO2'" 1 
ATOM   7920  H "H1'"  . C   B 2 21  ? 172.941 -4.383  174.584 1.00 155.16 ? 21  C   B "H1'"  1 
ATOM   7921  H H41    . C   B 2 21  ? 166.707 -4.345  172.864 1.00 181.88 ? 21  C   B H41    1 
ATOM   7922  H H42    . C   B 2 21  ? 167.016 -5.785  173.091 1.00 181.88 ? 21  C   B H42    1 
ATOM   7923  H H5     . C   B 2 21  ? 168.405 -2.619  172.961 1.00 171.05 ? 21  C   B H5     1 
ATOM   7924  H H6     . C   B 2 21  ? 170.617 -2.194  173.305 1.00 165.47 ? 21  C   B H6     1 
ATOM   7925  P P      . C   B 2 22  ? 174.139 -2.943  169.433 1.00 126.35 ? 22  C   B P      1 
ATOM   7926  O OP1    . C   B 2 22  ? 175.293 -2.493  168.615 1.00 125.10 ? 22  C   B OP1    1 
ATOM   7927  O OP2    . C   B 2 22  ? 172.769 -2.486  169.077 1.00 126.92 ? 22  C   B OP2    1 
ATOM   7928  O "O5'"  . C   B 2 22  ? 174.121 -4.537  169.432 1.00 122.11 ? 22  C   B "O5'"  1 
ATOM   7929  C "C5'"  . C   B 2 22  ? 175.270 -5.281  169.809 1.00 121.04 ? 22  C   B "C5'"  1 
ATOM   7930  C "C4'"  . C   B 2 22  ? 174.955 -6.746  169.958 1.00 125.22 ? 22  C   B "C4'"  1 
ATOM   7931  O "O4'"  . C   B 2 22  ? 173.880 -6.922  170.918 1.00 131.52 ? 22  C   B "O4'"  1 
ATOM   7932  C "C3'"  . C   B 2 22  ? 174.445 -7.446  168.710 1.00 127.54 ? 22  C   B "C3'"  1 
ATOM   7933  O "O3'"  . C   B 2 22  ? 175.476 -7.803  167.807 1.00 126.16 ? 22  C   B "O3'"  1 
ATOM   7934  C "C2'"  . C   B 2 22  ? 173.693 -8.636  169.288 1.00 132.44 ? 22  C   B "C2'"  1 
ATOM   7935  O "O2'"  . C   B 2 22  ? 174.587 -9.664  169.690 1.00 131.11 ? 22  C   B "O2'"  1 
ATOM   7936  C "C1'"  . C   B 2 22  ? 173.065 -8.012  170.532 1.00 136.90 ? 22  C   B "C1'"  1 
ATOM   7937  N N1     . C   B 2 22  ? 171.690 -7.517  170.276 1.00 143.36 ? 22  C   B N1     1 
ATOM   7938  C C2     . C   B 2 22  ? 170.647 -8.444  170.177 1.00 148.73 ? 22  C   B C2     1 
ATOM   7939  O O2     . C   B 2 22  ? 170.897 -9.654  170.302 1.00 150.74 ? 22  C   B O2     1 
ATOM   7940  N N3     . C   B 2 22  ? 169.389 -7.999  169.945 1.00 149.29 ? 22  C   B N3     1 
ATOM   7941  C C4     . C   B 2 22  ? 169.151 -6.694  169.814 1.00 146.22 ? 22  C   B C4     1 
ATOM   7942  N N4     . C   B 2 22  ? 167.894 -6.307  169.589 1.00 147.85 ? 22  C   B N4     1 
ATOM   7943  C C5     . C   B 2 22  ? 170.191 -5.729  169.911 1.00 142.53 ? 22  C   B C5     1 
ATOM   7944  C C6     . C   B 2 22  ? 171.431 -6.179  170.140 1.00 141.77 ? 22  C   B C6     1 
ATOM   7945  H "H5'"  . C   B 2 22  ? 175.605 -4.941  170.653 1.00 145.25 ? 22  C   B "H5'"  1 
ATOM   7946  H "H5''" . C   B 2 22  ? 175.955 -5.172  169.130 1.00 145.25 ? 22  C   B "H5''" 1 
ATOM   7947  H "H4'"  . C   B 2 22  ? 175.745 -7.208  170.280 1.00 150.26 ? 22  C   B "H4'"  1 
ATOM   7948  H "H3'"  . C   B 2 22  ? 173.815 -6.864  168.257 1.00 153.05 ? 22  C   B "H3'"  1 
ATOM   7949  H "H2'"  . C   B 2 22  ? 173.017 -8.964  168.674 1.00 158.92 ? 22  C   B "H2'"  1 
ATOM   7950  H "HO2'" . C   B 2 22  ? 174.933 -10.008 169.007 1.00 157.33 ? 22  C   B "HO2'" 1 
ATOM   7951  H "H1'"  . C   B 2 22  ? 173.044 -8.667  171.247 1.00 164.28 ? 22  C   B "H1'"  1 
ATOM   7952  H H41    . C   B 2 22  ? 167.711 -5.472  169.500 1.00 177.42 ? 22  C   B H41    1 
ATOM   7953  H H42    . C   B 2 22  ? 167.268 -6.893  169.532 1.00 177.42 ? 22  C   B H42    1 
ATOM   7954  H H5     . C   B 2 22  ? 170.016 -4.820  169.819 1.00 171.04 ? 22  C   B H5     1 
ATOM   7955  H H6     . C   B 2 22  ? 172.131 -5.570  170.208 1.00 170.12 ? 22  C   B H6     1 
ATOM   7956  P P      . C   B 2 23  ? 175.191 -7.809  166.225 1.00 109.78 ? 23  C   B P      1 
ATOM   7957  O OP1    . C   B 2 23  ? 176.478 -8.109  165.550 1.00 110.34 ? 23  C   B OP1    1 
ATOM   7958  O OP2    . C   B 2 23  ? 174.462 -6.560  165.877 1.00 106.90 ? 23  C   B OP2    1 
ATOM   7959  O "O5'"  . C   B 2 23  ? 174.224 -9.064  166.013 1.00 140.10 ? 23  C   B "O5'"  1 
ATOM   7960  C "C5'"  . C   B 2 23  ? 174.713 -10.391 166.166 1.00 140.46 ? 23  C   B "C5'"  1 
ATOM   7961  C "C4'"  . C   B 2 23  ? 173.610 -11.423 166.143 1.00 144.74 ? 23  C   B "C4'"  1 
ATOM   7962  O "O4'"  . C   B 2 23  ? 172.647 -11.153 167.196 1.00 146.24 ? 23  C   B "O4'"  1 
ATOM   7963  C "C3'"  . C   B 2 23  ? 172.760 -11.486 164.883 1.00 148.66 ? 23  C   B "C3'"  1 
ATOM   7964  O "O3'"  . C   B 2 23  ? 173.387 -12.170 163.811 1.00 150.50 ? 23  C   B "O3'"  1 
ATOM   7965  C "C2'"  . C   B 2 23  ? 171.494 -12.166 165.383 1.00 150.50 ? 23  C   B "C2'"  1 
ATOM   7966  O "O2'"  . C   B 2 23  ? 171.680 -13.569 165.519 1.00 151.41 ? 23  C   B "O2'"  1 
ATOM   7967  C "C1'"  . C   B 2 23  ? 171.355 -11.549 166.774 1.00 149.21 ? 23  C   B "C1'"  1 
ATOM   7968  N N1     . C   B 2 23  ? 170.466 -10.365 166.758 1.00 148.67 ? 23  C   B N1     1 
ATOM   7969  C C2     . C   B 2 23  ? 169.084 -10.573 166.753 1.00 153.76 ? 23  C   B C2     1 
ATOM   7970  O O2     . C   B 2 23  ? 168.648 -11.735 166.771 1.00 159.32 ? 23  C   B O2     1 
ATOM   7971  N N3     . C   B 2 23  ? 168.255 -9.504  166.732 1.00 151.34 ? 23  C   B N3     1 
ATOM   7972  C C4     . C   B 2 23  ? 168.756 -8.271  166.712 1.00 146.86 ? 23  C   B C4     1 
ATOM   7973  N N4     . C   B 2 23  ? 167.897 -7.250  166.693 1.00 147.94 ? 23  C   B N4     1 
ATOM   7974  C C5     . C   B 2 23  ? 170.159 -8.030  166.713 1.00 142.90 ? 23  C   B C5     1 
ATOM   7975  C C6     . C   B 2 23  ? 170.970 -9.095  166.733 1.00 143.53 ? 23  C   B C6     1 
ATOM   7976  H "H5'"  . C   B 2 23  ? 175.185 -10.455 167.011 1.00 168.55 ? 23  C   B "H5'"  1 
ATOM   7977  H "H5''" . C   B 2 23  ? 175.335 -10.580 165.446 1.00 168.55 ? 23  C   B "H5''" 1 
ATOM   7978  H "H4'"  . C   B 2 23  ? 174.001 -12.297 166.297 1.00 173.69 ? 23  C   B "H4'"  1 
ATOM   7979  H "H3'"  . C   B 2 23  ? 172.544 -10.584 164.600 1.00 178.39 ? 23  C   B "H3'"  1 
ATOM   7980  H "H2'"  . C   B 2 23  ? 170.730 -11.956 164.823 1.00 180.60 ? 23  C   B "H2'"  1 
ATOM   7981  H "HO2'" . C   B 2 23  ? 171.757 -13.909 164.755 1.00 181.70 ? 23  C   B "HO2'" 1 
ATOM   7982  H "H1'"  . C   B 2 23  ? 171.002 -12.212 167.389 1.00 179.05 ? 23  C   B "H1'"  1 
ATOM   7983  H H41    . C   B 2 23  ? 168.190 -6.442  166.680 1.00 177.53 ? 23  C   B H41    1 
ATOM   7984  H H42    . C   B 2 23  ? 167.050 -7.401  166.694 1.00 177.53 ? 23  C   B H42    1 
ATOM   7985  H H5     . C   B 2 23  ? 170.500 -7.165  166.699 1.00 171.48 ? 23  C   B H5     1 
ATOM   7986  H H6     . C   B 2 23  ? 171.891 -8.969  166.734 1.00 172.24 ? 23  C   B H6     1 
ATOM   7987  P P      . G   B 2 24  ? 173.084 -11.746 162.289 1.00 141.85 ? 24  G   B P      1 
ATOM   7988  O OP1    . G   B 2 24  ? 174.114 -12.402 161.443 1.00 142.18 ? 24  G   B OP1    1 
ATOM   7989  O OP2    . G   B 2 24  ? 172.921 -10.273 162.221 1.00 140.37 ? 24  G   B OP2    1 
ATOM   7990  O "O5'"  . G   B 2 24  ? 171.664 -12.401 161.974 1.00 170.40 ? 24  G   B "O5'"  1 
ATOM   7991  C "C5'"  . G   B 2 24  ? 171.520 -13.807 161.818 1.00 172.90 ? 24  G   B "C5'"  1 
ATOM   7992  C "C4'"  . G   B 2 24  ? 170.090 -14.196 161.525 1.00 176.84 ? 24  G   B "C4'"  1 
ATOM   7993  O "O4'"  . G   B 2 24  ? 169.239 -13.819 162.641 1.00 178.21 ? 24  G   B "O4'"  1 
ATOM   7994  C "C3'"  . G   B 2 24  ? 169.441 -13.524 160.321 1.00 178.20 ? 24  G   B "C3'"  1 
ATOM   7995  O "O3'"  . G   B 2 24  ? 169.788 -14.132 159.088 1.00 176.24 ? 24  G   B "O3'"  1 
ATOM   7996  C "C2'"  . G   B 2 24  ? 167.956 -13.612 160.651 1.00 183.23 ? 24  G   B "C2'"  1 
ATOM   7997  O "O2'"  . G   B 2 24  ? 167.431 -14.898 160.354 1.00 188.41 ? 24  G   B "O2'"  1 
ATOM   7998  C "C1'"  . G   B 2 24  ? 167.970 -13.419 162.167 1.00 180.98 ? 24  G   B "C1'"  1 
ATOM   7999  N N9     . G   B 2 24  ? 167.747 -12.012 162.547 1.00 179.12 ? 24  G   B N9     1 
ATOM   8000  C C8     . G   B 2 24  ? 168.666 -11.126 163.057 1.00 173.53 ? 24  G   B C8     1 
ATOM   8001  N N7     . G   B 2 24  ? 168.162 -9.946  163.293 1.00 173.61 ? 24  G   B N7     1 
ATOM   8002  C C5     . G   B 2 24  ? 166.832 -10.061 162.915 1.00 179.97 ? 24  G   B C5     1 
ATOM   8003  C C6     . G   B 2 24  ? 165.784 -9.107  162.940 1.00 184.17 ? 24  G   B C6     1 
ATOM   8004  O O6     . G   B 2 24  ? 165.825 -7.929  163.316 1.00 180.93 ? 24  G   B O6     1 
ATOM   8005  N N1     . G   B 2 24  ? 164.592 -9.647  162.465 1.00 192.92 ? 24  G   B N1     1 
ATOM   8006  C C2     . G   B 2 24  ? 164.427 -10.937 162.022 1.00 198.14 ? 24  G   B C2     1 
ATOM   8007  N N2     . G   B 2 24  ? 163.198 -11.268 161.603 1.00 205.44 ? 24  G   B N2     1 
ATOM   8008  N N3     . G   B 2 24  ? 165.395 -11.836 161.993 1.00 192.87 ? 24  G   B N3     1 
ATOM   8009  C C4     . G   B 2 24  ? 166.560 -11.331 162.451 1.00 184.13 ? 24  G   B C4     1 
ATOM   8010  H "H5'"  . G   B 2 24  ? 171.806 -14.246 162.634 1.00 207.48 ? 24  G   B "H5'"  1 
ATOM   8011  H "H5''" . G   B 2 24  ? 172.083 -14.103 161.086 1.00 207.48 ? 24  G   B "H5''" 1 
ATOM   8012  H "H4'"  . G   B 2 24  ? 170.045 -15.158 161.408 1.00 212.20 ? 24  G   B "H4'"  1 
ATOM   8013  H "H3'"  . G   B 2 24  ? 169.706 -12.591 160.299 1.00 213.84 ? 24  G   B "H3'"  1 
ATOM   8014  H "H2'"  . G   B 2 24  ? 167.453 -12.909 160.210 1.00 219.88 ? 24  G   B "H2'"  1 
ATOM   8015  H "HO2'" . G   B 2 24  ? 167.939 -15.280 159.804 1.00 226.10 ? 24  G   B "HO2'" 1 
ATOM   8016  H "H1'"  . G   B 2 24  ? 167.285 -13.975 162.570 1.00 217.17 ? 24  G   B "H1'"  1 
ATOM   8017  H H8     . G   B 2 24  ? 169.555 -11.346 163.219 1.00 208.24 ? 24  G   B H8     1 
ATOM   8018  H H1     . G   B 2 24  ? 163.904 -9.131  162.447 1.00 231.50 ? 24  G   B H1     1 
ATOM   8019  H H21    . G   B 2 24  ? 162.566 -10.685 161.620 1.00 246.53 ? 24  G   B H21    1 
ATOM   8020  H H22    . G   B 2 24  ? 163.041 -12.063 161.316 1.00 246.53 ? 24  G   B H22    1 
ATOM   8021  P P      . U   B 2 31  ? 161.978 -2.919  146.838 1.00 186.15 ? 31  U   B P      1 
ATOM   8022  O OP1    . U   B 2 31  ? 160.648 -2.732  146.209 1.00 185.08 ? 31  U   B OP1    1 
ATOM   8023  O OP2    . U   B 2 31  ? 163.176 -3.129  145.987 1.00 189.79 ? 31  U   B OP2    1 
ATOM   8024  O "O5'"  . U   B 2 31  ? 162.257 -1.652  147.761 1.00 167.25 ? 31  U   B "O5'"  1 
ATOM   8025  C "C5'"  . U   B 2 31  ? 161.423 -0.504  147.696 1.00 161.00 ? 31  U   B "C5'"  1 
ATOM   8026  C "C4'"  . U   B 2 31  ? 161.986 0.638   148.507 1.00 151.51 ? 31  U   B "C4'"  1 
ATOM   8027  O "O4'"  . U   B 2 31  ? 162.109 0.236   149.897 1.00 144.94 ? 31  U   B "O4'"  1 
ATOM   8028  C "C3'"  . U   B 2 31  ? 163.387 1.106   148.131 1.00 148.96 ? 31  U   B "C3'"  1 
ATOM   8029  O "O3'"  . U   B 2 31  ? 163.400 1.978   147.009 1.00 151.42 ? 31  U   B "O3'"  1 
ATOM   8030  C "C2'"  . U   B 2 31  ? 163.876 1.755   149.421 1.00 140.41 ? 31  U   B "C2'"  1 
ATOM   8031  O "O2'"  . U   B 2 31  ? 163.359 3.071   149.562 1.00 132.78 ? 31  U   B "O2'"  1 
ATOM   8032  C "C1'"  . U   B 2 31  ? 163.241 0.849   150.481 1.00 139.95 ? 31  U   B "C1'"  1 
ATOM   8033  N N1     . U   B 2 31  ? 164.169 -0.210  150.958 1.00 137.64 ? 31  U   B N1     1 
ATOM   8034  C C2     . U   B 2 31  ? 165.068 0.106   151.963 1.00 128.44 ? 31  U   B C2     1 
ATOM   8035  O O2     . U   B 2 31  ? 165.138 1.211   152.472 1.00 119.70 ? 31  U   B O2     1 
ATOM   8036  N N3     . U   B 2 31  ? 165.893 -0.923  152.355 1.00 131.73 ? 31  U   B N3     1 
ATOM   8037  C C4     . U   B 2 31  ? 165.915 -2.212  151.864 1.00 138.13 ? 31  U   B C4     1 
ATOM   8038  O O4     . U   B 2 31  ? 166.720 -3.026  152.323 1.00 137.88 ? 31  U   B O4     1 
ATOM   8039  C C5     . U   B 2 31  ? 164.959 -2.467  150.831 1.00 143.88 ? 31  U   B C5     1 
ATOM   8040  C C6     . U   B 2 31  ? 164.143 -1.482  150.429 1.00 143.60 ? 31  U   B C6     1 
ATOM   8041  H "H5'"  . U   B 2 31  ? 160.544 -0.732  148.038 1.00 193.19 ? 31  U   B "H5'"  1 
ATOM   8042  H "H5''" . U   B 2 31  ? 161.341 -0.225  146.771 1.00 193.19 ? 31  U   B "H5''" 1 
ATOM   8043  H "H4'"  . U   B 2 31  ? 161.378 1.391   148.451 1.00 181.81 ? 31  U   B "H4'"  1 
ATOM   8044  H "H3'"  . U   B 2 31  ? 163.938 0.332   147.937 1.00 178.75 ? 31  U   B "H3'"  1 
ATOM   8045  H "H2'"  . U   B 2 31  ? 164.844 1.742   149.480 1.00 168.50 ? 31  U   B "H2'"  1 
ATOM   8046  H "HO2'" . U   B 2 31  ? 162.810 3.083   150.198 1.00 159.34 ? 31  U   B "HO2'" 1 
ATOM   8047  H "H1'"  . U   B 2 31  ? 162.959 1.389   151.235 1.00 167.94 ? 31  U   B "H1'"  1 
ATOM   8048  H H3     . U   B 2 31  ? 166.458 -0.742  152.978 1.00 158.08 ? 31  U   B H3     1 
ATOM   8049  H H5     . U   B 2 31  ? 164.904 -3.310  150.441 1.00 172.65 ? 31  U   B H5     1 
ATOM   8050  H H6     . U   B 2 31  ? 163.529 -1.667  149.756 1.00 172.33 ? 31  U   B H6     1 
ATOM   8051  P P      . G   B 2 32  ? 164.678 2.052   146.030 1.00 143.19 ? 32  G   B P      1 
ATOM   8052  O OP1    . G   B 2 32  ? 164.270 2.774   144.801 1.00 144.42 ? 32  G   B OP1    1 
ATOM   8053  O OP2    . G   B 2 32  ? 165.284 0.703   145.907 1.00 145.45 ? 32  G   B OP2    1 
ATOM   8054  O "O5'"  . G   B 2 32  ? 165.704 2.986   146.809 1.00 129.57 ? 32  G   B "O5'"  1 
ATOM   8055  C "C5'"  . G   B 2 32  ? 165.353 4.317   147.155 1.00 122.23 ? 32  G   B "C5'"  1 
ATOM   8056  C "C4'"  . G   B 2 32  ? 166.343 4.929   148.115 1.00 114.49 ? 32  G   B "C4'"  1 
ATOM   8057  O "O4'"  . G   B 2 32  ? 166.378 4.161   149.351 1.00 110.74 ? 32  G   B "O4'"  1 
ATOM   8058  C "C3'"  . G   B 2 32  ? 167.795 4.958   147.661 1.00 114.90 ? 32  G   B "C3'"  1 
ATOM   8059  O "O3'"  . G   B 2 32  ? 168.082 6.014   146.760 1.00 116.02 ? 32  G   B "O3'"  1 
ATOM   8060  C "C2'"  . G   B 2 32  ? 168.542 5.057   148.984 1.00 113.48 ? 32  G   B "C2'"  1 
ATOM   8061  O "O2'"  . G   B 2 32  ? 168.488 6.378   149.506 1.00 111.72 ? 32  G   B "O2'"  1 
ATOM   8062  C "C1'"  . G   B 2 32  ? 167.693 4.148   149.870 1.00 111.39 ? 32  G   B "C1'"  1 
ATOM   8063  N N9     . G   B 2 32  ? 168.191 2.759   149.861 1.00 112.85 ? 32  G   B N9     1 
ATOM   8064  C C8     . G   B 2 32  ? 167.617 1.664   149.257 1.00 113.76 ? 32  G   B C8     1 
ATOM   8065  N N7     . G   B 2 32  ? 168.301 0.564   149.419 1.00 114.98 ? 32  G   B N7     1 
ATOM   8066  C C5     . G   B 2 32  ? 169.397 0.957   150.173 1.00 114.88 ? 32  G   B C5     1 
ATOM   8067  C C6     . G   B 2 32  ? 170.490 0.200   150.662 1.00 116.49 ? 32  G   B C6     1 
ATOM   8068  O O6     . G   B 2 32  ? 170.711 -1.008  150.518 1.00 119.88 ? 32  G   B O6     1 
ATOM   8069  N N1     . G   B 2 32  ? 171.379 0.991   151.384 1.00 115.34 ? 32  G   B N1     1 
ATOM   8070  C C2     . G   B 2 32  ? 171.238 2.339   151.608 1.00 114.01 ? 32  G   B C2     1 
ATOM   8071  N N2     . G   B 2 32  ? 172.206 2.926   152.331 1.00 113.77 ? 32  G   B N2     1 
ATOM   8072  N N3     . G   B 2 32  ? 170.222 3.057   151.156 1.00 113.06 ? 32  G   B N3     1 
ATOM   8073  C C4     . G   B 2 32  ? 169.346 2.307   150.453 1.00 113.57 ? 32  G   B C4     1 
ATOM   8074  H "H5'"  . G   B 2 32  ? 164.475 4.315   147.565 1.00 146.68 ? 32  G   B "H5'"  1 
ATOM   8075  H "H5''" . G   B 2 32  ? 165.323 4.855   146.348 1.00 146.68 ? 32  G   B "H5''" 1 
ATOM   8076  H "H4'"  . G   B 2 32  ? 166.061 5.835   148.318 1.00 137.39 ? 32  G   B "H4'"  1 
ATOM   8077  H "H3'"  . G   B 2 32  ? 168.012 4.113   147.238 1.00 137.88 ? 32  G   B "H3'"  1 
ATOM   8078  H "H2'"  . G   B 2 32  ? 169.453 4.734   148.908 1.00 136.18 ? 32  G   B "H2'"  1 
ATOM   8079  H "HO2'" . G   B 2 32  ? 168.926 6.407   150.221 1.00 134.07 ? 32  G   B "HO2'" 1 
ATOM   8080  H "H1'"  . G   B 2 32  ? 167.688 4.488   150.779 1.00 133.67 ? 32  G   B "H1'"  1 
ATOM   8081  H H8     . G   B 2 32  ? 166.819 1.703   148.781 1.00 136.51 ? 32  G   B H8     1 
ATOM   8082  H H1     . G   B 2 32  ? 172.072 0.605   151.715 1.00 138.41 ? 32  G   B H1     1 
ATOM   8083  H H21    . G   B 2 32  ? 172.866 2.459   152.625 1.00 136.53 ? 32  G   B H21    1 
ATOM   8084  H H22    . G   B 2 32  ? 172.166 3.768   152.500 1.00 136.53 ? 32  G   B H22    1 
ATOM   8085  P P      . C   B 2 33  ? 169.261 5.868   145.677 1.00 124.21 ? 33  C   B P      1 
ATOM   8086  O OP1    . C   B 2 33  ? 169.268 7.095   144.842 1.00 126.42 ? 33  C   B OP1    1 
ATOM   8087  O OP2    . C   B 2 33  ? 169.169 4.529   145.045 1.00 126.60 ? 33  C   B OP2    1 
ATOM   8088  O "O5'"  . C   B 2 33  ? 170.592 5.892   146.545 1.00 120.82 ? 33  C   B "O5'"  1 
ATOM   8089  C "C5'"  . C   B 2 33  ? 170.972 7.052   147.269 1.00 118.48 ? 33  C   B "C5'"  1 
ATOM   8090  C "C4'"  . C   B 2 33  ? 172.213 6.805   148.090 1.00 118.60 ? 33  C   B "C4'"  1 
ATOM   8091  O "O4'"  . C   B 2 33  ? 171.977 5.707   149.008 1.00 117.35 ? 33  C   B "O4'"  1 
ATOM   8092  C "C3'"  . C   B 2 33  ? 173.455 6.385   147.314 1.00 121.73 ? 33  C   B "C3'"  1 
ATOM   8093  O "O3'"  . C   B 2 33  ? 174.153 7.487   146.755 1.00 123.16 ? 33  C   B "O3'"  1 
ATOM   8094  C "C2'"  . C   B 2 33  ? 174.261 5.624   148.357 1.00 121.38 ? 33  C   B "C2'"  1 
ATOM   8095  O "O2'"  . C   B 2 33  ? 174.981 6.517   149.196 1.00 120.36 ? 33  C   B "O2'"  1 
ATOM   8096  C "C1'"  . C   B 2 33  ? 173.155 4.948   149.170 1.00 119.01 ? 33  C   B "C1'"  1 
ATOM   8097  N N1     . C   B 2 33  ? 172.886 3.559   148.729 1.00 121.82 ? 33  C   B N1     1 
ATOM   8098  C C2     . C   B 2 33  ? 173.773 2.546   149.107 1.00 124.01 ? 33  C   B C2     1 
ATOM   8099  O O2     . C   B 2 33  ? 174.767 2.840   149.787 1.00 121.33 ? 33  C   B O2     1 
ATOM   8100  N N3     . C   B 2 33  ? 173.530 1.272   148.716 1.00 131.86 ? 33  C   B N3     1 
ATOM   8101  C C4     . C   B 2 33  ? 172.450 0.987   147.985 1.00 136.62 ? 33  C   B C4     1 
ATOM   8102  N N4     . C   B 2 33  ? 172.250 -0.282  147.626 1.00 141.86 ? 33  C   B N4     1 
ATOM   8103  C C5     . C   B 2 33  ? 171.526 1.996   147.591 1.00 132.62 ? 33  C   B C5     1 
ATOM   8104  C C6     . C   B 2 33  ? 171.778 3.253   147.983 1.00 126.40 ? 33  C   B C6     1 
ATOM   8105  H "H5'"  . C   B 2 33  ? 170.246 7.308   147.860 1.00 142.17 ? 33  C   B "H5'"  1 
ATOM   8106  H "H5''" . C   B 2 33  ? 171.142 7.774   146.645 1.00 142.17 ? 33  C   B "H5''" 1 
ATOM   8107  H "H4'"  . C   B 2 33  ? 172.416 7.604   148.601 1.00 142.32 ? 33  C   B "H4'"  1 
ATOM   8108  H "H3'"  . C   B 2 33  ? 173.197 5.777   146.604 1.00 146.08 ? 33  C   B "H3'"  1 
ATOM   8109  H "H2'"  . C   B 2 33  ? 174.846 4.970   147.945 1.00 145.65 ? 33  C   B "H2'"  1 
ATOM   8110  H "HO2'" . C   B 2 33  ? 174.652 6.492   149.969 1.00 144.43 ? 33  C   B "HO2'" 1 
ATOM   8111  H "H1'"  . C   B 2 33  ? 173.405 4.943   150.107 1.00 142.81 ? 33  C   B "H1'"  1 
ATOM   8112  H H41    . C   B 2 33  ? 171.562 -0.492  147.155 1.00 170.23 ? 33  C   B H41    1 
ATOM   8113  H H42    . C   B 2 33  ? 172.809 -0.890  147.866 1.00 170.23 ? 33  C   B H42    1 
ATOM   8114  H H5     . C   B 2 33  ? 170.776 1.791   147.081 1.00 159.15 ? 33  C   B H5     1 
ATOM   8115  H H6     . C   B 2 33  ? 171.191 3.932   147.740 1.00 151.68 ? 33  C   B H6     1 
ATOM   8116  P P      . C   B 2 34  ? 174.671 7.446   145.233 1.00 126.14 ? 34  C   B P      1 
ATOM   8117  O OP1    . C   B 2 34  ? 175.109 8.815   144.865 1.00 126.48 ? 34  C   B OP1    1 
ATOM   8118  O OP2    . C   B 2 34  ? 173.653 6.757   144.408 1.00 129.50 ? 34  C   B OP2    1 
ATOM   8119  O "O5'"  . C   B 2 34  ? 175.990 6.561   145.298 1.00 130.83 ? 34  C   B "O5'"  1 
ATOM   8120  C "C5'"  . C   B 2 34  ? 177.180 7.110   145.841 1.00 134.73 ? 34  C   B "C5'"  1 
ATOM   8121  C "C4'"  . C   B 2 34  ? 178.116 6.047   146.355 1.00 141.27 ? 34  C   B "C4'"  1 
ATOM   8122  O "O4'"  . C   B 2 34  ? 177.414 5.150   147.256 1.00 140.88 ? 34  C   B "O4'"  1 
ATOM   8123  C "C3'"  . C   B 2 34  ? 178.703 5.105   145.323 1.00 150.28 ? 34  C   B "C3'"  1 
ATOM   8124  O "O3'"  . C   B 2 34  ? 179.732 5.682   144.534 1.00 156.51 ? 34  C   B "O3'"  1 
ATOM   8125  C "C2'"  . C   B 2 34  ? 179.145 3.936   146.188 1.00 151.91 ? 34  C   B "C2'"  1 
ATOM   8126  O "O2'"  . C   B 2 34  ? 180.341 4.234   146.894 1.00 156.03 ? 34  C   B "O2'"  1 
ATOM   8127  C "C1'"  . C   B 2 34  ? 177.998 3.861   147.187 1.00 146.57 ? 34  C   B "C1'"  1 
ATOM   8128  N N1     . C   B 2 34  ? 176.983 2.862   146.776 1.00 149.58 ? 34  C   B N1     1 
ATOM   8129  C C2     . C   B 2 34  ? 177.207 1.515   147.094 1.00 151.31 ? 34  C   B C2     1 
ATOM   8130  O O2     . C   B 2 34  ? 178.231 1.191   147.716 1.00 152.96 ? 34  C   B O2     1 
ATOM   8131  N N3     . C   B 2 34  ? 176.302 0.586   146.723 1.00 151.79 ? 34  C   B N3     1 
ATOM   8132  C C4     . C   B 2 34  ? 175.213 0.953   146.055 1.00 153.88 ? 34  C   B C4     1 
ATOM   8133  N N4     . C   B 2 34  ? 174.351 -0.003  145.712 1.00 157.14 ? 34  C   B N4     1 
ATOM   8134  C C5     . C   B 2 34  ? 174.959 2.312   145.710 1.00 152.45 ? 34  C   B C5     1 
ATOM   8135  C C6     . C   B 2 34  ? 175.864 3.226   146.082 1.00 151.15 ? 34  C   B C6     1 
ATOM   8136  H "H5'"  . C   B 2 34  ? 176.948 7.704   146.572 1.00 161.68 ? 34  C   B "H5'"  1 
ATOM   8137  H "H5''" . C   B 2 34  ? 177.633 7.621   145.152 1.00 161.68 ? 34  C   B "H5''" 1 
ATOM   8138  H "H4'"  . C   B 2 34  ? 178.840 6.473   146.838 1.00 169.52 ? 34  C   B "H4'"  1 
ATOM   8139  H "H3'"  . C   B 2 34  ? 177.992 4.806   144.734 1.00 180.34 ? 34  C   B "H3'"  1 
ATOM   8140  H "H2'"  . C   B 2 34  ? 179.223 3.118   145.672 1.00 182.29 ? 34  C   B "H2'"  1 
ATOM   8141  H "HO2'" . C   B 2 34  ? 180.977 4.277   146.347 1.00 187.23 ? 34  C   B "HO2'" 1 
ATOM   8142  H "H1'"  . C   B 2 34  ? 178.348 3.621   148.059 1.00 175.89 ? 34  C   B "H1'"  1 
ATOM   8143  H H41    . C   B 2 34  ? 173.635 0.198   145.279 1.00 188.57 ? 34  C   B H41    1 
ATOM   8144  H H42    . C   B 2 34  ? 174.509 -0.822  145.923 1.00 188.57 ? 34  C   B H42    1 
ATOM   8145  H H5     . C   B 2 34  ? 174.192 2.555   145.243 1.00 182.94 ? 34  C   B H5     1 
ATOM   8146  H H6     . C   B 2 34  ? 175.724 4.121   145.873 1.00 181.38 ? 34  C   B H6     1 
ATOM   8147  P P      . A   B 2 35  ? 180.835 4.779   143.775 1.00 253.25 ? 35  A   B P      1 
ATOM   8148  O OP1    . A   B 2 35  ? 181.455 3.812   144.703 1.00 252.32 ? 35  A   B OP1    1 
ATOM   8149  O OP2    . A   B 2 35  ? 181.730 5.749   143.090 1.00 255.69 ? 35  A   B OP2    1 
ATOM   8150  O "O5'"  . A   B 2 35  ? 180.060 4.005   142.608 1.00 281.49 ? 35  A   B "O5'"  1 
ATOM   8151  C "C5'"  . A   B 2 35  ? 178.925 3.170   142.827 1.00 279.07 ? 35  A   B "C5'"  1 
ATOM   8152  C "C4'"  . A   B 2 35  ? 179.263 1.872   143.519 1.00 278.45 ? 35  A   B "C4'"  1 
ATOM   8153  O "O4'"  . A   B 2 35  ? 178.097 1.402   144.255 1.00 273.21 ? 35  A   B "O4'"  1 
ATOM   8154  C "C3'"  . A   B 2 35  ? 179.614 0.719   142.592 1.00 285.15 ? 35  A   B "C3'"  1 
ATOM   8155  O "O3'"  . A   B 2 35  ? 180.976 0.722   142.194 1.00 293.36 ? 35  A   B "O3'"  1 
ATOM   8156  C "C2'"  . A   B 2 35  ? 179.199 -0.500  143.400 1.00 280.72 ? 35  A   B "C2'"  1 
ATOM   8157  O "O2'"  . A   B 2 35  ? 180.155 -0.798  144.408 1.00 279.57 ? 35  A   B "O2'"  1 
ATOM   8158  C "C1'"  . A   B 2 35  ? 177.927 0.016   144.061 1.00 276.28 ? 35  A   B "C1'"  1 
ATOM   8159  N N9     . A   B 2 35  ? 176.750 -0.153  143.189 1.00 280.55 ? 35  A   B N9     1 
ATOM   8160  C C8     . A   B 2 35  ? 176.215 0.836   142.404 1.00 282.74 ? 35  A   B C8     1 
ATOM   8161  N N7     . A   B 2 35  ? 175.172 0.466   141.708 1.00 285.57 ? 35  A   B N7     1 
ATOM   8162  C C5     . A   B 2 35  ? 175.005 -0.862  142.059 1.00 287.94 ? 35  A   B C5     1 
ATOM   8163  C C6     . A   B 2 35  ? 174.058 -1.814  141.652 1.00 292.84 ? 35  A   B C6     1 
ATOM   8164  N N6     . A   B 2 35  ? 173.082 -1.544  140.781 1.00 295.96 ? 35  A   B N6     1 
ATOM   8165  N N1     . A   B 2 35  ? 174.153 -3.053  142.180 1.00 292.22 ? 35  A   B N1     1 
ATOM   8166  C C2     . A   B 2 35  ? 175.138 -3.301  143.055 1.00 289.57 ? 35  A   B C2     1 
ATOM   8167  N N3     . A   B 2 35  ? 176.089 -2.487  143.514 1.00 286.56 ? 35  A   B N3     1 
ATOM   8168  C C4     . A   B 2 35  ? 175.967 -1.264  142.972 1.00 284.65 ? 35  A   B C4     1 
ATOM   8169  H "H5'"  . A   B 2 35  ? 178.517 2.969   141.970 1.00 334.89 ? 35  A   B "H5'"  1 
ATOM   8170  H "H5''" . A   B 2 35  ? 178.283 3.654   143.371 1.00 334.89 ? 35  A   B "H5''" 1 
ATOM   8171  H "H4'"  . A   B 2 35  ? 179.995 2.019   144.139 1.00 334.14 ? 35  A   B "H4'"  1 
ATOM   8172  H "H3'"  . A   B 2 35  ? 179.057 0.774   141.800 1.00 342.18 ? 35  A   B "H3'"  1 
ATOM   8173  H "H2'"  . A   B 2 35  ? 179.021 -1.265  142.830 1.00 336.87 ? 35  A   B "H2'"  1 
ATOM   8174  H "HO2'" . A   B 2 35  ? 180.857 -1.082  144.044 1.00 335.49 ? 35  A   B "HO2'" 1 
ATOM   8175  H "H1'"  . A   B 2 35  ? 177.784 -0.428  144.912 1.00 331.54 ? 35  A   B "H1'"  1 
ATOM   8176  H H8     . A   B 2 35  ? 176.565 1.696   142.368 1.00 339.28 ? 35  A   B H8     1 
ATOM   8177  H H61    . A   B 2 35  ? 172.521 -2.158  140.561 1.00 355.15 ? 35  A   B H61    1 
ATOM   8178  H H62    . A   B 2 35  ? 173.014 -0.758  140.441 1.00 355.15 ? 35  A   B H62    1 
ATOM   8179  H H2     . A   B 2 35  ? 175.163 -4.168  143.390 1.00 347.49 ? 35  A   B H2     1 
ATOM   8180  P P      . C   B 2 36  ? 181.364 0.639   140.637 1.00 387.42 ? 36  C   B P      1 
ATOM   8181  O OP1    . C   B 2 36  ? 180.099 0.748   139.874 1.00 385.92 ? 36  C   B OP1    1 
ATOM   8182  O OP2    . C   B 2 36  ? 182.251 -0.537  140.445 1.00 390.53 ? 36  C   B OP2    1 
ATOM   8183  O "O5'"  . C   B 2 36  ? 182.203 1.969   140.364 1.00 388.03 ? 36  C   B "O5'"  1 
ATOM   8184  C "C5'"  . C   B 2 36  ? 183.240 2.009   139.388 1.00 398.00 ? 36  C   B "C5'"  1 
ATOM   8185  C "C4'"  . C   B 2 36  ? 182.729 2.376   138.013 1.00 410.67 ? 36  C   B "C4'"  1 
ATOM   8186  O "O4'"  . C   B 2 36  ? 182.612 1.180   137.189 1.00 421.71 ? 36  C   B "O4'"  1 
ATOM   8187  C "C3'"  . C   B 2 36  ? 181.344 3.004   137.937 1.00 410.88 ? 36  C   B "C3'"  1 
ATOM   8188  O "O3'"  . C   B 2 36  ? 181.302 4.378   138.273 1.00 403.28 ? 36  C   B "O3'"  1 
ATOM   8189  C "C2'"  . C   B 2 36  ? 180.946 2.710   136.502 1.00 422.74 ? 36  C   B "C2'"  1 
ATOM   8190  O "O2'"  . C   B 2 36  ? 181.637 3.562   135.598 1.00 429.31 ? 36  C   B "O2'"  1 
ATOM   8191  C "C1'"  . C   B 2 36  ? 181.480 1.289   136.346 1.00 426.70 ? 36  C   B "C1'"  1 
ATOM   8192  N N1     . C   B 2 36  ? 180.492 0.259   136.762 1.00 428.51 ? 36  C   B N1     1 
ATOM   8193  C C2     . C   B 2 36  ? 179.185 0.221   136.243 1.00 430.31 ? 36  C   B C2     1 
ATOM   8194  O O2     . C   B 2 36  ? 178.807 1.067   135.421 1.00 433.98 ? 36  C   B O2     1 
ATOM   8195  N N3     . C   B 2 36  ? 178.327 -0.741  136.660 1.00 426.04 ? 36  C   B N3     1 
ATOM   8196  C C4     . C   B 2 36  ? 178.716 -1.657  137.545 1.00 422.20 ? 36  C   B C4     1 
ATOM   8197  N N4     . C   B 2 36  ? 177.844 -2.588  137.928 1.00 418.94 ? 36  C   B N4     1 
ATOM   8198  C C5     . C   B 2 36  ? 180.029 -1.655  138.082 1.00 423.10 ? 36  C   B C5     1 
ATOM   8199  C C6     . C   B 2 36  ? 180.871 -0.703  137.659 1.00 426.16 ? 36  C   B C6     1 
ATOM   8200  H "H5'"  . C   B 2 36  ? 183.661 1.136   139.344 1.00 477.59 ? 36  C   B "H5'"  1 
ATOM   8201  H "H5''" . C   B 2 36  ? 183.902 2.663   139.662 1.00 477.59 ? 36  C   B "H5''" 1 
ATOM   8202  H "H4'"  . C   B 2 36  ? 183.366 2.978   137.597 1.00 492.80 ? 36  C   B "H4'"  1 
ATOM   8203  H "H3'"  . C   B 2 36  ? 180.749 2.519   138.531 1.00 493.06 ? 36  C   B "H3'"  1 
ATOM   8204  H "H2'"  . C   B 2 36  ? 179.984 2.749   136.378 1.00 507.29 ? 36  C   B "H2'"  1 
ATOM   8205  H "HO2'" . C   B 2 36  ? 181.345 4.345   135.682 1.00 515.17 ? 36  C   B "HO2'" 1 
ATOM   8206  H "H1'"  . C   B 2 36  ? 181.743 1.137   135.424 1.00 512.04 ? 36  C   B "H1'"  1 
ATOM   8207  H H41    . C   B 2 36  ? 178.078 -3.188  138.499 1.00 502.73 ? 36  C   B H41    1 
ATOM   8208  H H42    . C   B 2 36  ? 177.047 -2.590  137.605 1.00 502.73 ? 36  C   B H42    1 
ATOM   8209  H H5     . C   B 2 36  ? 180.298 -2.297  138.699 1.00 507.73 ? 36  C   B H5     1 
ATOM   8210  H H6     . C   B 2 36  ? 181.734 -0.680  138.005 1.00 511.39 ? 36  C   B H6     1 
ATOM   8211  P P      . C   B 2 37  ? 179.900 5.175   138.268 1.00 434.10 ? 37  C   B P      1 
ATOM   8212  O OP1    . C   B 2 37  ? 179.370 5.209   136.884 1.00 440.15 ? 37  C   B OP1    1 
ATOM   8213  O OP2    . C   B 2 37  ? 180.136 6.450   138.993 1.00 427.98 ? 37  C   B OP2    1 
ATOM   8214  O "O5'"  . C   B 2 37  ? 178.914 4.306   139.178 1.00 439.20 ? 37  C   B "O5'"  1 
ATOM   8215  C "C5'"  . C   B 2 37  ? 178.212 3.172   138.674 1.00 441.03 ? 37  C   B "C5'"  1 
ATOM   8216  C "C4'"  . C   B 2 37  ? 176.881 3.534   138.058 1.00 441.33 ? 37  C   B "C4'"  1 
ATOM   8217  O "O4'"  . C   B 2 37  ? 175.811 2.861   138.769 1.00 436.89 ? 37  C   B "O4'"  1 
ATOM   8218  C "C3'"  . C   B 2 37  ? 176.487 5.003   138.093 1.00 441.89 ? 37  C   B "C3'"  1 
ATOM   8219  O "O3'"  . C   B 2 37  ? 177.087 5.750   137.052 1.00 445.40 ? 37  C   B "O3'"  1 
ATOM   8220  C "C2'"  . C   B 2 37  ? 174.967 4.945   137.995 1.00 438.83 ? 37  C   B "C2'"  1 
ATOM   8221  O "O2'"  . C   B 2 37  ? 174.544 4.779   136.649 1.00 444.06 ? 37  C   B "O2'"  1 
ATOM   8222  C "C1'"  . C   B 2 37  ? 174.653 3.667   138.775 1.00 430.67 ? 37  C   B "C1'"  1 
ATOM   8223  N N1     . C   B 2 37  ? 174.265 3.932   140.179 1.00 414.45 ? 37  C   B N1     1 
ATOM   8224  C C2     . C   B 2 37  ? 173.022 4.517   140.435 1.00 406.64 ? 37  C   B C2     1 
ATOM   8225  O O2     . C   B 2 37  ? 172.286 4.811   139.483 1.00 410.30 ? 37  C   B O2     1 
ATOM   8226  N N3     . C   B 2 37  ? 172.654 4.753   141.713 1.00 394.39 ? 37  C   B N3     1 
ATOM   8227  C C4     . C   B 2 37  ? 173.471 4.420   142.711 1.00 386.81 ? 37  C   B C4     1 
ATOM   8228  N N4     . C   B 2 37  ? 173.068 4.673   143.957 1.00 376.28 ? 37  C   B N4     1 
ATOM   8229  C C5     . C   B 2 37  ? 174.741 3.820   142.483 1.00 394.59 ? 37  C   B C5     1 
ATOM   8230  C C6     . C   B 2 37  ? 175.092 3.593   141.212 1.00 405.38 ? 37  C   B C6     1 
ATOM   8231  H "H5'"  . C   B 2 37  ? 178.059 2.550   139.403 1.00 529.23 ? 37  C   B "H5'"  1 
ATOM   8232  H "H5''" . C   B 2 37  ? 178.760 2.738   138.002 1.00 529.23 ? 37  C   B "H5''" 1 
ATOM   8233  H "H4'"  . C   B 2 37  ? 176.876 3.235   137.135 1.00 529.60 ? 37  C   B "H4'"  1 
ATOM   8234  H "H3'"  . C   B 2 37  ? 176.739 5.383   138.949 1.00 530.27 ? 37  C   B "H3'"  1 
ATOM   8235  H "H2'"  . C   B 2 37  ? 174.555 5.720   138.407 1.00 526.59 ? 37  C   B "H2'"  1 
ATOM   8236  H "HO2'" . C   B 2 37  ? 174.717 5.480   136.220 1.00 532.87 ? 37  C   B "HO2'" 1 
ATOM   8237  H "H1'"  . C   B 2 37  ? 173.933 3.192   138.330 1.00 516.81 ? 37  C   B "H1'"  1 
ATOM   8238  H H41    . C   B 2 37  ? 173.574 4.469   144.623 1.00 451.54 ? 37  C   B H41    1 
ATOM   8239  H H42    . C   B 2 37  ? 172.302 5.039   144.096 1.00 451.54 ? 37  C   B H42    1 
ATOM   8240  H H5     . C   B 2 37  ? 175.303 3.594   143.188 1.00 473.51 ? 37  C   B H5     1 
ATOM   8241  H H6     . C   B 2 37  ? 175.915 3.200   141.029 1.00 486.46 ? 37  C   B H6     1 
ATOM   8242  C CA     . MET C 1 1   ? 211.917 10.482  131.465 1.00 133.46 ? 1   MET C CA     1 
ATOM   8243  C C      . MET C 1 1   ? 212.046 8.958   131.435 1.00 129.56 ? 1   MET C C      1 
ATOM   8244  O O      . MET C 1 1   ? 211.506 8.259   132.297 1.00 124.71 ? 1   MET C O      1 
ATOM   8245  C CB     . MET C 1 1   ? 210.601 10.902  132.130 1.00 137.02 ? 1   MET C CB     1 
ATOM   8246  C CG     . MET C 1 1   ? 210.424 12.418  132.257 1.00 141.48 ? 1   MET C CG     1 
ATOM   8247  S SD     . MET C 1 1   ? 208.890 12.925  133.078 1.00 147.03 ? 1   MET C SD     1 
ATOM   8248  C CE     . MET C 1 1   ? 209.031 14.712  133.015 1.00 118.51 ? 1   MET C CE     1 
ATOM   8249  H HB2    . MET C 1 1   ? 209.862 10.562  131.602 1.00 164.43 ? 1   MET C HB2    1 
ATOM   8250  H HB3    . MET C 1 1   ? 210.568 10.525  133.023 1.00 164.43 ? 1   MET C HB3    1 
ATOM   8251  H HG2    . MET C 1 1   ? 211.165 12.776  132.771 1.00 169.78 ? 1   MET C HG2    1 
ATOM   8252  H HG3    . MET C 1 1   ? 210.425 12.807  131.369 1.00 169.78 ? 1   MET C HG3    1 
ATOM   8253  H HE1    . MET C 1 1   ? 208.250 15.106  133.434 1.00 142.22 ? 1   MET C HE1    1 
ATOM   8254  H HE2    . MET C 1 1   ? 209.833 14.982  133.490 1.00 142.22 ? 1   MET C HE2    1 
ATOM   8255  H HE3    . MET C 1 1   ? 209.086 14.991  132.087 1.00 142.22 ? 1   MET C HE3    1 
ATOM   8256  N N      . LYS C 1 2   ? 212.772 8.456   130.438 1.00 130.83 ? 2   LYS C N      1 
ATOM   8257  C CA     . LYS C 1 2   ? 212.978 7.019   130.263 1.00 128.42 ? 2   LYS C CA     1 
ATOM   8258  C C      . LYS C 1 2   ? 214.380 6.613   130.708 1.00 120.48 ? 2   LYS C C      1 
ATOM   8259  O O      . LYS C 1 2   ? 215.294 7.434   130.734 1.00 122.04 ? 2   LYS C O      1 
ATOM   8260  C CB     . LYS C 1 2   ? 212.771 6.624   128.797 1.00 133.25 ? 2   LYS C CB     1 
ATOM   8261  C CG     . LYS C 1 2   ? 211.348 6.814   128.284 1.00 135.63 ? 2   LYS C CG     1 
ATOM   8262  C CD     . LYS C 1 2   ? 211.259 6.531   126.791 1.00 138.47 ? 2   LYS C CD     1 
ATOM   8263  C CE     . LYS C 1 2   ? 209.843 6.705   126.264 1.00 139.71 ? 2   LYS C CE     1 
ATOM   8264  N NZ     . LYS C 1 2   ? 209.784 6.589   124.779 1.00 140.76 ? 2   LYS C NZ     1 
ATOM   8265  H H      . LYS C 1 2   ? 213.161 8.935   129.839 1.00 156.99 ? 2   LYS C H      1 
ATOM   8266  H HA     . LYS C 1 2   ? 212.334 6.535   130.803 1.00 154.11 ? 2   LYS C HA     1 
ATOM   8267  H HB2    . LYS C 1 2   ? 213.358 7.164   128.244 1.00 159.90 ? 2   LYS C HB2    1 
ATOM   8268  H HB3    . LYS C 1 2   ? 212.998 5.686   128.694 1.00 159.90 ? 2   LYS C HB3    1 
ATOM   8269  H HG2    . LYS C 1 2   ? 210.755 6.201   128.747 1.00 162.75 ? 2   LYS C HG2    1 
ATOM   8270  H HG3    . LYS C 1 2   ? 211.071 7.731   128.438 1.00 162.75 ? 2   LYS C HG3    1 
ATOM   8271  H HD2    . LYS C 1 2   ? 211.837 7.147   126.315 1.00 166.16 ? 2   LYS C HD2    1 
ATOM   8272  H HD3    . LYS C 1 2   ? 211.534 5.616   126.623 1.00 166.16 ? 2   LYS C HD3    1 
ATOM   8273  H HE2    . LYS C 1 2   ? 209.275 6.017   126.644 1.00 167.66 ? 2   LYS C HE2    1 
ATOM   8274  H HE3    . LYS C 1 2   ? 209.517 7.584   126.512 1.00 167.66 ? 2   LYS C HE3    1 
ATOM   8275  H HZ1    . LYS C 1 2   ? 208.946 6.694   124.499 1.00 168.92 ? 2   LYS C HZ1    1 
ATOM   8276  H HZ2    . LYS C 1 2   ? 210.296 7.214   124.404 1.00 168.92 ? 2   LYS C HZ2    1 
ATOM   8277  H HZ3    . LYS C 1 2   ? 210.075 5.787   124.525 1.00 168.92 ? 2   LYS C HZ3    1 
ATOM   8278  N N      . VAL C 1 3   ? 214.541 5.339   131.050 1.00 110.24 ? 3   VAL C N      1 
ATOM   8279  C CA     . VAL C 1 3   ? 215.828 4.812   131.488 1.00 100.42 ? 3   VAL C CA     1 
ATOM   8280  C C      . VAL C 1 3   ? 216.806 4.698   130.316 1.00 102.07 ? 3   VAL C C      1 
ATOM   8281  O O      . VAL C 1 3   ? 217.980 5.062   130.435 1.00 97.84  ? 3   VAL C O      1 
ATOM   8282  C CB     . VAL C 1 3   ? 215.665 3.421   132.131 1.00 91.63  ? 3   VAL C CB     1 
ATOM   8283  C CG1    . VAL C 1 3   ? 216.991 2.932   132.705 1.00 85.19  ? 3   VAL C CG1    1 
ATOM   8284  C CG2    . VAL C 1 3   ? 214.588 3.453   133.214 1.00 90.86  ? 3   VAL C CG2    1 
ATOM   8285  H H      . VAL C 1 3   ? 213.912 4.753   131.037 1.00 132.28 ? 3   VAL C H      1 
ATOM   8286  H HA     . VAL C 1 3   ? 216.212 5.410   132.148 1.00 120.50 ? 3   VAL C HA     1 
ATOM   8287  H HB     . VAL C 1 3   ? 215.384 2.791   131.449 1.00 109.96 ? 3   VAL C HB     1 
ATOM   8288  H HG11   . VAL C 1 3   ? 216.859 2.056   133.102 1.00 102.23 ? 3   VAL C HG11   1 
ATOM   8289  H HG12   . VAL C 1 3   ? 217.643 2.875   131.990 1.00 102.23 ? 3   VAL C HG12   1 
ATOM   8290  H HG13   . VAL C 1 3   ? 217.293 3.559   133.380 1.00 102.23 ? 3   VAL C HG13   1 
ATOM   8291  H HG21   . VAL C 1 3   ? 214.505 2.568   133.602 1.00 109.03 ? 3   VAL C HG21   1 
ATOM   8292  H HG22   . VAL C 1 3   ? 214.847 4.091   133.897 1.00 109.03 ? 3   VAL C HG22   1 
ATOM   8293  H HG23   . VAL C 1 3   ? 213.746 3.720   132.813 1.00 109.03 ? 3   VAL C HG23   1 
ATOM   8294  N N      . GLU C 1 4   ? 216.320 4.183   129.188 1.00 109.31 ? 4   GLU C N      1 
ATOM   8295  C CA     . GLU C 1 4   ? 217.156 3.995   128.003 1.00 118.30 ? 4   GLU C CA     1 
ATOM   8296  C C      . GLU C 1 4   ? 217.591 5.336   127.418 1.00 119.54 ? 4   GLU C C      1 
ATOM   8297  O O      . GLU C 1 4   ? 218.606 5.420   126.723 1.00 120.34 ? 4   GLU C O      1 
ATOM   8298  C CB     . GLU C 1 4   ? 216.420 3.174   126.938 1.00 125.61 ? 4   GLU C CB     1 
ATOM   8299  C CG     . GLU C 1 4   ? 216.342 1.672   127.226 1.00 128.22 ? 4   GLU C CG     1 
ATOM   8300  C CD     . GLU C 1 4   ? 215.481 1.335   128.433 1.00 128.41 ? 4   GLU C CD     1 
ATOM   8301  O OE1    . GLU C 1 4   ? 214.742 2.223   128.908 1.00 133.08 ? 4   GLU C OE1    1 
ATOM   8302  O OE2    . GLU C 1 4   ? 215.545 0.179   128.906 1.00 123.00 ? 4   GLU C OE2    1 
ATOM   8303  H H      . GLU C 1 4   ? 215.504 3.932   129.083 1.00 131.17 ? 4   GLU C H      1 
ATOM   8304  H HA     . GLU C 1 4   ? 217.955 3.507   128.257 1.00 141.95 ? 4   GLU C HA     1 
ATOM   8305  H HB2    . GLU C 1 4   ? 215.511 3.506   126.865 1.00 150.73 ? 4   GLU C HB2    1 
ATOM   8306  H HB3    . GLU C 1 4   ? 216.877 3.287   126.090 1.00 150.73 ? 4   GLU C HB3    1 
ATOM   8307  H HG2    . GLU C 1 4   ? 215.963 1.223   126.454 1.00 153.86 ? 4   GLU C HG2    1 
ATOM   8308  H HG3    . GLU C 1 4   ? 217.237 1.338   127.396 1.00 153.86 ? 4   GLU C HG3    1 
ATOM   8309  N N      . GLU C 1 5   ? 216.816 6.380   127.697 1.00 118.36 ? 5   GLU C N      1 
ATOM   8310  C CA     . GLU C 1 5   ? 217.174 7.726   127.275 1.00 117.46 ? 5   GLU C CA     1 
ATOM   8311  C C      . GLU C 1 5   ? 218.336 8.210   128.133 1.00 110.04 ? 5   GLU C C      1 
ATOM   8312  O O      . GLU C 1 5   ? 219.312 8.768   127.625 1.00 108.26 ? 5   GLU C O      1 
ATOM   8313  C CB     . GLU C 1 5   ? 215.977 8.669   127.424 1.00 122.82 ? 5   GLU C CB     1 
ATOM   8314  C CG     . GLU C 1 5   ? 216.187 10.055  126.817 1.00 127.83 ? 5   GLU C CG     1 
ATOM   8315  C CD     . GLU C 1 5   ? 215.155 11.072  127.287 1.00 129.89 ? 5   GLU C CD     1 
ATOM   8316  O OE1    . GLU C 1 5   ? 214.592 11.789  126.431 1.00 128.03 ? 5   GLU C OE1    1 
ATOM   8317  O OE2    . GLU C 1 5   ? 214.915 11.162  128.514 1.00 131.98 ? 5   GLU C OE2    1 
ATOM   8318  H H      . GLU C 1 5   ? 216.075 6.333   128.131 1.00 142.03 ? 5   GLU C H      1 
ATOM   8319  H HA     . GLU C 1 5   ? 217.453 7.717   126.346 1.00 140.96 ? 5   GLU C HA     1 
ATOM   8320  H HB2    . GLU C 1 5   ? 215.210 8.269   126.985 1.00 147.38 ? 5   GLU C HB2    1 
ATOM   8321  H HB3    . GLU C 1 5   ? 215.790 8.786   128.368 1.00 147.38 ? 5   GLU C HB3    1 
ATOM   8322  H HG2    . GLU C 1 5   ? 217.065 10.381  127.071 1.00 153.40 ? 5   GLU C HG2    1 
ATOM   8323  H HG3    . GLU C 1 5   ? 216.125 9.990   125.852 1.00 153.40 ? 5   GLU C HG3    1 
ATOM   8324  N N      . ILE C 1 6   ? 218.225 7.980   129.438 1.00 103.86 ? 6   ILE C N      1 
ATOM   8325  C CA     . ILE C 1 6   ? 219.251 8.402   130.379 1.00 95.54  ? 6   ILE C CA     1 
ATOM   8326  C C      . ILE C 1 6   ? 220.586 7.754   130.051 1.00 93.74  ? 6   ILE C C      1 
ATOM   8327  O O      . ILE C 1 6   ? 221.606 8.439   129.959 1.00 100.15 ? 6   ILE C O      1 
ATOM   8328  C CB     . ILE C 1 6   ? 218.859 8.060   131.828 1.00 85.43  ? 6   ILE C CB     1 
ATOM   8329  C CG1    . ILE C 1 6   ? 217.649 8.892   132.246 1.00 81.32  ? 6   ILE C CG1    1 
ATOM   8330  C CG2    . ILE C 1 6   ? 220.014 8.346   132.783 1.00 82.94  ? 6   ILE C CG2    1 
ATOM   8331  C CD1    . ILE C 1 6   ? 216.925 8.371   133.467 1.00 77.83  ? 6   ILE C CD1    1 
ATOM   8332  H H      . ILE C 1 6   ? 217.559 7.577   129.804 1.00 124.64 ? 6   ILE C H      1 
ATOM   8333  H HA     . ILE C 1 6   ? 219.360 9.364   130.317 1.00 114.65 ? 6   ILE C HA     1 
ATOM   8334  H HB     . ILE C 1 6   ? 218.630 7.119   131.881 1.00 102.52 ? 6   ILE C HB     1 
ATOM   8335  H HG12   . ILE C 1 6   ? 217.945 9.795   132.443 1.00 97.59  ? 6   ILE C HG12   1 
ATOM   8336  H HG13   . ILE C 1 6   ? 217.015 8.909   131.512 1.00 97.59  ? 6   ILE C HG13   1 
ATOM   8337  H HG21   . ILE C 1 6   ? 219.739 8.122   133.685 1.00 99.53  ? 6   ILE C HG21   1 
ATOM   8338  H HG22   . ILE C 1 6   ? 220.777 7.806   132.525 1.00 99.53  ? 6   ILE C HG22   1 
ATOM   8339  H HG23   . ILE C 1 6   ? 220.241 9.288   132.730 1.00 99.53  ? 6   ILE C HG23   1 
ATOM   8340  H HD11   . ILE C 1 6   ? 216.175 8.954   133.662 1.00 93.40  ? 6   ILE C HD11   1 
ATOM   8341  H HD12   . ILE C 1 6   ? 216.608 7.472   133.285 1.00 93.40  ? 6   ILE C HD12   1 
ATOM   8342  H HD13   . ILE C 1 6   ? 217.539 8.360   134.217 1.00 93.40  ? 6   ILE C HD13   1 
ATOM   8343  N N      . LEU C 1 7   ? 220.581 6.437   129.876 1.00 84.61  ? 7   LEU C N      1 
ATOM   8344  C CA     . LEU C 1 7   ? 221.826 5.720   129.646 1.00 86.18  ? 7   LEU C CA     1 
ATOM   8345  C C      . LEU C 1 7   ? 222.486 6.186   128.353 1.00 99.45  ? 7   LEU C C      1 
ATOM   8346  O O      . LEU C 1 7   ? 223.712 6.194   128.236 1.00 100.73 ? 7   LEU C O      1 
ATOM   8347  C CB     . LEU C 1 7   ? 221.587 4.211   129.612 1.00 80.53  ? 7   LEU C CB     1 
ATOM   8348  C CG     . LEU C 1 7   ? 221.112 3.570   130.918 1.00 79.35  ? 7   LEU C CG     1 
ATOM   8349  C CD1    . LEU C 1 7   ? 220.951 2.076   130.732 1.00 78.45  ? 7   LEU C CD1    1 
ATOM   8350  C CD2    . LEU C 1 7   ? 222.058 3.858   132.080 1.00 79.88  ? 7   LEU C CD2    1 
ATOM   8351  H H      . LEU C 1 7   ? 219.879 5.942   129.886 1.00 101.53 ? 7   LEU C H      1 
ATOM   8352  H HA     . LEU C 1 7   ? 222.437 5.909   130.376 1.00 103.42 ? 7   LEU C HA     1 
ATOM   8353  H HB2    . LEU C 1 7   ? 220.915 4.025   128.938 1.00 96.64  ? 7   LEU C HB2    1 
ATOM   8354  H HB3    . LEU C 1 7   ? 222.419 3.777   129.364 1.00 96.64  ? 7   LEU C HB3    1 
ATOM   8355  H HG     . LEU C 1 7   ? 220.243 3.935   131.146 1.00 95.22  ? 7   LEU C HG     1 
ATOM   8356  H HD11   . LEU C 1 7   ? 220.650 1.685   131.567 1.00 94.14  ? 7   LEU C HD11   1 
ATOM   8357  H HD12   . LEU C 1 7   ? 220.296 1.913   130.035 1.00 94.14  ? 7   LEU C HD12   1 
ATOM   8358  H HD13   . LEU C 1 7   ? 221.806 1.696   130.478 1.00 94.14  ? 7   LEU C HD13   1 
ATOM   8359  H HD21   . LEU C 1 7   ? 221.713 3.432   132.880 1.00 95.85  ? 7   LEU C HD21   1 
ATOM   8360  H HD22   . LEU C 1 7   ? 222.935 3.503   131.868 1.00 95.85  ? 7   LEU C HD22   1 
ATOM   8361  H HD23   . LEU C 1 7   ? 222.111 4.818   132.212 1.00 95.85  ? 7   LEU C HD23   1 
ATOM   8362  N N      . GLU C 1 8   ? 221.671 6.588   127.385 1.00 110.35 ? 8   GLU C N      1 
ATOM   8363  C CA     . GLU C 1 8   ? 222.202 7.053   126.119 1.00 116.67 ? 8   GLU C CA     1 
ATOM   8364  C C      . GLU C 1 8   ? 222.979 8.347   126.343 1.00 113.61 ? 8   GLU C C      1 
ATOM   8365  O O      . GLU C 1 8   ? 224.133 8.464   125.933 1.00 116.89 ? 8   GLU C O      1 
ATOM   8366  C CB     . GLU C 1 8   ? 221.073 7.254   125.112 1.00 123.68 ? 8   GLU C CB     1 
ATOM   8367  C CG     . GLU C 1 8   ? 221.549 7.535   123.701 1.00 130.79 ? 8   GLU C CG     1 
ATOM   8368  C CD     . GLU C 1 8   ? 220.421 7.481   122.692 1.00 137.23 ? 8   GLU C CD     1 
ATOM   8369  O OE1    . GLU C 1 8   ? 219.265 7.242   123.103 1.00 138.11 ? 8   GLU C OE1    1 
ATOM   8370  O OE2    . GLU C 1 8   ? 220.689 7.673   121.487 1.00 141.18 ? 8   GLU C OE2    1 
ATOM   8371  H H      . GLU C 1 8   ? 220.813 6.601   127.439 1.00 132.42 ? 8   GLU C H      1 
ATOM   8372  H HA     . GLU C 1 8   ? 222.813 6.389   125.763 1.00 140.01 ? 8   GLU C HA     1 
ATOM   8373  H HB2    . GLU C 1 8   ? 220.531 6.450   125.087 1.00 148.42 ? 8   GLU C HB2    1 
ATOM   8374  H HB3    . GLU C 1 8   ? 220.531 8.006   125.397 1.00 148.42 ? 8   GLU C HB3    1 
ATOM   8375  H HG2    . GLU C 1 8   ? 221.939 8.422   123.668 1.00 156.95 ? 8   GLU C HG2    1 
ATOM   8376  H HG3    . GLU C 1 8   ? 222.209 6.871   123.450 1.00 156.95 ? 8   GLU C HG3    1 
ATOM   8377  N N      . LYS C 1 9   ? 222.352 9.303   127.022 1.00 106.52 ? 9   LYS C N      1 
ATOM   8378  C CA     . LYS C 1 9   ? 222.983 10.593  127.276 1.00 105.17 ? 9   LYS C CA     1 
ATOM   8379  C C      . LYS C 1 9   ? 224.187 10.431  128.201 1.00 105.71 ? 9   LYS C C      1 
ATOM   8380  O O      . LYS C 1 9   ? 225.160 11.180  128.108 1.00 105.41 ? 9   LYS C O      1 
ATOM   8381  C CB     . LYS C 1 9   ? 221.978 11.573  127.890 1.00 106.57 ? 9   LYS C CB     1 
ATOM   8382  C CG     . LYS C 1 9   ? 220.758 11.870  127.017 1.00 111.64 ? 9   LYS C CG     1 
ATOM   8383  C CD     . LYS C 1 9   ? 221.110 12.610  125.719 1.00 116.53 ? 9   LYS C CD     1 
ATOM   8384  C CE     . LYS C 1 9   ? 221.620 14.022  125.978 1.00 117.42 ? 9   LYS C CE     1 
ATOM   8385  N NZ     . LYS C 1 9   ? 220.628 14.854  126.713 1.00 115.66 ? 9   LYS C NZ     1 
ATOM   8386  H H      . LYS C 1 9   ? 221.559 9.229   127.347 1.00 127.82 ? 9   LYS C H      1 
ATOM   8387  H HA     . LYS C 1 9   ? 223.295 10.966  126.436 1.00 126.21 ? 9   LYS C HA     1 
ATOM   8388  H HB2    . LYS C 1 9   ? 221.657 11.202  128.726 1.00 127.89 ? 9   LYS C HB2    1 
ATOM   8389  H HB3    . LYS C 1 9   ? 222.430 12.414  128.058 1.00 127.89 ? 9   LYS C HB3    1 
ATOM   8390  H HG2    . LYS C 1 9   ? 220.331 11.033  126.776 1.00 133.97 ? 9   LYS C HG2    1 
ATOM   8391  H HG3    . LYS C 1 9   ? 220.140 12.424  127.518 1.00 133.97 ? 9   LYS C HG3    1 
ATOM   8392  H HD2    . LYS C 1 9   ? 221.804 12.120  125.252 1.00 139.83 ? 9   LYS C HD2    1 
ATOM   8393  H HD3    . LYS C 1 9   ? 220.316 12.674  125.165 1.00 139.83 ? 9   LYS C HD3    1 
ATOM   8394  H HE2    . LYS C 1 9   ? 222.429 13.975  126.512 1.00 140.91 ? 9   LYS C HE2    1 
ATOM   8395  H HE3    . LYS C 1 9   ? 221.806 14.453  125.129 1.00 140.91 ? 9   LYS C HE3    1 
ATOM   8396  H HZ1    . LYS C 1 9   ? 220.956 15.670  126.848 1.00 138.79 ? 9   LYS C HZ1    1 
ATOM   8397  H HZ2    . LYS C 1 9   ? 219.876 14.918  126.240 1.00 138.79 ? 9   LYS C HZ2    1 
ATOM   8398  H HZ3    . LYS C 1 9   ? 220.443 14.482  127.500 1.00 138.79 ? 9   LYS C HZ3    1 
ATOM   8399  N N      . ALA C 1 10  ? 224.112 9.441   129.087 1.00 106.43 ? 10  ALA C N      1 
ATOM   8400  C CA     . ALA C 1 10  ? 225.162 9.195   130.070 1.00 103.96 ? 10  ALA C CA     1 
ATOM   8401  C C      . ALA C 1 10  ? 226.459 8.727   129.418 1.00 105.85 ? 10  ALA C C      1 
ATOM   8402  O O      . ALA C 1 10  ? 227.535 8.882   129.988 1.00 103.21 ? 10  ALA C O      1 
ATOM   8403  C CB     . ALA C 1 10  ? 224.692 8.168   131.079 1.00 99.79  ? 10  ALA C CB     1 
ATOM   8404  H H      . ALA C 1 10  ? 223.454 8.891   129.139 1.00 127.72 ? 10  ALA C H      1 
ATOM   8405  H HA     . ALA C 1 10  ? 225.347 10.019  130.547 1.00 124.76 ? 10  ALA C HA     1 
ATOM   8406  H HB1    . ALA C 1 10  ? 225.399 8.014   131.725 1.00 119.75 ? 10  ALA C HB1    1 
ATOM   8407  H HB2    . ALA C 1 10  ? 223.901 8.505   131.527 1.00 119.75 ? 10  ALA C HB2    1 
ATOM   8408  H HB3    . ALA C 1 10  ? 224.483 7.342   130.614 1.00 119.75 ? 10  ALA C HB3    1 
ATOM   8409  N N      . LEU C 1 11  ? 226.354 8.147   128.227 1.00 110.81 ? 11  LEU C N      1 
ATOM   8410  C CA     . LEU C 1 11  ? 227.529 7.661   127.515 1.00 113.79 ? 11  LEU C CA     1 
ATOM   8411  C C      . LEU C 1 11  ? 228.380 8.815   126.994 1.00 115.25 ? 11  LEU C C      1 
ATOM   8412  O O      . LEU C 1 11  ? 229.584 8.660   126.796 1.00 117.42 ? 11  LEU C O      1 
ATOM   8413  C CB     . LEU C 1 11  ? 227.113 6.753   126.357 1.00 115.62 ? 11  LEU C CB     1 
ATOM   8414  C CG     . LEU C 1 11  ? 226.544 5.377   126.721 1.00 115.99 ? 11  LEU C CG     1 
ATOM   8415  C CD1    . LEU C 1 11  ? 225.951 4.697   125.495 1.00 117.81 ? 11  LEU C CD1    1 
ATOM   8416  C CD2    . LEU C 1 11  ? 227.606 4.492   127.349 1.00 115.25 ? 11  LEU C CD2    1 
ATOM   8417  H H      . LEU C 1 11  ? 225.612 8.022   127.810 1.00 132.97 ? 11  LEU C H      1 
ATOM   8418  H HA     . LEU C 1 11  ? 228.074 7.139   128.125 1.00 136.55 ? 11  LEU C HA     1 
ATOM   8419  H HB2    . LEU C 1 11  ? 226.435 7.215   125.840 1.00 138.74 ? 11  LEU C HB2    1 
ATOM   8420  H HB3    . LEU C 1 11  ? 227.892 6.601   125.798 1.00 138.74 ? 11  LEU C HB3    1 
ATOM   8421  H HG     . LEU C 1 11  ? 225.832 5.494   127.370 1.00 139.19 ? 11  LEU C HG     1 
ATOM   8422  H HD11   . LEU C 1 11  ? 225.599 3.831   125.754 1.00 141.37 ? 11  LEU C HD11   1 
ATOM   8423  H HD12   . LEU C 1 11  ? 225.238 5.251   125.141 1.00 141.37 ? 11  LEU C HD12   1 
ATOM   8424  H HD13   . LEU C 1 11  ? 226.647 4.586   124.829 1.00 141.37 ? 11  LEU C HD13   1 
ATOM   8425  H HD21   . LEU C 1 11  ? 227.212 3.632   127.566 1.00 138.29 ? 11  LEU C HD21   1 
ATOM   8426  H HD22   . LEU C 1 11  ? 228.332 4.373   126.716 1.00 138.29 ? 11  LEU C HD22   1 
ATOM   8427  H HD23   . LEU C 1 11  ? 227.936 4.918   128.155 1.00 138.29 ? 11  LEU C HD23   1 
ATOM   8428  N N      . GLU C 1 12  ? 227.752 9.970   126.776 1.00 113.42 ? 12  GLU C N      1 
ATOM   8429  C CA     . GLU C 1 12  ? 228.448 11.152  126.261 1.00 116.49 ? 12  GLU C CA     1 
ATOM   8430  C C      . GLU C 1 12  ? 229.457 11.705  127.266 1.00 117.40 ? 12  GLU C C      1 
ATOM   8431  O O      . GLU C 1 12  ? 230.560 12.109  126.894 1.00 116.03 ? 12  GLU C O      1 
ATOM   8432  C CB     . GLU C 1 12  ? 227.444 12.251  125.907 1.00 119.68 ? 12  GLU C CB     1 
ATOM   8433  C CG     . GLU C 1 12  ? 226.444 11.867  124.833 1.00 123.08 ? 12  GLU C CG     1 
ATOM   8434  C CD     . GLU C 1 12  ? 225.434 12.965  124.562 1.00 127.04 ? 12  GLU C CD     1 
ATOM   8435  O OE1    . GLU C 1 12  ? 225.496 14.013  125.240 1.00 126.80 ? 12  GLU C OE1    1 
ATOM   8436  O OE2    . GLU C 1 12  ? 224.579 12.782  123.671 1.00 130.23 ? 12  GLU C OE2    1 
ATOM   8437  H H      . GLU C 1 12  ? 226.913 10.097  126.920 1.00 136.11 ? 12  GLU C H      1 
ATOM   8438  H HA     . GLU C 1 12  ? 228.928 10.910  125.453 1.00 139.79 ? 12  GLU C HA     1 
ATOM   8439  H HB2    . GLU C 1 12  ? 226.945 12.484  126.705 1.00 143.62 ? 12  GLU C HB2    1 
ATOM   8440  H HB3    . GLU C 1 12  ? 227.933 13.027  125.590 1.00 143.62 ? 12  GLU C HB3    1 
ATOM   8441  H HG2    . GLU C 1 12  ? 226.919 11.684  124.007 1.00 147.70 ? 12  GLU C HG2    1 
ATOM   8442  H HG3    . GLU C 1 12  ? 225.959 11.077  125.119 1.00 147.70 ? 12  GLU C HG3    1 
ATOM   8443  N N      . LEU C 1 13  ? 229.064 11.730  128.536 1.00 119.40 ? 13  LEU C N      1 
ATOM   8444  C CA     . LEU C 1 13  ? 229.926 12.217  129.611 1.00 118.80 ? 13  LEU C CA     1 
ATOM   8445  C C      . LEU C 1 13  ? 230.658 11.050  130.281 1.00 115.68 ? 13  LEU C C      1 
ATOM   8446  O O      . LEU C 1 13  ? 230.997 11.113  131.460 1.00 115.13 ? 13  LEU C O      1 
ATOM   8447  C CB     . LEU C 1 13  ? 229.111 13.031  130.633 1.00 116.24 ? 13  LEU C CB     1 
ATOM   8448  C CG     . LEU C 1 13  ? 227.765 12.466  131.106 1.00 112.56 ? 13  LEU C CG     1 
ATOM   8449  C CD1    . LEU C 1 13  ? 227.956 11.283  132.029 1.00 110.50 ? 13  LEU C CD1    1 
ATOM   8450  C CD2    . LEU C 1 13  ? 226.940 13.542  131.790 1.00 111.53 ? 13  LEU C CD2    1 
ATOM   8451  H H      . LEU C 1 13  ? 228.291 11.467  128.805 1.00 143.28 ? 13  LEU C H      1 
ATOM   8452  H HA     . LEU C 1 13  ? 230.596 12.806  129.230 1.00 142.56 ? 13  LEU C HA     1 
ATOM   8453  H HB2    . LEU C 1 13  ? 229.660 13.149  131.424 1.00 139.49 ? 13  LEU C HB2    1 
ATOM   8454  H HB3    . LEU C 1 13  ? 228.929 13.901  130.243 1.00 139.49 ? 13  LEU C HB3    1 
ATOM   8455  H HG     . LEU C 1 13  ? 227.267 12.160  130.332 1.00 135.07 ? 13  LEU C HG     1 
ATOM   8456  H HD11   . LEU C 1 13  ? 227.085 10.955  132.305 1.00 132.60 ? 13  LEU C HD11   1 
ATOM   8457  H HD12   . LEU C 1 13  ? 228.436 10.587  131.554 1.00 132.60 ? 13  LEU C HD12   1 
ATOM   8458  H HD13   . LEU C 1 13  ? 228.464 11.567  132.804 1.00 132.60 ? 13  LEU C HD13   1 
ATOM   8459  H HD21   . LEU C 1 13  ? 226.097 13.157  132.077 1.00 133.83 ? 13  LEU C HD21   1 
ATOM   8460  H HD22   . LEU C 1 13  ? 227.431 13.875  132.557 1.00 133.83 ? 13  LEU C HD22   1 
ATOM   8461  H HD23   . LEU C 1 13  ? 226.778 14.262  131.161 1.00 133.83 ? 13  LEU C HD23   1 
ATOM   8462  N N      . VAL C 1 14  ? 230.905 9.994   129.508 1.00 112.64 ? 14  VAL C N      1 
ATOM   8463  C CA     . VAL C 1 14  ? 231.554 8.783   130.011 1.00 105.85 ? 14  VAL C CA     1 
ATOM   8464  C C      . VAL C 1 14  ? 232.530 8.200   128.983 1.00 107.32 ? 14  VAL C C      1 
ATOM   8465  O O      . VAL C 1 14  ? 233.639 7.792   129.334 1.00 108.14 ? 14  VAL C O      1 
ATOM   8466  C CB     . VAL C 1 14  ? 230.501 7.718   130.399 1.00 98.05  ? 14  VAL C CB     1 
ATOM   8467  C CG1    . VAL C 1 14  ? 231.049 6.315   130.251 1.00 96.90  ? 14  VAL C CG1    1 
ATOM   8468  C CG2    . VAL C 1 14  ? 230.028 7.935   131.825 1.00 93.36  ? 14  VAL C CG2    1 
ATOM   8469  H H      . VAL C 1 14  ? 230.702 9.953   128.674 1.00 135.17 ? 14  VAL C H      1 
ATOM   8470  H HA     . VAL C 1 14  ? 232.060 9.006   130.807 1.00 127.02 ? 14  VAL C HA     1 
ATOM   8471  H HB     . VAL C 1 14  ? 229.734 7.804   129.812 1.00 117.66 ? 14  VAL C HB     1 
ATOM   8472  H HG11   . VAL C 1 14  ? 230.360 5.680   130.504 1.00 116.28 ? 14  VAL C HG11   1 
ATOM   8473  H HG12   . VAL C 1 14  ? 231.307 6.173   129.327 1.00 116.28 ? 14  VAL C HG12   1 
ATOM   8474  H HG13   . VAL C 1 14  ? 231.820 6.214   130.830 1.00 116.28 ? 14  VAL C HG13   1 
ATOM   8475  H HG21   . VAL C 1 14  ? 229.370 7.257   132.045 1.00 112.04 ? 14  VAL C HG21   1 
ATOM   8476  H HG22   . VAL C 1 14  ? 230.788 7.865   132.423 1.00 112.04 ? 14  VAL C HG22   1 
ATOM   8477  H HG23   . VAL C 1 14  ? 229.631 8.817   131.895 1.00 112.04 ? 14  VAL C HG23   1 
ATOM   8478  N N      . ILE C 1 15  ? 232.103 8.150   127.723 1.00 107.87 ? 15  ILE C N      1 
ATOM   8479  C CA     . ILE C 1 15  ? 232.940 7.638   126.636 1.00 108.42 ? 15  ILE C CA     1 
ATOM   8480  C C      . ILE C 1 15  ? 233.885 8.720   126.105 1.00 107.21 ? 15  ILE C C      1 
ATOM   8481  O O      . ILE C 1 15  ? 233.445 9.838   125.824 1.00 110.36 ? 15  ILE C O      1 
ATOM   8482  C CB     . ILE C 1 15  ? 232.078 7.122   125.465 1.00 109.76 ? 15  ILE C CB     1 
ATOM   8483  C CG1    . ILE C 1 15  ? 231.295 5.882   125.906 1.00 110.84 ? 15  ILE C CG1    1 
ATOM   8484  C CG2    . ILE C 1 15  ? 232.948 6.801   124.242 1.00 108.93 ? 15  ILE C CG2    1 
ATOM   8485  C CD1    . ILE C 1 15  ? 230.348 5.324   124.856 1.00 111.91 ? 15  ILE C CD1    1 
ATOM   8486  H H      . ILE C 1 15  ? 231.324 8.409   127.467 1.00 129.45 ? 15  ILE C H      1 
ATOM   8487  H HA     . ILE C 1 15  ? 233.477 6.901   126.966 1.00 130.10 ? 15  ILE C HA     1 
ATOM   8488  H HB     . ILE C 1 15  ? 231.445 7.815   125.219 1.00 131.71 ? 15  ILE C HB     1 
ATOM   8489  H HG12   . ILE C 1 15  ? 231.926 5.181   126.133 1.00 133.01 ? 15  ILE C HG12   1 
ATOM   8490  H HG13   . ILE C 1 15  ? 230.766 6.110   126.687 1.00 133.01 ? 15  ILE C HG13   1 
ATOM   8491  H HG21   . ILE C 1 15  ? 232.379 6.480   123.525 1.00 130.71 ? 15  ILE C HG21   1 
ATOM   8492  H HG22   . ILE C 1 15  ? 233.410 7.608   123.962 1.00 130.71 ? 15  ILE C HG22   1 
ATOM   8493  H HG23   . ILE C 1 15  ? 233.593 6.118   124.484 1.00 130.71 ? 15  ILE C HG23   1 
ATOM   8494  H HD11   . ILE C 1 15  ? 229.897 4.546   125.218 1.00 134.29 ? 15  ILE C HD11   1 
ATOM   8495  H HD12   . ILE C 1 15  ? 229.697 6.006   124.625 1.00 134.29 ? 15  ILE C HD12   1 
ATOM   8496  H HD13   . ILE C 1 15  ? 230.859 5.075   124.070 1.00 134.29 ? 15  ILE C HD13   1 
ATOM   8497  N N      . PRO C 1 16  ? 235.183 8.388   125.945 1.00 100.46 ? 16  PRO C N      1 
ATOM   8498  C CA     . PRO C 1 16  ? 236.128 9.372   125.401 1.00 106.86 ? 16  PRO C CA     1 
ATOM   8499  C C      . PRO C 1 16  ? 235.759 9.820   123.989 1.00 125.21 ? 16  PRO C C      1 
ATOM   8500  O O      . PRO C 1 16  ? 235.503 8.975   123.130 1.00 122.73 ? 16  PRO C O      1 
ATOM   8501  C CB     . PRO C 1 16  ? 237.457 8.609   125.372 1.00 97.82  ? 16  PRO C CB     1 
ATOM   8502  C CG     . PRO C 1 16  ? 237.294 7.500   126.342 1.00 90.59  ? 16  PRO C CG     1 
ATOM   8503  C CD     . PRO C 1 16  ? 235.855 7.120   126.283 1.00 90.88  ? 16  PRO C CD     1 
ATOM   8504  H HA     . PRO C 1 16  ? 236.202 10.143  125.985 1.00 128.23 ? 16  PRO C HA     1 
ATOM   8505  H HB2    . PRO C 1 16  ? 237.615 8.262   124.480 1.00 117.38 ? 16  PRO C HB2    1 
ATOM   8506  H HB3    . PRO C 1 16  ? 238.178 9.198   125.644 1.00 117.38 ? 16  PRO C HB3    1 
ATOM   8507  H HG2    . PRO C 1 16  ? 237.855 6.754   126.081 1.00 108.71 ? 16  PRO C HG2    1 
ATOM   8508  H HG3    . PRO C 1 16  ? 237.529 7.809   127.231 1.00 108.71 ? 16  PRO C HG3    1 
ATOM   8509  H HD2    . PRO C 1 16  ? 235.707 6.462   125.586 1.00 109.06 ? 16  PRO C HD2    1 
ATOM   8510  H HD3    . PRO C 1 16  ? 235.554 6.797   127.147 1.00 109.06 ? 16  PRO C HD3    1 
ATOM   8511  N N      . ASP C 1 17  ? 235.738 11.131  123.759 1.00 146.14 ? 17  ASP C N      1 
ATOM   8512  C CA     . ASP C 1 17  ? 235.418 11.681  122.441 1.00 161.43 ? 17  ASP C CA     1 
ATOM   8513  C C      . ASP C 1 17  ? 236.553 11.436  121.442 1.00 159.40 ? 17  ASP C C      1 
ATOM   8514  O O      . ASP C 1 17  ? 237.677 11.127  121.838 1.00 166.22 ? 17  ASP C O      1 
ATOM   8515  C CB     . ASP C 1 17  ? 235.099 13.180  122.543 1.00 173.10 ? 17  ASP C CB     1 
ATOM   8516  C CG     . ASP C 1 17  ? 236.148 13.957  123.322 1.00 180.31 ? 17  ASP C CG     1 
ATOM   8517  O OD1    . ASP C 1 17  ? 237.355 13.700  123.130 1.00 182.64 ? 17  ASP C OD1    1 
ATOM   8518  O OD2    . ASP C 1 17  ? 235.761 14.826  124.131 1.00 182.56 ? 17  ASP C OD2    1 
ATOM   8519  H H      . ASP C 1 17  ? 235.908 11.729  124.353 1.00 175.37 ? 17  ASP C H      1 
ATOM   8520  H HA     . ASP C 1 17  ? 234.627 11.234  122.102 1.00 193.71 ? 17  ASP C HA     1 
ATOM   8521  H HB2    . ASP C 1 17  ? 235.051 13.554  121.649 1.00 207.72 ? 17  ASP C HB2    1 
ATOM   8522  H HB3    . ASP C 1 17  ? 234.247 13.291  122.994 1.00 207.72 ? 17  ASP C HB3    1 
ATOM   8523  N N      . GLU C 1 18  ? 236.247 11.579  120.153 1.00 146.35 ? 18  GLU C N      1 
ATOM   8524  C CA     . GLU C 1 18  ? 237.204 11.307  119.077 1.00 138.83 ? 18  GLU C CA     1 
ATOM   8525  C C      . GLU C 1 18  ? 238.540 12.020  119.271 1.00 136.93 ? 18  GLU C C      1 
ATOM   8526  O O      . GLU C 1 18  ? 239.587 11.511  118.869 1.00 128.34 ? 18  GLU C O      1 
ATOM   8527  C CB     . GLU C 1 18  ? 236.609 11.719  117.728 1.00 139.25 ? 18  GLU C CB     1 
ATOM   8528  C CG     . GLU C 1 18  ? 235.369 10.932  117.323 1.00 137.62 ? 18  GLU C CG     1 
ATOM   8529  C CD     . GLU C 1 18  ? 234.804 11.367  115.979 1.00 136.86 ? 18  GLU C CD     1 
ATOM   8530  O OE1    . GLU C 1 18  ? 235.220 12.431  115.470 1.00 137.59 ? 18  GLU C OE1    1 
ATOM   8531  O OE2    . GLU C 1 18  ? 233.944 10.642  115.432 1.00 134.82 ? 18  GLU C OE2    1 
ATOM   8532  H H      . GLU C 1 18  ? 235.477 11.836  119.870 1.00 175.62 ? 18  GLU C H      1 
ATOM   8533  H HA     . GLU C 1 18  ? 237.377 10.353  119.046 1.00 166.59 ? 18  GLU C HA     1 
ATOM   8534  H HB2    . GLU C 1 18  ? 236.363 12.656  117.770 1.00 167.10 ? 18  GLU C HB2    1 
ATOM   8535  H HB3    . GLU C 1 18  ? 237.280 11.588  117.039 1.00 167.10 ? 18  GLU C HB3    1 
ATOM   8536  H HG2    . GLU C 1 18  ? 235.599 9.991   117.261 1.00 165.15 ? 18  GLU C HG2    1 
ATOM   8537  H HG3    . GLU C 1 18  ? 234.680 11.061  117.994 1.00 165.15 ? 18  GLU C HG3    1 
ATOM   8538  N N      . GLU C 1 19  ? 238.493 13.198  119.885 1.00 146.60 ? 19  GLU C N      1 
ATOM   8539  C CA     . GLU C 1 19  ? 239.698 13.970  120.174 1.00 154.44 ? 19  GLU C CA     1 
ATOM   8540  C C      . GLU C 1 19  ? 240.516 13.289  121.268 1.00 149.85 ? 19  GLU C C      1 
ATOM   8541  O O      . GLU C 1 19  ? 241.747 13.330  121.254 1.00 149.48 ? 19  GLU C O      1 
ATOM   8542  C CB     . GLU C 1 19  ? 239.322 15.392  120.606 1.00 162.74 ? 19  GLU C CB     1 
ATOM   8543  C CG     . GLU C 1 19  ? 240.505 16.343  120.737 1.00 169.28 ? 19  GLU C CG     1 
ATOM   8544  C CD     . GLU C 1 19  ? 240.095 17.736  121.182 1.00 172.93 ? 19  GLU C CD     1 
ATOM   8545  O OE1    . GLU C 1 19  ? 238.965 17.892  121.692 1.00 172.11 ? 19  GLU C OE1    1 
ATOM   8546  O OE2    . GLU C 1 19  ? 240.902 18.677  121.019 1.00 175.97 ? 19  GLU C OE2    1 
ATOM   8547  H H      . GLU C 1 19  ? 237.767 13.577  120.147 1.00 175.92 ? 19  GLU C H      1 
ATOM   8548  H HA     . GLU C 1 19  ? 240.243 14.028  119.374 1.00 185.32 ? 19  GLU C HA     1 
ATOM   8549  H HB2    . GLU C 1 19  ? 238.715 15.766  119.949 1.00 195.29 ? 19  GLU C HB2    1 
ATOM   8550  H HB3    . GLU C 1 19  ? 238.882 15.348  121.470 1.00 195.29 ? 19  GLU C HB3    1 
ATOM   8551  H HG2    . GLU C 1 19  ? 241.124 15.988  121.395 1.00 203.13 ? 19  GLU C HG2    1 
ATOM   8552  H HG3    . GLU C 1 19  ? 240.945 16.420  119.876 1.00 203.13 ? 19  GLU C HG3    1 
ATOM   8553  N N      . GLU C 1 20  ? 239.820 12.656  122.208 1.00 144.45 ? 20  GLU C N      1 
ATOM   8554  C CA     . GLU C 1 20  ? 240.462 11.982  123.333 1.00 137.28 ? 20  GLU C CA     1 
ATOM   8555  C C      . GLU C 1 20  ? 240.906 10.566  122.957 1.00 134.85 ? 20  GLU C C      1 
ATOM   8556  O O      . GLU C 1 20  ? 241.881 10.043  123.503 1.00 129.68 ? 20  GLU C O      1 
ATOM   8557  C CB     . GLU C 1 20  ? 239.499 11.933  124.520 1.00 130.20 ? 20  GLU C CB     1 
ATOM   8558  C CG     . GLU C 1 20  ? 240.095 11.337  125.781 1.00 124.95 ? 20  GLU C CG     1 
ATOM   8559  C CD     . GLU C 1 20  ? 239.148 11.412  126.963 1.00 120.98 ? 20  GLU C CD     1 
ATOM   8560  O OE1    . GLU C 1 20  ? 238.050 11.989  126.814 1.00 120.78 ? 20  GLU C OE1    1 
ATOM   8561  O OE2    . GLU C 1 20  ? 239.501 10.893  128.040 1.00 118.60 ? 20  GLU C OE2    1 
ATOM   8562  H H      . GLU C 1 20  ? 238.962 12.602  122.217 1.00 173.34 ? 20  GLU C H      1 
ATOM   8563  H HA     . GLU C 1 20  ? 241.247 12.485  123.600 1.00 164.74 ? 20  GLU C HA     1 
ATOM   8564  H HB2    . GLU C 1 20  ? 239.215 12.837  124.727 1.00 156.24 ? 20  GLU C HB2    1 
ATOM   8565  H HB3    . GLU C 1 20  ? 238.730 11.395  124.275 1.00 156.24 ? 20  GLU C HB3    1 
ATOM   8566  H HG2    . GLU C 1 20  ? 240.305 10.404  125.622 1.00 149.95 ? 20  GLU C HG2    1 
ATOM   8567  H HG3    . GLU C 1 20  ? 240.902 11.825  126.011 1.00 149.95 ? 20  GLU C HG3    1 
ATOM   8568  N N      . VAL C 1 21  ? 240.185 9.952   122.023 1.00 138.59 ? 21  VAL C N      1 
ATOM   8569  C CA     . VAL C 1 21  ? 240.517 8.613   121.548 1.00 143.47 ? 21  VAL C CA     1 
ATOM   8570  C C      . VAL C 1 21  ? 241.756 8.649   120.654 1.00 153.52 ? 21  VAL C C      1 
ATOM   8571  O O      . VAL C 1 21  ? 242.631 7.788   120.759 1.00 153.23 ? 21  VAL C O      1 
ATOM   8572  C CB     . VAL C 1 21  ? 239.334 7.983   120.768 1.00 136.93 ? 21  VAL C CB     1 
ATOM   8573  C CG1    . VAL C 1 21  ? 239.725 6.633   120.167 1.00 135.34 ? 21  VAL C CG1    1 
ATOM   8574  C CG2    . VAL C 1 21  ? 238.122 7.819   121.676 1.00 134.83 ? 21  VAL C CG2    1 
ATOM   8575  H H      . VAL C 1 21  ? 239.492 10.294  121.645 1.00 166.31 ? 21  VAL C H      1 
ATOM   8576  H HA     . VAL C 1 21  ? 240.711 8.045   122.310 1.00 172.16 ? 21  VAL C HA     1 
ATOM   8577  H HB     . VAL C 1 21  ? 239.085 8.574   120.040 1.00 164.32 ? 21  VAL C HB     1 
ATOM   8578  H HG11   . VAL C 1 21  ? 238.964 6.269   119.688 1.00 162.41 ? 21  VAL C HG11   1 
ATOM   8579  H HG12   . VAL C 1 21  ? 240.469 6.763   119.558 1.00 162.41 ? 21  VAL C HG12   1 
ATOM   8580  H HG13   . VAL C 1 21  ? 239.984 6.032   120.883 1.00 162.41 ? 21  VAL C HG13   1 
ATOM   8581  H HG21   . VAL C 1 21  ? 237.397 7.424   121.166 1.00 161.79 ? 21  VAL C HG21   1 
ATOM   8582  H HG22   . VAL C 1 21  ? 238.359 7.240   122.417 1.00 161.79 ? 21  VAL C HG22   1 
ATOM   8583  H HG23   . VAL C 1 21  ? 237.856 8.691   122.008 1.00 161.79 ? 21  VAL C HG23   1 
ATOM   8584  N N      . ARG C 1 22  ? 241.824 9.647   119.776 1.00 163.54 ? 22  ARG C N      1 
ATOM   8585  C CA     . ARG C 1 22  ? 242.924 9.759   118.821 1.00 170.57 ? 22  ARG C CA     1 
ATOM   8586  C C      . ARG C 1 22  ? 244.259 9.975   119.531 1.00 162.31 ? 22  ARG C C      1 
ATOM   8587  O O      . ARG C 1 22  ? 245.296 9.481   119.087 1.00 168.93 ? 22  ARG C O      1 
ATOM   8588  C CB     . ARG C 1 22  ? 242.665 10.903  117.834 1.00 182.23 ? 22  ARG C CB     1 
ATOM   8589  C CG     . ARG C 1 22  ? 243.634 10.933  116.654 1.00 189.32 ? 22  ARG C CG     1 
ATOM   8590  C CD     . ARG C 1 22  ? 243.283 12.022  115.649 1.00 194.10 ? 22  ARG C CD     1 
ATOM   8591  N NE     . ARG C 1 22  ? 243.491 13.364  116.191 1.00 197.35 ? 22  ARG C NE     1 
ATOM   8592  C CZ     . ARG C 1 22  ? 242.557 14.093  116.797 1.00 198.26 ? 22  ARG C CZ     1 
ATOM   8593  N NH1    . ARG C 1 22  ? 241.324 13.626  116.953 1.00 195.96 ? 22  ARG C NH1    1 
ATOM   8594  N NH2    . ARG C 1 22  ? 242.859 15.302  117.251 1.00 200.94 ? 22  ARG C NH2    1 
ATOM   8595  H H      . ARG C 1 22  ? 241.242 10.277  119.712 1.00 196.25 ? 22  ARG C H      1 
ATOM   8596  H HA     . ARG C 1 22  ? 242.986 8.934   118.314 1.00 204.68 ? 22  ARG C HA     1 
ATOM   8597  H HB2    . ARG C 1 22  ? 241.768 10.811  117.478 1.00 218.67 ? 22  ARG C HB2    1 
ATOM   8598  H HB3    . ARG C 1 22  ? 242.747 11.747  118.305 1.00 218.67 ? 22  ARG C HB3    1 
ATOM   8599  H HG2    . ARG C 1 22  ? 244.530 11.103  116.983 1.00 227.18 ? 22  ARG C HG2    1 
ATOM   8600  H HG3    . ARG C 1 22  ? 243.603 10.079  116.196 1.00 227.18 ? 22  ARG C HG3    1 
ATOM   8601  H HD2    . ARG C 1 22  ? 243.846 11.923  114.865 1.00 232.92 ? 22  ARG C HD2    1 
ATOM   8602  H HD3    . ARG C 1 22  ? 242.349 11.938  115.402 1.00 232.92 ? 22  ARG C HD3    1 
ATOM   8603  H HE     . ARG C 1 22  ? 244.275 13.708  116.113 1.00 236.82 ? 22  ARG C HE     1 
ATOM   8604  H HH11   . ARG C 1 22  ? 241.121 12.843  116.661 1.00 235.15 ? 22  ARG C HH11   1 
ATOM   8605  H HH12   . ARG C 1 22  ? 240.729 14.106  117.346 1.00 235.15 ? 22  ARG C HH12   1 
ATOM   8606  H HH21   . ARG C 1 22  ? 243.655 15.612  117.154 1.00 241.13 ? 22  ARG C HH21   1 
ATOM   8607  H HH22   . ARG C 1 22  ? 242.258 15.777  117.643 1.00 241.13 ? 22  ARG C HH22   1 
ATOM   8608  N N      . LYS C 1 23  ? 244.228 10.717  120.632 1.00 145.12 ? 23  LYS C N      1 
ATOM   8609  C CA     . LYS C 1 23  ? 245.424 10.952  121.427 1.00 136.02 ? 23  LYS C CA     1 
ATOM   8610  C C      . LYS C 1 23  ? 245.971 9.634   121.973 1.00 136.20 ? 23  LYS C C      1 
ATOM   8611  O O      . LYS C 1 23  ? 247.184 9.461   122.108 1.00 127.43 ? 23  LYS C O      1 
ATOM   8612  C CB     . LYS C 1 23  ? 245.102 11.904  122.579 1.00 132.69 ? 23  LYS C CB     1 
ATOM   8613  C CG     . LYS C 1 23  ? 246.271 12.189  123.509 1.00 133.97 ? 23  LYS C CG     1 
ATOM   8614  C CD     . LYS C 1 23  ? 245.830 13.011  124.712 1.00 134.92 ? 23  LYS C CD     1 
ATOM   8615  C CE     . LYS C 1 23  ? 246.967 13.205  125.704 1.00 135.91 ? 23  LYS C CE     1 
ATOM   8616  N NZ     . LYS C 1 23  ? 246.521 13.903  126.942 1.00 135.69 ? 23  LYS C NZ     1 
ATOM   8617  H H      . LYS C 1 23  ? 243.521 11.097  120.941 1.00 174.14 ? 23  LYS C H      1 
ATOM   8618  H HA     . LYS C 1 23  ? 246.107 11.361  120.872 1.00 163.22 ? 23  LYS C HA     1 
ATOM   8619  H HB2    . LYS C 1 23  ? 244.807 12.751  122.208 1.00 159.22 ? 23  LYS C HB2    1 
ATOM   8620  H HB3    . LYS C 1 23  ? 244.390 11.516  123.112 1.00 159.22 ? 23  LYS C HB3    1 
ATOM   8621  H HG2    . LYS C 1 23  ? 246.638 11.351  123.830 1.00 160.77 ? 23  LYS C HG2    1 
ATOM   8622  H HG3    . LYS C 1 23  ? 246.948 12.691  123.029 1.00 160.77 ? 23  LYS C HG3    1 
ATOM   8623  H HD2    . LYS C 1 23  ? 245.536 13.885  124.412 1.00 161.90 ? 23  LYS C HD2    1 
ATOM   8624  H HD3    . LYS C 1 23  ? 245.106 12.551  125.166 1.00 161.90 ? 23  LYS C HD3    1 
ATOM   8625  H HE2    . LYS C 1 23  ? 247.320 12.337  125.957 1.00 163.09 ? 23  LYS C HE2    1 
ATOM   8626  H HE3    . LYS C 1 23  ? 247.662 13.740  125.290 1.00 163.09 ? 23  LYS C HE3    1 
ATOM   8627  H HZ1    . LYS C 1 23  ? 247.207 14.000  127.500 1.00 162.83 ? 23  LYS C HZ1    1 
ATOM   8628  H HZ2    . LYS C 1 23  ? 246.197 14.706  126.738 1.00 162.83 ? 23  LYS C HZ2    1 
ATOM   8629  H HZ3    . LYS C 1 23  ? 245.885 13.429  127.346 1.00 162.83 ? 23  LYS C HZ3    1 
ATOM   8630  N N      . GLY C 1 24  ? 245.061 8.710   122.278 1.00 148.14 ? 24  GLY C N      1 
ATOM   8631  C CA     . GLY C 1 24  ? 245.413 7.435   122.877 1.00 151.12 ? 24  GLY C CA     1 
ATOM   8632  C C      . GLY C 1 24  ? 246.106 6.480   121.924 1.00 146.83 ? 24  GLY C C      1 
ATOM   8633  O O      . GLY C 1 24  ? 247.068 5.809   122.298 1.00 146.62 ? 24  GLY C O      1 
ATOM   8634  H H      . GLY C 1 24  ? 244.217 8.806   122.142 1.00 177.76 ? 24  GLY C H      1 
ATOM   8635  H HA2    . GLY C 1 24  ? 246.002 7.590   123.632 1.00 181.35 ? 24  GLY C HA2    1 
ATOM   8636  H HA3    . GLY C 1 24  ? 244.608 7.005   123.204 1.00 181.35 ? 24  GLY C HA3    1 
ATOM   8637  N N      . ARG C 1 25  ? 245.608 6.401   120.695 1.00 140.81 ? 25  ARG C N      1 
ATOM   8638  C CA     . ARG C 1 25  ? 246.171 5.489   119.704 1.00 139.56 ? 25  ARG C CA     1 
ATOM   8639  C C      . ARG C 1 25  ? 247.643 5.801   119.403 1.00 146.00 ? 25  ARG C C      1 
ATOM   8640  O O      . ARG C 1 25  ? 248.432 4.900   119.108 1.00 145.76 ? 25  ARG C O      1 
ATOM   8641  C CB     . ARG C 1 25  ? 245.345 5.528   118.410 1.00 137.23 ? 25  ARG C CB     1 
ATOM   8642  C CG     . ARG C 1 25  ? 245.730 4.452   117.396 1.00 137.81 ? 25  ARG C CG     1 
ATOM   8643  C CD     . ARG C 1 25  ? 244.907 4.529   116.109 1.00 141.69 ? 25  ARG C CD     1 
ATOM   8644  N NE     . ARG C 1 25  ? 245.284 5.678   115.286 1.00 148.03 ? 25  ARG C NE     1 
ATOM   8645  C CZ     . ARG C 1 25  ? 244.697 6.872   115.333 1.00 152.10 ? 25  ARG C CZ     1 
ATOM   8646  N NH1    . ARG C 1 25  ? 243.684 7.098   116.164 1.00 151.50 ? 25  ARG C NH1    1 
ATOM   8647  N NH2    . ARG C 1 25  ? 245.124 7.848   114.542 1.00 155.17 ? 25  ARG C NH2    1 
ATOM   8648  H H      . ARG C 1 25  ? 244.944 6.865   120.408 1.00 168.97 ? 25  ARG C H      1 
ATOM   8649  H HA     . ARG C 1 25  ? 246.128 4.586   120.054 1.00 167.48 ? 25  ARG C HA     1 
ATOM   8650  H HB2    . ARG C 1 25  ? 244.409 5.403   118.634 1.00 164.68 ? 25  ARG C HB2    1 
ATOM   8651  H HB3    . ARG C 1 25  ? 245.468 6.392   117.987 1.00 164.68 ? 25  ARG C HB3    1 
ATOM   8652  H HG2    . ARG C 1 25  ? 246.665 4.560   117.161 1.00 165.37 ? 25  ARG C HG2    1 
ATOM   8653  H HG3    . ARG C 1 25  ? 245.586 3.578   117.792 1.00 165.37 ? 25  ARG C HG3    1 
ATOM   8654  H HD2    . ARG C 1 25  ? 245.053 3.724   115.589 1.00 170.03 ? 25  ARG C HD2    1 
ATOM   8655  H HD3    . ARG C 1 25  ? 243.968 4.616   116.336 1.00 170.03 ? 25  ARG C HD3    1 
ATOM   8656  H HE     . ARG C 1 25  ? 245.933 5.575   114.731 1.00 177.64 ? 25  ARG C HE     1 
ATOM   8657  H HH11   . ARG C 1 25  ? 243.403 6.470   116.680 1.00 181.80 ? 25  ARG C HH11   1 
ATOM   8658  H HH12   . ARG C 1 25  ? 243.311 7.872   116.186 1.00 181.80 ? 25  ARG C HH12   1 
ATOM   8659  H HH21   . ARG C 1 25  ? 245.778 7.709   114.001 1.00 186.20 ? 25  ARG C HH21   1 
ATOM   8660  H HH22   . ARG C 1 25  ? 244.746 8.620   114.569 1.00 186.20 ? 25  ARG C HH22   1 
ATOM   8661  N N      . GLU C 1 26  ? 248.011 7.074   119.524 1.00 152.99 ? 26  GLU C N      1 
ATOM   8662  C CA     . GLU C 1 26  ? 249.321 7.555   119.094 1.00 162.17 ? 26  GLU C CA     1 
ATOM   8663  C C      . GLU C 1 26  ? 250.404 7.252   120.128 1.00 171.60 ? 26  GLU C C      1 
ATOM   8664  O O      . GLU C 1 26  ? 251.588 7.472   119.874 1.00 171.30 ? 26  GLU C O      1 
ATOM   8665  C CB     . GLU C 1 26  ? 249.242 9.062   118.801 1.00 162.97 ? 26  GLU C CB     1 
ATOM   8666  C CG     . GLU C 1 26  ? 248.431 9.404   117.540 1.00 162.94 ? 26  GLU C CG     1 
ATOM   8667  C CD     . GLU C 1 26  ? 248.275 10.897  117.299 1.00 164.31 ? 26  GLU C CD     1 
ATOM   8668  O OE1    . GLU C 1 26  ? 247.672 11.269  116.270 1.00 164.80 ? 26  GLU C OE1    1 
ATOM   8669  O OE2    . GLU C 1 26  ? 248.748 11.696  118.133 1.00 165.10 ? 26  GLU C OE2    1 
ATOM   8670  H H      . GLU C 1 26  ? 247.510 7.689   119.857 1.00 183.59 ? 26  GLU C H      1 
ATOM   8671  H HA     . GLU C 1 26  ? 249.564 7.105   118.270 1.00 194.60 ? 26  GLU C HA     1 
ATOM   8672  H HB2    . GLU C 1 26  ? 248.821 9.506   119.554 1.00 195.56 ? 26  GLU C HB2    1 
ATOM   8673  H HB3    . GLU C 1 26  ? 250.141 9.404   118.678 1.00 195.56 ? 26  GLU C HB3    1 
ATOM   8674  H HG2    . GLU C 1 26  ? 248.878 9.025   116.767 1.00 195.53 ? 26  GLU C HG2    1 
ATOM   8675  H HG3    . GLU C 1 26  ? 247.543 9.023   117.626 1.00 195.53 ? 26  GLU C HG3    1 
ATOM   8676  N N      . ALA C 1 27  ? 250.001 6.724   121.281 1.00 181.06 ? 27  ALA C N      1 
ATOM   8677  C CA     . ALA C 1 27  ? 250.949 6.431   122.351 1.00 187.08 ? 27  ALA C CA     1 
ATOM   8678  C C      . ALA C 1 27  ? 251.565 5.042   122.180 1.00 185.58 ? 27  ALA C C      1 
ATOM   8679  O O      . ALA C 1 27  ? 252.785 4.876   122.261 1.00 186.35 ? 27  ALA C O      1 
ATOM   8680  C CB     . ALA C 1 27  ? 250.277 6.532   123.712 1.00 188.85 ? 27  ALA C CB     1 
ATOM   8681  H H      . ALA C 1 27  ? 249.185 6.528   121.469 1.00 217.27 ? 27  ALA C H      1 
ATOM   8682  H HA     . ALA C 1 27  ? 251.668 7.082   122.323 1.00 224.49 ? 27  ALA C HA     1 
ATOM   8683  H HB1    . ALA C 1 27  ? 250.929 6.332   124.402 1.00 226.61 ? 27  ALA C HB1    1 
ATOM   8684  H HB2    . ALA C 1 27  ? 249.936 7.432   123.829 1.00 226.61 ? 27  ALA C HB2    1 
ATOM   8685  H HB3    . ALA C 1 27  ? 249.547 5.894   123.751 1.00 226.61 ? 27  ALA C HB3    1 
ATOM   8686  N N      . GLU C 1 28  ? 250.709 4.049   121.945 1.00 181.00 ? 28  GLU C N      1 
ATOM   8687  C CA     . GLU C 1 28  ? 251.123 2.641   121.897 1.00 173.07 ? 28  GLU C CA     1 
ATOM   8688  C C      . GLU C 1 28  ? 252.155 2.361   120.809 1.00 168.24 ? 28  GLU C C      1 
ATOM   8689  O O      . GLU C 1 28  ? 252.986 1.463   120.947 1.00 171.12 ? 28  GLU C O      1 
ATOM   8690  C CB     . GLU C 1 28  ? 249.903 1.727   121.688 1.00 167.64 ? 28  GLU C CB     1 
ATOM   8691  C CG     . GLU C 1 28  ? 250.226 0.230   121.594 1.00 161.06 ? 28  GLU C CG     1 
ATOM   8692  C CD     . GLU C 1 28  ? 248.980 -0.633  121.550 1.00 154.58 ? 28  GLU C CD     1 
ATOM   8693  O OE1    . GLU C 1 28  ? 247.874 -0.074  121.402 1.00 150.55 ? 28  GLU C OE1    1 
ATOM   8694  O OE2    . GLU C 1 28  ? 249.108 -1.869  121.663 1.00 153.95 ? 28  GLU C OE2    1 
ATOM   8695  H H      . GLU C 1 28  ? 249.868 4.165   121.807 1.00 217.20 ? 28  GLU C H      1 
ATOM   8696  H HA     . GLU C 1 28  ? 251.524 2.408   122.749 1.00 207.68 ? 28  GLU C HA     1 
ATOM   8697  H HB2    . GLU C 1 28  ? 249.295 1.848   122.434 1.00 201.17 ? 28  GLU C HB2    1 
ATOM   8698  H HB3    . GLU C 1 28  ? 249.462 1.984   120.863 1.00 201.17 ? 28  GLU C HB3    1 
ATOM   8699  H HG2    . GLU C 1 28  ? 250.734 0.066   120.784 1.00 193.27 ? 28  GLU C HG2    1 
ATOM   8700  H HG3    . GLU C 1 28  ? 250.745 -0.032  122.370 1.00 193.27 ? 28  GLU C HG3    1 
ATOM   8701  N N      . GLU C 1 29  ? 252.095 3.126   119.727 1.00 159.55 ? 29  GLU C N      1 
ATOM   8702  C CA     . GLU C 1 29  ? 252.989 2.915   118.599 1.00 153.34 ? 29  GLU C CA     1 
ATOM   8703  C C      . GLU C 1 29  ? 254.425 3.267   118.973 1.00 152.62 ? 29  GLU C C      1 
ATOM   8704  O O      . GLU C 1 29  ? 255.366 2.599   118.546 1.00 151.85 ? 29  GLU C O      1 
ATOM   8705  C CB     . GLU C 1 29  ? 252.529 3.750   117.405 1.00 150.96 ? 29  GLU C CB     1 
ATOM   8706  C CG     . GLU C 1 29  ? 251.086 3.481   116.995 1.00 149.92 ? 29  GLU C CG     1 
ATOM   8707  C CD     . GLU C 1 29  ? 250.605 4.402   115.893 1.00 153.95 ? 29  GLU C CD     1 
ATOM   8708  O OE1    . GLU C 1 29  ? 251.443 5.127   115.312 1.00 159.42 ? 29  GLU C OE1    1 
ATOM   8709  O OE2    . GLU C 1 29  ? 249.387 4.403   115.610 1.00 151.73 ? 29  GLU C OE2    1 
ATOM   8710  H H      . GLU C 1 29  ? 251.542 3.777   119.621 1.00 191.46 ? 29  GLU C H      1 
ATOM   8711  H HA     . GLU C 1 29  ? 252.963 1.980   118.342 1.00 184.01 ? 29  GLU C HA     1 
ATOM   8712  H HB2    . GLU C 1 29  ? 252.603 4.690   117.633 1.00 181.15 ? 29  GLU C HB2    1 
ATOM   8713  H HB3    . GLU C 1 29  ? 253.096 3.550   116.645 1.00 181.15 ? 29  GLU C HB3    1 
ATOM   8714  H HG2    . GLU C 1 29  ? 251.014 2.568   116.676 1.00 179.90 ? 29  GLU C HG2    1 
ATOM   8715  H HG3    . GLU C 1 29  ? 250.509 3.609   117.765 1.00 179.90 ? 29  GLU C HG3    1 
ATOM   8716  N N      . GLU C 1 30  ? 254.583 4.309   119.785 1.00 152.22 ? 30  GLU C N      1 
ATOM   8717  C CA     . GLU C 1 30  ? 255.901 4.751   120.230 1.00 155.51 ? 30  GLU C CA     1 
ATOM   8718  C C      . GLU C 1 30  ? 256.612 3.673   121.035 1.00 158.61 ? 30  GLU C C      1 
ATOM   8719  O O      . GLU C 1 30  ? 257.808 3.442   120.860 1.00 155.01 ? 30  GLU C O      1 
ATOM   8720  C CB     . GLU C 1 30  ? 255.772 6.006   121.092 1.00 158.11 ? 30  GLU C CB     1 
ATOM   8721  C CG     . GLU C 1 30  ? 255.357 7.253   120.332 1.00 161.07 ? 30  GLU C CG     1 
ATOM   8722  C CD     . GLU C 1 30  ? 256.481 7.845   119.496 1.00 163.96 ? 30  GLU C CD     1 
ATOM   8723  O OE1    . GLU C 1 30  ? 257.666 7.638   119.836 1.00 163.29 ? 30  GLU C OE1    1 
ATOM   8724  O OE2    . GLU C 1 30  ? 256.173 8.525   118.495 1.00 166.48 ? 30  GLU C OE2    1 
ATOM   8725  H H      . GLU C 1 30  ? 253.935 4.782   120.095 1.00 182.67 ? 30  GLU C H      1 
ATOM   8726  H HA     . GLU C 1 30  ? 256.446 4.965   119.457 1.00 186.61 ? 30  GLU C HA     1 
ATOM   8727  H HB2    . GLU C 1 30  ? 255.104 5.845   121.778 1.00 189.74 ? 30  GLU C HB2    1 
ATOM   8728  H HB3    . GLU C 1 30  ? 256.629 6.187   121.508 1.00 189.74 ? 30  GLU C HB3    1 
ATOM   8729  H HG2    . GLU C 1 30  ? 254.627 7.029   119.734 1.00 193.29 ? 30  GLU C HG2    1 
ATOM   8730  H HG3    . GLU C 1 30  ? 255.070 7.928   120.966 1.00 193.29 ? 30  GLU C HG3    1 
ATOM   8731  N N      . LEU C 1 31  ? 255.868 3.016   121.919 1.00 167.18 ? 31  LEU C N      1 
ATOM   8732  C CA     . LEU C 1 31  ? 256.452 2.060   122.851 1.00 171.38 ? 31  LEU C CA     1 
ATOM   8733  C C      . LEU C 1 31  ? 256.922 0.778   122.165 1.00 172.31 ? 31  LEU C C      1 
ATOM   8734  O O      . LEU C 1 31  ? 257.978 0.243   122.500 1.00 177.99 ? 31  LEU C O      1 
ATOM   8735  C CB     . LEU C 1 31  ? 255.451 1.727   123.957 1.00 170.21 ? 31  LEU C CB     1 
ATOM   8736  C CG     . LEU C 1 31  ? 255.903 0.707   125.005 1.00 169.41 ? 31  LEU C CG     1 
ATOM   8737  C CD1    . LEU C 1 31  ? 257.239 1.080   125.625 1.00 170.95 ? 31  LEU C CD1    1 
ATOM   8738  C CD2    . LEU C 1 31  ? 254.849 0.580   126.084 1.00 167.83 ? 31  LEU C CD2    1 
ATOM   8739  H H      . LEU C 1 31  ? 255.016 3.107   121.999 1.00 200.62 ? 31  LEU C H      1 
ATOM   8740  H HA     . LEU C 1 31  ? 257.226 2.469   123.269 1.00 205.66 ? 31  LEU C HA     1 
ATOM   8741  H HB2    . LEU C 1 31  ? 255.237 2.547   124.429 1.00 204.25 ? 31  LEU C HB2    1 
ATOM   8742  H HB3    . LEU C 1 31  ? 254.647 1.377   123.543 1.00 204.25 ? 31  LEU C HB3    1 
ATOM   8743  H HG     . LEU C 1 31  ? 256.002 -0.159  124.580 1.00 203.30 ? 31  LEU C HG     1 
ATOM   8744  H HD11   . LEU C 1 31  ? 257.482 0.407   126.280 1.00 205.15 ? 31  LEU C HD11   1 
ATOM   8745  H HD12   . LEU C 1 31  ? 257.910 1.121   124.926 1.00 205.15 ? 31  LEU C HD12   1 
ATOM   8746  H HD13   . LEU C 1 31  ? 257.156 1.946   126.055 1.00 205.15 ? 31  LEU C HD13   1 
ATOM   8747  H HD21   . LEU C 1 31  ? 255.147 -0.069  126.740 1.00 201.40 ? 31  LEU C HD21   1 
ATOM   8748  H HD22   . LEU C 1 31  ? 254.724 1.444   126.505 1.00 201.40 ? 31  LEU C HD22   1 
ATOM   8749  H HD23   . LEU C 1 31  ? 254.018 0.284   125.680 1.00 201.40 ? 31  LEU C HD23   1 
ATOM   8750  N N      . ARG C 1 32  ? 256.141 0.287   121.208 1.00 166.02 ? 32  ARG C N      1 
ATOM   8751  C CA     . ARG C 1 32  ? 256.504 -0.930  120.486 1.00 161.89 ? 32  ARG C CA     1 
ATOM   8752  C C      . ARG C 1 32  ? 257.678 -0.697  119.540 1.00 166.10 ? 32  ARG C C      1 
ATOM   8753  O O      . ARG C 1 32  ? 258.405 -1.631  119.201 1.00 165.87 ? 32  ARG C O      1 
ATOM   8754  C CB     . ARG C 1 32  ? 255.303 -1.473  119.715 1.00 156.21 ? 32  ARG C CB     1 
ATOM   8755  C CG     . ARG C 1 32  ? 254.194 -1.982  120.614 1.00 149.98 ? 32  ARG C CG     1 
ATOM   8756  C CD     . ARG C 1 32  ? 253.096 -2.661  119.819 1.00 144.74 ? 32  ARG C CD     1 
ATOM   8757  N NE     . ARG C 1 32  ? 252.100 -3.273  120.693 1.00 139.23 ? 32  ARG C NE     1 
ATOM   8758  C CZ     . ARG C 1 32  ? 251.051 -3.966  120.266 1.00 135.74 ? 32  ARG C CZ     1 
ATOM   8759  N NH1    . ARG C 1 32  ? 250.849 -4.141  118.967 1.00 135.56 ? 32  ARG C NH1    1 
ATOM   8760  N NH2    . ARG C 1 32  ? 250.201 -4.485  121.142 1.00 133.02 ? 32  ARG C NH2    1 
ATOM   8761  H H      . ARG C 1 32  ? 255.397 0.638   120.957 1.00 199.23 ? 32  ARG C H      1 
ATOM   8762  H HA     . ARG C 1 32  ? 256.772 -1.605  121.129 1.00 194.26 ? 32  ARG C HA     1 
ATOM   8763  H HB2    . ARG C 1 32  ? 254.938 -0.764  119.163 1.00 187.46 ? 32  ARG C HB2    1 
ATOM   8764  H HB3    . ARG C 1 32  ? 255.596 -2.209  119.156 1.00 187.46 ? 32  ARG C HB3    1 
ATOM   8765  H HG2    . ARG C 1 32  ? 254.560 -2.627  121.239 1.00 179.98 ? 32  ARG C HG2    1 
ATOM   8766  H HG3    . ARG C 1 32  ? 253.803 -1.235  121.094 1.00 179.98 ? 32  ARG C HG3    1 
ATOM   8767  H HD2    . ARG C 1 32  ? 252.649 -2.003  119.264 1.00 173.69 ? 32  ARG C HD2    1 
ATOM   8768  H HD3    . ARG C 1 32  ? 253.484 -3.358  119.267 1.00 173.69 ? 32  ARG C HD3    1 
ATOM   8769  H HE     . ARG C 1 32  ? 252.200 -3.179  121.542 1.00 167.08 ? 32  ARG C HE     1 
ATOM   8770  H HH11   . ARG C 1 32  ? 251.399 -3.806  118.397 1.00 162.68 ? 32  ARG C HH11   1 
ATOM   8771  H HH12   . ARG C 1 32  ? 250.168 -4.591  118.694 1.00 162.68 ? 32  ARG C HH12   1 
ATOM   8772  H HH21   . ARG C 1 32  ? 250.329 -4.372  121.985 1.00 159.62 ? 32  ARG C HH21   1 
ATOM   8773  H HH22   . ARG C 1 32  ? 249.520 -4.933  120.867 1.00 159.62 ? 32  ARG C HH22   1 
ATOM   8774  N N      . ARG C 1 33  ? 257.861 0.549   119.116 1.00 170.35 ? 33  ARG C N      1 
ATOM   8775  C CA     . ARG C 1 33  ? 259.019 0.919   118.311 1.00 174.60 ? 33  ARG C CA     1 
ATOM   8776  C C      . ARG C 1 33  ? 260.277 0.980   119.175 1.00 173.59 ? 33  ARG C C      1 
ATOM   8777  O O      . ARG C 1 33  ? 261.388 1.089   118.656 1.00 177.56 ? 33  ARG C O      1 
ATOM   8778  C CB     . ARG C 1 33  ? 258.787 2.268   117.626 1.00 179.99 ? 33  ARG C CB     1 
ATOM   8779  C CG     . ARG C 1 33  ? 257.979 2.178   116.337 1.00 182.54 ? 33  ARG C CG     1 
ATOM   8780  C CD     . ARG C 1 33  ? 257.670 3.556   115.762 1.00 186.43 ? 33  ARG C CD     1 
ATOM   8781  N NE     . ARG C 1 33  ? 256.624 4.245   116.513 1.00 187.38 ? 33  ARG C NE     1 
ATOM   8782  C CZ     . ARG C 1 33  ? 256.149 5.449   116.211 1.00 189.37 ? 33  ARG C CZ     1 
ATOM   8783  N NH1    . ARG C 1 33  ? 256.624 6.115   115.166 1.00 193.37 ? 33  ARG C NH1    1 
ATOM   8784  N NH2    . ARG C 1 33  ? 255.195 5.991   116.956 1.00 186.97 ? 33  ARG C NH2    1 
ATOM   8785  H H      . ARG C 1 33  ? 257.326 1.202   119.281 1.00 204.41 ? 33  ARG C H      1 
ATOM   8786  H HA     . ARG C 1 33  ? 259.157 0.249   117.623 1.00 209.52 ? 33  ARG C HA     1 
ATOM   8787  H HB2    . ARG C 1 33  ? 258.307 2.849   118.236 1.00 215.99 ? 33  ARG C HB2    1 
ATOM   8788  H HB3    . ARG C 1 33  ? 259.647 2.659   117.408 1.00 215.99 ? 33  ARG C HB3    1 
ATOM   8789  H HG2    . ARG C 1 33  ? 258.486 1.681   115.677 1.00 219.04 ? 33  ARG C HG2    1 
ATOM   8790  H HG3    . ARG C 1 33  ? 257.137 1.731   116.519 1.00 219.04 ? 33  ARG C HG3    1 
ATOM   8791  H HD2    . ARG C 1 33  ? 258.473 4.100   115.794 1.00 223.72 ? 33  ARG C HD2    1 
ATOM   8792  H HD3    . ARG C 1 33  ? 257.369 3.458   114.845 1.00 223.72 ? 33  ARG C HD3    1 
ATOM   8793  H HE     . ARG C 1 33  ? 256.292 3.844   117.198 1.00 224.85 ? 33  ARG C HE     1 
ATOM   8794  H HH11   . ARG C 1 33  ? 257.242 5.768   114.680 1.00 232.05 ? 33  ARG C HH11   1 
ATOM   8795  H HH12   . ARG C 1 33  ? 256.313 6.894   114.975 1.00 232.05 ? 33  ARG C HH12   1 
ATOM   8796  H HH21   . ARG C 1 33  ? 254.884 5.564   117.634 1.00 224.37 ? 33  ARG C HH21   1 
ATOM   8797  H HH22   . ARG C 1 33  ? 254.887 6.771   116.761 1.00 224.37 ? 33  ARG C HH22   1 
ATOM   8798  N N      . ARG C 1 34  ? 260.089 0.903   120.492 1.00 167.86 ? 34  ARG C N      1 
ATOM   8799  C CA     . ARG C 1 34  ? 261.188 0.993   121.453 1.00 166.70 ? 34  ARG C CA     1 
ATOM   8800  C C      . ARG C 1 34  ? 261.422 -0.330  122.182 1.00 170.82 ? 34  ARG C C      1 
ATOM   8801  O O      . ARG C 1 34  ? 262.528 -0.596  122.656 1.00 165.14 ? 34  ARG C O      1 
ATOM   8802  C CB     . ARG C 1 34  ? 260.901 2.090   122.480 1.00 163.29 ? 34  ARG C CB     1 
ATOM   8803  C CG     . ARG C 1 34  ? 260.847 3.495   121.903 1.00 164.10 ? 34  ARG C CG     1 
ATOM   8804  C CD     . ARG C 1 34  ? 260.260 4.470   122.908 1.00 163.76 ? 34  ARG C CD     1 
ATOM   8805  N NE     . ARG C 1 34  ? 260.286 5.850   122.434 1.00 165.70 ? 34  ARG C NE     1 
ATOM   8806  C CZ     . ARG C 1 34  ? 259.892 6.895   123.156 1.00 166.11 ? 34  ARG C CZ     1 
ATOM   8807  N NH1    . ARG C 1 34  ? 259.437 6.725   124.390 1.00 161.40 ? 34  ARG C NH1    1 
ATOM   8808  N NH2    . ARG C 1 34  ? 259.954 8.115   122.643 1.00 171.22 ? 34  ARG C NH2    1 
ATOM   8809  H H      . ARG C 1 34  ? 259.319 0.796   120.860 1.00 201.43 ? 34  ARG C H      1 
ATOM   8810  H HA     . ARG C 1 34  ? 262.003 1.226   120.982 1.00 200.04 ? 34  ARG C HA     1 
ATOM   8811  H HB2    . ARG C 1 34  ? 260.044 1.909   122.896 1.00 195.95 ? 34  ARG C HB2    1 
ATOM   8812  H HB3    . ARG C 1 34  ? 261.600 2.075   123.153 1.00 195.95 ? 34  ARG C HB3    1 
ATOM   8813  H HG2    . ARG C 1 34  ? 261.745 3.787   121.681 1.00 196.92 ? 34  ARG C HG2    1 
ATOM   8814  H HG3    . ARG C 1 34  ? 260.285 3.496   121.112 1.00 196.92 ? 34  ARG C HG3    1 
ATOM   8815  H HD2    . ARG C 1 34  ? 259.337 4.229   123.081 1.00 196.51 ? 34  ARG C HD2    1 
ATOM   8816  H HD3    . ARG C 1 34  ? 260.775 4.426   123.729 1.00 196.51 ? 34  ARG C HD3    1 
ATOM   8817  H HE     . ARG C 1 34  ? 260.595 5.999   121.646 1.00 198.84 ? 34  ARG C HE     1 
ATOM   8818  H HH11   . ARG C 1 34  ? 259.396 5.935   124.728 1.00 193.68 ? 34  ARG C HH11   1 
ATOM   8819  H HH12   . ARG C 1 34  ? 259.184 7.404   124.852 1.00 193.68 ? 34  ARG C HH12   1 
ATOM   8820  H HH21   . ARG C 1 34  ? 260.248 8.231   121.843 1.00 205.46 ? 34  ARG C HH21   1 
ATOM   8821  H HH22   . ARG C 1 34  ? 259.698 8.791   123.109 1.00 205.46 ? 34  ARG C HH22   1 
ATOM   8822  N N      . LEU C 1 35  ? 260.378 -1.150  122.280 1.00 182.90 ? 35  LEU C N      1 
ATOM   8823  C CA     . LEU C 1 35  ? 260.476 -2.440  122.960 1.00 186.89 ? 35  LEU C CA     1 
ATOM   8824  C C      . LEU C 1 35  ? 260.994 -3.536  122.034 1.00 180.45 ? 35  LEU C C      1 
ATOM   8825  O O      . LEU C 1 35  ? 261.762 -4.401  122.455 1.00 185.91 ? 35  LEU C O      1 
ATOM   8826  C CB     . LEU C 1 35  ? 259.117 -2.851  123.532 1.00 188.53 ? 35  LEU C CB     1 
ATOM   8827  C CG     . LEU C 1 35  ? 258.644 -2.114  124.787 1.00 187.56 ? 35  LEU C CG     1 
ATOM   8828  C CD1    . LEU C 1 35  ? 257.237 -2.553  125.146 1.00 183.27 ? 35  LEU C CD1    1 
ATOM   8829  C CD2    . LEU C 1 35  ? 259.584 -2.354  125.961 1.00 188.50 ? 35  LEU C CD2    1 
ATOM   8830  H H      . LEU C 1 35  ? 259.598 -0.982  121.960 1.00 219.48 ? 35  LEU C H      1 
ATOM   8831  H HA     . LEU C 1 35  ? 261.098 -2.358  123.700 1.00 224.27 ? 35  LEU C HA     1 
ATOM   8832  H HB2    . LEU C 1 35  ? 258.446 -2.710  122.847 1.00 226.24 ? 35  LEU C HB2    1 
ATOM   8833  H HB3    . LEU C 1 35  ? 259.155 -3.795  123.753 1.00 226.24 ? 35  LEU C HB3    1 
ATOM   8834  H HG     . LEU C 1 35  ? 258.625 -1.161  124.607 1.00 225.07 ? 35  LEU C HG     1 
ATOM   8835  H HD11   . LEU C 1 35  ? 256.952 -2.077  125.942 1.00 219.93 ? 35  LEU C HD11   1 
ATOM   8836  H HD12   . LEU C 1 35  ? 256.644 -2.346  124.406 1.00 219.93 ? 35  LEU C HD12   1 
ATOM   8837  H HD13   . LEU C 1 35  ? 257.237 -3.508  125.313 1.00 219.93 ? 35  LEU C HD13   1 
ATOM   8838  H HD21   . LEU C 1 35  ? 259.252 -1.873  126.735 1.00 226.20 ? 35  LEU C HD21   1 
ATOM   8839  H HD22   . LEU C 1 35  ? 259.615 -3.305  126.151 1.00 226.20 ? 35  LEU C HD22   1 
ATOM   8840  H HD23   . LEU C 1 35  ? 260.469 -2.035  125.727 1.00 226.20 ? 35  LEU C HD23   1 
ATOM   8841  N N      . ASP C 1 36  ? 260.568 -3.503  120.777 1.00 165.02 ? 36  ASP C N      1 
ATOM   8842  C CA     . ASP C 1 36  ? 261.041 -4.465  119.789 1.00 154.55 ? 36  ASP C CA     1 
ATOM   8843  C C      . ASP C 1 36  ? 262.430 -4.088  119.269 1.00 153.83 ? 36  ASP C C      1 
ATOM   8844  O O      . ASP C 1 36  ? 263.001 -4.789  118.434 1.00 152.33 ? 36  ASP C O      1 
ATOM   8845  C CB     . ASP C 1 36  ? 260.046 -4.569  118.633 1.00 150.20 ? 36  ASP C CB     1 
ATOM   8846  C CG     . ASP C 1 36  ? 258.714 -5.155  119.062 1.00 144.37 ? 36  ASP C CG     1 
ATOM   8847  O OD1    . ASP C 1 36  ? 257.813 -4.376  119.438 1.00 142.21 ? 36  ASP C OD1    1 
ATOM   8848  O OD2    . ASP C 1 36  ? 258.567 -6.395  119.026 1.00 142.06 ? 36  ASP C OD2    1 
ATOM   8849  H H      . ASP C 1 36  ? 260.004 -2.931  120.469 1.00 198.02 ? 36  ASP C H      1 
ATOM   8850  H HA     . ASP C 1 36  ? 261.105 -5.338  120.207 1.00 185.46 ? 36  ASP C HA     1 
ATOM   8851  H HB2    . ASP C 1 36  ? 259.883 -3.682  118.275 1.00 180.24 ? 36  ASP C HB2    1 
ATOM   8852  H HB3    . ASP C 1 36  ? 260.419 -5.142  117.944 1.00 180.24 ? 36  ASP C HB3    1 
ATOM   8853  N N      . GLU C 1 37  ? 262.966 -2.976  119.767 1.00 156.16 ? 37  GLU C N      1 
ATOM   8854  C CA     . GLU C 1 37  ? 264.328 -2.560  119.444 1.00 160.94 ? 37  GLU C CA     1 
ATOM   8855  C C      . GLU C 1 37  ? 265.329 -3.193  120.413 1.00 163.09 ? 37  GLU C C      1 
ATOM   8856  O O      . GLU C 1 37  ? 266.509 -3.343  120.091 1.00 164.64 ? 37  GLU C O      1 
ATOM   8857  C CB     . GLU C 1 37  ? 264.441 -1.034  119.492 1.00 164.25 ? 37  GLU C CB     1 
ATOM   8858  C CG     . GLU C 1 37  ? 265.794 -0.494  119.045 1.00 167.88 ? 37  GLU C CG     1 
ATOM   8859  C CD     . GLU C 1 37  ? 265.830 1.023   118.983 1.00 171.25 ? 37  GLU C CD     1 
ATOM   8860  O OE1    . GLU C 1 37  ? 264.797 1.659   119.279 1.00 171.40 ? 37  GLU C OE1    1 
ATOM   8861  O OE2    . GLU C 1 37  ? 266.894 1.580   118.638 1.00 173.70 ? 37  GLU C OE2    1 
ATOM   8862  H H      . GLU C 1 37  ? 262.556 -2.440  120.300 1.00 187.40 ? 37  GLU C H      1 
ATOM   8863  H HA     . GLU C 1 37  ? 264.547 -2.853  118.546 1.00 193.12 ? 37  GLU C HA     1 
ATOM   8864  H HB2    . GLU C 1 37  ? 263.764 -0.653  118.910 1.00 197.10 ? 37  GLU C HB2    1 
ATOM   8865  H HB3    . GLU C 1 37  ? 264.292 -0.739  120.404 1.00 197.10 ? 37  GLU C HB3    1 
ATOM   8866  H HG2    . GLU C 1 37  ? 266.473 -0.784  119.673 1.00 201.46 ? 37  GLU C HG2    1 
ATOM   8867  H HG3    . GLU C 1 37  ? 265.993 -0.835  118.159 1.00 201.46 ? 37  GLU C HG3    1 
ATOM   8868  N N      . LEU C 1 38  ? 264.846 -3.560  121.599 1.00 163.26 ? 38  LEU C N      1 
ATOM   8869  C CA     . LEU C 1 38  ? 265.666 -4.224  122.612 1.00 161.08 ? 38  LEU C CA     1 
ATOM   8870  C C      . LEU C 1 38  ? 265.385 -5.728  122.659 1.00 155.28 ? 38  LEU C C      1 
ATOM   8871  O O      . LEU C 1 38  ? 266.077 -6.474  123.351 1.00 152.60 ? 38  LEU C O      1 
ATOM   8872  C CB     . LEU C 1 38  ? 265.410 -3.606  123.990 1.00 161.07 ? 38  LEU C CB     1 
ATOM   8873  C CG     . LEU C 1 38  ? 265.737 -2.117  124.129 1.00 163.81 ? 38  LEU C CG     1 
ATOM   8874  C CD1    . LEU C 1 38  ? 265.329 -1.608  125.501 1.00 161.35 ? 38  LEU C CD1    1 
ATOM   8875  C CD2    . LEU C 1 38  ? 267.216 -1.859  123.886 1.00 168.18 ? 38  LEU C CD2    1 
ATOM   8876  H H      . LEU C 1 38  ? 264.032 -3.432  121.845 1.00 195.92 ? 38  LEU C H      1 
ATOM   8877  H HA     . LEU C 1 38  ? 266.603 -4.099  122.395 1.00 193.29 ? 38  LEU C HA     1 
ATOM   8878  H HB2    . LEU C 1 38  ? 264.471 -3.717  124.204 1.00 193.29 ? 38  LEU C HB2    1 
ATOM   8879  H HB3    . LEU C 1 38  ? 265.948 -4.082  124.642 1.00 193.29 ? 38  LEU C HB3    1 
ATOM   8880  H HG     . LEU C 1 38  ? 265.234 -1.621  123.465 1.00 196.57 ? 38  LEU C HG     1 
ATOM   8881  H HD11   . LEU C 1 38  ? 265.545 -0.664  125.565 1.00 193.62 ? 38  LEU C HD11   1 
ATOM   8882  H HD12   . LEU C 1 38  ? 264.374 -1.736  125.614 1.00 193.62 ? 38  LEU C HD12   1 
ATOM   8883  H HD13   . LEU C 1 38  ? 265.812 -2.105  126.179 1.00 193.62 ? 38  LEU C HD13   1 
ATOM   8884  H HD21   . LEU C 1 38  ? 267.391 -0.910  123.981 1.00 201.82 ? 38  LEU C HD21   1 
ATOM   8885  H HD22   . LEU C 1 38  ? 267.735 -2.358  124.536 1.00 201.82 ? 38  LEU C HD22   1 
ATOM   8886  H HD23   . LEU C 1 38  ? 267.443 -2.150  122.988 1.00 201.82 ? 38  LEU C HD23   1 
ATOM   8887  N N      . GLY C 1 39  ? 264.366 -6.165  121.925 1.00 153.20 ? 39  GLY C N      1 
ATOM   8888  C CA     . GLY C 1 39  ? 264.031 -7.575  121.846 1.00 153.37 ? 39  GLY C CA     1 
ATOM   8889  C C      . GLY C 1 39  ? 263.663 -8.170  123.194 1.00 156.53 ? 39  GLY C C      1 
ATOM   8890  O O      . GLY C 1 39  ? 264.351 -9.065  123.688 1.00 154.23 ? 39  GLY C O      1 
ATOM   8891  H H      . GLY C 1 39  ? 263.851 -5.657  121.459 1.00 183.84 ? 39  GLY C H      1 
ATOM   8892  H HA2    . GLY C 1 39  ? 263.279 -7.693  121.245 1.00 184.05 ? 39  GLY C HA2    1 
ATOM   8893  H HA3    . GLY C 1 39  ? 264.788 -8.066  121.491 1.00 184.05 ? 39  GLY C HA3    1 
ATOM   8894  N N      . VAL C 1 40  ? 262.580 -7.667  123.785 1.00 162.71 ? 40  VAL C N      1 
ATOM   8895  C CA     . VAL C 1 40  ? 262.091 -8.150  125.076 1.00 161.84 ? 40  VAL C CA     1 
ATOM   8896  C C      . VAL C 1 40  ? 260.626 -8.565  124.966 1.00 156.69 ? 40  VAL C C      1 
ATOM   8897  O O      . VAL C 1 40  ? 259.841 -7.917  124.273 1.00 155.85 ? 40  VAL C O      1 
ATOM   8898  C CB     . VAL C 1 40  ? 262.246 -7.072  126.181 1.00 158.64 ? 40  VAL C CB     1 
ATOM   8899  C CG1    . VAL C 1 40  ? 261.450 -5.814  125.838 1.00 159.20 ? 40  VAL C CG1    1 
ATOM   8900  C CG2    . VAL C 1 40  ? 261.830 -7.625  127.542 1.00 157.30 ? 40  VAL C CG2    1 
ATOM   8901  H H      . VAL C 1 40  ? 262.103 -7.034  123.452 1.00 195.25 ? 40  VAL C H      1 
ATOM   8902  H HA     . VAL C 1 40  ? 262.606 -8.929  125.339 1.00 194.20 ? 40  VAL C HA     1 
ATOM   8903  H HB     . VAL C 1 40  ? 263.181 -6.821  126.240 1.00 190.37 ? 40  VAL C HB     1 
ATOM   8904  H HG11   . VAL C 1 40  ? 261.569 -5.163  126.547 1.00 191.04 ? 40  VAL C HG11   1 
ATOM   8905  H HG12   . VAL C 1 40  ? 261.777 -5.454  124.999 1.00 191.04 ? 40  VAL C HG12   1 
ATOM   8906  H HG13   . VAL C 1 40  ? 260.513 -6.048  125.755 1.00 191.04 ? 40  VAL C HG13   1 
ATOM   8907  H HG21   . VAL C 1 40  ? 261.938 -6.930  128.210 1.00 188.76 ? 40  VAL C HG21   1 
ATOM   8908  H HG22   . VAL C 1 40  ? 260.902 -7.902  127.499 1.00 188.76 ? 40  VAL C HG22   1 
ATOM   8909  H HG23   . VAL C 1 40  ? 262.393 -8.384  127.760 1.00 188.76 ? 40  VAL C HG23   1 
ATOM   8910  N N      . GLU C 1 41  ? 260.264 -9.649  125.646 1.00 152.37 ? 41  GLU C N      1 
ATOM   8911  C CA     . GLU C 1 41  ? 258.879 -10.108 125.673 1.00 149.16 ? 41  GLU C CA     1 
ATOM   8912  C C      . GLU C 1 41  ? 258.026 -9.157  126.503 1.00 152.89 ? 41  GLU C C      1 
ATOM   8913  O O      . GLU C 1 41  ? 258.452 -8.696  127.560 1.00 152.35 ? 41  GLU C O      1 
ATOM   8914  C CB     . GLU C 1 41  ? 258.788 -11.525 126.243 1.00 143.76 ? 41  GLU C CB     1 
ATOM   8915  C CG     . GLU C 1 41  ? 259.468 -12.578 125.378 1.00 142.04 ? 41  GLU C CG     1 
ATOM   8916  C CD     . GLU C 1 41  ? 259.138 -14.002 125.797 1.00 138.84 ? 41  GLU C CD     1 
ATOM   8917  O OE1    . GLU C 1 41  ? 259.635 -14.940 125.135 1.00 138.35 ? 41  GLU C OE1    1 
ATOM   8918  O OE2    . GLU C 1 41  ? 258.382 -14.185 126.778 1.00 136.32 ? 41  GLU C OE2    1 
ATOM   8919  H H      . GLU C 1 41  ? 260.804 -10.139 126.102 1.00 182.84 ? 41  GLU C H      1 
ATOM   8920  H HA     . GLU C 1 41  ? 258.528 -10.121 124.768 1.00 178.99 ? 41  GLU C HA     1 
ATOM   8921  H HB2    . GLU C 1 41  ? 259.211 -11.539 127.116 1.00 172.51 ? 41  GLU C HB2    1 
ATOM   8922  H HB3    . GLU C 1 41  ? 257.852 -11.769 126.327 1.00 172.51 ? 41  GLU C HB3    1 
ATOM   8923  H HG2    . GLU C 1 41  ? 259.181 -12.463 124.458 1.00 170.44 ? 41  GLU C HG2    1 
ATOM   8924  H HG3    . GLU C 1 41  ? 260.429 -12.463 125.441 1.00 170.44 ? 41  GLU C HG3    1 
ATOM   8925  N N      . TYR C 1 42  ? 256.821 -8.867  126.021 1.00 158.27 ? 42  TYR C N      1 
ATOM   8926  C CA     . TYR C 1 42  ? 255.938 -7.918  126.692 1.00 163.60 ? 42  TYR C CA     1 
ATOM   8927  C C      . TYR C 1 42  ? 254.463 -8.256  126.466 1.00 160.42 ? 42  TYR C C      1 
ATOM   8928  O O      . TYR C 1 42  ? 254.132 -9.230  125.789 1.00 161.67 ? 42  TYR C O      1 
ATOM   8929  C CB     . TYR C 1 42  ? 256.228 -6.488  126.218 1.00 172.71 ? 42  TYR C CB     1 
ATOM   8930  C CG     . TYR C 1 42  ? 255.695 -6.163  124.837 1.00 179.72 ? 42  TYR C CG     1 
ATOM   8931  C CD1    . TYR C 1 42  ? 255.782 -7.080  123.796 1.00 182.71 ? 42  TYR C CD1    1 
ATOM   8932  C CD2    . TYR C 1 42  ? 255.098 -4.937  124.578 1.00 183.58 ? 42  TYR C CD2    1 
ATOM   8933  C CE1    . TYR C 1 42  ? 255.294 -6.783  122.539 1.00 186.20 ? 42  TYR C CE1    1 
ATOM   8934  C CE2    . TYR C 1 42  ? 254.608 -4.631  123.324 1.00 187.23 ? 42  TYR C CE2    1 
ATOM   8935  C CZ     . TYR C 1 42  ? 254.707 -5.558  122.309 1.00 188.91 ? 42  TYR C CZ     1 
ATOM   8936  O OH     . TYR C 1 42  ? 254.218 -5.257  121.059 1.00 191.59 ? 42  TYR C OH     1 
ATOM   8937  H H      . TYR C 1 42  ? 256.490 -9.208  125.304 1.00 189.92 ? 42  TYR C H      1 
ATOM   8938  H HA     . TYR C 1 42  ? 256.107 -7.955  127.647 1.00 196.32 ? 42  TYR C HA     1 
ATOM   8939  H HB2    . TYR C 1 42  ? 255.824 -5.866  126.843 1.00 207.25 ? 42  TYR C HB2    1 
ATOM   8940  H HB3    . TYR C 1 42  ? 257.189 -6.356  126.201 1.00 207.25 ? 42  TYR C HB3    1 
ATOM   8941  H HD1    . TYR C 1 42  ? 256.178 -7.908  123.948 1.00 219.25 ? 42  TYR C HD1    1 
ATOM   8942  H HD2    . TYR C 1 42  ? 255.029 -4.309  125.260 1.00 220.30 ? 42  TYR C HD2    1 
ATOM   8943  H HE1    . TYR C 1 42  ? 255.360 -7.407  121.852 1.00 223.44 ? 42  TYR C HE1    1 
ATOM   8944  H HE2    . TYR C 1 42  ? 254.211 -3.805  123.166 1.00 224.67 ? 42  TYR C HE2    1 
ATOM   8945  H HH     . TYR C 1 42  ? 254.342 -5.904  120.539 1.00 229.91 ? 42  TYR C HH     1 
ATOM   8946  N N      . VAL C 1 43  ? 253.585 -7.439  127.041 1.00 155.34 ? 43  VAL C N      1 
ATOM   8947  C CA     . VAL C 1 43  ? 252.144 -7.633  126.918 1.00 145.74 ? 43  VAL C CA     1 
ATOM   8948  C C      . VAL C 1 43  ? 251.412 -6.379  127.400 1.00 137.38 ? 43  VAL C C      1 
ATOM   8949  O O      . VAL C 1 43  ? 251.777 -5.790  128.418 1.00 140.24 ? 43  VAL C O      1 
ATOM   8950  C CB     . VAL C 1 43  ? 251.672 -8.883  127.716 1.00 121.62 ? 43  VAL C CB     1 
ATOM   8951  C CG1    . VAL C 1 43  ? 252.184 -8.844  129.149 1.00 120.90 ? 43  VAL C CG1    1 
ATOM   8952  C CG2    . VAL C 1 43  ? 250.151 -9.025  127.687 1.00 121.24 ? 43  VAL C CG2    1 
ATOM   8953  H H      . VAL C 1 43  ? 253.802 -6.755  127.515 1.00 186.41 ? 43  VAL C H      1 
ATOM   8954  H HA     . VAL C 1 43  ? 251.921 -7.770  125.984 1.00 174.89 ? 43  VAL C HA     1 
ATOM   8955  H HB     . VAL C 1 43  ? 252.046 -9.674  127.296 1.00 145.94 ? 43  VAL C HB     1 
ATOM   8956  H HG11   . VAL C 1 43  ? 251.873 -9.636  129.617 1.00 145.08 ? 43  VAL C HG11   1 
ATOM   8957  H HG12   . VAL C 1 43  ? 253.154 -8.826  129.138 1.00 145.08 ? 43  VAL C HG12   1 
ATOM   8958  H HG13   . VAL C 1 43  ? 251.843 -8.047  129.584 1.00 145.08 ? 43  VAL C HG13   1 
ATOM   8959  H HG21   . VAL C 1 43  ? 249.898 -9.813  128.194 1.00 145.49 ? 43  VAL C HG21   1 
ATOM   8960  H HG22   . VAL C 1 43  ? 249.754 -8.234  128.085 1.00 145.49 ? 43  VAL C HG22   1 
ATOM   8961  H HG23   . VAL C 1 43  ? 249.860 -9.115  126.767 1.00 145.49 ? 43  VAL C HG23   1 
ATOM   8962  N N      . PHE C 1 44  ? 250.393 -5.966  126.654 1.00 126.80 ? 44  PHE C N      1 
ATOM   8963  C CA     . PHE C 1 44  ? 249.555 -4.836  127.048 1.00 123.27 ? 44  PHE C CA     1 
ATOM   8964  C C      . PHE C 1 44  ? 248.320 -5.306  127.814 1.00 117.55 ? 44  PHE C C      1 
ATOM   8965  O O      . PHE C 1 44  ? 247.558 -6.137  127.315 1.00 112.52 ? 44  PHE C O      1 
ATOM   8966  C CB     . PHE C 1 44  ? 249.116 -4.049  125.817 1.00 128.17 ? 44  PHE C CB     1 
ATOM   8967  C CG     . PHE C 1 44  ? 250.101 -3.009  125.385 1.00 134.22 ? 44  PHE C CG     1 
ATOM   8968  C CD1    . PHE C 1 44  ? 251.172 -3.346  124.580 1.00 139.81 ? 44  PHE C CD1    1 
ATOM   8969  C CD2    . PHE C 1 44  ? 249.955 -1.691  125.783 1.00 134.24 ? 44  PHE C CD2    1 
ATOM   8970  C CE1    . PHE C 1 44  ? 252.081 -2.388  124.182 1.00 142.79 ? 44  PHE C CE1    1 
ATOM   8971  C CE2    . PHE C 1 44  ? 250.860 -0.728  125.387 1.00 136.88 ? 44  PHE C CE2    1 
ATOM   8972  C CZ     . PHE C 1 44  ? 251.924 -1.077  124.588 1.00 141.14 ? 44  PHE C CZ     1 
ATOM   8973  H H      . PHE C 1 44  ? 250.163 -6.326  125.907 1.00 152.16 ? 44  PHE C H      1 
ATOM   8974  H HA     . PHE C 1 44  ? 250.064 -4.244  127.624 1.00 147.93 ? 44  PHE C HA     1 
ATOM   8975  H HB2    . PHE C 1 44  ? 248.992 -4.666  125.079 1.00 153.80 ? 44  PHE C HB2    1 
ATOM   8976  H HB3    . PHE C 1 44  ? 248.278 -3.601  126.014 1.00 153.80 ? 44  PHE C HB3    1 
ATOM   8977  H HD1    . PHE C 1 44  ? 251.282 -4.227  124.305 1.00 167.77 ? 44  PHE C HD1    1 
ATOM   8978  H HD2    . PHE C 1 44  ? 249.238 -1.451  126.325 1.00 161.09 ? 44  PHE C HD2    1 
ATOM   8979  H HE1    . PHE C 1 44  ? 252.799 -2.624  123.640 1.00 171.35 ? 44  PHE C HE1    1 
ATOM   8980  H HE2    . PHE C 1 44  ? 250.752 0.154   125.662 1.00 164.25 ? 44  PHE C HE2    1 
ATOM   8981  H HZ     . PHE C 1 44  ? 252.535 -0.430  124.319 1.00 169.36 ? 44  PHE C HZ     1 
ATOM   8982  N N      . VAL C 1 45  ? 248.124 -4.762  129.016 1.00 116.87 ? 45  VAL C N      1 
ATOM   8983  C CA     . VAL C 1 45  ? 246.988 -5.129  129.867 1.00 111.77 ? 45  VAL C CA     1 
ATOM   8984  C C      . VAL C 1 45  ? 246.229 -3.893  130.343 1.00 110.88 ? 45  VAL C C      1 
ATOM   8985  O O      . VAL C 1 45  ? 246.452 -2.784  129.851 1.00 113.12 ? 45  VAL C O      1 
ATOM   8986  C CB     . VAL C 1 45  ? 247.443 -5.947  131.105 1.00 98.95  ? 45  VAL C CB     1 
ATOM   8987  C CG1    . VAL C 1 45  ? 248.059 -7.266  130.675 1.00 98.53  ? 45  VAL C CG1    1 
ATOM   8988  C CG2    . VAL C 1 45  ? 248.426 -5.150  131.950 1.00 97.19  ? 45  VAL C CG2    1 
ATOM   8989  H H      . VAL C 1 45  ? 248.641 -4.171  129.367 1.00 140.24 ? 45  VAL C H      1 
ATOM   8990  H HA     . VAL C 1 45  ? 246.375 -5.678  129.354 1.00 134.13 ? 45  VAL C HA     1 
ATOM   8991  H HB     . VAL C 1 45  ? 246.668 -6.144  131.654 1.00 118.74 ? 45  VAL C HB     1 
ATOM   8992  H HG11   . VAL C 1 45  ? 248.334 -7.757  131.465 1.00 118.24 ? 45  VAL C HG11   1 
ATOM   8993  H HG12   . VAL C 1 45  ? 247.399 -7.776  130.181 1.00 118.24 ? 45  VAL C HG12   1 
ATOM   8994  H HG13   . VAL C 1 45  ? 248.828 -7.086  130.113 1.00 118.24 ? 45  VAL C HG13   1 
ATOM   8995  H HG21   . VAL C 1 45  ? 248.691 -5.685  132.714 1.00 116.63 ? 45  VAL C HG21   1 
ATOM   8996  H HG22   . VAL C 1 45  ? 249.203 -4.934  131.411 1.00 116.63 ? 45  VAL C HG22   1 
ATOM   8997  H HG23   . VAL C 1 45  ? 247.995 -4.335  132.251 1.00 116.63 ? 45  VAL C HG23   1 
ATOM   8998  N N      . GLY C 1 46  ? 245.320 -4.094  131.293 1.00 109.04 ? 46  GLY C N      1 
ATOM   8999  C CA     . GLY C 1 46  ? 244.637 -2.989  131.939 1.00 108.80 ? 46  GLY C CA     1 
ATOM   9000  C C      . GLY C 1 46  ? 243.419 -2.494  131.186 1.00 104.73 ? 46  GLY C C      1 
ATOM   9001  O O      . GLY C 1 46  ? 242.960 -3.125  130.232 1.00 108.99 ? 46  GLY C O      1 
ATOM   9002  H H      . GLY C 1 46  ? 245.083 -4.869  131.580 1.00 130.85 ? 46  GLY C H      1 
ATOM   9003  H HA2    . GLY C 1 46  ? 244.353 -3.266  132.824 1.00 130.56 ? 46  GLY C HA2    1 
ATOM   9004  H HA3    . GLY C 1 46  ? 245.254 -2.247  132.037 1.00 130.56 ? 46  GLY C HA3    1 
ATOM   9005  N N      . SER C 1 47  ? 242.905 -1.347  131.621 1.00 93.16  ? 47  SER C N      1 
ATOM   9006  C CA     . SER C 1 47  ? 241.713 -0.751  131.032 1.00 84.30  ? 47  SER C CA     1 
ATOM   9007  C C      . SER C 1 47  ? 241.974 -0.273  129.610 1.00 85.16  ? 47  SER C C      1 
ATOM   9008  O O      . SER C 1 47  ? 241.066 -0.277  128.773 1.00 81.67  ? 47  SER C O      1 
ATOM   9009  C CB     . SER C 1 47  ? 241.234 0.428   131.882 1.00 79.63  ? 47  SER C CB     1 
ATOM   9010  O OG     . SER C 1 47  ? 240.024 0.964   131.377 1.00 76.34  ? 47  SER C OG     1 
ATOM   9011  H H      . SER C 1 47  ? 243.236 -0.888  132.269 1.00 111.79 ? 47  SER C H      1 
ATOM   9012  H HA     . SER C 1 47  ? 241.005 -1.414  131.005 1.00 101.16 ? 47  SER C HA     1 
ATOM   9013  H HB2    . SER C 1 47  ? 241.087 0.122   132.791 1.00 95.56  ? 47  SER C HB2    1 
ATOM   9014  H HB3    . SER C 1 47  ? 241.913 1.120   131.872 1.00 95.56  ? 47  SER C HB3    1 
ATOM   9015  H HG     . SER C 1 47  ? 239.425 0.375   131.380 1.00 91.61  ? 47  SER C HG     1 
ATOM   9016  N N      . TYR C 1 48  ? 243.209 0.146   129.340 1.00 88.36  ? 48  TYR C N      1 
ATOM   9017  C CA     . TYR C 1 48  ? 243.555 0.658   128.019 1.00 92.98  ? 48  TYR C CA     1 
ATOM   9018  C C      . TYR C 1 48  ? 243.440 -0.442  126.970 1.00 88.99  ? 48  TYR C C      1 
ATOM   9019  O O      . TYR C 1 48  ? 242.739 -0.284  125.968 1.00 84.58  ? 48  TYR C O      1 
ATOM   9020  C CB     . TYR C 1 48  ? 244.967 1.258   127.997 1.00 101.08 ? 48  TYR C CB     1 
ATOM   9021  C CG     . TYR C 1 48  ? 245.409 1.661   126.603 1.00 109.21 ? 48  TYR C CG     1 
ATOM   9022  C CD1    . TYR C 1 48  ? 245.028 2.882   126.055 1.00 111.90 ? 48  TYR C CD1    1 
ATOM   9023  C CD2    . TYR C 1 48  ? 246.187 0.811   125.825 1.00 113.20 ? 48  TYR C CD2    1 
ATOM   9024  C CE1    . TYR C 1 48  ? 245.421 3.247   124.773 1.00 114.50 ? 48  TYR C CE1    1 
ATOM   9025  C CE2    . TYR C 1 48  ? 246.583 1.169   124.545 1.00 115.77 ? 48  TYR C CE2    1 
ATOM   9026  C CZ     . TYR C 1 48  ? 246.198 2.387   124.024 1.00 116.96 ? 48  TYR C CZ     1 
ATOM   9027  O OH     . TYR C 1 48  ? 246.595 2.740   122.751 1.00 120.49 ? 48  TYR C OH     1 
ATOM   9028  H H      . TYR C 1 48  ? 243.861 0.144   129.901 1.00 106.03 ? 48  TYR C H      1 
ATOM   9029  H HA     . TYR C 1 48  ? 242.930 1.362   127.783 1.00 111.58 ? 48  TYR C HA     1 
ATOM   9030  H HB2    . TYR C 1 48  ? 244.984 2.049   128.558 1.00 121.29 ? 48  TYR C HB2    1 
ATOM   9031  H HB3    . TYR C 1 48  ? 245.595 0.599   128.332 1.00 121.29 ? 48  TYR C HB3    1 
ATOM   9032  H HD1    . TYR C 1 48  ? 244.504 3.464   126.555 1.00 134.28 ? 48  TYR C HD1    1 
ATOM   9033  H HD2    . TYR C 1 48  ? 246.449 -0.011  126.171 1.00 135.84 ? 48  TYR C HD2    1 
ATOM   9034  H HE1    . TYR C 1 48  ? 245.162 4.069   124.421 1.00 137.40 ? 48  TYR C HE1    1 
ATOM   9035  H HE2    . TYR C 1 48  ? 247.108 0.590   124.040 1.00 138.93 ? 48  TYR C HE2    1 
ATOM   9036  H HH     . TYR C 1 48  ? 246.296 3.501   122.557 1.00 144.59 ? 48  TYR C HH     1 
ATOM   9037  N N      . ALA C 1 49  ? 244.121 -1.557  127.213 1.00 91.06  ? 49  ALA C N      1 
ATOM   9038  C CA     . ALA C 1 49  ? 244.172 -2.654  126.254 1.00 94.71  ? 49  ALA C CA     1 
ATOM   9039  C C      . ALA C 1 49  ? 242.782 -3.181  125.877 1.00 96.91  ? 49  ALA C C      1 
ATOM   9040  O O      . ALA C 1 49  ? 242.561 -3.580  124.732 1.00 102.16 ? 49  ALA C O      1 
ATOM   9041  C CB     . ALA C 1 49  ? 245.037 -3.782  126.800 1.00 93.98  ? 49  ALA C CB     1 
ATOM   9042  H H      . ALA C 1 49  ? 244.567 -1.703  127.933 1.00 109.27 ? 49  ALA C H      1 
ATOM   9043  H HA     . ALA C 1 49  ? 244.591 -2.333  125.441 1.00 113.66 ? 49  ALA C HA     1 
ATOM   9044  H HB1    . ALA C 1 49  ? 245.061 -4.503  126.152 1.00 112.77 ? 49  ALA C HB1    1 
ATOM   9045  H HB2    . ALA C 1 49  ? 245.934 -3.445  126.954 1.00 112.77 ? 49  ALA C HB2    1 
ATOM   9046  H HB3    . ALA C 1 49  ? 244.655 -4.098  127.634 1.00 112.77 ? 49  ALA C HB3    1 
ATOM   9047  N N      . ARG C 1 50  ? 241.855 -3.172  126.836 1.00 91.00  ? 50  ARG C N      1 
ATOM   9048  C CA     . ARG C 1 50  ? 240.503 -3.694  126.616 1.00 81.78  ? 50  ARG C CA     1 
ATOM   9049  C C      . ARG C 1 50  ? 239.510 -2.598  126.256 1.00 77.84  ? 50  ARG C C      1 
ATOM   9050  O O      . ARG C 1 50  ? 238.316 -2.868  126.102 1.00 76.07  ? 50  ARG C O      1 
ATOM   9051  C CB     . ARG C 1 50  ? 240.000 -4.422  127.859 1.00 77.62  ? 50  ARG C CB     1 
ATOM   9052  C CG     . ARG C 1 50  ? 240.963 -5.451  128.395 1.00 78.31  ? 50  ARG C CG     1 
ATOM   9053  C CD     . ARG C 1 50  ? 240.389 -6.175  129.597 1.00 79.02  ? 50  ARG C CD     1 
ATOM   9054  N NE     . ARG C 1 50  ? 241.408 -6.374  130.628 1.00 81.65  ? 50  ARG C NE     1 
ATOM   9055  C CZ     . ARG C 1 50  ? 241.561 -5.606  131.703 1.00 85.49  ? 50  ARG C CZ     1 
ATOM   9056  N NH1    . ARG C 1 50  ? 240.750 -4.579  131.923 1.00 85.72  ? 50  ARG C NH1    1 
ATOM   9057  N NH2    . ARG C 1 50  ? 242.526 -5.874  132.574 1.00 89.17  ? 50  ARG C NH2    1 
ATOM   9058  H H      . ARG C 1 50  ? 241.984 -2.867  127.629 1.00 109.20 ? 50  ARG C H      1 
ATOM   9059  H HA     . ARG C 1 50  ? 240.526 -4.331  125.885 1.00 98.13  ? 50  ARG C HA     1 
ATOM   9060  H HB2    . ARG C 1 50  ? 239.843 -3.770  128.560 1.00 93.14  ? 50  ARG C HB2    1 
ATOM   9061  H HB3    . ARG C 1 50  ? 239.171 -4.876  127.641 1.00 93.14  ? 50  ARG C HB3    1 
ATOM   9062  H HG2    . ARG C 1 50  ? 241.147 -6.107  127.704 1.00 93.97  ? 50  ARG C HG2    1 
ATOM   9063  H HG3    . ARG C 1 50  ? 241.783 -5.011  128.668 1.00 93.97  ? 50  ARG C HG3    1 
ATOM   9064  H HD2    . ARG C 1 50  ? 239.669 -5.647  129.977 1.00 94.82  ? 50  ARG C HD2    1 
ATOM   9065  H HD3    . ARG C 1 50  ? 240.059 -7.045  129.322 1.00 94.82  ? 50  ARG C HD3    1 
ATOM   9066  H HE     . ARG C 1 50  ? 241.948 -7.036  130.531 1.00 97.98  ? 50  ARG C HE     1 
ATOM   9067  H HH11   . ARG C 1 50  ? 240.123 -4.399  131.362 1.00 102.86 ? 50  ARG C HH11   1 
ATOM   9068  H HH12   . ARG C 1 50  ? 240.856 -4.090  132.622 1.00 102.86 ? 50  ARG C HH12   1 
ATOM   9069  H HH21   . ARG C 1 50  ? 243.053 -6.540  132.441 1.00 107.00 ? 50  ARG C HH21   1 
ATOM   9070  H HH22   . ARG C 1 50  ? 242.623 -5.382  133.273 1.00 107.00 ? 50  ARG C HH22   1 
ATOM   9071  N N      . ASN C 1 51  ? 240.005 -1.369  126.134 1.00 76.79  ? 51  ASN C N      1 
ATOM   9072  C CA     . ASN C 1 51  ? 239.179 -0.237  125.724 1.00 81.83  ? 51  ASN C CA     1 
ATOM   9073  C C      . ASN C 1 51  ? 237.952 -0.051  126.618 1.00 83.36  ? 51  ASN C C      1 
ATOM   9074  O O      . ASN C 1 51  ? 236.816 -0.188  126.164 1.00 78.92  ? 51  ASN C O      1 
ATOM   9075  C CB     . ASN C 1 51  ? 238.747 -0.405  124.265 1.00 88.20  ? 51  ASN C CB     1 
ATOM   9076  C CG     . ASN C 1 51  ? 238.043 0.821   123.719 1.00 94.73  ? 51  ASN C CG     1 
ATOM   9077  O OD1    . ASN C 1 51  ? 238.192 1.924   124.248 1.00 98.51  ? 51  ASN C OD1    1 
ATOM   9078  N ND2    . ASN C 1 51  ? 237.270 0.635   122.655 1.00 94.99  ? 51  ASN C ND2    1 
ATOM   9079  H H      . ASN C 1 51  ? 240.826 -1.162  126.285 1.00 92.15  ? 51  ASN C H      1 
ATOM   9080  H HA     . ASN C 1 51  ? 239.711 0.572   125.783 1.00 98.20  ? 51  ASN C HA     1 
ATOM   9081  H HB2    . ASN C 1 51  ? 239.532 -0.569  123.719 1.00 105.84 ? 51  ASN C HB2    1 
ATOM   9082  H HB3    . ASN C 1 51  ? 238.135 -1.156  124.201 1.00 105.84 ? 51  ASN C HB3    1 
ATOM   9083  H HD21   . ASN C 1 51  ? 236.850 1.300   122.308 1.00 113.98 ? 51  ASN C HD21   1 
ATOM   9084  H HD22   . ASN C 1 51  ? 237.191 -0.150  122.313 1.00 113.98 ? 51  ASN C HD22   1 
ATOM   9085  N N      . THR C 1 52  ? 238.190 0.262   127.889 1.00 91.62  ? 52  THR C N      1 
ATOM   9086  C CA     . THR C 1 52  ? 237.109 0.443   128.856 1.00 95.96  ? 52  THR C CA     1 
ATOM   9087  C C      . THR C 1 52  ? 237.396 1.573   129.853 1.00 99.91  ? 52  THR C C      1 
ATOM   9088  O O      . THR C 1 52  ? 236.804 1.616   130.931 1.00 100.89 ? 52  THR C O      1 
ATOM   9089  C CB     . THR C 1 52  ? 236.844 -0.860  129.649 1.00 93.35  ? 52  THR C CB     1 
ATOM   9090  O OG1    . THR C 1 52  ? 238.051 -1.292  130.294 1.00 91.13  ? 52  THR C OG1    1 
ATOM   9091  C CG2    . THR C 1 52  ? 236.340 -1.958  128.732 1.00 92.99  ? 52  THR C CG2    1 
ATOM   9092  H H      . THR C 1 52  ? 238.975 0.377   128.220 1.00 109.94 ? 52  THR C H      1 
ATOM   9093  H HA     . THR C 1 52  ? 236.297 0.670   128.377 1.00 115.15 ? 52  THR C HA     1 
ATOM   9094  H HB     . THR C 1 52  ? 236.166 -0.692  130.322 1.00 112.02 ? 52  THR C HB     1 
ATOM   9095  H HG1    . THR C 1 52  ? 237.909 -1.999  130.725 1.00 109.36 ? 52  THR C HG1    1 
ATOM   9096  H HG21   . THR C 1 52  ? 236.179 -2.768  129.241 1.00 111.58 ? 52  THR C HG21   1 
ATOM   9097  H HG22   . THR C 1 52  ? 235.513 -1.682  128.308 1.00 111.58 ? 52  THR C HG22   1 
ATOM   9098  H HG23   . THR C 1 52  ? 236.999 -2.145  128.045 1.00 111.58 ? 52  THR C HG23   1 
ATOM   9099  N N      . TRP C 1 53  ? 238.296 2.488   129.497 1.00 100.56 ? 53  TRP C N      1 
ATOM   9100  C CA     . TRP C 1 53  ? 238.622 3.608   130.375 1.00 102.86 ? 53  TRP C CA     1 
ATOM   9101  C C      . TRP C 1 53  ? 237.564 4.704   130.250 1.00 105.95 ? 53  TRP C C      1 
ATOM   9102  O O      . TRP C 1 53  ? 236.834 4.755   129.261 1.00 108.38 ? 53  TRP C O      1 
ATOM   9103  C CB     . TRP C 1 53  ? 240.025 4.152   130.071 1.00 109.04 ? 53  TRP C CB     1 
ATOM   9104  C CG     . TRP C 1 53  ? 240.156 4.938   128.783 1.00 119.28 ? 53  TRP C CG     1 
ATOM   9105  C CD1    . TRP C 1 53  ? 239.858 6.259   128.591 1.00 124.61 ? 53  TRP C CD1    1 
ATOM   9106  C CD2    . TRP C 1 53  ? 240.644 4.456   127.523 1.00 124.44 ? 53  TRP C CD2    1 
ATOM   9107  N NE1    . TRP C 1 53  ? 240.121 6.625   127.293 1.00 127.48 ? 53  TRP C NE1    1 
ATOM   9108  C CE2    . TRP C 1 53  ? 240.603 5.536   126.616 1.00 127.19 ? 53  TRP C CE2    1 
ATOM   9109  C CE3    . TRP C 1 53  ? 241.105 3.215   127.073 1.00 125.91 ? 53  TRP C CE3    1 
ATOM   9110  C CZ2    . TRP C 1 53  ? 241.005 5.412   125.290 1.00 128.76 ? 53  TRP C CZ2    1 
ATOM   9111  C CZ3    . TRP C 1 53  ? 241.502 3.094   125.756 1.00 127.83 ? 53  TRP C CZ3    1 
ATOM   9112  C CH2    . TRP C 1 53  ? 241.451 4.186   124.880 1.00 129.27 ? 53  TRP C CH2    1 
ATOM   9113  H H      . TRP C 1 53  ? 238.729 2.483   128.754 1.00 120.68 ? 53  TRP C H      1 
ATOM   9114  H HA     . TRP C 1 53  ? 238.618 3.296   131.293 1.00 123.44 ? 53  TRP C HA     1 
ATOM   9115  H HB2    . TRP C 1 53  ? 240.291 4.737   130.797 1.00 130.85 ? 53  TRP C HB2    1 
ATOM   9116  H HB3    . TRP C 1 53  ? 240.639 3.403   130.018 1.00 130.85 ? 53  TRP C HB3    1 
ATOM   9117  H HD1    . TRP C 1 53  ? 239.524 6.828   129.247 1.00 149.54 ? 53  TRP C HD1    1 
ATOM   9118  H HE1    . TRP C 1 53  ? 240.001 7.408   126.960 1.00 152.98 ? 53  TRP C HE1    1 
ATOM   9119  H HE3    . TRP C 1 53  ? 241.142 2.486   127.649 1.00 151.09 ? 53  TRP C HE3    1 
ATOM   9120  H HZ2    . TRP C 1 53  ? 240.971 6.134   124.706 1.00 154.52 ? 53  TRP C HZ2    1 
ATOM   9121  H HZ3    . TRP C 1 53  ? 241.811 2.273   125.446 1.00 153.39 ? 53  TRP C HZ3    1 
ATOM   9122  H HH2    . TRP C 1 53  ? 241.725 4.075   123.998 1.00 155.12 ? 53  TRP C HH2    1 
ATOM   9123  N N      . LEU C 1 54  ? 237.479 5.573   131.256 1.00 108.09 ? 54  LEU C N      1 
ATOM   9124  C CA     . LEU C 1 54  ? 236.476 6.638   131.274 1.00 111.07 ? 54  LEU C CA     1 
ATOM   9125  C C      . LEU C 1 54  ? 236.953 7.928   130.614 1.00 119.49 ? 54  LEU C C      1 
ATOM   9126  O O      . LEU C 1 54  ? 238.151 8.164   130.473 1.00 120.23 ? 54  LEU C O      1 
ATOM   9127  C CB     . LEU C 1 54  ? 236.070 6.956   132.712 1.00 107.09 ? 54  LEU C CB     1 
ATOM   9128  C CG     . LEU C 1 54  ? 235.217 5.932   133.451 1.00 104.53 ? 54  LEU C CG     1 
ATOM   9129  C CD1    . LEU C 1 54  ? 234.972 6.411   134.874 1.00 102.25 ? 54  LEU C CD1    1 
ATOM   9130  C CD2    . LEU C 1 54  ? 233.903 5.704   132.729 1.00 106.10 ? 54  LEU C CD2    1 
ATOM   9131  H H      . LEU C 1 54  ? 237.994 5.567   131.945 1.00 129.70 ? 54  LEU C H      1 
ATOM   9132  H HA     . LEU C 1 54  ? 235.686 6.334   130.800 1.00 133.28 ? 54  LEU C HA     1 
ATOM   9133  H HB2    . LEU C 1 54  ? 236.881 7.078   133.231 1.00 128.51 ? 54  LEU C HB2    1 
ATOM   9134  H HB3    . LEU C 1 54  ? 235.571 7.788   132.704 1.00 128.51 ? 54  LEU C HB3    1 
ATOM   9135  H HG     . LEU C 1 54  ? 235.693 5.087   133.492 1.00 125.43 ? 54  LEU C HG     1 
ATOM   9136  H HD11   . LEU C 1 54  ? 234.429 5.754   135.338 1.00 122.70 ? 54  LEU C HD11   1 
ATOM   9137  H HD12   . LEU C 1 54  ? 235.826 6.513   135.324 1.00 122.70 ? 54  LEU C HD12   1 
ATOM   9138  H HD13   . LEU C 1 54  ? 234.509 7.262   134.844 1.00 122.70 ? 54  LEU C HD13   1 
ATOM   9139  H HD21   . LEU C 1 54  ? 233.383 5.050   133.220 1.00 127.32 ? 54  LEU C HD21   1 
ATOM   9140  H HD22   . LEU C 1 54  ? 233.420 6.544   132.681 1.00 127.32 ? 54  LEU C HD22   1 
ATOM   9141  H HD23   . LEU C 1 54  ? 234.088 5.377   131.835 1.00 127.32 ? 54  LEU C HD23   1 
ATOM   9142  N N      . LYS C 1 55  ? 235.993 8.767   130.230 1.00 126.25 ? 55  LYS C N      1 
ATOM   9143  C CA     . LYS C 1 55  ? 236.283 10.088  129.685 1.00 132.93 ? 55  LYS C CA     1 
ATOM   9144  C C      . LYS C 1 55  ? 237.042 10.926  130.712 1.00 137.52 ? 55  LYS C C      1 
ATOM   9145  O O      . LYS C 1 55  ? 236.675 10.965  131.889 1.00 139.16 ? 55  LYS C O      1 
ATOM   9146  C CB     . LYS C 1 55  ? 234.981 10.791  129.294 1.00 133.72 ? 55  LYS C CB     1 
ATOM   9147  C CG     . LYS C 1 55  ? 235.166 12.164  128.658 1.00 137.83 ? 55  LYS C CG     1 
ATOM   9148  C CD     . LYS C 1 55  ? 233.828 12.752  128.228 1.00 139.71 ? 55  LYS C CD     1 
ATOM   9149  C CE     . LYS C 1 55  ? 233.992 14.098  127.544 1.00 141.32 ? 55  LYS C CE     1 
ATOM   9150  N NZ     . LYS C 1 55  ? 232.681 14.657  127.115 1.00 140.11 ? 55  LYS C NZ     1 
ATOM   9151  H H      . LYS C 1 55  ? 235.153 8.589   130.275 1.00 151.50 ? 55  LYS C H      1 
ATOM   9152  H HA     . LYS C 1 55  ? 236.835 9.998   128.893 1.00 159.52 ? 55  LYS C HA     1 
ATOM   9153  H HB2    . LYS C 1 55  ? 234.508 10.234  128.656 1.00 160.46 ? 55  LYS C HB2    1 
ATOM   9154  H HB3    . LYS C 1 55  ? 234.440 10.907  130.090 1.00 160.46 ? 55  LYS C HB3    1 
ATOM   9155  H HG2    . LYS C 1 55  ? 235.570 12.765  129.303 1.00 165.39 ? 55  LYS C HG2    1 
ATOM   9156  H HG3    . LYS C 1 55  ? 235.730 12.081  127.874 1.00 165.39 ? 55  LYS C HG3    1 
ATOM   9157  H HD2    . LYS C 1 55  ? 233.399 12.145  127.604 1.00 167.66 ? 55  LYS C HD2    1 
ATOM   9158  H HD3    . LYS C 1 55  ? 233.268 12.877  129.011 1.00 167.66 ? 55  LYS C HD3    1 
ATOM   9159  H HE2    . LYS C 1 55  ? 234.401 14.723  128.162 1.00 169.58 ? 55  LYS C HE2    1 
ATOM   9160  H HE3    . LYS C 1 55  ? 234.549 13.991  126.757 1.00 169.58 ? 55  LYS C HE3    1 
ATOM   9161  H HZ1    . LYS C 1 55  ? 232.802 15.444  126.717 1.00 168.13 ? 55  LYS C HZ1    1 
ATOM   9162  H HZ2    . LYS C 1 55  ? 232.287 14.101  126.542 1.00 168.13 ? 55  LYS C HZ2    1 
ATOM   9163  H HZ3    . LYS C 1 55  ? 232.152 14.768  127.821 1.00 168.13 ? 55  LYS C HZ3    1 
ATOM   9164  N N      . GLY C 1 56  ? 238.104 11.587  130.260 1.00 138.98 ? 56  GLY C N      1 
ATOM   9165  C CA     . GLY C 1 56  ? 238.937 12.395  131.133 1.00 139.22 ? 56  GLY C CA     1 
ATOM   9166  C C      . GLY C 1 56  ? 240.101 11.604  131.702 1.00 139.33 ? 56  GLY C C      1 
ATOM   9167  O O      . GLY C 1 56  ? 241.129 12.175  132.064 1.00 140.73 ? 56  GLY C O      1 
ATOM   9168  H H      . GLY C 1 56  ? 238.363 11.581  129.440 1.00 166.77 ? 56  GLY C H      1 
ATOM   9169  H HA2    . GLY C 1 56  ? 239.291 13.150  130.636 1.00 167.07 ? 56  GLY C HA2    1 
ATOM   9170  H HA3    . GLY C 1 56  ? 238.404 12.733  131.869 1.00 167.07 ? 56  GLY C HA3    1 
ATOM   9171  N N      . SER C 1 57  ? 239.935 10.285  131.776 1.00 137.70 ? 57  SER C N      1 
ATOM   9172  C CA     . SER C 1 57  ? 240.963 9.390   132.303 1.00 135.43 ? 57  SER C CA     1 
ATOM   9173  C C      . SER C 1 57  ? 241.700 8.672   131.171 1.00 141.10 ? 57  SER C C      1 
ATOM   9174  O O      . SER C 1 57  ? 241.178 8.554   130.062 1.00 147.44 ? 57  SER C O      1 
ATOM   9175  C CB     . SER C 1 57  ? 240.320 8.362   133.231 1.00 126.00 ? 57  SER C CB     1 
ATOM   9176  O OG     . SER C 1 57  ? 239.500 9.003   134.191 1.00 120.95 ? 57  SER C OG     1 
ATOM   9177  H H      . SER C 1 57  ? 239.221 9.877   131.523 1.00 165.24 ? 57  SER C H      1 
ATOM   9178  H HA     . SER C 1 57  ? 241.609 9.904   132.813 1.00 162.52 ? 57  SER C HA     1 
ATOM   9179  H HB2    . SER C 1 57  ? 239.776 7.756   132.704 1.00 151.20 ? 57  SER C HB2    1 
ATOM   9180  H HB3    . SER C 1 57  ? 241.018 7.869   133.689 1.00 151.20 ? 57  SER C HB3    1 
ATOM   9181  H HG     . SER C 1 57  ? 239.150 8.431   134.697 1.00 145.14 ? 57  SER C HG     1 
ATOM   9182  N N      . LEU C 1 58  ? 242.912 8.197   131.458 1.00 137.20 ? 58  LEU C N      1 
ATOM   9183  C CA     . LEU C 1 58  ? 243.712 7.451   130.485 1.00 133.27 ? 58  LEU C CA     1 
ATOM   9184  C C      . LEU C 1 58  ? 244.981 6.920   131.147 1.00 137.33 ? 58  LEU C C      1 
ATOM   9185  O O      . LEU C 1 58  ? 245.786 7.694   131.662 1.00 135.71 ? 58  LEU C O      1 
ATOM   9186  C CB     . LEU C 1 58  ? 244.082 8.336   129.291 1.00 129.91 ? 58  LEU C CB     1 
ATOM   9187  C CG     . LEU C 1 58  ? 244.949 7.689   128.207 1.00 131.10 ? 58  LEU C CG     1 
ATOM   9188  C CD1    . LEU C 1 58  ? 244.290 6.441   127.648 1.00 129.38 ? 58  LEU C CD1    1 
ATOM   9189  C CD2    . LEU C 1 58  ? 245.231 8.682   127.085 1.00 135.00 ? 58  LEU C CD2    1 
ATOM   9190  H H      . LEU C 1 58  ? 243.298 8.296   132.220 1.00 164.64 ? 58  LEU C H      1 
ATOM   9191  H HA     . LEU C 1 58  ? 243.199 6.695   130.158 1.00 159.93 ? 58  LEU C HA     1 
ATOM   9192  H HB2    . LEU C 1 58  ? 243.262 8.630   128.866 1.00 155.89 ? 58  LEU C HB2    1 
ATOM   9193  H HB3    . LEU C 1 58  ? 244.567 9.107   129.624 1.00 155.89 ? 58  LEU C HB3    1 
ATOM   9194  H HG     . LEU C 1 58  ? 245.798 7.430   128.596 1.00 157.33 ? 58  LEU C HG     1 
ATOM   9195  H HD11   . LEU C 1 58  ? 244.864 6.059   126.966 1.00 155.26 ? 58  LEU C HD11   1 
ATOM   9196  H HD12   . LEU C 1 58  ? 244.161 5.804   128.368 1.00 155.26 ? 58  LEU C HD12   1 
ATOM   9197  H HD13   . LEU C 1 58  ? 243.433 6.682   127.263 1.00 155.26 ? 58  LEU C HD13   1 
ATOM   9198  H HD21   . LEU C 1 58  ? 245.780 8.250   126.412 1.00 162.00 ? 58  LEU C HD21   1 
ATOM   9199  H HD22   . LEU C 1 58  ? 244.389 8.964   126.694 1.00 162.00 ? 58  LEU C HD22   1 
ATOM   9200  H HD23   . LEU C 1 58  ? 245.699 9.448   127.452 1.00 162.00 ? 58  LEU C HD23   1 
ATOM   9201  N N      . GLU C 1 59  ? 245.159 5.603   131.125 1.00 144.73 ? 59  GLU C N      1 
ATOM   9202  C CA     . GLU C 1 59  ? 246.286 4.968   131.802 1.00 151.76 ? 59  GLU C CA     1 
ATOM   9203  C C      . GLU C 1 59  ? 246.729 3.707   131.065 1.00 142.93 ? 59  GLU C C      1 
ATOM   9204  O O      . GLU C 1 59  ? 246.041 2.687   131.096 1.00 148.41 ? 59  GLU C O      1 
ATOM   9205  C CB     . GLU C 1 59  ? 245.901 4.626   133.245 1.00 161.52 ? 59  GLU C CB     1 
ATOM   9206  C CG     . GLU C 1 59  ? 247.009 3.967   134.058 1.00 167.64 ? 59  GLU C CG     1 
ATOM   9207  C CD     . GLU C 1 59  ? 246.606 3.712   135.501 1.00 168.74 ? 59  GLU C CD     1 
ATOM   9208  O OE1    . GLU C 1 59  ? 245.503 4.144   135.899 1.00 168.24 ? 59  GLU C OE1    1 
ATOM   9209  O OE2    . GLU C 1 59  ? 247.391 3.077   136.238 1.00 168.96 ? 59  GLU C OE2    1 
ATOM   9210  H H      . GLU C 1 59  ? 244.637 5.050   130.722 1.00 173.68 ? 59  GLU C H      1 
ATOM   9211  H HA     . GLU C 1 59  ? 247.034 5.585   131.826 1.00 182.11 ? 59  GLU C HA     1 
ATOM   9212  H HB2    . GLU C 1 59  ? 245.649 5.444   133.701 1.00 193.82 ? 59  GLU C HB2    1 
ATOM   9213  H HB3    . GLU C 1 59  ? 245.147 4.016   133.228 1.00 193.82 ? 59  GLU C HB3    1 
ATOM   9214  H HG2    . GLU C 1 59  ? 247.234 3.114   133.654 1.00 201.17 ? 59  GLU C HG2    1 
ATOM   9215  H HG3    . GLU C 1 59  ? 247.786 4.548   134.061 1.00 201.17 ? 59  GLU C HG3    1 
ATOM   9216  N N      . ILE C 1 60  ? 247.883 3.785   130.408 1.00 126.23 ? 60  ILE C N      1 
ATOM   9217  C CA     . ILE C 1 60  ? 248.406 2.666   129.628 1.00 113.14 ? 60  ILE C CA     1 
ATOM   9218  C C      . ILE C 1 60  ? 249.276 1.737   130.473 1.00 114.63 ? 60  ILE C C      1 
ATOM   9219  O O      . ILE C 1 60  ? 250.414 2.065   130.803 1.00 104.96 ? 60  ILE C O      1 
ATOM   9220  C CB     . ILE C 1 60  ? 249.229 3.162   128.422 1.00 106.50 ? 60  ILE C CB     1 
ATOM   9221  C CG1    . ILE C 1 60  ? 248.347 4.001   127.492 1.00 104.83 ? 60  ILE C CG1    1 
ATOM   9222  C CG2    . ILE C 1 60  ? 249.838 1.978   127.657 1.00 103.91 ? 60  ILE C CG2    1 
ATOM   9223  C CD1    . ILE C 1 60  ? 249.089 4.619   126.306 1.00 106.28 ? 60  ILE C CD1    1 
ATOM   9224  H H      . ILE C 1 60  ? 248.388 4.481   130.399 1.00 151.47 ? 60  ILE C H      1 
ATOM   9225  H HA     . ILE C 1 60  ? 247.661 2.147   129.287 1.00 135.77 ? 60  ILE C HA     1 
ATOM   9226  H HB     . ILE C 1 60  ? 249.951 3.721   128.750 1.00 127.80 ? 60  ILE C HB     1 
ATOM   9227  H HG12   . ILE C 1 60  ? 247.643 3.435   127.137 1.00 125.80 ? 60  ILE C HG12   1 
ATOM   9228  H HG13   . ILE C 1 60  ? 247.957 4.726   128.005 1.00 125.80 ? 60  ILE C HG13   1 
ATOM   9229  H HG21   . ILE C 1 60  ? 250.349 2.317   126.906 1.00 124.69 ? 60  ILE C HG21   1 
ATOM   9230  H HG22   . ILE C 1 60  ? 250.418 1.481   128.255 1.00 124.69 ? 60  ILE C HG22   1 
ATOM   9231  H HG23   . ILE C 1 60  ? 249.122 1.406   127.339 1.00 124.69 ? 60  ILE C HG23   1 
ATOM   9232  H HD11   . ILE C 1 60  ? 248.461 5.130   125.773 1.00 127.54 ? 60  ILE C HD11   1 
ATOM   9233  H HD12   . ILE C 1 60  ? 249.790 5.200   126.641 1.00 127.54 ? 60  ILE C HD12   1 
ATOM   9234  H HD13   . ILE C 1 60  ? 249.476 3.908   125.772 1.00 127.54 ? 60  ILE C HD13   1 
ATOM   9235  N N      . ASP C 1 61  ? 248.734 0.568   130.801 1.00 130.81 ? 61  ASP C N      1 
ATOM   9236  C CA     . ASP C 1 61  ? 249.463 -0.430  131.572 1.00 140.34 ? 61  ASP C CA     1 
ATOM   9237  C C      . ASP C 1 61  ? 250.241 -1.352  130.636 1.00 136.57 ? 61  ASP C C      1 
ATOM   9238  O O      . ASP C 1 61  ? 249.706 -1.833  129.635 1.00 139.52 ? 61  ASP C O      1 
ATOM   9239  C CB     . ASP C 1 61  ? 248.497 -1.248  132.434 1.00 146.03 ? 61  ASP C CB     1 
ATOM   9240  C CG     . ASP C 1 61  ? 247.653 -0.380  133.351 1.00 150.80 ? 61  ASP C CG     1 
ATOM   9241  O OD1    . ASP C 1 61  ? 248.104 -0.088  134.479 1.00 153.98 ? 61  ASP C OD1    1 
ATOM   9242  O OD2    . ASP C 1 61  ? 246.535 0.008   132.947 1.00 150.75 ? 61  ASP C OD2    1 
ATOM   9243  H H      . ASP C 1 61  ? 247.937 0.328   130.585 1.00 156.98 ? 61  ASP C H      1 
ATOM   9244  H HA     . ASP C 1 61  ? 250.095 0.014   132.158 1.00 168.41 ? 61  ASP C HA     1 
ATOM   9245  H HB2    . ASP C 1 61  ? 247.898 -1.744  131.855 1.00 175.24 ? 61  ASP C HB2    1 
ATOM   9246  H HB3    . ASP C 1 61  ? 249.007 -1.860  132.987 1.00 175.24 ? 61  ASP C HB3    1 
ATOM   9247  N N      . VAL C 1 62  ? 251.507 -1.587  130.969 1.00 127.10 ? 62  VAL C N      1 
ATOM   9248  C CA     . VAL C 1 62  ? 252.375 -2.449  130.172 1.00 121.32 ? 62  VAL C CA     1 
ATOM   9249  C C      . VAL C 1 62  ? 253.246 -3.307  131.079 1.00 118.04 ? 62  VAL C C      1 
ATOM   9250  O O      . VAL C 1 62  ? 253.956 -2.791  131.941 1.00 112.73 ? 62  VAL C O      1 
ATOM   9251  C CB     . VAL C 1 62  ? 253.290 -1.627  129.252 1.00 124.55 ? 62  VAL C CB     1 
ATOM   9252  C CG1    . VAL C 1 62  ? 254.105 -2.549  128.342 1.00 123.85 ? 62  VAL C CG1    1 
ATOM   9253  C CG2    . VAL C 1 62  ? 252.468 -0.647  128.429 1.00 127.16 ? 62  VAL C CG2    1 
ATOM   9254  H H      . VAL C 1 62  ? 251.893 -1.253  131.661 1.00 152.52 ? 62  VAL C H      1 
ATOM   9255  H HA     . VAL C 1 62  ? 251.831 -3.035  129.622 1.00 145.58 ? 62  VAL C HA     1 
ATOM   9256  H HB     . VAL C 1 62  ? 253.911 -1.117  129.796 1.00 149.46 ? 62  VAL C HB     1 
ATOM   9257  H HG11   . VAL C 1 62  ? 254.674 -2.007  127.772 1.00 148.62 ? 62  VAL C HG11   1 
ATOM   9258  H HG12   . VAL C 1 62  ? 254.649 -3.135  128.892 1.00 148.62 ? 62  VAL C HG12   1 
ATOM   9259  H HG13   . VAL C 1 62  ? 253.497 -3.075  127.799 1.00 148.62 ? 62  VAL C HG13   1 
ATOM   9260  H HG21   . VAL C 1 62  ? 253.064 -0.139  127.856 1.00 152.59 ? 62  VAL C HG21   1 
ATOM   9261  H HG22   . VAL C 1 62  ? 251.833 -1.143  127.890 1.00 152.59 ? 62  VAL C HG22   1 
ATOM   9262  H HG23   . VAL C 1 62  ? 251.997 -0.049  129.031 1.00 152.59 ? 62  VAL C HG23   1 
ATOM   9263  N N      . PHE C 1 63  ? 253.196 -4.618  130.864 1.00 122.64 ? 63  PHE C N      1 
ATOM   9264  C CA     . PHE C 1 63  ? 253.917 -5.567  131.706 1.00 124.27 ? 63  PHE C CA     1 
ATOM   9265  C C      . PHE C 1 63  ? 255.041 -6.253  130.933 1.00 128.72 ? 63  PHE C C      1 
ATOM   9266  O O      . PHE C 1 63  ? 254.887 -6.583  129.753 1.00 131.51 ? 63  PHE C O      1 
ATOM   9267  C CB     . PHE C 1 63  ? 252.946 -6.606  132.280 1.00 117.23 ? 63  PHE C CB     1 
ATOM   9268  C CG     . PHE C 1 63  ? 252.138 -6.101  133.449 1.00 112.72 ? 63  PHE C CG     1 
ATOM   9269  C CD1    . PHE C 1 63  ? 251.422 -4.918  133.360 1.00 110.38 ? 63  PHE C CD1    1 
ATOM   9270  C CD2    . PHE C 1 63  ? 252.088 -6.815  134.633 1.00 110.58 ? 63  PHE C CD2    1 
ATOM   9271  C CE1    . PHE C 1 63  ? 250.680 -4.455  134.431 1.00 107.77 ? 63  PHE C CE1    1 
ATOM   9272  C CE2    . PHE C 1 63  ? 251.347 -6.357  135.705 1.00 108.01 ? 63  PHE C CE2    1 
ATOM   9273  C CZ     . PHE C 1 63  ? 250.642 -5.175  135.603 1.00 106.61 ? 63  PHE C CZ     1 
ATOM   9274  H H      . PHE C 1 63  ? 252.746 -4.987  130.231 1.00 147.17 ? 63  PHE C H      1 
ATOM   9275  H HA     . PHE C 1 63  ? 254.316 -5.088  132.449 1.00 149.12 ? 63  PHE C HA     1 
ATOM   9276  H HB2    . PHE C 1 63  ? 252.325 -6.872  131.584 1.00 140.68 ? 63  PHE C HB2    1 
ATOM   9277  H HB3    . PHE C 1 63  ? 253.453 -7.376  132.581 1.00 140.68 ? 63  PHE C HB3    1 
ATOM   9278  H HD1    . PHE C 1 63  ? 251.445 -4.426  132.571 1.00 132.46 ? 63  PHE C HD1    1 
ATOM   9279  H HD2    . PHE C 1 63  ? 252.562 -7.612  134.709 1.00 132.70 ? 63  PHE C HD2    1 
ATOM   9280  H HE1    . PHE C 1 63  ? 250.206 -3.659  134.359 1.00 129.32 ? 63  PHE C HE1    1 
ATOM   9281  H HE2    . PHE C 1 63  ? 251.323 -6.845  136.497 1.00 129.61 ? 63  PHE C HE2    1 
ATOM   9282  H HZ     . PHE C 1 63  ? 250.143 -4.866  136.324 1.00 127.93 ? 63  PHE C HZ     1 
ATOM   9283  N N      . LEU C 1 64  ? 256.171 -6.457  131.608 1.00 128.11 ? 64  LEU C N      1 
ATOM   9284  C CA     . LEU C 1 64  ? 257.312 -7.158  131.026 1.00 132.04 ? 64  LEU C CA     1 
ATOM   9285  C C      . LEU C 1 64  ? 257.435 -8.562  131.608 1.00 132.38 ? 64  LEU C C      1 
ATOM   9286  O O      . LEU C 1 64  ? 257.533 -8.731  132.823 1.00 130.18 ? 64  LEU C O      1 
ATOM   9287  C CB     . LEU C 1 64  ? 258.598 -6.376  131.285 1.00 137.98 ? 64  LEU C CB     1 
ATOM   9288  C CG     . LEU C 1 64  ? 258.631 -4.959  130.712 1.00 144.23 ? 64  LEU C CG     1 
ATOM   9289  C CD1    . LEU C 1 64  ? 259.898 -4.248  131.154 1.00 148.87 ? 64  LEU C CD1    1 
ATOM   9290  C CD2    . LEU C 1 64  ? 258.528 -4.980  129.191 1.00 145.01 ? 64  LEU C CD2    1 
ATOM   9291  H H      . LEU C 1 64  ? 256.301 -6.195  132.416 1.00 153.73 ? 64  LEU C H      1 
ATOM   9292  H HA     . LEU C 1 64  ? 257.188 -7.234  130.067 1.00 158.45 ? 64  LEU C HA     1 
ATOM   9293  H HB2    . LEU C 1 64  ? 258.726 -6.305  132.244 1.00 165.58 ? 64  LEU C HB2    1 
ATOM   9294  H HB3    . LEU C 1 64  ? 259.339 -6.865  130.895 1.00 165.58 ? 64  LEU C HB3    1 
ATOM   9295  H HG     . LEU C 1 64  ? 257.873 -4.461  131.056 1.00 173.08 ? 64  LEU C HG     1 
ATOM   9296  H HD11   . LEU C 1 64  ? 259.903 -3.352  130.783 1.00 178.65 ? 64  LEU C HD11   1 
ATOM   9297  H HD12   . LEU C 1 64  ? 259.913 -4.204  132.123 1.00 178.65 ? 64  LEU C HD12   1 
ATOM   9298  H HD13   . LEU C 1 64  ? 260.667 -4.744  130.833 1.00 178.65 ? 64  LEU C HD13   1 
ATOM   9299  H HD21   . LEU C 1 64  ? 258.552 -4.068  128.861 1.00 174.01 ? 64  LEU C HD21   1 
ATOM   9300  H HD22   . LEU C 1 64  ? 259.276 -5.482  128.832 1.00 174.01 ? 64  LEU C HD22   1 
ATOM   9301  H HD23   . LEU C 1 64  ? 257.693 -5.402  128.938 1.00 174.01 ? 64  LEU C HD23   1 
ATOM   9302  N N      . LEU C 1 65  ? 257.433 -9.564  130.733 1.00 137.04 ? 65  LEU C N      1 
ATOM   9303  C CA     . LEU C 1 65  ? 257.499 -10.960 131.154 1.00 141.52 ? 65  LEU C CA     1 
ATOM   9304  C C      . LEU C 1 65  ? 258.926 -11.498 131.093 1.00 152.41 ? 65  LEU C C      1 
ATOM   9305  O O      . LEU C 1 65  ? 259.640 -11.277 130.114 1.00 157.68 ? 65  LEU C O      1 
ATOM   9306  C CB     . LEU C 1 65  ? 256.588 -11.820 130.274 1.00 136.32 ? 65  LEU C CB     1 
ATOM   9307  C CG     . LEU C 1 65  ? 255.130 -11.368 130.185 1.00 132.12 ? 65  LEU C CG     1 
ATOM   9308  C CD1    . LEU C 1 65  ? 254.352 -12.273 129.249 1.00 130.41 ? 65  LEU C CD1    1 
ATOM   9309  C CD2    . LEU C 1 65  ? 254.482 -11.338 131.562 1.00 129.17 ? 65  LEU C CD2    1 
ATOM   9310  H H      . LEU C 1 65  ? 257.395 -9.460  129.880 1.00 164.44 ? 65  LEU C H      1 
ATOM   9311  H HA     . LEU C 1 65  ? 257.189 -11.031 132.071 1.00 169.82 ? 65  LEU C HA     1 
ATOM   9312  H HB2    . LEU C 1 65  ? 256.947 -11.822 129.373 1.00 163.59 ? 65  LEU C HB2    1 
ATOM   9313  H HB3    . LEU C 1 65  ? 256.590 -12.725 130.624 1.00 163.59 ? 65  LEU C HB3    1 
ATOM   9314  H HG     . LEU C 1 65  ? 255.102 -10.468 129.822 1.00 158.55 ? 65  LEU C HG     1 
ATOM   9315  H HD11   . LEU C 1 65  ? 253.432 -11.968 129.207 1.00 156.49 ? 65  LEU C HD11   1 
ATOM   9316  H HD12   . LEU C 1 65  ? 254.754 -12.235 128.367 1.00 156.49 ? 65  LEU C HD12   1 
ATOM   9317  H HD13   . LEU C 1 65  ? 254.385 -13.181 129.589 1.00 156.49 ? 65  LEU C HD13   1 
ATOM   9318  H HD21   . LEU C 1 65  ? 253.561 -11.048 131.470 1.00 155.00 ? 65  LEU C HD21   1 
ATOM   9319  H HD22   . LEU C 1 65  ? 254.513 -12.229 131.944 1.00 155.00 ? 65  LEU C HD22   1 
ATOM   9320  H HD23   . LEU C 1 65  ? 254.970 -10.719 132.127 1.00 155.00 ? 65  LEU C HD23   1 
ATOM   9321  N N      . PHE C 1 66  ? 259.329 -12.205 132.147 1.00 157.29 ? 66  PHE C N      1 
ATOM   9322  C CA     . PHE C 1 66  ? 260.636 -12.855 132.198 1.00 163.20 ? 66  PHE C CA     1 
ATOM   9323  C C      . PHE C 1 66  ? 260.493 -14.284 132.716 1.00 164.27 ? 66  PHE C C      1 
ATOM   9324  O O      . PHE C 1 66  ? 259.566 -14.580 133.469 1.00 160.26 ? 66  PHE C O      1 
ATOM   9325  C CB     . PHE C 1 66  ? 261.591 -12.072 133.100 1.00 167.60 ? 66  PHE C CB     1 
ATOM   9326  C CG     . PHE C 1 66  ? 261.913 -10.697 132.591 1.00 173.40 ? 66  PHE C CG     1 
ATOM   9327  C CD1    . PHE C 1 66  ? 262.826 -10.519 131.563 1.00 177.03 ? 66  PHE C CD1    1 
ATOM   9328  C CD2    . PHE C 1 66  ? 261.304 -9.582  133.141 1.00 175.39 ? 66  PHE C CD2    1 
ATOM   9329  C CE1    . PHE C 1 66  ? 263.123 -9.255  131.091 1.00 180.62 ? 66  PHE C CE1    1 
ATOM   9330  C CE2    . PHE C 1 66  ? 261.597 -8.315  132.675 1.00 179.05 ? 66  PHE C CE2    1 
ATOM   9331  C CZ     . PHE C 1 66  ? 262.508 -8.152  131.648 1.00 181.63 ? 66  PHE C CZ     1 
ATOM   9332  H H      . PHE C 1 66  ? 258.857 -12.323 132.855 1.00 188.75 ? 66  PHE C H      1 
ATOM   9333  H HA     . PHE C 1 66  ? 261.015 -12.889 131.306 1.00 195.84 ? 66  PHE C HA     1 
ATOM   9334  H HB2    . PHE C 1 66  ? 261.187 -11.977 133.976 1.00 201.12 ? 66  PHE C HB2    1 
ATOM   9335  H HB3    . PHE C 1 66  ? 262.425 -12.563 133.174 1.00 201.12 ? 66  PHE C HB3    1 
ATOM   9336  H HD1    . PHE C 1 66  ? 263.242 -11.260 131.185 1.00 212.43 ? 66  PHE C HD1    1 
ATOM   9337  H HD2    . PHE C 1 66  ? 260.689 -9.687  133.831 1.00 210.46 ? 66  PHE C HD2    1 
ATOM   9338  H HE1    . PHE C 1 66  ? 263.737 -9.148  130.401 1.00 216.74 ? 66  PHE C HE1    1 
ATOM   9339  H HE2    . PHE C 1 66  ? 261.181 -7.573  133.051 1.00 214.86 ? 66  PHE C HE2    1 
ATOM   9340  H HZ     . PHE C 1 66  ? 262.707 -7.300  131.334 1.00 217.96 ? 66  PHE C HZ     1 
ATOM   9341  N N      . PRO C 1 67  ? 261.412 -15.179 132.314 1.00 171.15 ? 67  PRO C N      1 
ATOM   9342  C CA     . PRO C 1 67  ? 261.343 -16.565 132.790 1.00 173.25 ? 67  PRO C CA     1 
ATOM   9343  C C      . PRO C 1 67  ? 261.569 -16.658 134.298 1.00 176.39 ? 67  PRO C C      1 
ATOM   9344  O O      . PRO C 1 67  ? 262.277 -15.822 134.861 1.00 176.12 ? 67  PRO C O      1 
ATOM   9345  C CB     . PRO C 1 67  ? 262.478 -17.256 132.027 1.00 174.17 ? 67  PRO C CB     1 
ATOM   9346  C CG     . PRO C 1 67  ? 263.428 -16.162 131.678 1.00 176.04 ? 67  PRO C CG     1 
ATOM   9347  C CD     . PRO C 1 67  ? 262.580 -14.951 131.444 1.00 175.37 ? 67  PRO C CD     1 
ATOM   9348  H HA     . PRO C 1 67  ? 260.494 -16.970 132.556 1.00 207.90 ? 67  PRO C HA     1 
ATOM   9349  H HB2    . PRO C 1 67  ? 262.906 -17.912 132.600 1.00 209.01 ? 67  PRO C HB2    1 
ATOM   9350  H HB3    . PRO C 1 67  ? 262.127 -17.675 131.226 1.00 209.01 ? 67  PRO C HB3    1 
ATOM   9351  H HG2    . PRO C 1 67  ? 264.038 -16.013 132.417 1.00 211.25 ? 67  PRO C HG2    1 
ATOM   9352  H HG3    . PRO C 1 67  ? 263.916 -16.398 130.874 1.00 211.25 ? 67  PRO C HG3    1 
ATOM   9353  H HD2    . PRO C 1 67  ? 263.053 -14.149 131.715 1.00 210.45 ? 67  PRO C HD2    1 
ATOM   9354  H HD3    . PRO C 1 67  ? 262.305 -14.906 130.514 1.00 210.45 ? 67  PRO C HD3    1 
ATOM   9355  N N      . GLU C 1 68  ? 260.972 -17.660 134.938 1.00 180.03 ? 68  GLU C N      1 
ATOM   9356  C CA     . GLU C 1 68  ? 261.062 -17.803 136.390 1.00 182.69 ? 68  GLU C CA     1 
ATOM   9357  C C      . GLU C 1 68  ? 262.475 -18.140 136.873 1.00 184.99 ? 68  GLU C C      1 
ATOM   9358  O O      . GLU C 1 68  ? 262.749 -18.089 138.074 1.00 187.36 ? 68  GLU C O      1 
ATOM   9359  C CB     . GLU C 1 68  ? 260.072 -18.859 136.894 1.00 179.70 ? 68  GLU C CB     1 
ATOM   9360  C CG     . GLU C 1 68  ? 258.661 -18.333 137.113 1.00 178.05 ? 68  GLU C CG     1 
ATOM   9361  C CD     . GLU C 1 68  ? 257.819 -19.257 137.978 1.00 175.43 ? 68  GLU C CD     1 
ATOM   9362  O OE1    . GLU C 1 68  ? 257.985 -20.491 137.872 1.00 173.74 ? 68  GLU C OE1    1 
ATOM   9363  O OE2    . GLU C 1 68  ? 256.997 -18.749 138.771 1.00 174.95 ? 68  GLU C OE2    1 
ATOM   9364  H H      . GLU C 1 68  ? 260.507 -18.273 134.554 1.00 216.04 ? 68  GLU C H      1 
ATOM   9365  H HA     . GLU C 1 68  ? 260.813 -16.957 136.795 1.00 219.23 ? 68  GLU C HA     1 
ATOM   9366  H HB2    . GLU C 1 68  ? 260.023 -19.575 136.242 1.00 215.63 ? 68  GLU C HB2    1 
ATOM   9367  H HB3    . GLU C 1 68  ? 260.393 -19.207 137.741 1.00 215.63 ? 68  GLU C HB3    1 
ATOM   9368  H HG2    . GLU C 1 68  ? 258.709 -17.470 137.554 1.00 213.67 ? 68  GLU C HG2    1 
ATOM   9369  H HG3    . GLU C 1 68  ? 258.220 -18.242 136.253 1.00 213.67 ? 68  GLU C HG3    1 
ATOM   9370  N N      . GLU C 1 69  ? 263.369 -18.480 135.947 1.00 182.02 ? 69  GLU C N      1 
ATOM   9371  C CA     . GLU C 1 69  ? 264.775 -18.699 136.288 1.00 179.07 ? 69  GLU C CA     1 
ATOM   9372  C C      . GLU C 1 69  ? 265.446 -17.356 136.585 1.00 171.15 ? 69  GLU C C      1 
ATOM   9373  O O      . GLU C 1 69  ? 266.425 -16.978 135.944 1.00 175.21 ? 69  GLU C O      1 
ATOM   9374  C CB     . GLU C 1 69  ? 265.510 -19.432 135.158 1.00 184.34 ? 69  GLU C CB     1 
ATOM   9375  C CG     . GLU C 1 69  ? 265.222 -20.931 135.080 1.00 185.59 ? 69  GLU C CG     1 
ATOM   9376  C CD     . GLU C 1 69  ? 263.800 -21.249 134.654 1.00 186.21 ? 69  GLU C CD     1 
ATOM   9377  O OE1    . GLU C 1 69  ? 263.108 -20.344 134.144 1.00 187.76 ? 69  GLU C OE1    1 
ATOM   9378  O OE2    . GLU C 1 69  ? 263.376 -22.411 134.830 1.00 184.95 ? 69  GLU C OE2    1 
ATOM   9379  H H      . GLU C 1 69  ? 263.188 -18.591 135.113 1.00 218.43 ? 69  GLU C H      1 
ATOM   9380  H HA     . GLU C 1 69  ? 264.827 -19.246 137.087 1.00 214.88 ? 69  GLU C HA     1 
ATOM   9381  H HB2    . GLU C 1 69  ? 265.248 -19.038 134.311 1.00 221.21 ? 69  GLU C HB2    1 
ATOM   9382  H HB3    . GLU C 1 69  ? 266.465 -19.323 135.287 1.00 221.21 ? 69  GLU C HB3    1 
ATOM   9383  H HG2    . GLU C 1 69  ? 265.824 -21.333 134.434 1.00 222.70 ? 69  GLU C HG2    1 
ATOM   9384  H HG3    . GLU C 1 69  ? 265.367 -21.324 135.954 1.00 222.70 ? 69  GLU C HG3    1 
ATOM   9385  N N      . PHE C 1 70  ? 264.905 -16.648 137.573 1.00 158.29 ? 70  PHE C N      1 
ATOM   9386  C CA     . PHE C 1 70  ? 265.337 -15.299 137.907 1.00 150.00 ? 70  PHE C CA     1 
ATOM   9387  C C      . PHE C 1 70  ? 265.108 -15.046 139.390 1.00 152.58 ? 70  PHE C C      1 
ATOM   9388  O O      . PHE C 1 70  ? 264.207 -15.629 139.996 1.00 137.82 ? 70  PHE C O      1 
ATOM   9389  C CB     . PHE C 1 70  ? 264.542 -14.273 137.095 1.00 143.55 ? 70  PHE C CB     1 
ATOM   9390  C CG     . PHE C 1 70  ? 265.260 -13.764 135.873 1.00 142.15 ? 70  PHE C CG     1 
ATOM   9391  C CD1    . PHE C 1 70  ? 265.244 -14.485 134.688 1.00 141.24 ? 70  PHE C CD1    1 
ATOM   9392  C CD2    . PHE C 1 70  ? 265.932 -12.552 135.904 1.00 142.58 ? 70  PHE C CD2    1 
ATOM   9393  C CE1    . PHE C 1 70  ? 265.901 -14.012 133.560 1.00 141.51 ? 70  PHE C CE1    1 
ATOM   9394  C CE2    . PHE C 1 70  ? 266.588 -12.074 134.782 1.00 143.06 ? 70  PHE C CE2    1 
ATOM   9395  C CZ     . PHE C 1 70  ? 266.572 -12.805 133.608 1.00 142.42 ? 70  PHE C CZ     1 
ATOM   9396  H H      . PHE C 1 70  ? 264.270 -16.938 138.075 1.00 189.94 ? 70  PHE C H      1 
ATOM   9397  H HA     . PHE C 1 70  ? 266.281 -15.194 137.711 1.00 180.00 ? 70  PHE C HA     1 
ATOM   9398  H HB2    . PHE C 1 70  ? 263.714 -14.683 136.802 1.00 172.26 ? 70  PHE C HB2    1 
ATOM   9399  H HB3    . PHE C 1 70  ? 264.348 -13.510 137.662 1.00 172.26 ? 70  PHE C HB3    1 
ATOM   9400  H HD1    . PHE C 1 70  ? 264.795 -15.298 134.651 1.00 169.49 ? 70  PHE C HD1    1 
ATOM   9401  H HD2    . PHE C 1 70  ? 265.948 -12.056 136.691 1.00 171.10 ? 70  PHE C HD2    1 
ATOM   9402  H HE1    . PHE C 1 70  ? 265.887 -14.506 132.772 1.00 169.81 ? 70  PHE C HE1    1 
ATOM   9403  H HE2    . PHE C 1 70  ? 267.039 -11.262 134.817 1.00 171.67 ? 70  PHE C HE2    1 
ATOM   9404  H HZ     . PHE C 1 70  ? 267.012 -12.486 132.853 1.00 170.91 ? 70  PHE C HZ     1 
ATOM   9405  N N      . SER C 1 71  ? 265.922 -14.171 139.971 1.00 174.33 ? 71  SER C N      1 
ATOM   9406  C CA     . SER C 1 71  ? 265.767 -13.800 141.371 1.00 185.50 ? 71  SER C CA     1 
ATOM   9407  C C      . SER C 1 71  ? 264.552 -12.895 141.525 1.00 182.83 ? 71  SER C C      1 
ATOM   9408  O O      . SER C 1 71  ? 264.165 -12.201 140.585 1.00 188.95 ? 71  SER C O      1 
ATOM   9409  C CB     . SER C 1 71  ? 267.017 -13.078 141.876 1.00 192.55 ? 71  SER C CB     1 
ATOM   9410  O OG     . SER C 1 71  ? 268.183 -13.851 141.648 1.00 193.28 ? 71  SER C OG     1 
ATOM   9411  H H      . SER C 1 71  ? 266.575 -13.778 139.574 1.00 209.20 ? 71  SER C H      1 
ATOM   9412  H HA     . SER C 1 71  ? 265.631 -14.596 141.907 1.00 222.60 ? 71  SER C HA     1 
ATOM   9413  H HB2    . SER C 1 71  ? 267.104 -12.233 141.408 1.00 231.06 ? 71  SER C HB2    1 
ATOM   9414  H HB3    . SER C 1 71  ? 266.926 -12.920 142.829 1.00 231.06 ? 71  SER C HB3    1 
ATOM   9415  H HG     . SER C 1 71  ? 268.859 -13.441 141.930 1.00 231.94 ? 71  SER C HG     1 
ATOM   9416  N N      . LYS C 1 72  ? 263.953 -12.905 142.712 1.00 170.51 ? 72  LYS C N      1 
ATOM   9417  C CA     . LYS C 1 72  ? 262.798 -12.058 142.989 1.00 161.33 ? 72  LYS C CA     1 
ATOM   9418  C C      . LYS C 1 72  ? 263.204 -10.582 143.003 1.00 163.50 ? 72  LYS C C      1 
ATOM   9419  O O      . LYS C 1 72  ? 262.351 -9.695  142.917 1.00 163.28 ? 72  LYS C O      1 
ATOM   9420  C CB     . LYS C 1 72  ? 262.160 -12.445 144.328 1.00 152.96 ? 72  LYS C CB     1 
ATOM   9421  C CG     . LYS C 1 72  ? 260.728 -11.949 144.508 1.00 148.03 ? 72  LYS C CG     1 
ATOM   9422  C CD     . LYS C 1 72  ? 260.121 -12.441 145.818 1.00 144.11 ? 72  LYS C CD     1 
ATOM   9423  C CE     . LYS C 1 72  ? 258.621 -12.181 145.879 1.00 141.60 ? 72  LYS C CE     1 
ATOM   9424  N NZ     . LYS C 1 72  ? 258.293 -10.733 145.767 1.00 142.38 ? 72  LYS C NZ     1 
ATOM   9425  H H      . LYS C 1 72  ? 264.198 -13.394 143.375 1.00 204.61 ? 72  LYS C H      1 
ATOM   9426  H HA     . LYS C 1 72  ? 262.136 -12.183 142.291 1.00 193.60 ? 72  LYS C HA     1 
ATOM   9427  H HB2    . LYS C 1 72  ? 262.147 -13.413 144.399 1.00 183.56 ? 72  LYS C HB2    1 
ATOM   9428  H HB3    . LYS C 1 72  ? 262.694 -12.072 145.047 1.00 183.56 ? 72  LYS C HB3    1 
ATOM   9429  H HG2    . LYS C 1 72  ? 260.725 -10.979 144.517 1.00 177.63 ? 72  LYS C HG2    1 
ATOM   9430  H HG3    . LYS C 1 72  ? 260.182 -12.278 143.777 1.00 177.63 ? 72  LYS C HG3    1 
ATOM   9431  H HD2    . LYS C 1 72  ? 260.266 -13.397 145.898 1.00 172.94 ? 72  LYS C HD2    1 
ATOM   9432  H HD3    . LYS C 1 72  ? 260.539 -11.975 146.559 1.00 172.94 ? 72  LYS C HD3    1 
ATOM   9433  H HE2    . LYS C 1 72  ? 258.188 -12.645 145.145 1.00 169.92 ? 72  LYS C HE2    1 
ATOM   9434  H HE3    . LYS C 1 72  ? 258.276 -12.503 146.726 1.00 169.92 ? 72  LYS C HE3    1 
ATOM   9435  H HZ1    . LYS C 1 72  ? 257.412 -10.616 145.806 1.00 170.85 ? 72  LYS C HZ1    1 
ATOM   9436  H HZ2    . LYS C 1 72  ? 258.674 -10.283 146.434 1.00 170.85 ? 72  LYS C HZ2    1 
ATOM   9437  H HZ3    . LYS C 1 72  ? 258.594 -10.412 144.993 1.00 170.85 ? 72  LYS C HZ3    1 
ATOM   9438  N N      . GLU C 1 73  ? 264.509 -10.330 143.105 1.00 165.63 ? 73  GLU C N      1 
ATOM   9439  C CA     . GLU C 1 73  ? 265.045 -8.971  143.121 1.00 168.42 ? 73  GLU C CA     1 
ATOM   9440  C C      . GLU C 1 73  ? 265.793 -8.646  141.829 1.00 171.47 ? 73  GLU C C      1 
ATOM   9441  O O      . GLU C 1 73  ? 266.434 -7.601  141.724 1.00 173.09 ? 73  GLU C O      1 
ATOM   9442  C CB     . GLU C 1 73  ? 265.977 -8.781  144.322 1.00 168.43 ? 73  GLU C CB     1 
ATOM   9443  C CG     . GLU C 1 73  ? 265.297 -8.968  145.673 1.00 167.28 ? 73  GLU C CG     1 
ATOM   9444  C CD     . GLU C 1 73  ? 266.220 -8.674  146.843 1.00 169.67 ? 73  GLU C CD     1 
ATOM   9445  O OE1    . GLU C 1 73  ? 267.406 -8.358  146.605 1.00 172.77 ? 73  GLU C OE1    1 
ATOM   9446  O OE2    . GLU C 1 73  ? 265.759 -8.754  148.001 1.00 168.62 ? 73  GLU C OE2    1 
ATOM   9447  H H      . GLU C 1 73  ? 265.112 -10.940 143.167 1.00 198.76 ? 73  GLU C H      1 
ATOM   9448  H HA     . GLU C 1 73  ? 264.311 -8.344  143.208 1.00 202.11 ? 73  GLU C HA     1 
ATOM   9449  H HB2    . GLU C 1 73  ? 266.698 -9.426  144.262 1.00 202.12 ? 73  GLU C HB2    1 
ATOM   9450  H HB3    . GLU C 1 73  ? 266.339 -7.881  144.296 1.00 202.12 ? 73  GLU C HB3    1 
ATOM   9451  H HG2    . GLU C 1 73  ? 264.538 -8.367  145.731 1.00 200.74 ? 73  GLU C HG2    1 
ATOM   9452  H HG3    . GLU C 1 73  ? 264.998 -9.888  145.751 1.00 200.74 ? 73  GLU C HG3    1 
ATOM   9453  N N      . GLU C 1 74  ? 265.710 -9.542  140.849 1.00 172.27 ? 74  GLU C N      1 
ATOM   9454  C CA     . GLU C 1 74  ? 266.340 -9.315  139.551 1.00 176.30 ? 74  GLU C CA     1 
ATOM   9455  C C      . GLU C 1 74  ? 265.419 -8.548  138.603 1.00 175.28 ? 74  GLU C C      1 
ATOM   9456  O O      . GLU C 1 74  ? 265.763 -8.314  137.444 1.00 175.34 ? 74  GLU C O      1 
ATOM   9457  C CB     . GLU C 1 74  ? 266.758 -10.643 138.917 1.00 179.93 ? 74  GLU C CB     1 
ATOM   9458  C CG     . GLU C 1 74  ? 268.223 -10.989 139.131 1.00 184.51 ? 74  GLU C CG     1 
ATOM   9459  C CD     . GLU C 1 74  ? 268.611 -12.303 138.484 1.00 186.20 ? 74  GLU C CD     1 
ATOM   9460  O OE1    . GLU C 1 74  ? 269.797 -12.466 138.131 1.00 189.60 ? 74  GLU C OE1    1 
ATOM   9461  O OE2    . GLU C 1 74  ? 267.729 -13.173 138.328 1.00 183.78 ? 74  GLU C OE2    1 
ATOM   9462  H H      . GLU C 1 74  ? 265.293 -10.291 140.910 1.00 206.73 ? 74  GLU C H      1 
ATOM   9463  H HA     . GLU C 1 74  ? 267.141 -8.783  139.681 1.00 211.55 ? 74  GLU C HA     1 
ATOM   9464  H HB2    . GLU C 1 74  ? 266.226 -11.355 139.304 1.00 215.91 ? 74  GLU C HB2    1 
ATOM   9465  H HB3    . GLU C 1 74  ? 266.601 -10.596 137.961 1.00 215.91 ? 74  GLU C HB3    1 
ATOM   9466  H HG2    . GLU C 1 74  ? 268.773 -10.290 138.744 1.00 221.42 ? 74  GLU C HG2    1 
ATOM   9467  H HG3    . GLU C 1 74  ? 268.396 -11.060 140.082 1.00 221.42 ? 74  GLU C HG3    1 
ATOM   9468  N N      . LEU C 1 75  ? 264.251 -8.154  139.101 1.00 174.15 ? 75  LEU C N      1 
ATOM   9469  C CA     . LEU C 1 75  ? 263.318 -7.358  138.313 1.00 173.65 ? 75  LEU C CA     1 
ATOM   9470  C C      . LEU C 1 75  ? 263.832 -5.932  138.131 1.00 177.67 ? 75  LEU C C      1 
ATOM   9471  O O      . LEU C 1 75  ? 263.369 -5.204  137.254 1.00 179.05 ? 75  LEU C O      1 
ATOM   9472  C CB     . LEU C 1 75  ? 261.942 -7.337  138.980 1.00 168.73 ? 75  LEU C CB     1 
ATOM   9473  C CG     . LEU C 1 75  ? 261.218 -8.683  139.071 1.00 162.14 ? 75  LEU C CG     1 
ATOM   9474  C CD1    . LEU C 1 75  ? 259.933 -8.548  139.879 1.00 158.01 ? 75  LEU C CD1    1 
ATOM   9475  C CD2    . LEU C 1 75  ? 260.921 -9.242  137.682 1.00 160.73 ? 75  LEU C CD2    1 
ATOM   9476  H H      . LEU C 1 75  ? 263.975 -8.336  139.894 1.00 208.98 ? 75  LEU C H      1 
ATOM   9477  H HA     . LEU C 1 75  ? 263.221 -7.758  137.435 1.00 208.38 ? 75  LEU C HA     1 
ATOM   9478  H HB2    . LEU C 1 75  ? 262.047 -7.004  139.885 1.00 202.48 ? 75  LEU C HB2    1 
ATOM   9479  H HB3    . LEU C 1 75  ? 261.369 -6.734  138.480 1.00 202.48 ? 75  LEU C HB3    1 
ATOM   9480  H HG     . LEU C 1 75  ? 261.792 -9.317  139.530 1.00 194.56 ? 75  LEU C HG     1 
ATOM   9481  H HD11   . LEU C 1 75  ? 259.495 -9.412  139.922 1.00 189.61 ? 75  LEU C HD11   1 
ATOM   9482  H HD12   . LEU C 1 75  ? 260.154 -8.244  140.774 1.00 189.61 ? 75  LEU C HD12   1 
ATOM   9483  H HD13   . LEU C 1 75  ? 259.354 -7.903  139.444 1.00 189.61 ? 75  LEU C HD13   1 
ATOM   9484  H HD21   . LEU C 1 75  ? 260.463 -10.093 137.775 1.00 192.87 ? 75  LEU C HD21   1 
ATOM   9485  H HD22   . LEU C 1 75  ? 260.357 -8.614  137.203 1.00 192.87 ? 75  LEU C HD22   1 
ATOM   9486  H HD23   . LEU C 1 75  ? 261.757 -9.366  137.206 1.00 192.87 ? 75  LEU C HD23   1 
ATOM   9487  N N      . ARG C 1 76  ? 264.788 -5.542  138.969 1.00 181.42 ? 76  ARG C N      1 
ATOM   9488  C CA     . ARG C 1 76  ? 265.411 -4.225  138.878 1.00 191.22 ? 76  ARG C CA     1 
ATOM   9489  C C      . ARG C 1 76  ? 266.858 -4.354  138.402 1.00 214.12 ? 76  ARG C C      1 
ATOM   9490  O O      . ARG C 1 76  ? 267.705 -3.508  138.700 1.00 209.12 ? 76  ARG C O      1 
ATOM   9491  C CB     . ARG C 1 76  ? 265.332 -3.503  140.227 1.00 183.87 ? 76  ARG C CB     1 
ATOM   9492  C CG     . ARG C 1 76  ? 265.973 -4.246  141.388 1.00 179.55 ? 76  ARG C CG     1 
ATOM   9493  C CD     . ARG C 1 76  ? 265.334 -3.857  142.714 1.00 176.06 ? 76  ARG C CD     1 
ATOM   9494  N NE     . ARG C 1 76  ? 265.408 -2.420  142.967 1.00 174.12 ? 76  ARG C NE     1 
ATOM   9495  C CZ     . ARG C 1 76  ? 264.857 -1.811  144.014 1.00 169.39 ? 76  ARG C CZ     1 
ATOM   9496  N NH1    . ARG C 1 76  ? 264.982 -0.499  144.154 1.00 170.95 ? 76  ARG C NH1    1 
ATOM   9497  N NH2    . ARG C 1 76  ? 264.181 -2.507  144.919 1.00 163.78 ? 76  ARG C NH2    1 
ATOM   9498  H H      . ARG C 1 76  ? 265.097 -6.029  139.607 1.00 217.70 ? 76  ARG C H      1 
ATOM   9499  H HA     . ARG C 1 76  ? 264.929 -3.693  138.226 1.00 229.47 ? 76  ARG C HA     1 
ATOM   9500  H HB2    . ARG C 1 76  ? 265.780 -2.646  140.145 1.00 220.65 ? 76  ARG C HB2    1 
ATOM   9501  H HB3    . ARG C 1 76  ? 264.398 -3.362  140.448 1.00 220.65 ? 76  ARG C HB3    1 
ATOM   9502  H HG2    . ARG C 1 76  ? 265.856 -5.201  141.261 1.00 215.46 ? 76  ARG C HG2    1 
ATOM   9503  H HG3    . ARG C 1 76  ? 266.917 -4.026  141.428 1.00 215.46 ? 76  ARG C HG3    1 
ATOM   9504  H HD2    . ARG C 1 76  ? 264.398 -4.113  142.703 1.00 211.27 ? 76  ARG C HD2    1 
ATOM   9505  H HD3    . ARG C 1 76  ? 265.795 -4.314  143.435 1.00 211.27 ? 76  ARG C HD3    1 
ATOM   9506  H HE     . ARG C 1 76  ? 265.837 -1.935  142.401 1.00 208.94 ? 76  ARG C HE     1 
ATOM   9507  H HH11   . ARG C 1 76  ? 265.419 -0.043  143.570 1.00 205.14 ? 76  ARG C HH11   1 
ATOM   9508  H HH12   . ARG C 1 76  ? 264.626 -0.103  144.830 1.00 205.14 ? 76  ARG C HH12   1 
ATOM   9509  H HH21   . ARG C 1 76  ? 264.097 -3.358  144.832 1.00 196.53 ? 76  ARG C HH21   1 
ATOM   9510  H HH22   . ARG C 1 76  ? 263.827 -2.106  145.593 1.00 196.53 ? 76  ARG C HH22   1 
ATOM   9511  N N      . GLU C 1 77  ? 267.122 -5.427  137.660 1.00 243.73 ? 77  GLU C N      1 
ATOM   9512  C CA     . GLU C 1 77  ? 268.416 -5.646  137.023 1.00 264.88 ? 77  GLU C CA     1 
ATOM   9513  C C      . GLU C 1 77  ? 268.274 -5.435  135.521 1.00 257.28 ? 77  GLU C C      1 
ATOM   9514  O O      . GLU C 1 77  ? 269.234 -5.070  134.842 1.00 272.95 ? 77  GLU C O      1 
ATOM   9515  C CB     . GLU C 1 77  ? 268.925 -7.062  137.313 1.00 280.09 ? 77  GLU C CB     1 
ATOM   9516  C CG     . GLU C 1 77  ? 270.191 -7.457  136.555 1.00 291.73 ? 77  GLU C CG     1 
ATOM   9517  C CD     . GLU C 1 77  ? 271.366 -6.542  136.846 1.00 301.55 ? 77  GLU C CD     1 
ATOM   9518  O OE1    . GLU C 1 77  ? 272.296 -6.485  136.013 1.00 305.56 ? 77  GLU C OE1    1 
ATOM   9519  O OE2    . GLU C 1 77  ? 271.365 -5.888  137.910 1.00 304.54 ? 77  GLU C OE2    1 
ATOM   9520  H H      . GLU C 1 77  ? 266.555 -6.055  137.509 1.00 292.48 ? 77  GLU C H      1 
ATOM   9521  H HA     . GLU C 1 77  ? 269.061 -5.008  137.366 1.00 317.86 ? 77  GLU C HA     1 
ATOM   9522  H HB2    . GLU C 1 77  ? 269.116 -7.133  138.261 1.00 336.11 ? 77  GLU C HB2    1 
ATOM   9523  H HB3    . GLU C 1 77  ? 268.230 -7.695  137.073 1.00 336.11 ? 77  GLU C HB3    1 
ATOM   9524  H HG2    . GLU C 1 77  ? 270.443 -8.358  136.810 1.00 350.08 ? 77  GLU C HG2    1 
ATOM   9525  H HG3    . GLU C 1 77  ? 270.013 -7.420  135.602 1.00 350.08 ? 77  GLU C HG3    1 
ATOM   9526  N N      . ARG C 1 78  ? 267.068 -5.671  135.011 1.00 225.57 ? 78  ARG C N      1 
ATOM   9527  C CA     . ARG C 1 78  ? 266.775 -5.471  133.596 1.00 202.23 ? 78  ARG C CA     1 
ATOM   9528  C C      . ARG C 1 78  ? 265.397 -4.847  133.410 1.00 191.82 ? 78  ARG C C      1 
ATOM   9529  O O      . ARG C 1 78  ? 265.190 -4.052  132.495 1.00 191.17 ? 78  ARG C O      1 
ATOM   9530  C CB     . ARG C 1 78  ? 266.851 -6.802  132.840 1.00 193.81 ? 78  ARG C CB     1 
ATOM   9531  C CG     . ARG C 1 78  ? 266.583 -6.697  131.341 1.00 191.61 ? 78  ARG C CG     1 
ATOM   9532  C CD     . ARG C 1 78  ? 267.689 -5.941  130.616 1.00 193.87 ? 78  ARG C CD     1 
ATOM   9533  N NE     . ARG C 1 78  ? 267.302 -5.566  129.257 1.00 196.02 ? 78  ARG C NE     1 
ATOM   9534  C CZ     . ARG C 1 78  ? 268.093 -4.924  128.402 1.00 199.89 ? 78  ARG C CZ     1 
ATOM   9535  N NH1    . ARG C 1 78  ? 269.325 -4.581  128.756 1.00 202.60 ? 78  ARG C NH1    1 
ATOM   9536  N NH2    . ARG C 1 78  ? 267.652 -4.625  127.188 1.00 200.57 ? 78  ARG C NH2    1 
ATOM   9537  H H      . ARG C 1 78  ? 266.396 -5.950  135.469 1.00 270.68 ? 78  ARG C H      1 
ATOM   9538  H HA     . ARG C 1 78  ? 267.434 -4.869  133.216 1.00 242.67 ? 78  ARG C HA     1 
ATOM   9539  H HB2    . ARG C 1 78  ? 267.739 -7.173  132.955 1.00 232.57 ? 78  ARG C HB2    1 
ATOM   9540  H HB3    . ARG C 1 78  ? 266.193 -7.408  133.215 1.00 232.57 ? 78  ARG C HB3    1 
ATOM   9541  H HG2    . ARG C 1 78  ? 266.528 -7.589  130.964 1.00 229.94 ? 78  ARG C HG2    1 
ATOM   9542  H HG3    . ARG C 1 78  ? 265.749 -6.222  131.199 1.00 229.94 ? 78  ARG C HG3    1 
ATOM   9543  H HD2    . ARG C 1 78  ? 267.894 -5.130  131.106 1.00 232.65 ? 78  ARG C HD2    1 
ATOM   9544  H HD3    . ARG C 1 78  ? 268.476 -6.506  130.561 1.00 232.65 ? 78  ARG C HD3    1 
ATOM   9545  H HE     . ARG C 1 78  ? 266.511 -5.775  128.993 1.00 235.23 ? 78  ARG C HE     1 
ATOM   9546  H HH11   . ARG C 1 78  ? 269.616 -4.772  129.542 1.00 243.12 ? 78  ARG C HH11   1 
ATOM   9547  H HH12   . ARG C 1 78  ? 269.833 -4.166  128.199 1.00 243.12 ? 78  ARG C HH12   1 
ATOM   9548  H HH21   . ARG C 1 78  ? 266.854 -4.845  126.954 1.00 240.69 ? 78  ARG C HH21   1 
ATOM   9549  H HH22   . ARG C 1 78  ? 268.163 -4.210  126.635 1.00 240.69 ? 78  ARG C HH22   1 
ATOM   9550  N N      . GLY C 1 79  ? 264.459 -5.211  134.279 1.00 184.26 ? 79  GLY C N      1 
ATOM   9551  C CA     . GLY C 1 79  ? 263.093 -4.729  134.175 1.00 176.94 ? 79  GLY C CA     1 
ATOM   9552  C C      . GLY C 1 79  ? 262.990 -3.218  134.262 1.00 171.60 ? 79  GLY C C      1 
ATOM   9553  O O      . GLY C 1 79  ? 262.220 -2.599  133.530 1.00 169.73 ? 79  GLY C O      1 
ATOM   9554  H H      . GLY C 1 79  ? 264.593 -5.742  134.942 1.00 221.11 ? 79  GLY C H      1 
ATOM   9555  H HA2    . GLY C 1 79  ? 262.716 -5.012  133.327 1.00 212.33 ? 79  GLY C HA2    1 
ATOM   9556  H HA3    . GLY C 1 79  ? 262.562 -5.113  134.890 1.00 212.33 ? 79  GLY C HA3    1 
ATOM   9557  N N      . LEU C 1 80  ? 263.772 -2.622  135.156 1.00 170.71 ? 80  LEU C N      1 
ATOM   9558  C CA     . LEU C 1 80  ? 263.763 -1.174  135.326 1.00 174.62 ? 80  LEU C CA     1 
ATOM   9559  C C      . LEU C 1 80  ? 264.597 -0.473  134.255 1.00 184.26 ? 80  LEU C C      1 
ATOM   9560  O O      . LEU C 1 80  ? 264.449 0.730   134.036 1.00 183.83 ? 80  LEU C O      1 
ATOM   9561  C CB     . LEU C 1 80  ? 264.268 -0.800  136.722 1.00 171.94 ? 80  LEU C CB     1 
ATOM   9562  C CG     . LEU C 1 80  ? 263.187 -0.686  137.801 1.00 169.13 ? 80  LEU C CG     1 
ATOM   9563  C CD1    . LEU C 1 80  ? 262.398 -1.980  137.938 1.00 165.42 ? 80  LEU C CD1    1 
ATOM   9564  C CD2    . LEU C 1 80  ? 263.804 -0.292  139.135 1.00 170.02 ? 80  LEU C CD2    1 
ATOM   9565  H H      . LEU C 1 80  ? 264.317 -3.035  135.677 1.00 204.85 ? 80  LEU C H      1 
ATOM   9566  H HA     . LEU C 1 80  ? 262.851 -0.856  135.247 1.00 209.54 ? 80  LEU C HA     1 
ATOM   9567  H HB2    . LEU C 1 80  ? 264.899 -1.478  137.012 1.00 206.33 ? 80  LEU C HB2    1 
ATOM   9568  H HB3    . LEU C 1 80  ? 264.717 0.058   136.666 1.00 206.33 ? 80  LEU C HB3    1 
ATOM   9569  H HG     . LEU C 1 80  ? 262.565 0.013   137.546 1.00 202.95 ? 80  LEU C HG     1 
ATOM   9570  H HD11   . LEU C 1 80  ? 261.726 -1.868  138.629 1.00 198.50 ? 80  LEU C HD11   1 
ATOM   9571  H HD12   . LEU C 1 80  ? 261.971 -2.181  137.091 1.00 198.50 ? 80  LEU C HD12   1 
ATOM   9572  H HD13   . LEU C 1 80  ? 263.006 -2.696  138.181 1.00 198.50 ? 80  LEU C HD13   1 
ATOM   9573  H HD21   . LEU C 1 80  ? 263.101 -0.227  139.800 1.00 204.02 ? 80  LEU C HD21   1 
ATOM   9574  H HD22   . LEU C 1 80  ? 264.446 -0.970  139.398 1.00 204.02 ? 80  LEU C HD22   1 
ATOM   9575  H HD23   . LEU C 1 80  ? 264.247 0.564   139.037 1.00 204.02 ? 80  LEU C HD23   1 
ATOM   9576  N N      . GLU C 1 81  ? 265.468 -1.226  133.587 1.00 194.37 ? 81  GLU C N      1 
ATOM   9577  C CA     . GLU C 1 81  ? 266.298 -0.668  132.523 1.00 205.98 ? 81  GLU C CA     1 
ATOM   9578  C C      . GLU C 1 81  ? 265.456 -0.343  131.292 1.00 207.32 ? 81  GLU C C      1 
ATOM   9579  O O      . GLU C 1 81  ? 265.725 0.628   130.585 1.00 213.18 ? 81  GLU C O      1 
ATOM   9580  C CB     . GLU C 1 81  ? 267.424 -1.635  132.143 1.00 212.32 ? 81  GLU C CB     1 
ATOM   9581  C CG     . GLU C 1 81  ? 268.446 -1.868  133.244 1.00 215.60 ? 81  GLU C CG     1 
ATOM   9582  C CD     . GLU C 1 81  ? 269.631 -2.690  132.775 1.00 217.36 ? 81  GLU C CD     1 
ATOM   9583  O OE1    . GLU C 1 81  ? 269.586 -3.210  131.640 1.00 217.03 ? 81  GLU C OE1    1 
ATOM   9584  O OE2    . GLU C 1 81  ? 270.611 -2.814  133.540 1.00 218.66 ? 81  GLU C OE2    1 
ATOM   9585  H H      . GLU C 1 81  ? 265.597 -2.064  133.731 1.00 233.24 ? 81  GLU C H      1 
ATOM   9586  H HA     . GLU C 1 81  ? 266.702 0.156   132.837 1.00 247.18 ? 81  GLU C HA     1 
ATOM   9587  H HB2    . GLU C 1 81  ? 267.033 -2.493  131.917 1.00 254.78 ? 81  GLU C HB2    1 
ATOM   9588  H HB3    . GLU C 1 81  ? 267.895 -1.277  131.374 1.00 254.78 ? 81  GLU C HB3    1 
ATOM   9589  H HG2    . GLU C 1 81  ? 268.778 -1.011  133.554 1.00 258.72 ? 81  GLU C HG2    1 
ATOM   9590  H HG3    . GLU C 1 81  ? 268.021 -2.344  133.975 1.00 258.72 ? 81  GLU C HG3    1 
ATOM   9591  N N      . ILE C 1 82  ? 264.438 -1.160  131.041 1.00 200.19 ? 82  ILE C N      1 
ATOM   9592  C CA     . ILE C 1 82  ? 263.553 -0.952  129.900 1.00 196.09 ? 82  ILE C CA     1 
ATOM   9593  C C      . ILE C 1 82  ? 262.673 0.274   130.130 1.00 202.12 ? 82  ILE C C      1 
ATOM   9594  O O      . ILE C 1 82  ? 262.394 1.030   129.199 1.00 197.18 ? 82  ILE C O      1 
ATOM   9595  C CB     . ILE C 1 82  ? 262.643 -2.179  129.652 1.00 188.21 ? 82  ILE C CB     1 
ATOM   9596  C CG1    . ILE C 1 82  ? 263.471 -3.466  129.553 1.00 185.66 ? 82  ILE C CG1    1 
ATOM   9597  C CG2    . ILE C 1 82  ? 261.806 -1.986  128.388 1.00 186.97 ? 82  ILE C CG2    1 
ATOM   9598  C CD1    . ILE C 1 82  ? 264.496 -3.471  128.436 1.00 186.99 ? 82  ILE C CD1    1 
ATOM   9599  H H      . ILE C 1 82  ? 264.237 -1.846  131.519 1.00 240.22 ? 82  ILE C H      1 
ATOM   9600  H HA     . ILE C 1 82  ? 264.086 -0.801  129.104 1.00 235.31 ? 82  ILE C HA     1 
ATOM   9601  H HB     . ILE C 1 82  ? 262.038 -2.265  130.405 1.00 225.85 ? 82  ILE C HB     1 
ATOM   9602  H HG12   . ILE C 1 82  ? 263.946 -3.593  130.389 1.00 222.79 ? 82  ILE C HG12   1 
ATOM   9603  H HG13   . ILE C 1 82  ? 262.868 -4.211  129.403 1.00 222.79 ? 82  ILE C HG13   1 
ATOM   9604  H HG21   . ILE C 1 82  ? 261.247 -2.768  128.257 1.00 224.37 ? 82  ILE C HG21   1 
ATOM   9605  H HG22   . ILE C 1 82  ? 261.252 -1.197  128.494 1.00 224.37 ? 82  ILE C HG22   1 
ATOM   9606  H HG23   . ILE C 1 82  ? 262.401 -1.874  127.630 1.00 224.37 ? 82  ILE C HG23   1 
ATOM   9607  H HD11   . ILE C 1 82  ? 264.970 -4.317  128.447 1.00 224.39 ? 82  ILE C HD11   1 
ATOM   9608  H HD12   . ILE C 1 82  ? 264.039 -3.359  127.588 1.00 224.39 ? 82  ILE C HD12   1 
ATOM   9609  H HD13   . ILE C 1 82  ? 265.118 -2.740  128.575 1.00 224.39 ? 82  ILE C HD13   1 
ATOM   9610  N N      . GLY C 1 83  ? 262.247 0.463   131.377 1.00 214.46 ? 83  GLY C N      1 
ATOM   9611  C CA     . GLY C 1 83  ? 261.323 1.527   131.734 1.00 217.41 ? 83  GLY C CA     1 
ATOM   9612  C C      . GLY C 1 83  ? 261.792 2.920   131.354 1.00 209.87 ? 83  GLY C C      1 
ATOM   9613  O O      . GLY C 1 83  ? 261.112 3.628   130.610 1.00 219.08 ? 83  GLY C O      1 
ATOM   9614  H H      . GLY C 1 83  ? 262.486 -0.024  132.045 1.00 257.35 ? 83  GLY C H      1 
ATOM   9615  H HA2    . GLY C 1 83  ? 260.472 1.367   131.296 1.00 260.89 ? 83  GLY C HA2    1 
ATOM   9616  H HA3    . GLY C 1 83  ? 261.177 1.511   132.693 1.00 260.89 ? 83  GLY C HA3    1 
ATOM   9617  N N      . LYS C 1 84  ? 262.952 3.315   131.871 1.00 186.62 ? 84  LYS C N      1 
ATOM   9618  C CA     . LYS C 1 84  ? 263.512 4.632   131.586 1.00 170.23 ? 84  LYS C CA     1 
ATOM   9619  C C      . LYS C 1 84  ? 263.833 4.789   130.100 1.00 166.25 ? 84  LYS C C      1 
ATOM   9620  O O      . LYS C 1 84  ? 263.832 5.900   129.567 1.00 165.92 ? 84  LYS C O      1 
ATOM   9621  C CB     . LYS C 1 84  ? 264.782 4.857   132.409 1.00 163.21 ? 84  LYS C CB     1 
ATOM   9622  C CG     . LYS C 1 84  ? 264.581 4.775   133.915 1.00 156.99 ? 84  LYS C CG     1 
ATOM   9623  C CD     . LYS C 1 84  ? 265.881 5.053   134.658 1.00 155.08 ? 84  LYS C CD     1 
ATOM   9624  C CE     . LYS C 1 84  ? 265.696 4.978   136.164 1.00 151.90 ? 84  LYS C CE     1 
ATOM   9625  N NZ     . LYS C 1 84  ? 266.955 5.288   136.899 1.00 152.05 ? 84  LYS C NZ     1 
ATOM   9626  H H      . LYS C 1 84  ? 263.437 2.835   132.394 1.00 223.95 ? 84  LYS C H      1 
ATOM   9627  H HA     . LYS C 1 84  ? 262.867 5.314   131.831 1.00 204.27 ? 84  LYS C HA     1 
ATOM   9628  H HB2    . LYS C 1 84  ? 265.435 4.184   132.162 1.00 195.86 ? 84  LYS C HB2    1 
ATOM   9629  H HB3    . LYS C 1 84  ? 265.131 5.740   132.207 1.00 195.86 ? 84  LYS C HB3    1 
ATOM   9630  H HG2    . LYS C 1 84  ? 263.926 5.435   134.189 1.00 188.39 ? 84  LYS C HG2    1 
ATOM   9631  H HG3    . LYS C 1 84  ? 264.280 3.883   134.151 1.00 188.39 ? 84  LYS C HG3    1 
ATOM   9632  H HD2    . LYS C 1 84  ? 266.543 4.393   134.401 1.00 186.10 ? 84  LYS C HD2    1 
ATOM   9633  H HD3    . LYS C 1 84  ? 266.191 5.945   134.435 1.00 186.10 ? 84  LYS C HD3    1 
ATOM   9634  H HE2    . LYS C 1 84  ? 265.022 5.622   136.434 1.00 182.28 ? 84  LYS C HE2    1 
ATOM   9635  H HE3    . LYS C 1 84  ? 265.417 4.081   136.406 1.00 182.28 ? 84  LYS C HE3    1 
ATOM   9636  H HZ1    . LYS C 1 84  ? 266.815 5.236   137.776 1.00 182.45 ? 84  LYS C HZ1    1 
ATOM   9637  H HZ2    . LYS C 1 84  ? 267.589 4.707   136.672 1.00 182.45 ? 84  LYS C HZ2    1 
ATOM   9638  H HZ3    . LYS C 1 84  ? 267.230 6.110   136.698 1.00 182.45 ? 84  LYS C HZ3    1 
ATOM   9639  N N      . ALA C 1 85  ? 264.102 3.666   129.439 1.00 164.61 ? 85  ALA C N      1 
ATOM   9640  C CA     . ALA C 1 85  ? 264.519 3.670   128.041 1.00 168.43 ? 85  ALA C CA     1 
ATOM   9641  C C      . ALA C 1 85  ? 263.365 3.963   127.086 1.00 172.68 ? 85  ALA C C      1 
ATOM   9642  O O      . ALA C 1 85  ? 263.581 4.500   125.997 1.00 173.35 ? 85  ALA C O      1 
ATOM   9643  C CB     . ALA C 1 85  ? 265.162 2.336   127.687 1.00 167.67 ? 85  ALA C CB     1 
ATOM   9644  H H      . ALA C 1 85  ? 264.050 2.880   129.783 1.00 197.54 ? 85  ALA C H      1 
ATOM   9645  H HA     . ALA C 1 85  ? 265.187 4.362   127.918 1.00 202.12 ? 85  ALA C HA     1 
ATOM   9646  H HB1    . ALA C 1 85  ? 265.433 2.354   126.756 1.00 201.21 ? 85  ALA C HB1    1 
ATOM   9647  H HB2    . ALA C 1 85  ? 265.936 2.199   128.255 1.00 201.21 ? 85  ALA C HB2    1 
ATOM   9648  H HB3    . ALA C 1 85  ? 264.516 1.627   127.831 1.00 201.21 ? 85  ALA C HB3    1 
ATOM   9649  N N      . VAL C 1 86  ? 262.148 3.608   127.491 1.00 175.26 ? 86  VAL C N      1 
ATOM   9650  C CA     . VAL C 1 86  ? 260.980 3.752   126.624 1.00 174.19 ? 86  VAL C CA     1 
ATOM   9651  C C      . VAL C 1 86  ? 260.097 4.941   127.006 1.00 173.72 ? 86  VAL C C      1 
ATOM   9652  O O      . VAL C 1 86  ? 258.957 5.040   126.550 1.00 171.15 ? 86  VAL C O      1 
ATOM   9653  C CB     . VAL C 1 86  ? 260.120 2.470   126.625 1.00 169.96 ? 86  VAL C CB     1 
ATOM   9654  C CG1    . VAL C 1 86  ? 260.944 1.278   126.160 1.00 168.92 ? 86  VAL C CG1    1 
ATOM   9655  C CG2    . VAL C 1 86  ? 259.526 2.208   128.008 1.00 167.15 ? 86  VAL C CG2    1 
ATOM   9656  H H      . VAL C 1 86  ? 261.970 3.282   128.267 1.00 210.31 ? 86  VAL C H      1 
ATOM   9657  H HA     . VAL C 1 86  ? 261.288 3.896   125.715 1.00 209.03 ? 86  VAL C HA     1 
ATOM   9658  H HB     . VAL C 1 86  ? 259.385 2.585   126.002 1.00 203.95 ? 86  VAL C HB     1 
ATOM   9659  H HG11   . VAL C 1 86  ? 260.384 0.486   126.168 1.00 202.70 ? 86  VAL C HG11   1 
ATOM   9660  H HG12   . VAL C 1 86  ? 261.264 1.448   125.260 1.00 202.70 ? 86  VAL C HG12   1 
ATOM   9661  H HG13   . VAL C 1 86  ? 261.695 1.160   126.762 1.00 202.70 ? 86  VAL C HG13   1 
ATOM   9662  H HG21   . VAL C 1 86  ? 258.994 1.398   127.974 1.00 200.59 ? 86  VAL C HG21   1 
ATOM   9663  H HG22   . VAL C 1 86  ? 260.249 2.102   128.646 1.00 200.59 ? 86  VAL C HG22   1 
ATOM   9664  H HG23   . VAL C 1 86  ? 258.969 2.961   128.260 1.00 200.59 ? 86  VAL C HG23   1 
ATOM   9665  N N      . LEU C 1 87  ? 260.632 5.842   127.828 1.00 175.97 ? 87  LEU C N      1 
ATOM   9666  C CA     . LEU C 1 87  ? 259.874 6.990   128.327 1.00 176.14 ? 87  LEU C CA     1 
ATOM   9667  C C      . LEU C 1 87  ? 260.544 8.324   128.015 1.00 181.41 ? 87  LEU C C      1 
ATOM   9668  O O      . LEU C 1 87  ? 261.762 8.468   128.140 1.00 185.96 ? 87  LEU C O      1 
ATOM   9669  C CB     . LEU C 1 87  ? 259.676 6.876   129.840 1.00 169.99 ? 87  LEU C CB     1 
ATOM   9670  C CG     . LEU C 1 87  ? 258.707 5.794   130.316 1.00 162.48 ? 87  LEU C CG     1 
ATOM   9671  C CD1    . LEU C 1 87  ? 258.804 5.643   131.822 1.00 161.37 ? 87  LEU C CD1    1 
ATOM   9672  C CD2    . LEU C 1 87  ? 257.281 6.126   129.904 1.00 158.26 ? 87  LEU C CD2    1 
ATOM   9673  H H      . LEU C 1 87  ? 261.442 5.810   128.116 1.00 211.16 ? 87  LEU C H      1 
ATOM   9674  H HA     . LEU C 1 87  ? 258.998 6.992   127.911 1.00 211.36 ? 87  LEU C HA     1 
ATOM   9675  H HB2    . LEU C 1 87  ? 260.537 6.690   130.246 1.00 203.99 ? 87  LEU C HB2    1 
ATOM   9676  H HB3    . LEU C 1 87  ? 259.343 7.726   130.168 1.00 203.99 ? 87  LEU C HB3    1 
ATOM   9677  H HG     . LEU C 1 87  ? 258.950 4.947   129.910 1.00 194.97 ? 87  LEU C HG     1 
ATOM   9678  H HD11   . LEU C 1 87  ? 258.184 4.954   132.109 1.00 193.65 ? 87  LEU C HD11   1 
ATOM   9679  H HD12   . LEU C 1 87  ? 259.711 5.391   132.056 1.00 193.65 ? 87  LEU C HD12   1 
ATOM   9680  H HD13   . LEU C 1 87  ? 258.576 6.488   132.239 1.00 193.65 ? 87  LEU C HD13   1 
ATOM   9681  H HD21   . LEU C 1 87  ? 256.690 5.425   130.219 1.00 189.91 ? 87  LEU C HD21   1 
ATOM   9682  H HD22   . LEU C 1 87  ? 257.028 6.975   130.299 1.00 189.91 ? 87  LEU C HD22   1 
ATOM   9683  H HD23   . LEU C 1 87  ? 257.239 6.186   128.937 1.00 189.91 ? 87  LEU C HD23   1 
ATOM   9684  N N      . ASP C 1 88  ? 259.729 9.298   127.621 1.00 179.76 ? 88  ASP C N      1 
ATOM   9685  C CA     . ASP C 1 88  ? 260.206 10.648  127.350 1.00 182.11 ? 88  ASP C CA     1 
ATOM   9686  C C      . ASP C 1 88  ? 260.451 11.389  128.664 1.00 191.23 ? 88  ASP C C      1 
ATOM   9687  O O      . ASP C 1 88  ? 261.395 12.173  128.779 1.00 191.88 ? 88  ASP C O      1 
ATOM   9688  C CB     . ASP C 1 88  ? 259.184 11.411  126.501 1.00 176.15 ? 88  ASP C CB     1 
ATOM   9689  C CG     . ASP C 1 88  ? 258.890 10.722  125.181 1.00 172.76 ? 88  ASP C CG     1 
ATOM   9690  O OD1    . ASP C 1 88  ? 258.052 9.797   125.164 1.00 169.64 ? 88  ASP C OD1    1 
ATOM   9691  O OD2    . ASP C 1 88  ? 259.489 11.108  124.157 1.00 174.52 ? 88  ASP C OD2    1 
ATOM   9692  H H      . ASP C 1 88  ? 258.883 9.199   127.502 1.00 215.72 ? 88  ASP C H      1 
ATOM   9693  H HA     . ASP C 1 88  ? 261.042 10.605  126.861 1.00 218.53 ? 88  ASP C HA     1 
ATOM   9694  H HB2    . ASP C 1 88  ? 258.352 11.482  126.995 1.00 211.38 ? 88  ASP C HB2    1 
ATOM   9695  H HB3    . ASP C 1 88  ? 259.532 12.295  126.307 1.00 211.38 ? 88  ASP C HB3    1 
ATOM   9696  N N      . SER C 1 89  ? 259.592 11.130  129.648 1.00 198.88 ? 89  SER C N      1 
ATOM   9697  C CA     . SER C 1 89  ? 259.693 11.753  130.968 1.00 205.00 ? 89  SER C CA     1 
ATOM   9698  C C      . SER C 1 89  ? 259.601 10.705  132.073 1.00 200.37 ? 89  SER C C      1 
ATOM   9699  O O      . SER C 1 89  ? 258.557 10.543  132.706 1.00 198.50 ? 89  SER C O      1 
ATOM   9700  C CB     . SER C 1 89  ? 258.586 12.792  131.153 1.00 210.23 ? 89  SER C CB     1 
ATOM   9701  O OG     . SER C 1 89  ? 258.609 13.330  132.464 1.00 212.04 ? 89  SER C OG     1 
ATOM   9702  H H      . SER C 1 89  ? 258.929 10.587  129.575 1.00 238.66 ? 89  SER C H      1 
ATOM   9703  H HA     . SER C 1 89  ? 260.549 12.203  131.045 1.00 246.00 ? 89  SER C HA     1 
ATOM   9704  H HB2    . SER C 1 89  ? 258.718 13.510  130.515 1.00 252.28 ? 89  SER C HB2    1 
ATOM   9705  H HB3    . SER C 1 89  ? 257.727 12.367  131.001 1.00 252.28 ? 89  SER C HB3    1 
ATOM   9706  H HG     . SER C 1 89  ? 257.997 13.898  132.552 1.00 254.45 ? 89  SER C HG     1 
ATOM   9707  N N      . TYR C 1 90  ? 260.704 10.002  132.304 1.00 196.66 ? 90  TYR C N      1 
ATOM   9708  C CA     . TYR C 1 90  ? 260.744 8.940   133.299 1.00 189.97 ? 90  TYR C CA     1 
ATOM   9709  C C      . TYR C 1 90  ? 260.619 9.510   134.706 1.00 186.66 ? 90  TYR C C      1 
ATOM   9710  O O      . TYR C 1 90  ? 260.944 10.672  134.946 1.00 188.77 ? 90  TYR C O      1 
ATOM   9711  C CB     . TYR C 1 90  ? 262.047 8.142   133.173 1.00 189.84 ? 90  TYR C CB     1 
ATOM   9712  C CG     . TYR C 1 90  ? 263.296 8.931   133.513 1.00 193.04 ? 90  TYR C CG     1 
ATOM   9713  C CD1    . TYR C 1 90  ? 263.928 9.719   132.558 1.00 196.86 ? 90  TYR C CD1    1 
ATOM   9714  C CD2    . TYR C 1 90  ? 263.848 8.881   134.788 1.00 193.43 ? 90  TYR C CD2    1 
ATOM   9715  C CE1    . TYR C 1 90  ? 265.070 10.440  132.865 1.00 200.43 ? 90  TYR C CE1    1 
ATOM   9716  C CE2    . TYR C 1 90  ? 264.989 9.598   135.103 1.00 197.02 ? 90  TYR C CE2    1 
ATOM   9717  C CZ     . TYR C 1 90  ? 265.595 10.374  134.138 1.00 201.29 ? 90  TYR C CZ     1 
ATOM   9718  O OH     . TYR C 1 90  ? 266.730 11.087  134.448 1.00 205.51 ? 90  TYR C OH     1 
ATOM   9719  H H      . TYR C 1 90  ? 261.450 10.123  131.892 1.00 235.99 ? 90  TYR C H      1 
ATOM   9720  H HA     . TYR C 1 90  ? 260.002 8.334   133.150 1.00 227.96 ? 90  TYR C HA     1 
ATOM   9721  H HB2    . TYR C 1 90  ? 262.005 7.382   133.774 1.00 227.81 ? 90  TYR C HB2    1 
ATOM   9722  H HB3    . TYR C 1 90  ? 262.134 7.831   132.258 1.00 227.81 ? 90  TYR C HB3    1 
ATOM   9723  H HD1    . TYR C 1 90  ? 263.576 9.766   131.698 1.00 236.24 ? 90  TYR C HD1    1 
ATOM   9724  H HD2    . TYR C 1 90  ? 263.442 8.359   135.441 1.00 232.11 ? 90  TYR C HD2    1 
ATOM   9725  H HE1    . TYR C 1 90  ? 265.481 10.964  132.216 1.00 240.51 ? 90  TYR C HE1    1 
ATOM   9726  H HE2    . TYR C 1 90  ? 265.346 9.556   135.961 1.00 236.42 ? 90  TYR C HE2    1 
ATOM   9727  H HH     . TYR C 1 90  ? 266.940 10.958  135.251 1.00 246.61 ? 90  TYR C HH     1 
ATOM   9728  N N      . GLU C 1 91  ? 260.138 8.687   135.630 1.00 182.33 ? 91  GLU C N      1 
ATOM   9729  C CA     . GLU C 1 91  ? 260.066 9.068   137.036 1.00 179.95 ? 91  GLU C CA     1 
ATOM   9730  C C      . GLU C 1 91  ? 259.921 7.832   137.920 1.00 171.83 ? 91  GLU C C      1 
ATOM   9731  O O      . GLU C 1 91  ? 259.834 6.708   137.423 1.00 170.43 ? 91  GLU C O      1 
ATOM   9732  C CB     . GLU C 1 91  ? 258.913 10.046  137.285 1.00 183.31 ? 91  GLU C CB     1 
ATOM   9733  C CG     . GLU C 1 91  ? 257.547 9.542   136.855 1.00 183.37 ? 91  GLU C CG     1 
ATOM   9734  C CD     . GLU C 1 91  ? 256.445 10.546  137.140 1.00 182.86 ? 91  GLU C CD     1 
ATOM   9735  O OE1    . GLU C 1 91  ? 256.567 11.305  138.124 1.00 180.43 ? 91  GLU C OE1    1 
ATOM   9736  O OE2    . GLU C 1 91  ? 255.458 10.581  136.375 1.00 184.37 ? 91  GLU C OE2    1 
ATOM   9737  H H      . GLU C 1 91  ? 259.845 7.895   135.468 1.00 218.80 ? 91  GLU C H      1 
ATOM   9738  H HA     . GLU C 1 91  ? 260.891 9.514   137.282 1.00 215.94 ? 91  GLU C HA     1 
ATOM   9739  H HB2    . GLU C 1 91  ? 258.869 10.237  138.234 1.00 219.97 ? 91  GLU C HB2    1 
ATOM   9740  H HB3    . GLU C 1 91  ? 259.090 10.864  136.795 1.00 219.97 ? 91  GLU C HB3    1 
ATOM   9741  H HG2    . GLU C 1 91  ? 257.559 9.369   135.901 1.00 220.05 ? 91  GLU C HG2    1 
ATOM   9742  H HG3    . GLU C 1 91  ? 257.344 8.726   137.339 1.00 220.05 ? 91  GLU C HG3    1 
ATOM   9743  N N      . ILE C 1 92  ? 259.897 8.054   139.231 1.00 166.20 ? 92  ILE C N      1 
ATOM   9744  C CA     . ILE C 1 92  ? 259.882 6.969   140.209 1.00 160.72 ? 92  ILE C CA     1 
ATOM   9745  C C      . ILE C 1 92  ? 258.582 6.969   141.011 1.00 160.95 ? 92  ILE C C      1 
ATOM   9746  O O      . ILE C 1 92  ? 258.483 7.610   142.057 1.00 154.79 ? 92  ILE C O      1 
ATOM   9747  C CB     . ILE C 1 92  ? 261.092 7.060   141.171 1.00 158.67 ? 92  ILE C CB     1 
ATOM   9748  C CG1    . ILE C 1 92  ? 261.419 8.524   141.499 1.00 157.81 ? 92  ILE C CG1    1 
ATOM   9749  C CG2    . ILE C 1 92  ? 262.305 6.376   140.549 1.00 159.68 ? 92  ILE C CG2    1 
ATOM   9750  C CD1    . ILE C 1 92  ? 262.454 8.704   142.595 1.00 156.86 ? 92  ILE C CD1    1 
ATOM   9751  H H      . ILE C 1 92  ? 259.888 8.837   139.585 1.00 199.44 ? 92  ILE C H      1 
ATOM   9752  H HA     . ILE C 1 92  ? 259.940 6.123   139.738 1.00 192.87 ? 92  ILE C HA     1 
ATOM   9753  H HB     . ILE C 1 92  ? 260.868 6.601   141.995 1.00 190.41 ? 92  ILE C HB     1 
ATOM   9754  H HG12   . ILE C 1 92  ? 261.760 8.954   140.699 1.00 189.37 ? 92  ILE C HG12   1 
ATOM   9755  H HG13   . ILE C 1 92  ? 260.606 8.967   141.787 1.00 189.37 ? 92  ILE C HG13   1 
ATOM   9756  H HG21   . ILE C 1 92  ? 263.053 6.441   141.162 1.00 191.62 ? 92  ILE C HG21   1 
ATOM   9757  H HG22   . ILE C 1 92  ? 262.091 5.444   140.385 1.00 191.62 ? 92  ILE C HG22   1 
ATOM   9758  H HG23   . ILE C 1 92  ? 262.522 6.818   139.713 1.00 191.62 ? 92  ILE C HG23   1 
ATOM   9759  H HD11   . ILE C 1 92  ? 262.601 9.652   142.738 1.00 188.24 ? 92  ILE C HD11   1 
ATOM   9760  H HD12   . ILE C 1 92  ? 262.126 8.293   143.410 1.00 188.24 ? 92  ILE C HD12   1 
ATOM   9761  H HD13   . ILE C 1 92  ? 263.282 8.279   142.320 1.00 188.24 ? 92  ILE C HD13   1 
ATOM   9762  N N      . ARG C 1 93  ? 257.590 6.240   140.507 1.00 169.77 ? 93  ARG C N      1 
ATOM   9763  C CA     . ARG C 1 93  ? 256.291 6.133   141.162 1.00 173.76 ? 93  ARG C CA     1 
ATOM   9764  C C      . ARG C 1 93  ? 256.221 4.857   142.000 1.00 172.76 ? 93  ARG C C      1 
ATOM   9765  O O      . ARG C 1 93  ? 256.524 3.770   141.506 1.00 176.44 ? 93  ARG C O      1 
ATOM   9766  C CB     . ARG C 1 93  ? 255.179 6.139   140.113 1.00 173.10 ? 93  ARG C CB     1 
ATOM   9767  C CG     . ARG C 1 93  ? 253.782 6.244   140.690 1.00 169.50 ? 93  ARG C CG     1 
ATOM   9768  C CD     . ARG C 1 93  ? 252.741 6.319   139.590 1.00 167.91 ? 93  ARG C CD     1 
ATOM   9769  N NE     . ARG C 1 93  ? 251.388 6.143   140.109 1.00 165.55 ? 93  ARG C NE     1 
ATOM   9770  C CZ     . ARG C 1 93  ? 250.307 5.979   139.351 1.00 163.71 ? 93  ARG C CZ     1 
ATOM   9771  N NH1    . ARG C 1 93  ? 250.413 5.963   138.029 1.00 164.90 ? 93  ARG C NH1    1 
ATOM   9772  N NH2    . ARG C 1 93  ? 249.117 5.826   139.917 1.00 160.75 ? 93  ARG C NH2    1 
ATOM   9773  H H      . ARG C 1 93  ? 257.646 5.792   139.775 1.00 203.72 ? 93  ARG C H      1 
ATOM   9774  H HA     . ARG C 1 93  ? 256.162 6.894   141.750 1.00 208.51 ? 93  ARG C HA     1 
ATOM   9775  H HB2    . ARG C 1 93  ? 255.313 6.897   139.522 1.00 207.73 ? 93  ARG C HB2    1 
ATOM   9776  H HB3    . ARG C 1 93  ? 255.227 5.315   139.604 1.00 207.73 ? 93  ARG C HB3    1 
ATOM   9777  H HG2    . ARG C 1 93  ? 253.599 5.460   141.231 1.00 203.40 ? 93  ARG C HG2    1 
ATOM   9778  H HG3    . ARG C 1 93  ? 253.717 7.048   141.228 1.00 203.40 ? 93  ARG C HG3    1 
ATOM   9779  H HD2    . ARG C 1 93  ? 252.790 7.189   139.162 1.00 201.49 ? 93  ARG C HD2    1 
ATOM   9780  H HD3    . ARG C 1 93  ? 252.910 5.618   138.942 1.00 201.49 ? 93  ARG C HD3    1 
ATOM   9781  H HE     . ARG C 1 93  ? 251.282 6.145   140.963 1.00 198.66 ? 93  ARG C HE     1 
ATOM   9782  H HH11   . ARG C 1 93  ? 251.183 6.062   137.658 1.00 197.88 ? 93  ARG C HH11   1 
ATOM   9783  H HH12   . ARG C 1 93  ? 249.712 5.856   137.542 1.00 197.88 ? 93  ARG C HH12   1 
ATOM   9784  H HH21   . ARG C 1 93  ? 249.043 5.835   140.774 1.00 192.90 ? 93  ARG C HH21   1 
ATOM   9785  H HH22   . ARG C 1 93  ? 248.418 5.719   139.427 1.00 192.90 ? 93  ARG C HH22   1 
ATOM   9786  N N      . TYR C 1 94  ? 255.817 4.997   143.263 1.00 165.54 ? 94  TYR C N      1 
ATOM   9787  C CA     . TYR C 1 94  ? 255.790 3.870   144.196 1.00 159.52 ? 94  TYR C CA     1 
ATOM   9788  C C      . TYR C 1 94  ? 254.370 3.524   144.666 1.00 155.99 ? 94  TYR C C      1 
ATOM   9789  O O      . TYR C 1 94  ? 253.960 3.866   145.776 1.00 154.63 ? 94  TYR C O      1 
ATOM   9790  C CB     . TYR C 1 94  ? 256.720 4.143   145.389 1.00 159.27 ? 94  TYR C CB     1 
ATOM   9791  C CG     . TYR C 1 94  ? 257.816 3.111   145.552 1.00 159.90 ? 94  TYR C CG     1 
ATOM   9792  C CD1    . TYR C 1 94  ? 257.515 1.796   145.887 1.00 159.00 ? 94  TYR C CD1    1 
ATOM   9793  C CD2    . TYR C 1 94  ? 259.151 3.453   145.376 1.00 161.39 ? 94  TYR C CD2    1 
ATOM   9794  C CE1    . TYR C 1 94  ? 258.514 0.850   146.037 1.00 159.21 ? 94  TYR C CE1    1 
ATOM   9795  C CE2    . TYR C 1 94  ? 260.156 2.516   145.526 1.00 161.59 ? 94  TYR C CE2    1 
ATOM   9796  C CZ     . TYR C 1 94  ? 259.834 1.217   145.857 1.00 160.63 ? 94  TYR C CZ     1 
ATOM   9797  O OH     . TYR C 1 94  ? 260.834 0.283   146.006 1.00 160.85 ? 94  TYR C OH     1 
ATOM   9798  H H      . TYR C 1 94  ? 255.551 5.740   143.606 1.00 198.65 ? 94  TYR C H      1 
ATOM   9799  H HA     . TYR C 1 94  ? 256.136 3.090   143.736 1.00 191.42 ? 94  TYR C HA     1 
ATOM   9800  H HB2    . TYR C 1 94  ? 257.142 5.008   145.265 1.00 191.13 ? 94  TYR C HB2    1 
ATOM   9801  H HB3    . TYR C 1 94  ? 256.192 4.147   146.203 1.00 191.13 ? 94  TYR C HB3    1 
ATOM   9802  H HD1    . TYR C 1 94  ? 256.628 1.547   146.009 1.00 190.80 ? 94  TYR C HD1    1 
ATOM   9803  H HD2    . TYR C 1 94  ? 259.373 4.328   145.153 1.00 193.67 ? 94  TYR C HD2    1 
ATOM   9804  H HE1    . TYR C 1 94  ? 258.299 -0.027  146.261 1.00 191.05 ? 94  TYR C HE1    1 
ATOM   9805  H HE2    . TYR C 1 94  ? 261.045 2.760   145.404 1.00 193.91 ? 94  TYR C HE2    1 
ATOM   9806  H HH     . TYR C 1 94  ? 261.582 0.639   145.869 1.00 193.02 ? 94  TYR C HH     1 
ATOM   9807  N N      . ALA C 1 95  ? 253.622 2.859   143.789 1.00 154.86 ? 95  ALA C N      1 
ATOM   9808  C CA     . ALA C 1 95  ? 252.362 2.226   144.161 1.00 152.41 ? 95  ALA C CA     1 
ATOM   9809  C C      . ALA C 1 95  ? 252.613 0.728   144.277 1.00 156.08 ? 95  ALA C C      1 
ATOM   9810  O O      . ALA C 1 95  ? 252.318 -0.041  143.356 1.00 152.31 ? 95  ALA C O      1 
ATOM   9811  C CB     . ALA C 1 95  ? 251.279 2.516   143.138 1.00 148.80 ? 95  ALA C CB     1 
ATOM   9812  H H      . ALA C 1 95  ? 253.826 2.760   142.960 1.00 185.83 ? 95  ALA C H      1 
ATOM   9813  H HA     . ALA C 1 95  ? 252.072 2.559   145.024 1.00 182.89 ? 95  ALA C HA     1 
ATOM   9814  H HB1    . ALA C 1 95  ? 250.458 2.081   143.416 1.00 178.57 ? 95  ALA C HB1    1 
ATOM   9815  H HB2    . ALA C 1 95  ? 251.144 3.475   143.085 1.00 178.57 ? 95  ALA C HB2    1 
ATOM   9816  H HB3    . ALA C 1 95  ? 251.559 2.173   142.275 1.00 178.57 ? 95  ALA C HB3    1 
ATOM   9817  N N      . GLU C 1 96  ? 253.205 0.356   145.412 1.00 163.97 ? 96  GLU C N      1 
ATOM   9818  C CA     . GLU C 1 96  ? 253.494 -1.031  145.820 1.00 165.56 ? 96  GLU C CA     1 
ATOM   9819  C C      . GLU C 1 96  ? 254.910 -1.510  145.430 1.00 174.01 ? 96  GLU C C      1 
ATOM   9820  O O      . GLU C 1 96  ? 255.844 -1.368  146.219 1.00 175.00 ? 96  GLU C O      1 
ATOM   9821  C CB     . GLU C 1 96  ? 252.406 -2.020  145.353 1.00 156.53 ? 96  GLU C CB     1 
ATOM   9822  C CG     . GLU C 1 96  ? 251.874 -2.945  146.443 1.00 147.67 ? 96  GLU C CG     1 
ATOM   9823  C CD     . GLU C 1 96  ? 252.968 -3.583  147.279 1.00 143.39 ? 96  GLU C CD     1 
ATOM   9824  O OE1    . GLU C 1 96  ? 253.301 -4.756  147.019 1.00 141.92 ? 96  GLU C OE1    1 
ATOM   9825  O OE2    . GLU C 1 96  ? 253.488 -2.919  148.202 1.00 142.14 ? 96  GLU C OE2    1 
ATOM   9826  H H      . GLU C 1 96  ? 253.465 0.925   146.002 1.00 196.77 ? 96  GLU C H      1 
ATOM   9827  H HA     . GLU C 1 96  ? 253.468 -1.048  146.789 1.00 198.67 ? 96  GLU C HA     1 
ATOM   9828  H HB2    . GLU C 1 96  ? 251.655 -1.513  145.006 1.00 187.84 ? 96  GLU C HB2    1 
ATOM   9829  H HB3    . GLU C 1 96  ? 252.776 -2.577  144.650 1.00 187.84 ? 96  GLU C HB3    1 
ATOM   9830  H HG2    . GLU C 1 96  ? 251.305 -2.433  147.039 1.00 177.20 ? 96  GLU C HG2    1 
ATOM   9831  H HG3    . GLU C 1 96  ? 251.363 -3.657  146.029 1.00 177.20 ? 96  GLU C HG3    1 
ATOM   9832  N N      . HIS C 1 97  ? 255.065 -2.055  144.224 1.00 180.09 ? 97  HIS C N      1 
ATOM   9833  C CA     . HIS C 1 97  ? 256.320 -2.684  143.799 1.00 184.63 ? 97  HIS C CA     1 
ATOM   9834  C C      . HIS C 1 97  ? 257.119 -1.746  142.894 1.00 187.07 ? 97  HIS C C      1 
ATOM   9835  O O      . HIS C 1 97  ? 256.600 -0.723  142.453 1.00 187.78 ? 97  HIS C O      1 
ATOM   9836  C CB     . HIS C 1 97  ? 256.013 -3.998  143.076 1.00 185.44 ? 97  HIS C CB     1 
ATOM   9837  C CG     . HIS C 1 97  ? 255.349 -5.021  143.946 1.00 185.02 ? 97  HIS C CG     1 
ATOM   9838  N ND1    . HIS C 1 97  ? 255.999 -5.652  144.983 1.00 185.08 ? 97  HIS C ND1    1 
ATOM   9839  C CD2    . HIS C 1 97  ? 254.090 -5.518  143.932 1.00 184.00 ? 97  HIS C CD2    1 
ATOM   9840  C CE1    . HIS C 1 97  ? 255.171 -6.498  145.571 1.00 183.43 ? 97  HIS C CE1    1 
ATOM   9841  N NE2    . HIS C 1 97  ? 254.004 -6.434  144.952 1.00 182.81 ? 97  HIS C NE2    1 
ATOM   9842  H H      . HIS C 1 97  ? 254.450 -2.075  143.623 1.00 216.10 ? 97  HIS C H      1 
ATOM   9843  H HA     . HIS C 1 97  ? 256.858 -2.884  144.581 1.00 221.56 ? 97  HIS C HA     1 
ATOM   9844  H HB2    . HIS C 1 97  ? 255.422 -3.815  142.330 1.00 222.53 ? 97  HIS C HB2    1 
ATOM   9845  H HB3    . HIS C 1 97  ? 256.844 -4.379  142.752 1.00 222.53 ? 97  HIS C HB3    1 
ATOM   9846  H HD1    . HIS C 1 97  ? 256.817 -5.518  145.211 1.00 222.10 ? 97  HIS C HD1    1 
ATOM   9847  H HD2    . HIS C 1 97  ? 253.411 -5.284  143.341 1.00 220.80 ? 97  HIS C HD2    1 
ATOM   9848  H HE1    . HIS C 1 97  ? 255.373 -7.042  146.297 1.00 220.12 ? 97  HIS C HE1    1 
ATOM   9849  H HE2    . HIS C 1 97  ? 253.305 -6.893  145.154 1.00 219.37 ? 97  HIS C HE2    1 
ATOM   9850  N N      . PRO C 1 98  ? 258.394 -2.079  142.621 1.00 188.01 ? 98  PRO C N      1 
ATOM   9851  C CA     . PRO C 1 98  ? 259.156 -1.127  141.808 1.00 189.12 ? 98  PRO C CA     1 
ATOM   9852  C C      . PRO C 1 98  ? 258.743 -1.148  140.338 1.00 182.35 ? 98  PRO C C      1 
ATOM   9853  O O      . PRO C 1 98  ? 259.047 -2.104  139.625 1.00 185.31 ? 98  PRO C O      1 
ATOM   9854  C CB     . PRO C 1 98  ? 260.600 -1.607  141.970 1.00 193.86 ? 98  PRO C CB     1 
ATOM   9855  C CG     . PRO C 1 98  ? 260.482 -3.056  142.236 1.00 191.93 ? 98  PRO C CG     1 
ATOM   9856  C CD     . PRO C 1 98  ? 259.213 -3.243  143.014 1.00 188.31 ? 98  PRO C CD     1 
ATOM   9857  H HA     . PRO C 1 98  ? 259.069 -0.228  142.160 1.00 226.95 ? 98  PRO C HA     1 
ATOM   9858  H HB2    . PRO C 1 98  ? 261.093 -1.446  141.150 1.00 232.63 ? 98  PRO C HB2    1 
ATOM   9859  H HB3    . PRO C 1 98  ? 261.016 -1.151  142.718 1.00 232.63 ? 98  PRO C HB3    1 
ATOM   9860  H HG2    . PRO C 1 98  ? 260.438 -3.537  141.395 1.00 230.31 ? 98  PRO C HG2    1 
ATOM   9861  H HG3    . PRO C 1 98  ? 261.245 -3.352  142.757 1.00 230.31 ? 98  PRO C HG3    1 
ATOM   9862  H HD2    . PRO C 1 98  ? 258.775 -4.068  142.753 1.00 225.97 ? 98  PRO C HD2    1 
ATOM   9863  H HD3    . PRO C 1 98  ? 259.394 -3.223  143.967 1.00 225.97 ? 98  PRO C HD3    1 
ATOM   9864  N N      . TYR C 1 99  ? 258.050 -0.099  139.903 1.00 170.79 ? 99  TYR C N      1 
ATOM   9865  C CA     . TYR C 1 99  ? 257.662 0.046   138.506 1.00 159.50 ? 99  TYR C CA     1 
ATOM   9866  C C      . TYR C 1 99  ? 257.862 1.495   138.070 1.00 157.80 ? 99  TYR C C      1 
ATOM   9867  O O      . TYR C 1 99  ? 257.717 2.419   138.873 1.00 157.61 ? 99  TYR C O      1 
ATOM   9868  C CB     . TYR C 1 99  ? 256.205 -0.374  138.308 1.00 150.82 ? 99  TYR C CB     1 
ATOM   9869  C CG     . TYR C 1 99  ? 255.206 0.614   138.858 1.00 145.75 ? 99  TYR C CG     1 
ATOM   9870  C CD1    . TYR C 1 99  ? 254.810 0.564   140.186 1.00 141.82 ? 99  TYR C CD1    1 
ATOM   9871  C CD2    . TYR C 1 99  ? 254.657 1.597   138.046 1.00 146.23 ? 99  TYR C CD2    1 
ATOM   9872  C CE1    . TYR C 1 99  ? 253.897 1.465   140.691 1.00 141.02 ? 99  TYR C CE1    1 
ATOM   9873  C CE2    . TYR C 1 99  ? 253.745 2.504   138.541 1.00 145.29 ? 99  TYR C CE2    1 
ATOM   9874  C CZ     . TYR C 1 99  ? 253.366 2.434   139.865 1.00 142.47 ? 99  TYR C CZ     1 
ATOM   9875  O OH     . TYR C 1 99  ? 252.454 3.339   140.360 1.00 140.95 ? 99  TYR C OH     1 
ATOM   9876  H H      . TYR C 1 99  ? 257.791 0.549   140.405 1.00 204.95 ? 99  TYR C H      1 
ATOM   9877  H HA     . TYR C 1 99  ? 258.223 -0.521  137.954 1.00 191.40 ? 99  TYR C HA     1 
ATOM   9878  H HB2    . TYR C 1 99  ? 256.034 -0.471  137.358 1.00 180.98 ? 99  TYR C HB2    1 
ATOM   9879  H HB3    . TYR C 1 99  ? 256.061 -1.222  138.756 1.00 180.98 ? 99  TYR C HB3    1 
ATOM   9880  H HD1    . TYR C 1 99  ? 255.166 -0.088  140.745 1.00 170.18 ? 99  TYR C HD1    1 
ATOM   9881  H HD2    . TYR C 1 99  ? 254.911 1.646   137.153 1.00 175.47 ? 99  TYR C HD2    1 
ATOM   9882  H HE1    . TYR C 1 99  ? 253.641 1.421   141.584 1.00 169.22 ? 99  TYR C HE1    1 
ATOM   9883  H HE2    . TYR C 1 99  ? 253.385 3.158   137.985 1.00 174.35 ? 99  TYR C HE2    1 
ATOM   9884  H HH     . TYR C 1 99  ? 252.215 3.868   139.753 1.00 169.14 ? 99  TYR C HH     1 
ATOM   9885  N N      . VAL C 1 100 ? 258.198 1.686   136.798 1.00 156.62 ? 100 VAL C N      1 
ATOM   9886  C CA     . VAL C 1 100 ? 258.480 3.016   136.267 1.00 157.19 ? 100 VAL C CA     1 
ATOM   9887  C C      . VAL C 1 100 ? 257.216 3.657   135.693 1.00 154.76 ? 100 VAL C C      1 
ATOM   9888  O O      . VAL C 1 100 ? 256.500 3.042   134.900 1.00 150.92 ? 100 VAL C O      1 
ATOM   9889  C CB     . VAL C 1 100 ? 259.569 2.963   135.169 1.00 159.20 ? 100 VAL C CB     1 
ATOM   9890  C CG1    . VAL C 1 100 ? 259.969 4.371   134.740 1.00 162.26 ? 100 VAL C CG1    1 
ATOM   9891  C CG2    . VAL C 1 100 ? 260.789 2.191   135.658 1.00 158.75 ? 100 VAL C CG2    1 
ATOM   9892  H H      . VAL C 1 100 ? 258.270 1.056   136.217 1.00 187.94 ? 100 VAL C H      1 
ATOM   9893  H HA     . VAL C 1 100 ? 258.804 3.581   136.985 1.00 188.63 ? 100 VAL C HA     1 
ATOM   9894  H HB     . VAL C 1 100 ? 259.213 2.503   134.393 1.00 191.05 ? 100 VAL C HB     1 
ATOM   9895  H HG11   . VAL C 1 100 ? 260.651 4.310   134.053 1.00 194.71 ? 100 VAL C HG11   1 
ATOM   9896  H HG12   . VAL C 1 100 ? 259.188 4.829   134.392 1.00 194.71 ? 100 VAL C HG12   1 
ATOM   9897  H HG13   . VAL C 1 100 ? 260.317 4.848   135.510 1.00 194.71 ? 100 VAL C HG13   1 
ATOM   9898  H HG21   . VAL C 1 100 ? 261.455 2.173   134.953 1.00 190.50 ? 100 VAL C HG21   1 
ATOM   9899  H HG22   . VAL C 1 100 ? 261.149 2.635   136.442 1.00 190.50 ? 100 VAL C HG22   1 
ATOM   9900  H HG23   . VAL C 1 100 ? 260.521 1.287   135.883 1.00 190.50 ? 100 VAL C HG23   1 
ATOM   9901  N N      . HIS C 1 101 ? 256.950 4.892   136.111 1.00 156.58 ? 101 HIS C N      1 
ATOM   9902  C CA     . HIS C 1 101 ? 255.858 5.692   135.565 1.00 159.69 ? 101 HIS C CA     1 
ATOM   9903  C C      . HIS C 1 101 ? 256.465 6.760   134.657 1.00 170.03 ? 101 HIS C C      1 
ATOM   9904  O O      . HIS C 1 101 ? 257.674 6.989   134.689 1.00 173.20 ? 101 HIS C O      1 
ATOM   9905  C CB     . HIS C 1 101 ? 255.053 6.337   136.699 1.00 155.96 ? 101 HIS C CB     1 
ATOM   9906  C CG     . HIS C 1 101 ? 253.759 6.949   136.256 1.00 154.46 ? 101 HIS C CG     1 
ATOM   9907  N ND1    . HIS C 1 101 ? 252.797 6.240   135.568 1.00 154.66 ? 101 HIS C ND1    1 
ATOM   9908  C CD2    . HIS C 1 101 ? 253.267 8.201   136.407 1.00 153.82 ? 101 HIS C CD2    1 
ATOM   9909  C CE1    . HIS C 1 101 ? 251.771 7.031   135.310 1.00 154.49 ? 101 HIS C CE1    1 
ATOM   9910  N NE2    . HIS C 1 101 ? 252.029 8.226   135.809 1.00 154.04 ? 101 HIS C NE2    1 
ATOM   9911  H H      . HIS C 1 101 ? 257.398 5.296   136.723 1.00 187.90 ? 101 HIS C H      1 
ATOM   9912  H HA     . HIS C 1 101 ? 255.268 5.131   135.039 1.00 191.63 ? 101 HIS C HA     1 
ATOM   9913  H HB2    . HIS C 1 101 ? 254.847 5.658   137.361 1.00 187.15 ? 101 HIS C HB2    1 
ATOM   9914  H HB3    . HIS C 1 101 ? 255.588 7.038   137.103 1.00 187.15 ? 101 HIS C HB3    1 
ATOM   9915  H HD1    . HIS C 1 101 ? 252.858 5.414   135.339 1.00 185.60 ? 101 HIS C HD1    1 
ATOM   9916  H HD2    . HIS C 1 101 ? 253.688 8.912   136.834 1.00 184.59 ? 101 HIS C HD2    1 
ATOM   9917  H HE1    . HIS C 1 101 ? 250.997 6.786   134.857 1.00 185.39 ? 101 HIS C HE1    1 
ATOM   9918  H HE2    . HIS C 1 101 ? 251.507 8.908   135.767 1.00 184.85 ? 101 HIS C HE2    1 
ATOM   9919  N N      . GLY C 1 102 ? 255.636 7.404   133.841 1.00 176.77 ? 102 GLY C N      1 
ATOM   9920  C CA     . GLY C 1 102 ? 256.119 8.452   132.959 1.00 183.84 ? 102 GLY C CA     1 
ATOM   9921  C C      . GLY C 1 102 ? 255.053 8.972   132.015 1.00 186.25 ? 102 GLY C C      1 
ATOM   9922  O O      . GLY C 1 102 ? 253.862 8.753   132.234 1.00 187.90 ? 102 GLY C O      1 
ATOM   9923  H H      . GLY C 1 102 ? 254.792 7.252   133.781 1.00 212.13 ? 102 GLY C H      1 
ATOM   9924  H HA2    . GLY C 1 102 ? 256.444 9.195   133.491 1.00 220.61 ? 102 GLY C HA2    1 
ATOM   9925  H HA3    . GLY C 1 102 ? 256.856 8.111   132.428 1.00 220.61 ? 102 GLY C HA3    1 
ATOM   9926  N N      . VAL C 1 103 ? 255.489 9.668   130.966 1.00 184.86 ? 103 VAL C N      1 
ATOM   9927  C CA     . VAL C 1 103 ? 254.583 10.234  129.970 1.00 184.25 ? 103 VAL C CA     1 
ATOM   9928  C C      . VAL C 1 103 ? 255.170 10.091  128.568 1.00 185.24 ? 103 VAL C C      1 
ATOM   9929  O O      . VAL C 1 103 ? 256.355 10.343  128.354 1.00 189.56 ? 103 VAL C O      1 
ATOM   9930  C CB     . VAL C 1 103 ? 254.306 11.730  130.240 1.00 185.69 ? 103 VAL C CB     1 
ATOM   9931  C CG1    . VAL C 1 103 ? 253.337 12.298  129.204 1.00 186.22 ? 103 VAL C CG1    1 
ATOM   9932  C CG2    . VAL C 1 103 ? 253.755 11.929  131.645 1.00 184.45 ? 103 VAL C CG2    1 
ATOM   9933  H H      . VAL C 1 103 ? 256.319 9.827   130.807 1.00 221.83 ? 103 VAL C H      1 
ATOM   9934  H HA     . VAL C 1 103 ? 253.738 9.758   129.998 1.00 221.10 ? 103 VAL C HA     1 
ATOM   9935  H HB     . VAL C 1 103 ? 255.140 12.222  130.173 1.00 222.83 ? 103 VAL C HB     1 
ATOM   9936  H HG11   . VAL C 1 103 ? 253.182 13.235  129.397 1.00 223.46 ? 103 VAL C HG11   1 
ATOM   9937  H HG12   . VAL C 1 103 ? 253.728 12.202  128.321 1.00 223.46 ? 103 VAL C HG12   1 
ATOM   9938  H HG13   . VAL C 1 103 ? 252.501 11.807  129.251 1.00 223.46 ? 103 VAL C HG13   1 
ATOM   9939  H HG21   . VAL C 1 103 ? 253.591 12.874  131.789 1.00 221.33 ? 103 VAL C HG21   1 
ATOM   9940  H HG22   . VAL C 1 103 ? 252.927 11.431  131.732 1.00 221.33 ? 103 VAL C HG22   1 
ATOM   9941  H HG23   . VAL C 1 103 ? 254.405 11.604  132.288 1.00 221.33 ? 103 VAL C HG23   1 
ATOM   9942  N N      . VAL C 1 104 ? 254.326 9.690   127.621 1.00 180.11 ? 104 VAL C N      1 
ATOM   9943  C CA     . VAL C 1 104 ? 254.723 9.554   126.222 1.00 175.46 ? 104 VAL C CA     1 
ATOM   9944  C C      . VAL C 1 104 ? 253.692 10.241  125.336 1.00 172.63 ? 104 VAL C C      1 
ATOM   9945  O O      . VAL C 1 104 ? 252.568 9.763   125.197 1.00 174.98 ? 104 VAL C O      1 
ATOM   9946  C CB     . VAL C 1 104 ? 254.833 8.073   125.806 1.00 171.52 ? 104 VAL C CB     1 
ATOM   9947  C CG1    . VAL C 1 104 ? 255.278 7.953   124.352 1.00 171.08 ? 104 VAL C CG1    1 
ATOM   9948  C CG2    . VAL C 1 104 ? 255.797 7.333   126.720 1.00 170.50 ? 104 VAL C CG2    1 
ATOM   9949  H H      . VAL C 1 104 ? 253.503 9.487   127.766 1.00 216.13 ? 104 VAL C H      1 
ATOM   9950  H HA     . VAL C 1 104 ? 255.584 9.980   126.085 1.00 210.55 ? 104 VAL C HA     1 
ATOM   9951  H HB     . VAL C 1 104 ? 253.962 7.656   125.888 1.00 205.83 ? 104 VAL C HB     1 
ATOM   9952  H HG11   . VAL C 1 104 ? 255.339 7.014   124.117 1.00 205.30 ? 104 VAL C HG11   1 
ATOM   9953  H HG12   . VAL C 1 104 ? 254.627 8.395   123.785 1.00 205.30 ? 104 VAL C HG12   1 
ATOM   9954  H HG13   . VAL C 1 104 ? 256.145 8.377   124.251 1.00 205.30 ? 104 VAL C HG13   1 
ATOM   9955  H HG21   . VAL C 1 104 ? 255.850 6.406   126.439 1.00 204.60 ? 104 VAL C HG21   1 
ATOM   9956  H HG22   . VAL C 1 104 ? 256.672 7.747   126.659 1.00 204.60 ? 104 VAL C HG22   1 
ATOM   9957  H HG23   . VAL C 1 104 ? 255.469 7.384   127.632 1.00 204.60 ? 104 VAL C HG23   1 
ATOM   9958  N N      . LYS C 1 105 ? 254.086 11.362  124.740 1.00 167.50 ? 105 LYS C N      1 
ATOM   9959  C CA     . LYS C 1 105 ? 253.193 12.152  123.895 1.00 162.44 ? 105 LYS C CA     1 
ATOM   9960  C C      . LYS C 1 105 ? 251.949 12.603  124.658 1.00 157.36 ? 105 LYS C C      1 
ATOM   9961  O O      . LYS C 1 105 ? 250.837 12.564  124.129 1.00 152.96 ? 105 LYS C O      1 
ATOM   9962  C CB     . LYS C 1 105 ? 252.796 11.367  122.643 1.00 161.53 ? 105 LYS C CB     1 
ATOM   9963  C CG     . LYS C 1 105 ? 253.981 10.953  121.790 1.00 163.29 ? 105 LYS C CG     1 
ATOM   9964  C CD     . LYS C 1 105 ? 253.553 10.176  120.558 1.00 163.20 ? 105 LYS C CD     1 
ATOM   9965  C CE     . LYS C 1 105 ? 252.745 11.031  119.596 1.00 164.48 ? 105 LYS C CE     1 
ATOM   9966  N NZ     . LYS C 1 105 ? 252.547 10.338  118.295 1.00 165.02 ? 105 LYS C NZ     1 
ATOM   9967  H H      . LYS C 1 105 ? 254.877 11.691  124.809 1.00 200.99 ? 105 LYS C H      1 
ATOM   9968  H HA     . LYS C 1 105 ? 253.665 12.949  123.605 1.00 194.93 ? 105 LYS C HA     1 
ATOM   9969  H HB2    . LYS C 1 105 ? 252.328 10.561  122.913 1.00 193.84 ? 105 LYS C HB2    1 
ATOM   9970  H HB3    . LYS C 1 105 ? 252.214 11.919  122.097 1.00 193.84 ? 105 LYS C HB3    1 
ATOM   9971  H HG2    . LYS C 1 105 ? 254.455 11.747  121.498 1.00 195.95 ? 105 LYS C HG2    1 
ATOM   9972  H HG3    . LYS C 1 105 ? 254.568 10.388  122.315 1.00 195.95 ? 105 LYS C HG3    1 
ATOM   9973  H HD2    . LYS C 1 105 ? 254.343 9.860   120.092 1.00 195.84 ? 105 LYS C HD2    1 
ATOM   9974  H HD3    . LYS C 1 105 ? 253.003 9.425   120.830 1.00 195.84 ? 105 LYS C HD3    1 
ATOM   9975  H HE2    . LYS C 1 105 ? 251.873 11.211  119.981 1.00 197.38 ? 105 LYS C HE2    1 
ATOM   9976  H HE3    . LYS C 1 105 ? 253.218 11.861  119.430 1.00 197.38 ? 105 LYS C HE3    1 
ATOM   9977  H HZ1    . LYS C 1 105 ? 252.073 10.853  117.745 1.00 198.02 ? 105 LYS C HZ1    1 
ATOM   9978  H HZ2    . LYS C 1 105 ? 253.335 10.164  117.920 1.00 198.02 ? 105 LYS C HZ2    1 
ATOM   9979  H HZ3    . LYS C 1 105 ? 252.111 9.572   118.422 1.00 198.02 ? 105 LYS C HZ3    1 
ATOM   9980  N N      . GLY C 1 106 ? 252.150 13.033  125.901 1.00 158.54 ? 106 GLY C N      1 
ATOM   9981  C CA     . GLY C 1 106 ? 251.070 13.545  126.726 1.00 160.36 ? 106 GLY C CA     1 
ATOM   9982  C C      . GLY C 1 106 ? 250.203 12.454  127.324 1.00 164.81 ? 106 GLY C C      1 
ATOM   9983  O O      . GLY C 1 106 ? 249.154 12.738  127.903 1.00 155.01 ? 106 GLY C O      1 
ATOM   9984  H H      . GLY C 1 106 ? 252.916 13.037  126.291 1.00 190.25 ? 106 GLY C H      1 
ATOM   9985  H HA2    . GLY C 1 106 ? 251.442 14.069  127.452 1.00 192.43 ? 106 GLY C HA2    1 
ATOM   9986  H HA3    . GLY C 1 106 ? 250.505 14.123  126.191 1.00 192.43 ? 106 GLY C HA3    1 
ATOM   9987  N N      . VAL C 1 107 ? 250.646 11.206  127.186 1.00 182.40 ? 107 VAL C N      1 
ATOM   9988  C CA     . VAL C 1 107 ? 249.900 10.050  127.676 1.00 189.99 ? 107 VAL C CA     1 
ATOM   9989  C C      . VAL C 1 107 ? 250.716 9.312   128.730 1.00 183.18 ? 107 VAL C C      1 
ATOM   9990  O O      . VAL C 1 107 ? 251.870 8.958   128.494 1.00 191.08 ? 107 VAL C O      1 
ATOM   9991  C CB     . VAL C 1 107 ? 249.567 9.070   126.528 1.00 196.33 ? 107 VAL C CB     1 
ATOM   9992  C CG1    . VAL C 1 107 ? 248.726 7.908   127.038 1.00 195.47 ? 107 VAL C CG1    1 
ATOM   9993  C CG2    . VAL C 1 107 ? 248.842 9.789   125.397 1.00 199.07 ? 107 VAL C CG2    1 
ATOM   9994  H H      . VAL C 1 107 ? 251.390 11.001  126.806 1.00 218.88 ? 107 VAL C H      1 
ATOM   9995  H HA     . VAL C 1 107 ? 249.069 10.347  128.080 1.00 227.99 ? 107 VAL C HA     1 
ATOM   9996  H HB     . VAL C 1 107 ? 250.394 8.708   126.172 1.00 235.60 ? 107 VAL C HB     1 
ATOM   9997  H HG11   . VAL C 1 107 ? 248.533 7.310   126.299 1.00 234.57 ? 107 VAL C HG11   1 
ATOM   9998  H HG12   . VAL C 1 107 ? 249.224 7.436   127.724 1.00 234.57 ? 107 VAL C HG12   1 
ATOM   9999  H HG13   . VAL C 1 107 ? 247.900 8.255   127.408 1.00 234.57 ? 107 VAL C HG13   1 
ATOM   10000 H HG21   . VAL C 1 107 ? 248.646 9.151   124.692 1.00 238.88 ? 107 VAL C HG21   1 
ATOM   10001 H HG22   . VAL C 1 107 ? 248.017 10.166  125.741 1.00 238.88 ? 107 VAL C HG22   1 
ATOM   10002 H HG23   . VAL C 1 107 ? 249.412 10.495  125.055 1.00 238.88 ? 107 VAL C HG23   1 
ATOM   10003 N N      . GLU C 1 108 ? 250.111 9.075   129.889 1.00 163.92 ? 108 GLU C N      1 
ATOM   10004 C CA     . GLU C 1 108 ? 250.786 8.365   130.969 1.00 150.53 ? 108 GLU C CA     1 
ATOM   10005 C C      . GLU C 1 108 ? 250.918 6.877   130.658 1.00 147.41 ? 108 GLU C C      1 
ATOM   10006 O O      . GLU C 1 108 ? 250.085 6.304   129.953 1.00 148.87 ? 108 GLU C O      1 
ATOM   10007 C CB     . GLU C 1 108 ? 250.032 8.549   132.282 1.00 143.50 ? 108 GLU C CB     1 
ATOM   10008 C CG     . GLU C 1 108 ? 250.043 9.968   132.800 1.00 141.57 ? 108 GLU C CG     1 
ATOM   10009 C CD     . GLU C 1 108 ? 249.431 10.080  134.177 1.00 139.09 ? 108 GLU C CD     1 
ATOM   10010 O OE1    . GLU C 1 108 ? 248.906 9.064   134.680 1.00 134.42 ? 108 GLU C OE1    1 
ATOM   10011 O OE2    . GLU C 1 108 ? 249.480 11.183  134.758 1.00 142.13 ? 108 GLU C OE2    1 
ATOM   10012 H H      . GLU C 1 108 ? 249.307 9.315   130.076 1.00 196.70 ? 108 GLU C H      1 
ATOM   10013 H HA     . GLU C 1 108 ? 251.678 8.730   131.079 1.00 180.63 ? 108 GLU C HA     1 
ATOM   10014 H HB2    . GLU C 1 108 ? 249.107 8.289   132.150 1.00 172.20 ? 108 GLU C HB2    1 
ATOM   10015 H HB3    . GLU C 1 108 ? 250.439 7.984   132.958 1.00 172.20 ? 108 GLU C HB3    1 
ATOM   10016 H HG2    . GLU C 1 108 ? 250.960 10.281  132.851 1.00 169.88 ? 108 GLU C HG2    1 
ATOM   10017 H HG3    . GLU C 1 108 ? 249.532 10.530  132.197 1.00 169.88 ? 108 GLU C HG3    1 
ATOM   10018 N N      . VAL C 1 109 ? 251.967 6.257   131.195 1.00 143.23 ? 109 VAL C N      1 
ATOM   10019 C CA     . VAL C 1 109 ? 252.241 4.843   130.954 1.00 137.55 ? 109 VAL C CA     1 
ATOM   10020 C C      . VAL C 1 109 ? 252.821 4.198   132.212 1.00 134.13 ? 109 VAL C C      1 
ATOM   10021 O O      . VAL C 1 109 ? 253.546 4.846   132.968 1.00 125.59 ? 109 VAL C O      1 
ATOM   10022 C CB     . VAL C 1 109 ? 253.238 4.653   129.779 1.00 137.64 ? 109 VAL C CB     1 
ATOM   10023 C CG1    . VAL C 1 109 ? 253.452 3.173   129.473 1.00 136.32 ? 109 VAL C CG1    1 
ATOM   10024 C CG2    . VAL C 1 109 ? 252.753 5.381   128.532 1.00 138.59 ? 109 VAL C CG2    1 
ATOM   10025 H H      . VAL C 1 109 ? 252.542 6.639   131.708 1.00 171.87 ? 109 VAL C H      1 
ATOM   10026 H HA     . VAL C 1 109 ? 251.414 4.388   130.730 1.00 165.06 ? 109 VAL C HA     1 
ATOM   10027 H HB     . VAL C 1 109 ? 254.095 5.032   130.031 1.00 165.17 ? 109 VAL C HB     1 
ATOM   10028 H HG11   . VAL C 1 109 ? 254.078 3.091   128.737 1.00 163.59 ? 109 VAL C HG11   1 
ATOM   10029 H HG12   . VAL C 1 109 ? 253.808 2.736   130.262 1.00 163.59 ? 109 VAL C HG12   1 
ATOM   10030 H HG13   . VAL C 1 109 ? 252.601 2.776   129.230 1.00 163.59 ? 109 VAL C HG13   1 
ATOM   10031 H HG21   . VAL C 1 109 ? 253.395 5.245   127.818 1.00 166.31 ? 109 VAL C HG21   1 
ATOM   10032 H HG22   . VAL C 1 109 ? 251.889 5.023   128.274 1.00 166.31 ? 109 VAL C HG22   1 
ATOM   10033 H HG23   . VAL C 1 109 ? 252.673 6.327   128.730 1.00 166.31 ? 109 VAL C HG23   1 
ATOM   10034 N N      . ASP C 1 110 ? 252.489 2.927   132.428 1.00 142.68 ? 110 ASP C N      1 
ATOM   10035 C CA     . ASP C 1 110 ? 253.042 2.143   133.531 1.00 149.89 ? 110 ASP C CA     1 
ATOM   10036 C C      . ASP C 1 110 ? 253.816 0.951   132.978 1.00 148.86 ? 110 ASP C C      1 
ATOM   10037 O O      . ASP C 1 110 ? 253.320 0.232   132.109 1.00 153.66 ? 110 ASP C O      1 
ATOM   10038 C CB     . ASP C 1 110 ? 251.931 1.637   134.459 1.00 153.05 ? 110 ASP C CB     1 
ATOM   10039 C CG     . ASP C 1 110 ? 251.265 2.751   135.246 1.00 154.93 ? 110 ASP C CG     1 
ATOM   10040 O OD1    . ASP C 1 110 ? 251.917 3.787   135.494 1.00 158.76 ? 110 ASP C OD1    1 
ATOM   10041 O OD2    . ASP C 1 110 ? 250.088 2.584   135.628 1.00 151.63 ? 110 ASP C OD2    1 
ATOM   10042 H H      . ASP C 1 110 ? 251.934 2.487   131.939 1.00 171.22 ? 110 ASP C H      1 
ATOM   10043 H HA     . ASP C 1 110 ? 253.651 2.693   134.048 1.00 179.87 ? 110 ASP C HA     1 
ATOM   10044 H HB2    . ASP C 1 110 ? 251.250 1.199   133.925 1.00 183.66 ? 110 ASP C HB2    1 
ATOM   10045 H HB3    . ASP C 1 110 ? 252.311 1.009   135.092 1.00 183.66 ? 110 ASP C HB3    1 
ATOM   10046 N N      . VAL C 1 111 ? 255.029 0.748   133.487 1.00 140.70 ? 111 VAL C N      1 
ATOM   10047 C CA     . VAL C 1 111 ? 255.874 -0.369  133.071 1.00 133.03 ? 111 VAL C CA     1 
ATOM   10048 C C      . VAL C 1 111 ? 256.180 -1.242  134.281 1.00 129.70 ? 111 VAL C C      1 
ATOM   10049 O O      . VAL C 1 111 ? 257.025 -0.893  135.104 1.00 130.62 ? 111 VAL C O      1 
ATOM   10050 C CB     . VAL C 1 111 ? 257.201 0.119   132.448 1.00 132.14 ? 111 VAL C CB     1 
ATOM   10051 C CG1    . VAL C 1 111 ? 258.025 -1.064  131.940 1.00 131.29 ? 111 VAL C CG1    1 
ATOM   10052 C CG2    . VAL C 1 111 ? 256.935 1.109   131.319 1.00 131.84 ? 111 VAL C CG2    1 
ATOM   10053 H H      . VAL C 1 111 ? 255.390 1.251   134.084 1.00 168.84 ? 111 VAL C H      1 
ATOM   10054 H HA     . VAL C 1 111 ? 255.404 -0.905  132.414 1.00 159.64 ? 111 VAL C HA     1 
ATOM   10055 H HB     . VAL C 1 111 ? 257.720 0.575   133.129 1.00 158.57 ? 111 VAL C HB     1 
ATOM   10056 H HG11   . VAL C 1 111 ? 258.851 -0.731  131.555 1.00 157.54 ? 111 VAL C HG11   1 
ATOM   10057 H HG12   . VAL C 1 111 ? 258.221 -1.654  132.685 1.00 157.54 ? 111 VAL C HG12   1 
ATOM   10058 H HG13   . VAL C 1 111 ? 257.513 -1.538  131.267 1.00 157.54 ? 111 VAL C HG13   1 
ATOM   10059 H HG21   . VAL C 1 111 ? 257.783 1.398   130.947 1.00 158.21 ? 111 VAL C HG21   1 
ATOM   10060 H HG22   . VAL C 1 111 ? 256.405 0.671   130.634 1.00 158.21 ? 111 VAL C HG22   1 
ATOM   10061 H HG23   . VAL C 1 111 ? 256.452 1.871   131.675 1.00 158.21 ? 111 VAL C HG23   1 
ATOM   10062 N N      . VAL C 1 112 ? 255.495 -2.377  134.378 1.00 126.84 ? 112 VAL C N      1 
ATOM   10063 C CA     . VAL C 1 112 ? 255.587 -3.245  135.550 1.00 125.72 ? 112 VAL C CA     1 
ATOM   10064 C C      . VAL C 1 112 ? 256.291 -4.558  135.205 1.00 138.79 ? 112 VAL C C      1 
ATOM   10065 O O      . VAL C 1 112 ? 255.826 -5.301  134.343 1.00 137.39 ? 112 VAL C O      1 
ATOM   10066 C CB     . VAL C 1 112 ? 254.184 -3.560  136.105 1.00 113.67 ? 112 VAL C CB     1 
ATOM   10067 C CG1    . VAL C 1 112 ? 254.276 -4.396  137.385 1.00 109.08 ? 112 VAL C CG1    1 
ATOM   10068 C CG2    . VAL C 1 112 ? 253.417 -2.267  136.360 1.00 110.13 ? 112 VAL C CG2    1 
ATOM   10069 H H      . VAL C 1 112 ? 254.962 -2.671  133.771 1.00 152.21 ? 112 VAL C H      1 
ATOM   10070 H HA     . VAL C 1 112 ? 256.097 -2.797  136.243 1.00 150.87 ? 112 VAL C HA     1 
ATOM   10071 H HB     . VAL C 1 112 ? 253.692 -4.075  135.446 1.00 136.41 ? 112 VAL C HB     1 
ATOM   10072 H HG11   . VAL C 1 112 ? 253.380 -4.577  137.709 1.00 130.89 ? 112 VAL C HG11   1 
ATOM   10073 H HG12   . VAL C 1 112 ? 254.731 -5.229  137.185 1.00 130.89 ? 112 VAL C HG12   1 
ATOM   10074 H HG13   . VAL C 1 112 ? 254.775 -3.898  138.052 1.00 130.89 ? 112 VAL C HG13   1 
ATOM   10075 H HG21   . VAL C 1 112 ? 252.538 -2.485  136.708 1.00 132.15 ? 112 VAL C HG21   1 
ATOM   10076 H HG22   . VAL C 1 112 ? 253.905 -1.732  137.005 1.00 132.15 ? 112 VAL C HG22   1 
ATOM   10077 H HG23   . VAL C 1 112 ? 253.331 -1.782  135.524 1.00 132.15 ? 112 VAL C HG23   1 
ATOM   10078 N N      . PRO C 1 113 ? 257.424 -4.847  135.865 1.00 155.17 ? 113 PRO C N      1 
ATOM   10079 C CA     . PRO C 1 113 ? 258.045 -6.157  135.639 1.00 161.10 ? 113 PRO C CA     1 
ATOM   10080 C C      . PRO C 1 113 ? 257.311 -7.275  136.376 1.00 156.06 ? 113 PRO C C      1 
ATOM   10081 O O      . PRO C 1 113 ? 256.778 -7.043  137.463 1.00 158.12 ? 113 PRO C O      1 
ATOM   10082 C CB     . PRO C 1 113 ? 259.458 -5.988  136.216 1.00 167.15 ? 113 PRO C CB     1 
ATOM   10083 C CG     . PRO C 1 113 ? 259.656 -4.518  136.376 1.00 168.86 ? 113 PRO C CG     1 
ATOM   10084 C CD     . PRO C 1 113 ? 258.303 -3.955  136.639 1.00 163.97 ? 113 PRO C CD     1 
ATOM   10085 H HA     . PRO C 1 113 ? 258.095 -6.360  134.692 1.00 193.32 ? 113 PRO C HA     1 
ATOM   10086 H HB2    . PRO C 1 113 ? 259.514 -6.435  137.075 1.00 200.58 ? 113