data_4X86
# 
_entry.id   4X86 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X86         
WWPDB D_1000205232 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X86 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kuwabara, N.' 1 
'Kato, R.'     2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                9387 
_citation.page_last                 9398 
_citation.title                     
;Structure of a BAG6 (Bcl-2-associated Athanogene 6)-Ubl4a (Ubiquitin-like Protein 4a) Complex Reveals a Novel Binding Interface That Functions in Tail-anchored Protein Biogenesis
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M114.631804 
_citation.pdbx_database_id_PubMed   25713138 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kuwabara, N.'  1 
primary 'Minami, R.'    2 
primary 'Yokota, N.'    3 
primary 'Matsumoto, H.' 4 
primary 'Senda, T.'     5 
primary 'Kawahara, H.'  6 
primary 'Kato, R.'      7 
# 
_cell.entry_id           4X86 
_cell.length_a           72.987 
_cell.length_b           72.987 
_cell.length_c           48.481 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4X86 
_symmetry.space_group_name_H-M             'P 62' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                171 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ubiquitin-like protein 4A'                                 6657.555 1  ? ? 'UNP residues 95-147'    ? 
2 polymer     man 'Large proline-rich protein BAG6'                           9003.036 1  ? ? 'UNP residues 1048-1123' ? 
3 non-polymer syn '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' 614.877  1  ? ? ?                        ? 
4 non-polymer syn 'SULFATE ION'                                               96.063   2  ? ? ?                        ? 
5 water       nat water                                                       18.015   21 ? ? ?                        ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Ubiquitin-like protein GDX' 
2 
;BAG family molecular chaperone regulator 6,BCL2-associated athanogene 6,BAG6,HLA-B-associated transcript 3,Protein G3,Protein Scythe
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GPLGSVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEV                           
GPLGSVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEV                           A ? 
2 'polypeptide(L)' no no 
;GPLGSAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFP
N
;
;GPLGSAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFP
N
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  VAL n 
1 7  TRP n 
1 8  GLN n 
1 9  LEU n 
1 10 ILE n 
1 11 SER n 
1 12 LYS n 
1 13 VAL n 
1 14 LEU n 
1 15 ALA n 
1 16 ARG n 
1 17 HIS n 
1 18 PHE n 
1 19 SER n 
1 20 ALA n 
1 21 ALA n 
1 22 ASP n 
1 23 ALA n 
1 24 SER n 
1 25 ARG n 
1 26 VAL n 
1 27 LEU n 
1 28 GLU n 
1 29 GLN n 
1 30 LEU n 
1 31 GLN n 
1 32 ARG n 
1 33 ASP n 
1 34 TYR n 
1 35 GLU n 
1 36 ARG n 
1 37 SER n 
1 38 LEU n 
1 39 SER n 
1 40 ARG n 
1 41 LEU n 
1 42 THR n 
1 43 LEU n 
1 44 ASP n 
1 45 ASP n 
1 46 ILE n 
1 47 GLU n 
1 48 ARG n 
1 49 LEU n 
1 50 ALA n 
1 51 SER n 
1 52 ARG n 
1 53 PHE n 
1 54 LEU n 
1 55 HIS n 
1 56 PRO n 
1 57 GLU n 
1 58 VAL n 
2 1  GLY n 
2 2  PRO n 
2 3  LEU n 
2 4  GLY n 
2 5  SER n 
2 6  ALA n 
2 7  LYS n 
2 8  ARG n 
2 9  ARG n 
2 10 LYS n 
2 11 THR n 
2 12 MET n 
2 13 GLN n 
2 14 GLY n 
2 15 GLU n 
2 16 GLY n 
2 17 PRO n 
2 18 GLN n 
2 19 LEU n 
2 20 LEU n 
2 21 LEU n 
2 22 SER n 
2 23 GLU n 
2 24 ALA n 
2 25 VAL n 
2 26 SER n 
2 27 ARG n 
2 28 ALA n 
2 29 ALA n 
2 30 LYS n 
2 31 ALA n 
2 32 ALA n 
2 33 GLY n 
2 34 ALA n 
2 35 ARG n 
2 36 PRO n 
2 37 LEU n 
2 38 THR n 
2 39 SER n 
2 40 PRO n 
2 41 GLU n 
2 42 SER n 
2 43 LEU n 
2 44 SER n 
2 45 ARG n 
2 46 ASP n 
2 47 LEU n 
2 48 GLU n 
2 49 ALA n 
2 50 PRO n 
2 51 GLU n 
2 52 VAL n 
2 53 GLN n 
2 54 GLU n 
2 55 SER n 
2 56 TYR n 
2 57 ARG n 
2 58 GLN n 
2 59 GLN n 
2 60 LEU n 
2 61 ARG n 
2 62 SER n 
2 63 ASP n 
2 64 ILE n 
2 65 GLN n 
2 66 LYS n 
2 67 ARG n 
2 68 LEU n 
2 69 GLN n 
2 70 GLU n 
2 71 ASP n 
2 72 PRO n 
2 73 ASN n 
2 74 TYR n 
2 75 SER n 
2 76 PRO n 
2 77 GLN n 
2 78 ARG n 
2 79 PHE n 
2 80 PRO n 
2 81 ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 58 Human ? UBL4A ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 81 Human ? BAG6  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 ? ? ? ? ? ? 'BL21(DE3)' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
UBL4A_HUMAN UNP ? 1 1 ? ? P11441 ? VWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEV                        95   ? 
BAG6_HUMAN  UNP ? 2 2 ? ? P46379 ? AKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPN 1048 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4X86 A 6 ? 58 ? P11441 95   ? 147  ? 95   147  
2 2 4X86 B 6 ? 81 ? P46379 1048 ? 1123 ? 1049 1124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X86 GLY A 1 ? UNP P11441 ? ? 'expression tag' 90   1  
1 4X86 PRO A 2 ? UNP P11441 ? ? 'expression tag' 91   2  
1 4X86 LEU A 3 ? UNP P11441 ? ? 'expression tag' 92   3  
1 4X86 GLY A 4 ? UNP P11441 ? ? 'expression tag' 93   4  
1 4X86 SER A 5 ? UNP P11441 ? ? 'expression tag' 94   5  
2 4X86 GLY B 1 ? UNP P46379 ? ? 'expression tag' 1044 6  
2 4X86 PRO B 2 ? UNP P46379 ? ? 'expression tag' 1045 7  
2 4X86 LEU B 3 ? UNP P46379 ? ? 'expression tag' 1046 8  
2 4X86 GLY B 4 ? UNP P46379 ? ? 'expression tag' 1047 9  
2 4X86 SER B 5 ? UNP P46379 ? ? 'expression tag' 1048 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                     ?     'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                    ?     'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ?     'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ?     'C4 H7 N O4'      133.103 
CPS non-polymer         . '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' CHAPS 'C32 H58 N2 O7 S' 614.877 
GLN 'L-peptide linking' y GLUTAMINE                                                   ?     'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ?     'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                     ?     'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                   ?     'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                       ?     'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                  ?     'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ?     'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                      ?     'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                  ?     'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                               ?     'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                     ?     'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                      ?     'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                               ?     'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                   ?     'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ?     'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ?     'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                      ?     'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X86 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.38 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.33 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              9.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'CAPS-NaOH, AmSO4, LiSO4, 2,2,2-trifluoroethanol, CHAPS' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-11-27 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-1A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL-1A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            46.410 
_reflns.entry_id                         4X86 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.850 
_reflns.d_resolution_low                 48.480 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12717 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  19.600 
_reflns.pdbx_Rmerge_I_obs                0.045 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             10 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.011 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         249572 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1.000 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.850 1.890  ? 1.100   15645 ? ? 789 ? 100.000 ? ? ? ? 0.03491 ? ? ? ? ? ? ? ? 19.800 ? ? ? ? ? 0.802 0 1 1 0.530 ? 
9.060 48.480 ? 109.900 2145  ? ? 120 ? 98.900  ? ? ? ? 0.027   ? ? ? ? ? ? ? ? 17.900 ? ? ? ? ? 0.006 0 2 1 1.000 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4X86 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     12693 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.469 
_refine.ls_d_res_high                            1.850 
_refine.ls_percent_reflns_obs                    99.94 
_refine.ls_R_factor_obs                          0.2075 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2042 
_refine.ls_R_factor_R_free                       0.2371 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.95 
_refine.ls_number_reflns_R_free                  1263 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.27 
_refine.pdbx_overall_phase_error                 25.87 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        828 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         52 
_refine_hist.number_atoms_solvent             21 
_refine_hist.number_atoms_total               901 
_refine_hist.d_res_high                       1.850 
_refine_hist.d_res_low                        38.469 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 890  'X-RAY DIFFRACTION' ? 
f_angle_d          1.150  ? ? 1209 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.672 ? ? 354  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.049  ? ? 142  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 149  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.8501 1.9241  1272 0.3232 100.00 0.3561 . . 141 . . . . 
'X-RAY DIFFRACTION' . 1.9241 2.0117  1255 0.2793 100.00 0.3222 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.0117 2.1178  1262 0.2193 100.00 0.2521 . . 135 . . . . 
'X-RAY DIFFRACTION' . 2.1178 2.2504  1256 0.2076 100.00 0.2366 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.2504 2.4242  1273 0.1997 100.00 0.2667 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.4242 2.6681  1250 0.2090 100.00 0.2401 . . 141 . . . . 
'X-RAY DIFFRACTION' . 2.6681 3.0540  1275 0.2201 100.00 0.2886 . . 145 . . . . 
'X-RAY DIFFRACTION' . 3.0540 3.8471  1285 0.1948 100.00 0.2259 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.8471 38.4770 1302 0.1956 100.00 0.2144 . . 144 . . . . 
# 
_struct.entry_id                     4X86 
_struct.title                        'Crystal structure of BAG6-Ubl4a complex' 
_struct.pdbx_descriptor              'Ubiquitin-like protein 4A/Large proline-rich protein BAG6' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X86 
_struct_keywords.text            'tail-anchored transmembrane protein biogenesis, quality control of proteins, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.details                      'biological unit is the same as asym.' 
_struct_biol.id                           1 
_struct_biol.pdbx_parent_biol_id          ? 
_struct_biol.pdbx_formula_weight          ? 
_struct_biol.pdbx_formula_weight_method   ? 
_struct_biol.pdbx_aggregation_state       ? 
_struct_biol.pdbx_assembly_method         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 5  ? PHE A 18 ? SER A 94   PHE A 107  1 ? 14 
HELX_P HELX_P2 AA2 SER A 19 ? LEU A 41 ? SER A 108  LEU A 130  1 ? 23 
HELX_P HELX_P3 AA3 THR A 42 ? LEU A 54 ? THR A 131  LEU A 143  1 ? 13 
HELX_P HELX_P4 AA4 LEU B 20 ? GLY B 33 ? LEU B 1063 GLY B 1076 1 ? 14 
HELX_P HELX_P5 AA5 SER B 39 ? GLU B 48 ? SER B 1082 GLU B 1091 1 ? 10 
HELX_P HELX_P6 AA6 ALA B 49 ? GLN B 69 ? ALA B 1092 GLN B 1112 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B CPS 1201 ? 4 'binding site for residue CPS B 1201' 
AC2 Software B SO4 1202 ? 6 'binding site for residue SO4 B 1202' 
AC3 Software B SO4 1203 ? 3 'binding site for residue SO4 B 1203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PHE A 53 ? PHE A 142  . ? 1_555 ? 
2  AC1 4 ARG B 57 ? ARG B 1100 . ? 1_555 ? 
3  AC1 4 ARG B 61 ? ARG B 1104 . ? 1_555 ? 
4  AC1 4 SO4 E .  ? SO4 B 1203 . ? 1_555 ? 
5  AC2 6 SER B 26 ? SER B 1069 . ? 1_555 ? 
6  AC2 6 ALA B 29 ? ALA B 1072 . ? 1_555 ? 
7  AC2 6 ALA B 34 ? ALA B 1077 . ? 1_555 ? 
8  AC2 6 PRO B 36 ? PRO B 1079 . ? 1_555 ? 
9  AC2 6 PRO B 40 ? PRO B 1083 . ? 1_555 ? 
10 AC2 6 LEU B 43 ? LEU B 1086 . ? 1_555 ? 
11 AC3 3 LEU B 19 ? LEU B 1062 . ? 1_555 ? 
12 AC3 3 CPS C .  ? CPS B 1201 . ? 1_555 ? 
13 AC3 3 HOH G .  ? HOH B 1301 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X86 
_atom_sites.fract_transf_matrix[1][1]   0.013701 
_atom_sites.fract_transf_matrix[1][2]   0.007910 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015821 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 4  ? -76.783 168.855 -4.651  1.00 56.59  ? 93   GLY A N   1 
ATOM   2   C CA  . GLY A 1 4  ? -77.222 168.673 -3.273  1.00 59.77  ? 93   GLY A CA  1 
ATOM   3   C C   . GLY A 1 4  ? -77.511 167.210 -3.002  1.00 64.63  ? 93   GLY A C   1 
ATOM   4   O O   . GLY A 1 4  ? -77.684 166.446 -3.955  1.00 65.32  ? 93   GLY A O   1 
ATOM   5   N N   . SER A 1 5  ? -77.577 166.800 -1.729  1.00 51.86  ? 94   SER A N   1 
ATOM   6   C CA  . SER A 1 5  ? -77.687 165.374 -1.462  1.00 43.14  ? 94   SER A CA  1 
ATOM   7   C C   . SER A 1 5  ? -78.312 165.003 -0.122  1.00 35.84  ? 94   SER A C   1 
ATOM   8   O O   . SER A 1 5  ? -78.363 165.814 0.817   1.00 40.25  ? 94   SER A O   1 
ATOM   9   C CB  . SER A 1 5  ? -76.308 164.731 -1.528  1.00 48.86  ? 94   SER A CB  1 
ATOM   10  O OG  . SER A 1 5  ? -75.580 165.033 -0.348  1.00 44.15  ? 94   SER A OG  1 
ATOM   11  N N   . VAL A 1 6  ? -78.728 163.749 -0.018  1.00 36.76  ? 95   VAL A N   1 
ATOM   12  C CA  . VAL A 1 6  ? -79.230 163.237 1.270   1.00 39.54  ? 95   VAL A CA  1 
ATOM   13  C C   . VAL A 1 6  ? -78.156 163.368 2.372   1.00 39.28  ? 95   VAL A C   1 
ATOM   14  O O   . VAL A 1 6  ? -78.475 163.619 3.552   1.00 36.60  ? 95   VAL A O   1 
ATOM   15  C CB  . VAL A 1 6  ? -79.683 161.763 1.136   1.00 40.97  ? 95   VAL A CB  1 
ATOM   16  C CG1 . VAL A 1 6  ? -78.511 160.853 0.801   1.00 42.45  ? 95   VAL A CG1 1 
ATOM   17  C CG2 . VAL A 1 6  ? -80.390 161.289 2.414   1.00 45.75  ? 95   VAL A CG2 1 
ATOM   18  N N   . TRP A 1 7  ? -76.885 163.242 1.998   1.00 33.08  ? 96   TRP A N   1 
ATOM   19  C CA  . TRP A 1 7  ? -75.803 163.291 3.011   1.00 34.55  ? 96   TRP A CA  1 
ATOM   20  C C   . TRP A 1 7  ? -75.735 164.662 3.654   1.00 36.06  ? 96   TRP A C   1 
ATOM   21  O O   . TRP A 1 7  ? -75.444 164.824 4.847   1.00 34.61  ? 96   TRP A O   1 
ATOM   22  C CB  . TRP A 1 7  ? -74.465 162.925 2.372   1.00 36.56  ? 96   TRP A CB  1 
ATOM   23  C CG  . TRP A 1 7  ? -74.556 161.636 1.589   1.00 45.51  ? 96   TRP A CG  1 
ATOM   24  C CD1 . TRP A 1 7  ? -74.368 161.468 0.236   1.00 46.85  ? 96   TRP A CD1 1 
ATOM   25  C CD2 . TRP A 1 7  ? -74.885 160.342 2.111   1.00 44.97  ? 96   TRP A CD2 1 
ATOM   26  N NE1 . TRP A 1 7  ? -74.548 160.149 -0.103  1.00 45.94  ? 96   TRP A NE1 1 
ATOM   27  C CE2 . TRP A 1 7  ? -74.869 159.436 1.031   1.00 48.58  ? 96   TRP A CE2 1 
ATOM   28  C CE3 . TRP A 1 7  ? -75.199 159.860 3.395   1.00 43.62  ? 96   TRP A CE3 1 
ATOM   29  C CZ2 . TRP A 1 7  ? -75.145 158.082 1.188   1.00 54.82  ? 96   TRP A CZ2 1 
ATOM   30  C CZ3 . TRP A 1 7  ? -75.469 158.519 3.550   1.00 51.51  ? 96   TRP A CZ3 1 
ATOM   31  C CH2 . TRP A 1 7  ? -75.434 157.641 2.452   1.00 51.89  ? 96   TRP A CH2 1 
ATOM   32  N N   . GLN A 1 8  ? -75.983 165.678 2.842   1.00 30.88  ? 97   GLN A N   1 
ATOM   33  C CA  . GLN A 1 8  ? -75.974 167.043 3.332   1.00 31.25  ? 97   GLN A CA  1 
ATOM   34  C C   . GLN A 1 8  ? -77.160 167.316 4.254   1.00 35.10  ? 97   GLN A C   1 
ATOM   35  O O   . GLN A 1 8  ? -77.025 168.002 5.268   1.00 31.77  ? 97   GLN A O   1 
ATOM   36  C CB  . GLN A 1 8  ? -75.974 167.995 2.126   1.00 33.77  ? 97   GLN A CB  1 
ATOM   37  C CG  . GLN A 1 8  ? -74.647 167.936 1.341   1.00 32.27  ? 97   GLN A CG  1 
ATOM   38  C CD  . GLN A 1 8  ? -74.761 168.643 -0.008  1.00 35.53  ? 97   GLN A CD  1 
ATOM   39  O OE1 . GLN A 1 8  ? -75.860 168.745 -0.556  1.00 37.71  ? 97   GLN A OE1 1 
ATOM   40  N NE2 . GLN A 1 8  ? -73.641 169.097 -0.547  1.00 36.26  ? 97   GLN A NE2 1 
ATOM   41  N N   . LEU A 1 9  ? -78.333 166.825 3.873   1.00 34.34  ? 98   LEU A N   1 
ATOM   42  C CA  . LEU A 1 9  ? -79.517 166.983 4.735   1.00 35.62  ? 98   LEU A CA  1 
ATOM   43  C C   . LEU A 1 9  ? -79.350 166.203 6.044   1.00 32.54  ? 98   LEU A C   1 
ATOM   44  O O   . LEU A 1 9  ? -79.656 166.722 7.117   1.00 37.27  ? 98   LEU A O   1 
ATOM   45  C CB  . LEU A 1 9  ? -80.781 166.503 4.029   1.00 33.11  ? 98   LEU A CB  1 
ATOM   46  C CG  . LEU A 1 9  ? -81.150 167.328 2.779   1.00 35.38  ? 98   LEU A CG  1 
ATOM   47  C CD1 . LEU A 1 9  ? -82.419 166.748 2.176   1.00 44.43  ? 98   LEU A CD1 1 
ATOM   48  C CD2 . LEU A 1 9  ? -81.361 168.747 3.171   1.00 43.07  ? 98   LEU A CD2 1 
ATOM   49  N N   . ILE A 1 10 ? -78.893 164.966 5.960   1.00 32.51  ? 99   ILE A N   1 
ATOM   50  C CA  . ILE A 1 10 ? -78.620 164.188 7.191   1.00 36.01  ? 99   ILE A CA  1 
ATOM   51  C C   . ILE A 1 10 ? -77.619 164.908 8.110   1.00 35.93  ? 99   ILE A C   1 
ATOM   52  O O   . ILE A 1 10 ? -77.795 164.951 9.326   1.00 35.91  ? 99   ILE A O   1 
ATOM   53  C CB  . ILE A 1 10 ? -78.097 162.776 6.831   1.00 37.95  ? 99   ILE A CB  1 
ATOM   54  C CG1 . ILE A 1 10 ? -79.230 161.946 6.192   1.00 38.24  ? 99   ILE A CG1 1 
ATOM   55  C CG2 . ILE A 1 10 ? -77.504 162.067 8.042   1.00 42.88  ? 99   ILE A CG2 1 
ATOM   56  C CD1 . ILE A 1 10 ? -78.733 160.643 5.552   1.00 40.24  ? 99   ILE A CD1 1 
ATOM   57  N N   . SER A 1 11 ? -76.573 165.507 7.532   1.00 29.76  ? 100  SER A N   1 
ATOM   58  C CA  . SER A 1 11 ? -75.556 166.193 8.339   1.00 33.80  ? 100  SER A CA  1 
ATOM   59  C C   . SER A 1 11 ? -76.115 167.404 9.090   1.00 39.40  ? 100  SER A C   1 
ATOM   60  O O   . SER A 1 11 ? -75.682 167.705 10.224  1.00 36.17  ? 100  SER A O   1 
ATOM   61  C CB  . SER A 1 11 ? -74.384 166.627 7.443   1.00 37.51  ? 100  SER A CB  1 
ATOM   62  O OG  . SER A 1 11 ? -73.413 167.337 8.190   1.00 50.87  ? 100  SER A OG  1 
ATOM   63  N N   . LYS A 1 12 ? -77.059 168.116 8.477   1.00 36.97  ? 101  LYS A N   1 
ATOM   64  C CA  . LYS A 1 12 ? -77.698 169.212 9.196   1.00 41.46  ? 101  LYS A CA  1 
ATOM   65  C C   . LYS A 1 12 ? -78.504 168.678 10.384  1.00 36.06  ? 101  LYS A C   1 
ATOM   66  O O   . LYS A 1 12 ? -78.597 169.348 11.400  1.00 36.02  ? 101  LYS A O   1 
ATOM   67  C CB  . LYS A 1 12 ? -78.602 170.032 8.276   1.00 39.84  ? 101  LYS A CB  1 
ATOM   68  C CG  . LYS A 1 12 ? -77.827 170.923 7.302   1.00 45.62  ? 101  LYS A CG  1 
ATOM   69  C CD  . LYS A 1 12 ? -78.773 171.888 6.603   1.00 63.72  ? 101  LYS A CD  1 
ATOM   70  C CE  . LYS A 1 12 ? -78.018 173.013 5.897   1.00 73.25  ? 101  LYS A CE  1 
ATOM   71  N NZ  . LYS A 1 12 ? -77.007 173.667 6.781   1.00 70.15  ? 101  LYS A NZ  1 
ATOM   72  N N   . VAL A 1 13 ? -79.141 167.525 10.226  1.00 32.49  ? 102  VAL A N   1 
ATOM   73  C CA  . VAL A 1 13 ? -79.874 166.923 11.361  1.00 38.01  ? 102  VAL A CA  1 
ATOM   74  C C   . VAL A 1 13 ? -78.891 166.471 12.440  1.00 36.83  ? 102  VAL A C   1 
ATOM   75  O O   . VAL A 1 13 ? -79.099 166.728 13.630  1.00 38.65  ? 102  VAL A O   1 
ATOM   76  C CB  . VAL A 1 13 ? -80.759 165.720 10.919  1.00 37.62  ? 102  VAL A CB  1 
ATOM   77  C CG1 . VAL A 1 13 ? -81.350 164.998 12.138  1.00 35.87  ? 102  VAL A CG1 1 
ATOM   78  C CG2 . VAL A 1 13 ? -81.897 166.201 10.003  1.00 37.37  ? 102  VAL A CG2 1 
ATOM   79  N N   . LEU A 1 14 ? -77.799 165.826 12.029  1.00 34.01  ? 103  LEU A N   1 
ATOM   80  C CA  . LEU A 1 14 ? -76.828 165.310 13.015  1.00 33.31  ? 103  LEU A CA  1 
ATOM   81  C C   . LEU A 1 14 ? -76.189 166.426 13.827  1.00 38.49  ? 103  LEU A C   1 
ATOM   82  O O   . LEU A 1 14 ? -75.805 166.210 14.986  1.00 36.87  ? 103  LEU A O   1 
ATOM   83  C CB  . LEU A 1 14 ? -75.727 164.500 12.335  1.00 35.20  ? 103  LEU A CB  1 
ATOM   84  C CG  . LEU A 1 14 ? -76.184 163.232 11.588  1.00 35.04  ? 103  LEU A CG  1 
ATOM   85  C CD1 . LEU A 1 14 ? -74.984 162.568 10.893  1.00 42.52  ? 103  LEU A CD1 1 
ATOM   86  C CD2 . LEU A 1 14 ? -76.913 162.265 12.535  1.00 39.40  ? 103  LEU A CD2 1 
ATOM   87  N N   . ALA A 1 15 ? -76.062 167.609 13.229  1.00 35.44  ? 104  ALA A N   1 
ATOM   88  C CA  . ALA A 1 15 ? -75.427 168.758 13.907  1.00 36.85  ? 104  ALA A CA  1 
ATOM   89  C C   . ALA A 1 15 ? -76.302 169.341 14.996  1.00 37.05  ? 104  ALA A C   1 
ATOM   90  O O   . ALA A 1 15 ? -75.832 170.160 15.804  1.00 37.41  ? 104  ALA A O   1 
ATOM   91  C CB  . ALA A 1 15 ? -75.073 169.856 12.895  1.00 40.93  ? 104  ALA A CB  1 
ATOM   92  N N   . ARG A 1 16 ? -77.563 168.933 15.024  1.00 35.57  ? 105  ARG A N   1 
ATOM   93  C CA  . ARG A 1 16 ? -78.478 169.338 16.107  1.00 32.99  ? 105  ARG A CA  1 
ATOM   94  C C   . ARG A 1 16 ? -78.502 168.361 17.282  1.00 42.94  ? 105  ARG A C   1 
ATOM   95  O O   . ARG A 1 16 ? -79.022 168.707 18.356  1.00 41.49  ? 105  ARG A O   1 
ATOM   96  C CB  . ARG A 1 16 ? -79.908 169.477 15.573  1.00 38.67  ? 105  ARG A CB  1 
ATOM   97  C CG  . ARG A 1 16 ? -80.106 170.624 14.583  1.00 40.39  ? 105  ARG A CG  1 
ATOM   98  C CD  . ARG A 1 16 ? -81.470 170.521 13.880  1.00 43.74  ? 105  ARG A CD  1 
ATOM   99  N NE  . ARG A 1 16 ? -82.581 170.318 14.816  1.00 46.27  ? 105  ARG A NE  1 
ATOM   100 C CZ  . ARG A 1 16 ? -83.163 171.286 15.522  1.00 51.25  ? 105  ARG A CZ  1 
ATOM   101 N NH1 . ARG A 1 16 ? -82.732 172.544 15.431  1.00 49.31  ? 105  ARG A NH1 1 
ATOM   102 N NH2 . ARG A 1 16 ? -84.174 170.997 16.342  1.00 59.54  ? 105  ARG A NH2 1 
ATOM   103 N N   . HIS A 1 17 ? -77.948 167.159 17.093  1.00 37.59  ? 106  HIS A N   1 
ATOM   104 C CA  . HIS A 1 17 ? -78.109 166.076 18.101  1.00 35.94  ? 106  HIS A CA  1 
ATOM   105 C C   . HIS A 1 17 ? -76.854 165.357 18.580  1.00 40.01  ? 106  HIS A C   1 
ATOM   106 O O   . HIS A 1 17 ? -76.926 164.529 19.505  1.00 40.98  ? 106  HIS A O   1 
ATOM   107 C CB  . HIS A 1 17 ? -79.078 165.032 17.524  1.00 36.57  ? 106  HIS A CB  1 
ATOM   108 C CG  . HIS A 1 17 ? -80.419 165.600 17.199  1.00 41.66  ? 106  HIS A CG  1 
ATOM   109 N ND1 . HIS A 1 17 ? -81.350 165.912 18.170  1.00 42.37  ? 106  HIS A ND1 1 
ATOM   110 C CD2 . HIS A 1 17 ? -80.970 165.966 16.017  1.00 39.05  ? 106  HIS A CD2 1 
ATOM   111 C CE1 . HIS A 1 17 ? -82.423 166.424 17.597  1.00 46.72  ? 106  HIS A CE1 1 
ATOM   112 N NE2 . HIS A 1 17 ? -82.222 166.465 16.293  1.00 40.84  ? 106  HIS A NE2 1 
ATOM   113 N N   . PHE A 1 18 ? -75.721 165.668 17.961  1.00 35.27  ? 107  PHE A N   1 
ATOM   114 C CA  . PHE A 1 18 ? -74.440 165.052 18.254  1.00 41.92  ? 107  PHE A CA  1 
ATOM   115 C C   . PHE A 1 18 ? -73.365 166.130 18.299  1.00 38.55  ? 107  PHE A C   1 
ATOM   116 O O   . PHE A 1 18 ? -73.460 167.151 17.613  1.00 39.55  ? 107  PHE A O   1 
ATOM   117 C CB  . PHE A 1 18 ? -74.056 164.005 17.187  1.00 39.47  ? 107  PHE A CB  1 
ATOM   118 C CG  . PHE A 1 18 ? -74.912 162.752 17.191  1.00 38.77  ? 107  PHE A CG  1 
ATOM   119 C CD1 . PHE A 1 18 ? -74.658 161.725 18.101  1.00 43.28  ? 107  PHE A CD1 1 
ATOM   120 C CD2 . PHE A 1 18 ? -75.938 162.584 16.271  1.00 40.83  ? 107  PHE A CD2 1 
ATOM   121 C CE1 . PHE A 1 18 ? -75.423 160.562 18.090  1.00 38.67  ? 107  PHE A CE1 1 
ATOM   122 C CE2 . PHE A 1 18 ? -76.702 161.420 16.246  1.00 41.32  ? 107  PHE A CE2 1 
ATOM   123 C CZ  . PHE A 1 18 ? -76.445 160.404 17.158  1.00 38.69  ? 107  PHE A CZ  1 
ATOM   124 N N   . SER A 1 19 ? -72.332 165.876 19.087  1.00 39.37  ? 108  SER A N   1 
ATOM   125 C CA  . SER A 1 19 ? -71.151 166.713 19.095  1.00 38.72  ? 108  SER A CA  1 
ATOM   126 C C   . SER A 1 19 ? -70.533 166.715 17.717  1.00 39.48  ? 108  SER A C   1 
ATOM   127 O O   . SER A 1 19 ? -70.829 165.831 16.886  1.00 36.26  ? 108  SER A O   1 
ATOM   128 C CB  . SER A 1 19 ? -70.142 166.196 20.125  1.00 45.82  ? 108  SER A CB  1 
ATOM   129 O OG  . SER A 1 19 ? -69.549 164.993 19.652  1.00 50.33  ? 108  SER A OG  1 
ATOM   130 N N   . ALA A 1 20 ? -69.667 167.688 17.456  1.00 42.86  ? 109  ALA A N   1 
ATOM   131 C CA  . ALA A 1 20 ? -69.067 167.784 16.121  1.00 44.58  ? 109  ALA A CA  1 
ATOM   132 C C   . ALA A 1 20 ? -68.346 166.488 15.740  1.00 45.04  ? 109  ALA A C   1 
ATOM   133 O O   . ALA A 1 20 ? -68.563 165.931 14.657  1.00 39.26  ? 109  ALA A O   1 
ATOM   134 C CB  . ALA A 1 20 ? -68.109 168.947 16.057  1.00 45.05  ? 109  ALA A CB  1 
ATOM   135 N N   . ALA A 1 21 ? -67.491 166.009 16.636  1.00 44.58  ? 110  ALA A N   1 
ATOM   136 C CA  . ALA A 1 21 ? -66.716 164.793 16.366  1.00 46.88  ? 110  ALA A CA  1 
ATOM   137 C C   . ALA A 1 21 ? -67.624 163.594 16.126  1.00 49.62  ? 110  ALA A C   1 
ATOM   138 O O   . ALA A 1 21 ? -67.407 162.819 15.183  1.00 47.23  ? 110  ALA A O   1 
ATOM   139 C CB  . ALA A 1 21 ? -65.761 164.500 17.507  1.00 45.67  ? 110  ALA A CB  1 
ATOM   140 N N   . ASP A 1 22 ? -68.647 163.451 16.968  1.00 44.59  ? 111  ASP A N   1 
ATOM   141 C CA  . ASP A 1 22 ? -69.577 162.336 16.841  1.00 45.49  ? 111  ASP A CA  1 
ATOM   142 C C   . ASP A 1 22 ? -70.377 162.417 15.540  1.00 42.40  ? 111  ASP A C   1 
ATOM   143 O O   . ASP A 1 22 ? -70.575 161.398 14.878  1.00 40.67  ? 111  ASP A O   1 
ATOM   144 C CB  . ASP A 1 22 ? -70.523 162.269 18.048  1.00 42.97  ? 111  ASP A CB  1 
ATOM   145 C CG  . ASP A 1 22 ? -69.911 161.526 19.240  1.00 53.25  ? 111  ASP A CG  1 
ATOM   146 O OD1 . ASP A 1 22 ? -68.935 160.773 19.036  1.00 54.93  ? 111  ASP A OD1 1 
ATOM   147 O OD2 . ASP A 1 22 ? -70.416 161.688 20.378  1.00 51.72  ? 111  ASP A OD2 1 
ATOM   148 N N   . ALA A 1 23 ? -70.829 163.618 15.169  1.00 38.35  ? 112  ALA A N   1 
ATOM   149 C CA  . ALA A 1 23 ? -71.618 163.798 13.937  1.00 34.30  ? 112  ALA A CA  1 
ATOM   150 C C   . ALA A 1 23 ? -70.829 163.320 12.741  1.00 42.39  ? 112  ALA A C   1 
ATOM   151 O O   . ALA A 1 23 ? -71.372 162.665 11.846  1.00 39.57  ? 112  ALA A O   1 
ATOM   152 C CB  . ALA A 1 23 ? -72.021 165.267 13.749  1.00 33.23  ? 112  ALA A CB  1 
ATOM   153 N N   . SER A 1 24 ? -69.539 163.656 12.721  1.00 38.16  ? 113  SER A N   1 
ATOM   154 C CA  . SER A 1 24 ? -68.697 163.271 11.595  1.00 40.98  ? 113  SER A CA  1 
ATOM   155 C C   . SER A 1 24 ? -68.539 161.748 11.582  1.00 43.53  ? 113  SER A C   1 
ATOM   156 O O   . SER A 1 24 ? -68.665 161.124 10.526  1.00 41.33  ? 113  SER A O   1 
ATOM   157 C CB  . SER A 1 24 ? -67.341 163.979 11.677  1.00 44.26  ? 113  SER A CB  1 
ATOM   158 O OG  . SER A 1 24 ? -66.497 163.610 10.601  1.00 52.93  ? 113  SER A OG  1 
ATOM   159 N N   . ARG A 1 25 ? -68.280 161.149 12.753  1.00 40.59  ? 114  ARG A N   1 
ATOM   160 C CA  . ARG A 1 25 ? -68.127 159.695 12.844  1.00 43.19  ? 114  ARG A CA  1 
ATOM   161 C C   . ARG A 1 25 ? -69.413 158.983 12.428  1.00 48.63  ? 114  ARG A C   1 
ATOM   162 O O   . ARG A 1 25 ? -69.364 157.967 11.733  1.00 47.98  ? 114  ARG A O   1 
ATOM   163 C CB  . ARG A 1 25 ? -67.714 159.258 14.264  1.00 45.53  ? 114  ARG A CB  1 
ATOM   164 C CG  . ARG A 1 25 ? -66.219 159.381 14.524  1.00 53.17  ? 114  ARG A CG  1 
ATOM   165 C CD  . ARG A 1 25 ? -65.806 158.736 15.862  1.00 60.45  ? 114  ARG A CD  1 
ATOM   166 N NE  . ARG A 1 25 ? -66.019 159.634 16.994  1.00 72.92  ? 114  ARG A NE  1 
ATOM   167 C CZ  . ARG A 1 25 ? -65.112 160.495 17.450  1.00 83.54  ? 114  ARG A CZ  1 
ATOM   168 N NH1 . ARG A 1 25 ? -63.919 160.583 16.873  1.00 90.97  ? 114  ARG A NH1 1 
ATOM   169 N NH2 . ARG A 1 25 ? -65.399 161.273 18.484  1.00 87.64  ? 114  ARG A NH2 1 
ATOM   170 N N   . VAL A 1 26 ? -70.565 159.525 12.818  1.00 41.39  ? 115  VAL A N   1 
ATOM   171 C CA  . VAL A 1 26 ? -71.834 158.897 12.462  1.00 41.77  ? 115  VAL A CA  1 
ATOM   172 C C   . VAL A 1 26 ? -72.090 158.965 10.942  1.00 42.69  ? 115  VAL A C   1 
ATOM   173 O O   . VAL A 1 26 ? -72.496 157.971 10.329  1.00 40.74  ? 115  VAL A O   1 
ATOM   174 C CB  . VAL A 1 26 ? -73.013 159.530 13.236  1.00 41.35  ? 115  VAL A CB  1 
ATOM   175 C CG1 . VAL A 1 26 ? -74.324 158.984 12.741  1.00 41.24  ? 115  VAL A CG1 1 
ATOM   176 C CG2 . VAL A 1 26 ? -72.886 159.244 14.741  1.00 43.77  ? 115  VAL A CG2 1 
ATOM   177 N N   . LEU A 1 27 ? -71.846 160.128 10.332  1.00 38.47  ? 116  LEU A N   1 
ATOM   178 C CA  . LEU A 1 27 ? -71.993 160.264 8.882   1.00 39.87  ? 116  LEU A CA  1 
ATOM   179 C C   . LEU A 1 27 ? -71.089 159.293 8.109   1.00 45.50  ? 116  LEU A C   1 
ATOM   180 O O   . LEU A 1 27 ? -71.525 158.629 7.169   1.00 40.25  ? 116  LEU A O   1 
ATOM   181 C CB  . LEU A 1 27 ? -71.692 161.701 8.461   1.00 38.40  ? 116  LEU A CB  1 
ATOM   182 C CG  . LEU A 1 27 ? -71.823 161.965 6.960   1.00 36.94  ? 116  LEU A CG  1 
ATOM   183 C CD1 . LEU A 1 27 ? -73.248 161.611 6.522   1.00 38.49  ? 116  LEU A CD1 1 
ATOM   184 C CD2 . LEU A 1 27 ? -71.473 163.407 6.630   1.00 40.34  ? 116  LEU A CD2 1 
ATOM   185 N N   . GLU A 1 28 ? -69.827 159.204 8.508   1.00 43.25  ? 117  GLU A N   1 
ATOM   186 C CA  . GLU A 1 28 ? -68.906 158.288 7.831   1.00 46.96  ? 117  GLU A CA  1 
ATOM   187 C C   . GLU A 1 28 ? -69.330 156.826 8.014   1.00 42.47  ? 117  GLU A C   1 
ATOM   188 O O   . GLU A 1 28 ? -69.246 156.021 7.082   1.00 47.52  ? 117  GLU A O   1 
ATOM   189 C CB  . GLU A 1 28 ? -67.477 158.496 8.341   1.00 45.57  ? 117  GLU A CB  1 
ATOM   190 C CG  . GLU A 1 28 ? -66.851 159.801 7.892   1.00 62.36  ? 117  GLU A CG  1 
ATOM   191 C CD  . GLU A 1 28 ? -65.404 159.946 8.336   1.00 75.49  ? 117  GLU A CD  1 
ATOM   192 O OE1 . GLU A 1 28 ? -65.154 159.910 9.562   1.00 89.58  ? 117  GLU A OE1 1 
ATOM   193 O OE2 . GLU A 1 28 ? -64.521 160.102 7.465   1.00 72.16  ? 117  GLU A OE2 1 
ATOM   194 N N   . GLN A 1 29 ? -69.781 156.475 9.213   1.00 42.19  ? 118  GLN A N   1 
ATOM   195 C CA  . GLN A 1 29 ? -70.251 155.111 9.458   1.00 43.46  ? 118  GLN A CA  1 
ATOM   196 C C   . GLN A 1 29 ? -71.506 154.797 8.634   1.00 50.45  ? 118  GLN A C   1 
ATOM   197 O O   . GLN A 1 29 ? -71.659 153.694 8.110   1.00 48.67  ? 118  GLN A O   1 
ATOM   198 C CB  . GLN A 1 29 ? -70.539 154.889 10.948  1.00 48.38  ? 118  GLN A CB  1 
ATOM   199 C CG  . GLN A 1 29 ? -70.964 153.471 11.270  1.00 54.12  ? 118  GLN A CG  1 
ATOM   200 C CD  . GLN A 1 29 ? -69.810 152.490 11.178  1.00 60.83  ? 118  GLN A CD  1 
ATOM   201 O OE1 . GLN A 1 29 ? -68.764 152.702 11.792  1.00 58.72  ? 118  GLN A OE1 1 
ATOM   202 N NE2 . GLN A 1 29 ? -69.991 151.412 10.410  1.00 57.40  ? 118  GLN A NE2 1 
ATOM   203 N N   . LEU A 1 30 ? -72.398 155.774 8.525   1.00 45.22  ? 119  LEU A N   1 
ATOM   204 C CA  . LEU A 1 30 ? -73.618 155.624 7.742   1.00 41.69  ? 119  LEU A CA  1 
ATOM   205 C C   . LEU A 1 30 ? -73.312 155.403 6.259   1.00 41.91  ? 119  LEU A C   1 
ATOM   206 O O   . LEU A 1 30 ? -73.941 154.575 5.596   1.00 41.69  ? 119  LEU A O   1 
ATOM   207 C CB  . LEU A 1 30 ? -74.491 156.868 7.904   1.00 40.46  ? 119  LEU A CB  1 
ATOM   208 C CG  . LEU A 1 30 ? -75.907 156.874 7.326   1.00 48.50  ? 119  LEU A CG  1 
ATOM   209 C CD1 . LEU A 1 30 ? -76.794 155.991 8.161   1.00 49.45  ? 119  LEU A CD1 1 
ATOM   210 C CD2 . LEU A 1 30 ? -76.449 158.310 7.298   1.00 56.03  ? 119  LEU A CD2 1 
ATOM   211 N N   . GLN A 1 31 ? -72.373 156.180 5.733   1.00 37.43  ? 120  GLN A N   1 
ATOM   212 C CA  . GLN A 1 31 ? -72.018 156.069 4.314   1.00 40.73  ? 120  GLN A CA  1 
ATOM   213 C C   . GLN A 1 31 ? -71.355 154.719 4.041   1.00 45.83  ? 120  GLN A C   1 
ATOM   214 O O   . GLN A 1 31 ? -71.566 154.085 2.992   1.00 41.71  ? 120  GLN A O   1 
ATOM   215 C CB  . GLN A 1 31 ? -71.093 157.212 3.901   1.00 45.09  ? 120  GLN A CB  1 
ATOM   216 C CG  . GLN A 1 31 ? -71.772 158.573 3.827   1.00 42.46  ? 120  GLN A CG  1 
ATOM   217 C CD  . GLN A 1 31 ? -70.816 159.690 3.456   1.00 48.41  ? 120  GLN A CD  1 
ATOM   218 O OE1 . GLN A 1 31 ? -69.609 159.591 3.667   1.00 55.37  ? 120  GLN A OE1 1 
ATOM   219 N NE2 . GLN A 1 31 ? -71.353 160.758 2.879   1.00 40.96  ? 120  GLN A NE2 1 
ATOM   220 N N   . ARG A 1 32 ? -70.544 154.276 4.992   1.00 42.96  ? 121  ARG A N   1 
ATOM   221 C CA  . ARG A 1 32 ? -69.894 152.971 4.861   1.00 55.68  ? 121  ARG A CA  1 
ATOM   222 C C   . ARG A 1 32 ? -70.895 151.814 4.928   1.00 52.77  ? 121  ARG A C   1 
ATOM   223 O O   . ARG A 1 32 ? -70.803 150.871 4.133   1.00 49.60  ? 121  ARG A O   1 
ATOM   224 C CB  . ARG A 1 32 ? -68.821 152.801 5.940   1.00 60.93  ? 121  ARG A CB  1 
ATOM   225 C CG  . ARG A 1 32 ? -68.265 151.396 6.052   1.00 70.54  ? 121  ARG A CG  1 
ATOM   226 C CD  . ARG A 1 32 ? -66.823 151.434 6.531   1.00 83.04  ? 121  ARG A CD  1 
ATOM   227 N NE  . ARG A 1 32 ? -66.574 152.597 7.377   1.00 87.76  ? 121  ARG A NE  1 
ATOM   228 C CZ  . ARG A 1 32 ? -65.363 153.039 7.702   1.00 97.75  ? 121  ARG A CZ  1 
ATOM   229 N NH1 . ARG A 1 32 ? -64.284 152.410 7.252   1.00 103.90 ? 121  ARG A NH1 1 
ATOM   230 N NH2 . ARG A 1 32 ? -65.231 154.109 8.478   1.00 98.22  ? 121  ARG A NH2 1 
ATOM   231 N N   . ASP A 1 33 ? -71.841 151.872 5.871   1.00 50.22  ? 122  ASP A N   1 
ATOM   232 C CA  . ASP A 1 33 ? -72.873 150.822 5.990   1.00 57.42  ? 122  ASP A CA  1 
ATOM   233 C C   . ASP A 1 33 ? -73.723 150.764 4.725   1.00 56.74  ? 122  ASP A C   1 
ATOM   234 O O   . ASP A 1 33 ? -74.042 149.689 4.203   1.00 53.20  ? 122  ASP A O   1 
ATOM   235 C CB  . ASP A 1 33 ? -73.804 151.067 7.193   1.00 54.59  ? 122  ASP A CB  1 
ATOM   236 C CG  . ASP A 1 33 ? -73.112 150.918 8.534   1.00 63.17  ? 122  ASP A CG  1 
ATOM   237 O OD1 . ASP A 1 33 ? -72.016 150.325 8.599   1.00 60.19  ? 122  ASP A OD1 1 
ATOM   238 O OD2 . ASP A 1 33 ? -73.692 151.391 9.540   1.00 64.06  ? 122  ASP A OD2 1 
ATOM   239 N N   . TYR A 1 34 ? -74.103 151.946 4.251   1.00 46.24  ? 123  TYR A N   1 
ATOM   240 C CA  . TYR A 1 34 ? -74.942 152.073 3.066   1.00 47.09  ? 123  TYR A CA  1 
ATOM   241 C C   . TYR A 1 34 ? -74.280 151.438 1.840   1.00 48.81  ? 123  TYR A C   1 
ATOM   242 O O   . TYR A 1 34 ? -74.894 150.656 1.106   1.00 49.73  ? 123  TYR A O   1 
ATOM   243 C CB  . TYR A 1 34 ? -75.254 153.559 2.824   1.00 46.52  ? 123  TYR A CB  1 
ATOM   244 C CG  . TYR A 1 34 ? -76.096 153.842 1.596   1.00 47.50  ? 123  TYR A CG  1 
ATOM   245 C CD1 . TYR A 1 34 ? -77.484 153.792 1.647   1.00 56.84  ? 123  TYR A CD1 1 
ATOM   246 C CD2 . TYR A 1 34 ? -75.503 154.195 0.399   1.00 48.67  ? 123  TYR A CD2 1 
ATOM   247 C CE1 . TYR A 1 34 ? -78.251 154.060 0.517   1.00 57.03  ? 123  TYR A CE1 1 
ATOM   248 C CE2 . TYR A 1 34 ? -76.263 154.466 -0.729  1.00 54.31  ? 123  TYR A CE2 1 
ATOM   249 C CZ  . TYR A 1 34 ? -77.630 154.397 -0.661  1.00 54.30  ? 123  TYR A CZ  1 
ATOM   250 O OH  . TYR A 1 34 ? -78.369 154.661 -1.788  1.00 56.02  ? 123  TYR A OH  1 
ATOM   251 N N   . GLU A 1 35 ? -73.012 151.755 1.622   1.00 49.55  ? 124  GLU A N   1 
ATOM   252 C CA  . GLU A 1 35 ? -72.327 151.262 0.436   1.00 52.65  ? 124  GLU A CA  1 
ATOM   253 C C   . GLU A 1 35 ? -72.067 149.751 0.528   1.00 61.35  ? 124  GLU A C   1 
ATOM   254 O O   . GLU A 1 35 ? -72.129 149.054 -0.480  1.00 65.49  ? 124  GLU A O   1 
ATOM   255 C CB  . GLU A 1 35 ? -71.036 152.050 0.214   1.00 59.13  ? 124  GLU A CB  1 
ATOM   256 C CG  . GLU A 1 35 ? -70.771 152.374 -1.276  1.00 80.17  ? 124  GLU A CG  1 
ATOM   257 C CD  . GLU A 1 35 ? -71.765 153.390 -1.870  1.00 88.01  ? 124  GLU A CD  1 
ATOM   258 O OE1 . GLU A 1 35 ? -72.001 154.461 -1.267  1.00 78.30  ? 124  GLU A OE1 1 
ATOM   259 O OE2 . GLU A 1 35 ? -72.324 153.099 -2.952  1.00 96.15  ? 124  GLU A OE2 1 
ATOM   260 N N   . ARG A 1 36 ? -71.811 149.242 1.732   1.00 60.23  ? 125  ARG A N   1 
ATOM   261 C CA  . ARG A 1 36 ? -71.690 147.795 1.921   1.00 64.23  ? 125  ARG A CA  1 
ATOM   262 C C   . ARG A 1 36 ? -73.008 147.088 1.608   1.00 61.50  ? 125  ARG A C   1 
ATOM   263 O O   . ARG A 1 36 ? -73.015 146.015 1.000   1.00 62.16  ? 125  ARG A O   1 
ATOM   264 C CB  . ARG A 1 36 ? -71.254 147.460 3.350   1.00 62.55  ? 125  ARG A CB  1 
ATOM   265 C CG  . ARG A 1 36 ? -71.217 145.971 3.662   1.00 81.15  ? 125  ARG A CG  1 
ATOM   266 C CD  . ARG A 1 36 ? -70.709 145.701 5.072   1.00 92.88  ? 125  ARG A CD  1 
ATOM   267 N N   . SER A 1 37 ? -74.113 147.688 2.045   1.00 60.26  ? 126  SER A N   1 
ATOM   268 C CA  . SER A 1 37 ? -75.447 147.141 1.812   1.00 69.50  ? 126  SER A CA  1 
ATOM   269 C C   . SER A 1 37 ? -75.767 147.060 0.325   1.00 64.41  ? 126  SER A C   1 
ATOM   270 O O   . SER A 1 37 ? -76.364 146.091 -0.140  1.00 70.39  ? 126  SER A O   1 
ATOM   271 C CB  . SER A 1 37 ? -76.505 147.992 2.520   1.00 71.92  ? 126  SER A CB  1 
ATOM   272 O OG  . SER A 1 37 ? -76.414 147.838 3.923   1.00 76.56  ? 126  SER A OG  1 
ATOM   273 N N   . LEU A 1 38 ? -75.375 148.088 -0.418  1.00 59.82  ? 127  LEU A N   1 
ATOM   274 C CA  . LEU A 1 38 ? -75.576 148.088 -1.864  1.00 66.97  ? 127  LEU A CA  1 
ATOM   275 C C   . LEU A 1 38 ? -74.731 147.025 -2.541  1.00 71.89  ? 127  LEU A C   1 
ATOM   276 O O   . LEU A 1 38 ? -75.145 146.429 -3.545  1.00 72.42  ? 127  LEU A O   1 
ATOM   277 C CB  . LEU A 1 38 ? -75.244 149.458 -2.451  1.00 70.33  ? 127  LEU A CB  1 
ATOM   278 C CG  . LEU A 1 38 ? -76.217 150.581 -2.120  1.00 71.25  ? 127  LEU A CG  1 
ATOM   279 C CD1 . LEU A 1 38 ? -75.724 151.865 -2.759  1.00 70.45  ? 127  LEU A CD1 1 
ATOM   280 C CD2 . LEU A 1 38 ? -77.603 150.216 -2.624  1.00 74.89  ? 127  LEU A CD2 1 
ATOM   281 N N   . SER A 1 39 ? -73.539 146.792 -2.000  1.00 75.08  ? 128  SER A N   1 
ATOM   282 C CA  . SER A 1 39 ? -72.622 145.813 -2.585  1.00 83.78  ? 128  SER A CA  1 
ATOM   283 C C   . SER A 1 39 ? -73.140 144.390 -2.421  1.00 81.58  ? 128  SER A C   1 
ATOM   284 O O   . SER A 1 39 ? -72.977 143.558 -3.310  1.00 86.06  ? 128  SER A O   1 
ATOM   285 C CB  . SER A 1 39 ? -71.235 145.938 -1.956  1.00 91.30  ? 128  SER A CB  1 
ATOM   286 O OG  . SER A 1 39 ? -70.699 147.230 -2.174  1.00 95.12  ? 128  SER A OG  1 
ATOM   287 N N   . ARG A 1 40 ? -73.759 144.109 -1.280  1.00 83.04  ? 129  ARG A N   1 
ATOM   288 C CA  . ARG A 1 40 ? -74.276 142.772 -1.005  1.00 91.83  ? 129  ARG A CA  1 
ATOM   289 C C   . ARG A 1 40 ? -75.541 142.467 -1.804  1.00 90.86  ? 129  ARG A C   1 
ATOM   290 O O   . ARG A 1 40 ? -75.958 141.312 -1.894  1.00 99.93  ? 129  ARG A O   1 
ATOM   291 C CB  . ARG A 1 40 ? -74.556 142.606 0.491   1.00 93.81  ? 129  ARG A CB  1 
ATOM   292 C CG  . ARG A 1 40 ? -73.315 142.621 1.370   1.00 95.39  ? 129  ARG A CG  1 
ATOM   293 C CD  . ARG A 1 40 ? -73.697 142.651 2.844   1.00 96.75  ? 129  ARG A CD  1 
ATOM   294 N N   . LEU A 1 41 ? -76.143 143.500 -2.389  1.00 79.94  ? 130  LEU A N   1 
ATOM   295 C CA  . LEU A 1 41 ? -77.421 143.355 -3.082  1.00 81.06  ? 130  LEU A CA  1 
ATOM   296 C C   . LEU A 1 41 ? -77.316 142.399 -4.278  1.00 87.99  ? 130  LEU A C   1 
ATOM   297 O O   . LEU A 1 41 ? -76.389 142.485 -5.085  1.00 90.67  ? 130  LEU A O   1 
ATOM   298 C CB  . LEU A 1 41 ? -77.940 144.721 -3.540  1.00 82.55  ? 130  LEU A CB  1 
ATOM   299 C CG  . LEU A 1 41 ? -79.422 145.025 -3.285  1.00 82.64  ? 130  LEU A CG  1 
ATOM   300 C CD1 . LEU A 1 41 ? -79.816 144.631 -1.874  1.00 78.62  ? 130  LEU A CD1 1 
ATOM   301 C CD2 . LEU A 1 41 ? -79.726 146.497 -3.519  1.00 78.93  ? 130  LEU A CD2 1 
ATOM   302 N N   . THR A 1 42 ? -78.272 141.482 -4.370  1.00 93.74  ? 131  THR A N   1 
ATOM   303 C CA  . THR A 1 42 ? -78.319 140.520 -5.461  1.00 90.54  ? 131  THR A CA  1 
ATOM   304 C C   . THR A 1 42 ? -79.624 140.671 -6.223  1.00 90.47  ? 131  THR A C   1 
ATOM   305 O O   . THR A 1 42 ? -80.537 141.360 -5.770  1.00 91.72  ? 131  THR A O   1 
ATOM   306 C CB  . THR A 1 42 ? -78.200 139.081 -4.949  1.00 105.64 ? 131  THR A CB  1 
ATOM   307 O OG1 . THR A 1 42 ? -79.352 138.766 -4.159  1.00 113.00 ? 131  THR A OG1 1 
ATOM   308 C CG2 . THR A 1 42 ? -76.951 138.922 -4.099  1.00 105.49 ? 131  THR A CG2 1 
ATOM   309 N N   . LEU A 1 43 ? -79.713 140.022 -7.378  1.00 96.27  ? 132  LEU A N   1 
ATOM   310 C CA  . LEU A 1 43 ? -80.936 140.042 -8.170  1.00 99.10  ? 132  LEU A CA  1 
ATOM   311 C C   . LEU A 1 43 ? -82.091 139.459 -7.364  1.00 98.06  ? 132  LEU A C   1 
ATOM   312 O O   . LEU A 1 43 ? -83.231 139.914 -7.473  1.00 95.63  ? 132  LEU A O   1 
ATOM   313 C CB  . LEU A 1 43 ? -80.749 139.265 -9.477  1.00 103.88 ? 132  LEU A CB  1 
ATOM   314 C CG  . LEU A 1 43 ? -79.974 139.982 -10.587 1.00 108.61 ? 132  LEU A CG  1 
ATOM   315 N N   . ASP A 1 44 ? -81.779 138.458 -6.546  1.00 96.28  ? 133  ASP A N   1 
ATOM   316 C CA  . ASP A 1 44 ? -82.763 137.828 -5.675  1.00 102.41 ? 133  ASP A CA  1 
ATOM   317 C C   . ASP A 1 44 ? -83.392 138.848 -4.729  1.00 98.01  ? 133  ASP A C   1 
ATOM   318 O O   . ASP A 1 44 ? -84.608 138.874 -4.543  1.00 99.27  ? 133  ASP A O   1 
ATOM   319 C CB  . ASP A 1 44 ? -82.115 136.696 -4.874  1.00 112.32 ? 133  ASP A CB  1 
ATOM   320 C CG  . ASP A 1 44 ? -83.062 136.079 -3.863  1.00 112.75 ? 133  ASP A CG  1 
ATOM   321 N N   . ASP A 1 45 ? -82.556 139.699 -4.147  1.00 90.53  ? 134  ASP A N   1 
ATOM   322 C CA  . ASP A 1 45 ? -83.036 140.692 -3.194  1.00 86.55  ? 134  ASP A CA  1 
ATOM   323 C C   . ASP A 1 45 ? -83.910 141.745 -3.858  1.00 84.11  ? 134  ASP A C   1 
ATOM   324 O O   . ASP A 1 45 ? -84.899 142.192 -3.277  1.00 84.17  ? 134  ASP A O   1 
ATOM   325 C CB  . ASP A 1 45 ? -81.861 141.363 -2.490  1.00 85.72  ? 134  ASP A CB  1 
ATOM   326 C CG  . ASP A 1 45 ? -80.991 140.373 -1.754  1.00 98.84  ? 134  ASP A CG  1 
ATOM   327 O OD1 . ASP A 1 45 ? -81.527 139.343 -1.290  1.00 101.32 ? 134  ASP A OD1 1 
ATOM   328 O OD2 . ASP A 1 45 ? -79.773 140.627 -1.641  1.00 105.29 ? 134  ASP A OD2 1 
ATOM   329 N N   . ILE A 1 46 ? -83.544 142.149 -5.070  1.00 84.81  ? 135  ILE A N   1 
ATOM   330 C CA  . ILE A 1 46 ? -84.307 143.167 -5.780  1.00 91.01  ? 135  ILE A CA  1 
ATOM   331 C C   . ILE A 1 46 ? -85.691 142.640 -6.142  1.00 94.05  ? 135  ILE A C   1 
ATOM   332 O O   . ILE A 1 46 ? -86.692 143.349 -5.997  1.00 94.35  ? 135  ILE A O   1 
ATOM   333 C CB  . ILE A 1 46 ? -83.580 143.644 -7.047  1.00 98.79  ? 135  ILE A CB  1 
ATOM   334 C CG1 . ILE A 1 46 ? -82.249 144.299 -6.673  1.00 99.27  ? 135  ILE A CG1 1 
ATOM   335 C CG2 . ILE A 1 46 ? -84.440 144.632 -7.813  1.00 103.90 ? 135  ILE A CG2 1 
ATOM   336 C CD1 . ILE A 1 46 ? -81.522 144.923 -7.849  1.00 101.68 ? 135  ILE A CD1 1 
ATOM   337 N N   . GLU A 1 47 ? -85.741 141.389 -6.595  1.00 94.57  ? 136  GLU A N   1 
ATOM   338 C CA  . GLU A 1 47 ? -87.003 140.730 -6.911  1.00 96.57  ? 136  GLU A CA  1 
ATOM   339 C C   . GLU A 1 47 ? -87.915 140.668 -5.686  1.00 100.79 ? 136  GLU A C   1 
ATOM   340 O O   . GLU A 1 47 ? -89.109 140.963 -5.776  1.00 105.73 ? 136  GLU A O   1 
ATOM   341 C CB  . GLU A 1 47 ? -86.753 139.319 -7.458  1.00 100.32 ? 136  GLU A CB  1 
ATOM   342 N N   . ARG A 1 48 ? -87.344 140.294 -4.544  1.00 99.58  ? 137  ARG A N   1 
ATOM   343 C CA  . ARG A 1 48 ? -88.098 140.194 -3.297  1.00 95.79  ? 137  ARG A CA  1 
ATOM   344 C C   . ARG A 1 48 ? -88.646 141.555 -2.863  1.00 95.25  ? 137  ARG A C   1 
ATOM   345 O O   . ARG A 1 48 ? -89.748 141.642 -2.321  1.00 100.15 ? 137  ARG A O   1 
ATOM   346 C CB  . ARG A 1 48 ? -87.220 139.604 -2.193  1.00 97.36  ? 137  ARG A CB  1 
ATOM   347 C CG  . ARG A 1 48 ? -87.956 139.323 -0.896  1.00 103.00 ? 137  ARG A CG  1 
ATOM   348 N N   . LEU A 1 49 ? -87.868 142.608 -3.106  1.00 85.93  ? 138  LEU A N   1 
ATOM   349 C CA  . LEU A 1 49 ? -88.290 143.978 -2.815  1.00 79.67  ? 138  LEU A CA  1 
ATOM   350 C C   . LEU A 1 49 ? -89.581 144.347 -3.541  1.00 84.32  ? 138  LEU A C   1 
ATOM   351 O O   . LEU A 1 49 ? -90.501 144.902 -2.942  1.00 88.86  ? 138  LEU A O   1 
ATOM   352 C CB  . LEU A 1 49 ? -87.189 144.976 -3.195  1.00 76.26  ? 138  LEU A CB  1 
ATOM   353 C CG  . LEU A 1 49 ? -86.264 145.488 -2.088  1.00 69.78  ? 138  LEU A CG  1 
ATOM   354 C CD1 . LEU A 1 49 ? -85.329 146.566 -2.624  1.00 70.33  ? 138  LEU A CD1 1 
ATOM   355 C CD2 . LEU A 1 49 ? -87.067 146.017 -0.908  1.00 68.10  ? 138  LEU A CD2 1 
ATOM   356 N N   . ALA A 1 50 ? -89.642 144.037 -4.832  1.00 91.53  ? 139  ALA A N   1 
ATOM   357 C CA  . ALA A 1 50 ? -90.808 144.363 -5.645  1.00 95.57  ? 139  ALA A CA  1 
ATOM   358 C C   . ALA A 1 50 ? -92.071 143.656 -5.148  1.00 102.74 ? 139  ALA A C   1 
ATOM   359 O O   . ALA A 1 50 ? -93.174 144.195 -5.250  1.00 107.86 ? 139  ALA A O   1 
ATOM   360 C CB  . ALA A 1 50 ? -90.546 144.015 -7.100  1.00 98.85  ? 139  ALA A CB  1 
ATOM   361 N N   . SER A 1 51 ? -91.909 142.455 -4.603  1.00 101.97 ? 140  SER A N   1 
ATOM   362 C CA  . SER A 1 51 ? -93.049 141.692 -4.103  1.00 105.42 ? 140  SER A CA  1 
ATOM   363 C C   . SER A 1 51 ? -93.637 142.318 -2.838  1.00 102.14 ? 140  SER A C   1 
ATOM   364 O O   . SER A 1 51 ? -94.828 142.174 -2.562  1.00 105.74 ? 140  SER A O   1 
ATOM   365 C CB  . SER A 1 51 ? -92.643 140.242 -3.831  1.00 109.36 ? 140  SER A CB  1 
ATOM   366 N N   . ARG A 1 52 ? -92.798 143.020 -2.082  1.00 96.10  ? 141  ARG A N   1 
ATOM   367 C CA  . ARG A 1 52 ? -93.199 143.593 -0.800  1.00 93.59  ? 141  ARG A CA  1 
ATOM   368 C C   . ARG A 1 52 ? -94.227 144.719 -0.922  1.00 93.88  ? 141  ARG A C   1 
ATOM   369 O O   . ARG A 1 52 ? -95.180 144.781 -0.148  1.00 97.84  ? 141  ARG A O   1 
ATOM   370 C CB  . ARG A 1 52 ? -91.973 144.121 -0.049  1.00 84.65  ? 141  ARG A CB  1 
ATOM   371 C CG  . ARG A 1 52 ? -91.387 143.172 0.980   1.00 79.68  ? 141  ARG A CG  1 
ATOM   372 C CD  . ARG A 1 52 ? -90.221 143.822 1.714   1.00 73.94  ? 141  ARG A CD  1 
ATOM   373 N NE  . ARG A 1 52 ? -90.652 144.578 2.888   1.00 78.48  ? 141  ARG A NE  1 
ATOM   374 C CZ  . ARG A 1 52 ? -89.822 145.198 3.724   1.00 73.86  ? 141  ARG A CZ  1 
ATOM   375 N NH1 . ARG A 1 52 ? -88.515 145.165 3.511   1.00 73.29  ? 141  ARG A NH1 1 
ATOM   376 N NH2 . ARG A 1 52 ? -90.299 145.855 4.773   1.00 67.89  ? 141  ARG A NH2 1 
ATOM   377 N N   . PHE A 1 53 ? -94.032 145.605 -1.892  1.00 93.00  ? 142  PHE A N   1 
ATOM   378 C CA  . PHE A 1 53 ? -94.783 146.859 -1.945  1.00 88.06  ? 142  PHE A CA  1 
ATOM   379 C C   . PHE A 1 53 ? -95.973 146.804 -2.898  1.00 92.44  ? 142  PHE A C   1 
ATOM   380 O O   . PHE A 1 53 ? -97.109 147.095 -2.514  1.00 96.54  ? 142  PHE A O   1 
ATOM   381 C CB  . PHE A 1 53 ? -93.842 148.003 -2.341  1.00 75.88  ? 142  PHE A CB  1 
ATOM   382 C CG  . PHE A 1 53 ? -92.814 148.322 -1.293  1.00 70.59  ? 142  PHE A CG  1 
ATOM   383 C CD1 . PHE A 1 53 ? -91.728 147.483 -1.084  1.00 72.82  ? 142  PHE A CD1 1 
ATOM   384 C CD2 . PHE A 1 53 ? -92.945 149.452 -0.499  1.00 69.97  ? 142  PHE A CD2 1 
ATOM   385 C CE1 . PHE A 1 53 ? -90.790 147.765 -0.101  1.00 69.47  ? 142  PHE A CE1 1 
ATOM   386 C CE2 . PHE A 1 53 ? -92.012 149.745 0.474   1.00 60.90  ? 142  PHE A CE2 1 
ATOM   387 C CZ  . PHE A 1 53 ? -90.933 148.901 0.678   1.00 66.43  ? 142  PHE A CZ  1 
ATOM   388 N N   . LEU A 1 54 ? -95.704 146.433 -4.141  1.00 88.31  ? 143  LEU A N   1 
ATOM   389 C CA  . LEU A 1 54 ? -96.744 146.386 -5.161  1.00 100.55 ? 143  LEU A CA  1 
ATOM   390 C C   . LEU A 1 54 ? -97.038 144.944 -5.563  1.00 98.40  ? 143  LEU A C   1 
ATOM   391 O O   . LEU A 1 54 ? -97.451 144.134 -4.730  1.00 94.11  ? 143  LEU A O   1 
ATOM   392 C CB  . LEU A 1 54 ? -96.325 147.225 -6.375  1.00 99.07  ? 143  LEU A CB  1 
ATOM   393 C CG  . LEU A 1 54 ? -96.161 148.713 -6.029  1.00 96.26  ? 143  LEU A CG  1 
ATOM   394 C CD1 . LEU A 1 54 ? -95.529 149.494 -7.155  1.00 96.66  ? 143  LEU A CD1 1 
ATOM   395 C CD2 . LEU A 1 54 ? -97.501 149.331 -5.645  1.00 102.06 ? 143  LEU A CD2 1 
ATOM   396 N N   . GLU B 2 15 ? -78.563 141.816 6.765   1.00 131.82 ? 1058 GLU B N   1 
ATOM   397 C CA  . GLU B 2 15 ? -79.867 141.438 6.229   1.00 134.31 ? 1058 GLU B CA  1 
ATOM   398 C C   . GLU B 2 15 ? -80.076 142.055 4.851   1.00 127.94 ? 1058 GLU B C   1 
ATOM   399 O O   . GLU B 2 15 ? -80.085 141.349 3.839   1.00 128.63 ? 1058 GLU B O   1 
ATOM   400 C CB  . GLU B 2 15 ? -80.982 141.872 7.182   1.00 136.36 ? 1058 GLU B CB  1 
ATOM   401 C CG  . GLU B 2 15 ? -82.385 141.633 6.656   1.00 139.14 ? 1058 GLU B CG  1 
ATOM   402 C CD  . GLU B 2 15 ? -83.129 140.593 7.468   1.00 147.33 ? 1058 GLU B CD  1 
ATOM   403 O OE1 . GLU B 2 15 ? -82.800 140.426 8.662   1.00 151.11 ? 1058 GLU B OE1 1 
ATOM   404 O OE2 . GLU B 2 15 ? -84.038 139.938 6.915   1.00 149.54 ? 1058 GLU B OE2 1 
ATOM   405 N N   . GLY B 2 16 ? -80.241 143.374 4.821   1.00 119.55 ? 1059 GLY B N   1 
ATOM   406 C CA  . GLY B 2 16 ? -80.421 144.091 3.572   1.00 111.94 ? 1059 GLY B CA  1 
ATOM   407 C C   . GLY B 2 16 ? -80.253 145.585 3.769   1.00 102.31 ? 1059 GLY B C   1 
ATOM   408 O O   . GLY B 2 16 ? -79.980 146.034 4.884   1.00 101.69 ? 1059 GLY B O   1 
ATOM   409 N N   . PRO B 2 17 ? -80.411 146.368 2.688   1.00 93.48  ? 1060 PRO B N   1 
ATOM   410 C CA  . PRO B 2 17 ? -80.342 147.827 2.816   1.00 87.20  ? 1060 PRO B CA  1 
ATOM   411 C C   . PRO B 2 17 ? -81.511 148.325 3.654   1.00 77.59  ? 1060 PRO B C   1 
ATOM   412 O O   . PRO B 2 17 ? -82.647 147.901 3.439   1.00 78.63  ? 1060 PRO B O   1 
ATOM   413 C CB  . PRO B 2 17 ? -80.430 148.319 1.367   1.00 85.67  ? 1060 PRO B CB  1 
ATOM   414 C CG  . PRO B 2 17 ? -81.161 147.244 0.655   1.00 89.99  ? 1060 PRO B CG  1 
ATOM   415 C CD  . PRO B 2 17 ? -80.777 145.950 1.325   1.00 93.89  ? 1060 PRO B CD  1 
ATOM   416 N N   . GLN B 2 18 ? -81.225 149.188 4.620   1.00 72.65  ? 1061 GLN B N   1 
ATOM   417 C CA  . GLN B 2 18 ? -82.245 149.658 5.545   1.00 67.18  ? 1061 GLN B CA  1 
ATOM   418 C C   . GLN B 2 18 ? -83.183 150.640 4.852   1.00 59.62  ? 1061 GLN B C   1 
ATOM   419 O O   . GLN B 2 18 ? -82.748 151.654 4.317   1.00 56.58  ? 1061 GLN B O   1 
ATOM   420 C CB  . GLN B 2 18 ? -81.594 150.304 6.770   1.00 64.64  ? 1061 GLN B CB  1 
ATOM   421 C CG  . GLN B 2 18 ? -82.586 150.716 7.832   1.00 68.35  ? 1061 GLN B CG  1 
ATOM   422 C CD  . GLN B 2 18 ? -83.524 149.592 8.204   1.00 77.43  ? 1061 GLN B CD  1 
ATOM   423 O OE1 . GLN B 2 18 ? -84.747 149.737 8.131   1.00 73.45  ? 1061 GLN B OE1 1 
ATOM   424 N NE2 . GLN B 2 18 ? -82.957 148.458 8.604   1.00 84.13  ? 1061 GLN B NE2 1 
ATOM   425 N N   . LEU B 2 19 ? -84.475 150.336 4.854   1.00 53.53  ? 1062 LEU B N   1 
ATOM   426 C CA  . LEU B 2 19 ? -85.425 151.176 4.138   1.00 47.08  ? 1062 LEU B CA  1 
ATOM   427 C C   . LEU B 2 19 ? -85.817 152.409 4.955   1.00 52.60  ? 1062 LEU B C   1 
ATOM   428 O O   . LEU B 2 19 ? -86.269 153.409 4.404   1.00 58.44  ? 1062 LEU B O   1 
ATOM   429 C CB  . LEU B 2 19 ? -86.666 150.370 3.770   1.00 50.49  ? 1062 LEU B CB  1 
ATOM   430 C CG  . LEU B 2 19 ? -86.440 149.157 2.865   1.00 57.24  ? 1062 LEU B CG  1 
ATOM   431 C CD1 . LEU B 2 19 ? -87.772 148.535 2.510   1.00 68.69  ? 1062 LEU B CD1 1 
ATOM   432 C CD2 . LEU B 2 19 ? -85.692 149.560 1.618   1.00 57.75  ? 1062 LEU B CD2 1 
ATOM   433 N N   . LEU B 2 20 ? -85.649 152.324 6.271   1.00 49.85  ? 1063 LEU B N   1 
ATOM   434 C CA  . LEU B 2 20 ? -85.981 153.432 7.157   1.00 51.45  ? 1063 LEU B CA  1 
ATOM   435 C C   . LEU B 2 20 ? -84.724 154.163 7.593   1.00 49.07  ? 1063 LEU B C   1 
ATOM   436 O O   . LEU B 2 20 ? -83.868 153.599 8.279   1.00 51.15  ? 1063 LEU B O   1 
ATOM   437 C CB  . LEU B 2 20 ? -86.746 152.944 8.377   1.00 57.41  ? 1063 LEU B CB  1 
ATOM   438 C CG  . LEU B 2 20 ? -88.094 152.293 8.088   1.00 73.66  ? 1063 LEU B CG  1 
ATOM   439 C CD1 . LEU B 2 20 ? -88.810 152.032 9.394   1.00 76.53  ? 1063 LEU B CD1 1 
ATOM   440 C CD2 . LEU B 2 20 ? -88.923 153.174 7.163   1.00 77.28  ? 1063 LEU B CD2 1 
ATOM   441 N N   . LEU B 2 21 ? -84.621 155.421 7.199   1.00 45.86  ? 1064 LEU B N   1 
ATOM   442 C CA  . LEU B 2 21 ? -83.437 156.199 7.508   1.00 50.08  ? 1064 LEU B CA  1 
ATOM   443 C C   . LEU B 2 21 ? -83.192 156.294 9.021   1.00 42.47  ? 1064 LEU B C   1 
ATOM   444 O O   . LEU B 2 21 ? -82.045 156.274 9.464   1.00 48.08  ? 1064 LEU B O   1 
ATOM   445 C CB  . LEU B 2 21 ? -83.548 157.595 6.902   1.00 52.31  ? 1064 LEU B CB  1 
ATOM   446 C CG  . LEU B 2 21 ? -82.392 158.512 7.295   1.00 50.26  ? 1064 LEU B CG  1 
ATOM   447 C CD1 . LEU B 2 21 ? -81.035 157.972 6.827   1.00 42.22  ? 1064 LEU B CD1 1 
ATOM   448 C CD2 . LEU B 2 21 ? -82.643 159.906 6.768   1.00 59.91  ? 1064 LEU B CD2 1 
ATOM   449 N N   . SER B 2 22 ? -84.260 156.384 9.807   1.00 44.42  ? 1065 SER B N   1 
ATOM   450 C CA  . SER B 2 22 ? -84.106 156.493 11.254  1.00 54.80  ? 1065 SER B CA  1 
ATOM   451 C C   . SER B 2 22 ? -83.387 155.267 11.830  1.00 56.02  ? 1065 SER B C   1 
ATOM   452 O O   . SER B 2 22 ? -82.555 155.391 12.725  1.00 50.20  ? 1065 SER B O   1 
ATOM   453 C CB  . SER B 2 22 ? -85.464 156.673 11.938  1.00 61.20  ? 1065 SER B CB  1 
ATOM   454 O OG  . SER B 2 22 ? -86.284 155.530 11.768  1.00 65.03  ? 1065 SER B OG  1 
ATOM   455 N N   . GLU B 2 23 ? -83.698 154.085 11.305  1.00 54.47  ? 1066 GLU B N   1 
ATOM   456 C CA  . GLU B 2 23 ? -83.032 152.864 11.753  1.00 59.83  ? 1066 GLU B CA  1 
ATOM   457 C C   . GLU B 2 23 ? -81.582 152.778 11.244  1.00 48.77  ? 1066 GLU B C   1 
ATOM   458 O O   . GLU B 2 23 ? -80.704 152.281 11.945  1.00 52.13  ? 1066 GLU B O   1 
ATOM   459 C CB  . GLU B 2 23 ? -83.828 151.631 11.308  1.00 66.64  ? 1066 GLU B CB  1 
ATOM   460 C CG  . GLU B 2 23 ? -83.245 150.303 11.762  1.00 82.61  ? 1066 GLU B CG  1 
ATOM   461 C CD  . GLU B 2 23 ? -83.261 150.117 13.273  1.00 95.39  ? 1066 GLU B CD  1 
ATOM   462 O OE1 . GLU B 2 23 ? -83.951 150.883 13.984  1.00 99.00  ? 1066 GLU B OE1 1 
ATOM   463 O OE2 . GLU B 2 23 ? -82.571 149.195 13.753  1.00 103.50 ? 1066 GLU B OE2 1 
ATOM   464 N N   . ALA B 2 24 ? -81.340 153.249 10.027  1.00 43.95  ? 1067 ALA B N   1 
ATOM   465 C CA  . ALA B 2 24 ? -79.978 153.319 9.487   1.00 42.66  ? 1067 ALA B CA  1 
ATOM   466 C C   . ALA B 2 24 ? -79.069 154.188 10.375  1.00 49.23  ? 1067 ALA B C   1 
ATOM   467 O O   . ALA B 2 24 ? -77.922 153.820 10.662  1.00 46.12  ? 1067 ALA B O   1 
ATOM   468 C CB  . ALA B 2 24 ? -79.989 153.867 8.082   1.00 42.48  ? 1067 ALA B CB  1 
ATOM   469 N N   . VAL B 2 25 ? -79.577 155.348 10.784  1.00 44.18  ? 1068 VAL B N   1 
ATOM   470 C CA  . VAL B 2 25 ? -78.789 156.266 11.627  1.00 41.23  ? 1068 VAL B CA  1 
ATOM   471 C C   . VAL B 2 25 ? -78.560 155.681 13.025  1.00 43.67  ? 1068 VAL B C   1 
ATOM   472 O O   . VAL B 2 25 ? -77.469 155.787 13.586  1.00 45.23  ? 1068 VAL B O   1 
ATOM   473 C CB  . VAL B 2 25 ? -79.471 157.650 11.742  1.00 43.17  ? 1068 VAL B CB  1 
ATOM   474 C CG1 . VAL B 2 25 ? -78.683 158.553 12.689  1.00 50.29  ? 1068 VAL B CG1 1 
ATOM   475 C CG2 . VAL B 2 25 ? -79.576 158.311 10.371  1.00 47.06  ? 1068 VAL B CG2 1 
ATOM   476 N N   . SER B 2 26 ? -79.592 155.058 13.585  1.00 48.59  ? 1069 SER B N   1 
ATOM   477 C CA  . SER B 2 26 ? -79.460 154.396 14.874  1.00 47.93  ? 1069 SER B CA  1 
ATOM   478 C C   . SER B 2 26 ? -78.345 153.354 14.852  1.00 52.71  ? 1069 SER B C   1 
ATOM   479 O O   . SER B 2 26 ? -77.503 153.303 15.759  1.00 55.98  ? 1069 SER B O   1 
ATOM   480 C CB  . SER B 2 26 ? -80.784 153.741 15.275  1.00 52.52  ? 1069 SER B CB  1 
ATOM   481 O OG  . SER B 2 26 ? -80.637 153.033 16.493  1.00 68.39  ? 1069 SER B OG  1 
ATOM   482 N N   . ARG B 2 27 ? -78.343 152.510 13.826  1.00 51.65  ? 1070 ARG B N   1 
ATOM   483 C CA  . ARG B 2 27 ? -77.314 151.484 13.721  1.00 52.84  ? 1070 ARG B CA  1 
ATOM   484 C C   . ARG B 2 27 ? -75.930 152.100 13.556  1.00 53.96  ? 1070 ARG B C   1 
ATOM   485 O O   . ARG B 2 27 ? -74.966 151.622 14.152  1.00 55.68  ? 1070 ARG B O   1 
ATOM   486 C CB  . ARG B 2 27 ? -77.613 150.536 12.555  1.00 53.41  ? 1070 ARG B CB  1 
ATOM   487 C CG  . ARG B 2 27 ? -78.762 149.599 12.849  1.00 68.05  ? 1070 ARG B CG  1 
ATOM   488 C CD  . ARG B 2 27 ? -79.248 148.890 11.604  1.00 76.41  ? 1070 ARG B CD  1 
ATOM   489 N NE  . ARG B 2 27 ? -80.145 147.790 11.945  1.00 90.30  ? 1070 ARG B NE  1 
ATOM   490 C CZ  . ARG B 2 27 ? -79.792 146.509 11.929  1.00 100.80 ? 1070 ARG B CZ  1 
ATOM   491 N NH1 . ARG B 2 27 ? -78.561 146.162 11.575  1.00 104.42 ? 1070 ARG B NH1 1 
ATOM   492 N NH2 . ARG B 2 27 ? -80.671 145.574 12.258  1.00 106.44 ? 1070 ARG B NH2 1 
ATOM   493 N N   . ALA B 2 28 ? -75.838 153.161 12.758  1.00 45.23  ? 1071 ALA B N   1 
ATOM   494 C CA  . ALA B 2 28 ? -74.553 153.814 12.493  1.00 51.66  ? 1071 ALA B CA  1 
ATOM   495 C C   . ALA B 2 28 ? -73.968 154.409 13.779  1.00 51.31  ? 1071 ALA B C   1 
ATOM   496 O O   . ALA B 2 28 ? -72.783 154.245 14.084  1.00 53.31  ? 1071 ALA B O   1 
ATOM   497 C CB  . ALA B 2 28 ? -74.717 154.888 11.435  1.00 44.20  ? 1071 ALA B CB  1 
ATOM   498 N N   . ALA B 2 29 ? -74.827 155.073 14.537  1.00 44.08  ? 1072 ALA B N   1 
ATOM   499 C CA  . ALA B 2 29 ? -74.423 155.718 15.786  1.00 42.14  ? 1072 ALA B CA  1 
ATOM   500 C C   . ALA B 2 29 ? -73.953 154.697 16.794  1.00 52.98  ? 1072 ALA B C   1 
ATOM   501 O O   . ALA B 2 29 ? -72.970 154.905 17.509  1.00 55.57  ? 1072 ALA B O   1 
ATOM   502 C CB  . ALA B 2 29 ? -75.571 156.527 16.342  1.00 43.19  ? 1072 ALA B CB  1 
ATOM   503 N N   . LYS B 2 30 ? -74.654 153.573 16.846  1.00 54.10  ? 1073 LYS B N   1 
ATOM   504 C CA  . LYS B 2 30 ? -74.271 152.530 17.778  1.00 57.88  ? 1073 LYS B CA  1 
ATOM   505 C C   . LYS B 2 30 ? -72.915 151.938 17.395  1.00 65.57  ? 1073 LYS B C   1 
ATOM   506 O O   . LYS B 2 30 ? -72.089 151.669 18.266  1.00 64.19  ? 1073 LYS B O   1 
ATOM   507 C CB  . LYS B 2 30 ? -75.349 151.453 17.846  1.00 70.71  ? 1073 LYS B CB  1 
ATOM   508 C CG  . LYS B 2 30 ? -76.490 151.847 18.773  1.00 80.88  ? 1073 LYS B CG  1 
ATOM   509 C CD  . LYS B 2 30 ? -77.323 150.636 19.173  1.00 93.61  ? 1073 LYS B CD  1 
ATOM   510 C CE  . LYS B 2 30 ? -78.785 151.019 19.326  1.00 96.94  ? 1073 LYS B CE  1 
ATOM   511 N NZ  . LYS B 2 30 ? -79.624 150.354 18.293  1.00 104.51 ? 1073 LYS B NZ  1 
ATOM   512 N N   . ALA B 2 31 ? -72.671 151.753 16.099  1.00 60.38  ? 1074 ALA B N   1 
ATOM   513 C CA  . ALA B 2 31 ? -71.377 151.234 15.671  1.00 64.35  ? 1074 ALA B CA  1 
ATOM   514 C C   . ALA B 2 31 ? -70.269 152.253 15.952  1.00 63.72  ? 1074 ALA B C   1 
ATOM   515 O O   . ALA B 2 31 ? -69.142 151.871 16.284  1.00 68.57  ? 1074 ALA B O   1 
ATOM   516 C CB  . ALA B 2 31 ? -71.403 150.854 14.191  1.00 57.12  ? 1074 ALA B CB  1 
ATOM   517 N N   . ALA B 2 32 ? -70.596 153.538 15.824  1.00 59.07  ? 1075 ALA B N   1 
ATOM   518 C CA  . ALA B 2 32 ? -69.639 154.617 16.080  1.00 57.60  ? 1075 ALA B CA  1 
ATOM   519 C C   . ALA B 2 32 ? -69.489 154.960 17.566  1.00 63.70  ? 1075 ALA B C   1 
ATOM   520 O O   . ALA B 2 32 ? -68.655 155.786 17.929  1.00 60.12  ? 1075 ALA B O   1 
ATOM   521 C CB  . ALA B 2 32 ? -70.038 155.861 15.313  1.00 49.67  ? 1075 ALA B CB  1 
ATOM   522 N N   . GLY B 2 33 ? -70.302 154.342 18.417  1.00 55.47  ? 1076 GLY B N   1 
ATOM   523 C CA  . GLY B 2 33 ? -70.286 154.659 19.838  1.00 58.60  ? 1076 GLY B CA  1 
ATOM   524 C C   . GLY B 2 33 ? -70.701 156.086 20.160  1.00 59.09  ? 1076 GLY B C   1 
ATOM   525 O O   . GLY B 2 33 ? -70.236 156.676 21.138  1.00 58.21  ? 1076 GLY B O   1 
ATOM   526 N N   . ALA B 2 34 ? -71.581 156.649 19.334  1.00 49.50  ? 1077 ALA B N   1 
ATOM   527 C CA  . ALA B 2 34 ? -72.043 158.025 19.519  1.00 53.93  ? 1077 ALA B CA  1 
ATOM   528 C C   . ALA B 2 34 ? -73.383 158.082 20.249  1.00 52.32  ? 1077 ALA B C   1 
ATOM   529 O O   . ALA B 2 34 ? -74.330 157.418 19.851  1.00 51.79  ? 1077 ALA B O   1 
ATOM   530 C CB  . ALA B 2 34 ? -72.168 158.725 18.164  1.00 49.65  ? 1077 ALA B CB  1 
ATOM   531 N N   . ARG B 2 35 ? -73.473 158.893 21.297  1.00 43.99  ? 1078 ARG B N   1 
ATOM   532 C CA  . ARG B 2 35 ? -74.741 159.082 22.001  1.00 49.86  ? 1078 ARG B CA  1 
ATOM   533 C C   . ARG B 2 35 ? -75.220 160.514 21.828  1.00 47.18  ? 1078 ARG B C   1 
ATOM   534 O O   . ARG B 2 35 ? -74.412 161.444 21.813  1.00 49.16  ? 1078 ARG B O   1 
ATOM   535 C CB  . ARG B 2 35 ? -74.606 158.730 23.488  1.00 59.32  ? 1078 ARG B CB  1 
ATOM   536 C CG  . ARG B 2 35 ? -74.251 157.263 23.723  1.00 75.06  ? 1078 ARG B CG  1 
ATOM   537 C CD  . ARG B 2 35 ? -75.406 156.353 23.301  1.00 85.72  ? 1078 ARG B CD  1 
ATOM   538 N NE  . ARG B 2 35 ? -75.145 154.935 23.551  1.00 100.37 ? 1078 ARG B NE  1 
ATOM   539 C CZ  . ARG B 2 35 ? -74.649 154.088 22.651  1.00 98.51  ? 1078 ARG B CZ  1 
ATOM   540 N NH1 . ARG B 2 35 ? -74.361 154.505 21.425  1.00 90.40  ? 1078 ARG B NH1 1 
ATOM   541 N NH2 . ARG B 2 35 ? -74.450 152.816 22.980  1.00 102.53 ? 1078 ARG B NH2 1 
ATOM   542 N N   . PRO B 2 36 ? -76.534 160.694 21.646  1.00 52.06  ? 1079 PRO B N   1 
ATOM   543 C CA  . PRO B 2 36 ? -76.981 162.037 21.265  1.00 48.77  ? 1079 PRO B CA  1 
ATOM   544 C C   . PRO B 2 36 ? -76.901 163.022 22.423  1.00 45.91  ? 1079 PRO B C   1 
ATOM   545 O O   . PRO B 2 36 ? -76.954 162.627 23.588  1.00 47.02  ? 1079 PRO B O   1 
ATOM   546 C CB  . PRO B 2 36 ? -78.441 161.825 20.823  1.00 49.70  ? 1079 PRO B CB  1 
ATOM   547 C CG  . PRO B 2 36 ? -78.570 160.360 20.580  1.00 57.07  ? 1079 PRO B CG  1 
ATOM   548 C CD  . PRO B 2 36 ? -77.597 159.689 21.503  1.00 59.20  ? 1079 PRO B CD  1 
ATOM   549 N N   . LEU B 2 37 ? -76.725 164.291 22.084  1.00 39.04  ? 1080 LEU B N   1 
ATOM   550 C CA  . LEU B 2 37 ? -76.752 165.387 23.045  1.00 44.03  ? 1080 LEU B CA  1 
ATOM   551 C C   . LEU B 2 37 ? -78.163 165.548 23.579  1.00 46.56  ? 1080 LEU B C   1 
ATOM   552 O O   . LEU B 2 37 ? -78.376 165.911 24.733  1.00 46.75  ? 1080 LEU B O   1 
ATOM   553 C CB  . LEU B 2 37 ? -76.296 166.692 22.391  1.00 52.59  ? 1080 LEU B CB  1 
ATOM   554 C CG  . LEU B 2 37 ? -74.924 166.760 21.718  1.00 52.39  ? 1080 LEU B CG  1 
ATOM   555 C CD1 . LEU B 2 37 ? -74.687 168.150 21.159  1.00 48.51  ? 1080 LEU B CD1 1 
ATOM   556 C CD2 . LEU B 2 37 ? -73.848 166.418 22.715  1.00 56.90  ? 1080 LEU B CD2 1 
ATOM   557 N N   . THR B 2 38 ? -79.133 165.269 22.716  1.00 44.58  ? 1081 THR B N   1 
ATOM   558 C CA  . THR B 2 38 ? -80.544 165.424 23.052  1.00 45.06  ? 1081 THR B CA  1 
ATOM   559 C C   . THR B 2 38 ? -81.128 164.101 23.558  1.00 47.35  ? 1081 THR B C   1 
ATOM   560 O O   . THR B 2 38 ? -81.018 163.774 24.738  1.00 49.76  ? 1081 THR B O   1 
ATOM   561 C CB  . THR B 2 38 ? -81.339 165.907 21.823  1.00 47.68  ? 1081 THR B CB  1 
ATOM   562 O OG1 . THR B 2 38 ? -81.010 165.068 20.712  1.00 46.24  ? 1081 THR B OG1 1 
ATOM   563 C CG2 . THR B 2 38 ? -80.927 167.317 21.440  1.00 41.35  ? 1081 THR B CG2 1 
ATOM   564 N N   . SER B 2 39 ? -81.743 163.348 22.651  1.00 49.96  ? 1082 SER B N   1 
ATOM   565 C CA  . SER B 2 39 ? -82.316 162.034 22.954  1.00 58.29  ? 1082 SER B CA  1 
ATOM   566 C C   . SER B 2 39 ? -82.516 161.281 21.635  1.00 51.49  ? 1082 SER B C   1 
ATOM   567 O O   . SER B 2 39 ? -82.611 161.912 20.588  1.00 52.88  ? 1082 SER B O   1 
ATOM   568 C CB  . SER B 2 39 ? -83.647 162.167 23.689  1.00 59.28  ? 1082 SER B CB  1 
ATOM   569 O OG  . SER B 2 39 ? -84.601 162.811 22.860  1.00 56.13  ? 1082 SER B OG  1 
ATOM   570 N N   . PRO B 2 40 ? -82.580 159.934 21.676  1.00 56.38  ? 1083 PRO B N   1 
ATOM   571 C CA  . PRO B 2 40 ? -82.838 159.231 20.412  1.00 57.37  ? 1083 PRO B CA  1 
ATOM   572 C C   . PRO B 2 40 ? -84.176 159.630 19.806  1.00 61.45  ? 1083 PRO B C   1 
ATOM   573 O O   . PRO B 2 40 ? -84.317 159.687 18.588  1.00 60.00  ? 1083 PRO B O   1 
ATOM   574 C CB  . PRO B 2 40 ? -82.851 157.756 20.823  1.00 59.83  ? 1083 PRO B CB  1 
ATOM   575 C CG  . PRO B 2 40 ? -82.010 157.716 22.045  1.00 63.00  ? 1083 PRO B CG  1 
ATOM   576 C CD  . PRO B 2 40 ? -82.312 158.993 22.774  1.00 62.34  ? 1083 PRO B CD  1 
ATOM   577 N N   . GLU B 2 41 ? -85.145 159.905 20.669  1.00 62.57  ? 1084 GLU B N   1 
ATOM   578 C CA  . GLU B 2 41 ? -86.477 160.301 20.240  1.00 61.28  ? 1084 GLU B CA  1 
ATOM   579 C C   . GLU B 2 41 ? -86.484 161.637 19.498  1.00 56.56  ? 1084 GLU B C   1 
ATOM   580 O O   . GLU B 2 41 ? -87.169 161.790 18.492  1.00 57.27  ? 1084 GLU B O   1 
ATOM   581 C CB  . GLU B 2 41 ? -87.406 160.360 21.457  1.00 66.09  ? 1084 GLU B CB  1 
ATOM   582 C CG  . GLU B 2 41 ? -87.736 158.991 22.047  1.00 74.90  ? 1084 GLU B CG  1 
ATOM   583 C CD  . GLU B 2 41 ? -86.689 158.480 23.033  1.00 76.01  ? 1084 GLU B CD  1 
ATOM   584 O OE1 . GLU B 2 41 ? -85.781 159.252 23.414  1.00 71.48  ? 1084 GLU B OE1 1 
ATOM   585 O OE2 . GLU B 2 41 ? -86.783 157.300 23.436  1.00 80.41  ? 1084 GLU B OE2 1 
ATOM   586 N N   . SER B 2 42 ? -85.713 162.606 19.976  1.00 53.60  ? 1085 SER B N   1 
ATOM   587 C CA  . SER B 2 42 ? -85.619 163.897 19.276  1.00 50.85  ? 1085 SER B CA  1 
ATOM   588 C C   . SER B 2 42 ? -84.889 163.783 17.935  1.00 45.76  ? 1085 SER B C   1 
ATOM   589 O O   . SER B 2 42 ? -85.288 164.402 16.947  1.00 45.72  ? 1085 SER B O   1 
ATOM   590 C CB  . SER B 2 42 ? -84.921 164.939 20.154  1.00 59.65  ? 1085 SER B CB  1 
ATOM   591 O OG  . SER B 2 42 ? -85.675 165.178 21.331  1.00 67.55  ? 1085 SER B OG  1 
ATOM   592 N N   . LEU B 2 43 ? -83.819 162.995 17.909  1.00 59.67  ? 1086 LEU B N   1 
ATOM   593 C CA  . LEU B 2 43 ? -83.077 162.729 16.672  1.00 50.07  ? 1086 LEU B CA  1 
ATOM   594 C C   . LEU B 2 43 ? -83.991 162.070 15.627  1.00 41.58  ? 1086 LEU B C   1 
ATOM   595 O O   . LEU B 2 43 ? -84.079 162.519 14.495  1.00 46.30  ? 1086 LEU B O   1 
ATOM   596 C CB  . LEU B 2 43 ? -81.868 161.823 16.953  1.00 45.84  ? 1086 LEU B CB  1 
ATOM   597 C CG  . LEU B 2 43 ? -81.200 161.205 15.720  1.00 45.39  ? 1086 LEU B CG  1 
ATOM   598 C CD1 . LEU B 2 43 ? -80.623 162.309 14.818  1.00 39.24  ? 1086 LEU B CD1 1 
ATOM   599 C CD2 . LEU B 2 43 ? -80.140 160.178 16.142  1.00 46.50  ? 1086 LEU B CD2 1 
ATOM   600 N N   . SER B 2 44 ? -84.698 161.025 16.035  1.00 47.97  ? 1087 SER B N   1 
ATOM   601 C CA  . SER B 2 44 ? -85.580 160.298 15.120  1.00 49.79  ? 1087 SER B CA  1 
ATOM   602 C C   . SER B 2 44 ? -86.719 161.163 14.562  1.00 56.35  ? 1087 SER B C   1 
ATOM   603 O O   . SER B 2 44 ? -87.114 161.008 13.407  1.00 56.86  ? 1087 SER B O   1 
ATOM   604 C CB  . SER B 2 44 ? -86.160 159.066 15.809  1.00 60.28  ? 1087 SER B CB  1 
ATOM   605 O OG  . SER B 2 44 ? -87.068 158.423 14.933  1.00 80.07  ? 1087 SER B OG  1 
ATOM   606 N N   . ARG B 2 45 ? -87.242 162.069 15.380  1.00 54.60  ? 1088 ARG B N   1 
ATOM   607 C CA  . ARG B 2 45 ? -88.272 163.004 14.934  1.00 57.71  ? 1088 ARG B CA  1 
ATOM   608 C C   . ARG B 2 45 ? -87.771 163.872 13.788  1.00 55.39  ? 1088 ARG B C   1 
ATOM   609 O O   . ARG B 2 45 ? -88.483 164.124 12.808  1.00 52.53  ? 1088 ARG B O   1 
ATOM   610 C CB  . ARG B 2 45 ? -88.712 163.884 16.103  1.00 63.39  ? 1088 ARG B CB  1 
ATOM   611 C CG  . ARG B 2 45 ? -89.754 164.932 15.760  1.00 76.09  ? 1088 ARG B CG  1 
ATOM   612 C CD  . ARG B 2 45 ? -90.124 165.718 17.017  1.00 82.43  ? 1088 ARG B CD  1 
ATOM   613 N NE  . ARG B 2 45 ? -90.258 164.838 18.177  1.00 89.46  ? 1088 ARG B NE  1 
ATOM   614 C CZ  . ARG B 2 45 ? -89.741 165.091 19.378  1.00 92.65  ? 1088 ARG B CZ  1 
ATOM   615 N NH1 . ARG B 2 45 ? -89.046 166.203 19.589  1.00 93.94  ? 1088 ARG B NH1 1 
ATOM   616 N NH2 . ARG B 2 45 ? -89.915 164.229 20.371  1.00 91.68  ? 1088 ARG B NH2 1 
ATOM   617 N N   . ASP B 2 46 ? -86.531 164.334 13.918  1.00 48.43  ? 1089 ASP B N   1 
ATOM   618 C CA  . ASP B 2 46 ? -85.927 165.173 12.887  1.00 47.15  ? 1089 ASP B CA  1 
ATOM   619 C C   . ASP B 2 46 ? -85.603 164.378 11.615  1.00 45.16  ? 1089 ASP B C   1 
ATOM   620 O O   . ASP B 2 46 ? -85.697 164.904 10.510  1.00 45.22  ? 1089 ASP B O   1 
ATOM   621 C CB  . ASP B 2 46 ? -84.662 165.855 13.438  1.00 46.98  ? 1089 ASP B CB  1 
ATOM   622 C CG  . ASP B 2 46 ? -84.975 167.109 14.263  1.00 56.71  ? 1089 ASP B CG  1 
ATOM   623 O OD1 . ASP B 2 46 ? -86.162 167.500 14.341  1.00 58.32  ? 1089 ASP B OD1 1 
ATOM   624 O OD2 . ASP B 2 46 ? -84.032 167.722 14.816  1.00 57.06  ? 1089 ASP B OD2 1 
ATOM   625 N N   . LEU B 2 47 ? -85.225 163.114 11.764  1.00 44.34  ? 1090 LEU B N   1 
ATOM   626 C CA  . LEU B 2 47 ? -84.909 162.279 10.598  1.00 45.82  ? 1090 LEU B CA  1 
ATOM   627 C C   . LEU B 2 47 ? -86.156 161.946 9.774   1.00 50.37  ? 1090 LEU B C   1 
ATOM   628 O O   . LEU B 2 47 ? -86.072 161.607 8.583   1.00 47.20  ? 1090 LEU B O   1 
ATOM   629 C CB  . LEU B 2 47 ? -84.217 160.992 11.041  1.00 46.00  ? 1090 LEU B CB  1 
ATOM   630 C CG  . LEU B 2 47 ? -82.796 161.224 11.564  1.00 39.59  ? 1090 LEU B CG  1 
ATOM   631 C CD1 . LEU B 2 47 ? -82.232 159.917 12.085  1.00 42.76  ? 1090 LEU B CD1 1 
ATOM   632 C CD2 . LEU B 2 47 ? -81.928 161.788 10.457  1.00 44.85  ? 1090 LEU B CD2 1 
ATOM   633 N N   . GLU B 2 48 ? -87.316 162.060 10.408  1.00 48.01  ? 1091 GLU B N   1 
ATOM   634 C CA  . GLU B 2 48 ? -88.579 161.780 9.728   1.00 60.30  ? 1091 GLU B CA  1 
ATOM   635 C C   . GLU B 2 48 ? -89.136 162.982 8.940   1.00 53.69  ? 1091 GLU B C   1 
ATOM   636 O O   . GLU B 2 48 ? -90.165 162.861 8.280   1.00 57.80  ? 1091 GLU B O   1 
ATOM   637 C CB  . GLU B 2 48 ? -89.608 161.287 10.749  1.00 58.19  ? 1091 GLU B CB  1 
ATOM   638 C CG  . GLU B 2 48 ? -89.361 159.847 11.207  1.00 77.66  ? 1091 GLU B CG  1 
ATOM   639 C CD  . GLU B 2 48 ? -89.922 159.542 12.602  1.00 90.41  ? 1091 GLU B CD  1 
ATOM   640 O OE1 . GLU B 2 48 ? -90.785 160.308 13.088  1.00 94.26  ? 1091 GLU B OE1 1 
ATOM   641 O OE2 . GLU B 2 48 ? -89.507 158.527 13.211  1.00 94.18  ? 1091 GLU B OE2 1 
ATOM   642 N N   . ALA B 2 49 ? -88.461 164.131 9.002   1.00 50.09  ? 1092 ALA B N   1 
ATOM   643 C CA  . ALA B 2 49 ? -88.860 165.289 8.194   1.00 50.57  ? 1092 ALA B CA  1 
ATOM   644 C C   . ALA B 2 49 ? -89.021 164.847 6.738   1.00 51.44  ? 1092 ALA B C   1 
ATOM   645 O O   . ALA B 2 49 ? -88.161 164.123 6.215   1.00 48.84  ? 1092 ALA B O   1 
ATOM   646 C CB  . ALA B 2 49 ? -87.830 166.413 8.297   1.00 46.07  ? 1092 ALA B CB  1 
ATOM   647 N N   . PRO B 2 50 ? -90.126 165.252 6.093   1.00 48.61  ? 1093 PRO B N   1 
ATOM   648 C CA  . PRO B 2 50 ? -90.430 164.760 4.735   1.00 48.91  ? 1093 PRO B CA  1 
ATOM   649 C C   . PRO B 2 50 ? -89.292 164.937 3.732   1.00 50.03  ? 1093 PRO B C   1 
ATOM   650 O O   . PRO B 2 50 ? -89.054 164.020 2.943   1.00 52.61  ? 1093 PRO B O   1 
ATOM   651 C CB  . PRO B 2 50 ? -91.647 165.603 4.316   1.00 52.33  ? 1093 PRO B CB  1 
ATOM   652 C CG  . PRO B 2 50 ? -92.322 165.954 5.590   1.00 51.88  ? 1093 PRO B CG  1 
ATOM   653 C CD  . PRO B 2 50 ? -91.240 166.041 6.666   1.00 47.25  ? 1093 PRO B CD  1 
ATOM   654 N N   . GLU B 2 51 ? -88.617 166.085 3.761   1.00 48.24  ? 1094 GLU B N   1 
ATOM   655 C CA  . GLU B 2 51 ? -87.494 166.358 2.864   1.00 42.78  ? 1094 GLU B CA  1 
ATOM   656 C C   . GLU B 2 51 ? -86.360 165.359 3.046   1.00 53.08  ? 1094 GLU B C   1 
ATOM   657 O O   . GLU B 2 51 ? -85.758 164.898 2.080   1.00 48.77  ? 1094 GLU B O   1 
ATOM   658 C CB  . GLU B 2 51 ? -86.935 167.767 3.084   1.00 50.99  ? 1094 GLU B CB  1 
ATOM   659 C CG  . GLU B 2 51 ? -87.906 168.892 2.809   1.00 65.37  ? 1094 GLU B CG  1 
ATOM   660 C CD  . GLU B 2 51 ? -88.685 169.303 4.040   1.00 68.22  ? 1094 GLU B CD  1 
ATOM   661 O OE1 . GLU B 2 51 ? -88.811 168.482 4.981   1.00 61.17  ? 1094 GLU B OE1 1 
ATOM   662 O OE2 . GLU B 2 51 ? -89.161 170.459 4.069   1.00 73.79  ? 1094 GLU B OE2 1 
ATOM   663 N N   . VAL B 2 52 ? -86.055 165.043 4.298   1.00 46.69  ? 1095 VAL B N   1 
ATOM   664 C CA  . VAL B 2 52 ? -84.961 164.135 4.596   1.00 47.81  ? 1095 VAL B CA  1 
ATOM   665 C C   . VAL B 2 52 ? -85.300 162.714 4.144   1.00 46.72  ? 1095 VAL B C   1 
ATOM   666 O O   . VAL B 2 52 ? -84.496 162.062 3.481   1.00 41.68  ? 1095 VAL B O   1 
ATOM   667 C CB  . VAL B 2 52 ? -84.625 164.157 6.096   1.00 46.05  ? 1095 VAL B CB  1 
ATOM   668 C CG1 . VAL B 2 52 ? -83.403 163.310 6.376   1.00 55.87  ? 1095 VAL B CG1 1 
ATOM   669 C CG2 . VAL B 2 52 ? -84.374 165.588 6.540   1.00 45.54  ? 1095 VAL B CG2 1 
ATOM   670 N N   . GLN B 2 53 ? -86.495 162.237 4.491   1.00 41.64  ? 1096 GLN B N   1 
ATOM   671 C CA  . GLN B 2 53 ? -86.927 160.892 4.094   1.00 43.00  ? 1096 GLN B CA  1 
ATOM   672 C C   . GLN B 2 53 ? -87.037 160.744 2.565   1.00 43.27  ? 1096 GLN B C   1 
ATOM   673 O O   . GLN B 2 53 ? -86.689 159.707 1.994   1.00 39.76  ? 1096 GLN B O   1 
ATOM   674 C CB  . GLN B 2 53 ? -88.272 160.550 4.750   1.00 54.06  ? 1096 GLN B CB  1 
ATOM   675 C CG  . GLN B 2 53 ? -88.847 159.195 4.329   1.00 67.11  ? 1096 GLN B CG  1 
ATOM   676 C CD  . GLN B 2 53 ? -87.876 158.034 4.549   1.00 70.55  ? 1096 GLN B CD  1 
ATOM   677 O OE1 . GLN B 2 53 ? -87.324 157.860 5.637   1.00 61.40  ? 1096 GLN B OE1 1 
ATOM   678 N NE2 . GLN B 2 53 ? -87.659 157.240 3.502   1.00 70.40  ? 1096 GLN B NE2 1 
ATOM   679 N N   . GLU B 2 54 ? -87.497 161.795 1.901   1.00 43.76  ? 1097 GLU B N   1 
ATOM   680 C CA  . GLU B 2 54 ? -87.665 161.752 0.454   1.00 44.35  ? 1097 GLU B CA  1 
ATOM   681 C C   . GLU B 2 54 ? -86.310 161.750 -0.257  1.00 48.65  ? 1097 GLU B C   1 
ATOM   682 O O   . GLU B 2 54 ? -86.108 161.025 -1.233  1.00 48.53  ? 1097 GLU B O   1 
ATOM   683 C CB  . GLU B 2 54 ? -88.519 162.934 -0.020  1.00 49.37  ? 1097 GLU B CB  1 
ATOM   684 C CG  . GLU B 2 54 ? -88.669 163.049 -1.535  1.00 49.51  ? 1097 GLU B CG  1 
ATOM   685 C CD  . GLU B 2 54 ? -89.497 161.927 -2.138  1.00 50.87  ? 1097 GLU B CD  1 
ATOM   686 O OE1 . GLU B 2 54 ? -90.049 161.086 -1.389  1.00 54.39  ? 1097 GLU B OE1 1 
ATOM   687 O OE2 . GLU B 2 54 ? -89.599 161.890 -3.378  1.00 57.89  ? 1097 GLU B OE2 1 
ATOM   688 N N   . SER B 2 55 ? -85.377 162.558 0.229   1.00 44.56  ? 1098 SER B N   1 
ATOM   689 C CA  . SER B 2 55 ? -84.040 162.553 -0.345  1.00 46.58  ? 1098 SER B CA  1 
ATOM   690 C C   . SER B 2 55 ? -83.404 161.161 -0.197  1.00 44.58  ? 1098 SER B C   1 
ATOM   691 O O   . SER B 2 55 ? -82.769 160.652 -1.125  1.00 42.10  ? 1098 SER B O   1 
ATOM   692 C CB  . SER B 2 55 ? -83.179 163.631 0.302   1.00 43.98  ? 1098 SER B CB  1 
ATOM   693 O OG  . SER B 2 55 ? -81.879 163.608 -0.238  1.00 57.94  ? 1098 SER B OG  1 
ATOM   694 N N   . TYR B 2 56 ? -83.600 160.530 0.959   1.00 39.26  ? 1099 TYR B N   1 
ATOM   695 C CA  . TYR B 2 56 ? -83.066 159.187 1.187   1.00 43.59  ? 1099 TYR B CA  1 
ATOM   696 C C   . TYR B 2 56 ? -83.684 158.177 0.212   1.00 44.44  ? 1099 TYR B C   1 
ATOM   697 O O   . TYR B 2 56 ? -82.958 157.387 -0.408  1.00 46.32  ? 1099 TYR B O   1 
ATOM   698 C CB  . TYR B 2 56 ? -83.320 158.746 2.633   1.00 42.71  ? 1099 TYR B CB  1 
ATOM   699 C CG  . TYR B 2 56 ? -82.730 157.390 2.981   1.00 39.39  ? 1099 TYR B CG  1 
ATOM   700 C CD1 . TYR B 2 56 ? -81.350 157.205 3.045   1.00 49.15  ? 1099 TYR B CD1 1 
ATOM   701 C CD2 . TYR B 2 56 ? -83.552 156.303 3.248   1.00 42.26  ? 1099 TYR B CD2 1 
ATOM   702 C CE1 . TYR B 2 56 ? -80.800 155.964 3.365   1.00 54.31  ? 1099 TYR B CE1 1 
ATOM   703 C CE2 . TYR B 2 56 ? -83.012 155.049 3.584   1.00 51.39  ? 1099 TYR B CE2 1 
ATOM   704 C CZ  . TYR B 2 56 ? -81.636 154.888 3.634   1.00 54.04  ? 1099 TYR B CZ  1 
ATOM   705 O OH  . TYR B 2 56 ? -81.093 153.658 3.967   1.00 58.04  ? 1099 TYR B OH  1 
ATOM   706 N N   . ARG B 2 57 ? -85.012 158.218 0.071   1.00 38.23  ? 1100 ARG B N   1 
ATOM   707 C CA  . ARG B 2 57 ? -85.733 157.334 -0.847  1.00 41.98  ? 1100 ARG B CA  1 
ATOM   708 C C   . ARG B 2 57 ? -85.205 157.467 -2.290  1.00 42.39  ? 1100 ARG B C   1 
ATOM   709 O O   . ARG B 2 57 ? -84.999 156.471 -3.004  1.00 45.72  ? 1100 ARG B O   1 
ATOM   710 C CB  . ARG B 2 57 ? -87.243 157.646 -0.832  1.00 44.63  ? 1100 ARG B CB  1 
ATOM   711 C CG  . ARG B 2 57 ? -88.073 156.738 -1.727  1.00 46.93  ? 1100 ARG B CG  1 
ATOM   712 C CD  . ARG B 2 57 ? -89.487 157.282 -1.952  1.00 44.12  ? 1100 ARG B CD  1 
ATOM   713 N NE  . ARG B 2 57 ? -89.448 158.514 -2.735  1.00 50.00  ? 1100 ARG B NE  1 
ATOM   714 C CZ  . ARG B 2 57 ? -89.531 158.558 -4.060  1.00 51.31  ? 1100 ARG B CZ  1 
ATOM   715 N NH1 . ARG B 2 57 ? -89.703 157.434 -4.758  1.00 51.44  ? 1100 ARG B NH1 1 
ATOM   716 N NH2 . ARG B 2 57 ? -89.477 159.724 -4.689  1.00 56.84  ? 1100 ARG B NH2 1 
ATOM   717 N N   . GLN B 2 58 ? -85.014 158.700 -2.720  1.00 42.14  ? 1101 GLN B N   1 
ATOM   718 C CA  . GLN B 2 58 ? -84.497 158.960 -4.068  1.00 46.99  ? 1101 GLN B CA  1 
ATOM   719 C C   . GLN B 2 58 ? -83.058 158.456 -4.261  1.00 52.24  ? 1101 GLN B C   1 
ATOM   720 O O   . GLN B 2 58 ? -82.715 157.936 -5.322  1.00 44.68  ? 1101 GLN B O   1 
ATOM   721 C CB  . GLN B 2 58 ? -84.575 160.454 -4.370  1.00 45.94  ? 1101 GLN B CB  1 
ATOM   722 C CG  . GLN B 2 58 ? -85.998 160.976 -4.529  1.00 50.71  ? 1101 GLN B CG  1 
ATOM   723 C CD  . GLN B 2 58 ? -86.058 162.485 -4.678  1.00 64.33  ? 1101 GLN B CD  1 
ATOM   724 O OE1 . GLN B 2 58 ? -85.304 163.211 -4.034  1.00 73.19  ? 1101 GLN B OE1 1 
ATOM   725 N NE2 . GLN B 2 58 ? -86.952 162.963 -5.534  1.00 69.15  ? 1101 GLN B NE2 1 
ATOM   726 N N   . GLN B 2 59 ? -82.213 158.625 -3.246  1.00 40.74  ? 1102 GLN B N   1 
ATOM   727 C CA  . GLN B 2 59 ? -80.833 158.134 -3.316  1.00 46.98  ? 1102 GLN B CA  1 
ATOM   728 C C   . GLN B 2 59 ? -80.837 156.624 -3.467  1.00 46.88  ? 1102 GLN B C   1 
ATOM   729 O O   . GLN B 2 59 ? -80.136 156.065 -4.318  1.00 51.95  ? 1102 GLN B O   1 
ATOM   730 C CB  . GLN B 2 59 ? -80.035 158.526 -2.065  1.00 47.26  ? 1102 GLN B CB  1 
ATOM   731 C CG  . GLN B 2 59 ? -78.537 158.172 -2.139  1.00 45.92  ? 1102 GLN B CG  1 
ATOM   732 C CD  . GLN B 2 59 ? -77.801 158.923 -3.237  1.00 50.68  ? 1102 GLN B CD  1 
ATOM   733 O OE1 . GLN B 2 59 ? -77.833 160.156 -3.310  1.00 55.82  ? 1102 GLN B OE1 1 
ATOM   734 N NE2 . GLN B 2 59 ? -77.125 158.172 -4.107  1.00 59.65  ? 1102 GLN B NE2 1 
ATOM   735 N N   . LEU B 2 60 ? -81.652 155.978 -2.642  1.00 42.55  ? 1103 LEU B N   1 
ATOM   736 C CA  . LEU B 2 60 ? -81.799 154.529 -2.661  1.00 47.57  ? 1103 LEU B CA  1 
ATOM   737 C C   . LEU B 2 60 ? -82.285 154.033 -4.021  1.00 52.33  ? 1103 LEU B C   1 
ATOM   738 O O   . LEU B 2 60 ? -81.733 153.078 -4.581  1.00 53.40  ? 1103 LEU B O   1 
ATOM   739 C CB  . LEU B 2 60 ? -82.770 154.087 -1.565  1.00 55.66  ? 1103 LEU B CB  1 
ATOM   740 C CG  . LEU B 2 60 ? -82.746 152.627 -1.123  1.00 68.38  ? 1103 LEU B CG  1 
ATOM   741 C CD1 . LEU B 2 60 ? -81.332 152.067 -1.166  1.00 72.29  ? 1103 LEU B CD1 1 
ATOM   742 C CD2 . LEU B 2 60 ? -83.314 152.517 0.283   1.00 74.29  ? 1103 LEU B CD2 1 
ATOM   743 N N   . ARG B 2 61 ? -83.313 154.680 -4.559  1.00 42.32  ? 1104 ARG B N   1 
ATOM   744 C CA  . ARG B 2 61 ? -83.862 154.242 -5.849  1.00 45.13  ? 1104 ARG B CA  1 
ATOM   745 C C   . ARG B 2 61 ? -82.818 154.378 -6.958  1.00 52.72  ? 1104 ARG B C   1 
ATOM   746 O O   . ARG B 2 61 ? -82.677 153.487 -7.790  1.00 58.89  ? 1104 ARG B O   1 
ATOM   747 C CB  . ARG B 2 61 ? -85.118 155.037 -6.205  1.00 51.83  ? 1104 ARG B CB  1 
ATOM   748 C CG  . ARG B 2 61 ? -85.755 154.613 -7.509  1.00 58.20  ? 1104 ARG B CG  1 
ATOM   749 C CD  . ARG B 2 61 ? -86.987 155.452 -7.829  1.00 73.75  ? 1104 ARG B CD  1 
ATOM   750 N NE  . ARG B 2 61 ? -86.651 156.868 -7.975  1.00 81.67  ? 1104 ARG B NE  1 
ATOM   751 C CZ  . ARG B 2 61 ? -87.539 157.859 -7.977  1.00 87.27  ? 1104 ARG B CZ  1 
ATOM   752 N NH1 . ARG B 2 61 ? -88.836 157.598 -7.858  1.00 86.94  ? 1104 ARG B NH1 1 
ATOM   753 N NH2 . ARG B 2 61 ? -87.129 159.116 -8.110  1.00 88.58  ? 1104 ARG B NH2 1 
ATOM   754 N N   . SER B 2 62 ? -82.082 155.488 -6.955  1.00 49.16  ? 1105 SER B N   1 
ATOM   755 C CA  . SER B 2 62 ? -81.045 155.734 -7.961  1.00 55.76  ? 1105 SER B CA  1 
ATOM   756 C C   . SER B 2 62 ? -79.925 154.698 -7.906  1.00 56.20  ? 1105 SER B C   1 
ATOM   757 O O   . SER B 2 62 ? -79.507 154.146 -8.940  1.00 54.72  ? 1105 SER B O   1 
ATOM   758 C CB  . SER B 2 62 ? -80.446 157.134 -7.789  1.00 54.40  ? 1105 SER B CB  1 
ATOM   759 O OG  . SER B 2 62 ? -79.446 157.377 -8.777  1.00 64.29  ? 1105 SER B OG  1 
ATOM   760 N N   . ASP B 2 63 ? -79.437 154.439 -6.700  1.00 50.16  ? 1106 ASP B N   1 
ATOM   761 C CA  . ASP B 2 63 ? -78.325 153.517 -6.514  1.00 54.25  ? 1106 ASP B CA  1 
ATOM   762 C C   . ASP B 2 63 ? -78.694 152.068 -6.833  1.00 59.73  ? 1106 ASP B C   1 
ATOM   763 O O   . ASP B 2 63 ? -77.885 151.320 -7.392  1.00 54.54  ? 1106 ASP B O   1 
ATOM   764 C CB  . ASP B 2 63 ? -77.786 153.624 -5.090  1.00 51.29  ? 1106 ASP B CB  1 
ATOM   765 C CG  . ASP B 2 63 ? -76.958 154.881 -4.880  1.00 63.10  ? 1106 ASP B CG  1 
ATOM   766 O OD1 . ASP B 2 63 ? -76.401 155.393 -5.876  1.00 52.69  ? 1106 ASP B OD1 1 
ATOM   767 O OD2 . ASP B 2 63 ? -76.857 155.360 -3.724  1.00 49.16  ? 1106 ASP B OD2 1 
ATOM   768 N N   . ILE B 2 64 ? -79.910 151.665 -6.490  1.00 52.91  ? 1107 ILE B N   1 
ATOM   769 C CA  . ILE B 2 64 ? -80.320 150.295 -6.776  1.00 60.88  ? 1107 ILE B CA  1 
ATOM   770 C C   . ILE B 2 64 ? -80.410 150.077 -8.285  1.00 65.47  ? 1107 ILE B C   1 
ATOM   771 O O   . ILE B 2 64 ? -79.914 149.073 -8.811  1.00 72.10  ? 1107 ILE B O   1 
ATOM   772 C CB  . ILE B 2 64 ? -81.663 149.953 -6.104  1.00 59.89  ? 1107 ILE B CB  1 
ATOM   773 C CG1 . ILE B 2 64 ? -81.480 149.907 -4.586  1.00 61.67  ? 1107 ILE B CG1 1 
ATOM   774 C CG2 . ILE B 2 64 ? -82.187 148.600 -6.605  1.00 55.49  ? 1107 ILE B CG2 1 
ATOM   775 C CD1 . ILE B 2 64 ? -82.741 149.612 -3.803  1.00 58.93  ? 1107 ILE B CD1 1 
ATOM   776 N N   . GLN B 2 65 ? -81.019 151.032 -8.982  1.00 65.62  ? 1108 GLN B N   1 
ATOM   777 C CA  . GLN B 2 65 ? -81.155 150.959 -10.437 1.00 72.84  ? 1108 GLN B CA  1 
ATOM   778 C C   . GLN B 2 65 ? -79.799 150.858 -11.129 1.00 72.87  ? 1108 GLN B C   1 
ATOM   779 O O   . GLN B 2 65 ? -79.643 150.127 -12.112 1.00 73.18  ? 1108 GLN B O   1 
ATOM   780 C CB  . GLN B 2 65 ? -81.916 152.183 -10.953 1.00 77.63  ? 1108 GLN B CB  1 
ATOM   781 C CG  . GLN B 2 65 ? -83.413 152.136 -10.693 1.00 82.77  ? 1108 GLN B CG  1 
ATOM   782 C CD  . GLN B 2 65 ? -84.118 153.412 -11.113 1.00 91.19  ? 1108 GLN B CD  1 
ATOM   783 O OE1 . GLN B 2 65 ? -83.513 154.486 -11.138 1.00 91.53  ? 1108 GLN B OE1 1 
ATOM   784 N NE2 . GLN B 2 65 ? -85.401 153.301 -11.451 1.00 94.31  ? 1108 GLN B NE2 1 
ATOM   785 N N   . LYS B 2 66 ? -78.824 151.595 -10.606 1.00 68.49  ? 1109 LYS B N   1 
ATOM   786 C CA  . LYS B 2 66 ? -77.493 151.658 -11.197 1.00 79.09  ? 1109 LYS B CA  1 
ATOM   787 C C   . LYS B 2 66 ? -76.721 150.352 -11.032 1.00 84.69  ? 1109 LYS B C   1 
ATOM   788 O O   . LYS B 2 66 ? -76.005 149.929 -11.943 1.00 87.53  ? 1109 LYS B O   1 
ATOM   789 C CB  . LYS B 2 66 ? -76.704 152.815 -10.591 1.00 78.35  ? 1109 LYS B CB  1 
ATOM   790 C CG  . LYS B 2 66 ? -77.046 154.167 -11.200 1.00 84.03  ? 1109 LYS B CG  1 
ATOM   791 C CD  . LYS B 2 66 ? -76.477 155.327 -10.387 1.00 87.41  ? 1109 LYS B CD  1 
ATOM   792 C CE  . LYS B 2 66 ? -75.059 155.048 -9.904  1.00 92.78  ? 1109 LYS B CE  1 
ATOM   793 N NZ  . LYS B 2 66 ? -74.142 154.677 -11.027 1.00 98.33  ? 1109 LYS B NZ  1 
ATOM   794 N N   . ARG B 2 67 ? -76.862 149.711 -9.876  1.00 80.57  ? 1110 ARG B N   1 
ATOM   795 C CA  . ARG B 2 67 ? -76.213 148.423 -9.670  1.00 87.63  ? 1110 ARG B CA  1 
ATOM   796 C C   . ARG B 2 67 ? -76.930 147.352 -10.481 1.00 92.27  ? 1110 ARG B C   1 
ATOM   797 O O   . ARG B 2 67 ? -76.317 146.394 -10.952 1.00 95.29  ? 1110 ARG B O   1 
ATOM   798 C CB  . ARG B 2 67 ? -76.175 148.054 -8.185  1.00 87.06  ? 1110 ARG B CB  1 
ATOM   799 C CG  . ARG B 2 67 ? -74.764 148.059 -7.607  1.00 92.49  ? 1110 ARG B CG  1 
ATOM   800 C CD  . ARG B 2 67 ? -74.745 148.537 -6.164  1.00 96.86  ? 1110 ARG B CD  1 
ATOM   801 N NE  . ARG B 2 67 ? -73.385 148.747 -5.670  1.00 99.80  ? 1110 ARG B NE  1 
ATOM   802 C CZ  . ARG B 2 67 ? -72.690 149.867 -5.843  1.00 100.22 ? 1110 ARG B CZ  1 
ATOM   803 N NH1 . ARG B 2 67 ? -73.223 150.892 -6.495  1.00 100.80 ? 1110 ARG B NH1 1 
ATOM   804 N NH2 . ARG B 2 67 ? -71.460 149.965 -5.361  1.00 105.08 ? 1110 ARG B NH2 1 
ATOM   805 N N   . LEU B 2 68 ? -78.230 147.545 -10.672 1.00 85.90  ? 1111 LEU B N   1 
ATOM   806 C CA  . LEU B 2 68 ? -79.021 146.649 -11.503 1.00 92.19  ? 1111 LEU B CA  1 
ATOM   807 C C   . LEU B 2 68 ? -78.567 146.733 -12.962 1.00 100.52 ? 1111 LEU B C   1 
ATOM   808 O O   . LEU B 2 68 ? -78.793 145.809 -13.744 1.00 107.82 ? 1111 LEU B O   1 
ATOM   809 C CB  . LEU B 2 68 ? -80.511 146.988 -11.381 1.00 83.16  ? 1111 LEU B CB  1 
ATOM   810 C CG  . LEU B 2 68 ? -81.511 145.842 -11.552 1.00 85.34  ? 1111 LEU B CG  1 
ATOM   811 N N   . GLN B 2 69 ? -77.897 147.832 -13.314 1.00 102.63 ? 1112 GLN B N   1 
ATOM   812 C CA  . GLN B 2 69 ? -77.498 148.097 -14.700 1.00 109.28 ? 1112 GLN B CA  1 
ATOM   813 C C   . GLN B 2 69 ? -76.322 147.259 -15.187 1.00 117.14 ? 1112 GLN B C   1 
ATOM   814 O O   . GLN B 2 69 ? -75.697 147.596 -16.186 1.00 123.23 ? 1112 GLN B O   1 
ATOM   815 C CB  . GLN B 2 69 ? -77.153 149.579 -14.890 1.00 109.82 ? 1112 GLN B CB  1 
ATOM   816 C CG  . GLN B 2 69 ? -78.226 150.386 -15.606 1.00 113.65 ? 1112 GLN B CG  1 
ATOM   817 C CD  . GLN B 2 69 ? -77.955 151.874 -15.549 1.00 115.06 ? 1112 GLN B CD  1 
ATOM   818 O OE1 . GLN B 2 69 ? -76.831 152.315 -15.777 1.00 119.35 ? 1112 GLN B OE1 1 
ATOM   819 N NE2 . GLN B 2 69 ? -78.984 152.656 -15.240 1.00 113.11 ? 1112 GLN B NE2 1 
ATOM   820 N N   . GLU B 2 70 ? -76.020 146.171 -14.488 1.00 114.78 ? 1113 GLU B N   1 
ATOM   821 C CA  . GLU B 2 70 ? -75.014 145.224 -14.964 1.00 117.51 ? 1113 GLU B CA  1 
ATOM   822 C C   . GLU B 2 70 ? -75.698 143.980 -15.515 1.00 122.08 ? 1113 GLU B C   1 
ATOM   823 O O   . GLU B 2 70 ? -75.395 143.543 -16.619 1.00 129.29 ? 1113 GLU B O   1 
ATOM   824 C CB  . GLU B 2 70 ? -74.027 144.833 -13.854 1.00 117.85 ? 1113 GLU B CB  1 
ATOM   825 C CG  . GLU B 2 70 ? -74.270 143.454 -13.266 1.00 122.16 ? 1113 GLU B CG  1 
ATOM   826 C CD  . GLU B 2 70 ? -73.079 142.926 -12.483 1.00 125.11 ? 1113 GLU B CD  1 
ATOM   827 O OE1 . GLU B 2 70 ? -71.923 143.279 -12.815 1.00 127.90 ? 1113 GLU B OE1 1 
ATOM   828 O OE2 . GLU B 2 70 ? -73.299 142.133 -11.546 1.00 123.47 ? 1113 GLU B OE2 1 
HETATM 829 C C1  . CPS C 3 .  ? -86.834 152.691 -3.374  1.00 44.71  ? 1201 CPS B C1  1 
HETATM 830 C C2  . CPS C 3 .  ? -87.404 151.275 -3.376  1.00 49.45  ? 1201 CPS B C2  1 
HETATM 831 C C3  . CPS C 3 .  ? -86.298 150.906 -5.630  1.00 52.71  ? 1201 CPS B C3  1 
HETATM 832 C C4  . CPS C 3 .  ? -86.423 150.400 -7.079  1.00 53.38  ? 1201 CPS B C4  1 
HETATM 833 C C5  . CPS C 3 .  ? -87.068 149.020 -7.141  1.00 58.79  ? 1201 CPS B C5  1 
HETATM 834 C C6  . CPS C 3 .  ? -88.356 149.042 -6.341  1.00 60.51  ? 1201 CPS B C6  1 
HETATM 835 C C7  . CPS C 3 .  ? -89.016 147.705 -6.646  1.00 72.81  ? 1201 CPS B C7  1 
HETATM 836 C C8  . CPS C 3 .  ? -88.652 147.466 -8.113  1.00 72.40  ? 1201 CPS B C8  1 
HETATM 837 C C9  . CPS C 3 .  ? -87.628 148.542 -8.494  1.00 71.33  ? 1201 CPS B C9  1 
HETATM 838 C C10 . CPS C 3 .  ? -86.127 147.979 -6.533  1.00 61.45  ? 1201 CPS B C10 1 
HETATM 839 C C11 . CPS C 3 .  ? -86.427 150.362 -2.648  1.00 50.97  ? 1201 CPS B C11 1 
HETATM 840 C C12 . CPS C 3 .  ? -87.823 153.725 -3.902  1.00 44.83  ? 1201 CPS B C12 1 
HETATM 841 C C13 . CPS C 3 .  ? -89.139 153.679 -3.126  1.00 48.38  ? 1201 CPS B C13 1 
HETATM 842 C C14 . CPS C 3 .  ? -89.728 152.276 -3.191  1.00 51.81  ? 1201 CPS B C14 1 
HETATM 843 C C15 . CPS C 3 .  ? -88.749 151.234 -2.650  1.00 56.01  ? 1201 CPS B C15 1 
HETATM 844 C C16 . CPS C 3 .  ? -89.357 149.827 -2.679  1.00 60.98  ? 1201 CPS B C16 1 
HETATM 845 C C17 . CPS C 3 .  ? -89.458 149.240 -4.094  1.00 58.37  ? 1201 CPS B C17 1 
HETATM 846 C C18 . CPS C 3 .  ? -88.150 149.382 -4.871  1.00 56.36  ? 1201 CPS B C18 1 
HETATM 847 C C19 . CPS C 3 .  ? -87.594 150.800 -4.821  1.00 50.16  ? 1201 CPS B C19 1 
HETATM 848 C C20 . CPS C 3 .  ? -86.745 148.007 -9.634  1.00 81.84  ? 1201 CPS B C20 1 
HETATM 849 C C21 . CPS C 3 .  ? -85.428 148.738 -9.884  1.00 76.76  ? 1201 CPS B C21 1 
HETATM 850 C C22 . CPS C 3 .  ? -87.586 148.028 -10.915 1.00 93.76  ? 1201 CPS B C22 1 
HETATM 851 C C23 . CPS C 3 .  ? -86.964 147.238 -12.069 1.00 103.89 ? 1201 CPS B C23 1 
HETATM 852 C C24 . CPS C 3 .  ? -87.405 147.785 -13.415 1.00 110.63 ? 1201 CPS B C24 1 
HETATM 853 C C25 . CPS C 3 .  ? -85.359 147.067 -14.527 1.00 120.04 ? 1201 CPS B C25 1 
HETATM 854 C C26 . CPS C 3 .  ? -85.078 146.862 -16.012 1.00 122.29 ? 1201 CPS B C26 1 
HETATM 855 C C27 . CPS C 3 .  ? -84.149 145.678 -16.263 1.00 125.79 ? 1201 CPS B C27 1 
HETATM 856 C C28 . CPS C 3 .  ? -85.370 145.235 -18.286 1.00 131.30 ? 1201 CPS B C28 1 
HETATM 857 C C29 . CPS C 3 .  ? -83.407 146.614 -18.346 1.00 132.26 ? 1201 CPS B C29 1 
HETATM 858 C C30 . CPS C 3 .  ? -83.204 144.255 -17.961 1.00 130.53 ? 1201 CPS B C30 1 
HETATM 859 C C31 . CPS C 3 .  ? -83.088 144.029 -19.464 1.00 130.78 ? 1201 CPS B C31 1 
HETATM 860 C C32 . CPS C 3 .  ? -82.963 142.546 -19.785 1.00 131.91 ? 1201 CPS B C32 1 
HETATM 861 N N1  . CPS C 3 .  ? -86.447 148.005 -14.315 1.00 116.60 ? 1201 CPS B N1  1 
HETATM 862 N N2  . CPS C 3 .  ? -84.032 145.445 -17.712 1.00 130.60 ? 1201 CPS B N2  1 
HETATM 863 O O1  . CPS C 3 .  ? -88.582 148.016 -13.647 1.00 111.14 ? 1201 CPS B O1  1 
HETATM 864 O O2  . CPS C 3 .  ? -90.043 154.619 -3.717  1.00 49.53  ? 1201 CPS B O2  1 
HETATM 865 O O3  . CPS C 3 .  ? -90.518 149.869 -4.823  1.00 64.22  ? 1201 CPS B O3  1 
HETATM 866 O O4  . CPS C 3 .  ? -87.176 151.326 -7.869  1.00 51.52  ? 1201 CPS B O4  1 
HETATM 867 O O2S . CPS C 3 .  ? -84.716 143.392 -21.463 1.00 193.47 ? 1201 CPS B O2S 1 
HETATM 868 O O3S . CPS C 3 .  ? -83.113 141.751 -22.225 1.00 193.58 ? 1201 CPS B O3S 1 
HETATM 869 O O1S . CPS C 3 .  ? -84.875 141.102 -20.707 1.00 193.65 ? 1201 CPS B O1S 1 
HETATM 870 S S   . CPS C 3 .  ? -83.943 142.189 -21.080 1.00 193.98 ? 1201 CPS B S   1 
HETATM 871 S S   . SO4 D 4 .  ? -79.019 156.984 18.515  1.00 107.36 ? 1202 SO4 B S   1 
HETATM 872 O O1  . SO4 D 4 .  ? -80.033 157.790 19.190  1.00 108.17 ? 1202 SO4 B O1  1 
HETATM 873 O O2  . SO4 D 4 .  ? -79.103 157.217 17.078  1.00 105.36 ? 1202 SO4 B O2  1 
HETATM 874 O O3  . SO4 D 4 .  ? -77.693 157.366 18.992  1.00 102.49 ? 1202 SO4 B O3  1 
HETATM 875 O O4  . SO4 D 4 .  ? -79.249 155.567 18.795  1.00 107.22 ? 1202 SO4 B O4  1 
HETATM 876 S S   . SO4 E 4 .  ? -88.845 153.413 1.273   1.00 130.81 ? 1203 SO4 B S   1 
HETATM 877 O O1  . SO4 E 4 .  ? -89.003 153.208 2.711   1.00 131.91 ? 1203 SO4 B O1  1 
HETATM 878 O O2  . SO4 E 4 .  ? -89.921 154.274 0.793   1.00 132.66 ? 1203 SO4 B O2  1 
HETATM 879 O O3  . SO4 E 4 .  ? -87.555 154.043 1.009   1.00 128.63 ? 1203 SO4 B O3  1 
HETATM 880 O O4  . SO4 E 4 .  ? -88.907 152.128 0.584   1.00 130.02 ? 1203 SO4 B O4  1 
HETATM 881 O O   . HOH F 5 .  ? -67.427 156.191 5.213   1.00 83.69  ? 201  HOH A O   1 
HETATM 882 O O   . HOH F 5 .  ? -69.053 167.424 12.543  1.00 39.46  ? 202  HOH A O   1 
HETATM 883 O O   . HOH F 5 .  ? -73.149 167.289 11.091  1.00 50.60  ? 203  HOH A O   1 
HETATM 884 O O   . HOH F 5 .  ? -77.940 171.993 11.469  1.00 58.09  ? 204  HOH A O   1 
HETATM 885 O O   . HOH F 5 .  ? -75.003 169.897 5.224   1.00 45.22  ? 205  HOH A O   1 
HETATM 886 O O   . HOH F 5 .  ? -68.877 169.519 19.443  1.00 41.05  ? 206  HOH A O   1 
HETATM 887 O O   . HOH F 5 .  ? -73.635 158.955 -2.485  1.00 49.63  ? 207  HOH A O   1 
HETATM 888 O O   . HOH F 5 .  ? -72.126 165.231 9.682   1.00 52.41  ? 208  HOH A O   1 
HETATM 889 O O   . HOH F 5 .  ? -73.665 169.777 -3.368  1.00 37.39  ? 209  HOH A O   1 
HETATM 890 O O   . HOH F 5 .  ? -64.712 162.734 14.049  1.00 53.84  ? 210  HOH A O   1 
HETATM 891 O O   . HOH F 5 .  ? -78.417 170.912 2.675   1.00 56.59  ? 211  HOH A O   1 
HETATM 892 O O   . HOH G 5 .  ? -91.674 155.873 0.906   1.00 52.26  ? 1301 HOH B O   1 
HETATM 893 O O   . HOH G 5 .  ? -76.572 167.127 26.154  1.00 48.75  ? 1302 HOH B O   1 
HETATM 894 O O   . HOH G 5 .  ? -85.733 166.024 -0.441  1.00 66.03  ? 1303 HOH B O   1 
HETATM 895 O O   . HOH G 5 .  ? -74.138 156.464 -3.518  1.00 61.42  ? 1304 HOH B O   1 
HETATM 896 O O   . HOH G 5 .  ? -72.744 163.551 20.769  1.00 38.98  ? 1305 HOH B O   1 
HETATM 897 O O   . HOH G 5 .  ? -78.886 162.517 -2.517  1.00 46.25  ? 1306 HOH B O   1 
HETATM 898 O O   . HOH G 5 .  ? -76.451 152.287 9.029   1.00 45.47  ? 1307 HOH B O   1 
HETATM 899 O O   . HOH G 5 .  ? -78.001 149.805 8.194   1.00 74.18  ? 1308 HOH B O   1 
HETATM 900 O O   . HOH G 5 .  ? -81.570 162.118 -3.110  1.00 54.32  ? 1309 HOH B O   1 
HETATM 901 O O   . HOH G 5 .  ? -78.749 152.324 4.782   1.00 56.82  ? 1310 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . GLY A 4  ? 0.7424 0.7589 0.6488 -0.1450 -0.0299 0.0267  93   GLY A N   
2   C CA  . GLY A 4  ? 0.7845 0.7679 0.7186 -0.1181 -0.0308 0.0182  93   GLY A CA  
3   C C   . GLY A 4  ? 0.8273 0.8331 0.7951 -0.0847 -0.0150 -0.0044 93   GLY A C   
4   O O   . GLY A 4  ? 0.8259 0.8589 0.7973 -0.0782 -0.0081 -0.0151 93   GLY A O   
5   N N   . SER A 5  ? 0.6610 0.6560 0.6533 -0.0646 -0.0111 -0.0113 94   SER A N   
6   C CA  . SER A 5  ? 0.5331 0.5490 0.5572 -0.0375 0.0007  -0.0286 94   SER A CA  
7   C C   . SER A 5  ? 0.4447 0.4302 0.4870 -0.0174 0.0004  -0.0308 94   SER A C   
8   O O   . SER A 5  ? 0.5111 0.4728 0.5453 -0.0233 -0.0058 -0.0230 94   SER A O   
9   C CB  . SER A 5  ? 0.5801 0.6561 0.6205 -0.0393 0.0111  -0.0384 94   SER A CB  
10  O OG  . SER A 5  ? 0.5185 0.5949 0.5642 -0.0415 0.0104  -0.0334 94   SER A OG  
11  N N   . VAL A 6  ? 0.4462 0.4368 0.5139 0.0045  0.0064  -0.0421 95   VAL A N   
12  C CA  . VAL A 6  ? 0.4834 0.4526 0.5663 0.0191  0.0073  -0.0415 95   VAL A CA  
13  C C   . VAL A 6  ? 0.4745 0.4594 0.5585 0.0149  0.0075  -0.0353 95   VAL A C   
14  O O   . VAL A 6  ? 0.4482 0.4138 0.5287 0.0161  0.0057  -0.0297 95   VAL A O   
15  C CB  . VAL A 6  ? 0.4905 0.4638 0.6023 0.0398  0.0110  -0.0517 95   VAL A CB  
16  C CG1 . VAL A 6  ? 0.4876 0.5036 0.6216 0.0467  0.0121  -0.0612 95   VAL A CG1 
17  C CG2 . VAL A 6  ? 0.5566 0.5044 0.6775 0.0482  0.0113  -0.0465 95   VAL A CG2 
18  N N   . TRP A 7  ? 0.3812 0.4058 0.4700 0.0091  0.0094  -0.0388 96   TRP A N   
19  C CA  . TRP A 7  ? 0.3923 0.4347 0.4859 0.0073  0.0081  -0.0359 96   TRP A CA  
20  C C   . TRP A 7  ? 0.4250 0.4496 0.4956 -0.0095 0.0039  -0.0251 96   TRP A C   
21  O O   . TRP A 7  ? 0.4079 0.4286 0.4786 -0.0076 0.0012  -0.0211 96   TRP A O   
22  C CB  . TRP A 7  ? 0.3952 0.4907 0.5031 0.0042  0.0106  -0.0478 96   TRP A CB  
23  C CG  . TRP A 7  ? 0.4920 0.6092 0.6278 0.0220  0.0116  -0.0649 96   TRP A CG  
24  C CD1 . TRP A 7  ? 0.4955 0.6490 0.6356 0.0177  0.0165  -0.0793 96   TRP A CD1 
25  C CD2 . TRP A 7  ? 0.4800 0.5844 0.6444 0.0459  0.0055  -0.0700 96   TRP A CD2 
26  N NE1 . TRP A 7  ? 0.4684 0.6345 0.6427 0.0407  0.0134  -0.0973 96   TRP A NE1 
27  C CE2 . TRP A 7  ? 0.5077 0.6399 0.6981 0.0579  0.0052  -0.0904 96   TRP A CE2 
28  C CE3 . TRP A 7  ? 0.4718 0.5443 0.6410 0.0561  -0.0014 -0.0583 96   TRP A CE3 
29  C CZ2 . TRP A 7  ? 0.5778 0.7016 0.8035 0.0812  -0.0042 -0.0999 96   TRP A CZ2 
30  C CZ3 . TRP A 7  ? 0.5652 0.6282 0.7636 0.0755  -0.0101 -0.0630 96   TRP A CZ3 
31  C CH2 . TRP A 7  ? 0.5522 0.6382 0.7811 0.0887  -0.0128 -0.0840 96   TRP A CH2 
32  N N   . GLN A 8  ? 0.3696 0.3830 0.4206 -0.0267 0.0005  -0.0203 97   GLN A N   
33  C CA  . GLN A 8  ? 0.3876 0.3786 0.4212 -0.0428 -0.0089 -0.0115 97   GLN A CA  
34  C C   . GLN A 8  ? 0.4492 0.4016 0.4829 -0.0321 -0.0146 -0.0134 97   GLN A C   
35  O O   . GLN A 8  ? 0.4100 0.3552 0.4417 -0.0353 -0.0205 -0.0131 97   GLN A O   
36  C CB  . GLN A 8  ? 0.4290 0.4127 0.4413 -0.0658 -0.0161 -0.0033 97   GLN A CB  
37  C CG  . GLN A 8  ? 0.3944 0.4283 0.4034 -0.0844 -0.0088 -0.0022 97   GLN A CG  
38  C CD  . GLN A 8  ? 0.4453 0.4765 0.4281 -0.1098 -0.0145 0.0087  97   GLN A CD  
39  O OE1 . GLN A 8  ? 0.4879 0.4844 0.4604 -0.1053 -0.0220 0.0115  97   GLN A OE1 
40  N NE2 . GLN A 8  ? 0.4454 0.5150 0.4170 -0.1375 -0.0114 0.0146  97   GLN A NE2 
41  N N   . LEU A 9  ? 0.4450 0.3773 0.4827 -0.0203 -0.0132 -0.0185 98   LEU A N   
42  C CA  . LEU A 9  ? 0.4686 0.3745 0.5103 -0.0108 -0.0164 -0.0254 98   LEU A CA  
43  C C   . LEU A 9  ? 0.4214 0.3425 0.4726 -0.0011 -0.0081 -0.0258 98   LEU A C   
44  O O   . LEU A 9  ? 0.4835 0.4003 0.5322 -0.0019 -0.0112 -0.0298 98   LEU A O   
45  C CB  . LEU A 9  ? 0.4413 0.3279 0.4888 -0.0004 -0.0153 -0.0330 98   LEU A CB  
46  C CG  . LEU A 9  ? 0.4818 0.3466 0.5160 -0.0096 -0.0279 -0.0319 98   LEU A CG  
47  C CD1 . LEU A 9  ? 0.5989 0.4472 0.6421 0.0040  -0.0268 -0.0424 98   LEU A CD1 
48  C CD2 . LEU A 9  ? 0.5909 0.4291 0.6164 -0.0198 -0.0462 -0.0326 98   LEU A CD2 
49  N N   . ILE A 10 ? 0.4112 0.3507 0.4736 0.0078  -0.0003 -0.0225 99   ILE A N   
50  C CA  . ILE A 10 ? 0.4502 0.4001 0.5181 0.0145  0.0026  -0.0177 99   ILE A CA  
51  C C   . ILE A 10 ? 0.4470 0.4120 0.5061 0.0066  -0.0019 -0.0143 99   ILE A C   
52  O O   . ILE A 10 ? 0.4482 0.4145 0.5016 0.0069  -0.0023 -0.0126 99   ILE A O   
53  C CB  . ILE A 10 ? 0.4639 0.4278 0.5501 0.0259  0.0043  -0.0155 99   ILE A CB  
54  C CG1 . ILE A 10 ? 0.4690 0.4163 0.5676 0.0351  0.0078  -0.0196 99   ILE A CG1 
55  C CG2 . ILE A 10 ? 0.5225 0.4948 0.6119 0.0303  0.0004  -0.0067 99   ILE A CG2 
56  C CD1 . ILE A 10 ? 0.4817 0.4423 0.6051 0.0479  0.0055  -0.0231 99   ILE A CD1 
57  N N   . SER A 11 ? 0.3645 0.3445 0.4217 -0.0023 -0.0050 -0.0143 100  SER A N   
58  C CA  . SER A 11 ? 0.4119 0.4079 0.4644 -0.0101 -0.0098 -0.0128 100  SER A CA  
59  C C   . SER A 11 ? 0.4917 0.4713 0.5342 -0.0171 -0.0166 -0.0169 100  SER A C   
60  O O   . SER A 11 ? 0.4477 0.4389 0.4877 -0.0175 -0.0198 -0.0183 100  SER A O   
61  C CB  . SER A 11 ? 0.4508 0.4696 0.5049 -0.0225 -0.0106 -0.0131 100  SER A CB  
62  O OG  . SER A 11 ? 0.6154 0.6496 0.6677 -0.0310 -0.0157 -0.0131 100  SER A OG  
63  N N   . LYS A 12 ? 0.4706 0.4245 0.5095 -0.0213 -0.0215 -0.0216 101  LYS A N   
64  C CA  . LYS A 12 ? 0.5329 0.4720 0.5702 -0.0242 -0.0319 -0.0321 101  LYS A CA  
65  C C   . LYS A 12 ? 0.4611 0.4086 0.5002 -0.0139 -0.0252 -0.0401 101  LYS A C   
66  O O   . LYS A 12 ? 0.4577 0.4140 0.4968 -0.0152 -0.0307 -0.0509 101  LYS A O   
67  C CB  . LYS A 12 ? 0.5235 0.4300 0.5602 -0.0286 -0.0437 -0.0377 101  LYS A CB  
68  C CG  . LYS A 12 ? 0.6029 0.4988 0.6317 -0.0465 -0.0556 -0.0273 101  LYS A CG  
69  C CD  . LYS A 12 ? 0.8462 0.7019 0.8730 -0.0514 -0.0754 -0.0317 101  LYS A CD  
70  C CE  . LYS A 12 ? 0.9759 0.8154 0.9920 -0.0750 -0.0935 -0.0181 101  LYS A CE  
71  N NZ  . LYS A 12 ? 0.9297 0.7845 0.9510 -0.0841 -0.0985 -0.0183 101  LYS A NZ  
72  N N   . VAL A 13 ? 0.4155 0.3621 0.4568 -0.0058 -0.0144 -0.0363 102  VAL A N   
73  C CA  . VAL A 13 ? 0.4821 0.4406 0.5214 -0.0020 -0.0068 -0.0396 102  VAL A CA  
74  C C   . VAL A 13 ? 0.4622 0.4442 0.4929 -0.0031 -0.0055 -0.0284 102  VAL A C   
75  O O   . VAL A 13 ? 0.4821 0.4818 0.5048 -0.0063 -0.0053 -0.0342 102  VAL A O   
76  C CB  . VAL A 13 ? 0.4783 0.4277 0.5233 0.0040  0.0030  -0.0350 102  VAL A CB  
77  C CG1 . VAL A 13 ? 0.4530 0.4182 0.4918 0.0014  0.0111  -0.0320 102  VAL A CG1 
78  C CG2 . VAL A 13 ? 0.4795 0.4074 0.5331 0.0065  0.0006  -0.0498 102  VAL A CG2 
79  N N   . LEU A 14 ? 0.4242 0.4104 0.4577 -0.0003 -0.0064 -0.0153 103  LEU A N   
80  C CA  . LEU A 14 ? 0.4110 0.4164 0.4384 0.0010  -0.0095 -0.0051 103  LEU A CA  
81  C C   . LEU A 14 ? 0.4732 0.4952 0.4942 -0.0047 -0.0160 -0.0131 103  LEU A C   
82  O O   . LEU A 14 ? 0.4503 0.4898 0.4609 -0.0048 -0.0186 -0.0087 103  LEU A O   
83  C CB  . LEU A 14 ? 0.4292 0.4394 0.4687 0.0075  -0.0128 0.0029  103  LEU A CB  
84  C CG  . LEU A 14 ? 0.4273 0.4245 0.4794 0.0162  -0.0101 0.0086  103  LEU A CG  
85  C CD1 . LEU A 14 ? 0.5111 0.5225 0.5819 0.0244  -0.0162 0.0075  103  LEU A CD1 
86  C CD2 . LEU A 14 ? 0.4880 0.4763 0.5326 0.0170  -0.0102 0.0213  103  LEU A CD2 
87  N N   . ALA A 15 ? 0.4349 0.4501 0.4616 -0.0105 -0.0210 -0.0238 104  ALA A N   
88  C CA  . ALA A 15 ? 0.4486 0.4767 0.4749 -0.0164 -0.0302 -0.0334 104  ALA A CA  
89  C C   . ALA A 15 ? 0.4495 0.4864 0.4717 -0.0163 -0.0323 -0.0492 104  ALA A C   
90  O O   . ALA A 15 ? 0.4483 0.5018 0.4715 -0.0187 -0.0406 -0.0602 104  ALA A O   
91  C CB  . ALA A 15 ? 0.5025 0.5156 0.5369 -0.0261 -0.0387 -0.0375 104  ALA A CB  
92  N N   . ARG A 16 ? 0.4334 0.4645 0.4537 -0.0138 -0.0251 -0.0539 105  ARG A N   
93  C CA  . ARG A 16 ? 0.3945 0.4466 0.4122 -0.0148 -0.0242 -0.0735 105  ARG A CA  
94  C C   . ARG A 16 ? 0.5177 0.5981 0.5158 -0.0174 -0.0148 -0.0623 105  ARG A C   
95  O O   . ARG A 16 ? 0.4912 0.6026 0.4828 -0.0214 -0.0132 -0.0786 105  ARG A O   
96  C CB  . ARG A 16 ? 0.4678 0.5057 0.4958 -0.0129 -0.0215 -0.0892 105  ARG A CB  
97  C CG  . ARG A 16 ? 0.4938 0.5017 0.5391 -0.0116 -0.0370 -0.1031 105  ARG A CG  
98  C CD  . ARG A 16 ? 0.5391 0.5283 0.5947 -0.0072 -0.0356 -0.1154 105  ARG A CD  
99  N NE  . ARG A 16 ? 0.5599 0.5793 0.6187 -0.0062 -0.0270 -0.1370 105  ARG A NE  
100 C CZ  . ARG A 16 ? 0.6110 0.6515 0.6846 -0.0042 -0.0370 -0.1711 105  ARG A CZ  
101 N NH1 . ARG A 16 ? 0.5861 0.6132 0.6741 -0.0019 -0.0593 -0.1857 105  ARG A NH1 
102 N NH2 . ARG A 16 ? 0.7025 0.7811 0.7786 -0.0059 -0.0257 -0.1925 105  ARG A NH2 
103 N N   . HIS A 17 ? 0.4557 0.5274 0.4450 -0.0160 -0.0111 -0.0359 106  HIS A N   
104 C CA  . HIS A 17 ? 0.4364 0.5245 0.4046 -0.0213 -0.0060 -0.0186 106  HIS A CA  
105 C C   . HIS A 17 ? 0.4906 0.5817 0.4478 -0.0189 -0.0149 0.0034  106  HIS A C   
106 O O   . HIS A 17 ? 0.5067 0.6081 0.4425 -0.0255 -0.0159 0.0209  106  HIS A O   
107 C CB  . HIS A 17 ? 0.4501 0.5189 0.4204 -0.0229 0.0031  -0.0072 106  HIS A CB  
108 C CG  . HIS A 17 ? 0.5106 0.5807 0.4916 -0.0251 0.0113  -0.0305 106  HIS A CG  
109 N ND1 . HIS A 17 ? 0.5113 0.6148 0.4840 -0.0347 0.0184  -0.0476 106  HIS A ND1 
110 C CD2 . HIS A 17 ? 0.4792 0.5249 0.4798 -0.0185 0.0114  -0.0428 106  HIS A CD2 
111 C CE1 . HIS A 17 ? 0.5617 0.6606 0.5528 -0.0320 0.0219  -0.0719 106  HIS A CE1 
112 N NE2 . HIS A 17 ? 0.4948 0.5553 0.5015 -0.0220 0.0166  -0.0676 106  HIS A NE2 
113 N N   . PHE A 18 ? 0.4284 0.5116 0.3999 -0.0113 -0.0230 0.0025  107  PHE A N   
114 C CA  . PHE A 18 ? 0.5120 0.5992 0.4816 -0.0057 -0.0341 0.0168  107  PHE A CA  
115 C C   . PHE A 18 ? 0.4608 0.5637 0.4402 -0.0040 -0.0410 0.0021  107  PHE A C   
116 O O   . PHE A 18 ? 0.4704 0.5688 0.4634 -0.0067 -0.0387 -0.0132 107  PHE A O   
117 C CB  . PHE A 18 ? 0.4826 0.5477 0.4695 0.0031  -0.0370 0.0285  107  PHE A CB  
118 C CG  . PHE A 18 ? 0.4818 0.5280 0.4632 0.0023  -0.0353 0.0461  107  PHE A CG  
119 C CD1 . PHE A 18 ? 0.5450 0.5883 0.5112 0.0010  -0.0474 0.0680  107  PHE A CD1 
120 C CD2 . PHE A 18 ? 0.5102 0.5389 0.5022 0.0019  -0.0246 0.0421  107  PHE A CD2 
121 C CE1 . PHE A 18 ? 0.4950 0.5167 0.4577 -0.0030 -0.0488 0.0871  107  PHE A CE1 
122 C CE2 . PHE A 18 ? 0.5227 0.5336 0.5136 0.0001  -0.0239 0.0577  107  PHE A CE2 
123 C CZ  . PHE A 18 ? 0.4957 0.5021 0.4724 -0.0034 -0.0361 0.0811  107  PHE A CZ  
124 N N   . SER A 19 ? 0.4681 0.5868 0.4409 -0.0005 -0.0519 0.0081  108  SER A N   
125 C CA  . SER A 19 ? 0.4500 0.5850 0.4360 0.0013  -0.0595 -0.0048 108  SER A CA  
126 C C   . SER A 19 ? 0.4546 0.5801 0.4653 0.0033  -0.0579 -0.0080 108  SER A C   
127 O O   . SER A 19 ? 0.4170 0.5262 0.4346 0.0075  -0.0539 0.0006  108  SER A O   
128 C CB  . SER A 19 ? 0.5374 0.6899 0.5136 0.0073  -0.0736 0.0030  108  SER A CB  
129 O OG  . SER A 19 ? 0.5954 0.7352 0.5818 0.0168  -0.0819 0.0163  108  SER A OG  
130 N N   . ALA A 20 ? 0.4281 0.6443 0.5562 -0.0545 -0.0444 -0.0693 109  ALA A N   
131 C CA  . ALA A 20 ? 0.4429 0.6563 0.5945 -0.0583 -0.0514 -0.0491 109  ALA A CA  
132 C C   . ALA A 20 ? 0.4641 0.6799 0.5672 -0.0301 -0.0493 -0.0277 109  ALA A C   
133 O O   . ALA A 20 ? 0.4038 0.5891 0.4986 -0.0303 -0.0429 -0.0082 109  ALA A O   
134 C CB  . ALA A 20 ? 0.4159 0.6777 0.6182 -0.0771 -0.0636 -0.0670 109  ALA A CB  
135 N N   . ALA A 21 ? 0.4562 0.7076 0.5301 -0.0036 -0.0600 -0.0357 110  ALA A N   
136 C CA  . ALA A 21 ? 0.4953 0.7489 0.5369 0.0328  -0.0696 -0.0244 110  ALA A CA  
137 C C   . ALA A 21 ? 0.5755 0.7486 0.5610 0.0445  -0.0599 0.0033  110  ALA A C   
138 O O   . ALA A 21 ? 0.5496 0.7089 0.5358 0.0591  -0.0582 0.0120  110  ALA A O   
139 C CB  . ALA A 21 ? 0.4753 0.7680 0.4918 0.0652  -0.0965 -0.0382 110  ALA A CB  
140 N N   . ASP A 22 ? 0.5430 0.6683 0.4828 0.0326  -0.0499 0.0107  111  ASP A N   
141 C CA  . ASP A 22 ? 0.5992 0.6458 0.4832 0.0332  -0.0360 0.0339  111  ASP A CA  
142 C C   . ASP A 22 ? 0.5525 0.5789 0.4796 0.0150  -0.0184 0.0368  111  ASP A C   
143 O O   . ASP A 22 ? 0.5531 0.5354 0.4568 0.0265  -0.0138 0.0522  111  ASP A O   
144 C CB  . ASP A 22 ? 0.5979 0.6108 0.4238 0.0093  -0.0204 0.0328  111  ASP A CB  
145 C CG  . ASP A 22 ? 0.7689 0.7552 0.4992 0.0285  -0.0420 0.0492  111  ASP A CG  
146 O OD1 . ASP A 22 ? 0.8011 0.7739 0.5120 0.0698  -0.0731 0.0647  111  ASP A OD1 
147 O OD2 . ASP A 22 ? 0.7712 0.7496 0.4444 0.0018  -0.0307 0.0434  111  ASP A OD2 
148 N N   . ALA A 23 ? 0.4720 0.5248 0.4605 -0.0118 -0.0145 0.0210  112  ALA A N   
149 C CA  . ALA A 23 ? 0.4173 0.4452 0.4406 -0.0286 -0.0096 0.0253  112  ALA A CA  
150 C C   . ALA A 23 ? 0.5180 0.5539 0.5388 -0.0182 -0.0140 0.0389  112  ALA A C   
151 O O   . ALA A 23 ? 0.4973 0.4985 0.5078 -0.0196 -0.0072 0.0483  112  ALA A O   
152 C CB  . ALA A 23 ? 0.3765 0.4213 0.4646 -0.0535 -0.0208 0.0082  112  ALA A CB  
153 N N   . SER A 24 ? 0.4412 0.5326 0.4761 -0.0111 -0.0231 0.0319  113  SER A N   
154 C CA  . SER A 24 ? 0.4651 0.5859 0.5062 -0.0082 -0.0209 0.0310  113  SER A CA  
155 C C   . SER A 24 ? 0.5168 0.6127 0.5243 0.0296  -0.0196 0.0331  113  SER A C   
156 O O   . SER A 24 ? 0.4941 0.5778 0.4984 0.0288  -0.0109 0.0337  113  SER A O   
157 C CB  . SER A 24 ? 0.4688 0.6694 0.5437 -0.0141 -0.0265 0.0108  113  SER A CB  
158 O OG  . SER A 24 ? 0.5594 0.8059 0.6457 -0.0185 -0.0171 -0.0019 113  SER A OG  
159 N N   . ARG A 25 ? 0.4951 0.5753 0.4718 0.0612  -0.0323 0.0344  114  ARG A N   
160 C CA  . ARG A 25 ? 0.5567 0.5893 0.4949 0.0995  -0.0418 0.0405  114  ARG A CA  
161 C C   . ARG A 25 ? 0.6632 0.6153 0.5692 0.0854  -0.0237 0.0585  114  ARG A C   
162 O O   . ARG A 25 ? 0.6666 0.5897 0.5667 0.1033  -0.0233 0.0565  114  ARG A O   
163 C CB  . ARG A 25 ? 0.6110 0.6186 0.5004 0.1303  -0.0682 0.0483  114  ARG A CB  
164 C CG  . ARG A 25 ? 0.6699 0.7546 0.5958 0.1657  -0.0983 0.0217  114  ARG A CG  
165 C CD  . ARG A 25 ? 0.7972 0.8396 0.6601 0.2046  -0.1388 0.0337  114  ARG A CD  
166 N NE  . ARG A 25 ? 0.9596 1.0177 0.7934 0.1808  -0.1390 0.0386  114  ARG A NE  
167 C CZ  . ARG A 25 ? 1.0507 1.1968 0.9267 0.1859  -0.1555 0.0112  114  ARG A CZ  
168 N NH1 . ARG A 25 ? 1.0910 1.3226 1.0427 0.2111  -0.1706 -0.0242 114  ARG A NH1 
169 N NH2 . ARG A 25 ? 1.1083 1.2656 0.9561 0.1623  -0.1538 0.0113  114  ARG A NH2 
170 N N   . VAL A 26 ? 0.5840 0.5083 0.4805 0.0528  -0.0083 0.0670  115  VAL A N   
171 C CA  . VAL A 26 ? 0.6162 0.4770 0.4938 0.0352  0.0105  0.0745  115  VAL A CA  
172 C C   . VAL A 26 ? 0.6101 0.4855 0.5266 0.0242  0.0162  0.0673  115  VAL A C   
173 O O   . VAL A 26 ? 0.6041 0.4380 0.5058 0.0290  0.0238  0.0681  115  VAL A O   
174 C CB  . VAL A 26 ? 0.6150 0.4640 0.4923 0.0014  0.0268  0.0693  115  VAL A CB  
175 C CG1 . VAL A 26 ? 0.6282 0.4319 0.5068 -0.0204 0.0472  0.0651  115  VAL A CG1 
176 C CG2 . VAL A 26 ? 0.6752 0.5000 0.4878 0.0023  0.0271  0.0774  115  VAL A CG2 
177 N N   . LEU A 27 ? 0.5254 0.4529 0.4832 0.0056  0.0103  0.0613  116  LEU A N   
178 C CA  . LEU A 27 ? 0.5346 0.4722 0.5080 -0.0117 0.0107  0.0596  116  LEU A CA  
179 C C   . LEU A 27 ? 0.6020 0.5606 0.5662 0.0080  0.0155  0.0489  116  LEU A C   
180 O O   . LEU A 27 ? 0.5447 0.4835 0.5010 0.0040  0.0226  0.0440  116  LEU A O   
181 C CB  . LEU A 27 ? 0.4945 0.4702 0.4945 -0.0404 -0.0014 0.0619  116  LEU A CB  
182 C CG  . LEU A 27 ? 0.4783 0.4544 0.4709 -0.0686 -0.0062 0.0678  116  LEU A CG  
183 C CD1 . LEU A 27 ? 0.5163 0.4388 0.5074 -0.0727 -0.0117 0.0702  116  LEU A CD1 
184 C CD2 . LEU A 27 ? 0.5131 0.5047 0.5148 -0.1039 -0.0227 0.0783  116  LEU A CD2 
185 N N   . GLU A 28 ? 0.5544 0.5607 0.5281 0.0311  0.0100  0.0365  117  GLU A N   
186 C CA  . GLU A 28 ? 0.5862 0.6270 0.5711 0.0554  0.0122  0.0107  117  GLU A CA  
187 C C   . GLU A 28 ? 0.5612 0.5295 0.5228 0.0894  0.0088  0.0110  117  GLU A C   
188 O O   . GLU A 28 ? 0.6216 0.5919 0.5919 0.0972  0.0157  -0.0100 117  GLU A O   
189 C CB  . GLU A 28 ? 0.5332 0.6486 0.5498 0.0789  0.0008  -0.0132 117  GLU A CB  
190 C CG  . GLU A 28 ? 0.7103 0.9052 0.7537 0.0371  0.0105  -0.0227 117  GLU A CG  
191 C CD  . GLU A 28 ? 0.8316 1.1169 0.9199 0.0577  0.0025  -0.0588 117  GLU A CD  
192 O OE1 . GLU A 28 ? 1.0130 1.2886 1.1021 0.0910  -0.0205 -0.0551 117  GLU A OE1 
193 O OE2 . GLU A 28 ? 0.7496 1.1208 0.8712 0.0372  0.0194  -0.0948 117  GLU A OE2 
194 N N   . GLN A 29 ? 0.5921 0.4927 0.5184 0.1044  -0.0010 0.0332  118  GLN A N   
195 C CA  . GLN A 29 ? 0.6510 0.4604 0.5400 0.1264  -0.0051 0.0411  118  GLN A CA  
196 C C   . GLN A 29 ? 0.7547 0.5233 0.6388 0.0955  0.0178  0.0427  118  GLN A C   
197 O O   . GLN A 29 ? 0.7485 0.4732 0.6276 0.1092  0.0194  0.0316  118  GLN A O   
198 C CB  . GLN A 29 ? 0.7568 0.4949 0.5865 0.1323  -0.0169 0.0702  118  GLN A CB  
199 C CG  . GLN A 29 ? 0.8863 0.5099 0.6599 0.1468  -0.0239 0.0858  118  GLN A CG  
200 C CD  . GLN A 29 ? 0.9740 0.5799 0.7571 0.2053  -0.0612 0.0708  118  GLN A CD  
201 O OE1 . GLN A 29 ? 0.9334 0.5742 0.7235 0.2398  -0.0933 0.0659  118  GLN A OE1 
202 N NE2 . GLN A 29 ? 0.9442 0.4999 0.7370 0.2193  -0.0609 0.0561  118  GLN A NE2 
203 N N   . LEU A 30 ? 0.6804 0.4644 0.5733 0.0567  0.0304  0.0509  119  LEU A N   
204 C CA  . LEU A 30 ? 0.6421 0.4005 0.5415 0.0289  0.0445  0.0462  119  LEU A CA  
205 C C   . LEU A 30 ? 0.6259 0.4221 0.5444 0.0272  0.0454  0.0259  119  LEU A C   
206 O O   . LEU A 30 ? 0.6351 0.3984 0.5507 0.0232  0.0534  0.0135  119  LEU A O   
207 C CB  . LEU A 30 ? 0.6124 0.3910 0.5338 -0.0036 0.0450  0.0507  119  LEU A CB  
208 C CG  . LEU A 30 ? 0.7148 0.4724 0.6557 -0.0297 0.0509  0.0397  119  LEU A CG  
209 C CD1 . LEU A 30 ? 0.7532 0.4518 0.6738 -0.0385 0.0721  0.0361  119  LEU A CD1 
210 C CD2 . LEU A 30 ? 0.7860 0.5762 0.7666 -0.0499 0.0348  0.0372  119  LEU A CD2 
211 N N   . GLN A 31 ? 0.5396 0.4084 0.4742 0.0226  0.0401  0.0193  120  GLN A N   
212 C CA  . GLN A 31 ? 0.5641 0.4797 0.5037 0.0086  0.0462  -0.0027 120  GLN A CA  
213 C C   . GLN A 31 ? 0.6248 0.5416 0.5749 0.0436  0.0517  -0.0354 120  GLN A C   
214 O O   . GLN A 31 ? 0.5704 0.4932 0.5212 0.0366  0.0610  -0.0603 120  GLN A O   
215 C CB  . GLN A 31 ? 0.5921 0.5841 0.5372 -0.0160 0.0451  -0.0034 120  GLN A CB  
216 C CG  . GLN A 31 ? 0.5663 0.5459 0.5011 -0.0542 0.0318  0.0259  120  GLN A CG  
217 C CD  . GLN A 31 ? 0.6237 0.6617 0.5538 -0.0866 0.0310  0.0295  120  GLN A CD  
218 O OE1 . GLN A 31 ? 0.6853 0.7852 0.6334 -0.0766 0.0428  0.0082  120  GLN A OE1 
219 N NE2 . GLN A 31 ? 0.5445 0.5603 0.4516 -0.1275 0.0136  0.0541  120  GLN A NE2 
220 N N   . ARG A 32 ? 0.5874 0.4968 0.5479 0.0841  0.0404  -0.0392 121  ARG A N   
221 C CA  . ARG A 32 ? 0.7461 0.6427 0.7265 0.1282  0.0330  -0.0733 121  ARG A CA  
222 C C   . ARG A 32 ? 0.7529 0.5433 0.7089 0.1359  0.0333  -0.0659 121  ARG A C   
223 O O   . ARG A 32 ? 0.7078 0.4933 0.6836 0.1498  0.0366  -0.1019 121  ARG A O   
224 C CB  . ARG A 32 ? 0.8061 0.7077 0.8012 0.1753  0.0064  -0.0764 121  ARG A CB  
225 C CG  . ARG A 32 ? 0.9362 0.7926 0.9513 0.2322  -0.0180 -0.1062 121  ARG A CG  
226 C CD  . ARG A 32 ? 1.0560 0.9798 1.1195 0.2797  -0.0474 -0.1382 121  ARG A CD  
227 N NE  . ARG A 32 ? 1.1080 1.0698 1.1566 0.2637  -0.0512 -0.1091 121  ARG A NE  
228 C CZ  . ARG A 32 ? 1.1883 1.2407 1.2852 0.2875  -0.0684 -0.1392 121  ARG A CZ  
229 N NH1 . ARG A 32 ? 1.2187 1.3403 1.3889 0.3305  -0.0837 -0.2037 121  ARG A NH1 
230 N NH2 . ARG A 32 ? 1.1897 1.2709 1.2713 0.2685  -0.0706 -0.1134 121  ARG A NH2 
231 N N   . ASP A 33 ? 0.7609 0.4707 0.6764 0.1220  0.0331  -0.0260 122  ASP A N   
232 C CA  . ASP A 33 ? 0.8958 0.5026 0.7834 0.1151  0.0401  -0.0189 122  ASP A CA  
233 C C   . ASP A 33 ? 0.8731 0.5029 0.7797 0.0836  0.0596  -0.0419 122  ASP A C   
234 O O   . ASP A 33 ? 0.8421 0.4263 0.7532 0.0892  0.0640  -0.0647 122  ASP A O   
235 C CB  . ASP A 33 ? 0.8984 0.4369 0.7388 0.0887  0.0472  0.0203  122  ASP A CB  
236 C CG  . ASP A 33 ? 1.0370 0.5290 0.8342 0.1152  0.0248  0.0475  122  ASP A CG  
237 O OD1 . ASP A 33 ? 0.9994 0.4836 0.8040 0.1631  -0.0042 0.0369  122  ASP A OD1 
238 O OD2 . ASP A 33 ? 1.0705 0.5362 0.8273 0.0879  0.0337  0.0746  122  ASP A OD2 
239 N N   . TYR A 34 ? 0.7156 0.4100 0.6314 0.0505  0.0657  -0.0359 123  TYR A N   
240 C CA  . TYR A 34 ? 0.7156 0.4330 0.6405 0.0195  0.0732  -0.0530 123  TYR A CA  
241 C C   . TYR A 34 ? 0.7181 0.4804 0.6560 0.0287  0.0771  -0.0938 123  TYR A C   
242 O O   . TYR A 34 ? 0.7355 0.4765 0.6775 0.0211  0.0840  -0.1195 123  TYR A O   
243 C CB  . TYR A 34 ? 0.6909 0.4594 0.6171 -0.0112 0.0642  -0.0344 123  TYR A CB  
244 C CG  . TYR A 34 ? 0.6971 0.4846 0.6229 -0.0415 0.0574  -0.0463 123  TYR A CG  
245 C CD1 . TYR A 34 ? 0.8226 0.5739 0.7632 -0.0577 0.0538  -0.0496 123  TYR A CD1 
246 C CD2 . TYR A 34 ? 0.6986 0.5443 0.6062 -0.0580 0.0529  -0.0572 123  TYR A CD2 
247 C CE1 . TYR A 34 ? 0.8187 0.5879 0.7603 -0.0802 0.0366  -0.0628 123  TYR A CE1 
248 C CE2 . TYR A 34 ? 0.7729 0.6279 0.6628 -0.0874 0.0384  -0.0632 123  TYR A CE2 
249 C CZ  . TYR A 34 ? 0.7798 0.5946 0.6889 -0.0938 0.0256  -0.0652 123  TYR A CZ  
250 O OH  . TYR A 34 ? 0.8037 0.6284 0.6964 -0.1179 0.0011  -0.0736 123  TYR A OH  
251 N N   . GLU A 35 ? 0.6999 0.5334 0.6495 0.0422  0.0756  -0.1084 124  GLU A N   
252 C CA  . GLU A 35 ? 0.7114 0.6109 0.6781 0.0433  0.0858  -0.1590 124  GLU A CA  
253 C C   . GLU A 35 ? 0.8274 0.6793 0.8245 0.0873  0.0835  -0.1976 124  GLU A C   
254 O O   . GLU A 35 ? 0.8675 0.7412 0.8795 0.0836  0.0937  -0.2436 124  GLU A O   
255 C CB  . GLU A 35 ? 0.7558 0.7569 0.7341 0.0375  0.0907  -0.1733 124  GLU A CB  
256 C CG  . GLU A 35 ? 0.9988 1.0882 0.9591 -0.0077 0.1096  -0.2065 124  GLU A CG  
257 C CD  . GLU A 35 ? 1.1231 1.1960 1.0250 -0.0622 0.1021  -0.1646 124  GLU A CD  
258 O OE1 . GLU A 35 ? 1.0126 1.0637 0.8987 -0.0760 0.0875  -0.1173 124  GLU A OE1 
259 O OE2 . GLU A 35 ? 1.2332 1.3126 1.1075 -0.0887 0.1055  -0.1828 124  GLU A OE2 
260 N N   . ARG A 36 ? 0.8365 0.6149 0.8372 0.1274  0.0659  -0.1786 125  ARG A N   
261 C CA  . ARG A 36 ? 0.9078 0.6054 0.9271 0.1693  0.0525  -0.2047 125  ARG A CA  
262 C C   . ARG A 36 ? 0.9079 0.5223 0.9067 0.1433  0.0646  -0.2017 125  ARG A C   
263 O O   . ARG A 36 ? 0.9164 0.5039 0.9413 0.1588  0.0647  -0.2459 125  ARG A O   
264 C CB  . ARG A 36 ? 0.9209 0.5328 0.9230 0.2106  0.0221  -0.1709 125  ARG A CB  
265 C CG  . ARG A 36 ? 1.1958 0.6872 1.2002 0.2520  -0.0030 -0.1845 125  ARG A CG  
266 C CD  . ARG A 36 ? 1.3874 0.7860 1.3556 0.2915  -0.0438 -0.1442 125  ARG A CD  
267 N N   . SER A 37 ? 0.9160 0.4956 0.8779 0.1040  0.0746  -0.1576 126  SER A N   
268 C CA  . SER A 37 ? 1.0581 0.5735 1.0092 0.0721  0.0887  -0.1595 126  SER A CA  
269 C C   . SER A 37 ? 0.9629 0.5467 0.9377 0.0517  0.0994  -0.2058 126  SER A C   
270 O O   . SER A 37 ? 1.0498 0.5883 1.0363 0.0456  0.1064  -0.2364 126  SER A O   
271 C CB  . SER A 37 ? 1.1026 0.6015 1.0285 0.0335  0.0977  -0.1180 126  SER A CB  
272 O OG  . SER A 37 ? 1.1996 0.6200 1.0895 0.0420  0.0935  -0.0795 126  SER A OG  
273 N N   . LEU A 38 ? 0.8703 0.5585 0.8441 0.0357  0.0996  -0.2101 127  LEU A N   
274 C CA  . LEU A 38 ? 0.9374 0.6941 0.9128 0.0103  0.1064  -0.2507 127  LEU A CA  
275 C C   . LEU A 38 ? 0.9799 0.7636 0.9878 0.0371  0.1138  -0.3139 127  LEU A C   
276 O O   . LEU A 38 ? 0.9786 0.7792 0.9938 0.0222  0.1219  -0.3591 127  LEU A O   
277 C CB  . LEU A 38 ? 0.9597 0.8063 0.9061 -0.0201 0.1021  -0.2331 127  LEU A CB  
278 C CG  . LEU A 38 ? 0.9850 0.8131 0.9090 -0.0484 0.0864  -0.1844 127  LEU A CG  
279 C CD1 . LEU A 38 ? 0.9638 0.8620 0.8510 -0.0783 0.0759  -0.1657 127  LEU A CD1 
280 C CD2 . LEU A 38 ? 1.0402 0.8366 0.9688 -0.0691 0.0806  -0.1987 127  LEU A CD2 
281 N N   . SER A 39 ? 1.0078 0.8021 1.0428 0.0786  0.1079  -0.3248 128  SER A N   
282 C CA  . SER A 39 ? 1.0883 0.9198 1.1750 0.1128  0.1102  -0.3979 128  SER A CA  
283 C C   . SER A 39 ? 1.0898 0.8090 1.2009 0.1392  0.1014  -0.4218 128  SER A C   
284 O O   . SER A 39 ? 1.1252 0.8730 1.2716 0.1460  0.1070  -0.4842 128  SER A O   
285 C CB  . SER A 39 ? 1.1574 1.0298 1.2817 0.1575  0.0970  -0.4093 128  SER A CB  
286 O OG  . SER A 39 ? 1.1766 1.1561 1.2813 0.1257  0.1097  -0.3942 128  SER A OG  
287 N N   . ARG A 40 ? 1.1597 0.7512 1.2442 0.1466  0.0879  -0.3672 129  ARG A N   
288 C CA  . ARG A 40 ? 1.3126 0.7794 1.3971 0.1597  0.0777  -0.3705 129  ARG A CA  
289 C C   . ARG A 40 ? 1.3053 0.7682 1.3786 0.1129  0.0962  -0.3830 129  ARG A C   
290 O O   . ARG A 40 ? 1.4448 0.8362 1.5158 0.1151  0.0894  -0.3911 129  ARG A O   
291 C CB  . ARG A 40 ? 1.3993 0.7316 1.4335 0.1672  0.0609  -0.3018 129  ARG A CB  
292 C CG  . ARG A 40 ? 1.4216 0.7403 1.4624 0.2196  0.0311  -0.2848 129  ARG A CG  
293 C CD  . ARG A 40 ? 1.4956 0.7029 1.4777 0.2090  0.0206  -0.2095 129  ARG A CD  
294 N N   . LEU A 41 ? 1.2488 0.6530 1.1357 0.1035  0.2414  -0.2657 130  LEU A N   
295 C CA  . LEU A 41 ? 1.2974 0.6519 1.1306 0.0884  0.2194  -0.2754 130  LEU A CA  
296 C C   . LEU A 41 ? 1.4212 0.7116 1.2105 0.1142  0.1916  -0.3106 130  LEU A C   
297 O O   . LEU A 41 ? 1.4509 0.7630 1.2309 0.1488  0.2061  -0.3262 130  LEU A O   
298 C CB  . LEU A 41 ? 1.3059 0.7152 1.1155 0.0821  0.2469  -0.2637 130  LEU A CB  
299 C CG  . LEU A 41 ? 1.3200 0.7163 1.1035 0.0503  0.2378  -0.2568 130  LEU A CG  
300 C CD1 . LEU A 41 ? 1.2553 0.6446 1.0873 0.0168  0.2273  -0.2418 130  LEU A CD1 
301 C CD2 . LEU A 41 ? 1.2555 0.7155 1.0282 0.0516  0.2699  -0.2387 130  LEU A CD2 
302 N N   . THR A 42 ? 1.5255 0.7401 1.2961 0.0936  0.1505  -0.3252 131  THR A N   
303 C CA  . THR A 42 ? 1.5138 0.6692 1.2569 0.1124  0.1200  -0.3685 131  THR A CA  
304 C C   . THR A 42 ? 1.5372 0.6727 1.2275 0.0917  0.1033  -0.3881 131  THR A C   
305 O O   . THR A 42 ? 1.5522 0.7060 1.2268 0.0599  0.1077  -0.3645 131  THR A O   
306 C CB  . THR A 42 ? 1.7177 0.7934 1.5025 0.1033  0.0805  -0.3764 131  THR A CB  
307 O OG1 . THR A 42 ? 1.8195 0.8537 1.6202 0.0494  0.0518  -0.3519 131  THR A OG1 
308 C CG2 . THR A 42 ? 1.6966 0.7900 1.5214 0.1277  0.0962  -0.3553 131  THR A CG2 
309 N N   . LEU A 43 ? 1.6315 0.7338 1.2925 0.1088  0.0874  -0.4353 132  LEU A N   
310 C CA  . LEU A 43 ? 1.6943 0.7768 1.2944 0.0907  0.0673  -0.4622 132  LEU A CA  
311 C C   . LEU A 43 ? 1.6935 0.7220 1.3103 0.0298  0.0219  -0.4502 132  LEU A C   
312 O O   . LEU A 43 ? 1.6751 0.7124 1.2459 0.0012  0.0048  -0.4487 132  LEU A O   
313 C CB  . LEU A 43 ? 1.7770 0.8275 1.3423 0.1153  0.0609  -0.5186 132  LEU A CB  
314 C CG  . LEU A 43 ? 1.8298 0.9419 1.3550 0.1677  0.1037  -0.5302 132  LEU A CG  
315 N N   . ASP A 44 ? 1.6651 0.6434 1.3497 0.0085  0.0027  -0.4369 133  ASP A N   
316 C CA  . ASP A 44 ? 1.7456 0.6802 1.4653 -0.0561 -0.0383 -0.4099 133  ASP A CA  
317 C C   . ASP A 44 ? 1.6739 0.6595 1.3906 -0.0889 -0.0321 -0.3602 133  ASP A C   
318 O O   . ASP A 44 ? 1.6928 0.6801 1.3987 -0.1428 -0.0679 -0.3475 133  ASP A O   
319 C CB  . ASP A 44 ? 1.8652 0.7448 1.6576 -0.0637 -0.0418 -0.3889 133  ASP A CB  
320 C CG  . ASP A 44 ? 1.8657 0.7150 1.7033 -0.1311 -0.0791 -0.3415 133  ASP A CG  
321 N N   . ASP A 45 ? 1.5576 0.5956 1.2865 -0.0602 0.0154  -0.3333 134  ASP A N   
322 C CA  . ASP A 45 ? 1.4833 0.5838 1.2214 -0.0904 0.0392  -0.2903 134  ASP A CA  
323 C C   . ASP A 45 ? 1.4488 0.6164 1.1307 -0.0901 0.0481  -0.2968 134  ASP A C   
324 O O   . ASP A 45 ? 1.4127 0.6647 1.1209 -0.1259 0.0326  -0.2584 134  ASP A O   
325 C CB  . ASP A 45 ? 1.4416 0.5961 1.2194 -0.0562 0.0923  -0.2707 134  ASP A CB  
326 C CG  . ASP A 45 ? 1.5989 0.7195 1.4370 -0.0475 0.0807  -0.2554 134  ASP A CG  
327 O OD1 . ASP A 45 ? 1.6407 0.7009 1.5079 -0.0856 0.0392  -0.2366 134  ASP A OD1 
328 O OD2 . ASP A 45 ? 1.6621 0.8197 1.5188 -0.0044 0.1116  -0.2582 134  ASP A OD2 
329 N N   . ILE A 46 ? 1.4889 0.6355 1.0978 -0.0433 0.0732  -0.3392 135  ILE A N   
330 C CA  . ILE A 46 ? 1.5736 0.7704 1.1141 -0.0326 0.0881  -0.3452 135  ILE A CA  
331 C C   . ILE A 46 ? 1.6157 0.8208 1.1371 -0.0725 0.0247  -0.3551 135  ILE A C   
332 O O   . ILE A 46 ? 1.5917 0.8843 1.1089 -0.0904 0.0178  -0.3286 135  ILE A O   
333 C CB  . ILE A 46 ? 1.6782 0.8987 1.1767 0.0315  0.1215  -0.3677 135  ILE A CB  
334 C CG1 . ILE A 46 ? 1.6463 0.9215 1.2040 0.0612  0.1706  -0.3379 135  ILE A CG1 
335 C CG2 . ILE A 46 ? 1.7534 1.0190 1.1753 0.0472  0.1356  -0.3690 135  ILE A CG2 
336 C CD1 . ILE A 46 ? 1.6698 0.9894 1.2044 0.1097  0.2022  -0.3427 135  ILE A CD1 
337 N N   . GLU A 47 ? 1.6542 0.7700 1.1691 -0.0863 -0.0226 -0.3956 136  GLU A N   
338 C CA  . GLU A 47 ? 1.6794 0.7966 1.1931 -0.1335 -0.0895 -0.4123 136  GLU A CA  
339 C C   . GLU A 47 ? 1.6780 0.8711 1.2805 -0.2002 -0.1170 -0.3489 136  GLU A C   
340 O O   . GLU A 47 ? 1.7146 0.9881 1.3147 -0.2305 -0.1454 -0.3374 136  GLU A O   
341 C CB  . GLU A 47 ? 1.7589 0.7707 1.2822 -0.1383 -0.1318 -0.4638 136  GLU A CB  
342 N N   . ARG A 48 ? 1.6420 0.8205 1.3213 -0.2178 -0.1070 -0.3058 137  ARG A N   
343 C CA  . ARG A 48 ? 1.5393 0.7962 1.3039 -0.2740 -0.1274 -0.2384 137  ARG A CA  
344 C C   . ARG A 48 ? 1.4882 0.8836 1.2471 -0.2659 -0.0978 -0.1997 137  ARG A C   
345 O O   . ARG A 48 ? 1.5071 0.9933 1.3050 -0.3089 -0.1245 -0.1597 137  ARG A O   
346 C CB  . ARG A 48 ? 1.5479 0.7679 1.3836 -0.2776 -0.1149 -0.1996 137  ARG A CB  
347 C CG  . ARG A 48 ? 1.5642 0.8614 1.4880 -0.3323 -0.1369 -0.1251 137  ARG A CG  
348 N N   . LEU A 49 ? 1.3802 0.7905 1.0941 -0.2101 -0.0416 -0.2114 138  LEU A N   
349 C CA  . LEU A 49 ? 1.2685 0.7893 0.9692 -0.1931 -0.0091 -0.1835 138  LEU A CA  
350 C C   . LEU A 49 ? 1.3239 0.9041 0.9757 -0.2019 -0.0359 -0.1915 138  LEU A C   
351 O O   . LEU A 49 ? 1.3377 1.0251 1.0135 -0.2204 -0.0437 -0.1522 138  LEU A O   
352 C CB  . LEU A 49 ? 1.2457 0.7471 0.9047 -0.1333 0.0561  -0.2029 138  LEU A CB  
353 C CG  . LEU A 49 ? 1.1330 0.6664 0.8520 -0.1216 0.0967  -0.1761 138  LEU A CG  
354 C CD1 . LEU A 49 ? 1.1574 0.6760 0.8389 -0.0702 0.1605  -0.1976 138  LEU A CD1 
355 C CD2 . LEU A 49 ? 1.0559 0.7048 0.8267 -0.1473 0.0871  -0.1266 138  LEU A CD2 
356 N N   . ALA A 50 ? 1.4591 0.9784 1.0401 -0.1830 -0.0505 -0.2445 139  ALA A N   
357 C CA  . ALA A 50 ? 1.5081 1.0885 1.0344 -0.1827 -0.0778 -0.2598 139  ALA A CA  
358 C C   . ALA A 50 ? 1.5571 1.2005 1.1459 -0.2524 -0.1413 -0.2376 139  ALA A C   
359 O O   . ALA A 50 ? 1.5914 1.3397 1.1670 -0.2597 -0.1575 -0.2225 139  ALA A O   
360 C CB  . ALA A 50 ? 1.6042 1.1083 1.0433 -0.1460 -0.0861 -0.3267 139  ALA A CB  
361 N N   . SER A 51 ? 1.5440 1.1261 1.2043 -0.3026 -0.1751 -0.2318 140  SER A N   
362 C CA  . SER A 51 ? 1.5455 1.1800 1.2799 -0.3766 -0.2325 -0.2044 140  SER A CA  
363 C C   . SER A 51 ? 1.4389 1.2069 1.2352 -0.3975 -0.2191 -0.1279 140  SER A C   
364 O O   . SER A 51 ? 1.4377 1.3033 1.2766 -0.4448 -0.2560 -0.0993 140  SER A O   
365 C CB  . SER A 51 ? 1.6132 1.1310 1.4111 -0.4219 -0.2663 -0.2115 140  SER A CB  
366 N N   . ARG A 52 ? 1.3564 1.1362 1.1586 -0.3604 -0.1670 -0.0984 141  ARG A N   
367 C CA  . ARG A 52 ? 1.2651 1.1676 1.1235 -0.3710 -0.1526 -0.0318 141  ARG A CA  
368 C C   . ARG A 52 ? 1.2366 1.2703 1.0603 -0.3527 -0.1472 -0.0185 141  ARG A C   
369 O O   . ARG A 52 ? 1.2297 1.3834 1.1045 -0.3842 -0.1662 0.0305  141  ARG A O   
370 C CB  . ARG A 52 ? 1.1553 1.0374 1.0236 -0.3296 -0.1003 -0.0186 141  ARG A CB  
371 C CG  . ARG A 52 ? 1.0776 0.9261 1.0237 -0.3570 -0.1075 0.0172  141  ARG A CG  
372 C CD  . ARG A 52 ? 1.0000 0.8547 0.9548 -0.3114 -0.0578 0.0240  141  ARG A CD  
373 N NE  . ARG A 52 ? 0.9987 0.9922 0.9909 -0.3076 -0.0453 0.0733  141  ARG A NE  
374 C CZ  . ARG A 52 ? 0.9215 0.9515 0.9332 -0.2728 -0.0095 0.0809  141  ARG A CZ  
375 N NH1 . ARG A 52 ? 0.9465 0.8892 0.9492 -0.2423 0.0192  0.0463  141  ARG A NH1 
376 N NH2 . ARG A 52 ? 0.7921 0.9536 0.8337 -0.2666 -0.0036 0.1195  141  ARG A NH2 
377 N N   . PHE A 53 ? 1.2611 1.2750 0.9975 -0.2978 -0.1193 -0.0581 142  PHE A N   
378 C CA  . PHE A 53 ? 1.1752 1.2997 0.8711 -0.2624 -0.1007 -0.0423 142  PHE A CA  
379 C C   . PHE A 53 ? 1.2256 1.4077 0.8792 -0.2705 -0.1408 -0.0620 142  PHE A C   
380 O O   . PHE A 53 ? 1.2265 1.5386 0.9031 -0.2867 -0.1621 -0.0290 142  PHE A O   
381 C CB  . PHE A 53 ? 1.0595 1.1332 0.6904 -0.1925 -0.0380 -0.0626 142  PHE A CB  
382 C CG  . PHE A 53 ? 0.9827 1.0379 0.6616 -0.1816 0.0017  -0.0433 142  PHE A CG  
383 C CD1 . PHE A 53 ? 1.0308 0.9915 0.7446 -0.1957 0.0053  -0.0563 142  PHE A CD1 
384 C CD2 . PHE A 53 ? 0.9436 1.0811 0.6340 -0.1544 0.0326  -0.0158 142  PHE A CD2 
385 C CE1 . PHE A 53 ? 0.9728 0.9328 0.7338 -0.1839 0.0382  -0.0412 142  PHE A CE1 
386 C CE2 . PHE A 53 ? 0.8152 0.9461 0.5528 -0.1444 0.0639  -0.0066 142  PHE A CE2 
387 C CZ  . PHE A 53 ? 0.9006 0.9487 0.6746 -0.1598 0.0663  -0.0187 142  PHE A CZ  
388 N N   . LEU A 54 ? 1.2231 1.3184 0.8138 -0.2549 -0.1517 -0.1178 143  LEU A N   
389 C CA  . LEU A 54 ? 1.3760 1.5271 0.9172 -0.2541 -0.1914 -0.1477 143  LEU A CA  
390 C C   . LEU A 54 ? 1.3528 1.4536 0.9325 -0.3171 -0.2556 -0.1850 143  LEU A C   
391 O O   . LEU A 54 ? 1.2582 1.3842 0.9334 -0.3864 -0.2899 -0.1539 143  LEU A O   
392 C CB  . LEU A 54 ? 1.4094 1.5195 0.8353 -0.1752 -0.1538 -0.1852 143  LEU A CB  
393 C CG  . LEU A 54 ? 1.3698 1.5257 0.7619 -0.1154 -0.0914 -0.1471 143  LEU A CG  
394 C CD1 . LEU A 54 ? 1.4303 1.5233 0.7189 -0.0395 -0.0431 -0.1732 143  LEU A CD1 
395 C CD2 . LEU A 54 ? 1.3889 1.6979 0.7912 -0.1169 -0.1102 -0.1100 143  LEU A CD2 
396 N N   . GLU B 15 ? 2.3275 1.1391 1.5419 -0.0117 -0.1752 -0.0089 1058 GLU B N   
397 C CA  . GLU B 15 ? 2.3731 1.1688 1.5614 -0.0738 -0.1567 -0.0074 1058 GLU B CA  
398 C C   . GLU B 15 ? 2.2298 1.1269 1.5044 -0.0494 -0.1277 -0.0350 1058 GLU B C   
399 O O   . GLU B 15 ? 2.2528 1.1148 1.5197 -0.0323 -0.1451 -0.0566 1058 GLU B O   
400 C CB  . GLU B 15 ? 2.4058 1.2137 1.5615 -0.1582 -0.1218 0.0187  1058 GLU B CB  
401 C CG  . GLU B 15 ? 2.4346 1.2638 1.5883 -0.2272 -0.0954 0.0159  1058 GLU B CG  
402 C CD  . GLU B 15 ? 2.5905 1.3539 1.6536 -0.2953 -0.1082 0.0383  1058 GLU B CD  
403 O OE1 . GLU B 15 ? 2.6729 1.3932 1.6753 -0.3091 -0.1221 0.0587  1058 GLU B OE1 
404 O OE2 . GLU B 15 ? 2.6258 1.3809 1.6753 -0.3355 -0.1064 0.0345  1058 GLU B OE2 
405 N N   . GLY B 16 ? 2.0465 1.0867 1.4091 -0.0478 -0.0855 -0.0341 1059 GLY B N   
406 C CA  . GLY B 16 ? 1.8810 1.0404 1.3318 -0.0279 -0.0604 -0.0549 1059 GLY B CA  
407 C C   . GLY B 16 ? 1.6849 0.9787 1.2237 -0.0142 -0.0295 -0.0504 1059 GLY B C   
408 O O   . GLY B 16 ? 1.6779 0.9742 1.2115 -0.0168 -0.0259 -0.0339 1059 GLY B O   
409 N N   . PRO B 17 ? 1.5127 0.9119 1.1270 -0.0012 -0.0115 -0.0645 1060 PRO B N   
410 C CA  . PRO B 17 ? 1.3654 0.8855 1.0622 0.0073  0.0106  -0.0593 1060 PRO B CA  
411 C C   . PRO B 17 ? 1.2265 0.7828 0.9389 -0.0485 0.0316  -0.0481 1060 PRO B C   
412 O O   . PRO B 17 ? 1.2472 0.7932 0.9474 -0.0968 0.0389  -0.0526 1060 PRO B O   
413 C CB  . PRO B 17 ? 1.3025 0.8991 1.0533 0.0202  0.0162  -0.0753 1060 PRO B CB  
414 C CG  . PRO B 17 ? 1.3942 0.9264 1.0985 -0.0061 0.0076  -0.0865 1060 PRO B CG  
415 C CD  . PRO B 17 ? 1.5148 0.9188 1.1341 -0.0018 -0.0145 -0.0841 1060 PRO B CD  
416 N N   . GLN B 18 ? 1.1398 0.7405 0.8800 -0.0423 0.0412  -0.0378 1061 GLN B N   
417 C CA  . GLN B 18 ? 1.0523 0.6931 0.8072 -0.0926 0.0632  -0.0346 1061 GLN B CA  
418 C C   . GLN B 18 ? 0.8877 0.6421 0.7357 -0.1076 0.0772  -0.0508 1061 GLN B C   
419 O O   . GLN B 18 ? 0.8023 0.6297 0.7176 -0.0724 0.0721  -0.0536 1061 GLN B O   
420 C CB  . GLN B 18 ? 1.0161 0.6687 0.7711 -0.0771 0.0663  -0.0224 1061 GLN B CB  
421 C CG  . GLN B 18 ? 1.0478 0.7408 0.8086 -0.1303 0.0919  -0.0248 1061 GLN B CG  
422 C CD  . GLN B 18 ? 1.2126 0.8341 0.8953 -0.1965 0.1008  -0.0231 1061 GLN B CD  
423 O OE1 . GLN B 18 ? 1.1305 0.8122 0.8482 -0.2456 0.1237  -0.0399 1061 GLN B OE1 
424 N NE2 . GLN B 18 ? 1.3763 0.8670 0.9535 -0.1998 0.0787  -0.0043 1061 GLN B NE2 
425 N N   . LEU B 19 ? 0.8052 0.5719 0.6568 -0.1621 0.0906  -0.0622 1062 LEU B N   
426 C CA  . LEU B 19 ? 0.6596 0.5263 0.6031 -0.1746 0.0948  -0.0824 1062 LEU B CA  
427 C C   . LEU B 19 ? 0.6715 0.6362 0.6910 -0.1799 0.1085  -0.0941 1062 LEU B C   
428 O O   . LEU B 19 ? 0.6871 0.7377 0.7956 -0.1703 0.1001  -0.1105 1062 LEU B O   
429 C CB  . LEU B 19 ? 0.7129 0.5628 0.6427 -0.2290 0.1011  -0.0961 1062 LEU B CB  
430 C CG  . LEU B 19 ? 0.8537 0.6077 0.7133 -0.2261 0.0835  -0.0898 1062 LEU B CG  
431 C CD1 . LEU B 19 ? 0.9994 0.7511 0.8595 -0.2835 0.0886  -0.1045 1062 LEU B CD1 
432 C CD2 . LEU B 19 ? 0.8449 0.6170 0.7323 -0.1740 0.0638  -0.0910 1062 LEU B CD2 
433 N N   . LEU B 20 ? 0.6561 0.6017 0.6364 -0.1956 0.1252  -0.0874 1063 LEU B N   
434 C CA  . LEU B 20 ? 0.6249 0.6601 0.6699 -0.2002 0.1399  -0.1031 1063 LEU B CA  
435 C C   . LEU B 20 ? 0.5939 0.6284 0.6420 -0.1479 0.1277  -0.0856 1063 LEU B C   
436 O O   . LEU B 20 ? 0.6727 0.6287 0.6419 -0.1386 0.1261  -0.0637 1063 LEU B O   
437 C CB  . LEU B 20 ? 0.7176 0.7464 0.7175 -0.2619 0.1711  -0.1124 1063 LEU B CB  
438 C CG  . LEU B 20 ? 0.9154 0.9621 0.9213 -0.3239 0.1880  -0.1342 1063 LEU B CG  
439 C CD1 . LEU B 20 ? 0.9586 1.0222 0.9269 -0.3903 0.2245  -0.1471 1063 LEU B CD1 
440 C CD2 . LEU B 20 ? 0.8835 1.0386 1.0143 -0.3127 0.1787  -0.1673 1063 LEU B CD2 
441 N N   . LEU B 21 ? 0.4955 0.6128 0.6343 -0.1152 0.1139  -0.0952 1064 LEU B N   
442 C CA  . LEU B 21 ? 0.5429 0.6666 0.6932 -0.0673 0.0996  -0.0787 1064 LEU B CA  
443 C C   . LEU B 21 ? 0.4625 0.5739 0.5771 -0.0761 0.1156  -0.0757 1064 LEU B C   
444 O O   . LEU B 21 ? 0.5623 0.6278 0.6368 -0.0445 0.1055  -0.0538 1064 LEU B O   
445 C CB  . LEU B 21 ? 0.5077 0.7203 0.7596 -0.0418 0.0781  -0.0903 1064 LEU B CB  
446 C CG  . LEU B 21 ? 0.4713 0.6978 0.7406 0.0013  0.0625  -0.0739 1064 LEU B CG  
447 C CD1 . LEU B 21 ? 0.4090 0.5731 0.6223 0.0338  0.0533  -0.0461 1064 LEU B CD1 
448 C CD2 . LEU B 21 ? 0.5354 0.8408 0.9001 0.0179  0.0351  -0.0854 1064 LEU B CD2 
449 N N   . SER B 22 ? 0.4682 0.6231 0.5966 -0.1207 0.1403  -0.1003 1065 SER B N   
450 C CA  . SER B 22 ? 0.6162 0.7632 0.7027 -0.1369 0.1583  -0.1004 1065 SER B CA  
451 C C   . SER B 22 ? 0.7167 0.7376 0.6741 -0.1496 0.1582  -0.0681 1065 SER B C   
452 O O   . SER B 22 ? 0.6713 0.6526 0.5833 -0.1330 0.1519  -0.0516 1065 SER B O   
453 C CB  . SER B 22 ? 0.6609 0.8843 0.7800 -0.1923 0.1913  -0.1394 1065 SER B CB  
454 O OG  . SER B 22 ? 0.7395 0.9259 0.8055 -0.2491 0.2109  -0.1425 1065 SER B OG  
455 N N   . GLU B 23 ? 0.7402 0.6914 0.6381 -0.1776 0.1587  -0.0596 1066 GLU B N   
456 C CA  . GLU B 23 ? 0.8941 0.7108 0.6683 -0.1873 0.1467  -0.0303 1066 GLU B CA  
457 C C   . GLU B 23 ? 0.7757 0.5365 0.5409 -0.1183 0.1116  -0.0092 1066 GLU B C   
458 O O   . GLU B 23 ? 0.8736 0.5446 0.5625 -0.1048 0.0933  0.0112  1066 GLU B O   
459 C CB  . GLU B 23 ? 1.0205 0.7756 0.7358 -0.2383 0.1521  -0.0299 1066 GLU B CB  
460 C CG  . GLU B 23 ? 1.3187 0.9200 0.9001 -0.2532 0.1305  -0.0007 1066 GLU B CG  
461 C CD  . GLU B 23 ? 1.5281 1.0781 1.0183 -0.2994 0.1404  0.0125  1066 GLU B CD  
462 O OE1 . GLU B 23 ? 1.5307 1.1731 1.0576 -0.3334 0.1746  -0.0065 1066 GLU B OE1 
463 O OE2 . GLU B 23 ? 1.7132 1.1272 1.0922 -0.3016 0.1107  0.0399  1066 GLU B OE2 
464 N N   . ALA B 24 ? 0.6711 0.4859 0.5127 -0.0779 0.1009  -0.0164 1067 ALA B N   
465 C CA  . ALA B 24 ? 0.6601 0.4512 0.5095 -0.0155 0.0745  -0.0043 1067 ALA B CA  
466 C C   . ALA B 24 ? 0.7301 0.5429 0.5976 0.0178  0.0664  0.0049  1067 ALA B C   
467 O O   . ALA B 24 ? 0.7250 0.4747 0.5529 0.0533  0.0445  0.0184  1067 ALA B O   
468 C CB  . ALA B 24 ? 0.6082 0.4703 0.5356 0.0094  0.0698  -0.0148 1067 ALA B CB  
469 N N   . VAL B 25 ? 0.6140 0.5173 0.5472 0.0091  0.0800  -0.0061 1068 VAL B N   
470 C CA  . VAL B 25 ? 0.5609 0.4895 0.5160 0.0390  0.0710  0.0008  1068 VAL B CA  
471 C C   . VAL B 25 ? 0.6507 0.4971 0.5114 0.0185  0.0721  0.0132  1068 VAL B C   
472 O O   . VAL B 25 ? 0.6914 0.4985 0.5288 0.0527  0.0510  0.0282  1068 VAL B O   
473 C CB  . VAL B 25 ? 0.5168 0.5578 0.5655 0.0347  0.0801  -0.0193 1068 VAL B CB  
474 C CG1 . VAL B 25 ? 0.5961 0.6549 0.6599 0.0630  0.0690  -0.0128 1068 VAL B CG1 
475 C CG2 . VAL B 25 ? 0.5159 0.6236 0.6487 0.0554  0.0673  -0.0260 1068 VAL B CG2 
476 N N   . SER B 26 ? 0.7412 0.5605 0.5443 -0.0415 0.0948  0.0068  1069 SER B N   
477 C CA  . SER B 26 ? 0.8004 0.5280 0.4927 -0.0746 0.0945  0.0219  1069 SER B CA  
478 C C   . SER B 26 ? 0.9318 0.5293 0.5417 -0.0457 0.0564  0.0477  1069 SER B C   
479 O O   . SER B 26 ? 1.0128 0.5459 0.5681 -0.0294 0.0338  0.0639  1069 SER B O   
480 C CB  . SER B 26 ? 0.8807 0.5978 0.5170 -0.1542 0.1263  0.0115  1069 SER B CB  
481 O OG  . SER B 26 ? 1.1579 0.7725 0.6680 -0.1955 0.1229  0.0309  1069 SER B OG  
482 N N   . ARG B 27 ? 0.9349 0.4911 0.5365 -0.0377 0.0452  0.0479  1070 ARG B N   
483 C CA  . ARG B 27 ? 1.0124 0.4484 0.5467 -0.0046 0.0043  0.0628  1070 ARG B CA  
484 C C   . ARG B 27 ? 0.9983 0.4609 0.5911 0.0694  -0.0212 0.0633  1070 ARG B C   
485 O O   . ARG B 27 ? 1.0681 0.4411 0.6064 0.0965  -0.0572 0.0749  1070 ARG B O   
486 C CB  . ARG B 27 ? 1.0343 0.4344 0.5605 -0.0066 -0.0018 0.0552  1070 ARG B CB  
487 C CG  . ARG B 27 ? 1.2706 0.6038 0.7113 -0.0814 0.0106  0.0604  1070 ARG B CG  
488 C CD  . ARG B 27 ? 1.3756 0.6996 0.8282 -0.0862 0.0102  0.0487  1070 ARG B CD  
489 N NE  . ARG B 27 ? 1.6156 0.8465 0.9688 -0.1568 0.0110  0.0581  1070 ARG B NE  
490 C CZ  . ARG B 27 ? 1.8288 0.9155 1.0857 -0.1592 -0.0288 0.0703  1070 ARG B CZ  
491 N NH1 . ARG B 27 ? 1.8944 0.9219 1.1513 -0.0892 -0.0714 0.0682  1070 ARG B NH1 
492 N NH2 . ARG B 27 ? 1.9594 0.9623 1.1226 -0.2325 -0.0285 0.0817  1070 ARG B NH2 
493 N N   . ALA B 28 ? 0.8109 0.3943 0.5132 0.0990  -0.0062 0.0504  1071 ALA B N   
494 C CA  . ALA B 28 ? 0.8577 0.4822 0.6228 0.1618  -0.0261 0.0496  1071 ALA B CA  
495 C C   . ALA B 28 ? 0.8623 0.4748 0.6123 0.1725  -0.0387 0.0618  1071 ALA B C   
496 O O   . ALA B 28 ? 0.9016 0.4776 0.6462 0.2119  -0.0695 0.0659  1071 ALA B O   
497 C CB  . ALA B 28 ? 0.6860 0.4361 0.5572 0.1756  -0.0083 0.0380  1071 ALA B CB  
498 N N   . ALA B 29 ? 0.7574 0.4106 0.5068 0.1327  -0.0146 0.0619  1072 ALA B N   
499 C CA  . ALA B 29 ? 0.7402 0.3886 0.4724 0.1366  -0.0226 0.0704  1072 ALA B CA  
500 C C   . ALA B 29 ? 0.9632 0.4736 0.5762 0.1263  -0.0508 0.0884  1072 ALA B C   
501 O O   . ALA B 29 ? 1.0137 0.4869 0.6108 0.1582  -0.0805 0.0987  1072 ALA B O   
502 C CB  . ALA B 29 ? 0.7213 0.4445 0.4750 0.0920  0.0121  0.0576  1072 ALA B CB  
503 N N   . LYS B 30 ? 1.0347 0.4613 0.5596 0.0796  -0.0469 0.0933  1073 LYS B N   
504 C CA  . LYS B 30 ? 1.1757 0.4516 0.5718 0.0621  -0.0821 0.1139  1073 LYS B CA  
505 C C   . LYS B 30 ? 1.2706 0.5205 0.7002 0.1209  -0.1277 0.1060  1073 LYS B C   
506 O O   . LYS B 30 ? 1.2707 0.4896 0.6788 0.1275  -0.1574 0.1058  1073 LYS B O   
507 C CB  . LYS B 30 ? 1.3960 0.5956 0.6950 -0.0091 -0.0690 0.1200  1073 LYS B CB  
508 C CG  . LYS B 30 ? 1.5259 0.7640 0.7832 -0.0848 -0.0256 0.1184  1073 LYS B CG  
509 C CD  . LYS B 30 ? 1.7671 0.8965 0.8931 -0.1648 -0.0227 0.1322  1073 LYS B CD  
510 C CE  . LYS B 30 ? 1.7694 1.0001 0.9139 -0.2380 0.0390  0.1123  1073 LYS B CE  
511 N NZ  . LYS B 30 ? 1.8550 1.0969 1.0189 -0.2646 0.0545  0.1027  1073 LYS B NZ  
512 N N   . ALA B 31 ? 1.1629 0.4641 0.6670 0.1543  -0.1257 0.0892  1074 ALA B N   
513 C CA  . ALA B 31 ? 1.1843 0.5141 0.7465 0.1943  -0.1533 0.0700  1074 ALA B CA  
514 C C   . ALA B 31 ? 1.1112 0.5432 0.7666 0.2218  -0.1517 0.0631  1074 ALA B C   
515 O O   . ALA B 31 ? 1.1705 0.5960 0.8388 0.2387  -0.1765 0.0548  1074 ALA B O   
516 C CB  . ALA B 31 ? 1.0630 0.4308 0.6767 0.2147  -0.1449 0.0524  1074 ALA B CB  
517 N N   . ALA B 32 ? 1.0017 0.5234 0.7194 0.2219  -0.1238 0.0663  1075 ALA B N   
518 C CA  . ALA B 32 ? 0.9217 0.5402 0.7268 0.2328  -0.1189 0.0629  1075 ALA B CA  
519 C C   . ALA B 32 ? 1.0281 0.6066 0.7858 0.2237  -0.1320 0.0744  1075 ALA B C   
520 O O   . ALA B 32 ? 0.9409 0.5835 0.7598 0.2292  -0.1306 0.0729  1075 ALA B O   
521 C CB  . ALA B 32 ? 0.7566 0.4834 0.6471 0.2287  -0.0906 0.0603  1075 ALA B CB  
522 N N   . GLY B 33 ? 0.9049 0.4740 0.7288 -0.0348 -0.1107 0.0120  1076 GLY B N   
523 C CA  . GLY B 33 ? 0.9663 0.5349 0.7255 0.0068  -0.1246 0.0177  1076 GLY B CA  
524 C C   . GLY B 33 ? 0.9476 0.5740 0.7234 0.0070  -0.1348 -0.0044 1076 GLY B C   
525 O O   . GLY B 33 ? 0.9413 0.5836 0.6867 0.0430  -0.1602 -0.0183 1076 GLY B O   
526 N N   . ALA B 34 ? 0.7988 0.4587 0.6234 -0.0331 -0.1137 -0.0079 1077 ALA B N   
527 C CA  . ALA B 34 ? 0.8293 0.5423 0.6777 -0.0349 -0.1167 -0.0265 1077 ALA B CA  
528 C C   . ALA B 34 ? 0.8260 0.5371 0.6248 -0.0411 -0.0855 -0.0014 1077 ALA B C   
529 O O   . ALA B 34 ? 0.8256 0.5231 0.6190 -0.0718 -0.0525 0.0250  1077 ALA B O   
530 C CB  . ALA B 34 ? 0.7305 0.4887 0.6672 -0.0704 -0.1125 -0.0436 1077 ALA B CB  
531 N N   . ARG B 35 ? 0.7266 0.4537 0.4913 -0.0141 -0.0944 -0.0114 1078 ARG B N   
532 C CA  . ARG B 35 ? 0.8146 0.5437 0.5361 -0.0188 -0.0640 0.0099  1078 ARG B CA  
533 C C   . ARG B 35 ? 0.7467 0.5303 0.5155 -0.0277 -0.0591 -0.0103 1078 ARG B C   
534 O O   . ARG B 35 ? 0.7518 0.5617 0.5544 -0.0126 -0.0851 -0.0447 1078 ARG B O   
535 C CB  . ARG B 35 ? 0.9763 0.6720 0.6055 0.0209  -0.0706 0.0208  1078 ARG B CB  
536 C CG  . ARG B 35 ? 1.2126 0.8494 0.7900 0.0328  -0.0681 0.0486  1078 ARG B CG  
537 C CD  . ARG B 35 ? 1.3601 0.9686 0.9282 -0.0028 -0.0237 0.0845  1078 ARG B CD  
538 N NE  . ARG B 35 ? 1.5839 1.1284 1.1013 0.0075  -0.0135 0.1128  1078 ARG B NE  
539 C CZ  . ARG B 35 ? 1.5588 1.0765 1.1077 -0.0089 -0.0117 0.1160  1078 ARG B CZ  
540 N NH1 . ARG B 35 ? 1.4176 0.9700 1.0472 -0.0374 -0.0214 0.0923  1078 ARG B NH1 
541 N NH2 . ARG B 35 ? 1.6476 1.1018 1.1463 0.0037  0.0027  0.1437  1078 ARG B NH2 
542 N N   . PRO B 36 ? 0.8001 0.6019 0.5761 -0.0531 -0.0234 0.0111  1079 PRO B N   
543 C CA  . PRO B 36 ? 0.7212 0.5767 0.5552 -0.0630 -0.0150 -0.0047 1079 PRO B CA  
544 C C   . PRO B 36 ? 0.6938 0.5564 0.4940 -0.0315 -0.0217 -0.0245 1079 PRO B C   
545 O O   . PRO B 36 ? 0.7441 0.5757 0.4666 -0.0077 -0.0225 -0.0162 1079 PRO B O   
546 C CB  . PRO B 36 ? 0.7225 0.5975 0.5685 -0.0967 0.0258  0.0283  1079 PRO B CB  
547 C CG  . PRO B 36 ? 0.8392 0.6741 0.6550 -0.1145 0.0355  0.0535  1079 PRO B CG  
548 C CD  . PRO B 36 ? 0.9062 0.6869 0.6562 -0.0794 0.0115  0.0488  1079 PRO B CD  
549 N N   . LEU B 37 ? 0.5744 0.4765 0.4326 -0.0313 -0.0255 -0.0518 1080 LEU B N   
550 C CA  . LEU B 37 ? 0.6406 0.5538 0.4786 -0.0079 -0.0248 -0.0749 1080 LEU B CA  
551 C C   . LEU B 37 ? 0.6815 0.5996 0.4882 -0.0136 0.0146  -0.0471 1080 LEU B C   
552 O O   . LEU B 37 ? 0.7062 0.6134 0.4568 0.0081  0.0201  -0.0535 1080 LEU B O   
553 C CB  . LEU B 37 ? 0.7097 0.6610 0.6275 -0.0112 -0.0305 -0.1086 1080 LEU B CB  
554 C CG  . LEU B 37 ? 0.6897 0.6451 0.6557 -0.0088 -0.0659 -0.1399 1080 LEU B CG  
555 C CD1 . LEU B 37 ? 0.6031 0.5943 0.6456 -0.0128 -0.0614 -0.1698 1080 LEU B CD1 
556 C CD2 . LEU B 37 ? 0.7745 0.7047 0.6828 0.0215  -0.1014 -0.1634 1080 LEU B CD2 
557 N N   . THR B 38 ? 0.6373 0.5752 0.4813 -0.0441 0.0424  -0.0166 1081 THR B N   
558 C CA  . THR B 38 ? 0.6442 0.5961 0.4720 -0.0535 0.0823  0.0124  1081 THR B CA  
559 C C   . THR B 38 ? 0.7088 0.6231 0.4671 -0.0594 0.0960  0.0465  1081 THR B C   
560 O O   . THR B 38 ? 0.7776 0.6550 0.4581 -0.0348 0.0926  0.0478  1081 THR B O   
561 C CB  . THR B 38 ? 0.6317 0.6371 0.5427 -0.0838 0.1063  0.0279  1081 THR B CB  
562 O OG1 . THR B 38 ? 0.6010 0.6094 0.5465 -0.1095 0.0946  0.0359  1081 THR B OG1 
563 C CG2 . THR B 38 ? 0.5185 0.5578 0.4947 -0.0747 0.1022  -0.0009 1081 THR B CG2 
564 N N   . SER B 39 ? 0.7286 0.6538 0.5157 -0.0930 0.1130  0.0733  1082 SER B N   
565 C CA  . SER B 39 ? 0.8649 0.7534 0.5965 -0.1055 0.1310  0.1052  1082 SER B CA  
566 C C   . SER B 39 ? 0.7564 0.6606 0.5394 -0.1461 0.1378  0.1188  1082 SER B C   
567 O O   . SER B 39 ? 0.7317 0.6874 0.5900 -0.1655 0.1376  0.1116  1082 SER B O   
568 C CB  . SER B 39 ? 0.8865 0.7828 0.5833 -0.1077 0.1692  0.1309  1082 SER B CB  
569 O OG  . SER B 39 ? 0.8029 0.7607 0.5689 -0.1341 0.1937  0.1419  1082 SER B OG  
570 N N   . PRO B 40 ? 0.9887 0.5106 0.6429 -0.2524 -0.0089 0.1236  1083 PRO B N   
571 C CA  . PRO B 40 ? 0.9548 0.5442 0.6807 -0.2689 -0.0095 0.1177  1083 PRO B CA  
572 C C   . PRO B 40 ? 0.9832 0.6485 0.7030 -0.3188 0.0145  0.1347  1083 PRO B C   
573 O O   . PRO B 40 ? 0.9358 0.6365 0.7076 -0.3140 0.0066  0.1265  1083 PRO B O   
574 C CB  . PRO B 40 ? 0.9801 0.5856 0.7077 -0.3007 -0.0099 0.1191  1083 PRO B CB  
575 C CG  . PRO B 40 ? 1.0531 0.5984 0.7421 -0.2782 -0.0190 0.1156  1083 PRO B CG  
576 C CD  . PRO B 40 ? 1.0847 0.5819 0.7022 -0.2722 -0.0106 0.1257  1083 PRO B CD  
577 N N   . GLU B 41 ? 0.9918 0.7248 0.6606 -0.3545 0.0521  0.1549  1084 GLU B N   
578 C CA  . GLU B 41 ? 0.8932 0.8138 0.6215 -0.3430 0.0800  0.1425  1084 GLU B CA  
579 C C   . GLU B 41 ? 0.8063 0.7679 0.5749 -0.2559 0.0681  0.1151  1084 GLU B C   
580 O O   . GLU B 41 ? 0.7590 0.8249 0.5920 -0.2498 0.0686  0.1014  1084 GLU B O   
581 C CB  . GLU B 41 ? 0.9323 0.9525 0.6264 -0.3500 0.1238  0.1517  1084 GLU B CB  
582 C CG  . GLU B 41 ? 1.0510 1.0721 0.7228 -0.4439 0.1453  0.1831  1084 GLU B CG  
583 C CD  . GLU B 41 ? 1.1476 1.0014 0.7392 -0.4438 0.1247  0.1930  1084 GLU B CD  
584 O OE1 . GLU B 41 ? 1.1510 0.8878 0.6772 -0.3982 0.1070  0.1897  1084 GLU B OE1 
585 O OE2 . GLU B 41 ? 1.2034 1.0462 0.8059 -0.4758 0.1204  0.1983  1084 GLU B OE2 
586 N N   . SER B 42 ? 0.8102 0.6842 0.5421 -0.1874 0.0532  0.1069  1085 SER B N   
587 C CA  . SER B 42 ? 0.7546 0.6516 0.5257 -0.1043 0.0384  0.0844  1085 SER B CA  
588 C C   . SER B 42 ? 0.7004 0.5243 0.5140 -0.1022 0.0119  0.0843  1085 SER B C   
589 O O   . SER B 42 ? 0.6602 0.5555 0.5214 -0.0633 0.0092  0.0696  1085 SER B O   
590 C CB  . SER B 42 ? 0.9097 0.7200 0.6369 -0.0324 0.0231  0.0767  1085 SER B CB  
591 O OG  . SER B 42 ? 0.9996 0.8868 0.6803 -0.0197 0.0495  0.0731  1085 SER B OG  
592 N N   . LEU B 43 ? 0.9318 0.6113 0.7241 -0.1412 -0.0070 0.1006  1086 LEU B N   
593 C CA  . LEU B 43 ? 0.8244 0.4276 0.6504 -0.1440 -0.0271 0.1035  1086 LEU B CA  
594 C C   . LEU B 43 ? 0.6680 0.3802 0.5317 -0.1833 -0.0198 0.0987  1086 LEU B C   
595 O O   . LEU B 43 ? 0.7069 0.4469 0.6053 -0.1461 -0.0263 0.0883  1086 LEU B O   
596 C CB  . LEU B 43 ? 0.7523 0.3606 0.6289 -0.1296 -0.0249 0.0869  1086 LEU B CB  
597 C CG  . LEU B 43 ? 0.7224 0.3589 0.6433 -0.1174 -0.0247 0.0738  1086 LEU B CG  
598 C CD1 . LEU B 43 ? 0.6358 0.2728 0.5822 -0.0685 -0.0226 0.0672  1086 LEU B CD1 
599 C CD2 . LEU B 43 ? 0.7545 0.3687 0.6437 -0.1294 -0.0448 0.0693  1086 LEU B CD2 
600 N N   . SER B 44 ? 0.7311 0.5037 0.5878 -0.2563 -0.0078 0.1066  1087 SER B N   
601 C CA  . SER B 44 ? 0.7069 0.5782 0.6068 -0.2993 -0.0083 0.1011  1087 SER B CA  
602 C C   . SER B 44 ? 0.7217 0.7499 0.6695 -0.2521 0.0021  0.0785  1087 SER B C   
603 O O   . SER B 44 ? 0.7006 0.7749 0.6851 -0.2498 -0.0118 0.0661  1087 SER B O   
604 C CB  . SER B 44 ? 0.8280 0.7398 0.7225 -0.3812 0.0031  0.1151  1087 SER B CB  
605 O OG  . SER B 44 ? 1.0276 1.0387 0.9759 -0.4146 -0.0029 0.1063  1087 SER B OG  
606 N N   . ARG B 45 ? 0.6749 0.7809 0.6188 -0.2111 0.0233  0.0710  1088 ARG B N   
607 C CA  . ARG B 45 ? 0.6511 0.9015 0.6401 -0.1584 0.0310  0.0468  1088 ARG B CA  
608 C C   . ARG B 45 ? 0.6332 0.8373 0.6341 -0.0888 0.0081  0.0335  1088 ARG B C   
609 O O   . ARG B 45 ? 0.5548 0.8461 0.5951 -0.0669 -0.0001 0.0152  1088 ARG B O   
610 C CB  . ARG B 45 ? 0.7069 1.0238 0.6780 -0.1178 0.0557  0.0409  1088 ARG B CB  
611 C CG  . ARG B 45 ? 0.8030 1.2680 0.8199 -0.0576 0.0625  0.0134  1088 ARG B CG  
612 C CD  . ARG B 45 ? 0.8737 1.3946 0.8636 -0.0177 0.0872  0.0076  1088 ARG B CD  
613 N NE  . ARG B 45 ? 0.9757 1.4951 0.9283 -0.0797 0.1160  0.0297  1088 ARG B NE  
614 C CZ  . ARG B 45 ? 1.0639 1.5098 0.9464 -0.0609 0.1255  0.0391  1088 ARG B CZ  
615 N NH1 . ARG B 45 ? 1.1161 1.4852 0.9678 0.0172  0.1042  0.0264  1088 ARG B NH1 
616 N NH2 . ARG B 45 ? 1.0658 1.5097 0.9079 -0.1189 0.1536  0.0618  1088 ARG B NH2 
617 N N   . ASP B 46 ? 0.6031 0.6657 0.5714 -0.0528 -0.0030 0.0438  1089 ASP B N   
618 C CA  . ASP B 46 ? 0.6025 0.6066 0.5823 0.0134  -0.0192 0.0388  1089 ASP B CA  
619 C C   . ASP B 46 ? 0.5925 0.5451 0.5781 -0.0127 -0.0333 0.0437  1089 ASP B C   
620 O O   . ASP B 46 ? 0.5843 0.5502 0.5835 0.0346  -0.0416 0.0345  1089 ASP B O   
621 C CB  . ASP B 46 ? 0.6540 0.5193 0.6115 0.0556  -0.0270 0.0511  1089 ASP B CB  
622 C CG  . ASP B 46 ? 0.7610 0.6763 0.7175 0.1193  -0.0237 0.0379  1089 ASP B CG  
623 O OD1 . ASP B 46 ? 0.7275 0.7882 0.7002 0.1348  -0.0122 0.0189  1089 ASP B OD1 
624 O OD2 . ASP B 46 ? 0.8052 0.6137 0.7491 0.1570  -0.0358 0.0447  1089 ASP B OD2 
625 N N   . LEU B 47 ? 0.6086 0.4981 0.5780 -0.0846 -0.0375 0.0578  1090 LEU B N   
626 C CA  . LEU B 47 ? 0.6454 0.4813 0.6142 -0.1089 -0.0539 0.0601  1090 LEU B CA  
627 C C   . LEU B 47 ? 0.6500 0.6156 0.6484 -0.1223 -0.0625 0.0400  1090 LEU B C   
628 O O   . LEU B 47 ? 0.6198 0.5586 0.6150 -0.1142 -0.0803 0.0338  1090 LEU B O   
629 C CB  . LEU B 47 ? 0.6889 0.4250 0.6340 -0.1833 -0.0611 0.0778  1090 LEU B CB  
630 C CG  . LEU B 47 ? 0.6329 0.2940 0.5775 -0.1333 -0.0432 0.0764  1090 LEU B CG  
631 C CD1 . LEU B 47 ? 0.6596 0.3450 0.6199 -0.1472 -0.0294 0.0658  1090 LEU B CD1 
632 C CD2 . LEU B 47 ? 0.6929 0.3500 0.6612 -0.0690 -0.0246 0.0666  1090 LEU B CD2 
633 N N   . GLU B 48 ? 0.5637 0.6685 0.5919 -0.1388 -0.0506 0.0287  1091 GLU B N   
634 C CA  . GLU B 48 ? 0.6597 0.8986 0.7328 -0.1523 -0.0614 0.0073  1091 GLU B CA  
635 C C   . GLU B 48 ? 0.5452 0.8584 0.6364 -0.0706 -0.0675 -0.0168 1091 GLU B C   
636 O O   . GLU B 48 ? 0.5490 0.9682 0.6789 -0.0711 -0.0827 -0.0389 1091 GLU B O   
637 C CB  . GLU B 48 ? 0.5797 0.9415 0.6898 -0.2114 -0.0425 0.0083  1091 GLU B CB  
638 C CG  . GLU B 48 ? 0.8466 1.1553 0.9487 -0.3035 -0.0450 0.0296  1091 GLU B CG  
639 C CD  . GLU B 48 ? 0.9810 1.3614 1.0927 -0.3536 -0.0124 0.0450  1091 GLU B CD  
640 O OE1 . GLU B 48 ? 0.9788 1.4837 1.1190 -0.3238 0.0117  0.0342  1091 GLU B OE1 
641 O OE2 . GLU B 48 ? 1.0600 1.3707 1.1476 -0.4214 -0.0101 0.0683  1091 GLU B OE2 
642 N N   . ALA B 49 ? 0.5272 0.7816 0.5943 -0.0008 -0.0599 -0.0128 1092 ALA B N   
643 C CA  . ALA B 49 ? 0.5136 0.8175 0.5904 0.0797  -0.0684 -0.0323 1092 ALA B CA  
644 C C   . ALA B 49 ? 0.5318 0.8211 0.6017 0.0874  -0.0941 -0.0432 1092 ALA B C   
645 O O   . ALA B 49 ? 0.5486 0.7218 0.5853 0.0666  -0.1015 -0.0278 1092 ALA B O   
646 C CB  . ALA B 49 ? 0.4989 0.7020 0.5496 0.1476  -0.0613 -0.0189 1092 ALA B CB  
647 N N   . PRO B 50 ? 0.6257 0.6511 0.5703 -0.1266 -0.0414 -0.0122 1093 PRO B N   
648 C CA  . PRO B 50 ? 0.6243 0.6532 0.5808 -0.1349 -0.0390 0.0025  1093 PRO B CA  
649 C C   . PRO B 50 ? 0.6457 0.6503 0.6051 -0.1474 -0.0386 0.0065  1093 PRO B C   
650 O O   . PRO B 50 ? 0.6737 0.6888 0.6362 -0.1548 -0.0383 0.0141  1093 PRO B O   
651 C CB  . PRO B 50 ? 0.6674 0.6984 0.6223 -0.1152 -0.0394 0.0026  1093 PRO B CB  
652 C CG  . PRO B 50 ? 0.6583 0.7026 0.6105 -0.1021 -0.0347 -0.0078 1093 PRO B CG  
653 C CD  . PRO B 50 ? 0.6100 0.6388 0.5466 -0.1068 -0.0374 -0.0189 1093 PRO B CD  
654 N N   . GLU B 51 ? 0.6328 0.6037 0.5966 -0.1511 -0.0331 -0.0012 1094 GLU B N   
655 C CA  . GLU B 51 ? 0.5678 0.5129 0.5446 -0.1673 -0.0186 0.0032  1094 GLU B CA  
656 C C   . GLU B 51 ? 0.6789 0.6574 0.6804 -0.1830 -0.0245 -0.0071 1094 GLU B C   
657 O O   . GLU B 51 ? 0.6229 0.6016 0.6285 -0.1906 -0.0136 0.0031  1094 GLU B O   
658 C CB  . GLU B 51 ? 0.6801 0.5792 0.6781 -0.1773 -0.0027 -0.0109 1094 GLU B CB  
659 C CG  . GLU B 51 ? 0.8898 0.7364 0.8577 -0.1551 0.0087  0.0024  1094 GLU B CG  
660 C CD  . GLU B 51 ? 0.9225 0.7812 0.8883 -0.1399 -0.0085 -0.0198 1094 GLU B CD  
661 O OE1 . GLU B 51 ? 0.8144 0.7268 0.7831 -0.1390 -0.0282 -0.0340 1094 GLU B OE1 
662 O OE2 . GLU B 51 ? 1.0139 0.8212 0.9685 -0.1243 0.0024  -0.0209 1094 GLU B OE2 
663 N N   . VAL B 52 ? 0.5855 0.5926 0.5959 -0.1794 -0.0419 -0.0282 1095 VAL B N   
664 C CA  . VAL B 52 ? 0.5824 0.6237 0.6103 -0.1808 -0.0526 -0.0403 1095 VAL B CA  
665 C C   . VAL B 52 ? 0.5745 0.6219 0.5788 -0.1736 -0.0512 -0.0165 1095 VAL B C   
666 O O   . VAL B 52 ? 0.5028 0.5595 0.5212 -0.1786 -0.0478 -0.0154 1095 VAL B O   
667 C CB  . VAL B 52 ? 0.5519 0.6224 0.5754 -0.1621 -0.0762 -0.0689 1095 VAL B CB  
668 C CG1 . VAL B 52 ? 0.6571 0.7688 0.6971 -0.1516 -0.0926 -0.0854 1095 VAL B CG1 
669 C CG2 . VAL B 52 ? 0.5369 0.6005 0.5929 -0.1718 -0.0798 -0.1048 1095 VAL B CG2 
670 N N   . GLN B 53 ? 0.5212 0.5629 0.4982 -0.1637 -0.0495 -0.0019 1096 GLN B N   
671 C CA  . GLN B 53 ? 0.5414 0.5812 0.5111 -0.1638 -0.0424 0.0132  1096 GLN B CA  
672 C C   . GLN B 53 ? 0.5425 0.5794 0.5221 -0.1746 -0.0383 0.0158  1096 GLN B C   
673 O O   . GLN B 53 ? 0.4971 0.5336 0.4800 -0.1767 -0.0363 0.0161  1096 GLN B O   
674 C CB  . GLN B 53 ? 0.6856 0.7235 0.6450 -0.1592 -0.0314 0.0224  1096 GLN B CB  
675 C CG  . GLN B 53 ? 0.8488 0.8796 0.8216 -0.1689 -0.0164 0.0299  1096 GLN B CG  
676 C CD  . GLN B 53 ? 0.9046 0.9130 0.8629 -0.1611 -0.0118 0.0384  1096 GLN B CD  
677 O OE1 . GLN B 53 ? 0.8034 0.8014 0.7282 -0.1381 -0.0112 0.0476  1096 GLN B OE1 
678 N NE2 . GLN B 53 ? 0.8988 0.9005 0.8756 -0.1719 -0.0112 0.0323  1096 GLN B NE2 
679 N N   . GLU B 54 ? 0.5524 0.5829 0.5275 -0.1737 -0.0369 0.0173  1097 GLU B N   
680 C CA  . GLU B 54 ? 0.5649 0.5926 0.5276 -0.1690 -0.0346 0.0211  1097 GLU B CA  
681 C C   . GLU B 54 ? 0.6226 0.6406 0.5854 -0.1745 -0.0221 0.0242  1097 GLU B C   
682 O O   . GLU B 54 ? 0.6229 0.6464 0.5744 -0.1696 -0.0202 0.0232  1097 GLU B O   
683 C CB  . GLU B 54 ? 0.6400 0.6552 0.5806 -0.1518 -0.0346 0.0278  1097 GLU B CB  
684 C CG  . GLU B 54 ? 0.6563 0.6650 0.5598 -0.1303 -0.0333 0.0349  1097 GLU B CG  
685 C CD  . GLU B 54 ? 0.6572 0.7084 0.5671 -0.1221 -0.0541 0.0140  1097 GLU B CD  
686 O OE1 . GLU B 54 ? 0.6788 0.7565 0.6311 -0.1395 -0.0611 -0.0023 1097 GLU B OE1 
687 O OE2 . GLU B 54 ? 0.7571 0.8132 0.6293 -0.0967 -0.0602 0.0116  1097 GLU B OE2 
688 N N   . SER B 55 ? 0.5668 0.5761 0.5503 -0.1852 -0.0118 0.0215  1098 SER B N   
689 C CA  . SER B 55 ? 0.5839 0.5967 0.5894 -0.1955 0.0068  0.0188  1098 SER B CA  
690 C C   . SER B 55 ? 0.5435 0.5876 0.5627 -0.1924 -0.0049 0.0081  1098 SER B C   
691 O O   . SER B 55 ? 0.5103 0.5606 0.5287 -0.1901 0.0079  0.0090  1098 SER B O   
692 C CB  . SER B 55 ? 0.5361 0.5464 0.5884 -0.2140 0.0185  0.0033  1098 SER B CB  
693 O OG  . SER B 55 ? 0.6937 0.7198 0.7879 -0.2288 0.0422  -0.0051 1098 SER B OG  
694 N N   . TYR B 56 ? 0.4710 0.5277 0.4932 -0.1857 -0.0252 0.0007  1099 TYR B N   
695 C CA  . TYR B 56 ? 0.5214 0.5901 0.5446 -0.1734 -0.0330 -0.0035 1099 TYR B CA  
696 C C   . TYR B 56 ? 0.5449 0.5960 0.5476 -0.1711 -0.0281 0.0027  1099 TYR B C   
697 O O   . TYR B 56 ? 0.5659 0.6215 0.5726 -0.1642 -0.0238 -0.0035 1099 TYR B O   
698 C CB  . TYR B 56 ? 0.5157 0.5833 0.5237 -0.1568 -0.0475 -0.0025 1099 TYR B CB  
699 C CG  . TYR B 56 ? 0.4793 0.5426 0.4749 -0.1328 -0.0514 0.0000  1099 TYR B CG  
700 C CD1 . TYR B 56 ? 0.5829 0.6821 0.6024 -0.1165 -0.0618 -0.0176 1099 TYR B CD1 
701 C CD2 . TYR B 56 ? 0.5394 0.5608 0.5057 -0.1251 -0.0406 0.0182  1099 TYR B CD2 
702 C CE1 . TYR B 56 ? 0.6577 0.7481 0.6579 -0.0829 -0.0667 -0.0136 1099 TYR B CE1 
703 C CE2 . TYR B 56 ? 0.6701 0.6664 0.6161 -0.0974 -0.0372 0.0262  1099 TYR B CE2 
704 C CZ  . TYR B 56 ? 0.6892 0.7186 0.6452 -0.0715 -0.0530 0.0120  1099 TYR B CZ  
705 O OH  . TYR B 56 ? 0.7588 0.7594 0.6872 -0.0328 -0.0513 0.0214  1099 TYR B OH  
706 N N   . ARG B 57 ? 0.4751 0.5137 0.4639 -0.1752 -0.0304 0.0068  1100 ARG B N   
707 C CA  . ARG B 57 ? 0.5256 0.5595 0.5098 -0.1752 -0.0317 -0.0030 1100 ARG B CA  
708 C C   . ARG B 57 ? 0.5344 0.5760 0.5001 -0.1661 -0.0278 -0.0091 1100 ARG B C   
709 O O   . ARG B 57 ? 0.5780 0.6186 0.5406 -0.1599 -0.0287 -0.0244 1100 ARG B O   
710 C CB  . ARG B 57 ? 0.5548 0.5971 0.5440 -0.1797 -0.0384 -0.0083 1100 ARG B CB  
711 C CG  . ARG B 57 ? 0.5748 0.6290 0.5792 -0.1817 -0.0462 -0.0352 1100 ARG B CG  
712 C CD  . ARG B 57 ? 0.5233 0.6108 0.5422 -0.1790 -0.0594 -0.0506 1100 ARG B CD  
713 N NE  . ARG B 57 ? 0.6097 0.7061 0.5837 -0.1533 -0.0692 -0.0410 1100 ARG B NE  
714 C CZ  . ARG B 57 ? 0.6327 0.7446 0.5723 -0.1277 -0.0827 -0.0555 1100 ARG B CZ  
715 N NH1 . ARG B 57 ? 0.6223 0.7541 0.5782 -0.1281 -0.0954 -0.0915 1100 ARG B NH1 
716 N NH2 . ARG B 57 ? 0.7248 0.8267 0.6082 -0.0971 -0.0814 -0.0352 1100 ARG B NH2 
717 N N   . GLN B 58 ? 0.5373 0.5786 0.4850 -0.1623 -0.0185 0.0036  1101 GLN B N   
718 C CA  . GLN B 58 ? 0.6109 0.6497 0.5250 -0.1474 -0.0024 0.0079  1101 GLN B CA  
719 C C   . GLN B 58 ? 0.6675 0.7158 0.6015 -0.1503 0.0158  0.0043  1101 GLN B C   
720 O O   . GLN B 58 ? 0.5790 0.6313 0.4872 -0.1344 0.0249  -0.0023 1101 GLN B O   
721 C CB  . GLN B 58 ? 0.6142 0.6301 0.5013 -0.1416 0.0171  0.0315  1101 GLN B CB  
722 C CG  . GLN B 58 ? 0.6869 0.6985 0.5413 -0.1224 -0.0019 0.0337  1101 GLN B CG  
723 C CD  . GLN B 58 ? 0.8833 0.8542 0.7066 -0.1112 0.0210  0.0616  1101 GLN B CD  
724 O OE1 . GLN B 58 ? 0.9922 0.9402 0.8485 -0.1347 0.0441  0.0709  1101 GLN B OE1 
725 N NE2 . GLN B 58 ? 0.9688 0.9291 0.7297 -0.0713 0.0142  0.0710  1101 GLN B NE2 
726 N N   . GLN B 59 ? 0.5023 0.5628 0.4828 -0.1649 0.0189  0.0032  1102 GLN B N   
727 C CA  . GLN B 59 ? 0.5608 0.6482 0.5760 -0.1633 0.0313  -0.0080 1102 GLN B CA  
728 C C   . GLN B 59 ? 0.5636 0.6495 0.5683 -0.1461 0.0165  -0.0215 1102 GLN B C   
729 O O   . GLN B 59 ? 0.6253 0.7222 0.6263 -0.1331 0.0299  -0.0308 1102 GLN B O   
730 C CB  . GLN B 59 ? 0.5357 0.6523 0.6079 -0.1738 0.0237  -0.0195 1102 GLN B CB  
731 C CG  . GLN B 59 ? 0.4842 0.6498 0.6106 -0.1690 0.0343  -0.0399 1102 GLN B CG  
732 C CD  . GLN B 59 ? 0.5334 0.7089 0.6832 -0.1840 0.0806  -0.0364 1102 GLN B CD  
733 O OE1 . GLN B 59 ? 0.5982 0.7575 0.7651 -0.2073 0.1062  -0.0279 1102 GLN B OE1 
734 N NE2 . GLN B 59 ? 0.6413 0.8357 0.7893 -0.1686 0.0985  -0.0416 1102 GLN B NE2 
735 N N   . LEU B 60 ? 0.5171 0.5826 0.5171 -0.1457 -0.0046 -0.0224 1103 LEU B N   
736 C CA  . LEU B 60 ? 0.5903 0.6327 0.5845 -0.1335 -0.0114 -0.0337 1103 LEU B CA  
737 C C   . LEU B 60 ? 0.6608 0.6957 0.6317 -0.1288 -0.0100 -0.0520 1103 LEU B C   
738 O O   . LEU B 60 ? 0.6773 0.7061 0.6456 -0.1136 -0.0062 -0.0691 1103 LEU B O   
739 C CB  . LEU B 60 ? 0.7036 0.7137 0.6974 -0.1397 -0.0194 -0.0254 1103 LEU B CB  
740 C CG  . LEU B 60 ? 0.8804 0.8451 0.8724 -0.1266 -0.0144 -0.0269 1103 LEU B CG  
741 C CD1 . LEU B 60 ? 0.9266 0.9004 0.9196 -0.0971 -0.0142 -0.0312 1103 LEU B CD1 
742 C CD2 . LEU B 60 ? 0.9687 0.9025 0.9514 -0.1254 -0.0094 -0.0043 1103 LEU B CD2 
743 N N   . ARG B 61 ? 0.5393 0.5788 0.4900 -0.1347 -0.0165 -0.0535 1104 ARG B N   
744 C CA  . ARG B 61 ? 0.5826 0.6275 0.5048 -0.1205 -0.0251 -0.0809 1104 ARG B CA  
745 C C   . ARG B 61 ? 0.6864 0.7443 0.5725 -0.0971 -0.0063 -0.0805 1104 ARG B C   
746 O O   . ARG B 61 ? 0.7701 0.8283 0.6392 -0.0792 -0.0098 -0.1093 1104 ARG B O   
747 C CB  . ARG B 61 ? 0.6689 0.7292 0.5710 -0.1179 -0.0411 -0.0842 1104 ARG B CB  
748 C CG  . ARG B 61 ? 0.7534 0.8345 0.6233 -0.0932 -0.0609 -0.1230 1104 ARG B CG  
749 C CD  . ARG B 61 ? 0.9481 1.0570 0.7971 -0.0782 -0.0833 -0.1292 1104 ARG B CD  
750 N NE  . ARG B 61 ? 1.0705 1.1667 0.8659 -0.0601 -0.0640 -0.0832 1104 ARG B NE  
751 C CZ  . ARG B 61 ? 1.1464 1.2506 0.9189 -0.0436 -0.0753 -0.0719 1104 ARG B CZ  
752 N NH1 . ARG B 61 ? 1.1179 1.2614 0.9239 -0.0422 -0.1100 -0.1079 1104 ARG B NH1 
753 N NH2 . ARG B 61 ? 1.1901 1.2623 0.9132 -0.0280 -0.0483 -0.0272 1104 ARG B NH2 
754 N N   . SER B 62 ? 0.6407 0.7071 0.5202 -0.0985 0.0189  -0.0507 1105 SER B N   
755 C CA  . SER B 62 ? 0.7295 0.8072 0.5817 -0.0803 0.0527  -0.0438 1105 SER B CA  
756 C C   . SER B 62 ? 0.7184 0.8118 0.6053 -0.0741 0.0607  -0.0621 1105 SER B C   
757 O O   . SER B 62 ? 0.7081 0.8087 0.5623 -0.0485 0.0734  -0.0781 1105 SER B O   
758 C CB  . SER B 62 ? 0.7088 0.7852 0.5730 -0.0948 0.0892  -0.0101 1105 SER B CB  
759 O OG  . SER B 62 ? 0.8381 0.9221 0.6825 -0.0809 0.1361  -0.0001 1105 SER B OG  
760 N N   . ASP B 63 ? 0.6198 0.7204 0.5656 -0.0890 0.0518  -0.0614 1106 ASP B N   
761 C CA  . ASP B 63 ? 0.6539 0.7733 0.6341 -0.0734 0.0559  -0.0775 1106 ASP B CA  
762 C C   . ASP B 63 ? 0.7416 0.8276 0.7003 -0.0534 0.0387  -0.1035 1106 ASP B C   
763 O O   . ASP B 63 ? 0.6726 0.7683 0.6315 -0.0287 0.0495  -0.1221 1106 ASP B O   
764 C CB  . ASP B 63 ? 0.5918 0.7298 0.6271 -0.0807 0.0429  -0.0727 1106 ASP B CB  
765 C CG  . ASP B 63 ? 0.7087 0.8950 0.7937 -0.0994 0.0644  -0.0668 1106 ASP B CG  
766 O OD1 . ASP B 63 ? 0.5695 0.7750 0.6574 -0.1028 0.1023  -0.0643 1106 ASP B OD1 
767 O OD2 . ASP B 63 ? 0.5140 0.7172 0.6366 -0.1103 0.0474  -0.0672 1106 ASP B OD2 
768 N N   . ILE B 64 ? 0.6718 0.7181 0.6202 -0.0654 0.0162  -0.1090 1107 ILE B N   
769 C CA  . ILE B 64 ? 0.7880 0.7931 0.7321 -0.0552 0.0059  -0.1405 1107 ILE B CA  
770 C C   . ILE B 64 ? 0.8549 0.8741 0.7587 -0.0356 0.0068  -0.1737 1107 ILE B C   
771 O O   . ILE B 64 ? 0.9451 0.9503 0.8441 -0.0129 0.0102  -0.2031 1107 ILE B O   
772 C CB  . ILE B 64 ? 0.7835 0.7477 0.7443 -0.0806 -0.0088 -0.1443 1107 ILE B CB  
773 C CG1 . ILE B 64 ? 0.8075 0.7462 0.7894 -0.0862 -0.0044 -0.1110 1107 ILE B CG1 
774 C CG2 . ILE B 64 ? 0.7393 0.6587 0.7105 -0.0792 -0.0132 -0.1883 1107 ILE B CG2 
775 C CD1 . ILE B 64 ? 0.7815 0.6772 0.7804 -0.1115 -0.0042 -0.1062 1107 ILE B CD1 
776 N N   . GLN B 65 ? 0.8610 0.9059 0.7264 -0.0360 0.0036  -0.1694 1108 GLN B N   
777 C CA  . GLN B 65 ? 0.9670 1.0297 0.7710 -0.0042 0.0020  -0.1986 1108 GLN B CA  
778 C C   . GLN B 65 ? 0.9691 1.0502 0.7493 0.0247  0.0360  -0.1944 1108 GLN B C   
779 O O   . GLN B 65 ? 0.9849 1.0683 0.7271 0.0566  0.0347  -0.2322 1108 GLN B O   
780 C CB  . GLN B 65 ? 1.0384 1.1214 0.7897 0.0037  -0.0024 -0.1805 1108 GLN B CB  
781 C CG  . GLN B 65 ? 1.0969 1.1817 0.8663 -0.0109 -0.0419 -0.2056 1108 GLN B CG  
782 C CD  . GLN B 65 ? 1.2152 1.3202 0.9294 0.0074  -0.0481 -0.1834 1108 GLN B CD  
783 O OE1 . GLN B 65 ? 1.2337 1.3304 0.9137 0.0136  -0.0151 -0.1334 1108 GLN B OE1 
784 N NE2 . GLN B 65 ? 1.2470 1.3782 0.9581 0.0180  -0.0886 -0.2240 1108 GLN B NE2 
785 N N   . LYS B 66 ? 0.8971 0.9975 0.7076 0.0133  0.0672  -0.1551 1109 LYS B N   
786 C CA  . LYS B 66 ? 1.0213 1.1535 0.8305 0.0344  0.1091  -0.1500 1109 LYS B CA  
787 C C   . LYS B 66 ? 1.0800 1.2125 0.9253 0.0532  0.1042  -0.1813 1109 LYS B C   
788 O O   . LYS B 66 ? 1.1178 1.2695 0.9383 0.0858  0.1277  -0.2003 1109 LYS B O   
789 C CB  . LYS B 66 ? 0.9851 1.1465 0.8455 0.0085  0.1430  -0.1113 1109 LYS B CB  
790 C CG  . LYS B 66 ? 1.0770 1.2297 0.8862 0.0039  0.1746  -0.0762 1109 LYS B CG  
791 C CD  . LYS B 66 ? 1.0916 1.2588 0.9708 -0.0341 0.2032  -0.0464 1109 LYS B CD  
792 C CE  . LYS B 66 ? 1.1088 1.3321 1.0845 -0.0437 0.2242  -0.0620 1109 LYS B CE  
793 N NZ  . LYS B 66 ? 1.1753 1.4267 1.1340 -0.0153 0.2715  -0.0704 1109 LYS B NZ  
794 N N   . ARG B 67 ? 1.0200 1.1258 0.9153 0.0398  0.0778  -0.1842 1110 ARG B N   
795 C CA  . ARG B 67 ? 1.1078 1.1952 1.0264 0.0667  0.0731  -0.2097 1110 ARG B CA  
796 C C   . ARG B 67 ? 1.1961 1.2348 1.0749 0.0828  0.0572  -0.2546 1110 ARG B C   
797 O O   . ARG B 67 ? 1.2396 1.2672 1.1137 0.1161  0.0639  -0.2857 1110 ARG B O   
798 C CB  . ARG B 67 ? 1.0949 1.1541 1.0589 0.0590  0.0547  -0.1926 1110 ARG B CB  
799 C CG  . ARG B 67 ? 1.1295 1.2420 1.1426 0.0838  0.0645  -0.1864 1110 ARG B CG  
800 C CD  . ARG B 67 ? 1.1704 1.2922 1.2176 0.0717  0.0463  -0.1602 1110 ARG B CD  
801 N NE  . ARG B 67 ? 1.1616 1.3626 1.2677 0.0962  0.0485  -0.1664 1110 ARG B NE  
802 C CZ  . ARG B 67 ? 1.1208 1.4065 1.2807 0.0753  0.0679  -0.1684 1110 ARG B CZ  
803 N NH1 . ARG B 67 ? 1.1334 1.4186 1.2778 0.0351  0.0909  -0.1540 1110 ARG B NH1 
804 N NH2 . ARG B 67 ? 1.1294 1.5001 1.3632 0.0969  0.0662  -0.1875 1110 ARG B NH2 
805 N N   . LEU B 68 ? 1.1302 1.1469 0.9868 0.0606  0.0350  -0.2654 1111 LEU B N   
806 C CA  . LEU B 68 ? 1.2279 1.2145 1.0605 0.0710  0.0142  -0.3231 1111 LEU B CA  
807 C C   . LEU B 68 ? 1.3427 1.3695 1.1072 0.1138  0.0256  -0.3508 1111 LEU B C   
808 O O   . LEU B 68 ? 1.4482 1.4576 1.1910 0.1374  0.0111  -0.4100 1111 LEU B O   
809 C CB  . LEU B 68 ? 1.1136 1.0940 0.9523 0.0392  -0.0146 -0.3348 1111 LEU B CB  
810 C CG  . LEU B 68 ? 1.1447 1.0813 1.0165 0.0261  -0.0393 -0.3997 1111 LEU B CG  
811 N N   . GLN B 69 ? 1.3640 1.4401 1.0952 0.1247  0.0569  -0.3093 1112 GLN B N   
812 C CA  . GLN B 69 ? 1.4645 1.5747 1.1130 0.1695  0.0808  -0.3213 1112 GLN B CA  
813 C C   . GLN B 69 ? 1.5602 1.6814 1.2093 0.2065  0.1077  -0.3461 1112 GLN B C   
814 O O   . GLN B 69 ? 1.6461 1.8021 1.2340 0.2433  0.1453  -0.3421 1112 GLN B O   
815 C CB  . GLN B 69 ? 1.4714 1.6142 1.0871 0.1661  0.1222  -0.2609 1112 GLN B CB  
816 C CG  . GLN B 69 ? 1.5496 1.6914 1.0772 0.1823  0.1077  -0.2543 1112 GLN B CG  
817 C CD  . GLN B 69 ? 1.5731 1.7198 1.0789 0.1718  0.1537  -0.1859 1112 GLN B CD  
818 O OE1 . GLN B 69 ? 1.6203 1.7829 1.1314 0.1755  0.2144  -0.1541 1112 GLN B OE1 
819 N NE2 . GLN B 69 ? 1.5586 1.6906 1.0484 0.1575  0.1294  -0.1658 1112 GLN B NE2 
820 N N   . GLU B 70 ? 1.5206 1.6075 1.2329 0.2023  0.0937  -0.3690 1113 GLU B N   
821 C CA  . GLU B 70 ? 1.5541 1.6445 1.2664 0.2455  0.1125  -0.4022 1113 GLU B CA  
822 C C   . GLU B 70 ? 1.6384 1.6733 1.3267 0.2648  0.0792  -0.4748 1113 GLU B C   
823 O O   . GLU B 70 ? 1.7437 1.7932 1.3754 0.3103  0.0874  -0.5193 1113 GLU B O   
824 C CB  . GLU B 70 ? 1.5312 1.6208 1.3256 0.2436  0.1228  -0.3801 1113 GLU B CB  
825 C CG  . GLU B 70 ? 1.6036 1.6105 1.4273 0.2520  0.0962  -0.4123 1113 GLU B CG  
826 C CD  . GLU B 70 ? 1.6215 1.6341 1.4981 0.2818  0.1085  -0.3984 1113 GLU B CD  
827 O OE1 . GLU B 70 ? 1.6244 1.7177 1.5175 0.3088  0.1382  -0.3926 1113 GLU B OE1 
828 O OE2 . GLU B 70 ? 1.6177 1.5543 1.5194 0.2828  0.0914  -0.3945 1113 GLU B OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  90   ?    ?   ?   A . n 
A 1 2  PRO 2  91   ?    ?   ?   A . n 
A 1 3  LEU 3  92   ?    ?   ?   A . n 
A 1 4  GLY 4  93   93   GLY GLY A . n 
A 1 5  SER 5  94   94   SER SER A . n 
A 1 6  VAL 6  95   95   VAL VAL A . n 
A 1 7  TRP 7  96   96   TRP TRP A . n 
A 1 8  GLN 8  97   97   GLN GLN A . n 
A 1 9  LEU 9  98   98   LEU LEU A . n 
A 1 10 ILE 10 99   99   ILE ILE A . n 
A 1 11 SER 11 100  100  SER SER A . n 
A 1 12 LYS 12 101  101  LYS LYS A . n 
A 1 13 VAL 13 102  102  VAL VAL A . n 
A 1 14 LEU 14 103  103  LEU LEU A . n 
A 1 15 ALA 15 104  104  ALA ALA A . n 
A 1 16 ARG 16 105  105  ARG ARG A . n 
A 1 17 HIS 17 106  106  HIS HIS A . n 
A 1 18 PHE 18 107  107  PHE PHE A . n 
A 1 19 SER 19 108  108  SER SER A . n 
A 1 20 ALA 20 109  109  ALA ALA A . n 
A 1 21 ALA 21 110  110  ALA ALA A . n 
A 1 22 ASP 22 111  111  ASP ASP A . n 
A 1 23 ALA 23 112  112  ALA ALA A . n 
A 1 24 SER 24 113  113  SER SER A . n 
A 1 25 ARG 25 114  114  ARG ARG A . n 
A 1 26 VAL 26 115  115  VAL VAL A . n 
A 1 27 LEU 27 116  116  LEU LEU A . n 
A 1 28 GLU 28 117  117  GLU GLU A . n 
A 1 29 GLN 29 118  118  GLN GLN A . n 
A 1 30 LEU 30 119  119  LEU LEU A . n 
A 1 31 GLN 31 120  120  GLN GLN A . n 
A 1 32 ARG 32 121  121  ARG ARG A . n 
A 1 33 ASP 33 122  122  ASP ASP A . n 
A 1 34 TYR 34 123  123  TYR TYR A . n 
A 1 35 GLU 35 124  124  GLU GLU A . n 
A 1 36 ARG 36 125  125  ARG ARG A . n 
A 1 37 SER 37 126  126  SER SER A . n 
A 1 38 LEU 38 127  127  LEU LEU A . n 
A 1 39 SER 39 128  128  SER SER A . n 
A 1 40 ARG 40 129  129  ARG ARG A . n 
A 1 41 LEU 41 130  130  LEU LEU A . n 
A 1 42 THR 42 131  131  THR THR A . n 
A 1 43 LEU 43 132  132  LEU LEU A . n 
A 1 44 ASP 44 133  133  ASP ASP A . n 
A 1 45 ASP 45 134  134  ASP ASP A . n 
A 1 46 ILE 46 135  135  ILE ILE A . n 
A 1 47 GLU 47 136  136  GLU GLU A . n 
A 1 48 ARG 48 137  137  ARG ARG A . n 
A 1 49 LEU 49 138  138  LEU LEU A . n 
A 1 50 ALA 50 139  139  ALA ALA A . n 
A 1 51 SER 51 140  140  SER SER A . n 
A 1 52 ARG 52 141  141  ARG ARG A . n 
A 1 53 PHE 53 142  142  PHE PHE A . n 
A 1 54 LEU 54 143  143  LEU LEU A . n 
A 1 55 HIS 55 144  ?    ?   ?   A . n 
A 1 56 PRO 56 145  ?    ?   ?   A . n 
A 1 57 GLU 57 146  ?    ?   ?   A . n 
A 1 58 VAL 58 147  ?    ?   ?   A . n 
B 2 1  GLY 1  1044 ?    ?   ?   B . n 
B 2 2  PRO 2  1045 ?    ?   ?   B . n 
B 2 3  LEU 3  1046 ?    ?   ?   B . n 
B 2 4  GLY 4  1047 ?    ?   ?   B . n 
B 2 5  SER 5  1048 ?    ?   ?   B . n 
B 2 6  ALA 6  1049 ?    ?   ?   B . n 
B 2 7  LYS 7  1050 ?    ?   ?   B . n 
B 2 8  ARG 8  1051 ?    ?   ?   B . n 
B 2 9  ARG 9  1052 ?    ?   ?   B . n 
B 2 10 LYS 10 1053 ?    ?   ?   B . n 
B 2 11 THR 11 1054 ?    ?   ?   B . n 
B 2 12 MET 12 1055 ?    ?   ?   B . n 
B 2 13 GLN 13 1056 ?    ?   ?   B . n 
B 2 14 GLY 14 1057 ?    ?   ?   B . n 
B 2 15 GLU 15 1058 1058 GLU GLU B . n 
B 2 16 GLY 16 1059 1059 GLY GLY B . n 
B 2 17 PRO 17 1060 1060 PRO PRO B . n 
B 2 18 GLN 18 1061 1061 GLN GLN B . n 
B 2 19 LEU 19 1062 1062 LEU LEU B . n 
B 2 20 LEU 20 1063 1063 LEU LEU B . n 
B 2 21 LEU 21 1064 1064 LEU LEU B . n 
B 2 22 SER 22 1065 1065 SER SER B . n 
B 2 23 GLU 23 1066 1066 GLU GLU B . n 
B 2 24 ALA 24 1067 1067 ALA ALA B . n 
B 2 25 VAL 25 1068 1068 VAL VAL B . n 
B 2 26 SER 26 1069 1069 SER SER B . n 
B 2 27 ARG 27 1070 1070 ARG ARG B . n 
B 2 28 ALA 28 1071 1071 ALA ALA B . n 
B 2 29 ALA 29 1072 1072 ALA ALA B . n 
B 2 30 LYS 30 1073 1073 LYS LYS B . n 
B 2 31 ALA 31 1074 1074 ALA ALA B . n 
B 2 32 ALA 32 1075 1075 ALA ALA B . n 
B 2 33 GLY 33 1076 1076 GLY GLY B . n 
B 2 34 ALA 34 1077 1077 ALA ALA B . n 
B 2 35 ARG 35 1078 1078 ARG ARG B . n 
B 2 36 PRO 36 1079 1079 PRO PRO B . n 
B 2 37 LEU 37 1080 1080 LEU LEU B . n 
B 2 38 THR 38 1081 1081 THR THR B . n 
B 2 39 SER 39 1082 1082 SER SER B . n 
B 2 40 PRO 40 1083 1083 PRO PRO B . n 
B 2 41 GLU 41 1084 1084 GLU GLU B . n 
B 2 42 SER 42 1085 1085 SER SER B . n 
B 2 43 LEU 43 1086 1086 LEU LEU B . n 
B 2 44 SER 44 1087 1087 SER SER B . n 
B 2 45 ARG 45 1088 1088 ARG ARG B . n 
B 2 46 ASP 46 1089 1089 ASP ASP B . n 
B 2 47 LEU 47 1090 1090 LEU LEU B . n 
B 2 48 GLU 48 1091 1091 GLU GLU B . n 
B 2 49 ALA 49 1092 1092 ALA ALA B . n 
B 2 50 PRO 50 1093 1093 PRO PRO B . n 
B 2 51 GLU 51 1094 1094 GLU GLU B . n 
B 2 52 VAL 52 1095 1095 VAL VAL B . n 
B 2 53 GLN 53 1096 1096 GLN GLN B . n 
B 2 54 GLU 54 1097 1097 GLU GLU B . n 
B 2 55 SER 55 1098 1098 SER SER B . n 
B 2 56 TYR 56 1099 1099 TYR TYR B . n 
B 2 57 ARG 57 1100 1100 ARG ARG B . n 
B 2 58 GLN 58 1101 1101 GLN GLN B . n 
B 2 59 GLN 59 1102 1102 GLN GLN B . n 
B 2 60 LEU 60 1103 1103 LEU LEU B . n 
B 2 61 ARG 61 1104 1104 ARG ARG B . n 
B 2 62 SER 62 1105 1105 SER SER B . n 
B 2 63 ASP 63 1106 1106 ASP ASP B . n 
B 2 64 ILE 64 1107 1107 ILE ILE B . n 
B 2 65 GLN 65 1108 1108 GLN GLN B . n 
B 2 66 LYS 66 1109 1109 LYS LYS B . n 
B 2 67 ARG 67 1110 1110 ARG ARG B . n 
B 2 68 LEU 68 1111 1111 LEU LEU B . n 
B 2 69 GLN 69 1112 1112 GLN GLN B . n 
B 2 70 GLU 70 1113 1113 GLU GLU B . n 
B 2 71 ASP 71 1114 ?    ?   ?   B . n 
B 2 72 PRO 72 1115 ?    ?   ?   B . n 
B 2 73 ASN 73 1116 ?    ?   ?   B . n 
B 2 74 TYR 74 1117 ?    ?   ?   B . n 
B 2 75 SER 75 1118 ?    ?   ?   B . n 
B 2 76 PRO 76 1119 ?    ?   ?   B . n 
B 2 77 GLN 77 1120 ?    ?   ?   B . n 
B 2 78 ARG 78 1121 ?    ?   ?   B . n 
B 2 79 PHE 79 1122 ?    ?   ?   B . n 
B 2 80 PRO 80 1123 ?    ?   ?   B . n 
B 2 81 ASN 81 1124 ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CPS 1  1201 1  CPS CPS B . 
D 4 SO4 1  1202 2  SO4 SO4 B . 
E 4 SO4 1  1203 3  SO4 SO4 B . 
F 5 HOH 1  201  22 HOH HOH A . 
F 5 HOH 2  202  8  HOH HOH A . 
F 5 HOH 3  203  10 HOH HOH A . 
F 5 HOH 4  204  19 HOH HOH A . 
F 5 HOH 5  205  7  HOH HOH A . 
F 5 HOH 6  206  1  HOH HOH A . 
F 5 HOH 7  207  14 HOH HOH A . 
F 5 HOH 8  208  18 HOH HOH A . 
F 5 HOH 9  209  3  HOH HOH A . 
F 5 HOH 10 210  6  HOH HOH A . 
F 5 HOH 11 211  13 HOH HOH A . 
G 5 HOH 1  1301 15 HOH HOH B . 
G 5 HOH 2  1302 17 HOH HOH B . 
G 5 HOH 3  1303 20 HOH HOH B . 
G 5 HOH 4  1304 23 HOH HOH B . 
G 5 HOH 5  1305 2  HOH HOH B . 
G 5 HOH 6  1306 4  HOH HOH B . 
G 5 HOH 7  1307 9  HOH HOH B . 
G 5 HOH 8  1308 11 HOH HOH B . 
G 5 HOH 9  1309 12 HOH HOH B . 
G 5 HOH 10 1310 16 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3720 ? 
1 MORE         -69  ? 
1 'SSA (A^2)'  7050 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-02-25 
2 'Structure model' 1 1 2015-03-11 
3 'Structure model' 1 2 2015-04-22 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Database references'  
3 4 'Structure model' 'Data collection'      
4 4 'Structure model' 'Database references'  
5 4 'Structure model' 'Derived calculations' 
6 4 'Structure model' 'Source and taxonomy'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' diffrn_detector       
3 4 'Structure model' diffrn_source         
4 4 'Structure model' entity_src_gen        
5 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_diffrn_detector.detector'                 
3 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
4 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
5 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -77.2316 165.9382 9.0552  0.3471 0.3169 0.3961 -0.0016 -0.0072 -0.0154 5.0544 2.0831 2.8500 1.0954 
2.8645  2.2815  -0.1113 -0.2270 -0.0349 0.0928  -0.0421 -0.0313 -0.1373 0.4467  0.2045  
'X-RAY DIFFRACTION' 2 ? refined -71.3769 155.1994 6.9386  0.5612 0.4041 0.4869 0.0745  0.0298  0.0164  8.7028 8.4833 8.3037 3.6085 
2.9484  6.6606  -0.1976 0.4142  -0.8760 0.4378  0.4611  -0.4178 1.1317  1.2046  -0.2032 
'X-RAY DIFFRACTION' 3 ? refined -87.1387 143.0609 -3.6862 1.2531 0.6312 0.9206 -0.1659 -0.0057 -0.2394 9.8092 3.3297 7.7572 
-4.0297 -0.2798 -0.0818 1.0473  0.5814  -2.2358 -1.7235 -0.1859 0.0345  1.6389  -1.3207 -0.9229 
'X-RAY DIFFRACTION' 4 ? refined -79.9480 151.5149 10.4981 0.8234 0.4421 0.5139 -0.0563 0.0639  0.0144  4.2390 5.8122 5.8907 2.7020 
4.4326  3.3021  0.5602  -0.3943 -0.4740 1.1723  -0.5143 0.1742  2.4476  -0.8358 -0.2079 
'X-RAY DIFFRACTION' 5 ? refined -76.7109 160.9989 21.8940 0.6364 0.4452 0.4069 -0.0488 -0.0205 0.0093  3.6661 1.8904 3.0140 
-0.0328 -2.6990 -0.0364 -0.5326 -1.0620 -0.0897 1.5758  0.8257  -0.1447 0.9262  -0.2382 -0.8096 
'X-RAY DIFFRACTION' 6 ? refined -86.1906 162.2821 15.3656 0.6413 0.6233 0.5576 -0.1883 0.0089  0.0773  3.2874 7.3783 1.9993 
-3.1769 2.4331  0.2972  0.2110  -0.6251 -0.4057 0.7906  -0.3468 0.7070  0.5224  -3.4694 -0.5495 
'X-RAY DIFFRACTION' 7 ? refined -82.2622 155.9141 -4.4459 0.5257 0.5844 0.4799 -0.1365 0.0031  -0.0304 9.7789 9.6417 9.0463 
-6.0411 -3.4318 4.4876  0.3435  0.7931  -0.2829 -0.7236 -0.2253 -0.4001 0.1613  0.3312  -0.1132 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 93 through 108 )
;
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 109 through 129 )
;
'X-RAY DIFFRACTION' 3 3 ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 130 through 143 )
;
'X-RAY DIFFRACTION' 4 4 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 1058 through 1075 )
;
'X-RAY DIFFRACTION' 5 5 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 1076 through 1082 )
;
'X-RAY DIFFRACTION' 6 6 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 1083 through 1092 )
;
'X-RAY DIFFRACTION' 7 7 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 1093 through 1113 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? '(phenix.refine: 1.9_1692)' 1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.1.27                      2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15                        3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? .                           4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .                           5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    THR 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     1081 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -94.10 
_pdbx_validate_torsion.psi             -95.11 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 125  ? NE  ? A ARG 36 NE  
2  1 Y 1 A ARG 125  ? CZ  ? A ARG 36 CZ  
3  1 Y 1 A ARG 125  ? NH1 ? A ARG 36 NH1 
4  1 Y 1 A ARG 125  ? NH2 ? A ARG 36 NH2 
5  1 Y 1 A ARG 129  ? NE  ? A ARG 40 NE  
6  1 Y 1 A ARG 129  ? CZ  ? A ARG 40 CZ  
7  1 Y 1 A ARG 129  ? NH1 ? A ARG 40 NH1 
8  1 Y 1 A ARG 129  ? NH2 ? A ARG 40 NH2 
9  1 Y 1 A LEU 132  ? CD1 ? A LEU 43 CD1 
10 1 Y 1 A LEU 132  ? CD2 ? A LEU 43 CD2 
11 1 Y 1 A ASP 133  ? OD1 ? A ASP 44 OD1 
12 1 Y 1 A ASP 133  ? OD2 ? A ASP 44 OD2 
13 1 Y 1 A GLU 136  ? CG  ? A GLU 47 CG  
14 1 Y 1 A GLU 136  ? CD  ? A GLU 47 CD  
15 1 Y 1 A GLU 136  ? OE1 ? A GLU 47 OE1 
16 1 Y 1 A GLU 136  ? OE2 ? A GLU 47 OE2 
17 1 Y 1 A ARG 137  ? CD  ? A ARG 48 CD  
18 1 Y 1 A ARG 137  ? NE  ? A ARG 48 NE  
19 1 Y 1 A ARG 137  ? CZ  ? A ARG 48 CZ  
20 1 Y 1 A ARG 137  ? NH1 ? A ARG 48 NH1 
21 1 Y 1 A ARG 137  ? NH2 ? A ARG 48 NH2 
22 1 Y 1 A SER 140  ? OG  ? A SER 51 OG  
23 1 Y 1 B LEU 1111 ? CD1 ? B LEU 68 CD1 
24 1 Y 1 B LEU 1111 ? CD2 ? B LEU 68 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 90   ? A GLY 1  
2  1 Y 1 A PRO 91   ? A PRO 2  
3  1 Y 1 A LEU 92   ? A LEU 3  
4  1 Y 1 A HIS 144  ? A HIS 55 
5  1 Y 1 A PRO 145  ? A PRO 56 
6  1 Y 1 A GLU 146  ? A GLU 57 
7  1 Y 1 A VAL 147  ? A VAL 58 
8  1 Y 1 B GLY 1044 ? B GLY 1  
9  1 Y 1 B PRO 1045 ? B PRO 2  
10 1 Y 1 B LEU 1046 ? B LEU 3  
11 1 Y 1 B GLY 1047 ? B GLY 4  
12 1 Y 1 B SER 1048 ? B SER 5  
13 1 Y 1 B ALA 1049 ? B ALA 6  
14 1 Y 1 B LYS 1050 ? B LYS 7  
15 1 Y 1 B ARG 1051 ? B ARG 8  
16 1 Y 1 B ARG 1052 ? B ARG 9  
17 1 Y 1 B LYS 1053 ? B LYS 10 
18 1 Y 1 B THR 1054 ? B THR 11 
19 1 Y 1 B MET 1055 ? B MET 12 
20 1 Y 1 B GLN 1056 ? B GLN 13 
21 1 Y 1 B GLY 1057 ? B GLY 14 
22 1 Y 1 B ASP 1114 ? B ASP 71 
23 1 Y 1 B PRO 1115 ? B PRO 72 
24 1 Y 1 B ASN 1116 ? B ASN 73 
25 1 Y 1 B TYR 1117 ? B TYR 74 
26 1 Y 1 B SER 1118 ? B SER 75 
27 1 Y 1 B PRO 1119 ? B PRO 76 
28 1 Y 1 B GLN 1120 ? B GLN 77 
29 1 Y 1 B ARG 1121 ? B ARG 78 
30 1 Y 1 B PHE 1122 ? B PHE 79 
31 1 Y 1 B PRO 1123 ? B PRO 80 
32 1 Y 1 B ASN 1124 ? B ASN 81 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' CPS 
4 'SULFATE ION'                                               SO4 
5 water                                                       HOH 
#