data_4X8G
# 
_entry.id   4X8G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4X8G         
WWPDB D_1000205243 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          4X8C 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4X8G 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lewis, H.D.'   1 
'Bax, B.D.'     2 
'Chung, C.-W.'  3 
'Polyakova, O.' 4 
'Thorpe, J.'    5 
# 
_citation.id                        primary 
_citation.title                     'Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation.' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            11 
_citation.page_first                189 
_citation.page_last                 191 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4469 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25622091 
_citation.pdbx_database_id_DOI      10.1038/nchembio.1735 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lewis, H.D.'    1  
primary 'Liddle, J.'     2  
primary 'Coote, J.E.'    3  
primary 'Atkinson, S.J.' 4  
primary 'Barker, M.D.'   5  
primary 'Bax, B.D.'      6  
primary 'Bicker, K.L.'   7  
primary 'Bingham, R.P.'  8  
primary 'Campbell, M.'   9  
primary 'Chen, Y.H.'     10 
primary 'Chung, C.W.'    11 
primary 'Craggs, P.D.'   12 
primary 'Davis, R.P.'    13 
primary 'Eberhard, D.'   14 
primary 'Joberty, G.'    15 
primary 'Lind, K.E.'     16 
primary 'Locke, K.'      17 
primary 'Maller, C.'     18 
primary 'Martinod, K.'   19 
primary 'Patten, C.'     20 
primary 'Polyakova, O.'  21 
primary 'Rise, C.E.'     22 
primary 'Rudiger, M.'    23 
primary 'Sheppard, R.J.' 24 
primary 'Slade, D.J.'    25 
primary 'Thomas, P.'     26 
primary 'Thorpe, J.'     27 
primary 'Yao, G.'        28 
primary 'Drewes, G.'     29 
primary 'Wagner, D.D.'   30 
primary 'Thompson, P.R.' 31 
primary 'Prinjha, R.K.'  32 
primary 'Wilson, D.M.'   33 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   124.71 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4X8G 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     150.990 
_cell.length_a_esd                 ? 
_cell.length_b                     62.250 
_cell.length_b_esd                 ? 
_cell.length_c                     116.750 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4X8G 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein-arginine deiminase type-4' 74917.836 1  3.5.3.15 C645A ? ? 
2 non-polymer syn 'CALCIUM ION' 40.078    4  ?        ?     ? ? 
3 non-polymer syn 
'[(3R)-3-aminopiperidin-1-yl][2-(1-ethyl-1H-pyrrolo[2,3-b]pyridin-2-yl)-7-methoxy-1-methyl-1H-benzimidazol-5-yl]methanone' 432.518 
1  ?        ?     ? ? 
4 water       nat water 18.015    24 ?        ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HL-60 PAD,Peptidylarginine deiminase IV,Protein-arginine deiminase type IV' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSPEFMAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPLDP
GVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLV
NCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPK
WPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTPNTQPPQEVYACS
IFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYV
TRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHV
DEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNREL
LKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFIND
FFTYHIRHGEVHAGTNVRRKPFSFKWWNMVP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSPEFMAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPLDP
GVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLV
NCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPK
WPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTPNTQPPQEVYACS
IFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYV
TRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHV
DEFLSFVPAPDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNREL
LKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFIND
FFTYHIRHGEVHAGTNVRRKPFSFKWWNMVP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   PRO n 
1 7   GLU n 
1 8   PHE n 
1 9   MET n 
1 10  ALA n 
1 11  GLN n 
1 12  GLY n 
1 13  THR n 
1 14  LEU n 
1 15  ILE n 
1 16  ARG n 
1 17  VAL n 
1 18  THR n 
1 19  PRO n 
1 20  GLU n 
1 21  GLN n 
1 22  PRO n 
1 23  THR n 
1 24  HIS n 
1 25  ALA n 
1 26  VAL n 
1 27  CYS n 
1 28  VAL n 
1 29  LEU n 
1 30  GLY n 
1 31  THR n 
1 32  LEU n 
1 33  THR n 
1 34  GLN n 
1 35  LEU n 
1 36  ASP n 
1 37  ILE n 
1 38  CYS n 
1 39  SER n 
1 40  SER n 
1 41  ALA n 
1 42  PRO n 
1 43  GLU n 
1 44  ASP n 
1 45  CYS n 
1 46  THR n 
1 47  SER n 
1 48  PHE n 
1 49  SER n 
1 50  ILE n 
1 51  ASN n 
1 52  ALA n 
1 53  SER n 
1 54  PRO n 
1 55  GLY n 
1 56  VAL n 
1 57  VAL n 
1 58  VAL n 
1 59  ASP n 
1 60  ILE n 
1 61  ALA n 
1 62  HIS n 
1 63  GLY n 
1 64  PRO n 
1 65  PRO n 
1 66  ALA n 
1 67  LYS n 
1 68  LYS n 
1 69  LYS n 
1 70  SER n 
1 71  THR n 
1 72  GLY n 
1 73  SER n 
1 74  SER n 
1 75  THR n 
1 76  TRP n 
1 77  PRO n 
1 78  LEU n 
1 79  ASP n 
1 80  PRO n 
1 81  GLY n 
1 82  VAL n 
1 83  GLU n 
1 84  VAL n 
1 85  THR n 
1 86  LEU n 
1 87  THR n 
1 88  MET n 
1 89  LYS n 
1 90  VAL n 
1 91  ALA n 
1 92  SER n 
1 93  GLY n 
1 94  SER n 
1 95  THR n 
1 96  GLY n 
1 97  ASP n 
1 98  GLN n 
1 99  LYS n 
1 100 VAL n 
1 101 GLN n 
1 102 ILE n 
1 103 SER n 
1 104 TYR n 
1 105 TYR n 
1 106 GLY n 
1 107 PRO n 
1 108 LYS n 
1 109 THR n 
1 110 PRO n 
1 111 PRO n 
1 112 VAL n 
1 113 LYS n 
1 114 ALA n 
1 115 LEU n 
1 116 LEU n 
1 117 TYR n 
1 118 LEU n 
1 119 THR n 
1 120 GLY n 
1 121 VAL n 
1 122 GLU n 
1 123 ILE n 
1 124 SER n 
1 125 LEU n 
1 126 CYS n 
1 127 ALA n 
1 128 ASP n 
1 129 ILE n 
1 130 THR n 
1 131 ARG n 
1 132 THR n 
1 133 GLY n 
1 134 LYS n 
1 135 VAL n 
1 136 LYS n 
1 137 PRO n 
1 138 THR n 
1 139 ARG n 
1 140 ALA n 
1 141 VAL n 
1 142 LYS n 
1 143 ASP n 
1 144 GLN n 
1 145 ARG n 
1 146 THR n 
1 147 TRP n 
1 148 THR n 
1 149 TRP n 
1 150 GLY n 
1 151 PRO n 
1 152 CYS n 
1 153 GLY n 
1 154 GLN n 
1 155 GLY n 
1 156 ALA n 
1 157 ILE n 
1 158 LEU n 
1 159 LEU n 
1 160 VAL n 
1 161 ASN n 
1 162 CYS n 
1 163 ASP n 
1 164 ARG n 
1 165 ASP n 
1 166 ASN n 
1 167 LEU n 
1 168 GLU n 
1 169 SER n 
1 170 SER n 
1 171 ALA n 
1 172 MET n 
1 173 ASP n 
1 174 CYS n 
1 175 GLU n 
1 176 ASP n 
1 177 ASP n 
1 178 GLU n 
1 179 VAL n 
1 180 LEU n 
1 181 ASP n 
1 182 SER n 
1 183 GLU n 
1 184 ASP n 
1 185 LEU n 
1 186 GLN n 
1 187 ASP n 
1 188 MET n 
1 189 SER n 
1 190 LEU n 
1 191 MET n 
1 192 THR n 
1 193 LEU n 
1 194 SER n 
1 195 THR n 
1 196 LYS n 
1 197 THR n 
1 198 PRO n 
1 199 LYS n 
1 200 ASP n 
1 201 PHE n 
1 202 PHE n 
1 203 THR n 
1 204 ASN n 
1 205 HIS n 
1 206 THR n 
1 207 LEU n 
1 208 VAL n 
1 209 LEU n 
1 210 HIS n 
1 211 VAL n 
1 212 ALA n 
1 213 ARG n 
1 214 SER n 
1 215 GLU n 
1 216 MET n 
1 217 ASP n 
1 218 LYS n 
1 219 VAL n 
1 220 ARG n 
1 221 VAL n 
1 222 PHE n 
1 223 GLN n 
1 224 ALA n 
1 225 THR n 
1 226 ARG n 
1 227 GLY n 
1 228 LYS n 
1 229 LEU n 
1 230 SER n 
1 231 SER n 
1 232 LYS n 
1 233 CYS n 
1 234 SER n 
1 235 VAL n 
1 236 VAL n 
1 237 LEU n 
1 238 GLY n 
1 239 PRO n 
1 240 LYS n 
1 241 TRP n 
1 242 PRO n 
1 243 SER n 
1 244 HIS n 
1 245 TYR n 
1 246 LEU n 
1 247 MET n 
1 248 VAL n 
1 249 PRO n 
1 250 GLY n 
1 251 GLY n 
1 252 LYS n 
1 253 HIS n 
1 254 ASN n 
1 255 MET n 
1 256 ASP n 
1 257 PHE n 
1 258 TYR n 
1 259 VAL n 
1 260 GLU n 
1 261 ALA n 
1 262 LEU n 
1 263 ALA n 
1 264 PHE n 
1 265 PRO n 
1 266 ASP n 
1 267 THR n 
1 268 ASP n 
1 269 PHE n 
1 270 PRO n 
1 271 GLY n 
1 272 LEU n 
1 273 ILE n 
1 274 THR n 
1 275 LEU n 
1 276 THR n 
1 277 ILE n 
1 278 SER n 
1 279 LEU n 
1 280 LEU n 
1 281 ASP n 
1 282 THR n 
1 283 SER n 
1 284 ASN n 
1 285 LEU n 
1 286 GLU n 
1 287 LEU n 
1 288 PRO n 
1 289 GLU n 
1 290 ALA n 
1 291 VAL n 
1 292 VAL n 
1 293 PHE n 
1 294 GLN n 
1 295 ASP n 
1 296 SER n 
1 297 VAL n 
1 298 VAL n 
1 299 PHE n 
1 300 ARG n 
1 301 VAL n 
1 302 ALA n 
1 303 PRO n 
1 304 TRP n 
1 305 ILE n 
1 306 MET n 
1 307 THR n 
1 308 PRO n 
1 309 ASN n 
1 310 THR n 
1 311 GLN n 
1 312 PRO n 
1 313 PRO n 
1 314 GLN n 
1 315 GLU n 
1 316 VAL n 
1 317 TYR n 
1 318 ALA n 
1 319 CYS n 
1 320 SER n 
1 321 ILE n 
1 322 PHE n 
1 323 GLU n 
1 324 ASN n 
1 325 GLU n 
1 326 ASP n 
1 327 PHE n 
1 328 LEU n 
1 329 LYS n 
1 330 SER n 
1 331 VAL n 
1 332 THR n 
1 333 THR n 
1 334 LEU n 
1 335 ALA n 
1 336 MET n 
1 337 LYS n 
1 338 ALA n 
1 339 LYS n 
1 340 CYS n 
1 341 LYS n 
1 342 LEU n 
1 343 THR n 
1 344 ILE n 
1 345 CYS n 
1 346 PRO n 
1 347 GLU n 
1 348 GLU n 
1 349 GLU n 
1 350 ASN n 
1 351 MET n 
1 352 ASP n 
1 353 ASP n 
1 354 GLN n 
1 355 TRP n 
1 356 MET n 
1 357 GLN n 
1 358 ASP n 
1 359 GLU n 
1 360 MET n 
1 361 GLU n 
1 362 ILE n 
1 363 GLY n 
1 364 TYR n 
1 365 ILE n 
1 366 GLN n 
1 367 ALA n 
1 368 PRO n 
1 369 HIS n 
1 370 LYS n 
1 371 THR n 
1 372 LEU n 
1 373 PRO n 
1 374 VAL n 
1 375 VAL n 
1 376 PHE n 
1 377 ASP n 
1 378 SER n 
1 379 PRO n 
1 380 ARG n 
1 381 ASN n 
1 382 ARG n 
1 383 GLY n 
1 384 LEU n 
1 385 LYS n 
1 386 GLU n 
1 387 PHE n 
1 388 PRO n 
1 389 ILE n 
1 390 LYS n 
1 391 ARG n 
1 392 VAL n 
1 393 MET n 
1 394 GLY n 
1 395 PRO n 
1 396 ASP n 
1 397 PHE n 
1 398 GLY n 
1 399 TYR n 
1 400 VAL n 
1 401 THR n 
1 402 ARG n 
1 403 GLY n 
1 404 PRO n 
1 405 GLN n 
1 406 THR n 
1 407 GLY n 
1 408 GLY n 
1 409 ILE n 
1 410 SER n 
1 411 GLY n 
1 412 LEU n 
1 413 ASP n 
1 414 SER n 
1 415 PHE n 
1 416 GLY n 
1 417 ASN n 
1 418 LEU n 
1 419 GLU n 
1 420 VAL n 
1 421 SER n 
1 422 PRO n 
1 423 PRO n 
1 424 VAL n 
1 425 THR n 
1 426 VAL n 
1 427 ARG n 
1 428 GLY n 
1 429 LYS n 
1 430 GLU n 
1 431 TYR n 
1 432 PRO n 
1 433 LEU n 
1 434 GLY n 
1 435 ARG n 
1 436 ILE n 
1 437 LEU n 
1 438 PHE n 
1 439 GLY n 
1 440 ASP n 
1 441 SER n 
1 442 CYS n 
1 443 TYR n 
1 444 PRO n 
1 445 SER n 
1 446 ASN n 
1 447 ASP n 
1 448 SER n 
1 449 ARG n 
1 450 GLN n 
1 451 MET n 
1 452 HIS n 
1 453 GLN n 
1 454 ALA n 
1 455 LEU n 
1 456 GLN n 
1 457 ASP n 
1 458 PHE n 
1 459 LEU n 
1 460 SER n 
1 461 ALA n 
1 462 GLN n 
1 463 GLN n 
1 464 VAL n 
1 465 GLN n 
1 466 ALA n 
1 467 PRO n 
1 468 VAL n 
1 469 LYS n 
1 470 LEU n 
1 471 TYR n 
1 472 SER n 
1 473 ASP n 
1 474 TRP n 
1 475 LEU n 
1 476 SER n 
1 477 VAL n 
1 478 GLY n 
1 479 HIS n 
1 480 VAL n 
1 481 ASP n 
1 482 GLU n 
1 483 PHE n 
1 484 LEU n 
1 485 SER n 
1 486 PHE n 
1 487 VAL n 
1 488 PRO n 
1 489 ALA n 
1 490 PRO n 
1 491 ASP n 
1 492 ARG n 
1 493 LYS n 
1 494 GLY n 
1 495 PHE n 
1 496 ARG n 
1 497 LEU n 
1 498 LEU n 
1 499 LEU n 
1 500 ALA n 
1 501 SER n 
1 502 PRO n 
1 503 ARG n 
1 504 SER n 
1 505 CYS n 
1 506 TYR n 
1 507 LYS n 
1 508 LEU n 
1 509 PHE n 
1 510 GLN n 
1 511 GLU n 
1 512 GLN n 
1 513 GLN n 
1 514 ASN n 
1 515 GLU n 
1 516 GLY n 
1 517 HIS n 
1 518 GLY n 
1 519 GLU n 
1 520 ALA n 
1 521 LEU n 
1 522 LEU n 
1 523 PHE n 
1 524 GLU n 
1 525 GLY n 
1 526 ILE n 
1 527 LYS n 
1 528 LYS n 
1 529 LYS n 
1 530 LYS n 
1 531 GLN n 
1 532 GLN n 
1 533 LYS n 
1 534 ILE n 
1 535 LYS n 
1 536 ASN n 
1 537 ILE n 
1 538 LEU n 
1 539 SER n 
1 540 ASN n 
1 541 LYS n 
1 542 THR n 
1 543 LEU n 
1 544 ARG n 
1 545 GLU n 
1 546 HIS n 
1 547 ASN n 
1 548 SER n 
1 549 PHE n 
1 550 VAL n 
1 551 GLU n 
1 552 ARG n 
1 553 CYS n 
1 554 ILE n 
1 555 ASP n 
1 556 TRP n 
1 557 ASN n 
1 558 ARG n 
1 559 GLU n 
1 560 LEU n 
1 561 LEU n 
1 562 LYS n 
1 563 ARG n 
1 564 GLU n 
1 565 LEU n 
1 566 GLY n 
1 567 LEU n 
1 568 ALA n 
1 569 GLU n 
1 570 SER n 
1 571 ASP n 
1 572 ILE n 
1 573 ILE n 
1 574 ASP n 
1 575 ILE n 
1 576 PRO n 
1 577 GLN n 
1 578 LEU n 
1 579 PHE n 
1 580 LYS n 
1 581 LEU n 
1 582 LYS n 
1 583 GLU n 
1 584 PHE n 
1 585 SER n 
1 586 LYS n 
1 587 ALA n 
1 588 GLU n 
1 589 ALA n 
1 590 PHE n 
1 591 PHE n 
1 592 PRO n 
1 593 ASN n 
1 594 MET n 
1 595 VAL n 
1 596 ASN n 
1 597 MET n 
1 598 LEU n 
1 599 VAL n 
1 600 LEU n 
1 601 GLY n 
1 602 LYS n 
1 603 HIS n 
1 604 LEU n 
1 605 GLY n 
1 606 ILE n 
1 607 PRO n 
1 608 LYS n 
1 609 PRO n 
1 610 PHE n 
1 611 GLY n 
1 612 PRO n 
1 613 VAL n 
1 614 ILE n 
1 615 ASN n 
1 616 GLY n 
1 617 ARG n 
1 618 CYS n 
1 619 CYS n 
1 620 LEU n 
1 621 GLU n 
1 622 GLU n 
1 623 LYS n 
1 624 VAL n 
1 625 CYS n 
1 626 SER n 
1 627 LEU n 
1 628 LEU n 
1 629 GLU n 
1 630 PRO n 
1 631 LEU n 
1 632 GLY n 
1 633 LEU n 
1 634 GLN n 
1 635 CYS n 
1 636 THR n 
1 637 PHE n 
1 638 ILE n 
1 639 ASN n 
1 640 ASP n 
1 641 PHE n 
1 642 PHE n 
1 643 THR n 
1 644 TYR n 
1 645 HIS n 
1 646 ILE n 
1 647 ARG n 
1 648 HIS n 
1 649 GLY n 
1 650 GLU n 
1 651 VAL n 
1 652 HIS n 
1 653 ALA n 
1 654 GLY n 
1 655 THR n 
1 656 ASN n 
1 657 VAL n 
1 658 ARG n 
1 659 ARG n 
1 660 LYS n 
1 661 PRO n 
1 662 PHE n 
1 663 SER n 
1 664 PHE n 
1 665 LYS n 
1 666 TRP n 
1 667 TRP n 
1 668 ASN n 
1 669 MET n 
1 670 VAL n 
1 671 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   671 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PADI4, PADI5, PDI5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-Gold(DE3)pLysS AG' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PADI4_HUMAN 
_struct_ref.pdbx_db_accession          Q9UM07 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPLDPGVEVTLTM
KVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAILLVNCDRDNLE
SSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMV
PGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFL
KSVTTLAMKAKCKLTICPEEENMDDQWMQDEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGG
ISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVP
APDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA
ESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRH
GEVHCGTNVRRKPFSFKWWNMVP
;
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4X8G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 9 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 671 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UM07 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  663 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       663 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4X8G GLY A 1   ? UNP Q9UM07 ?   ?   'expression tag'      -7  1 
1 4X8G PRO A 2   ? UNP Q9UM07 ?   ?   'expression tag'      -6  2 
1 4X8G LEU A 3   ? UNP Q9UM07 ?   ?   'expression tag'      -5  3 
1 4X8G GLY A 4   ? UNP Q9UM07 ?   ?   'expression tag'      -4  4 
1 4X8G SER A 5   ? UNP Q9UM07 ?   ?   'expression tag'      -3  5 
1 4X8G PRO A 6   ? UNP Q9UM07 ?   ?   'expression tag'      -2  6 
1 4X8G GLU A 7   ? UNP Q9UM07 ?   ?   'expression tag'      -1  7 
1 4X8G PHE A 8   ? UNP Q9UM07 ?   ?   'expression tag'      0   8 
1 4X8G ALA A 653 ? UNP Q9UM07 CYS 645 'engineered mutation' 645 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3Z0 non-polymer         . 
'[(3R)-3-aminopiperidin-1-yl][2-(1-ethyl-1H-pyrrolo[2,3-b]pyridin-2-yl)-7-methoxy-1-methyl-1H-benzimidazol-5-yl]methanone' ? 
'C24 H28 N6 O2'  432.518 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION' ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4X8G 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM imidazole, pH 7.8, 200 mM Li2SO4, 2 mM TCEP, 6-7.5% PEG 2K MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-05-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4X8G 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.29 
_reflns.d_resolution_low                 19.86 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       13385 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4X8G 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.29 
_refine.ls_d_res_low                             19.86 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     13383 
_refine.ls_number_reflns_R_free                  648 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.55 
_refine.ls_percent_reflns_R_free                 4.84 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2000 
_refine.ls_R_factor_R_free                       0.2298 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1984 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.69 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.32 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4502 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         36 
_refine_hist.number_atoms_solvent             24 
_refine_hist.number_atoms_total               4562 
_refine_hist.d_res_high                       3.29 
_refine_hist.d_res_low                        19.86 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 4641 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.560  ? 6344 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.170 ? 1595 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.023  ? 738  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 825  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.29   3.5432  . . 116 2587 99.00 . . . 0.2967 . 0.2968 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5432 3.8974  . . 146 2525 98.00 . . . 0.2933 . 0.2503 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8974 4.4558  . . 119 2524 98.00 . . . 0.2237 . 0.2072 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4558 5.5930  . . 112 2524 96.00 . . . 0.2492 . 0.1799 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.5930 19.8638 . . 155 2575 97.00 . . . 0.1986 . 0.1750 . . . . . . . . . . 
# 
_struct.entry_id                     4X8G 
_struct.title                        'Crystal structure of human peptidylarginine deiminase type4 (PAD4) in complex with GSK199' 
_struct.pdbx_descriptor              'peptidylarginine deiminase type4 (PAD4)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4X8G 
_struct_keywords.text            'Hydrolase-Hydrolase Inhibitor complex' 
_struct_keywords.pdbx_keywords   'Hydrolase/Hydrolase Inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 MET A 172 ? ASP A 176 ? MET A 164 ASP A 168 5 ? 5  
HELX_P HELX_P2  AA2 ASP A 181 ? LEU A 185 ? ASP A 173 LEU A 177 5 ? 5  
HELX_P HELX_P3  AA3 PRO A 198 ? THR A 203 ? PRO A 190 THR A 195 5 ? 6  
HELX_P HELX_P4  AA4 ASN A 324 ? ALA A 338 ? ASN A 316 ALA A 330 1 ? 15 
HELX_P HELX_P5  AA5 HIS A 452 ? GLN A 462 ? HIS A 444 GLN A 454 1 ? 11 
HELX_P HELX_P6  AA6 PRO A 502 ? GLU A 515 ? PRO A 494 GLU A 507 1 ? 14 
HELX_P HELX_P7  AA7 ILE A 534 ? SER A 539 ? ILE A 526 SER A 531 1 ? 6  
HELX_P HELX_P8  AA8 ASN A 540 ? LEU A 565 ? ASN A 532 LEU A 557 1 ? 26 
HELX_P HELX_P9  AA9 ALA A 568 ? SER A 570 ? ALA A 560 SER A 562 5 ? 3  
HELX_P HELX_P10 AB1 GLU A 583 ? SER A 585 ? GLU A 575 SER A 577 5 ? 3  
HELX_P HELX_P11 AB2 CYS A 619 ? GLU A 629 ? CYS A 611 GLU A 621 1 ? 11 
HELX_P HELX_P12 AB3 PRO A 630 ? GLY A 632 ? PRO A 622 GLY A 624 5 ? 3  
HELX_P HELX_P13 AB4 LYS A 665 ? MET A 669 ? LYS A 657 MET A 661 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASN 161 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASN 153 A CA  702 1_555 ? ? ? ? ? ? ? 2.602 ? 
metalc2  metalc ? ? A ASP 163 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 155 A CA  702 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc3  metalc ? ? A ASP 165 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 157 A CA  703 1_555 ? ? ? ? ? ? ? 2.572 ? 
metalc4  metalc ? ? A ASP 165 OD2 ? ? ? 1_555 C CA  . CA ? ? A ASP 157 A CA  702 1_555 ? ? ? ? ? ? ? 2.412 ? 
metalc5  metalc ? ? A ASP 173 O   ? ? ? 1_555 E CA  . CA ? ? A ASP 165 A CA  704 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc6  metalc ? ? A ASP 173 OD2 ? ? ? 1_555 C CA  . CA ? ? A ASP 165 A CA  702 1_555 ? ? ? ? ? ? ? 2.627 ? 
metalc7  metalc ? ? A ASP 176 OD1 ? ? ? 1_555 E CA  . CA ? ? A ASP 168 A CA  704 1_555 ? ? ? ? ? ? ? 3.186 ? 
metalc8  metalc ? ? A ASP 176 OD2 ? ? ? 1_555 E CA  . CA ? ? A ASP 168 A CA  704 1_555 ? ? ? ? ? ? ? 2.752 ? 
metalc9  metalc ? ? A GLU 178 O   ? ? ? 1_555 E CA  . CA ? ? A GLU 170 A CA  704 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc10 metalc ? ? A ASP 184 OD1 ? ? ? 1_555 C CA  . CA ? ? A ASP 176 A CA  702 1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc11 metalc ? ? A ASP 187 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 179 A CA  703 1_555 ? ? ? ? ? ? ? 2.626 ? 
metalc12 metalc ? ? A ASP 187 OD2 ? ? ? 1_555 D CA  . CA ? ? A ASP 179 A CA  703 1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc13 metalc ? ? A ASP 187 OD2 ? ? ? 1_555 C CA  . CA ? ? A ASP 179 A CA  702 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc14 metalc ? ? A GLU 361 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 353 A CA  701 1_555 ? ? ? ? ? ? ? 2.866 ? 
metalc15 metalc ? ? A ASP 396 OD1 ? ? ? 1_555 D CA  . CA ? ? A ASP 388 A CA  703 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc16 metalc ? ? A PHE 415 O   ? ? ? 1_555 B CA  . CA ? ? A PHE 407 A CA  701 1_555 ? ? ? ? ? ? ? 2.543 ? 
metalc17 metalc ? ? A LEU 418 O   ? ? ? 1_555 B CA  . CA ? ? A LEU 410 A CA  701 1_555 ? ? ? ? ? ? ? 2.496 ? 
metalc18 metalc ? ? A GLU 419 OE1 ? ? ? 1_555 B CA  . CA ? ? A GLU 411 A CA  701 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc19 metalc ? ? B CA  .   CA  ? ? ? 1_555 G HOH . O  ? ? A CA  701 A HOH 818 1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc20 metalc ? ? B CA  .   CA  ? ? ? 1_555 G HOH . O  ? ? A CA  701 A HOH 819 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc21 metalc ? ? E CA  .   CA  ? ? ? 1_555 G HOH . O  ? ? A CA  704 A HOH 821 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc22 metalc ? ? E CA  .   CA  ? ? ? 1_555 G HOH . O  ? ? A CA  704 A HOH 822 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc23 metalc ? ? E CA  .   CA  ? ? ? 1_555 G HOH . O  ? ? A CA  704 A HOH 813 1_555 ? ? ? ? ? ? ? 2.553 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 6 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 12  ? ARG A 16  ? GLY A 4   ARG A 8   
AA1 2 LEU A 32  ? ASP A 36  ? LEU A 24  ASP A 28  
AA1 3 GLU A 83  ? MET A 88  ? GLU A 75  MET A 80  
AA1 4 VAL A 56  ? ALA A 61  ? VAL A 48  ALA A 53  
AA2 1 THR A 23  ? VAL A 28  ? THR A 15  VAL A 20  
AA2 2 VAL A 112 ? ALA A 127 ? VAL A 104 ALA A 119 
AA2 3 GLN A 98  ? TYR A 105 ? GLN A 90  TYR A 97  
AA2 4 SER A 47  ? ALA A 52  ? SER A 39  ALA A 44  
AA3 1 THR A 23  ? VAL A 28  ? THR A 15  VAL A 20  
AA3 2 VAL A 112 ? ALA A 127 ? VAL A 104 ALA A 119 
AA3 3 SER A 189 ? THR A 197 ? SER A 181 THR A 189 
AA3 4 GLY A 251 ? ALA A 261 ? GLY A 243 ALA A 253 
AA3 5 VAL A 219 ? GLN A 223 ? VAL A 211 GLN A 215 
AA3 6 SER A 234 ? LEU A 237 ? SER A 226 LEU A 229 
AA4 1 ALA A 156 ? LEU A 158 ? ALA A 148 LEU A 150 
AA4 2 ALA A 290 ? VAL A 301 ? ALA A 282 VAL A 293 
AA4 3 LEU A 272 ? ASP A 281 ? LEU A 264 ASP A 273 
AA4 4 HIS A 205 ? VAL A 211 ? HIS A 197 VAL A 203 
AA4 5 SER A 243 ? TYR A 245 ? SER A 235 TYR A 237 
AA5 1 LYS A 341 ? THR A 343 ? LYS A 333 THR A 335 
AA5 2 PRO A 313 ? TYR A 317 ? PRO A 305 TYR A 309 
AA5 3 ASN A 656 ? ARG A 659 ? ASN A 648 ARG A 651 
AA6 1 MET A 360 ? GLN A 366 ? MET A 352 GLN A 358 
AA6 2 THR A 371 ? ASP A 377 ? THR A 363 ASP A 369 
AA6 3 GLY A 398 ? VAL A 400 ? GLY A 390 VAL A 392 
AA7 1 LEU A 418 ? VAL A 420 ? LEU A 410 VAL A 412 
AA7 2 ILE A 436 ? ASP A 440 ? ILE A 428 ASP A 432 
AA7 3 VAL A 468 ? TYR A 471 ? VAL A 460 TYR A 463 
AA8 1 VAL A 424 ? VAL A 426 ? VAL A 416 VAL A 418 
AA8 2 LYS A 429 ? TYR A 431 ? LYS A 421 TYR A 423 
AA9 1 LEU A 484 ? PRO A 488 ? LEU A 476 PRO A 480 
AA9 2 PHE A 495 ? SER A 501 ? PHE A 487 SER A 493 
AA9 3 ILE A 572 ? PRO A 576 ? ILE A 564 PRO A 568 
AB1 1 LEU A 521 ? LEU A 522 ? LEU A 513 LEU A 514 
AB1 2 GLN A 532 ? LYS A 533 ? GLN A 524 LYS A 525 
AB2 1 PHE A 579 ? LEU A 581 ? PHE A 571 LEU A 573 
AB2 2 ALA A 587 ? ALA A 589 ? ALA A 579 ALA A 581 
AB3 1 VAL A 613 ? ILE A 614 ? VAL A 605 ILE A 606 
AB3 2 ARG A 617 ? CYS A 618 ? ARG A 609 CYS A 610 
AB4 1 THR A 643 ? HIS A 645 ? THR A 635 HIS A 637 
AB4 2 GLU A 650 ? HIS A 652 ? GLU A 642 HIS A 644 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 15  ? N ILE A 7   O ASP A 36  ? O ASP A 28  
AA1 2 3 N THR A 33  ? N THR A 25  O LEU A 86  ? O LEU A 78  
AA1 3 4 O GLU A 83  ? O GLU A 75  N ALA A 61  ? N ALA A 53  
AA2 1 2 N CYS A 27  ? N CYS A 19  O VAL A 121 ? O VAL A 113 
AA2 2 3 O ALA A 114 ? O ALA A 106 N ILE A 102 ? N ILE A 94  
AA2 3 4 O GLN A 101 ? O GLN A 93  N ASN A 51  ? N ASN A 43  
AA3 1 2 N CYS A 27  ? N CYS A 19  O VAL A 121 ? O VAL A 113 
AA3 2 3 N CYS A 126 ? N CYS A 118 O THR A 192 ? O THR A 184 
AA3 3 4 N THR A 195 ? N THR A 187 O HIS A 253 ? O HIS A 245 
AA3 4 5 O TYR A 258 ? O TYR A 250 N PHE A 222 ? N PHE A 214 
AA3 5 6 N GLN A 223 ? N GLN A 215 O SER A 234 ? O SER A 226 
AA4 1 2 N LEU A 158 ? N LEU A 150 O ARG A 300 ? O ARG A 292 
AA4 2 3 O PHE A 293 ? O PHE A 285 N LEU A 279 ? N LEU A 271 
AA4 3 4 O LEU A 280 ? O LEU A 272 N THR A 206 ? N THR A 198 
AA4 4 5 N LEU A 209 ? N LEU A 201 O HIS A 244 ? O HIS A 236 
AA5 1 2 O THR A 343 ? O THR A 335 N VAL A 316 ? N VAL A 308 
AA5 2 3 N TYR A 317 ? N TYR A 309 O ASN A 656 ? O ASN A 648 
AA6 1 2 N GLY A 363 ? N GLY A 355 O VAL A 374 ? O VAL A 366 
AA6 2 3 N PRO A 373 ? N PRO A 365 O GLY A 398 ? O GLY A 390 
AA7 1 2 N GLU A 419 ? N GLU A 411 O LEU A 437 ? O LEU A 429 
AA7 2 3 N PHE A 438 ? N PHE A 430 O LEU A 470 ? O LEU A 462 
AA8 1 2 N VAL A 424 ? N VAL A 416 O TYR A 431 ? O TYR A 423 
AA9 1 2 N SER A 485 ? N SER A 477 O LEU A 498 ? O LEU A 490 
AA9 2 3 N LEU A 499 ? N LEU A 491 O ILE A 575 ? O ILE A 567 
AB1 1 2 N LEU A 522 ? N LEU A 514 O GLN A 532 ? O GLN A 524 
AB2 1 2 N LYS A 580 ? N LYS A 572 O GLU A 588 ? O GLU A 580 
AB3 1 2 N ILE A 614 ? N ILE A 606 O ARG A 617 ? O ARG A 609 
AB4 1 2 N THR A 643 ? N THR A 635 O HIS A 652 ? O HIS A 644 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  701 ? 6  'binding site for residue CA A 701'  
AC2 Software A CA  702 ? 6  'binding site for residue CA A 702'  
AC3 Software A CA  703 ? 5  'binding site for residue CA A 703'  
AC4 Software A CA  704 ? 6  'binding site for residue CA A 704'  
AC5 Software A 3Z0 705 ? 11 'binding site for residue 3Z0 A 705' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  GLU A 361 ? GLU A 353 . ? 1_555 ? 
2  AC1 6  PHE A 415 ? PHE A 407 . ? 1_555 ? 
3  AC1 6  LEU A 418 ? LEU A 410 . ? 1_555 ? 
4  AC1 6  GLU A 419 ? GLU A 411 . ? 1_555 ? 
5  AC1 6  HOH G .   ? HOH A 818 . ? 1_555 ? 
6  AC1 6  HOH G .   ? HOH A 819 . ? 1_555 ? 
7  AC2 6  ASN A 161 ? ASN A 153 . ? 1_555 ? 
8  AC2 6  ASP A 163 ? ASP A 155 . ? 1_555 ? 
9  AC2 6  ASP A 165 ? ASP A 157 . ? 1_555 ? 
10 AC2 6  ASP A 173 ? ASP A 165 . ? 1_555 ? 
11 AC2 6  ASP A 184 ? ASP A 176 . ? 1_555 ? 
12 AC2 6  ASP A 187 ? ASP A 179 . ? 1_555 ? 
13 AC3 5  ASP A 163 ? ASP A 155 . ? 1_555 ? 
14 AC3 5  ASP A 165 ? ASP A 157 . ? 1_555 ? 
15 AC3 5  ASP A 187 ? ASP A 179 . ? 1_555 ? 
16 AC3 5  LYS A 370 ? LYS A 362 . ? 1_555 ? 
17 AC3 5  ASP A 396 ? ASP A 388 . ? 1_555 ? 
18 AC4 6  ASP A 173 ? ASP A 165 . ? 1_555 ? 
19 AC4 6  ASP A 176 ? ASP A 168 . ? 1_555 ? 
20 AC4 6  GLU A 178 ? GLU A 170 . ? 1_555 ? 
21 AC4 6  HOH G .   ? HOH A 813 . ? 1_555 ? 
22 AC4 6  HOH G .   ? HOH A 821 . ? 1_555 ? 
23 AC4 6  HOH G .   ? HOH A 822 . ? 1_555 ? 
24 AC5 11 VAL A 477 ? VAL A 469 . ? 1_555 ? 
25 AC5 11 HIS A 479 ? HIS A 471 . ? 1_555 ? 
26 AC5 11 ASP A 481 ? ASP A 473 . ? 1_555 ? 
27 AC5 11 GLU A 482 ? GLU A 474 . ? 1_555 ? 
28 AC5 11 ALA A 589 ? ALA A 581 . ? 1_555 ? 
29 AC5 11 PHE A 590 ? PHE A 582 . ? 1_555 ? 
30 AC5 11 PHE A 591 ? PHE A 583 . ? 1_555 ? 
31 AC5 11 PRO A 592 ? PRO A 584 . ? 1_555 ? 
32 AC5 11 ASN A 593 ? ASN A 585 . ? 1_555 ? 
33 AC5 11 ASN A 596 ? ASN A 588 . ? 1_555 ? 
34 AC5 11 VAL A 651 ? VAL A 643 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4X8G 
_atom_sites.fract_transf_matrix[1][1]   0.006623 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004588 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016064 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010420 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 11  ? -3.594  23.908 -25.345 1.00 137.80 ? 3   GLN A N   1 
ATOM   2    C  CA  . GLN A 1 11  ? -2.785  23.007 -26.157 1.00 137.33 ? 3   GLN A CA  1 
ATOM   3    C  C   . GLN A 1 11  ? -3.633  22.310 -27.217 1.00 141.17 ? 3   GLN A C   1 
ATOM   4    O  O   . GLN A 1 11  ? -3.355  21.173 -27.600 1.00 141.60 ? 3   GLN A O   1 
ATOM   5    C  CB  . GLN A 1 11  ? -2.089  21.969 -25.274 1.00 98.28  ? 3   GLN A CB  1 
ATOM   6    N  N   . GLY A 1 12  ? -4.667  22.998 -27.688 1.00 132.60 ? 4   GLY A N   1 
ATOM   7    C  CA  . GLY A 1 12  ? -5.563  22.434 -28.680 1.00 133.88 ? 4   GLY A CA  1 
ATOM   8    C  C   . GLY A 1 12  ? -6.050  23.456 -29.688 1.00 135.37 ? 4   GLY A C   1 
ATOM   9    O  O   . GLY A 1 12  ? -5.912  24.661 -29.484 1.00 135.35 ? 4   GLY A O   1 
ATOM   10   N  N   . THR A 1 13  ? -6.623  22.967 -30.783 1.00 128.68 ? 5   THR A N   1 
ATOM   11   C  CA  . THR A 1 13  ? -7.142  23.836 -31.832 1.00 130.10 ? 5   THR A CA  1 
ATOM   12   C  C   . THR A 1 13  ? -8.184  23.113 -32.684 1.00 132.04 ? 5   THR A C   1 
ATOM   13   O  O   . THR A 1 13  ? -7.917  22.050 -33.246 1.00 132.34 ? 5   THR A O   1 
ATOM   14   C  CB  . THR A 1 13  ? -6.008  24.365 -32.737 1.00 136.79 ? 5   THR A CB  1 
ATOM   15   O  OG1 . THR A 1 13  ? -6.561  24.859 -33.963 1.00 139.61 ? 5   THR A OG1 1 
ATOM   16   C  CG2 . THR A 1 13  ? -5.003  23.261 -33.045 1.00 136.20 ? 5   THR A CG2 1 
ATOM   17   N  N   . LEU A 1 14  ? -9.375  23.698 -32.770 1.00 127.18 ? 6   LEU A N   1 
ATOM   18   C  CA  . LEU A 1 14  ? -10.476 23.092 -33.510 1.00 128.81 ? 6   LEU A CA  1 
ATOM   19   C  C   . LEU A 1 14  ? -10.688 23.778 -34.856 1.00 133.53 ? 6   LEU A C   1 
ATOM   20   O  O   . LEU A 1 14  ? -10.964 24.976 -34.915 1.00 134.72 ? 6   LEU A O   1 
ATOM   21   C  CB  . LEU A 1 14  ? -11.765 23.147 -32.688 1.00 128.96 ? 6   LEU A CB  1 
ATOM   22   C  CG  . LEU A 1 14  ? -12.977 22.434 -33.290 1.00 133.53 ? 6   LEU A CG  1 
ATOM   23   C  CD1 . LEU A 1 14  ? -12.783 20.925 -33.251 1.00 132.67 ? 6   LEU A CD1 1 
ATOM   24   C  CD2 . LEU A 1 14  ? -14.256 22.838 -32.573 1.00 135.39 ? 6   LEU A CD2 1 
ATOM   25   N  N   . ILE A 1 15  ? -10.562 23.009 -35.933 1.00 131.98 ? 7   ILE A N   1 
ATOM   26   C  CA  . ILE A 1 15  ? -10.740 23.539 -37.280 1.00 134.50 ? 7   ILE A CA  1 
ATOM   27   C  C   . ILE A 1 15  ? -12.046 23.045 -37.895 1.00 139.27 ? 7   ILE A C   1 
ATOM   28   O  O   . ILE A 1 15  ? -12.381 21.865 -37.794 1.00 138.32 ? 7   ILE A O   1 
ATOM   29   C  CB  . ILE A 1 15  ? -9.574  23.141 -38.202 1.00 135.84 ? 7   ILE A CB  1 
ATOM   30   C  CG1 . ILE A 1 15  ? -8.242  23.253 -37.459 1.00 132.62 ? 7   ILE A CG1 1 
ATOM   31   C  CG2 . ILE A 1 15  ? -9.569  24.000 -39.457 1.00 140.24 ? 7   ILE A CG2 1 
ATOM   32   C  CD1 . ILE A 1 15  ? -7.062  22.728 -38.246 1.00 134.10 ? 7   ILE A CD1 1 
ATOM   33   N  N   . ARG A 1 16  ? -12.779 23.952 -38.535 1.00 139.68 ? 8   ARG A N   1 
ATOM   34   C  CA  . ARG A 1 16  ? -14.041 23.600 -39.177 1.00 143.04 ? 8   ARG A CA  1 
ATOM   35   C  C   . ARG A 1 16  ? -13.962 23.799 -40.686 1.00 149.57 ? 8   ARG A C   1 
ATOM   36   O  O   . ARG A 1 16  ? -13.856 24.926 -41.166 1.00 151.89 ? 8   ARG A O   1 
ATOM   37   C  CB  . ARG A 1 16  ? -15.190 24.431 -38.598 1.00 143.89 ? 8   ARG A CB  1 
ATOM   38   C  CG  . ARG A 1 16  ? -15.112 24.642 -37.098 1.00 141.69 ? 8   ARG A CG  1 
ATOM   39   C  CD  . ARG A 1 16  ? -16.409 25.210 -36.545 1.00 142.68 ? 8   ARG A CD  1 
ATOM   40   N  NE  . ARG A 1 16  ? -16.235 25.727 -35.191 1.00 142.76 ? 8   ARG A NE  1 
ATOM   41   C  CZ  . ARG A 1 16  ? -17.233 26.107 -34.401 1.00 146.72 ? 8   ARG A CZ  1 
ATOM   42   N  NH1 . ARG A 1 16  ? -18.488 26.020 -34.821 1.00 136.56 ? 8   ARG A NH1 1 
ATOM   43   N  NH2 . ARG A 1 16  ? -16.978 26.568 -33.184 1.00 138.49 ? 8   ARG A NH2 1 
ATOM   44   N  N   . VAL A 1 17  ? -14.018 22.701 -41.432 1.00 144.93 ? 9   VAL A N   1 
ATOM   45   C  CA  . VAL A 1 17  ? -13.927 22.765 -42.887 1.00 147.59 ? 9   VAL A CA  1 
ATOM   46   C  C   . VAL A 1 17  ? -15.312 22.819 -43.534 1.00 154.63 ? 9   VAL A C   1 
ATOM   47   O  O   . VAL A 1 17  ? -16.275 22.252 -43.015 1.00 154.89 ? 9   VAL A O   1 
ATOM   48   C  CB  . VAL A 1 17  ? -13.145 21.565 -43.455 1.00 147.80 ? 9   VAL A CB  1 
ATOM   49   C  CG1 . VAL A 1 17  ? -11.673 21.667 -43.075 1.00 144.40 ? 9   VAL A CG1 1 
ATOM   50   C  CG2 . VAL A 1 17  ? -13.738 20.254 -42.959 1.00 146.94 ? 9   VAL A CG2 1 
ATOM   51   N  N   . THR A 1 18  ? -15.403 23.512 -44.666 1.00 147.92 ? 10  THR A N   1 
ATOM   52   C  CA  . THR A 1 18  ? -16.661 23.645 -45.399 1.00 152.46 ? 10  THR A CA  1 
ATOM   53   C  C   . THR A 1 18  ? -16.435 23.367 -46.890 1.00 156.91 ? 10  THR A C   1 
ATOM   54   O  O   . THR A 1 18  ? -15.383 23.705 -47.436 1.00 156.08 ? 10  THR A O   1 
ATOM   55   C  CB  . THR A 1 18  ? -17.286 25.051 -45.199 1.00 159.83 ? 10  THR A CB  1 
ATOM   56   O  OG1 . THR A 1 18  ? -18.568 25.113 -45.837 1.00 164.31 ? 10  THR A OG1 1 
ATOM   57   C  CG2 . THR A 1 18  ? -16.387 26.143 -45.763 1.00 160.61 ? 10  THR A CG2 1 
ATOM   58   N  N   . PRO A 1 19  ? -17.415 22.727 -47.550 1.00 153.51 ? 11  PRO A N   1 
ATOM   59   C  CA  . PRO A 1 19  ? -17.259 22.362 -48.963 1.00 155.45 ? 11  PRO A CA  1 
ATOM   60   C  C   . PRO A 1 19  ? -17.313 23.556 -49.914 1.00 161.84 ? 11  PRO A C   1 
ATOM   61   O  O   . PRO A 1 19  ? -16.732 23.497 -50.997 1.00 162.36 ? 11  PRO A O   1 
ATOM   62   C  CB  . PRO A 1 19  ? -18.443 21.423 -49.211 1.00 158.01 ? 11  PRO A CB  1 
ATOM   63   C  CG  . PRO A 1 19  ? -19.464 21.844 -48.216 1.00 161.49 ? 11  PRO A CG  1 
ATOM   64   C  CD  . PRO A 1 19  ? -18.682 22.223 -46.992 1.00 155.45 ? 11  PRO A CD  1 
ATOM   65   N  N   . GLU A 1 20  ? -18.002 24.619 -49.513 1.00 157.55 ? 12  GLU A N   1 
ATOM   66   C  CA  . GLU A 1 20  ? -18.187 25.779 -50.380 1.00 162.26 ? 12  GLU A CA  1 
ATOM   67   C  C   . GLU A 1 20  ? -16.917 26.620 -50.499 1.00 163.41 ? 12  GLU A C   1 
ATOM   68   O  O   . GLU A 1 20  ? -16.722 27.323 -51.494 1.00 165.93 ? 12  GLU A O   1 
ATOM   69   C  CB  . GLU A 1 20  ? -19.341 26.644 -49.871 1.00 166.52 ? 12  GLU A CB  1 
ATOM   70   C  CG  . GLU A 1 20  ? -19.275 26.960 -48.388 1.00 171.61 ? 12  GLU A CG  1 
ATOM   71   N  N   . GLN A 1 21  ? -16.051 26.541 -49.493 1.00 157.51 ? 13  GLN A N   1 
ATOM   72   C  CA  . GLN A 1 21  ? -14.810 27.308 -49.492 1.00 156.09 ? 13  GLN A CA  1 
ATOM   73   C  C   . GLN A 1 21  ? -13.678 26.545 -48.808 1.00 152.63 ? 13  GLN A C   1 
ATOM   74   O  O   . GLN A 1 21  ? -13.854 26.019 -47.710 1.00 149.53 ? 13  GLN A O   1 
ATOM   75   C  CB  . GLN A 1 21  ? -15.023 28.658 -48.804 1.00 158.74 ? 13  GLN A CB  1 
ATOM   76   N  N   . PRO A 1 22  ? -12.506 26.487 -49.459 1.00 146.77 ? 14  PRO A N   1 
ATOM   77   C  CA  . PRO A 1 22  ? -11.337 25.797 -48.899 1.00 144.06 ? 14  PRO A CA  1 
ATOM   78   C  C   . PRO A 1 22  ? -10.841 26.457 -47.616 1.00 141.14 ? 14  PRO A C   1 
ATOM   79   O  O   . PRO A 1 22  ? -10.854 27.683 -47.512 1.00 141.97 ? 14  PRO A O   1 
ATOM   80   C  CB  . PRO A 1 22  ? -10.295 25.914 -50.014 1.00 146.37 ? 14  PRO A CB  1 
ATOM   81   C  CG  . PRO A 1 22  ? -10.706 27.122 -50.788 1.00 149.62 ? 14  PRO A CG  1 
ATOM   82   C  CD  . PRO A 1 22  ? -12.206 27.117 -50.755 1.00 150.40 ? 14  PRO A CD  1 
ATOM   83   N  N   . THR A 1 23  ? -10.408 25.649 -46.653 1.00 142.23 ? 15  THR A N   1 
ATOM   84   C  CA  . THR A 1 23  ? -9.942  26.170 -45.373 1.00 139.04 ? 15  THR A CA  1 
ATOM   85   C  C   . THR A 1 23  ? -8.427  26.056 -45.228 1.00 137.09 ? 15  THR A C   1 
ATOM   86   O  O   . THR A 1 23  ? -7.851  24.990 -45.441 1.00 136.36 ? 15  THR A O   1 
ATOM   87   C  CB  . THR A 1 23  ? -10.610 25.440 -44.192 1.00 135.58 ? 15  THR A CB  1 
ATOM   88   N  N   . HIS A 1 24  ? -7.789  27.165 -44.866 1.00 134.16 ? 16  HIS A N   1 
ATOM   89   C  CA  . HIS A 1 24  ? -6.353  27.182 -44.615 1.00 132.81 ? 16  HIS A CA  1 
ATOM   90   C  C   . HIS A 1 24  ? -6.100  27.282 -43.116 1.00 129.22 ? 16  HIS A C   1 
ATOM   91   O  O   . HIS A 1 24  ? -6.670  28.141 -42.443 1.00 128.69 ? 16  HIS A O   1 
ATOM   92   C  CB  . HIS A 1 24  ? -5.684  28.345 -45.352 1.00 135.22 ? 16  HIS A CB  1 
ATOM   93   C  CG  . HIS A 1 24  ? -5.835  28.287 -46.841 1.00 139.03 ? 16  HIS A CG  1 
ATOM   94   N  ND1 . HIS A 1 24  ? -7.065  28.244 -47.465 1.00 141.11 ? 16  HIS A ND1 1 
ATOM   95   C  CD2 . HIS A 1 24  ? -4.912  28.266 -47.832 1.00 141.35 ? 16  HIS A CD2 1 
ATOM   96   C  CE1 . HIS A 1 24  ? -6.892  28.198 -48.773 1.00 144.45 ? 16  HIS A CE1 1 
ATOM   97   N  NE2 . HIS A 1 24  ? -5.594  28.211 -49.023 1.00 144.74 ? 16  HIS A NE2 1 
ATOM   98   N  N   . ALA A 1 25  ? -5.251  26.404 -42.591 1.00 132.15 ? 17  ALA A N   1 
ATOM   99   C  CA  . ALA A 1 25  ? -5.016  26.360 -41.152 1.00 128.43 ? 17  ALA A CA  1 
ATOM   100  C  C   . ALA A 1 25  ? -3.545  26.172 -40.793 1.00 127.37 ? 17  ALA A C   1 
ATOM   101  O  O   . ALA A 1 25  ? -2.826  25.406 -41.434 1.00 127.21 ? 17  ALA A O   1 
ATOM   102  C  CB  . ALA A 1 25  ? -5.848  25.258 -40.525 1.00 126.88 ? 17  ALA A CB  1 
ATOM   103  N  N   . VAL A 1 26  ? -3.114  26.879 -39.754 1.00 123.00 ? 18  VAL A N   1 
ATOM   104  C  CA  . VAL A 1 26  ? -1.756  26.758 -39.238 1.00 121.22 ? 18  VAL A CA  1 
ATOM   105  C  C   . VAL A 1 26  ? -1.730  25.748 -38.094 1.00 118.30 ? 18  VAL A C   1 
ATOM   106  O  O   . VAL A 1 26  ? -2.645  25.716 -37.271 1.00 117.01 ? 18  VAL A O   1 
ATOM   107  C  CB  . VAL A 1 26  ? -1.217  28.113 -38.738 1.00 120.64 ? 18  VAL A CB  1 
ATOM   108  C  CG1 . VAL A 1 26  ? 0.286   28.044 -38.521 1.00 119.58 ? 18  VAL A CG1 1 
ATOM   109  C  CG2 . VAL A 1 26  ? -1.567  29.221 -39.722 1.00 123.78 ? 18  VAL A CG2 1 
ATOM   110  N  N   . CYS A 1 27  ? -0.686  24.924 -38.044 1.00 123.47 ? 19  CYS A N   1 
ATOM   111  C  CA  . CYS A 1 27  ? -0.561  23.912 -36.999 1.00 120.45 ? 19  CYS A CA  1 
ATOM   112  C  C   . CYS A 1 27  ? 0.804   23.953 -36.317 1.00 118.71 ? 19  CYS A C   1 
ATOM   113  O  O   . CYS A 1 27  ? 1.839   23.811 -36.967 1.00 119.20 ? 19  CYS A O   1 
ATOM   114  C  CB  . CYS A 1 27  ? -0.806  22.515 -37.574 1.00 121.93 ? 19  CYS A CB  1 
ATOM   115  S  SG  . CYS A 1 27  ? -2.524  22.173 -38.011 1.00 125.73 ? 19  CYS A SG  1 
ATOM   116  N  N   . VAL A 1 28  ? 0.795   24.142 -35.001 1.00 116.54 ? 20  VAL A N   1 
ATOM   117  C  CA  . VAL A 1 28  ? 2.025   24.162 -34.217 1.00 114.29 ? 20  VAL A CA  1 
ATOM   118  C  C   . VAL A 1 28  ? 2.375   22.759 -33.737 1.00 115.55 ? 20  VAL A C   1 
ATOM   119  O  O   . VAL A 1 28  ? 1.569   22.107 -33.073 1.00 114.77 ? 20  VAL A O   1 
ATOM   120  C  CB  . VAL A 1 28  ? 1.906   25.098 -32.998 1.00 114.23 ? 20  VAL A CB  1 
ATOM   121  C  CG1 . VAL A 1 28  ? 3.177   25.048 -32.161 1.00 112.05 ? 20  VAL A CG1 1 
ATOM   122  C  CG2 . VAL A 1 28  ? 1.607   26.519 -33.447 1.00 115.81 ? 20  VAL A CG2 1 
ATOM   123  N  N   . LEU A 1 29  ? 3.576   22.300 -34.079 1.00 115.95 ? 21  LEU A N   1 
ATOM   124  C  CA  . LEU A 1 29  ? 4.032   20.966 -33.699 1.00 115.90 ? 21  LEU A CA  1 
ATOM   125  C  C   . LEU A 1 29  ? 4.023   20.790 -32.182 1.00 115.32 ? 21  LEU A C   1 
ATOM   126  O  O   . LEU A 1 29  ? 4.651   21.560 -31.456 1.00 112.40 ? 21  LEU A O   1 
ATOM   127  C  CB  . LEU A 1 29  ? 5.435   20.705 -34.253 1.00 117.43 ? 21  LEU A CB  1 
ATOM   128  C  CG  . LEU A 1 29  ? 5.613   20.824 -35.769 1.00 121.93 ? 21  LEU A CG  1 
ATOM   129  C  CD1 . LEU A 1 29  ? 7.085   20.951 -36.132 1.00 122.85 ? 21  LEU A CD1 1 
ATOM   130  C  CD2 . LEU A 1 29  ? 4.991   19.635 -36.483 1.00 125.41 ? 21  LEU A CD2 1 
ATOM   131  N  N   . GLY A 1 30  ? 3.295   19.781 -31.713 1.00 114.69 ? 22  GLY A N   1 
ATOM   132  C  CA  . GLY A 1 30  ? 3.201   19.498 -30.292 1.00 113.12 ? 22  GLY A CA  1 
ATOM   133  C  C   . GLY A 1 30  ? 1.810   19.716 -29.726 1.00 115.07 ? 22  GLY A C   1 
ATOM   134  O  O   . GLY A 1 30  ? 1.535   19.360 -28.580 1.00 113.53 ? 22  GLY A O   1 
ATOM   135  N  N   . THR A 1 31  ? 0.928   20.301 -30.529 1.00 117.85 ? 23  THR A N   1 
ATOM   136  C  CA  . THR A 1 31  ? -0.433  20.582 -30.085 1.00 117.16 ? 23  THR A CA  1 
ATOM   137  C  C   . THR A 1 31  ? -1.444  19.659 -30.760 1.00 123.23 ? 23  THR A C   1 
ATOM   138  O  O   . THR A 1 31  ? -1.358  19.400 -31.960 1.00 125.01 ? 23  THR A O   1 
ATOM   139  C  CB  . THR A 1 31  ? -0.825  22.046 -30.361 1.00 119.05 ? 23  THR A CB  1 
ATOM   140  O  OG1 . THR A 1 31  ? -0.830  22.287 -31.774 1.00 122.13 ? 23  THR A OG1 1 
ATOM   141  C  CG2 . THR A 1 31  ? 0.160   22.993 -29.693 1.00 114.67 ? 23  THR A CG2 1 
ATOM   142  N  N   . LEU A 1 32  ? -2.399  19.161 -29.981 1.00 119.83 ? 24  LEU A N   1 
ATOM   143  C  CA  . LEU A 1 32  ? -3.432  18.279 -30.511 1.00 122.56 ? 24  LEU A CA  1 
ATOM   144  C  C   . LEU A 1 32  ? -4.423  19.064 -31.361 1.00 125.07 ? 24  LEU A C   1 
ATOM   145  O  O   . LEU A 1 32  ? -4.870  20.143 -30.970 1.00 123.07 ? 24  LEU A O   1 
ATOM   146  C  CB  . LEU A 1 32  ? -4.162  17.558 -29.377 1.00 114.90 ? 24  LEU A CB  1 
ATOM   147  N  N   . THR A 1 33  ? -4.765  18.519 -32.523 1.00 124.87 ? 25  THR A N   1 
ATOM   148  C  CA  . THR A 1 33  ? -5.673  19.194 -33.442 1.00 126.27 ? 25  THR A CA  1 
ATOM   149  C  C   . THR A 1 33  ? -6.853  18.306 -33.830 1.00 131.90 ? 25  THR A C   1 
ATOM   150  O  O   . THR A 1 33  ? -6.671  17.215 -34.371 1.00 134.39 ? 25  THR A O   1 
ATOM   151  C  CB  . THR A 1 33  ? -4.945  19.641 -34.723 1.00 131.33 ? 25  THR A CB  1 
ATOM   152  O  OG1 . THR A 1 33  ? -3.762  20.372 -34.376 1.00 130.64 ? 25  THR A OG1 1 
ATOM   153  C  CG2 . THR A 1 33  ? -5.852  20.517 -35.567 1.00 130.45 ? 25  THR A CG2 1 
ATOM   154  N  N   . GLN A 1 34  ? -8.063  18.782 -33.554 1.00 130.20 ? 26  GLN A N   1 
ATOM   155  C  CA  . GLN A 1 34  ? -9.272  18.042 -33.898 1.00 132.71 ? 26  GLN A CA  1 
ATOM   156  C  C   . GLN A 1 34  ? -10.020 18.721 -35.041 1.00 138.01 ? 26  GLN A C   1 
ATOM   157  O  O   . GLN A 1 34  ? -9.888  19.928 -35.252 1.00 137.77 ? 26  GLN A O   1 
ATOM   158  C  CB  . GLN A 1 34  ? -10.184 17.900 -32.679 1.00 132.64 ? 26  GLN A CB  1 
ATOM   159  N  N   . LEU A 1 35  ? -10.805 17.939 -35.775 1.00 132.54 ? 27  LEU A N   1 
ATOM   160  C  CA  . LEU A 1 35  ? -11.531 18.448 -36.933 1.00 134.76 ? 27  LEU A CA  1 
ATOM   161  C  C   . LEU A 1 35  ? -13.038 18.484 -36.716 1.00 138.56 ? 27  LEU A C   1 
ATOM   162  O  O   . LEU A 1 35  ? -13.619 17.564 -36.140 1.00 138.50 ? 27  LEU A O   1 
ATOM   163  C  CB  . LEU A 1 35  ? -11.220 17.604 -38.170 1.00 137.03 ? 27  LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 35  ? -9.884  17.861 -38.864 1.00 139.07 ? 27  LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 35  ? -9.734  16.954 -40.073 1.00 141.68 ? 27  LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 35  ? -9.775  19.321 -39.270 1.00 140.56 ? 27  LEU A CD2 1 
ATOM   167  N  N   . ASP A 1 36  ? -13.659 19.558 -37.192 1.00 139.51 ? 28  ASP A N   1 
ATOM   168  C  CA  . ASP A 1 36  ? -15.107 19.710 -37.161 1.00 142.29 ? 28  ASP A CA  1 
ATOM   169  C  C   . ASP A 1 36  ? -15.653 19.614 -38.581 1.00 149.24 ? 28  ASP A C   1 
ATOM   170  O  O   . ASP A 1 36  ? -15.650 20.597 -39.320 1.00 150.40 ? 28  ASP A O   1 
ATOM   171  C  CB  . ASP A 1 36  ? -15.496 21.049 -36.524 1.00 142.89 ? 28  ASP A CB  1 
ATOM   172  C  CG  . ASP A 1 36  ? -16.987 21.160 -36.241 1.00 151.10 ? 28  ASP A CG  1 
ATOM   173  O  OD1 . ASP A 1 36  ? -17.762 20.301 -36.713 1.00 153.57 ? 28  ASP A OD1 1 
ATOM   174  O  OD2 . ASP A 1 36  ? -17.385 22.118 -35.547 1.00 154.59 ? 28  ASP A OD2 1 
ATOM   175  N  N   . ILE A 1 37  ? -16.118 18.428 -38.961 1.00 153.40 ? 29  ILE A N   1 
ATOM   176  C  CA  . ILE A 1 37  ? -16.637 18.218 -40.308 1.00 157.27 ? 29  ILE A CA  1 
ATOM   177  C  C   . ILE A 1 37  ? -18.159 18.105 -40.321 1.00 163.83 ? 29  ILE A C   1 
ATOM   178  O  O   . ILE A 1 37  ? -18.780 18.137 -41.382 1.00 166.97 ? 29  ILE A O   1 
ATOM   179  C  CB  . ILE A 1 37  ? -16.037 16.954 -40.950 1.00 139.13 ? 29  ILE A CB  1 
ATOM   180  N  N   . CYS A 1 38  ? -18.756 17.980 -39.141 1.00 162.37 ? 30  CYS A N   1 
ATOM   181  C  CA  . CYS A 1 38  ? -20.200 17.791 -39.032 1.00 165.84 ? 30  CYS A CA  1 
ATOM   182  C  C   . CYS A 1 38  ? -20.973 19.106 -39.119 1.00 169.79 ? 30  CYS A C   1 
ATOM   183  O  O   . CYS A 1 38  ? -22.059 19.156 -39.698 1.00 173.54 ? 30  CYS A O   1 
ATOM   184  C  CB  . CYS A 1 38  ? -20.545 17.078 -37.721 1.00 165.37 ? 30  CYS A CB  1 
ATOM   185  S  SG  . CYS A 1 38  ? -19.984 15.362 -37.626 1.00 167.12 ? 30  CYS A SG  1 
ATOM   186  N  N   . SER A 1 39  ? -20.407 20.163 -38.546 1.00 160.48 ? 31  SER A N   1 
ATOM   187  C  CA  . SER A 1 39  ? -21.090 21.451 -38.437 1.00 162.55 ? 31  SER A CA  1 
ATOM   188  C  C   . SER A 1 39  ? -21.439 22.078 -39.786 1.00 168.38 ? 31  SER A C   1 
ATOM   189  O  O   . SER A 1 39  ? -22.428 22.803 -39.902 1.00 171.89 ? 31  SER A O   1 
ATOM   190  C  CB  . SER A 1 39  ? -20.236 22.428 -37.626 1.00 161.29 ? 31  SER A CB  1 
ATOM   191  O  OG  . SER A 1 39  ? -18.959 22.603 -38.216 1.00 165.14 ? 31  SER A OG  1 
ATOM   192  N  N   . SER A 1 40  ? -20.626 21.804 -40.801 1.00 161.15 ? 32  SER A N   1 
ATOM   193  C  CA  . SER A 1 40  ? -20.841 22.384 -42.121 1.00 164.77 ? 32  SER A CA  1 
ATOM   194  C  C   . SER A 1 40  ? -20.992 21.308 -43.192 1.00 167.79 ? 32  SER A C   1 
ATOM   195  O  O   . SER A 1 40  ? -20.680 21.534 -44.361 1.00 169.50 ? 32  SER A O   1 
ATOM   196  C  CB  . SER A 1 40  ? -19.691 23.329 -42.480 1.00 165.45 ? 32  SER A CB  1 
ATOM   197  O  OG  . SER A 1 40  ? -19.631 24.422 -41.580 1.00 168.78 ? 32  SER A OG  1 
ATOM   198  N  N   . ALA A 1 41  ? -21.474 20.139 -42.784 1.00 169.39 ? 33  ALA A N   1 
ATOM   199  C  CA  . ALA A 1 41  ? -21.698 19.031 -43.704 1.00 170.56 ? 33  ALA A CA  1 
ATOM   200  C  C   . ALA A 1 41  ? -23.052 19.171 -44.396 1.00 177.77 ? 33  ALA A C   1 
ATOM   201  O  O   . ALA A 1 41  ? -23.979 19.742 -43.828 1.00 178.36 ? 33  ALA A O   1 
ATOM   202  C  CB  . ALA A 1 41  ? -21.616 17.706 -42.962 1.00 168.82 ? 33  ALA A CB  1 
ATOM   203  N  N   . PRO A 1 42  ? -23.169 18.657 -45.630 1.00 187.93 ? 34  PRO A N   1 
ATOM   204  C  CA  . PRO A 1 42  ? -24.463 18.642 -46.320 1.00 190.95 ? 34  PRO A CA  1 
ATOM   205  C  C   . PRO A 1 42  ? -25.524 17.888 -45.526 1.00 191.27 ? 34  PRO A C   1 
ATOM   206  O  O   . PRO A 1 42  ? -25.255 16.804 -45.009 1.00 189.96 ? 34  PRO A O   1 
ATOM   207  C  CB  . PRO A 1 42  ? -24.156 17.918 -47.633 1.00 182.44 ? 34  PRO A CB  1 
ATOM   208  C  CG  . PRO A 1 42  ? -22.711 18.129 -47.848 1.00 180.86 ? 34  PRO A CG  1 
ATOM   209  C  CD  . PRO A 1 42  ? -22.084 18.155 -46.488 1.00 177.71 ? 34  PRO A CD  1 
ATOM   210  N  N   . GLU A 1 43  ? -26.717 18.464 -45.431 1.00 195.03 ? 35  GLU A N   1 
ATOM   211  C  CA  . GLU A 1 43  ? -27.813 17.855 -44.682 1.00 195.84 ? 35  GLU A CA  1 
ATOM   212  C  C   . GLU A 1 43  ? -28.280 16.536 -45.294 1.00 197.24 ? 35  GLU A C   1 
ATOM   213  O  O   . GLU A 1 43  ? -28.834 15.689 -44.600 1.00 197.35 ? 35  GLU A O   1 
ATOM   214  C  CB  . GLU A 1 43  ? -28.993 18.827 -44.584 1.00 188.26 ? 35  GLU A CB  1 
ATOM   215  N  N   . ASP A 1 44  ? -28.057 16.358 -46.591 1.00 193.10 ? 36  ASP A N   1 
ATOM   216  C  CA  . ASP A 1 44  ? -28.468 15.125 -47.258 1.00 193.68 ? 36  ASP A CA  1 
ATOM   217  C  C   . ASP A 1 44  ? -27.409 14.033 -47.113 1.00 193.09 ? 36  ASP A C   1 
ATOM   218  O  O   . ASP A 1 44  ? -27.670 12.862 -47.392 1.00 193.45 ? 36  ASP A O   1 
ATOM   219  C  CB  . ASP A 1 44  ? -28.758 15.379 -48.740 1.00 196.70 ? 36  ASP A CB  1 
ATOM   220  N  N   . CYS A 1 45  ? -26.218 14.423 -46.668 1.00 188.04 ? 37  CYS A N   1 
ATOM   221  C  CA  . CYS A 1 45  ? -25.117 13.482 -46.484 1.00 184.96 ? 37  CYS A CA  1 
ATOM   222  C  C   . CYS A 1 45  ? -25.212 12.777 -45.134 1.00 187.14 ? 37  CYS A C   1 
ATOM   223  O  O   . CYS A 1 45  ? -25.447 13.413 -44.106 1.00 186.00 ? 37  CYS A O   1 
ATOM   224  C  CB  . CYS A 1 45  ? -23.771 14.200 -46.610 1.00 181.48 ? 37  CYS A CB  1 
ATOM   225  N  N   . THR A 1 46  ? -25.023 11.462 -45.143 1.00 177.95 ? 38  THR A N   1 
ATOM   226  C  CA  . THR A 1 46  ? -25.148 10.662 -43.929 1.00 178.30 ? 38  THR A CA  1 
ATOM   227  C  C   . THR A 1 46  ? -23.826 10.012 -43.532 1.00 178.27 ? 38  THR A C   1 
ATOM   228  O  O   . THR A 1 46  ? -23.693 9.484  -42.429 1.00 177.30 ? 38  THR A O   1 
ATOM   229  C  CB  . THR A 1 46  ? -26.215 9.562  -44.094 1.00 186.14 ? 38  THR A CB  1 
ATOM   230  O  OG1 . THR A 1 46  ? -25.814 8.655  -45.129 1.00 185.54 ? 38  THR A OG1 1 
ATOM   231  C  CG2 . THR A 1 46  ? -27.560 10.175 -44.456 1.00 188.23 ? 38  THR A CG2 1 
ATOM   232  N  N   . SER A 1 47  ? -22.850 10.054 -44.434 1.00 178.51 ? 39  SER A N   1 
ATOM   233  C  CA  . SER A 1 47  ? -21.552 9.438  -44.182 1.00 176.35 ? 39  SER A CA  1 
ATOM   234  C  C   . SER A 1 47  ? -20.416 10.276 -44.755 1.00 175.46 ? 39  SER A C   1 
ATOM   235  O  O   . SER A 1 47  ? -20.649 11.193 -45.542 1.00 175.03 ? 39  SER A O   1 
ATOM   236  C  CB  . SER A 1 47  ? -21.507 8.027  -44.772 1.00 180.91 ? 39  SER A CB  1 
ATOM   237  O  OG  . SER A 1 47  ? -22.542 7.219  -44.240 1.00 188.96 ? 39  SER A OG  1 
ATOM   238  N  N   . PHE A 1 48  ? -19.187 9.955  -44.359 1.00 175.41 ? 40  PHE A N   1 
ATOM   239  C  CA  . PHE A 1 48  ? -18.016 10.662 -44.867 1.00 172.68 ? 40  PHE A CA  1 
ATOM   240  C  C   . PHE A 1 48  ? -16.735 9.841  -44.722 1.00 173.43 ? 40  PHE A C   1 
ATOM   241  O  O   . PHE A 1 48  ? -16.678 8.881  -43.953 1.00 174.01 ? 40  PHE A O   1 
ATOM   242  C  CB  . PHE A 1 48  ? -17.858 12.022 -44.167 1.00 171.10 ? 40  PHE A CB  1 
ATOM   243  C  CG  . PHE A 1 48  ? -17.317 11.942 -42.759 1.00 169.86 ? 40  PHE A CG  1 
ATOM   244  C  CD1 . PHE A 1 48  ? -17.749 10.969 -41.870 1.00 173.24 ? 40  PHE A CD1 1 
ATOM   245  C  CD2 . PHE A 1 48  ? -16.378 12.863 -42.323 1.00 167.83 ? 40  PHE A CD2 1 
ATOM   246  C  CE1 . PHE A 1 48  ? -17.247 10.913 -40.582 1.00 171.72 ? 40  PHE A CE1 1 
ATOM   247  C  CE2 . PHE A 1 48  ? -15.877 12.812 -41.037 1.00 167.25 ? 40  PHE A CE2 1 
ATOM   248  C  CZ  . PHE A 1 48  ? -16.310 11.835 -40.167 1.00 167.60 ? 40  PHE A CZ  1 
ATOM   249  N  N   . SER A 1 49  ? -15.715 10.227 -45.480 1.00 167.96 ? 41  SER A N   1 
ATOM   250  C  CA  . SER A 1 49  ? -14.417 9.569  -45.431 1.00 166.98 ? 41  SER A CA  1 
ATOM   251  C  C   . SER A 1 49  ? -13.319 10.596 -45.689 1.00 165.01 ? 41  SER A C   1 
ATOM   252  O  O   . SER A 1 49  ? -13.528 11.560 -46.426 1.00 164.30 ? 41  SER A O   1 
ATOM   253  C  CB  . SER A 1 49  ? -14.348 8.431  -46.452 1.00 172.04 ? 41  SER A CB  1 
ATOM   254  O  OG  . SER A 1 49  ? -13.206 7.620  -46.237 1.00 178.12 ? 41  SER A OG  1 
ATOM   255  N  N   . ILE A 1 50  ? -12.155 10.395 -45.079 1.00 162.81 ? 42  ILE A N   1 
ATOM   256  C  CA  . ILE A 1 50  ? -11.071 11.369 -45.173 1.00 159.46 ? 42  ILE A CA  1 
ATOM   257  C  C   . ILE A 1 50  ? -9.750  10.751 -45.619 1.00 159.81 ? 42  ILE A C   1 
ATOM   258  O  O   . ILE A 1 50  ? -9.336  9.708  -45.112 1.00 160.33 ? 42  ILE A O   1 
ATOM   259  C  CB  . ILE A 1 50  ? -10.827 12.083 -43.823 1.00 158.42 ? 42  ILE A CB  1 
ATOM   260  C  CG1 . ILE A 1 50  ? -12.130 12.647 -43.251 1.00 157.40 ? 42  ILE A CG1 1 
ATOM   261  C  CG2 . ILE A 1 50  ? -9.785  13.181 -43.975 1.00 157.17 ? 42  ILE A CG2 1 
ATOM   262  C  CD1 . ILE A 1 50  ? -12.790 11.743 -42.231 1.00 160.46 ? 42  ILE A CD1 1 
ATOM   263  N  N   . ASN A 1 51  ? -9.090  11.409 -46.566 1.00 153.73 ? 43  ASN A N   1 
ATOM   264  C  CA  . ASN A 1 51  ? -7.731  11.054 -46.947 1.00 153.39 ? 43  ASN A CA  1 
ATOM   265  C  C   . ASN A 1 51  ? -6.832  12.284 -46.899 1.00 152.31 ? 43  ASN A C   1 
ATOM   266  O  O   . ASN A 1 51  ? -7.275  13.394 -47.196 1.00 151.18 ? 43  ASN A O   1 
ATOM   267  C  CB  . ASN A 1 51  ? -7.704  10.426 -48.339 1.00 150.29 ? 43  ASN A CB  1 
ATOM   268  C  CG  . ASN A 1 51  ? -6.333  9.902  -48.714 1.00 151.93 ? 43  ASN A CG  1 
ATOM   269  O  OD1 . ASN A 1 51  ? -5.946  8.805  -48.313 1.00 152.39 ? 43  ASN A OD1 1 
ATOM   270  N  ND2 . ASN A 1 51  ? -5.590  10.686 -49.487 1.00 153.14 ? 43  ASN A ND2 1 
ATOM   271  N  N   . ALA A 1 52  ? -5.573  12.089 -46.520 1.00 142.91 ? 44  ALA A N   1 
ATOM   272  C  CA  . ALA A 1 52  ? -4.639  13.202 -46.395 1.00 141.65 ? 44  ALA A CA  1 
ATOM   273  C  C   . ALA A 1 52  ? -3.242  12.830 -46.881 1.00 143.42 ? 44  ALA A C   1 
ATOM   274  O  O   . ALA A 1 52  ? -2.979  11.680 -47.234 1.00 145.56 ? 44  ALA A O   1 
ATOM   275  C  CB  . ALA A 1 52  ? -4.583  13.682 -44.953 1.00 137.80 ? 44  ALA A CB  1 
ATOM   276  N  N   . SER A 1 53  ? -2.352  13.818 -46.894 1.00 141.30 ? 45  SER A N   1 
ATOM   277  C  CA  . SER A 1 53  ? -0.969  13.616 -47.311 1.00 143.03 ? 45  SER A CA  1 
ATOM   278  C  C   . SER A 1 53  ? -0.204  12.771 -46.291 1.00 142.44 ? 45  SER A C   1 
ATOM   279  O  O   . SER A 1 53  ? -0.608  12.687 -45.129 1.00 140.33 ? 45  SER A O   1 
ATOM   280  C  CB  . SER A 1 53  ? -0.274  14.968 -47.507 1.00 142.70 ? 45  SER A CB  1 
ATOM   281  O  OG  . SER A 1 53  ? -0.100  15.644 -46.272 1.00 141.43 ? 45  SER A OG  1 
ATOM   282  N  N   . PRO A 1 54  ? 0.897   12.129 -46.726 1.00 143.57 ? 46  PRO A N   1 
ATOM   283  C  CA  . PRO A 1 54  ? 1.744   11.322 -45.836 1.00 142.65 ? 46  PRO A CA  1 
ATOM   284  C  C   . PRO A 1 54  ? 2.198   12.067 -44.582 1.00 138.68 ? 46  PRO A C   1 
ATOM   285  O  O   . PRO A 1 54  ? 2.305   11.460 -43.517 1.00 137.37 ? 46  PRO A O   1 
ATOM   286  C  CB  . PRO A 1 54  ? 2.945   10.981 -46.720 1.00 146.30 ? 46  PRO A CB  1 
ATOM   287  C  CG  . PRO A 1 54  ? 2.390   10.951 -48.092 1.00 149.79 ? 46  PRO A CG  1 
ATOM   288  C  CD  . PRO A 1 54  ? 1.331   12.021 -48.132 1.00 147.84 ? 46  PRO A CD  1 
ATOM   289  N  N   . GLY A 1 55  ? 2.457   13.364 -44.711 1.00 140.37 ? 47  GLY A N   1 
ATOM   290  C  CA  . GLY A 1 55  ? 2.897   14.169 -43.587 1.00 138.10 ? 47  GLY A CA  1 
ATOM   291  C  C   . GLY A 1 55  ? 1.831   14.323 -42.518 1.00 139.01 ? 47  GLY A C   1 
ATOM   292  O  O   . GLY A 1 55  ? 2.140   14.546 -41.348 1.00 136.78 ? 47  GLY A O   1 
ATOM   293  N  N   . VAL A 1 56  ? 0.571   14.202 -42.925 1.00 136.50 ? 48  VAL A N   1 
ATOM   294  C  CA  . VAL A 1 56  ? -0.552  14.317 -42.000 1.00 134.75 ? 48  VAL A CA  1 
ATOM   295  C  C   . VAL A 1 56  ? -1.019  12.940 -41.533 1.00 140.04 ? 48  VAL A C   1 
ATOM   296  O  O   . VAL A 1 56  ? -1.232  12.040 -42.344 1.00 142.64 ? 48  VAL A O   1 
ATOM   297  C  CB  . VAL A 1 56  ? -1.736  15.067 -42.646 1.00 136.11 ? 48  VAL A CB  1 
ATOM   298  C  CG1 . VAL A 1 56  ? -2.927  15.107 -41.700 1.00 134.60 ? 48  VAL A CG1 1 
ATOM   299  C  CG2 . VAL A 1 56  ? -1.318  16.475 -43.044 1.00 134.76 ? 48  VAL A CG2 1 
ATOM   300  N  N   . VAL A 1 57  ? -1.172  12.782 -40.222 1.00 136.66 ? 49  VAL A N   1 
ATOM   301  C  CA  . VAL A 1 57  ? -1.611  11.514 -39.649 1.00 139.96 ? 49  VAL A CA  1 
ATOM   302  C  C   . VAL A 1 57  ? -2.986  11.649 -39.000 1.00 142.31 ? 49  VAL A C   1 
ATOM   303  O  O   . VAL A 1 57  ? -3.217  12.554 -38.196 1.00 138.67 ? 49  VAL A O   1 
ATOM   304  C  CB  . VAL A 1 57  ? -0.604  10.991 -38.608 1.00 143.09 ? 49  VAL A CB  1 
ATOM   305  C  CG1 . VAL A 1 57  ? -1.100  9.692  -37.992 1.00 146.62 ? 49  VAL A CG1 1 
ATOM   306  C  CG2 . VAL A 1 57  ? 0.761   10.796 -39.246 1.00 144.89 ? 49  VAL A CG2 1 
ATOM   307  N  N   . VAL A 1 58  ? -3.895  10.745 -39.351 1.00 146.12 ? 50  VAL A N   1 
ATOM   308  C  CA  . VAL A 1 58  ? -5.259  10.794 -38.840 1.00 145.93 ? 50  VAL A CA  1 
ATOM   309  C  C   . VAL A 1 58  ? -5.551  9.659  -37.861 1.00 151.30 ? 50  VAL A C   1 
ATOM   310  O  O   . VAL A 1 58  ? -5.373  8.485  -38.185 1.00 155.14 ? 50  VAL A O   1 
ATOM   311  C  CB  . VAL A 1 58  ? -6.288  10.735 -39.985 1.00 149.42 ? 50  VAL A CB  1 
ATOM   312  C  CG1 . VAL A 1 58  ? -7.697  10.901 -39.439 1.00 148.27 ? 50  VAL A CG1 1 
ATOM   313  C  CG2 . VAL A 1 58  ? -5.985  11.801 -41.026 1.00 147.56 ? 50  VAL A CG2 1 
ATOM   314  N  N   . ASP A 1 59  ? -5.999  10.022 -36.663 1.00 148.47 ? 51  ASP A N   1 
ATOM   315  C  CA  . ASP A 1 59  ? -6.415  9.044  -35.664 1.00 151.07 ? 51  ASP A CA  1 
ATOM   316  C  C   . ASP A 1 59  ? -7.883  9.250  -35.299 1.00 151.66 ? 51  ASP A C   1 
ATOM   317  O  O   . ASP A 1 59  ? -8.202  9.946  -34.335 1.00 148.45 ? 51  ASP A O   1 
ATOM   318  C  CB  . ASP A 1 59  ? -5.537  9.136  -34.413 1.00 151.30 ? 51  ASP A CB  1 
ATOM   319  C  CG  . ASP A 1 59  ? -4.147  8.568  -34.632 1.00 162.59 ? 51  ASP A CG  1 
ATOM   320  O  OD1 . ASP A 1 59  ? -3.987  7.717  -35.532 1.00 168.33 ? 51  ASP A OD1 1 
ATOM   321  O  OD2 . ASP A 1 59  ? -3.215  8.966  -33.901 1.00 164.12 ? 51  ASP A OD2 1 
ATOM   322  N  N   . ILE A 1 60  ? -8.771  8.640  -36.078 1.00 150.51 ? 52  ILE A N   1 
ATOM   323  C  CA  . ILE A 1 60  ? -10.206 8.801  -35.876 1.00 150.15 ? 52  ILE A CA  1 
ATOM   324  C  C   . ILE A 1 60  ? -10.790 7.644  -35.061 1.00 154.82 ? 52  ILE A C   1 
ATOM   325  O  O   . ILE A 1 60  ? -10.422 6.484  -35.254 1.00 158.21 ? 52  ILE A O   1 
ATOM   326  C  CB  . ILE A 1 60  ? -10.950 8.924  -37.230 1.00 153.09 ? 52  ILE A CB  1 
ATOM   327  C  CG1 . ILE A 1 60  ? -12.439 9.201  -37.009 1.00 154.76 ? 52  ILE A CG1 1 
ATOM   328  C  CG2 . ILE A 1 60  ? -10.744 7.680  -38.087 1.00 157.12 ? 52  ILE A CG2 1 
ATOM   329  C  CD1 . ILE A 1 60  ? -13.203 9.477  -38.284 1.00 160.78 ? 52  ILE A CD1 1 
ATOM   330  N  N   . ALA A 1 61  ? -11.690 7.970  -34.137 1.00 154.89 ? 53  ALA A N   1 
ATOM   331  C  CA  . ALA A 1 61  ? -12.312 6.964  -33.283 1.00 157.78 ? 53  ALA A CA  1 
ATOM   332  C  C   . ALA A 1 61  ? -13.748 7.344  -32.933 1.00 158.33 ? 53  ALA A C   1 
ATOM   333  O  O   . ALA A 1 61  ? -14.110 8.521  -32.946 1.00 154.32 ? 53  ALA A O   1 
ATOM   334  C  CB  . ALA A 1 61  ? -11.493 6.765  -32.017 1.00 157.25 ? 53  ALA A CB  1 
ATOM   335  N  N   . SER A 1 74  ? -15.739 0.715  -44.425 1.00 185.44 ? 66  SER A N   1 
ATOM   336  C  CA  . SER A 1 74  ? -14.771 1.403  -43.580 1.00 180.56 ? 66  SER A CA  1 
ATOM   337  C  C   . SER A 1 74  ? -15.009 2.911  -43.577 1.00 180.21 ? 66  SER A C   1 
ATOM   338  O  O   . SER A 1 74  ? -14.124 3.688  -43.220 1.00 179.23 ? 66  SER A O   1 
ATOM   339  C  CB  . SER A 1 74  ? -13.345 1.096  -44.042 1.00 180.93 ? 66  SER A CB  1 
ATOM   340  O  OG  . SER A 1 74  ? -12.391 1.734  -43.211 1.00 181.49 ? 66  SER A OG  1 
ATOM   341  N  N   . THR A 1 75  ? -16.208 3.318  -43.981 1.00 188.57 ? 67  THR A N   1 
ATOM   342  C  CA  . THR A 1 75  ? -16.578 4.728  -43.973 1.00 186.19 ? 67  THR A CA  1 
ATOM   343  C  C   . THR A 1 75  ? -17.429 5.040  -42.742 1.00 189.29 ? 67  THR A C   1 
ATOM   344  O  O   . THR A 1 75  ? -18.217 4.208  -42.290 1.00 192.00 ? 67  THR A O   1 
ATOM   345  C  CB  . THR A 1 75  ? -17.332 5.123  -45.261 1.00 188.11 ? 67  THR A CB  1 
ATOM   346  O  OG1 . THR A 1 75  ? -17.714 6.503  -45.194 1.00 185.76 ? 67  THR A OG1 1 
ATOM   347  C  CG2 . THR A 1 75  ? -18.570 4.259  -45.454 1.00 186.02 ? 67  THR A CG2 1 
ATOM   348  N  N   . TRP A 1 76  ? -17.259 6.242  -42.201 1.00 184.85 ? 68  TRP A N   1 
ATOM   349  C  CA  . TRP A 1 76  ? -17.850 6.600  -40.914 1.00 184.23 ? 68  TRP A CA  1 
ATOM   350  C  C   . TRP A 1 76  ? -19.218 7.274  -41.075 1.00 186.83 ? 68  TRP A C   1 
ATOM   351  O  O   . TRP A 1 76  ? -19.482 7.908  -42.096 1.00 186.18 ? 68  TRP A O   1 
ATOM   352  C  CB  . TRP A 1 76  ? -16.879 7.500  -40.145 1.00 179.50 ? 68  TRP A CB  1 
ATOM   353  C  CG  . TRP A 1 76  ? -15.475 6.971  -40.157 1.00 180.15 ? 68  TRP A CG  1 
ATOM   354  C  CD1 . TRP A 1 76  ? -14.399 7.519  -40.792 1.00 179.93 ? 68  TRP A CD1 1 
ATOM   355  C  CD2 . TRP A 1 76  ? -15.002 5.772  -39.530 1.00 182.62 ? 68  TRP A CD2 1 
ATOM   356  N  NE1 . TRP A 1 76  ? -13.281 6.745  -40.586 1.00 180.86 ? 68  TRP A NE1 1 
ATOM   357  C  CE2 . TRP A 1 76  ? -13.626 5.665  -39.815 1.00 184.47 ? 68  TRP A CE2 1 
ATOM   358  C  CE3 . TRP A 1 76  ? -15.607 4.782  -38.749 1.00 186.17 ? 68  TRP A CE3 1 
ATOM   359  C  CZ2 . TRP A 1 76  ? -12.846 4.609  -39.348 1.00 186.73 ? 68  TRP A CZ2 1 
ATOM   360  C  CZ3 . TRP A 1 76  ? -14.830 3.734  -38.286 1.00 189.53 ? 68  TRP A CZ3 1 
ATOM   361  C  CH2 . TRP A 1 76  ? -13.465 3.656  -38.587 1.00 189.78 ? 68  TRP A CH2 1 
ATOM   362  N  N   . PRO A 1 77  ? -20.097 7.130  -40.063 1.00 184.64 ? 69  PRO A N   1 
ATOM   363  C  CA  . PRO A 1 77  ? -21.498 7.556  -40.174 1.00 186.42 ? 69  PRO A CA  1 
ATOM   364  C  C   . PRO A 1 77  ? -21.775 9.009  -39.774 1.00 185.48 ? 69  PRO A C   1 
ATOM   365  O  O   . PRO A 1 77  ? -22.938 9.355  -39.559 1.00 187.37 ? 69  PRO A O   1 
ATOM   366  C  CB  . PRO A 1 77  ? -22.229 6.602  -39.215 1.00 190.68 ? 69  PRO A CB  1 
ATOM   367  C  CG  . PRO A 1 77  ? -21.144 5.824  -38.475 1.00 192.65 ? 69  PRO A CG  1 
ATOM   368  C  CD  . PRO A 1 77  ? -19.841 6.488  -38.766 1.00 185.95 ? 69  PRO A CD  1 
ATOM   369  N  N   . LEU A 1 78  ? -20.734 9.831  -39.674 1.00 185.80 ? 70  LEU A N   1 
ATOM   370  C  CA  . LEU A 1 78  ? -20.885 11.267 -39.420 1.00 182.91 ? 70  LEU A CA  1 
ATOM   371  C  C   . LEU A 1 78  ? -21.671 11.596 -38.147 1.00 185.29 ? 70  LEU A C   1 
ATOM   372  O  O   . LEU A 1 78  ? -22.356 12.616 -38.082 1.00 184.82 ? 70  LEU A O   1 
ATOM   373  C  CB  . LEU A 1 78  ? -21.554 11.944 -40.622 1.00 154.87 ? 70  LEU A CB  1 
ATOM   374  N  N   . ASP A 1 79  ? -21.572 10.731 -37.144 1.00 178.46 ? 71  ASP A N   1 
ATOM   375  C  CA  . ASP A 1 79  ? -22.177 10.996 -35.843 1.00 177.29 ? 71  ASP A CA  1 
ATOM   376  C  C   . ASP A 1 79  ? -21.367 12.072 -35.126 1.00 173.44 ? 71  ASP A C   1 
ATOM   377  O  O   . ASP A 1 79  ? -20.148 12.113 -35.260 1.00 170.43 ? 71  ASP A O   1 
ATOM   378  C  CB  . ASP A 1 79  ? -22.243 9.713  -35.007 1.00 180.72 ? 71  ASP A CB  1 
ATOM   379  C  CG  . ASP A 1 79  ? -22.909 9.922  -33.660 1.00 186.29 ? 71  ASP A CG  1 
ATOM   380  O  OD1 . ASP A 1 79  ? -24.149 9.801  -33.584 1.00 188.99 ? 71  ASP A OD1 1 
ATOM   381  O  OD2 . ASP A 1 79  ? -22.191 10.209 -32.679 1.00 186.52 ? 71  ASP A OD2 1 
ATOM   382  N  N   . PRO A 1 80  ? -22.043 12.960 -34.377 1.00 178.49 ? 72  PRO A N   1 
ATOM   383  C  CA  . PRO A 1 80  ? -21.345 14.014 -33.628 1.00 173.57 ? 72  PRO A CA  1 
ATOM   384  C  C   . PRO A 1 80  ? -20.294 13.476 -32.655 1.00 172.19 ? 72  PRO A C   1 
ATOM   385  O  O   . PRO A 1 80  ? -19.327 14.174 -32.354 1.00 168.37 ? 72  PRO A O   1 
ATOM   386  C  CB  . PRO A 1 80  ? -22.478 14.706 -32.866 1.00 174.86 ? 72  PRO A CB  1 
ATOM   387  C  CG  . PRO A 1 80  ? -23.680 14.483 -33.712 1.00 182.08 ? 72  PRO A CG  1 
ATOM   388  C  CD  . PRO A 1 80  ? -23.507 13.117 -34.312 1.00 182.34 ? 72  PRO A CD  1 
ATOM   389  N  N   . GLY A 1 81  ? -20.481 12.247 -32.185 1.00 174.49 ? 73  GLY A N   1 
ATOM   390  C  CA  . GLY A 1 81  ? -19.597 11.662 -31.193 1.00 172.73 ? 73  GLY A CA  1 
ATOM   391  C  C   . GLY A 1 81  ? -18.246 11.197 -31.707 1.00 173.47 ? 73  GLY A C   1 
ATOM   392  O  O   . GLY A 1 81  ? -17.384 10.809 -30.918 1.00 171.91 ? 73  GLY A O   1 
ATOM   393  N  N   . VAL A 1 82  ? -18.051 11.231 -33.022 1.00 171.77 ? 74  VAL A N   1 
ATOM   394  C  CA  . VAL A 1 82  ? -16.790 10.781 -33.603 1.00 170.77 ? 74  VAL A CA  1 
ATOM   395  C  C   . VAL A 1 82  ? -15.700 11.838 -33.399 1.00 167.26 ? 74  VAL A C   1 
ATOM   396  O  O   . VAL A 1 82  ? -15.966 13.041 -33.451 1.00 164.64 ? 74  VAL A O   1 
ATOM   397  C  CB  . VAL A 1 82  ? -16.943 10.446 -35.111 1.00 149.88 ? 74  VAL A CB  1 
ATOM   398  C  CG1 . VAL A 1 82  ? -17.112 11.708 -35.949 1.00 149.78 ? 74  VAL A CG1 1 
ATOM   399  C  CG2 . VAL A 1 82  ? -15.757 9.631  -35.602 1.00 149.82 ? 74  VAL A CG2 1 
ATOM   400  N  N   . GLU A 1 83  ? -14.476 11.386 -33.138 1.00 156.20 ? 75  GLU A N   1 
ATOM   401  C  CA  . GLU A 1 83  ? -13.355 12.297 -32.919 1.00 151.54 ? 75  GLU A CA  1 
ATOM   402  C  C   . GLU A 1 83  ? -12.276 12.144 -33.984 1.00 152.19 ? 75  GLU A C   1 
ATOM   403  O  O   . GLU A 1 83  ? -11.581 11.129 -34.036 1.00 153.91 ? 75  GLU A O   1 
ATOM   404  C  CB  . GLU A 1 83  ? -12.737 12.077 -31.534 1.00 150.94 ? 75  GLU A CB  1 
ATOM   405  C  CG  . GLU A 1 83  ? -13.536 12.661 -30.378 1.00 154.83 ? 75  GLU A CG  1 
ATOM   406  C  CD  . GLU A 1 83  ? -12.710 12.792 -29.110 1.00 165.16 ? 75  GLU A CD  1 
ATOM   407  O  OE1 . GLU A 1 83  ? -12.890 11.966 -28.190 1.00 168.04 ? 75  GLU A OE1 1 
ATOM   408  O  OE2 . GLU A 1 83  ? -11.880 13.723 -29.032 1.00 156.75 ? 75  GLU A OE2 1 
ATOM   409  N  N   . VAL A 1 84  ? -12.136 13.162 -34.827 1.00 143.49 ? 76  VAL A N   1 
ATOM   410  C  CA  . VAL A 1 84  ? -11.091 13.177 -35.844 1.00 143.25 ? 76  VAL A CA  1 
ATOM   411  C  C   . VAL A 1 84  ? -9.868  13.936 -35.338 1.00 142.40 ? 76  VAL A C   1 
ATOM   412  O  O   . VAL A 1 84  ? -9.896  15.159 -35.211 1.00 139.64 ? 76  VAL A O   1 
ATOM   413  C  CB  . VAL A 1 84  ? -11.581 13.819 -37.155 1.00 145.79 ? 76  VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 84  ? -10.484 13.783 -38.205 1.00 145.76 ? 76  VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 84  ? -12.827 13.111 -37.659 1.00 149.16 ? 76  VAL A CG2 1 
ATOM   416  N  N   . THR A 1 85  ? -8.796  13.204 -35.051 1.00 140.32 ? 77  THR A N   1 
ATOM   417  C  CA  . THR A 1 85  ? -7.576  13.803 -34.520 1.00 137.26 ? 77  THR A CA  1 
ATOM   418  C  C   . THR A 1 85  ? -6.493  13.885 -35.594 1.00 139.96 ? 77  THR A C   1 
ATOM   419  O  O   . THR A 1 85  ? -6.325  12.959 -36.387 1.00 142.93 ? 77  THR A O   1 
ATOM   420  C  CB  . THR A 1 85  ? -7.040  13.005 -33.315 1.00 141.16 ? 77  THR A CB  1 
ATOM   421  O  OG1 . THR A 1 85  ? -8.121  12.692 -32.427 1.00 141.58 ? 77  THR A OG1 1 
ATOM   422  C  CG2 . THR A 1 85  ? -5.984  13.802 -32.565 1.00 136.46 ? 77  THR A CG2 1 
ATOM   423  N  N   . LEU A 1 86  ? -5.763  14.997 -35.617 1.00 134.57 ? 78  LEU A N   1 
ATOM   424  C  CA  . LEU A 1 86  ? -4.693  15.188 -36.592 1.00 134.86 ? 78  LEU A CA  1 
ATOM   425  C  C   . LEU A 1 86  ? -3.331  15.356 -35.928 1.00 135.10 ? 78  LEU A C   1 
ATOM   426  O  O   . LEU A 1 86  ? -3.209  15.991 -34.880 1.00 131.73 ? 78  LEU A O   1 
ATOM   427  C  CB  . LEU A 1 86  ? -4.983  16.400 -37.481 1.00 133.85 ? 78  LEU A CB  1 
ATOM   428  C  CG  . LEU A 1 86  ? -6.161  16.298 -38.452 1.00 138.16 ? 78  LEU A CG  1 
ATOM   429  C  CD1 . LEU A 1 86  ? -6.173  17.493 -39.393 1.00 138.00 ? 78  LEU A CD1 1 
ATOM   430  C  CD2 . LEU A 1 86  ? -6.111  14.994 -39.231 1.00 142.57 ? 78  LEU A CD2 1 
ATOM   431  N  N   . THR A 1 87  ? -2.308  14.784 -36.555 1.00 130.85 ? 79  THR A N   1 
ATOM   432  C  CA  . THR A 1 87  ? -0.939  14.902 -36.069 1.00 129.76 ? 79  THR A CA  1 
ATOM   433  C  C   . THR A 1 87  ? 0.019   15.042 -37.248 1.00 132.83 ? 79  THR A C   1 
ATOM   434  O  O   . THR A 1 87  ? -0.016  14.242 -38.183 1.00 135.38 ? 79  THR A O   1 
ATOM   435  C  CB  . THR A 1 87  ? -0.530  13.685 -35.215 1.00 135.13 ? 79  THR A CB  1 
ATOM   436  O  OG1 . THR A 1 87  ? -1.537  13.429 -34.229 1.00 134.28 ? 79  THR A OG1 1 
ATOM   437  C  CG2 . THR A 1 87  ? 0.801   13.939 -34.525 1.00 132.98 ? 79  THR A CG2 1 
ATOM   438  N  N   . MET A 1 88  ? 0.870   16.063 -37.205 1.00 129.34 ? 80  MET A N   1 
ATOM   439  C  CA  . MET A 1 88  ? 1.818   16.303 -38.287 1.00 130.42 ? 80  MET A CA  1 
ATOM   440  C  C   . MET A 1 88  ? 3.236   15.906 -37.882 1.00 133.00 ? 80  MET A C   1 
ATOM   441  O  O   . MET A 1 88  ? 3.671   16.168 -36.761 1.00 130.93 ? 80  MET A O   1 
ATOM   442  C  CB  . MET A 1 88  ? 1.776   17.770 -38.719 1.00 130.00 ? 80  MET A CB  1 
ATOM   443  C  CG  . MET A 1 88  ? 0.430   18.200 -39.287 1.00 132.47 ? 80  MET A CG  1 
ATOM   444  S  SD  . MET A 1 88  ? 0.461   19.849 -40.014 1.00 135.21 ? 80  MET A SD  1 
ATOM   445  C  CE  . MET A 1 88  ? 1.684   19.623 -41.302 1.00 135.76 ? 80  MET A CE  1 
ATOM   446  N  N   . LYS A 1 89  ? 3.952   15.275 -38.808 1.00 129.19 ? 81  LYS A N   1 
ATOM   447  C  CA  . LYS A 1 89  ? 5.271   14.720 -38.523 1.00 130.98 ? 81  LYS A CA  1 
ATOM   448  C  C   . LYS A 1 89  ? 6.331   15.796 -38.301 1.00 131.66 ? 81  LYS A C   1 
ATOM   449  O  O   . LYS A 1 89  ? 7.045   15.770 -37.298 1.00 131.10 ? 81  LYS A O   1 
ATOM   450  C  CB  . LYS A 1 89  ? 5.710   13.793 -39.657 1.00 136.58 ? 81  LYS A CB  1 
ATOM   451  N  N   . VAL A 1 90  ? 6.437   16.737 -39.234 1.00 133.14 ? 82  VAL A N   1 
ATOM   452  C  CA  . VAL A 1 90  ? 7.475   17.760 -39.151 1.00 132.24 ? 82  VAL A CA  1 
ATOM   453  C  C   . VAL A 1 90  ? 7.020   19.118 -39.680 1.00 131.89 ? 82  VAL A C   1 
ATOM   454  O  O   . VAL A 1 90  ? 5.915   19.260 -40.203 1.00 130.79 ? 82  VAL A O   1 
ATOM   455  C  CB  . VAL A 1 90  ? 8.738   17.331 -39.921 1.00 126.58 ? 82  VAL A CB  1 
ATOM   456  N  N   . ALA A 1 91  ? 7.893   20.110 -39.535 1.00 129.02 ? 83  ALA A N   1 
ATOM   457  C  CA  . ALA A 1 91  ? 7.610   21.470 -39.978 1.00 127.81 ? 83  ALA A CA  1 
ATOM   458  C  C   . ALA A 1 91  ? 7.472   21.548 -41.494 1.00 132.82 ? 83  ALA A C   1 
ATOM   459  O  O   . ALA A 1 91  ? 8.133   20.814 -42.228 1.00 135.55 ? 83  ALA A O   1 
ATOM   460  C  CB  . ALA A 1 91  ? 8.700   22.416 -39.501 1.00 127.20 ? 83  ALA A CB  1 
ATOM   461  N  N   . SER A 1 92  ? 6.606   22.445 -41.954 1.00 129.79 ? 84  SER A N   1 
ATOM   462  C  CA  . SER A 1 92  ? 6.384   22.647 -43.381 1.00 132.94 ? 84  SER A CA  1 
ATOM   463  C  C   . SER A 1 92  ? 7.544   23.389 -44.034 1.00 135.88 ? 84  SER A C   1 
ATOM   464  O  O   . SER A 1 92  ? 8.126   24.296 -43.440 1.00 134.67 ? 84  SER A O   1 
ATOM   465  C  CB  . SER A 1 92  ? 5.083   23.417 -43.615 1.00 132.93 ? 84  SER A CB  1 
ATOM   466  O  OG  . SER A 1 92  ? 3.956   22.660 -43.212 1.00 134.86 ? 84  SER A OG  1 
ATOM   467  N  N   . GLY A 1 93  ? 7.871   22.999 -45.261 1.00 132.21 ? 85  GLY A N   1 
ATOM   468  C  CA  . GLY A 1 93  ? 8.877   23.695 -46.041 1.00 135.35 ? 85  GLY A CA  1 
ATOM   469  C  C   . GLY A 1 93  ? 8.243   24.794 -46.870 1.00 137.53 ? 85  GLY A C   1 
ATOM   470  O  O   . GLY A 1 93  ? 8.909   25.746 -47.279 1.00 139.53 ? 85  GLY A O   1 
ATOM   471  N  N   . SER A 1 94  ? 6.945   24.654 -47.119 1.00 141.87 ? 86  SER A N   1 
ATOM   472  C  CA  . SER A 1 94  ? 6.182   25.653 -47.859 1.00 143.92 ? 86  SER A CA  1 
ATOM   473  C  C   . SER A 1 94  ? 4.825   25.873 -47.199 1.00 142.72 ? 86  SER A C   1 
ATOM   474  O  O   . SER A 1 94  ? 4.379   25.055 -46.395 1.00 140.56 ? 86  SER A O   1 
ATOM   475  C  CB  . SER A 1 94  ? 5.999   25.225 -49.316 1.00 148.43 ? 86  SER A CB  1 
ATOM   476  O  OG  . SER A 1 94  ? 7.248   24.972 -49.934 1.00 156.67 ? 86  SER A OG  1 
ATOM   477  N  N   . THR A 1 95  ? 4.170   26.979 -47.539 1.00 141.15 ? 87  THR A N   1 
ATOM   478  C  CA  . THR A 1 95  ? 2.863   27.288 -46.966 1.00 139.07 ? 87  THR A CA  1 
ATOM   479  C  C   . THR A 1 95  ? 1.777   26.406 -47.570 1.00 140.13 ? 87  THR A C   1 
ATOM   480  O  O   . THR A 1 95  ? 1.532   26.441 -48.776 1.00 143.72 ? 87  THR A O   1 
ATOM   481  C  CB  . THR A 1 95  ? 2.489   28.769 -47.168 1.00 141.42 ? 87  THR A CB  1 
ATOM   482  O  OG1 . THR A 1 95  ? 3.316   29.588 -46.331 1.00 139.79 ? 87  THR A OG1 1 
ATOM   483  C  CG2 . THR A 1 95  ? 1.030   29.005 -46.805 1.00 140.95 ? 87  THR A CG2 1 
ATOM   484  N  N   . GLY A 1 96  ? 1.131   25.614 -46.721 1.00 133.65 ? 88  GLY A N   1 
ATOM   485  C  CA  . GLY A 1 96  ? 0.079   24.716 -47.160 1.00 134.39 ? 88  GLY A CA  1 
ATOM   486  C  C   . GLY A 1 96  ? 0.598   23.573 -48.009 1.00 136.69 ? 88  GLY A C   1 
ATOM   487  O  O   . GLY A 1 96  ? -0.034  23.189 -48.993 1.00 139.34 ? 88  GLY A O   1 
ATOM   488  N  N   . ASP A 1 97  ? 1.749   23.024 -47.629 1.00 139.16 ? 89  ASP A N   1 
ATOM   489  C  CA  . ASP A 1 97  ? 2.353   21.930 -48.383 1.00 141.65 ? 89  ASP A CA  1 
ATOM   490  C  C   . ASP A 1 97  ? 1.760   20.577 -47.990 1.00 140.37 ? 89  ASP A C   1 
ATOM   491  O  O   . ASP A 1 97  ? 2.132   19.542 -48.543 1.00 142.45 ? 89  ASP A O   1 
ATOM   492  C  CB  . ASP A 1 97  ? 3.874   21.916 -48.195 1.00 141.89 ? 89  ASP A CB  1 
ATOM   493  C  CG  . ASP A 1 97  ? 4.289   21.891 -46.735 1.00 143.55 ? 89  ASP A CG  1 
ATOM   494  O  OD1 . ASP A 1 97  ? 3.417   21.713 -45.859 1.00 142.64 ? 89  ASP A OD1 1 
ATOM   495  O  OD2 . ASP A 1 97  ? 5.500   22.042 -46.467 1.00 147.08 ? 89  ASP A OD2 1 
ATOM   496  N  N   . GLN A 1 98  ? 0.840   20.593 -47.030 1.00 138.42 ? 90  GLN A N   1 
ATOM   497  C  CA  . GLN A 1 98  ? 0.133   19.383 -46.625 1.00 137.36 ? 90  GLN A CA  1 
ATOM   498  C  C   . GLN A 1 98  ? -1.366  19.561 -46.827 1.00 137.49 ? 90  GLN A C   1 
ATOM   499  O  O   . GLN A 1 98  ? -1.916  20.624 -46.539 1.00 136.45 ? 90  GLN A O   1 
ATOM   500  C  CB  . GLN A 1 98  ? 0.439   19.034 -45.167 1.00 133.62 ? 90  GLN A CB  1 
ATOM   501  C  CG  . GLN A 1 98  ? 1.922   18.861 -44.854 1.00 133.31 ? 90  GLN A CG  1 
ATOM   502  C  CD  . GLN A 1 98  ? 2.511   17.573 -45.409 1.00 143.47 ? 90  GLN A CD  1 
ATOM   503  O  OE1 . GLN A 1 98  ? 1.883   16.874 -46.203 1.00 141.98 ? 90  GLN A OE1 1 
ATOM   504  N  NE2 . GLN A 1 98  ? 3.728   17.254 -44.985 1.00 138.30 ? 90  GLN A NE2 1 
ATOM   505  N  N   . LYS A 1 99  ? -2.025  18.519 -47.324 1.00 138.63 ? 91  LYS A N   1 
ATOM   506  C  CA  . LYS A 1 99  ? -3.432  18.618 -47.692 1.00 139.38 ? 91  LYS A CA  1 
ATOM   507  C  C   . LYS A 1 99  ? -4.312  17.614 -46.950 1.00 137.73 ? 91  LYS A C   1 
ATOM   508  O  O   . LYS A 1 99  ? -3.862  16.532 -46.574 1.00 137.29 ? 91  LYS A O   1 
ATOM   509  C  CB  . LYS A 1 99  ? -3.593  18.422 -49.202 1.00 143.49 ? 91  LYS A CB  1 
ATOM   510  C  CG  . LYS A 1 99  ? -2.678  19.295 -50.046 1.00 145.84 ? 91  LYS A CG  1 
ATOM   511  C  CD  . LYS A 1 99  ? -2.733  18.897 -51.513 1.00 150.18 ? 91  LYS A CD  1 
ATOM   512  N  N   . VAL A 1 100 ? -5.570  17.990 -46.743 1.00 137.56 ? 92  VAL A N   1 
ATOM   513  C  CA  . VAL A 1 100 ? -6.568  17.091 -46.176 1.00 136.63 ? 92  VAL A CA  1 
ATOM   514  C  C   . VAL A 1 100 ? -7.871  17.194 -46.963 1.00 138.71 ? 92  VAL A C   1 
ATOM   515  O  O   . VAL A 1 100 ? -8.482  18.261 -47.028 1.00 138.74 ? 92  VAL A O   1 
ATOM   516  C  CB  . VAL A 1 100 ? -6.845  17.398 -44.690 1.00 133.13 ? 92  VAL A CB  1 
ATOM   517  C  CG1 . VAL A 1 100 ? -8.036  16.593 -44.197 1.00 132.74 ? 92  VAL A CG1 1 
ATOM   518  C  CG2 . VAL A 1 100 ? -5.615  17.107 -43.844 1.00 131.06 ? 92  VAL A CG2 1 
ATOM   519  N  N   . GLN A 1 101 ? -8.292  16.086 -47.566 1.00 141.74 ? 93  GLN A N   1 
ATOM   520  C  CA  . GLN A 1 101 ? -9.525  16.073 -48.346 1.00 143.88 ? 93  GLN A CA  1 
ATOM   521  C  C   . GLN A 1 101 ? -10.663 15.424 -47.569 1.00 146.35 ? 93  GLN A C   1 
ATOM   522  O  O   . GLN A 1 101 ? -10.559 14.276 -47.137 1.00 145.79 ? 93  GLN A O   1 
ATOM   523  C  CB  . GLN A 1 101 ? -9.320  15.345 -49.677 1.00 147.38 ? 93  GLN A CB  1 
ATOM   524  C  CG  . GLN A 1 101 ? -10.504 15.470 -50.627 1.00 158.62 ? 93  GLN A CG  1 
ATOM   525  C  CD  . GLN A 1 101 ? -10.320 14.685 -51.911 1.00 172.30 ? 93  GLN A CD  1 
ATOM   526  O  OE1 . GLN A 1 101 ? -9.600  13.688 -51.946 1.00 170.03 ? 93  GLN A OE1 1 
ATOM   527  N  NE2 . GLN A 1 101 ? -10.972 15.135 -52.978 1.00 170.09 ? 93  GLN A NE2 1 
ATOM   528  N  N   . ILE A 1 102 ? -11.749 16.168 -47.393 1.00 148.94 ? 94  ILE A N   1 
ATOM   529  C  CA  . ILE A 1 102 ? -12.923 15.656 -46.699 1.00 150.27 ? 94  ILE A CA  1 
ATOM   530  C  C   . ILE A 1 102 ? -14.079 15.497 -47.679 1.00 156.93 ? 94  ILE A C   1 
ATOM   531  O  O   . ILE A 1 102 ? -14.609 16.483 -48.191 1.00 158.40 ? 94  ILE A O   1 
ATOM   532  C  CB  . ILE A 1 102 ? -13.355 16.577 -45.538 1.00 150.53 ? 94  ILE A CB  1 
ATOM   533  C  CG1 . ILE A 1 102 ? -12.195 16.809 -44.564 1.00 147.60 ? 94  ILE A CG1 1 
ATOM   534  C  CG2 . ILE A 1 102 ? -14.551 15.986 -44.807 1.00 151.76 ? 94  ILE A CG2 1 
ATOM   535  C  CD1 . ILE A 1 102 ? -11.395 18.075 -44.830 1.00 152.28 ? 94  ILE A CD1 1 
ATOM   536  N  N   . SER A 1 103 ? -14.462 14.251 -47.942 1.00 157.98 ? 95  SER A N   1 
ATOM   537  C  CA  . SER A 1 103 ? -15.533 13.963 -48.890 1.00 161.28 ? 95  SER A CA  1 
ATOM   538  C  C   . SER A 1 103 ? -16.820 13.546 -48.182 1.00 165.13 ? 95  SER A C   1 
ATOM   539  O  O   . SER A 1 103 ? -16.799 12.726 -47.265 1.00 164.14 ? 95  SER A O   1 
ATOM   540  C  CB  . SER A 1 103 ? -15.096 12.871 -49.869 1.00 164.57 ? 95  SER A CB  1 
ATOM   541  O  OG  . SER A 1 103 ? -14.669 11.707 -49.182 1.00 168.81 ? 95  SER A OG  1 
ATOM   542  N  N   . TYR A 1 104 ? -17.938 14.118 -48.618 1.00 164.47 ? 96  TYR A N   1 
ATOM   543  C  CA  . TYR A 1 104 ? -19.240 13.814 -48.032 1.00 166.42 ? 96  TYR A CA  1 
ATOM   544  C  C   . TYR A 1 104 ? -20.060 12.897 -48.936 1.00 170.44 ? 96  TYR A C   1 
ATOM   545  O  O   . TYR A 1 104 ? -19.945 12.950 -50.160 1.00 171.17 ? 96  TYR A O   1 
ATOM   546  C  CB  . TYR A 1 104 ? -20.017 15.104 -47.755 1.00 168.51 ? 96  TYR A CB  1 
ATOM   547  C  CG  . TYR A 1 104 ? -19.310 16.050 -46.813 1.00 167.23 ? 96  TYR A CG  1 
ATOM   548  C  CD1 . TYR A 1 104 ? -19.257 15.789 -45.450 1.00 166.53 ? 96  TYR A CD1 1 
ATOM   549  C  CD2 . TYR A 1 104 ? -18.700 17.206 -47.284 1.00 167.30 ? 96  TYR A CD2 1 
ATOM   550  C  CE1 . TYR A 1 104 ? -18.612 16.649 -44.582 1.00 164.39 ? 96  TYR A CE1 1 
ATOM   551  C  CE2 . TYR A 1 104 ? -18.053 18.075 -46.422 1.00 165.30 ? 96  TYR A CE2 1 
ATOM   552  C  CZ  . TYR A 1 104 ? -18.012 17.790 -45.072 1.00 168.26 ? 96  TYR A CZ  1 
ATOM   553  O  OH  . TYR A 1 104 ? -17.371 18.648 -44.206 1.00 167.87 ? 96  TYR A OH  1 
ATOM   554  N  N   . TYR A 1 105 ? -20.891 12.059 -48.324 1.00 166.03 ? 97  TYR A N   1 
ATOM   555  C  CA  . TYR A 1 105 ? -21.739 11.141 -49.076 1.00 168.48 ? 97  TYR A CA  1 
ATOM   556  C  C   . TYR A 1 105 ? -23.157 11.121 -48.515 1.00 172.17 ? 97  TYR A C   1 
ATOM   557  O  O   . TYR A 1 105 ? -23.401 10.571 -47.441 1.00 171.54 ? 97  TYR A O   1 
ATOM   558  C  CB  . TYR A 1 105 ? -21.148 9.731  -49.063 1.00 169.17 ? 97  TYR A CB  1 
ATOM   559  C  CG  . TYR A 1 105 ? -19.690 9.681  -49.460 1.00 168.03 ? 97  TYR A CG  1 
ATOM   560  C  CD1 . TYR A 1 105 ? -19.311 9.752  -50.793 1.00 169.68 ? 97  TYR A CD1 1 
ATOM   561  C  CD2 . TYR A 1 105 ? -18.693 9.567  -48.500 1.00 166.30 ? 97  TYR A CD2 1 
ATOM   562  C  CE1 . TYR A 1 105 ? -17.979 9.710  -51.161 1.00 168.49 ? 97  TYR A CE1 1 
ATOM   563  C  CE2 . TYR A 1 105 ? -17.359 9.523  -48.857 1.00 165.27 ? 97  TYR A CE2 1 
ATOM   564  C  CZ  . TYR A 1 105 ? -17.007 9.595  -50.188 1.00 170.13 ? 97  TYR A CZ  1 
ATOM   565  O  OH  . TYR A 1 105 ? -15.680 9.552  -50.548 1.00 169.27 ? 97  TYR A OH  1 
ATOM   566  N  N   . PRO A 1 111 ? -21.518 13.151 -54.470 1.00 168.18 ? 103 PRO A N   1 
ATOM   567  C  CA  . PRO A 1 111 ? -20.641 13.484 -53.346 1.00 164.92 ? 103 PRO A CA  1 
ATOM   568  C  C   . PRO A 1 111 ? -20.014 14.873 -53.468 1.00 165.05 ? 103 PRO A C   1 
ATOM   569  O  O   . PRO A 1 111 ? -19.792 15.354 -54.579 1.00 166.63 ? 103 PRO A O   1 
ATOM   570  C  CB  . PRO A 1 111 ? -19.569 12.392 -53.417 1.00 164.74 ? 103 PRO A CB  1 
ATOM   571  C  CG  . PRO A 1 111 ? -20.240 11.223 -54.140 1.00 167.95 ? 103 PRO A CG  1 
ATOM   572  C  CD  . PRO A 1 111 ? -21.563 11.698 -54.699 1.00 169.33 ? 103 PRO A CD  1 
ATOM   573  N  N   . VAL A 1 112 ? -19.738 15.505 -52.332 1.00 162.37 ? 104 VAL A N   1 
ATOM   574  C  CA  . VAL A 1 112 ? -19.110 16.823 -52.313 1.00 161.40 ? 104 VAL A CA  1 
ATOM   575  C  C   . VAL A 1 112 ? -17.858 16.811 -51.440 1.00 159.32 ? 104 VAL A C   1 
ATOM   576  O  O   . VAL A 1 112 ? -17.876 16.291 -50.325 1.00 157.06 ? 104 VAL A O   1 
ATOM   577  C  CB  . VAL A 1 112 ? -20.079 17.906 -51.799 1.00 165.34 ? 104 VAL A CB  1 
ATOM   578  N  N   . LYS A 1 113 ? -16.773 17.388 -51.951 1.00 156.22 ? 105 LYS A N   1 
ATOM   579  C  CA  . LYS A 1 113 ? -15.491 17.362 -51.254 1.00 153.80 ? 105 LYS A CA  1 
ATOM   580  C  C   . LYS A 1 113 ? -15.156 18.697 -50.590 1.00 152.07 ? 105 LYS A C   1 
ATOM   581  O  O   . LYS A 1 113 ? -15.449 19.764 -51.130 1.00 153.76 ? 105 LYS A O   1 
ATOM   582  C  CB  . LYS A 1 113 ? -14.372 16.971 -52.222 1.00 155.55 ? 105 LYS A CB  1 
ATOM   583  N  N   . ALA A 1 114 ? -14.538 18.622 -49.414 1.00 151.34 ? 106 ALA A N   1 
ATOM   584  C  CA  . ALA A 1 114 ? -14.083 19.807 -48.692 1.00 149.53 ? 106 ALA A CA  1 
ATOM   585  C  C   . ALA A 1 114 ? -12.569 19.763 -48.503 1.00 148.15 ? 106 ALA A C   1 
ATOM   586  O  O   . ALA A 1 114 ? -12.011 18.729 -48.135 1.00 146.97 ? 106 ALA A O   1 
ATOM   587  C  CB  . ALA A 1 114 ? -14.786 19.918 -47.347 1.00 147.15 ? 106 ALA A CB  1 
ATOM   588  N  N   . LEU A 1 115 ? -11.909 20.890 -48.754 1.00 141.87 ? 107 LEU A N   1 
ATOM   589  C  CA  . LEU A 1 115 ? -10.450 20.945 -48.718 1.00 141.08 ? 107 LEU A CA  1 
ATOM   590  C  C   . LEU A 1 115 ? -9.906  21.588 -47.447 1.00 137.92 ? 107 LEU A C   1 
ATOM   591  O  O   . LEU A 1 115 ? -10.596 22.361 -46.780 1.00 136.94 ? 107 LEU A O   1 
ATOM   592  C  CB  . LEU A 1 115 ? -9.923  21.697 -49.942 1.00 144.08 ? 107 LEU A CB  1 
ATOM   593  C  CG  . LEU A 1 115 ? -9.687  20.849 -51.193 1.00 147.06 ? 107 LEU A CG  1 
ATOM   594  C  CD1 . LEU A 1 115 ? -9.452  21.730 -52.407 1.00 150.48 ? 107 LEU A CD1 1 
ATOM   595  C  CD2 . LEU A 1 115 ? -8.509  19.909 -50.975 1.00 146.13 ? 107 LEU A CD2 1 
ATOM   596  N  N   . LEU A 1 116 ? -8.657  21.260 -47.127 1.00 136.92 ? 108 LEU A N   1 
ATOM   597  C  CA  . LEU A 1 116 ? -7.985  21.793 -45.948 1.00 133.94 ? 108 LEU A CA  1 
ATOM   598  C  C   . LEU A 1 116 ? -6.472  21.843 -46.153 1.00 133.92 ? 108 LEU A C   1 
ATOM   599  O  O   . LEU A 1 116 ? -5.809  20.806 -46.185 1.00 133.76 ? 108 LEU A O   1 
ATOM   600  C  CB  . LEU A 1 116 ? -8.316  20.952 -44.714 1.00 131.16 ? 108 LEU A CB  1 
ATOM   601  C  CG  . LEU A 1 116 ? -7.600  21.339 -43.419 1.00 127.99 ? 108 LEU A CG  1 
ATOM   602  C  CD1 . LEU A 1 116 ? -8.016  22.730 -42.965 1.00 127.46 ? 108 LEU A CD1 1 
ATOM   603  C  CD2 . LEU A 1 116 ? -7.860  20.312 -42.327 1.00 125.78 ? 108 LEU A CD2 1 
ATOM   604  N  N   . TYR A 1 117 ? -5.931  23.049 -46.293 1.00 133.61 ? 109 TYR A N   1 
ATOM   605  C  CA  . TYR A 1 117 ? -4.495  23.221 -46.481 1.00 133.83 ? 109 TYR A CA  1 
ATOM   606  C  C   . TYR A 1 117 ? -3.810  23.537 -45.154 1.00 130.42 ? 109 TYR A C   1 
ATOM   607  O  O   . TYR A 1 117 ? -4.128  24.531 -44.499 1.00 129.17 ? 109 TYR A O   1 
ATOM   608  C  CB  . TYR A 1 117 ? -4.215  24.321 -47.508 1.00 136.83 ? 109 TYR A CB  1 
ATOM   609  C  CG  . TYR A 1 117 ? -4.698  23.987 -48.905 1.00 140.54 ? 109 TYR A CG  1 
ATOM   610  C  CD1 . TYR A 1 117 ? -3.895  23.275 -49.787 1.00 142.75 ? 109 TYR A CD1 1 
ATOM   611  C  CD2 . TYR A 1 117 ? -5.957  24.382 -49.341 1.00 142.05 ? 109 TYR A CD2 1 
ATOM   612  C  CE1 . TYR A 1 117 ? -4.332  22.966 -51.064 1.00 146.31 ? 109 TYR A CE1 1 
ATOM   613  C  CE2 . TYR A 1 117 ? -6.403  24.077 -50.616 1.00 145.49 ? 109 TYR A CE2 1 
ATOM   614  C  CZ  . TYR A 1 117 ? -5.585  23.369 -51.473 1.00 147.62 ? 109 TYR A CZ  1 
ATOM   615  O  OH  . TYR A 1 117 ? -6.022  23.063 -52.742 1.00 151.92 ? 109 TYR A OH  1 
ATOM   616  N  N   . LEU A 1 118 ? -2.870  22.683 -44.764 1.00 130.41 ? 110 LEU A N   1 
ATOM   617  C  CA  . LEU A 1 118 ? -2.221  22.795 -43.463 1.00 127.12 ? 110 LEU A CA  1 
ATOM   618  C  C   . LEU A 1 118 ? -0.759  23.211 -43.575 1.00 127.35 ? 110 LEU A C   1 
ATOM   619  O  O   . LEU A 1 118 ? -0.064  22.833 -44.517 1.00 129.77 ? 110 LEU A O   1 
ATOM   620  C  CB  . LEU A 1 118 ? -2.321  21.467 -42.708 1.00 125.28 ? 110 LEU A CB  1 
ATOM   621  C  CG  . LEU A 1 118 ? -3.737  20.962 -42.422 1.00 124.90 ? 110 LEU A CG  1 
ATOM   622  C  CD1 . LEU A 1 118 ? -3.702  19.574 -41.805 1.00 123.72 ? 110 LEU A CD1 1 
ATOM   623  C  CD2 . LEU A 1 118 ? -4.470  21.934 -41.516 1.00 123.07 ? 110 LEU A CD2 1 
ATOM   624  N  N   . THR A 1 119 ? -0.302  23.990 -42.600 1.00 128.30 ? 111 THR A N   1 
ATOM   625  C  CA  . THR A 1 119 ? 1.093   24.406 -42.533 1.00 128.21 ? 111 THR A CA  1 
ATOM   626  C  C   . THR A 1 119 ? 1.675   24.079 -41.161 1.00 124.71 ? 111 THR A C   1 
ATOM   627  O  O   . THR A 1 119 ? 1.217   24.599 -40.143 1.00 122.31 ? 111 THR A O   1 
ATOM   628  C  CB  . THR A 1 119 ? 1.251   25.913 -42.809 1.00 129.34 ? 111 THR A CB  1 
ATOM   629  O  OG1 . THR A 1 119 ? 0.603   26.246 -44.042 1.00 132.71 ? 111 THR A OG1 1 
ATOM   630  C  CG2 . THR A 1 119 ? 2.723   26.289 -42.895 1.00 129.82 ? 111 THR A CG2 1 
ATOM   631  N  N   . GLY A 1 120 ? 2.680   23.210 -41.138 1.00 127.18 ? 112 GLY A N   1 
ATOM   632  C  CA  . GLY A 1 120 ? 3.301   22.798 -39.893 1.00 124.75 ? 112 GLY A CA  1 
ATOM   633  C  C   . GLY A 1 120 ? 4.413   23.734 -39.466 1.00 126.34 ? 112 GLY A C   1 
ATOM   634  O  O   . GLY A 1 120 ? 5.364   23.963 -40.214 1.00 128.38 ? 112 GLY A O   1 
ATOM   635  N  N   . VAL A 1 121 ? 4.293   24.281 -38.260 1.00 126.06 ? 113 VAL A N   1 
ATOM   636  C  CA  . VAL A 1 121 ? 5.300   25.192 -37.731 1.00 123.34 ? 113 VAL A CA  1 
ATOM   637  C  C   . VAL A 1 121 ? 5.769   24.755 -36.348 1.00 122.93 ? 113 VAL A C   1 
ATOM   638  O  O   . VAL A 1 121 ? 5.040   24.087 -35.614 1.00 121.58 ? 113 VAL A O   1 
ATOM   639  C  CB  . VAL A 1 121 ? 4.770   26.637 -37.649 1.00 125.22 ? 113 VAL A CB  1 
ATOM   640  C  CG1 . VAL A 1 121 ? 4.430   27.158 -39.037 1.00 128.32 ? 113 VAL A CG1 1 
ATOM   641  C  CG2 . VAL A 1 121 ? 3.557   26.709 -36.733 1.00 122.04 ? 113 VAL A CG2 1 
ATOM   642  N  N   . GLU A 1 122 ? 6.994   25.133 -36.001 1.00 125.17 ? 114 GLU A N   1 
ATOM   643  C  CA  . GLU A 1 122 ? 7.549   24.819 -34.691 1.00 122.38 ? 114 GLU A CA  1 
ATOM   644  C  C   . GLU A 1 122 ? 7.757   26.088 -33.872 1.00 118.73 ? 114 GLU A C   1 
ATOM   645  O  O   . GLU A 1 122 ? 8.543   26.952 -34.251 1.00 118.97 ? 114 GLU A O   1 
ATOM   646  C  CB  . GLU A 1 122 ? 8.871   24.065 -34.834 1.00 125.93 ? 114 GLU A CB  1 
ATOM   647  C  CG  . GLU A 1 122 ? 9.608   23.864 -33.521 1.00 133.35 ? 114 GLU A CG  1 
ATOM   648  C  CD  . GLU A 1 122 ? 10.951  23.183 -33.706 1.00 151.38 ? 114 GLU A CD  1 
ATOM   649  O  OE1 . GLU A 1 122 ? 11.163  22.563 -34.769 1.00 157.63 ? 114 GLU A OE1 1 
ATOM   650  O  OE2 . GLU A 1 122 ? 11.795  23.273 -32.790 1.00 142.78 ? 114 GLU A OE2 1 
ATOM   651  N  N   . ILE A 1 123 ? 7.042   26.203 -32.757 1.00 115.90 ? 115 ILE A N   1 
ATOM   652  C  CA  . ILE A 1 123 ? 7.194   27.349 -31.865 1.00 112.22 ? 115 ILE A CA  1 
ATOM   653  C  C   . ILE A 1 123 ? 7.404   26.888 -30.425 1.00 112.90 ? 115 ILE A C   1 
ATOM   654  O  O   . ILE A 1 123 ? 6.439   26.679 -29.689 1.00 111.02 ? 115 ILE A O   1 
ATOM   655  C  CB  . ILE A 1 123 ? 5.965   28.286 -31.910 1.00 111.40 ? 115 ILE A CB  1 
ATOM   656  C  CG1 . ILE A 1 123 ? 5.506   28.537 -33.349 1.00 114.30 ? 115 ILE A CG1 1 
ATOM   657  C  CG2 . ILE A 1 123 ? 6.273   29.600 -31.203 1.00 108.49 ? 115 ILE A CG2 1 
ATOM   658  C  CD1 . ILE A 1 123 ? 6.441   29.410 -34.155 1.00 118.69 ? 115 ILE A CD1 1 
ATOM   659  N  N   . SER A 1 124 ? 8.661   26.734 -30.020 1.00 111.57 ? 116 SER A N   1 
ATOM   660  C  CA  . SER A 1 124 ? 8.965   26.249 -28.677 1.00 109.82 ? 116 SER A CA  1 
ATOM   661  C  C   . SER A 1 124 ? 9.727   27.277 -27.843 1.00 111.02 ? 116 SER A C   1 
ATOM   662  O  O   . SER A 1 124 ? 10.782  27.766 -28.250 1.00 112.64 ? 116 SER A O   1 
ATOM   663  C  CB  . SER A 1 124 ? 9.766   24.948 -28.750 1.00 114.98 ? 116 SER A CB  1 
ATOM   664  O  OG  . SER A 1 124 ? 11.006  25.145 -29.410 1.00 123.23 ? 116 SER A OG  1 
ATOM   665  N  N   . LEU A 1 125 ? 9.180   27.600 -26.675 1.00 109.25 ? 117 LEU A N   1 
ATOM   666  C  CA  . LEU A 1 125 ? 9.836   28.498 -25.730 1.00 107.53 ? 117 LEU A CA  1 
ATOM   667  C  C   . LEU A 1 125 ? 10.514  27.672 -24.641 1.00 110.82 ? 117 LEU A C   1 
ATOM   668  O  O   . LEU A 1 125 ? 9.872   26.849 -23.989 1.00 109.20 ? 117 LEU A O   1 
ATOM   669  C  CB  . LEU A 1 125 ? 8.828   29.477 -25.124 1.00 103.14 ? 117 LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 125 ? 9.380   30.703 -24.394 1.00 103.99 ? 117 LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 125 ? 10.254  31.531 -25.322 1.00 106.41 ? 117 LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 125 ? 8.243   31.545 -23.836 1.00 102.34 ? 117 LEU A CD2 1 
ATOM   673  N  N   . CYS A 1 126 ? 11.810  27.890 -24.448 1.00 113.87 ? 118 CYS A N   1 
ATOM   674  C  CA  . CYS A 1 126 ? 12.600  27.021 -23.582 1.00 115.70 ? 118 CYS A CA  1 
ATOM   675  C  C   . CYS A 1 126 ? 13.294  27.771 -22.448 1.00 115.31 ? 118 CYS A C   1 
ATOM   676  O  O   . CYS A 1 126 ? 13.779  28.887 -22.631 1.00 115.55 ? 118 CYS A O   1 
ATOM   677  C  CB  . CYS A 1 126 ? 13.641  26.269 -24.414 1.00 121.38 ? 118 CYS A CB  1 
ATOM   678  S  SG  . CYS A 1 126 ? 13.039  25.682 -26.017 1.00 125.74 ? 118 CYS A SG  1 
ATOM   679  N  N   . ALA A 1 127 ? 13.339  27.139 -21.278 1.00 114.36 ? 119 ALA A N   1 
ATOM   680  C  CA  . ALA A 1 127 ? 14.021  27.694 -20.114 1.00 113.64 ? 119 ALA A CA  1 
ATOM   681  C  C   . ALA A 1 127 ? 14.514  26.567 -19.211 1.00 116.75 ? 119 ALA A C   1 
ATOM   682  O  O   . ALA A 1 127 ? 14.151  25.407 -19.406 1.00 117.15 ? 119 ALA A O   1 
ATOM   683  C  CB  . ALA A 1 127 ? 13.099  28.631 -19.347 1.00 108.82 ? 119 ALA A CB  1 
ATOM   684  N  N   . ASP A 1 128 ? 15.339  26.905 -18.226 1.00 108.27 ? 120 ASP A N   1 
ATOM   685  C  CA  . ASP A 1 128 ? 15.876  25.900 -17.312 1.00 109.53 ? 120 ASP A CA  1 
ATOM   686  C  C   . ASP A 1 128 ? 14.820  25.469 -16.297 1.00 107.67 ? 120 ASP A C   1 
ATOM   687  O  O   . ASP A 1 128 ? 14.895  25.819 -15.120 1.00 106.28 ? 120 ASP A O   1 
ATOM   688  C  CB  . ASP A 1 128 ? 17.118  26.438 -16.596 1.00 112.58 ? 120 ASP A CB  1 
ATOM   689  C  CG  . ASP A 1 128 ? 17.789  25.393 -15.724 1.00 117.31 ? 120 ASP A CG  1 
ATOM   690  O  OD1 . ASP A 1 128 ? 17.626  24.187 -16.001 1.00 117.56 ? 120 ASP A OD1 1 
ATOM   691  O  OD2 . ASP A 1 128 ? 18.482  25.781 -14.759 1.00 121.10 ? 120 ASP A OD2 1 
ATOM   692  N  N   . ILE A 1 129 ? 13.837  24.703 -16.761 1.00 109.80 ? 121 ILE A N   1 
ATOM   693  C  CA  . ILE A 1 129 ? 12.726  24.284 -15.913 1.00 104.84 ? 121 ILE A CA  1 
ATOM   694  C  C   . ILE A 1 129 ? 13.069  23.031 -15.111 1.00 109.40 ? 121 ILE A C   1 
ATOM   695  O  O   . ILE A 1 129 ? 12.354  22.667 -14.176 1.00 106.27 ? 121 ILE A O   1 
ATOM   696  C  CB  . ILE A 1 129 ? 11.453  24.015 -16.741 1.00 103.76 ? 121 ILE A CB  1 
ATOM   697  C  CG1 . ILE A 1 129 ? 11.617  22.755 -17.597 1.00 107.30 ? 121 ILE A CG1 1 
ATOM   698  C  CG2 . ILE A 1 129 ? 11.121  25.218 -17.613 1.00 102.90 ? 121 ILE A CG2 1 
ATOM   699  C  CD1 . ILE A 1 129 ? 10.378  22.392 -18.389 1.00 111.65 ? 121 ILE A CD1 1 
ATOM   700  N  N   . THR A 1 130 ? 14.166  22.376 -15.477 1.00 107.76 ? 122 THR A N   1 
ATOM   701  C  CA  . THR A 1 130 ? 14.597  21.162 -14.796 1.00 109.38 ? 122 THR A CA  1 
ATOM   702  C  C   . THR A 1 130 ? 15.571  21.475 -13.665 1.00 114.00 ? 122 THR A C   1 
ATOM   703  O  O   . THR A 1 130 ? 15.964  20.582 -12.912 1.00 114.87 ? 122 THR A O   1 
ATOM   704  C  CB  . THR A 1 130 ? 15.257  20.174 -15.771 1.00 117.86 ? 122 THR A CB  1 
ATOM   705  O  OG1 . THR A 1 130 ? 16.261  20.853 -16.536 1.00 121.38 ? 122 THR A OG1 1 
ATOM   706  C  CG2 . THR A 1 130 ? 14.221  19.588 -16.716 1.00 115.30 ? 122 THR A CG2 1 
ATOM   707  N  N   . ARG A 1 131 ? 15.954  22.747 -13.562 1.00 111.77 ? 123 ARG A N   1 
ATOM   708  C  CA  . ARG A 1 131 ? 16.839  23.230 -12.502 1.00 113.84 ? 123 ARG A CA  1 
ATOM   709  C  C   . ARG A 1 131 ? 18.168  22.477 -12.475 1.00 120.73 ? 123 ARG A C   1 
ATOM   710  O  O   . ARG A 1 131 ? 18.635  22.062 -11.413 1.00 120.22 ? 123 ARG A O   1 
ATOM   711  C  CB  . ARG A 1 131 ? 16.146  23.122 -11.143 1.00 109.67 ? 123 ARG A CB  1 
ATOM   712  C  CG  . ARG A 1 131 ? 14.721  23.648 -11.134 1.00 104.88 ? 123 ARG A CG  1 
ATOM   713  C  CD  . ARG A 1 131 ? 13.982  23.194 -9.888  1.00 100.03 ? 123 ARG A CD  1 
ATOM   714  N  NE  . ARG A 1 131 ? 12.573  23.573 -9.910  1.00 94.82  ? 123 ARG A NE  1 
ATOM   715  C  CZ  . ARG A 1 131 ? 11.663  23.100 -9.065  1.00 99.21  ? 123 ARG A CZ  1 
ATOM   716  N  NH1 . ARG A 1 131 ? 12.017  22.223 -8.134  1.00 90.42  ? 123 ARG A NH1 1 
ATOM   717  N  NH2 . ARG A 1 131 ? 10.401  23.496 -9.152  1.00 89.99  ? 123 ARG A NH2 1 
ATOM   718  N  N   . THR A 1 132 ? 18.772  22.305 -13.647 1.00 113.68 ? 124 THR A N   1 
ATOM   719  C  CA  . THR A 1 132 ? 20.034  21.583 -13.758 1.00 116.95 ? 124 THR A CA  1 
ATOM   720  C  C   . THR A 1 132 ? 21.138  22.470 -14.327 1.00 122.54 ? 124 THR A C   1 
ATOM   721  O  O   . THR A 1 132 ? 22.315  22.106 -14.301 1.00 124.59 ? 124 THR A O   1 
ATOM   722  C  CB  . THR A 1 132 ? 19.889  20.329 -14.643 1.00 123.16 ? 124 THR A CB  1 
ATOM   723  O  OG1 . THR A 1 132 ? 19.504  20.715 -15.968 1.00 123.83 ? 124 THR A OG1 1 
ATOM   724  C  CG2 . THR A 1 132 ? 18.839  19.389 -14.069 1.00 120.03 ? 124 THR A CG2 1 
ATOM   725  N  N   . GLY A 1 133 ? 20.754  23.634 -14.840 1.00 123.12 ? 125 GLY A N   1 
ATOM   726  C  CA  . GLY A 1 133 ? 21.711  24.573 -15.397 1.00 125.85 ? 125 GLY A CA  1 
ATOM   727  C  C   . GLY A 1 133 ? 21.658  24.626 -16.911 1.00 131.26 ? 125 GLY A C   1 
ATOM   728  O  O   . GLY A 1 133 ? 22.216  25.532 -17.531 1.00 132.37 ? 125 GLY A O   1 
ATOM   729  N  N   . LYS A 1 134 ? 20.984  23.647 -17.506 1.00 127.74 ? 126 LYS A N   1 
ATOM   730  C  CA  . LYS A 1 134 ? 20.843  23.577 -18.954 1.00 129.11 ? 126 LYS A CA  1 
ATOM   731  C  C   . LYS A 1 134 ? 19.401  23.846 -19.373 1.00 130.40 ? 126 LYS A C   1 
ATOM   732  O  O   . LYS A 1 134 ? 18.458  23.426 -18.701 1.00 127.60 ? 126 LYS A O   1 
ATOM   733  C  CB  . LYS A 1 134 ? 21.301  22.213 -19.474 1.00 132.66 ? 126 LYS A CB  1 
ATOM   734  N  N   . VAL A 1 135 ? 19.238  24.546 -20.490 1.00 126.85 ? 127 VAL A N   1 
ATOM   735  C  CA  . VAL A 1 135 ? 17.917  24.945 -20.965 1.00 125.15 ? 127 VAL A CA  1 
ATOM   736  C  C   . VAL A 1 135 ? 17.171  23.781 -21.619 1.00 130.60 ? 127 VAL A C   1 
ATOM   737  O  O   . VAL A 1 135 ? 17.669  23.159 -22.558 1.00 132.15 ? 127 VAL A O   1 
ATOM   738  C  CB  . VAL A 1 135 ? 18.021  26.111 -21.965 1.00 127.36 ? 127 VAL A CB  1 
ATOM   739  C  CG1 . VAL A 1 135 ? 16.646  26.510 -22.464 1.00 124.09 ? 127 VAL A CG1 1 
ATOM   740  C  CG2 . VAL A 1 135 ? 18.721  27.299 -21.320 1.00 127.57 ? 127 VAL A CG2 1 
ATOM   741  N  N   . LYS A 1 136 ? 15.974  23.495 -21.113 1.00 133.44 ? 128 LYS A N   1 
ATOM   742  C  CA  . LYS A 1 136 ? 15.145  22.418 -21.646 1.00 134.76 ? 128 LYS A CA  1 
ATOM   743  C  C   . LYS A 1 136 ? 13.812  22.956 -22.170 1.00 136.88 ? 128 LYS A C   1 
ATOM   744  O  O   . LYS A 1 136 ? 13.204  23.826 -21.547 1.00 132.94 ? 128 LYS A O   1 
ATOM   745  C  CB  . LYS A 1 136 ? 14.901  21.353 -20.575 1.00 135.82 ? 128 LYS A CB  1 
ATOM   746  N  N   . PRO A 1 137 ? 13.352  22.433 -23.318 1.00 146.22 ? 129 PRO A N   1 
ATOM   747  C  CA  . PRO A 1 137 ? 12.115  22.899 -23.961 1.00 143.95 ? 129 PRO A CA  1 
ATOM   748  C  C   . PRO A 1 137 ? 10.847  22.540 -23.185 1.00 143.13 ? 129 PRO A C   1 
ATOM   749  O  O   . PRO A 1 137 ? 10.911  21.835 -22.175 1.00 141.96 ? 129 PRO A O   1 
ATOM   750  C  CB  . PRO A 1 137 ? 12.137  22.184 -25.315 1.00 148.25 ? 129 PRO A CB  1 
ATOM   751  C  CG  . PRO A 1 137 ? 12.958  20.967 -25.083 1.00 153.72 ? 129 PRO A CG  1 
ATOM   752  C  CD  . PRO A 1 137 ? 14.014  21.374 -24.100 1.00 151.11 ? 129 PRO A CD  1 
ATOM   753  N  N   . THR A 1 138 ? 9.706   23.032 -23.660 1.00 146.47 ? 130 THR A N   1 
ATOM   754  C  CA  . THR A 1 138 ? 8.420   22.745 -23.034 1.00 142.86 ? 130 THR A CA  1 
ATOM   755  C  C   . THR A 1 138 ? 7.618   21.750 -23.866 1.00 147.07 ? 130 THR A C   1 
ATOM   756  O  O   . THR A 1 138 ? 7.164   20.725 -23.358 1.00 146.63 ? 130 THR A O   1 
ATOM   757  C  CB  . THR A 1 138 ? 7.583   24.028 -22.836 1.00 141.51 ? 130 THR A CB  1 
ATOM   758  O  OG1 . THR A 1 138 ? 7.424   24.701 -24.091 1.00 142.36 ? 130 THR A OG1 1 
ATOM   759  C  CG2 . THR A 1 138 ? 8.263   24.963 -21.849 1.00 136.47 ? 130 THR A CG2 1 
ATOM   760  N  N   . ALA A 1 140 ? 9.001   17.249 -19.513 1.00 153.00 ? 132 ALA A N   1 
ATOM   761  C  CA  . ALA A 1 140 ? 8.633   18.552 -20.055 1.00 151.36 ? 132 ALA A CA  1 
ATOM   762  C  C   . ALA A 1 140 ? 7.121   18.754 -20.037 1.00 150.91 ? 132 ALA A C   1 
ATOM   763  O  O   . ALA A 1 140 ? 6.637   19.859 -19.791 1.00 146.74 ? 132 ALA A O   1 
ATOM   764  C  CB  . ALA A 1 140 ? 9.171   18.706 -21.471 1.00 155.21 ? 132 ALA A CB  1 
ATOM   765  N  N   . VAL A 1 141 ? 6.381   17.681 -20.295 1.00 158.07 ? 133 VAL A N   1 
ATOM   766  C  CA  . VAL A 1 141 ? 4.926   17.753 -20.376 1.00 156.35 ? 133 VAL A CA  1 
ATOM   767  C  C   . VAL A 1 141 ? 4.272   17.782 -18.996 1.00 154.84 ? 133 VAL A C   1 
ATOM   768  O  O   . VAL A 1 141 ? 3.101   18.138 -18.863 1.00 153.02 ? 133 VAL A O   1 
ATOM   769  C  CB  . VAL A 1 141 ? 4.351   16.566 -21.172 1.00 162.44 ? 133 VAL A CB  1 
ATOM   770  N  N   . LYS A 1 142 ? 5.033   17.409 -17.973 1.00 153.01 ? 134 LYS A N   1 
ATOM   771  C  CA  . LYS A 1 142 ? 4.509   17.350 -16.612 1.00 149.71 ? 134 LYS A CA  1 
ATOM   772  C  C   . LYS A 1 142 ? 4.459   18.727 -15.955 1.00 146.53 ? 134 LYS A C   1 
ATOM   773  O  O   . LYS A 1 142 ? 3.712   18.937 -14.998 1.00 143.71 ? 134 LYS A O   1 
ATOM   774  C  CB  . LYS A 1 142 ? 5.351   16.398 -15.760 1.00 151.41 ? 134 LYS A CB  1 
ATOM   775  N  N   . ASP A 1 143 ? 5.255   19.659 -16.472 1.00 147.26 ? 135 ASP A N   1 
ATOM   776  C  CA  . ASP A 1 143 ? 5.329   21.006 -15.912 1.00 143.60 ? 135 ASP A CA  1 
ATOM   777  C  C   . ASP A 1 143 ? 3.988   21.732 -16.003 1.00 142.54 ? 135 ASP A C   1 
ATOM   778  O  O   . ASP A 1 143 ? 3.488   22.245 -15.001 1.00 141.35 ? 135 ASP A O   1 
ATOM   779  C  CB  . ASP A 1 143 ? 6.414   21.820 -16.621 1.00 145.54 ? 135 ASP A CB  1 
ATOM   780  N  N   . GLN A 1 144 ? 3.423   21.769 -17.207 1.00 137.53 ? 136 GLN A N   1 
ATOM   781  C  CA  . GLN A 1 144 ? 2.116   22.379 -17.457 1.00 135.46 ? 136 GLN A CA  1 
ATOM   782  C  C   . GLN A 1 144 ? 2.089   23.852 -17.043 1.00 132.38 ? 136 GLN A C   1 
ATOM   783  O  O   . GLN A 1 144 ? 1.075   24.351 -16.553 1.00 131.46 ? 136 GLN A O   1 
ATOM   784  C  CB  . GLN A 1 144 ? 1.015   21.595 -16.730 1.00 136.29 ? 136 GLN A CB  1 
ATOM   785  C  CG  . GLN A 1 144 ? -0.367  21.695 -17.366 1.00 143.46 ? 136 GLN A CG  1 
ATOM   786  C  CD  . GLN A 1 144 ? -1.313  22.585 -16.581 1.00 152.63 ? 136 GLN A CD  1 
ATOM   787  O  OE1 . GLN A 1 144 ? -1.611  22.320 -15.415 1.00 149.44 ? 136 GLN A OE1 1 
ATOM   788  N  NE2 . GLN A 1 144 ? -1.786  23.651 -17.216 1.00 146.99 ? 136 GLN A NE2 1 
ATOM   789  N  N   . ARG A 1 145 ? 3.214   24.536 -17.246 1.00 121.49 ? 137 ARG A N   1 
ATOM   790  C  CA  . ARG A 1 145 ? 3.349   25.956 -16.922 1.00 118.35 ? 137 ARG A CA  1 
ATOM   791  C  C   . ARG A 1 145 ? 2.966   26.270 -15.476 1.00 115.11 ? 137 ARG A C   1 
ATOM   792  O  O   . ARG A 1 145 ? 2.347   27.299 -15.198 1.00 114.50 ? 137 ARG A O   1 
ATOM   793  C  CB  . ARG A 1 145 ? 2.504   26.805 -17.877 1.00 119.64 ? 137 ARG A CB  1 
ATOM   794  N  N   . THR A 1 146 ? 3.335   25.379 -14.562 1.00 111.82 ? 138 THR A N   1 
ATOM   795  C  CA  . THR A 1 146 ? 3.052   25.568 -13.144 1.00 108.01 ? 138 THR A CA  1 
ATOM   796  C  C   . THR A 1 146 ? 4.301   25.306 -12.309 1.00 105.90 ? 138 THR A C   1 
ATOM   797  O  O   . THR A 1 146 ? 4.938   24.261 -12.444 1.00 107.28 ? 138 THR A O   1 
ATOM   798  C  CB  . THR A 1 146 ? 1.911   24.646 -12.665 1.00 109.56 ? 138 THR A CB  1 
ATOM   799  O  OG1 . THR A 1 146 ? 0.682   25.036 -13.291 1.00 110.05 ? 138 THR A OG1 1 
ATOM   800  C  CG2 . THR A 1 146 ? 1.750   24.730 -11.155 1.00 106.38 ? 138 THR A CG2 1 
ATOM   801  N  N   . TRP A 1 147 ? 4.650   26.259 -11.452 1.00 87.72  ? 139 TRP A N   1 
ATOM   802  C  CA  . TRP A 1 147 ? 5.828   26.122 -10.603 1.00 86.42  ? 139 TRP A CA  1 
ATOM   803  C  C   . TRP A 1 147 ? 5.528   25.238 -9.395  1.00 86.96  ? 139 TRP A C   1 
ATOM   804  O  O   . TRP A 1 147 ? 4.520   25.427 -8.713  1.00 85.71  ? 139 TRP A O   1 
ATOM   805  C  CB  . TRP A 1 147 ? 6.324   27.496 -10.147 1.00 84.10  ? 139 TRP A CB  1 
ATOM   806  C  CG  . TRP A 1 147 ? 7.806   27.549 -9.968  1.00 85.67  ? 139 TRP A CG  1 
ATOM   807  C  CD1 . TRP A 1 147 ? 8.724   28.003 -10.869 1.00 88.86  ? 139 TRP A CD1 1 
ATOM   808  C  CD2 . TRP A 1 147 ? 8.548   27.118 -8.821  1.00 86.42  ? 139 TRP A CD2 1 
ATOM   809  N  NE1 . TRP A 1 147 ? 9.991   27.885 -10.353 1.00 91.09  ? 139 TRP A NE1 1 
ATOM   810  C  CE2 . TRP A 1 147 ? 9.911   27.344 -9.097  1.00 91.50  ? 139 TRP A CE2 1 
ATOM   811  C  CE3 . TRP A 1 147 ? 8.192   26.566 -7.587  1.00 86.33  ? 139 TRP A CE3 1 
ATOM   812  C  CZ2 . TRP A 1 147 ? 10.918  27.042 -8.183  1.00 93.53  ? 139 TRP A CZ2 1 
ATOM   813  C  CZ3 . TRP A 1 147 ? 9.191   26.265 -6.683  1.00 89.11  ? 139 TRP A CZ3 1 
ATOM   814  C  CH2 . TRP A 1 147 ? 10.539  26.503 -6.985  1.00 92.49  ? 139 TRP A CH2 1 
ATOM   815  N  N   . THR A 1 148 ? 6.403   24.272 -9.135  1.00 85.23  ? 140 THR A N   1 
ATOM   816  C  CA  . THR A 1 148 ? 6.188   23.323 -8.046  1.00 85.01  ? 140 THR A CA  1 
ATOM   817  C  C   . THR A 1 148 ? 7.460   23.045 -7.247  1.00 88.61  ? 140 THR A C   1 
ATOM   818  O  O   . THR A 1 148 ? 8.512   22.753 -7.818  1.00 90.16  ? 140 THR A O   1 
ATOM   819  C  CB  . THR A 1 148 ? 5.639   21.985 -8.573  1.00 89.39  ? 140 THR A CB  1 
ATOM   820  O  OG1 . THR A 1 148 ? 6.393   21.580 -9.722  1.00 89.95  ? 140 THR A OG1 1 
ATOM   821  C  CG2 . THR A 1 148 ? 4.175   22.123 -8.960  1.00 88.75  ? 140 THR A CG2 1 
ATOM   822  N  N   . TRP A 1 149 ? 7.347   23.129 -5.923  1.00 84.33  ? 141 TRP A N   1 
ATOM   823  C  CA  . TRP A 1 149 ? 8.466   22.861 -5.022  1.00 86.42  ? 141 TRP A CA  1 
ATOM   824  C  C   . TRP A 1 149 ? 8.860   21.388 -5.050  1.00 91.18  ? 141 TRP A C   1 
ATOM   825  O  O   . TRP A 1 149 ? 8.066   20.533 -5.443  1.00 90.84  ? 141 TRP A O   1 
ATOM   826  C  CB  . TRP A 1 149 ? 8.114   23.267 -3.586  1.00 84.99  ? 141 TRP A CB  1 
ATOM   827  C  CG  . TRP A 1 149 ? 7.863   24.734 -3.392  1.00 84.04  ? 141 TRP A CG  1 
ATOM   828  C  CD1 . TRP A 1 149 ? 6.679   25.392 -3.558  1.00 83.66  ? 141 TRP A CD1 1 
ATOM   829  C  CD2 . TRP A 1 149 ? 8.816   25.721 -2.976  1.00 84.98  ? 141 TRP A CD2 1 
ATOM   830  N  NE1 . TRP A 1 149 ? 6.838   26.729 -3.280  1.00 82.85  ? 141 TRP A NE1 1 
ATOM   831  C  CE2 . TRP A 1 149 ? 8.140   26.957 -2.921  1.00 85.48  ? 141 TRP A CE2 1 
ATOM   832  C  CE3 . TRP A 1 149 ? 10.175  25.681 -2.651  1.00 88.47  ? 141 TRP A CE3 1 
ATOM   833  C  CZ2 . TRP A 1 149 ? 8.777   28.141 -2.553  1.00 85.72  ? 141 TRP A CZ2 1 
ATOM   834  C  CZ3 . TRP A 1 149 ? 10.806  26.858 -2.286  1.00 90.25  ? 141 TRP A CZ3 1 
ATOM   835  C  CH2 . TRP A 1 149 ? 10.107  28.071 -2.240  1.00 88.31  ? 141 TRP A CH2 1 
ATOM   836  N  N   . GLY A 1 150 ? 10.085  21.095 -4.624  1.00 91.12  ? 142 GLY A N   1 
ATOM   837  C  CA  . GLY A 1 150 ? 10.522  19.720 -4.463  1.00 93.90  ? 142 GLY A CA  1 
ATOM   838  C  C   . GLY A 1 150 ? 11.477  19.210 -5.527  1.00 99.21  ? 142 GLY A C   1 
ATOM   839  O  O   . GLY A 1 150 ? 11.714  19.882 -6.532  1.00 99.62  ? 142 GLY A O   1 
ATOM   840  N  N   . PRO A 1 151 ? 12.038  18.010 -5.300  1.00 99.48  ? 143 PRO A N   1 
ATOM   841  C  CA  . PRO A 1 151 ? 12.944  17.328 -6.231  1.00 103.23 ? 143 PRO A CA  1 
ATOM   842  C  C   . PRO A 1 151 ? 12.213  16.801 -7.464  1.00 107.88 ? 143 PRO A C   1 
ATOM   843  O  O   . PRO A 1 151 ? 12.824  16.643 -8.521  1.00 109.51 ? 143 PRO A O   1 
ATOM   844  C  CB  . PRO A 1 151 ? 13.506  16.167 -5.396  1.00 106.94 ? 143 PRO A CB  1 
ATOM   845  C  CG  . PRO A 1 151 ? 13.189  16.513 -3.968  1.00 107.15 ? 143 PRO A CG  1 
ATOM   846  C  CD  . PRO A 1 151 ? 11.910  17.277 -4.031  1.00 100.19 ? 143 PRO A CD  1 
ATOM   847  N  N   . CYS A 1 152 ? 10.919  16.530 -7.322  1.00 118.06 ? 144 CYS A N   1 
ATOM   848  C  CA  . CYS A 1 152 ? 10.113  16.036 -8.432  1.00 118.07 ? 144 CYS A CA  1 
ATOM   849  C  C   . CYS A 1 152 ? 9.291   17.156 -9.067  1.00 115.83 ? 144 CYS A C   1 
ATOM   850  O  O   . CYS A 1 152 ? 8.428   16.904 -9.907  1.00 115.29 ? 144 CYS A O   1 
ATOM   851  C  CB  . CYS A 1 152 ? 9.189   14.909 -7.965  1.00 119.51 ? 144 CYS A CB  1 
ATOM   852  S  SG  . CYS A 1 152 ? 10.043  13.383 -7.498  1.00 126.05 ? 144 CYS A SG  1 
ATOM   853  N  N   . GLY A 1 153 ? 9.567   18.392 -8.662  1.00 100.69 ? 145 GLY A N   1 
ATOM   854  C  CA  . GLY A 1 153 ? 8.853   19.542 -9.185  1.00 97.60  ? 145 GLY A CA  1 
ATOM   855  C  C   . GLY A 1 153 ? 9.564   20.176 -10.365 1.00 100.31 ? 145 GLY A C   1 
ATOM   856  O  O   . GLY A 1 153 ? 10.718  19.854 -10.647 1.00 103.86 ? 145 GLY A O   1 
ATOM   857  N  N   . GLN A 1 154 ? 8.875   21.079 -11.055 1.00 96.17  ? 146 GLN A N   1 
ATOM   858  C  CA  . GLN A 1 154 ? 9.448   21.764 -12.211 1.00 96.78  ? 146 GLN A CA  1 
ATOM   859  C  C   . GLN A 1 154 ? 9.204   23.269 -12.149 1.00 95.75  ? 146 GLN A C   1 
ATOM   860  O  O   . GLN A 1 154 ? 8.217   23.725 -11.571 1.00 92.71  ? 146 GLN A O   1 
ATOM   861  C  CB  . GLN A 1 154 ? 8.871   21.195 -13.509 1.00 98.35  ? 146 GLN A CB  1 
ATOM   862  N  N   . GLY A 1 155 ? 10.108  24.035 -12.752 1.00 91.60  ? 147 GLY A N   1 
ATOM   863  C  CA  . GLY A 1 155 ? 10.003  25.482 -12.761 1.00 88.79  ? 147 GLY A CA  1 
ATOM   864  C  C   . GLY A 1 155 ? 11.362  26.150 -12.716 1.00 92.33  ? 147 GLY A C   1 
ATOM   865  O  O   . GLY A 1 155 ? 12.223  25.772 -11.923 1.00 93.40  ? 147 GLY A O   1 
ATOM   866  N  N   . ALA A 1 156 ? 11.555  27.150 -13.571 1.00 88.82  ? 148 ALA A N   1 
ATOM   867  C  CA  . ALA A 1 156 ? 12.835  27.844 -13.663 1.00 92.41  ? 148 ALA A CA  1 
ATOM   868  C  C   . ALA A 1 156 ? 13.060  28.785 -12.484 1.00 93.86  ? 148 ALA A C   1 
ATOM   869  O  O   . ALA A 1 156 ? 12.108  29.275 -11.875 1.00 89.33  ? 148 ALA A O   1 
ATOM   870  C  CB  . ALA A 1 156 ? 12.922  28.612 -14.970 1.00 93.40  ? 148 ALA A CB  1 
ATOM   871  N  N   . ILE A 1 157 ? 14.328  29.036 -12.171 1.00 85.58  ? 149 ILE A N   1 
ATOM   872  C  CA  . ILE A 1 157 ? 14.688  29.935 -11.078 1.00 85.19  ? 149 ILE A CA  1 
ATOM   873  C  C   . ILE A 1 157 ? 15.282  31.238 -11.617 1.00 89.03  ? 149 ILE A C   1 
ATOM   874  O  O   . ILE A 1 157 ? 16.106  31.228 -12.533 1.00 92.57  ? 149 ILE A O   1 
ATOM   875  C  CB  . ILE A 1 157 ? 15.686  29.264 -10.099 1.00 90.24  ? 149 ILE A CB  1 
ATOM   876  C  CG1 . ILE A 1 157 ? 14.953  28.307 -9.158  1.00 86.87  ? 149 ILE A CG1 1 
ATOM   877  C  CG2 . ILE A 1 157 ? 16.430  30.297 -9.269  1.00 92.22  ? 149 ILE A CG2 1 
ATOM   878  C  CD1 . ILE A 1 157 ? 14.801  26.909 -9.693  1.00 93.49  ? 149 ILE A CD1 1 
ATOM   879  N  N   . LEU A 1 158 ? 14.842  32.356 -11.049 1.00 88.70  ? 150 LEU A N   1 
ATOM   880  C  CA  . LEU A 1 158 ? 15.320  33.676 -11.442 1.00 89.52  ? 150 LEU A CA  1 
ATOM   881  C  C   . LEU A 1 158 ? 15.917  34.411 -10.241 1.00 92.53  ? 150 LEU A C   1 
ATOM   882  O  O   . LEU A 1 158 ? 15.327  34.425 -9.164  1.00 90.64  ? 150 LEU A O   1 
ATOM   883  C  CB  . LEU A 1 158 ? 14.176  34.490 -12.053 1.00 85.15  ? 150 LEU A CB  1 
ATOM   884  C  CG  . LEU A 1 158 ? 14.489  35.917 -12.500 1.00 87.92  ? 150 LEU A CG  1 
ATOM   885  C  CD1 . LEU A 1 158 ? 15.559  35.910 -13.574 1.00 91.91  ? 150 LEU A CD1 1 
ATOM   886  C  CD2 . LEU A 1 158 ? 13.228  36.607 -12.997 1.00 85.29  ? 150 LEU A CD2 1 
ATOM   887  N  N   . LEU A 1 159 ? 17.087  35.014 -10.426 1.00 90.62  ? 151 LEU A N   1 
ATOM   888  C  CA  . LEU A 1 159 ? 17.747  35.742 -9.344  1.00 91.66  ? 151 LEU A CA  1 
ATOM   889  C  C   . LEU A 1 159 ? 17.478  37.241 -9.415  1.00 93.32  ? 151 LEU A C   1 
ATOM   890  O  O   . LEU A 1 159 ? 17.305  37.798 -10.499 1.00 94.24  ? 151 LEU A O   1 
ATOM   891  C  CB  . LEU A 1 159 ? 19.260  35.501 -9.371  1.00 96.81  ? 151 LEU A CB  1 
ATOM   892  C  CG  . LEU A 1 159 ? 19.790  34.096 -9.081  1.00 102.48 ? 151 LEU A CG  1 
ATOM   893  C  CD1 . LEU A 1 159 ? 21.282  34.026 -9.368  1.00 106.41 ? 151 LEU A CD1 1 
ATOM   894  C  CD2 . LEU A 1 159 ? 19.508  33.689 -7.646  1.00 103.86 ? 151 LEU A CD2 1 
ATOM   895  N  N   . VAL A 1 160 ? 17.445  37.888 -8.254  1.00 101.08 ? 152 VAL A N   1 
ATOM   896  C  CA  . VAL A 1 160 ? 17.379  39.343 -8.195  1.00 100.08 ? 152 VAL A CA  1 
ATOM   897  C  C   . VAL A 1 160 ? 18.740  39.921 -8.557  1.00 107.80 ? 152 VAL A C   1 
ATOM   898  O  O   . VAL A 1 160 ? 19.758  39.527 -7.989  1.00 111.14 ? 152 VAL A O   1 
ATOM   899  C  CB  . VAL A 1 160 ? 16.968  39.854 -6.800  1.00 100.70 ? 152 VAL A CB  1 
ATOM   900  C  CG1 . VAL A 1 160 ? 16.961  41.376 -6.772  1.00 100.95 ? 152 VAL A CG1 1 
ATOM   901  C  CG2 . VAL A 1 160 ? 15.610  39.308 -6.408  1.00 96.20  ? 152 VAL A CG2 1 
ATOM   902  N  N   . ASN A 1 161 ? 18.760  40.850 -9.505  1.00 114.41 ? 153 ASN A N   1 
ATOM   903  C  CA  . ASN A 1 161 ? 20.004  41.488 -9.918  1.00 117.83 ? 153 ASN A CA  1 
ATOM   904  C  C   . ASN A 1 161 ? 20.386  42.605 -8.956  1.00 120.93 ? 153 ASN A C   1 
ATOM   905  O  O   . ASN A 1 161 ? 20.307  43.784 -9.300  1.00 120.98 ? 153 ASN A O   1 
ATOM   906  C  CB  . ASN A 1 161 ? 19.875  42.032 -11.341 1.00 116.80 ? 153 ASN A CB  1 
ATOM   907  C  CG  . ASN A 1 161 ? 21.199  42.072 -12.073 1.00 133.49 ? 153 ASN A CG  1 
ATOM   908  O  OD1 . ASN A 1 161 ? 22.182  41.469 -11.640 1.00 130.49 ? 153 ASN A OD1 1 
ATOM   909  N  ND2 . ASN A 1 161 ? 21.228  42.772 -13.200 1.00 131.92 ? 153 ASN A ND2 1 
ATOM   910  N  N   . CYS A 1 162 ? 20.801  42.227 -7.750  1.00 123.14 ? 154 CYS A N   1 
ATOM   911  C  CA  . CYS A 1 162 ? 21.011  43.193 -6.676  1.00 124.20 ? 154 CYS A CA  1 
ATOM   912  C  C   . CYS A 1 162 ? 22.483  43.448 -6.358  1.00 130.67 ? 154 CYS A C   1 
ATOM   913  O  O   . CYS A 1 162 ? 22.810  43.930 -5.274  1.00 131.41 ? 154 CYS A O   1 
ATOM   914  C  CB  . CYS A 1 162 ? 20.289  42.730 -5.409  1.00 122.48 ? 154 CYS A CB  1 
ATOM   915  S  SG  . CYS A 1 162 ? 20.660  41.032 -4.907  1.00 125.76 ? 154 CYS A SG  1 
ATOM   916  N  N   . ASP A 1 163 ? 23.366  43.134 -7.302  1.00 132.04 ? 155 ASP A N   1 
ATOM   917  C  CA  . ASP A 1 163 ? 24.794  43.367 -7.108  1.00 136.07 ? 155 ASP A CA  1 
ATOM   918  C  C   . ASP A 1 163 ? 25.308  44.451 -8.051  1.00 140.84 ? 155 ASP A C   1 
ATOM   919  O  O   . ASP A 1 163 ? 24.527  45.235 -8.592  1.00 138.99 ? 155 ASP A O   1 
ATOM   920  C  CB  . ASP A 1 163 ? 25.586  42.072 -7.307  1.00 139.13 ? 155 ASP A CB  1 
ATOM   921  C  CG  . ASP A 1 163 ? 25.583  41.597 -8.750  1.00 143.74 ? 155 ASP A CG  1 
ATOM   922  O  OD1 . ASP A 1 163 ? 24.606  41.879 -9.473  1.00 141.38 ? 155 ASP A OD1 1 
ATOM   923  O  OD2 . ASP A 1 163 ? 26.562  40.938 -9.160  1.00 149.06 ? 155 ASP A OD2 1 
ATOM   924  N  N   . ARG A 1 164 ? 26.621  44.484 -8.253  1.00 146.99 ? 156 ARG A N   1 
ATOM   925  C  CA  . ARG A 1 164 ? 27.236  45.541 -9.045  1.00 149.52 ? 156 ARG A CA  1 
ATOM   926  C  C   . ARG A 1 164 ? 28.544  45.080 -9.684  1.00 157.05 ? 156 ARG A C   1 
ATOM   927  O  O   . ARG A 1 164 ? 29.629  45.421 -9.212  1.00 160.17 ? 156 ARG A O   1 
ATOM   928  C  CB  . ARG A 1 164 ? 27.483  46.765 -8.165  1.00 149.68 ? 156 ARG A CB  1 
ATOM   929  C  CG  . ARG A 1 164 ? 27.668  48.067 -8.917  1.00 152.64 ? 156 ARG A CG  1 
ATOM   930  C  CD  . ARG A 1 164 ? 27.843  49.219 -7.942  1.00 154.23 ? 156 ARG A CD  1 
ATOM   931  N  NE  . ARG A 1 164 ? 29.116  49.145 -7.231  1.00 155.47 ? 156 ARG A NE  1 
ATOM   932  C  CZ  . ARG A 1 164 ? 29.450  49.925 -6.208  1.00 160.97 ? 156 ARG A CZ  1 
ATOM   933  N  NH1 . ARG A 1 164 ? 30.632  49.786 -5.624  1.00 163.10 ? 156 ARG A NH1 1 
ATOM   934  N  NH2 . ARG A 1 164 ? 28.600  50.841 -5.765  1.00 157.97 ? 156 ARG A NH2 1 
ATOM   935  N  N   . ASP A 1 165 ? 28.438  44.307 -10.761 1.00 151.44 ? 157 ASP A N   1 
ATOM   936  C  CA  . ASP A 1 165 ? 29.614  43.780 -11.445 1.00 155.45 ? 157 ASP A CA  1 
ATOM   937  C  C   . ASP A 1 165 ? 30.390  44.892 -12.145 1.00 161.77 ? 157 ASP A C   1 
ATOM   938  O  O   . ASP A 1 165 ? 31.622  44.919 -12.113 1.00 165.99 ? 157 ASP A O   1 
ATOM   939  C  CB  . ASP A 1 165 ? 29.205  42.703 -12.452 1.00 155.59 ? 157 ASP A CB  1 
ATOM   940  C  CG  . ASP A 1 165 ? 28.432  41.567 -11.807 1.00 159.57 ? 157 ASP A CG  1 
ATOM   941  O  OD1 . ASP A 1 165 ? 29.074  40.627 -11.295 1.00 161.23 ? 157 ASP A OD1 1 
ATOM   942  O  OD2 . ASP A 1 165 ? 27.184  41.615 -11.812 1.00 160.14 ? 157 ASP A OD2 1 
ATOM   943  N  N   . ASN A 1 166 ? 29.661  45.808 -12.775 1.00 164.55 ? 158 ASN A N   1 
ATOM   944  C  CA  . ASN A 1 166 ? 30.270  46.958 -13.432 1.00 168.53 ? 158 ASN A CA  1 
ATOM   945  C  C   . ASN A 1 166 ? 30.943  47.877 -12.417 1.00 176.84 ? 158 ASN A C   1 
ATOM   946  O  O   . ASN A 1 166 ? 30.272  48.623 -11.703 1.00 174.55 ? 158 ASN A O   1 
ATOM   947  C  CB  . ASN A 1 166 ? 29.223  47.733 -14.233 1.00 167.60 ? 158 ASN A CB  1 
ATOM   948  N  N   . LEU A 1 167 ? 32.270  47.815 -12.359 1.00 166.97 ? 159 LEU A N   1 
ATOM   949  C  CA  . LEU A 1 167 ? 33.043  48.567 -11.374 1.00 172.56 ? 159 LEU A CA  1 
ATOM   950  C  C   . LEU A 1 167 ? 32.855  50.076 -11.503 1.00 178.25 ? 159 LEU A C   1 
ATOM   951  O  O   . LEU A 1 167 ? 32.965  50.808 -10.519 1.00 180.63 ? 159 LEU A O   1 
ATOM   952  C  CB  . LEU A 1 167 ? 34.530  48.222 -11.493 1.00 179.29 ? 159 LEU A CB  1 
ATOM   953  N  N   . GLU A 1 168 ? 32.570  50.539 -12.716 1.00 172.53 ? 160 GLU A N   1 
ATOM   954  C  CA  . GLU A 1 168 ? 32.407  51.968 -12.959 1.00 177.86 ? 160 GLU A CA  1 
ATOM   955  C  C   . GLU A 1 168 ? 31.059  52.472 -12.450 1.00 172.78 ? 160 GLU A C   1 
ATOM   956  O  O   . GLU A 1 168 ? 30.996  53.467 -11.728 1.00 176.18 ? 160 GLU A O   1 
ATOM   957  C  CB  . GLU A 1 168 ? 32.554  52.281 -14.448 1.00 181.70 ? 160 GLU A CB  1 
ATOM   958  C  CG  . GLU A 1 168 ? 32.618  53.768 -14.761 1.00 189.15 ? 160 GLU A CG  1 
ATOM   959  C  CD  . GLU A 1 168 ? 33.766  54.466 -14.052 1.00 207.11 ? 160 GLU A CD  1 
ATOM   960  O  OE1 . GLU A 1 168 ? 33.559  54.972 -12.929 1.00 200.24 ? 160 GLU A OE1 1 
ATOM   961  O  OE2 . GLU A 1 168 ? 34.877  54.518 -14.623 1.00 212.58 ? 160 GLU A OE2 1 
ATOM   962  N  N   . SER A 1 169 ? 29.987  51.784 -12.833 1.00 173.77 ? 161 SER A N   1 
ATOM   963  C  CA  . SER A 1 169 ? 28.645  52.141 -12.385 1.00 168.02 ? 161 SER A CA  1 
ATOM   964  C  C   . SER A 1 169 ? 28.541  52.047 -10.866 1.00 168.03 ? 161 SER A C   1 
ATOM   965  O  O   . SER A 1 169 ? 28.922  51.038 -10.273 1.00 165.26 ? 161 SER A O   1 
ATOM   966  C  CB  . SER A 1 169 ? 27.600  51.237 -13.042 1.00 171.66 ? 161 SER A CB  1 
ATOM   967  N  N   . SER A 1 170 ? 28.033  53.103 -10.239 1.00 168.56 ? 162 SER A N   1 
ATOM   968  C  CA  . SER A 1 170 ? 27.915  53.138 -8.785  1.00 167.37 ? 162 SER A CA  1 
ATOM   969  C  C   . SER A 1 170 ? 26.575  52.573 -8.322  1.00 162.58 ? 162 SER A C   1 
ATOM   970  O  O   . SER A 1 170 ? 26.442  52.121 -7.185  1.00 159.56 ? 162 SER A O   1 
ATOM   971  C  CB  . SER A 1 170 ? 28.088  54.567 -8.266  1.00 175.76 ? 162 SER A CB  1 
ATOM   972  O  OG  . SER A 1 170 ? 27.040  55.408 -8.718  1.00 180.01 ? 162 SER A OG  1 
ATOM   973  N  N   . ALA A 1 171 ? 25.588  52.598 -9.212  1.00 162.95 ? 163 ALA A N   1 
ATOM   974  C  CA  . ALA A 1 171 ? 24.245  52.134 -8.879  1.00 158.65 ? 163 ALA A CA  1 
ATOM   975  C  C   . ALA A 1 171 ? 24.099  50.627 -9.071  1.00 157.64 ? 163 ALA A C   1 
ATOM   976  O  O   . ALA A 1 171 ? 25.014  49.957 -9.551  1.00 158.61 ? 163 ALA A O   1 
ATOM   977  C  CB  . ALA A 1 171 ? 23.212  52.875 -9.716  1.00 158.19 ? 163 ALA A CB  1 
ATOM   978  N  N   . MET A 1 172 ? 22.938  50.102 -8.689  1.00 150.74 ? 164 MET A N   1 
ATOM   979  C  CA  . MET A 1 172 ? 22.640  48.683 -8.843  1.00 147.66 ? 164 MET A CA  1 
ATOM   980  C  C   . MET A 1 172 ? 22.455  48.346 -10.321 1.00 148.11 ? 164 MET A C   1 
ATOM   981  O  O   . MET A 1 172 ? 22.135  49.221 -11.125 1.00 148.64 ? 164 MET A O   1 
ATOM   982  C  CB  . MET A 1 172 ? 21.389  48.313 -8.042  1.00 145.50 ? 164 MET A CB  1 
ATOM   983  C  CG  . MET A 1 172 ? 21.308  46.855 -7.622  1.00 144.48 ? 164 MET A CG  1 
ATOM   984  S  SD  . MET A 1 172 ? 19.917  46.544 -6.515  1.00 143.17 ? 164 MET A SD  1 
ATOM   985  C  CE  . MET A 1 172 ? 20.228  47.758 -5.234  1.00 142.85 ? 164 MET A CE  1 
ATOM   986  N  N   . ASP A 1 173 ? 22.663  47.082 -10.679 1.00 139.35 ? 165 ASP A N   1 
ATOM   987  C  CA  . ASP A 1 173 ? 22.544  46.659 -12.072 1.00 138.92 ? 165 ASP A CA  1 
ATOM   988  C  C   . ASP A 1 173 ? 21.096  46.671 -12.555 1.00 139.25 ? 165 ASP A C   1 
ATOM   989  O  O   . ASP A 1 173 ? 20.830  46.905 -13.733 1.00 140.11 ? 165 ASP A O   1 
ATOM   990  C  CB  . ASP A 1 173 ? 23.136  45.259 -12.263 1.00 139.74 ? 165 ASP A CB  1 
ATOM   991  C  CG  . ASP A 1 173 ? 24.623  45.208 -11.977 1.00 147.57 ? 165 ASP A CG  1 
ATOM   992  O  OD1 . ASP A 1 173 ? 25.283  46.264 -12.059 1.00 151.13 ? 165 ASP A OD1 1 
ATOM   993  O  OD2 . ASP A 1 173 ? 25.133  44.109 -11.674 1.00 150.03 ? 165 ASP A OD2 1 
ATOM   994  N  N   . CYS A 1 174 ? 20.163  46.421 -11.642 1.00 140.42 ? 166 CYS A N   1 
ATOM   995  C  CA  . CYS A 1 174 ? 18.755  46.306 -12.006 1.00 136.93 ? 166 CYS A CA  1 
ATOM   996  C  C   . CYS A 1 174 ? 18.034  47.652 -11.996 1.00 138.29 ? 166 CYS A C   1 
ATOM   997  O  O   . CYS A 1 174 ? 16.818  47.713 -12.187 1.00 135.58 ? 166 CYS A O   1 
ATOM   998  C  CB  . CYS A 1 174 ? 18.044  45.334 -11.064 1.00 134.12 ? 166 CYS A CB  1 
ATOM   999  S  SG  . CYS A 1 174 ? 17.847  45.937 -9.371  1.00 136.10 ? 166 CYS A SG  1 
ATOM   1000 N  N   . GLU A 1 175 ? 18.784  48.728 -11.779 1.00 140.93 ? 167 GLU A N   1 
ATOM   1001 C  CA  . GLU A 1 175 ? 18.201  50.064 -11.708 1.00 141.29 ? 167 GLU A CA  1 
ATOM   1002 C  C   . GLU A 1 175 ? 18.121  50.725 -13.083 1.00 144.53 ? 167 GLU A C   1 
ATOM   1003 O  O   . GLU A 1 175 ? 17.432  51.731 -13.258 1.00 145.30 ? 167 GLU A O   1 
ATOM   1004 C  CB  . GLU A 1 175 ? 19.006  50.944 -10.750 1.00 148.14 ? 167 GLU A CB  1 
ATOM   1005 N  N   . ASP A 1 176 ? 18.827  50.155 -14.054 1.00 139.84 ? 168 ASP A N   1 
ATOM   1006 C  CA  . ASP A 1 176 ? 18.838  50.691 -15.411 1.00 141.15 ? 168 ASP A CA  1 
ATOM   1007 C  C   . ASP A 1 176 ? 18.274  49.685 -16.410 1.00 140.76 ? 168 ASP A C   1 
ATOM   1008 O  O   . ASP A 1 176 ? 17.801  48.615 -16.026 1.00 137.65 ? 168 ASP A O   1 
ATOM   1009 C  CB  . ASP A 1 176 ? 20.257  51.088 -15.816 1.00 146.30 ? 168 ASP A CB  1 
ATOM   1010 C  CG  . ASP A 1 176 ? 21.207  49.907 -15.838 1.00 149.19 ? 168 ASP A CG  1 
ATOM   1011 O  OD1 . ASP A 1 176 ? 21.789  49.590 -14.779 1.00 150.49 ? 168 ASP A OD1 1 
ATOM   1012 O  OD2 . ASP A 1 176 ? 21.368  49.294 -16.914 1.00 150.30 ? 168 ASP A OD2 1 
ATOM   1013 N  N   . ASP A 1 177 ? 18.334  50.030 -17.692 1.00 140.53 ? 169 ASP A N   1 
ATOM   1014 C  CA  . ASP A 1 177 ? 17.820  49.158 -18.743 1.00 138.58 ? 169 ASP A CA  1 
ATOM   1015 C  C   . ASP A 1 177 ? 18.884  48.858 -19.799 1.00 142.67 ? 169 ASP A C   1 
ATOM   1016 O  O   . ASP A 1 177 ? 18.673  49.086 -20.990 1.00 143.27 ? 169 ASP A O   1 
ATOM   1017 C  CB  . ASP A 1 177 ? 16.588  49.787 -19.399 1.00 138.98 ? 169 ASP A CB  1 
ATOM   1018 C  CG  . ASP A 1 177 ? 16.861  51.176 -19.947 1.00 157.82 ? 169 ASP A CG  1 
ATOM   1019 O  OD1 . ASP A 1 177 ? 17.817  51.826 -19.473 1.00 165.08 ? 169 ASP A OD1 1 
ATOM   1020 O  OD2 . ASP A 1 177 ? 16.121  51.615 -20.853 1.00 163.07 ? 169 ASP A OD2 1 
ATOM   1021 N  N   . GLU A 1 178 ? 20.025  48.340 -19.357 1.00 137.66 ? 170 GLU A N   1 
ATOM   1022 C  CA  . GLU A 1 178 ? 21.111  48.001 -20.270 1.00 141.00 ? 170 GLU A CA  1 
ATOM   1023 C  C   . GLU A 1 178 ? 22.053  46.964 -19.668 1.00 143.84 ? 170 GLU A C   1 
ATOM   1024 O  O   . GLU A 1 178 ? 22.195  46.873 -18.449 1.00 142.30 ? 170 GLU A O   1 
ATOM   1025 C  CB  . GLU A 1 178 ? 21.897  49.257 -20.656 1.00 155.68 ? 170 GLU A CB  1 
ATOM   1026 N  N   . VAL A 1 179 ? 22.691  46.181 -20.531 1.00 144.23 ? 171 VAL A N   1 
ATOM   1027 C  CA  . VAL A 1 179 ? 23.681  45.202 -20.096 1.00 145.69 ? 171 VAL A CA  1 
ATOM   1028 C  C   . VAL A 1 179 ? 25.080  45.704 -20.435 1.00 153.35 ? 171 VAL A C   1 
ATOM   1029 O  O   . VAL A 1 179 ? 25.476  45.720 -21.600 1.00 156.08 ? 171 VAL A O   1 
ATOM   1030 C  CB  . VAL A 1 179 ? 23.455  43.829 -20.752 1.00 146.72 ? 171 VAL A CB  1 
ATOM   1031 C  CG1 . VAL A 1 179 ? 24.460  42.817 -20.223 1.00 148.47 ? 171 VAL A CG1 1 
ATOM   1032 C  CG2 . VAL A 1 179 ? 22.033  43.352 -20.506 1.00 141.98 ? 171 VAL A CG2 1 
ATOM   1033 N  N   . LEU A 1 180 ? 25.824  46.112 -19.412 1.00 157.47 ? 172 LEU A N   1 
ATOM   1034 C  CA  . LEU A 1 180 ? 27.117  46.757 -19.619 1.00 161.88 ? 172 LEU A CA  1 
ATOM   1035 C  C   . LEU A 1 180 ? 28.266  45.764 -19.791 1.00 166.95 ? 172 LEU A C   1 
ATOM   1036 O  O   . LEU A 1 180 ? 29.051  45.873 -20.733 1.00 170.81 ? 172 LEU A O   1 
ATOM   1037 C  CB  . LEU A 1 180 ? 27.424  47.701 -18.454 1.00 162.32 ? 172 LEU A CB  1 
ATOM   1038 C  CG  . LEU A 1 180 ? 26.364  48.755 -18.132 1.00 162.83 ? 172 LEU A CG  1 
ATOM   1039 C  CD1 . LEU A 1 180 ? 26.852  49.681 -17.028 1.00 165.59 ? 172 LEU A CD1 1 
ATOM   1040 C  CD2 . LEU A 1 180 ? 25.983  49.546 -19.375 1.00 165.11 ? 172 LEU A CD2 1 
ATOM   1041 N  N   . ASP A 1 181 ? 28.369  44.802 -18.878 1.00 163.09 ? 173 ASP A N   1 
ATOM   1042 C  CA  . ASP A 1 181 ? 29.477  43.854 -18.904 1.00 165.72 ? 173 ASP A CA  1 
ATOM   1043 C  C   . ASP A 1 181 ? 29.023  42.440 -19.250 1.00 166.09 ? 173 ASP A C   1 
ATOM   1044 O  O   . ASP A 1 181 ? 27.863  42.080 -19.050 1.00 162.70 ? 173 ASP A O   1 
ATOM   1045 C  CB  . ASP A 1 181 ? 30.205  43.846 -17.557 1.00 167.93 ? 173 ASP A CB  1 
ATOM   1046 C  CG  . ASP A 1 181 ? 30.796  45.198 -17.207 1.00 185.43 ? 173 ASP A CG  1 
ATOM   1047 O  OD1 . ASP A 1 181 ? 30.080  46.213 -17.330 1.00 185.79 ? 173 ASP A OD1 1 
ATOM   1048 O  OD2 . ASP A 1 181 ? 31.981  45.246 -16.815 1.00 197.48 ? 173 ASP A OD2 1 
ATOM   1049 N  N   . SER A 1 182 ? 29.952  41.645 -19.773 1.00 161.94 ? 174 SER A N   1 
ATOM   1050 C  CA  . SER A 1 182 ? 29.683  40.249 -20.093 1.00 160.58 ? 174 SER A CA  1 
ATOM   1051 C  C   . SER A 1 182 ? 29.594  39.414 -18.821 1.00 161.56 ? 174 SER A C   1 
ATOM   1052 O  O   . SER A 1 182 ? 28.990  38.342 -18.809 1.00 159.72 ? 174 SER A O   1 
ATOM   1053 C  CB  . SER A 1 182 ? 30.768  39.689 -21.016 1.00 166.01 ? 174 SER A CB  1 
ATOM   1054 O  OG  . SER A 1 182 ? 32.042  39.744 -20.397 1.00 178.71 ? 174 SER A OG  1 
ATOM   1055 N  N   . GLU A 1 183 ? 30.202  39.919 -17.752 1.00 160.24 ? 175 GLU A N   1 
ATOM   1056 C  CA  . GLU A 1 183 ? 30.209  39.229 -16.468 1.00 159.06 ? 175 GLU A CA  1 
ATOM   1057 C  C   . GLU A 1 183 ? 28.839  39.283 -15.799 1.00 155.75 ? 175 GLU A C   1 
ATOM   1058 O  O   . GLU A 1 183 ? 28.566  38.536 -14.860 1.00 154.89 ? 175 GLU A O   1 
ATOM   1059 C  CB  . GLU A 1 183 ? 31.269  39.835 -15.544 1.00 162.55 ? 175 GLU A CB  1 
ATOM   1060 N  N   . ASP A 1 184 ? 27.983  40.172 -16.292 1.00 146.21 ? 176 ASP A N   1 
ATOM   1061 C  CA  . ASP A 1 184 ? 26.654  40.362 -15.722 1.00 141.52 ? 176 ASP A CA  1 
ATOM   1062 C  C   . ASP A 1 184 ? 25.675  39.292 -16.202 1.00 140.95 ? 176 ASP A C   1 
ATOM   1063 O  O   . ASP A 1 184 ? 24.657  39.037 -15.557 1.00 137.51 ? 176 ASP A O   1 
ATOM   1064 C  CB  . ASP A 1 184 ? 26.126  41.755 -16.074 1.00 141.03 ? 176 ASP A CB  1 
ATOM   1065 C  CG  . ASP A 1 184 ? 24.824  42.083 -15.370 1.00 140.49 ? 176 ASP A CG  1 
ATOM   1066 O  OD1 . ASP A 1 184 ? 24.614  41.585 -14.245 1.00 138.98 ? 176 ASP A OD1 1 
ATOM   1067 O  OD2 . ASP A 1 184 ? 24.011  42.840 -15.942 1.00 141.08 ? 176 ASP A OD2 1 
ATOM   1068 N  N   . LEU A 1 185 ? 25.989  38.661 -17.330 1.00 139.45 ? 177 LEU A N   1 
ATOM   1069 C  CA  . LEU A 1 185 ? 25.100  37.663 -17.920 1.00 137.42 ? 177 LEU A CA  1 
ATOM   1070 C  C   . LEU A 1 185 ? 25.021  36.388 -17.083 1.00 139.14 ? 177 LEU A C   1 
ATOM   1071 O  O   . LEU A 1 185 ? 24.060  35.628 -17.188 1.00 137.67 ? 177 LEU A O   1 
ATOM   1072 C  CB  . LEU A 1 185 ? 25.546  37.323 -19.345 1.00 139.83 ? 177 LEU A CB  1 
ATOM   1073 C  CG  . LEU A 1 185 ? 25.408  38.428 -20.397 1.00 142.76 ? 177 LEU A CG  1 
ATOM   1074 C  CD1 . LEU A 1 185 ? 25.716  37.889 -21.785 1.00 144.36 ? 177 LEU A CD1 1 
ATOM   1075 C  CD2 . LEU A 1 185 ? 24.021  39.052 -20.355 1.00 140.28 ? 177 LEU A CD2 1 
ATOM   1076 N  N   . GLN A 1 186 ? 26.033  36.160 -16.251 1.00 134.66 ? 178 GLN A N   1 
ATOM   1077 C  CA  . GLN A 1 186 ? 26.064  34.984 -15.386 1.00 134.30 ? 178 GLN A CA  1 
ATOM   1078 C  C   . GLN A 1 186 ? 24.969  35.042 -14.325 1.00 132.36 ? 178 GLN A C   1 
ATOM   1079 O  O   . GLN A 1 186 ? 24.515  34.012 -13.830 1.00 131.48 ? 178 GLN A O   1 
ATOM   1080 C  CB  . GLN A 1 186 ? 27.431  34.850 -14.713 1.00 138.17 ? 178 GLN A CB  1 
ATOM   1081 C  CG  . GLN A 1 186 ? 28.602  34.819 -15.680 1.00 154.55 ? 178 GLN A CG  1 
ATOM   1082 C  CD  . GLN A 1 186 ? 29.937  34.966 -14.976 1.00 170.17 ? 178 GLN A CD  1 
ATOM   1083 O  OE1 . GLN A 1 186 ? 30.496  33.994 -14.467 1.00 168.27 ? 178 GLN A OE1 1 
ATOM   1084 N  NE2 . GLN A 1 186 ? 30.456  36.189 -14.942 1.00 169.43 ? 178 GLN A NE2 1 
ATOM   1085 N  N   . ASP A 1 187 ? 24.548  36.255 -13.982 1.00 129.80 ? 179 ASP A N   1 
ATOM   1086 C  CA  . ASP A 1 187 ? 23.527  36.451 -12.958 1.00 126.20 ? 179 ASP A CA  1 
ATOM   1087 C  C   . ASP A 1 187 ? 22.114  36.280 -13.517 1.00 125.65 ? 179 ASP A C   1 
ATOM   1088 O  O   . ASP A 1 187 ? 21.179  35.972 -12.776 1.00 123.77 ? 179 ASP A O   1 
ATOM   1089 C  CB  . ASP A 1 187 ? 23.670  37.838 -12.324 1.00 125.98 ? 179 ASP A CB  1 
ATOM   1090 C  CG  . ASP A 1 187 ? 25.033  38.052 -11.688 1.00 129.99 ? 179 ASP A CG  1 
ATOM   1091 O  OD1 . ASP A 1 187 ? 25.558  37.105 -11.066 1.00 131.20 ? 179 ASP A OD1 1 
ATOM   1092 O  OD2 . ASP A 1 187 ? 25.581  39.168 -11.810 1.00 132.69 ? 179 ASP A OD2 1 
ATOM   1093 N  N   . MET A 1 188 ? 21.965  36.480 -14.823 1.00 116.26 ? 180 MET A N   1 
ATOM   1094 C  CA  . MET A 1 188 ? 20.655  36.410 -15.465 1.00 112.73 ? 180 MET A CA  1 
ATOM   1095 C  C   . MET A 1 188 ? 20.327  35.003 -15.964 1.00 115.71 ? 180 MET A C   1 
ATOM   1096 O  O   . MET A 1 188 ? 21.212  34.263 -16.395 1.00 119.14 ? 180 MET A O   1 
ATOM   1097 C  CB  . MET A 1 188 ? 20.582  37.402 -16.627 1.00 113.76 ? 180 MET A CB  1 
ATOM   1098 C  CG  . MET A 1 188 ? 20.795  38.851 -16.215 1.00 115.29 ? 180 MET A CG  1 
ATOM   1099 S  SD  . MET A 1 188 ? 20.669  40.004 -17.596 1.00 118.23 ? 180 MET A SD  1 
ATOM   1100 C  CE  . MET A 1 188 ? 21.045  41.551 -16.775 1.00 116.79 ? 180 MET A CE  1 
ATOM   1101 N  N   . SER A 1 189 ? 19.049  34.642 -15.902 1.00 109.75 ? 181 SER A N   1 
ATOM   1102 C  CA  . SER A 1 189 ? 18.592  33.344 -16.387 1.00 110.41 ? 181 SER A CA  1 
ATOM   1103 C  C   . SER A 1 189 ? 18.423  33.364 -17.904 1.00 114.17 ? 181 SER A C   1 
ATOM   1104 O  O   . SER A 1 189 ? 18.078  34.394 -18.483 1.00 112.77 ? 181 SER A O   1 
ATOM   1105 C  CB  . SER A 1 189 ? 17.276  32.950 -15.711 1.00 89.98  ? 181 SER A CB  1 
ATOM   1106 N  N   . LEU A 1 190 ? 18.663  32.222 -18.542 1.00 107.11 ? 182 LEU A N   1 
ATOM   1107 C  CA  . LEU A 1 190 ? 18.583  32.128 -19.996 1.00 108.26 ? 182 LEU A CA  1 
ATOM   1108 C  C   . LEU A 1 190 ? 17.230  31.591 -20.460 1.00 108.26 ? 182 LEU A C   1 
ATOM   1109 O  O   . LEU A 1 190 ? 16.662  30.688 -19.843 1.00 107.22 ? 182 LEU A O   1 
ATOM   1110 C  CB  . LEU A 1 190 ? 19.710  31.241 -20.533 1.00 112.35 ? 182 LEU A CB  1 
ATOM   1111 C  CG  . LEU A 1 190 ? 19.822  31.082 -22.051 1.00 116.60 ? 182 LEU A CG  1 
ATOM   1112 C  CD1 . LEU A 1 190 ? 19.958  32.439 -22.723 1.00 116.36 ? 182 LEU A CD1 1 
ATOM   1113 C  CD2 . LEU A 1 190 ? 20.996  30.185 -22.409 1.00 121.78 ? 182 LEU A CD2 1 
ATOM   1114 N  N   . MET A 1 191 ? 16.720  32.160 -21.548 1.00 113.68 ? 183 MET A N   1 
ATOM   1115 C  CA  . MET A 1 191 ? 15.472  31.709 -22.155 1.00 110.83 ? 183 MET A CA  1 
ATOM   1116 C  C   . MET A 1 191 ? 15.594  31.749 -23.675 1.00 115.75 ? 183 MET A C   1 
ATOM   1117 O  O   . MET A 1 191 ? 15.976  32.771 -24.244 1.00 116.85 ? 183 MET A O   1 
ATOM   1118 C  CB  . MET A 1 191 ? 14.299  32.573 -21.692 1.00 106.89 ? 183 MET A CB  1 
ATOM   1119 C  CG  . MET A 1 191 ? 12.966  32.191 -22.312 1.00 106.07 ? 183 MET A CG  1 
ATOM   1120 S  SD  . MET A 1 191 ? 11.620  33.258 -21.768 1.00 103.10 ? 183 MET A SD  1 
ATOM   1121 C  CE  . MET A 1 191 ? 12.253  34.864 -22.243 1.00 102.73 ? 183 MET A CE  1 
ATOM   1122 N  N   . THR A 1 192 ? 15.272  30.640 -24.331 1.00 112.47 ? 184 THR A N   1 
ATOM   1123 C  CA  . THR A 1 192 ? 15.467  30.537 -25.774 1.00 114.78 ? 184 THR A CA  1 
ATOM   1124 C  C   . THR A 1 192 ? 14.157  30.316 -26.530 1.00 113.82 ? 184 THR A C   1 
ATOM   1125 O  O   . THR A 1 192 ? 13.261  29.621 -26.050 1.00 111.31 ? 184 THR A O   1 
ATOM   1126 C  CB  . THR A 1 192 ? 16.440  29.392 -26.123 1.00 123.23 ? 184 THR A CB  1 
ATOM   1127 O  OG1 . THR A 1 192 ? 15.804  28.129 -25.889 1.00 123.78 ? 184 THR A OG1 1 
ATOM   1128 C  CG2 . THR A 1 192 ? 17.703  29.484 -25.277 1.00 122.75 ? 184 THR A CG2 1 
ATOM   1129 N  N   . LEU A 1 193 ? 14.055  30.918 -27.711 1.00 114.39 ? 185 LEU A N   1 
ATOM   1130 C  CA  . LEU A 1 193 ? 12.909  30.704 -28.590 1.00 112.41 ? 185 LEU A CA  1 
ATOM   1131 C  C   . LEU A 1 193 ? 13.367  30.116 -29.919 1.00 118.23 ? 185 LEU A C   1 
ATOM   1132 O  O   . LEU A 1 193 ? 13.913  30.821 -30.767 1.00 119.78 ? 185 LEU A O   1 
ATOM   1133 C  CB  . LEU A 1 193 ? 12.145  32.011 -28.825 1.00 109.56 ? 185 LEU A CB  1 
ATOM   1134 C  CG  . LEU A 1 193 ? 10.922  31.918 -29.745 1.00 110.37 ? 185 LEU A CG  1 
ATOM   1135 C  CD1 . LEU A 1 193 ? 9.898   30.939 -29.193 1.00 107.45 ? 185 LEU A CD1 1 
ATOM   1136 C  CD2 . LEU A 1 193 ? 10.293  33.288 -29.961 1.00 108.82 ? 185 LEU A CD2 1 
ATOM   1137 N  N   . SER A 1 194 ? 13.148  28.816 -30.088 1.00 113.03 ? 186 SER A N   1 
ATOM   1138 C  CA  . SER A 1 194 ? 13.533  28.126 -31.312 1.00 116.85 ? 186 SER A CA  1 
ATOM   1139 C  C   . SER A 1 194 ? 12.328  27.935 -32.226 1.00 116.89 ? 186 SER A C   1 
ATOM   1140 O  O   . SER A 1 194 ? 11.292  27.421 -31.802 1.00 114.67 ? 186 SER A O   1 
ATOM   1141 C  CB  . SER A 1 194 ? 14.171  26.774 -30.986 1.00 118.51 ? 186 SER A CB  1 
ATOM   1142 N  N   . THR A 1 195 ? 12.467  28.352 -33.482 1.00 119.81 ? 187 THR A N   1 
ATOM   1143 C  CA  . THR A 1 195 ? 11.368  28.270 -34.438 1.00 119.95 ? 187 THR A CA  1 
ATOM   1144 C  C   . THR A 1 195 ? 11.793  27.694 -35.788 1.00 126.63 ? 187 THR A C   1 
ATOM   1145 O  O   . THR A 1 195 ? 12.823  28.076 -36.345 1.00 128.76 ? 187 THR A O   1 
ATOM   1146 C  CB  . THR A 1 195 ? 10.729  29.654 -34.672 1.00 122.99 ? 187 THR A CB  1 
ATOM   1147 O  OG1 . THR A 1 195 ? 11.754  30.614 -34.958 1.00 126.57 ? 187 THR A OG1 1 
ATOM   1148 C  CG2 . THR A 1 195 ? 9.959   30.100 -33.439 1.00 117.10 ? 187 THR A CG2 1 
ATOM   1149 N  N   . LYS A 1 196 ? 10.988  26.771 -36.307 1.00 128.80 ? 188 LYS A N   1 
ATOM   1150 C  CA  . LYS A 1 196 ? 11.234  26.176 -37.616 1.00 132.31 ? 188 LYS A CA  1 
ATOM   1151 C  C   . LYS A 1 196 ? 9.976   26.254 -38.479 1.00 134.64 ? 188 LYS A C   1 
ATOM   1152 O  O   . LYS A 1 196 ? 9.085   25.412 -38.370 1.00 134.40 ? 188 LYS A O   1 
ATOM   1153 C  CB  . LYS A 1 196 ? 11.693  24.724 -37.474 1.00 135.19 ? 188 LYS A CB  1 
ATOM   1154 N  N   . THR A 1 197 ? 9.906   27.276 -39.327 1.00 130.75 ? 189 THR A N   1 
ATOM   1155 C  CA  . THR A 1 197 ? 8.728   27.529 -40.152 1.00 131.45 ? 189 THR A CA  1 
ATOM   1156 C  C   . THR A 1 197 ? 9.124   27.739 -41.614 1.00 137.83 ? 189 THR A C   1 
ATOM   1157 O  O   . THR A 1 197 ? 10.306  27.874 -41.917 1.00 139.82 ? 189 THR A O   1 
ATOM   1158 C  CB  . THR A 1 197 ? 7.954   28.772 -39.657 1.00 134.81 ? 189 THR A CB  1 
ATOM   1159 O  OG1 . THR A 1 197 ? 8.699   29.957 -39.963 1.00 135.99 ? 189 THR A OG1 1 
ATOM   1160 C  CG2 . THR A 1 197 ? 7.710   28.700 -38.157 1.00 129.70 ? 189 THR A CG2 1 
ATOM   1161 N  N   . PRO A 1 198 ? 8.141   27.751 -42.532 1.00 136.88 ? 190 PRO A N   1 
ATOM   1162 C  CA  . PRO A 1 198 ? 8.467   28.165 -43.903 1.00 140.17 ? 190 PRO A CA  1 
ATOM   1163 C  C   . PRO A 1 198 ? 9.016   29.591 -43.972 1.00 142.44 ? 190 PRO A C   1 
ATOM   1164 O  O   . PRO A 1 198 ? 8.864   30.360 -43.022 1.00 139.07 ? 190 PRO A O   1 
ATOM   1165 C  CB  . PRO A 1 198 ? 7.123   28.067 -44.626 1.00 141.98 ? 190 PRO A CB  1 
ATOM   1166 C  CG  . PRO A 1 198 ? 6.388   27.009 -43.889 1.00 143.11 ? 190 PRO A CG  1 
ATOM   1167 C  CD  . PRO A 1 198 ? 6.795   27.155 -42.447 1.00 137.02 ? 190 PRO A CD  1 
ATOM   1168 N  N   . LYS A 1 199 ? 9.642   29.935 -45.093 1.00 146.94 ? 191 LYS A N   1 
ATOM   1169 C  CA  . LYS A 1 199 ? 10.269  31.243 -45.254 1.00 147.29 ? 191 LYS A CA  1 
ATOM   1170 C  C   . LYS A 1 199 ? 9.243   32.362 -45.419 1.00 148.62 ? 191 LYS A C   1 
ATOM   1171 O  O   . LYS A 1 199 ? 9.373   33.427 -44.814 1.00 146.78 ? 191 LYS A O   1 
ATOM   1172 C  CB  . LYS A 1 199 ? 11.222  31.230 -46.451 1.00 152.81 ? 191 LYS A CB  1 
ATOM   1173 N  N   . ASP A 1 200 ? 8.224   32.118 -46.238 1.00 150.58 ? 192 ASP A N   1 
ATOM   1174 C  CA  . ASP A 1 200 ? 7.202   33.128 -46.502 1.00 150.01 ? 192 ASP A CA  1 
ATOM   1175 C  C   . ASP A 1 200 ? 6.096   33.098 -45.453 1.00 147.82 ? 192 ASP A C   1 
ATOM   1176 O  O   . ASP A 1 200 ? 5.064   33.753 -45.604 1.00 147.67 ? 192 ASP A O   1 
ATOM   1177 C  CB  . ASP A 1 200 ? 6.601   32.932 -47.898 1.00 154.64 ? 192 ASP A CB  1 
ATOM   1178 C  CG  . ASP A 1 200 ? 5.704   31.712 -47.984 1.00 160.11 ? 192 ASP A CG  1 
ATOM   1179 O  OD1 . ASP A 1 200 ? 4.478   31.860 -47.789 1.00 162.57 ? 192 ASP A OD1 1 
ATOM   1180 O  OD2 . ASP A 1 200 ? 6.222   30.608 -48.251 1.00 161.91 ? 192 ASP A OD2 1 
ATOM   1181 N  N   . PHE A 1 201 ? 6.323   32.341 -44.387 1.00 142.48 ? 193 PHE A N   1 
ATOM   1182 C  CA  . PHE A 1 201 ? 5.319   32.156 -43.345 1.00 139.04 ? 193 PHE A CA  1 
ATOM   1183 C  C   . PHE A 1 201 ? 5.121   33.406 -42.486 1.00 139.62 ? 193 PHE A C   1 
ATOM   1184 O  O   . PHE A 1 201 ? 4.080   33.572 -41.854 1.00 137.48 ? 193 PHE A O   1 
ATOM   1185 C  CB  . PHE A 1 201 ? 5.701   30.961 -42.463 1.00 137.98 ? 193 PHE A CB  1 
ATOM   1186 C  CG  . PHE A 1 201 ? 4.859   30.821 -41.225 1.00 134.66 ? 193 PHE A CG  1 
ATOM   1187 C  CD1 . PHE A 1 201 ? 3.551   30.371 -41.305 1.00 135.93 ? 193 PHE A CD1 1 
ATOM   1188 C  CD2 . PHE A 1 201 ? 5.377   31.136 -39.981 1.00 132.23 ? 193 PHE A CD2 1 
ATOM   1189 C  CE1 . PHE A 1 201 ? 2.776   30.243 -40.164 1.00 133.35 ? 193 PHE A CE1 1 
ATOM   1190 C  CE2 . PHE A 1 201 ? 4.608   31.011 -38.838 1.00 130.33 ? 193 PHE A CE2 1 
ATOM   1191 C  CZ  . PHE A 1 201 ? 3.306   30.564 -38.930 1.00 129.40 ? 193 PHE A CZ  1 
ATOM   1192 N  N   . PHE A 1 202 ? 6.110   34.295 -42.480 1.00 142.71 ? 194 PHE A N   1 
ATOM   1193 C  CA  . PHE A 1 202 ? 6.086   35.443 -41.574 1.00 139.91 ? 194 PHE A CA  1 
ATOM   1194 C  C   . PHE A 1 202 ? 5.606   36.751 -42.199 1.00 143.00 ? 194 PHE A C   1 
ATOM   1195 O  O   . PHE A 1 202 ? 5.657   37.796 -41.551 1.00 140.90 ? 194 PHE A O   1 
ATOM   1196 C  CB  . PHE A 1 202 ? 7.476   35.668 -40.972 1.00 140.36 ? 194 PHE A CB  1 
ATOM   1197 C  CG  . PHE A 1 202 ? 7.671   35.007 -39.641 1.00 137.74 ? 194 PHE A CG  1 
ATOM   1198 C  CD1 . PHE A 1 202 ? 6.764   34.076 -39.169 1.00 136.95 ? 194 PHE A CD1 1 
ATOM   1199 C  CD2 . PHE A 1 202 ? 8.756   35.330 -38.853 1.00 138.57 ? 194 PHE A CD2 1 
ATOM   1200 C  CE1 . PHE A 1 202 ? 6.950   33.471 -37.939 1.00 134.70 ? 194 PHE A CE1 1 
ATOM   1201 C  CE2 . PHE A 1 202 ? 8.945   34.734 -37.625 1.00 137.29 ? 194 PHE A CE2 1 
ATOM   1202 C  CZ  . PHE A 1 202 ? 8.039   33.801 -37.167 1.00 133.58 ? 194 PHE A CZ  1 
ATOM   1203 N  N   . THR A 1 203 ? 5.146   36.706 -43.445 1.00 146.08 ? 195 THR A N   1 
ATOM   1204 C  CA  . THR A 1 203 ? 4.651   37.920 -44.085 1.00 148.08 ? 195 THR A CA  1 
ATOM   1205 C  C   . THR A 1 203 ? 3.231   38.237 -43.623 1.00 148.76 ? 195 THR A C   1 
ATOM   1206 O  O   . THR A 1 203 ? 2.777   39.377 -43.726 1.00 149.68 ? 195 THR A O   1 
ATOM   1207 C  CB  . THR A 1 203 ? 4.671   37.813 -45.622 1.00 158.60 ? 195 THR A CB  1 
ATOM   1208 O  OG1 . THR A 1 203 ? 4.214   39.046 -46.192 1.00 162.54 ? 195 THR A OG1 1 
ATOM   1209 C  CG2 . THR A 1 203 ? 3.773   36.683 -46.096 1.00 157.51 ? 195 THR A CG2 1 
ATOM   1210 N  N   . ASN A 1 204 ? 2.541   37.226 -43.106 1.00 148.45 ? 196 ASN A N   1 
ATOM   1211 C  CA  . ASN A 1 204 ? 1.159   37.386 -42.667 1.00 147.27 ? 196 ASN A CA  1 
ATOM   1212 C  C   . ASN A 1 204 ? 0.942   36.947 -41.221 1.00 144.78 ? 196 ASN A C   1 
ATOM   1213 O  O   . ASN A 1 204 ? -0.165  37.052 -40.693 1.00 144.32 ? 196 ASN A O   1 
ATOM   1214 C  CB  . ASN A 1 204 ? 0.219   36.612 -43.594 1.00 144.48 ? 196 ASN A CB  1 
ATOM   1215 C  CG  . ASN A 1 204 ? 0.730   35.220 -43.916 1.00 144.24 ? 196 ASN A CG  1 
ATOM   1216 O  OD1 . ASN A 1 204 ? 1.559   34.667 -43.194 1.00 141.59 ? 196 ASN A OD1 1 
ATOM   1217 N  ND2 . ASN A 1 204 ? 0.238   34.647 -45.010 1.00 147.44 ? 196 ASN A ND2 1 
ATOM   1218 N  N   . HIS A 1 205 ? 2.000   36.450 -40.589 1.00 130.61 ? 197 HIS A N   1 
ATOM   1219 C  CA  . HIS A 1 205 ? 1.952   36.086 -39.176 1.00 126.30 ? 197 HIS A CA  1 
ATOM   1220 C  C   . HIS A 1 205 ? 2.986   36.871 -38.379 1.00 127.43 ? 197 HIS A C   1 
ATOM   1221 O  O   . HIS A 1 205 ? 3.921   37.436 -38.946 1.00 129.33 ? 197 HIS A O   1 
ATOM   1222 C  CB  . HIS A 1 205 ? 2.181   34.584 -38.991 1.00 125.61 ? 197 HIS A CB  1 
ATOM   1223 C  CG  . HIS A 1 205 ? 1.003   33.741 -39.361 1.00 128.57 ? 197 HIS A CG  1 
ATOM   1224 N  ND1 . HIS A 1 205 ? -0.112  33.624 -38.559 1.00 126.99 ? 197 HIS A ND1 1 
ATOM   1225 C  CD2 . HIS A 1 205 ? 0.769   32.962 -40.445 1.00 132.94 ? 197 HIS A CD2 1 
ATOM   1226 C  CE1 . HIS A 1 205 ? -0.983  32.815 -39.133 1.00 128.87 ? 197 HIS A CE1 1 
ATOM   1227 N  NE2 . HIS A 1 205 ? -0.472  32.400 -40.279 1.00 132.57 ? 197 HIS A NE2 1 
ATOM   1228 N  N   . THR A 1 206 ? 2.818   36.896 -37.060 1.00 121.40 ? 198 THR A N   1 
ATOM   1229 C  CA  . THR A 1 206 ? 3.733   37.627 -36.191 1.00 119.39 ? 198 THR A CA  1 
ATOM   1230 C  C   . THR A 1 206 ? 3.800   37.044 -34.781 1.00 117.49 ? 198 THR A C   1 
ATOM   1231 O  O   . THR A 1 206 ? 2.816   36.509 -34.265 1.00 115.81 ? 198 THR A O   1 
ATOM   1232 C  CB  . THR A 1 206 ? 3.342   39.116 -36.095 1.00 126.74 ? 198 THR A CB  1 
ATOM   1233 O  OG1 . THR A 1 206 ? 4.177   39.769 -35.131 1.00 125.09 ? 198 THR A OG1 1 
ATOM   1234 C  CG2 . THR A 1 206 ? 1.886   39.262 -35.680 1.00 126.22 ? 198 THR A CG2 1 
ATOM   1235 N  N   . LEU A 1 207 ? 4.975   37.149 -34.168 1.00 113.24 ? 199 LEU A N   1 
ATOM   1236 C  CA  . LEU A 1 207 ? 5.185   36.687 -32.801 1.00 109.78 ? 199 LEU A CA  1 
ATOM   1237 C  C   . LEU A 1 207 ? 5.342   37.860 -31.844 1.00 110.22 ? 199 LEU A C   1 
ATOM   1238 O  O   . LEU A 1 207 ? 5.942   38.879 -32.189 1.00 111.63 ? 199 LEU A O   1 
ATOM   1239 C  CB  . LEU A 1 207 ? 6.416   35.783 -32.717 1.00 109.80 ? 199 LEU A CB  1 
ATOM   1240 C  CG  . LEU A 1 207 ? 6.243   34.319 -33.118 1.00 113.08 ? 199 LEU A CG  1 
ATOM   1241 C  CD1 . LEU A 1 207 ? 7.587   33.614 -33.113 1.00 114.42 ? 199 LEU A CD1 1 
ATOM   1242 C  CD2 . LEU A 1 207 ? 5.271   33.619 -32.184 1.00 111.06 ? 199 LEU A CD2 1 
ATOM   1243 N  N   . VAL A 1 208 ? 4.805   37.709 -30.639 1.00 109.21 ? 200 VAL A N   1 
ATOM   1244 C  CA  . VAL A 1 208 ? 4.918   38.747 -29.625 1.00 107.43 ? 200 VAL A CA  1 
ATOM   1245 C  C   . VAL A 1 208 ? 5.188   38.145 -28.247 1.00 106.39 ? 200 VAL A C   1 
ATOM   1246 O  O   . VAL A 1 208 ? 4.502   37.220 -27.809 1.00 103.88 ? 200 VAL A O   1 
ATOM   1247 C  CB  . VAL A 1 208 ? 3.646   39.629 -29.575 1.00 110.02 ? 200 VAL A CB  1 
ATOM   1248 C  CG1 . VAL A 1 208 ? 2.389   38.770 -29.538 1.00 109.91 ? 200 VAL A CG1 1 
ATOM   1249 C  CG2 . VAL A 1 208 ? 3.695   40.581 -28.388 1.00 108.13 ? 200 VAL A CG2 1 
ATOM   1250 N  N   . LEU A 1 209 ? 6.211   38.667 -27.579 1.00 108.50 ? 201 LEU A N   1 
ATOM   1251 C  CA  . LEU A 1 209 ? 6.545   38.244 -26.226 1.00 105.75 ? 201 LEU A CA  1 
ATOM   1252 C  C   . LEU A 1 209 ? 5.941   39.220 -25.221 1.00 106.47 ? 201 LEU A C   1 
ATOM   1253 O  O   . LEU A 1 209 ? 6.033   40.436 -25.403 1.00 108.21 ? 201 LEU A O   1 
ATOM   1254 C  CB  . LEU A 1 209 ? 8.061   38.159 -26.048 1.00 106.28 ? 201 LEU A CB  1 
ATOM   1255 C  CG  . LEU A 1 209 ? 8.571   37.442 -24.797 1.00 106.79 ? 201 LEU A CG  1 
ATOM   1256 C  CD1 . LEU A 1 209 ? 8.311   35.944 -24.891 1.00 106.56 ? 201 LEU A CD1 1 
ATOM   1257 C  CD2 . LEU A 1 209 ? 10.049  37.724 -24.583 1.00 109.67 ? 201 LEU A CD2 1 
ATOM   1258 N  N   . HIS A 1 210 ? 5.322   38.697 -24.167 1.00 96.30  ? 202 HIS A N   1 
ATOM   1259 C  CA  . HIS A 1 210 ? 4.645   39.561 -23.205 1.00 95.34  ? 202 HIS A CA  1 
ATOM   1260 C  C   . HIS A 1 210 ? 4.578   38.987 -21.791 1.00 95.10  ? 202 HIS A C   1 
ATOM   1261 O  O   . HIS A 1 210 ? 4.725   37.781 -21.580 1.00 93.50  ? 202 HIS A O   1 
ATOM   1262 C  CB  . HIS A 1 210 ? 3.229   39.879 -23.697 1.00 97.68  ? 202 HIS A CB  1 
ATOM   1263 C  CG  . HIS A 1 210 ? 2.395   38.667 -23.976 1.00 99.80  ? 202 HIS A CG  1 
ATOM   1264 N  ND1 . HIS A 1 210 ? 1.334   38.295 -23.180 1.00 100.67 ? 202 HIS A ND1 1 
ATOM   1265 C  CD2 . HIS A 1 210 ? 2.462   37.746 -24.967 1.00 101.51 ? 202 HIS A CD2 1 
ATOM   1266 C  CE1 . HIS A 1 210 ? 0.784   37.196 -23.667 1.00 100.99 ? 202 HIS A CE1 1 
ATOM   1267 N  NE2 . HIS A 1 210 ? 1.451   36.842 -24.750 1.00 101.61 ? 202 HIS A NE2 1 
ATOM   1268 N  N   . VAL A 1 211 ? 4.355   39.876 -20.828 1.00 96.19  ? 203 VAL A N   1 
ATOM   1269 C  CA  . VAL A 1 211 ? 4.229   39.513 -19.421 1.00 94.09  ? 203 VAL A CA  1 
ATOM   1270 C  C   . VAL A 1 211 ? 3.037   40.270 -18.833 1.00 97.75  ? 203 VAL A C   1 
ATOM   1271 O  O   . VAL A 1 211 ? 2.651   41.316 -19.354 1.00 99.11  ? 203 VAL A O   1 
ATOM   1272 C  CB  . VAL A 1 211 ? 5.523   39.841 -18.633 1.00 95.00  ? 203 VAL A CB  1 
ATOM   1273 C  CG1 . VAL A 1 211 ? 5.725   41.347 -18.531 1.00 96.41  ? 203 VAL A CG1 1 
ATOM   1274 C  CG2 . VAL A 1 211 ? 5.504   39.202 -17.248 1.00 92.60  ? 203 VAL A CG2 1 
ATOM   1275 N  N   . ALA A 1 212 ? 2.442   39.736 -17.768 1.00 96.74  ? 204 ALA A N   1 
ATOM   1276 C  CA  . ALA A 1 212 ? 1.317   40.394 -17.107 1.00 98.41  ? 204 ALA A CA  1 
ATOM   1277 C  C   . ALA A 1 212 ? 1.690   41.806 -16.661 1.00 100.06 ? 204 ALA A C   1 
ATOM   1278 O  O   . ALA A 1 212 ? 2.855   42.090 -16.380 1.00 98.54  ? 204 ALA A O   1 
ATOM   1279 C  CB  . ALA A 1 212 ? 0.843   39.568 -15.920 1.00 98.06  ? 204 ALA A CB  1 
ATOM   1280 N  N   . ARG A 1 213 ? 0.698   42.689 -16.602 1.00 102.53 ? 205 ARG A N   1 
ATOM   1281 C  CA  . ARG A 1 213 ? 0.941   44.087 -16.257 1.00 103.20 ? 205 ARG A CA  1 
ATOM   1282 C  C   . ARG A 1 213 ? 1.317   44.268 -14.789 1.00 104.74 ? 205 ARG A C   1 
ATOM   1283 O  O   . ARG A 1 213 ? 1.910   45.280 -14.415 1.00 104.92 ? 205 ARG A O   1 
ATOM   1284 C  CB  . ARG A 1 213 ? -0.289  44.938 -16.587 1.00 105.59 ? 205 ARG A CB  1 
ATOM   1285 C  CG  . ARG A 1 213 ? -0.392  45.339 -18.049 1.00 110.53 ? 205 ARG A CG  1 
ATOM   1286 C  CD  . ARG A 1 213 ? -1.660  46.134 -18.318 1.00 116.54 ? 205 ARG A CD  1 
ATOM   1287 N  NE  . ARG A 1 213 ? -1.671  46.708 -19.661 1.00 121.81 ? 205 ARG A NE  1 
ATOM   1288 C  CZ  . ARG A 1 213 ? -2.750  46.792 -20.431 1.00 131.49 ? 205 ARG A CZ  1 
ATOM   1289 N  NH1 . ARG A 1 213 ? -3.916  46.332 -19.996 1.00 127.23 ? 205 ARG A NH1 1 
ATOM   1290 N  NH2 . ARG A 1 213 ? -2.664  47.332 -21.639 1.00 123.02 ? 205 ARG A NH2 1 
ATOM   1291 N  N   . SER A 1 214 ? 0.976   43.288 -13.960 1.00 103.54 ? 206 SER A N   1 
ATOM   1292 C  CA  . SER A 1 214 ? 1.267   43.364 -12.533 1.00 103.43 ? 206 SER A CA  1 
ATOM   1293 C  C   . SER A 1 214 ? 2.689   42.907 -12.220 1.00 103.82 ? 206 SER A C   1 
ATOM   1294 O  O   . SER A 1 214 ? 3.266   43.295 -11.204 1.00 103.19 ? 206 SER A O   1 
ATOM   1295 C  CB  . SER A 1 214 ? 0.265   42.523 -11.740 1.00 106.73 ? 206 SER A CB  1 
ATOM   1296 O  OG  . SER A 1 214 ? 0.371   41.153 -12.084 1.00 111.09 ? 206 SER A OG  1 
ATOM   1297 N  N   . GLU A 1 215 ? 3.249   42.083 -13.100 1.00 99.67  ? 207 GLU A N   1 
ATOM   1298 C  CA  . GLU A 1 215 ? 4.562   41.489 -12.871 1.00 96.91  ? 207 GLU A CA  1 
ATOM   1299 C  C   . GLU A 1 215 ? 5.681   42.258 -13.564 1.00 99.03  ? 207 GLU A C   1 
ATOM   1300 O  O   . GLU A 1 215 ? 6.860   42.020 -13.300 1.00 98.10  ? 207 GLU A O   1 
ATOM   1301 C  CB  . GLU A 1 215 ? 4.577   40.036 -13.351 1.00 95.77  ? 207 GLU A CB  1 
ATOM   1302 C  CG  . GLU A 1 215 ? 3.482   39.162 -12.766 1.00 97.99  ? 207 GLU A CG  1 
ATOM   1303 C  CD  . GLU A 1 215 ? 3.503   37.756 -13.334 1.00 107.23 ? 207 GLU A CD  1 
ATOM   1304 O  OE1 . GLU A 1 215 ? 2.622   36.950 -12.969 1.00 101.38 ? 207 GLU A OE1 1 
ATOM   1305 O  OE2 . GLU A 1 215 ? 4.403   37.459 -14.148 1.00 107.19 ? 207 GLU A OE2 1 
ATOM   1306 N  N   . MET A 1 216 ? 5.308   43.181 -14.444 1.00 101.70 ? 208 MET A N   1 
ATOM   1307 C  CA  . MET A 1 216 ? 6.266   43.833 -15.333 1.00 102.84 ? 208 MET A CA  1 
ATOM   1308 C  C   . MET A 1 216 ? 7.300   44.694 -14.607 1.00 105.22 ? 208 MET A C   1 
ATOM   1309 O  O   . MET A 1 216 ? 8.375   44.960 -15.145 1.00 106.05 ? 208 MET A O   1 
ATOM   1310 C  CB  . MET A 1 216 ? 5.526   44.689 -16.365 1.00 106.38 ? 208 MET A CB  1 
ATOM   1311 C  CG  . MET A 1 216 ? 4.765   45.865 -15.778 1.00 109.83 ? 208 MET A CG  1 
ATOM   1312 S  SD  . MET A 1 216 ? 3.980   46.866 -17.057 1.00 115.30 ? 208 MET A SD  1 
ATOM   1313 C  CE  . MET A 1 216 ? 3.175   48.123 -16.068 1.00 114.80 ? 208 MET A CE  1 
ATOM   1314 N  N   . ASP A 1 217 ? 6.983   45.126 -13.391 1.00 104.22 ? 209 ASP A N   1 
ATOM   1315 C  CA  . ASP A 1 217 ? 7.894   45.986 -12.642 1.00 105.16 ? 209 ASP A CA  1 
ATOM   1316 C  C   . ASP A 1 217 ? 8.887   45.176 -11.812 1.00 104.24 ? 209 ASP A C   1 
ATOM   1317 O  O   . ASP A 1 217 ? 9.772   45.738 -11.165 1.00 105.21 ? 209 ASP A O   1 
ATOM   1318 C  CB  . ASP A 1 217 ? 7.109   46.941 -11.738 1.00 107.78 ? 209 ASP A CB  1 
ATOM   1319 C  CG  . ASP A 1 217 ? 6.060   46.230 -10.906 1.00 115.02 ? 209 ASP A CG  1 
ATOM   1320 O  OD1 . ASP A 1 217 ? 5.334   45.378 -11.461 1.00 115.40 ? 209 ASP A OD1 1 
ATOM   1321 O  OD2 . ASP A 1 217 ? 5.962   46.523 -9.695  1.00 118.00 ? 209 ASP A OD2 1 
ATOM   1322 N  N   . LYS A 1 218 ? 8.743   43.855 -11.844 1.00 99.74  ? 210 LYS A N   1 
ATOM   1323 C  CA  . LYS A 1 218 ? 9.624   42.970 -11.091 1.00 98.17  ? 210 LYS A CA  1 
ATOM   1324 C  C   . LYS A 1 218 ? 10.652  42.289 -11.990 1.00 100.86 ? 210 LYS A C   1 
ATOM   1325 O  O   . LYS A 1 218 ? 11.608  41.685 -11.502 1.00 101.49 ? 210 LYS A O   1 
ATOM   1326 C  CB  . LYS A 1 218 ? 8.814   41.904 -10.346 1.00 96.76  ? 210 LYS A CB  1 
ATOM   1327 C  CG  . LYS A 1 218 ? 8.071   42.402 -9.111  1.00 98.16  ? 210 LYS A CG  1 
ATOM   1328 C  CD  . LYS A 1 218 ? 6.735   43.038 -9.464  1.00 103.32 ? 210 LYS A CD  1 
ATOM   1329 C  CE  . LYS A 1 218 ? 5.961   43.420 -8.212  1.00 114.24 ? 210 LYS A CE  1 
ATOM   1330 N  NZ  . LYS A 1 218 ? 4.638   44.030 -8.530  1.00 125.20 ? 210 LYS A NZ  1 
ATOM   1331 N  N   . VAL A 1 219 ? 10.457  42.391 -13.301 1.00 97.95  ? 211 VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 219 ? 11.284  41.654 -14.249 1.00 99.27  ? 211 VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 219 ? 11.661  42.510 -15.461 1.00 105.11 ? 211 VAL A C   1 
ATOM   1334 O  O   . VAL A 1 219 ? 10.883  43.357 -15.902 1.00 105.27 ? 211 VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 219 ? 10.558  40.366 -14.719 1.00 99.63  ? 211 VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 219 ? 9.280   40.708 -15.473 1.00 98.87  ? 211 VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 219 ? 11.471  39.496 -15.567 1.00 101.14 ? 211 VAL A CG2 1 
ATOM   1338 N  N   . ARG A 1 220 ? 12.870  42.302 -15.976 1.00 105.40 ? 212 ARG A N   1 
ATOM   1339 C  CA  . ARG A 1 220 ? 13.308  42.935 -17.217 1.00 108.26 ? 212 ARG A CA  1 
ATOM   1340 C  C   . ARG A 1 220 ? 13.953  41.892 -18.128 1.00 113.07 ? 212 ARG A C   1 
ATOM   1341 O  O   . ARG A 1 220 ? 14.781  41.095 -17.686 1.00 113.95 ? 212 ARG A O   1 
ATOM   1342 C  CB  . ARG A 1 220 ? 14.284  44.081 -16.935 1.00 110.74 ? 212 ARG A CB  1 
ATOM   1343 C  CG  . ARG A 1 220 ? 14.746  44.824 -18.183 1.00 117.49 ? 212 ARG A CG  1 
ATOM   1344 C  CD  . ARG A 1 220 ? 15.645  46.010 -17.849 1.00 121.19 ? 212 ARG A CD  1 
ATOM   1345 N  NE  . ARG A 1 220 ? 14.950  47.038 -17.078 1.00 118.38 ? 212 ARG A NE  1 
ATOM   1346 C  CZ  . ARG A 1 220 ? 15.139  47.257 -15.781 1.00 123.01 ? 212 ARG A CZ  1 
ATOM   1347 N  NH1 . ARG A 1 220 ? 16.013  46.526 -15.105 1.00 114.63 ? 212 ARG A NH1 1 
ATOM   1348 N  NH2 . ARG A 1 220 ? 14.462  48.214 -15.162 1.00 115.81 ? 212 ARG A NH2 1 
ATOM   1349 N  N   . VAL A 1 221 ? 13.566  41.896 -19.400 1.00 109.90 ? 213 VAL A N   1 
ATOM   1350 C  CA  . VAL A 1 221 ? 14.038  40.888 -20.345 1.00 111.60 ? 213 VAL A CA  1 
ATOM   1351 C  C   . VAL A 1 221 ? 14.895  41.504 -21.449 1.00 118.05 ? 213 VAL A C   1 
ATOM   1352 O  O   . VAL A 1 221 ? 14.543  42.538 -22.018 1.00 118.71 ? 213 VAL A O   1 
ATOM   1353 C  CB  . VAL A 1 221 ? 12.857  40.128 -20.985 1.00 111.62 ? 213 VAL A CB  1 
ATOM   1354 C  CG1 . VAL A 1 221 ? 13.358  39.039 -21.924 1.00 113.64 ? 213 VAL A CG1 1 
ATOM   1355 C  CG2 . VAL A 1 221 ? 11.967  39.532 -19.905 1.00 107.83 ? 213 VAL A CG2 1 
ATOM   1356 N  N   . PHE A 1 222 ? 16.023  40.864 -21.745 1.00 113.25 ? 214 PHE A N   1 
ATOM   1357 C  CA  . PHE A 1 222 ? 16.912  41.324 -22.805 1.00 116.97 ? 214 PHE A CA  1 
ATOM   1358 C  C   . PHE A 1 222 ? 16.961  40.332 -23.961 1.00 121.97 ? 214 PHE A C   1 
ATOM   1359 O  O   . PHE A 1 222 ? 16.842  39.124 -23.758 1.00 120.91 ? 214 PHE A O   1 
ATOM   1360 C  CB  . PHE A 1 222 ? 18.326  41.549 -22.266 1.00 120.39 ? 214 PHE A CB  1 
ATOM   1361 C  CG  . PHE A 1 222 ? 18.417  42.622 -21.223 1.00 120.02 ? 214 PHE A CG  1 
ATOM   1362 C  CD1 . PHE A 1 222 ? 18.548  43.951 -21.588 1.00 123.12 ? 214 PHE A CD1 1 
ATOM   1363 C  CD2 . PHE A 1 222 ? 18.385  42.303 -19.876 1.00 119.03 ? 214 PHE A CD2 1 
ATOM   1364 C  CE1 . PHE A 1 222 ? 18.637  44.942 -20.630 1.00 123.29 ? 214 PHE A CE1 1 
ATOM   1365 C  CE2 . PHE A 1 222 ? 18.474  43.289 -18.913 1.00 120.01 ? 214 PHE A CE2 1 
ATOM   1366 C  CZ  . PHE A 1 222 ? 18.600  44.611 -19.292 1.00 120.60 ? 214 PHE A CZ  1 
ATOM   1367 N  N   . GLN A 1 223 ? 17.135  40.848 -25.173 1.00 122.40 ? 215 GLN A N   1 
ATOM   1368 C  CA  . GLN A 1 223 ? 17.332  40.002 -26.343 1.00 124.51 ? 215 GLN A CA  1 
ATOM   1369 C  C   . GLN A 1 223 ? 18.785  40.068 -26.791 1.00 130.56 ? 215 GLN A C   1 
ATOM   1370 O  O   . GLN A 1 223 ? 19.324  41.151 -27.020 1.00 132.07 ? 215 GLN A O   1 
ATOM   1371 C  CB  . GLN A 1 223 ? 16.404  40.419 -27.484 1.00 125.11 ? 215 GLN A CB  1 
ATOM   1372 C  CG  . GLN A 1 223 ? 16.595  39.613 -28.761 1.00 135.64 ? 215 GLN A CG  1 
ATOM   1373 C  CD  . GLN A 1 223 ? 15.700  40.086 -29.889 1.00 141.69 ? 215 GLN A CD  1 
ATOM   1374 O  OE1 . GLN A 1 223 ? 14.974  41.070 -29.750 1.00 137.13 ? 215 GLN A OE1 1 
ATOM   1375 N  NE2 . GLN A 1 223 ? 15.748  39.385 -31.016 1.00 135.83 ? 215 GLN A NE2 1 
ATOM   1376 N  N   . ALA A 1 224 ? 19.418  38.906 -26.911 1.00 131.61 ? 216 ALA A N   1 
ATOM   1377 C  CA  . ALA A 1 224 ? 20.829  38.840 -27.275 1.00 135.84 ? 216 ALA A CA  1 
ATOM   1378 C  C   . ALA A 1 224 ? 21.013  38.666 -28.778 1.00 141.95 ? 216 ALA A C   1 
ATOM   1379 O  O   . ALA A 1 224 ? 20.278  37.915 -29.421 1.00 141.70 ? 216 ALA A O   1 
ATOM   1380 C  CB  . ALA A 1 224 ? 21.512  37.709 -26.528 1.00 137.01 ? 216 ALA A CB  1 
ATOM   1381 N  N   . THR A 1 225 ? 22.003  39.361 -29.330 1.00 141.83 ? 217 THR A N   1 
ATOM   1382 C  CA  . THR A 1 225 ? 22.285  39.291 -30.759 1.00 144.33 ? 217 THR A CA  1 
ATOM   1383 C  C   . THR A 1 225 ? 23.682  38.732 -31.018 1.00 149.01 ? 217 THR A C   1 
ATOM   1384 O  O   . THR A 1 225 ? 24.672  39.228 -30.479 1.00 152.10 ? 217 THR A O   1 
ATOM   1385 C  CB  . THR A 1 225 ? 22.159  40.675 -31.425 1.00 146.67 ? 217 THR A CB  1 
ATOM   1386 O  OG1 . THR A 1 225 ? 20.896  41.258 -31.083 1.00 142.81 ? 217 THR A OG1 1 
ATOM   1387 C  CG2 . THR A 1 225 ? 22.264  40.555 -32.937 1.00 150.56 ? 217 THR A CG2 1 
ATOM   1388 N  N   . LYS A 1 232 ? 25.972  42.966 -27.024 1.00 153.05 ? 224 LYS A N   1 
ATOM   1389 C  CA  . LYS A 1 232 ? 24.861  43.120 -27.954 1.00 150.65 ? 224 LYS A CA  1 
ATOM   1390 C  C   . LYS A 1 232 ? 23.548  42.664 -27.324 1.00 149.13 ? 224 LYS A C   1 
ATOM   1391 O  O   . LYS A 1 232 ? 23.066  41.565 -27.598 1.00 147.65 ? 224 LYS A O   1 
ATOM   1392 C  CB  . LYS A 1 232 ? 25.128  42.335 -29.241 1.00 152.31 ? 224 LYS A CB  1 
ATOM   1393 N  N   . CYS A 1 233 ? 22.975  43.515 -26.476 1.00 153.69 ? 225 CYS A N   1 
ATOM   1394 C  CA  . CYS A 1 233 ? 21.714  43.206 -25.809 1.00 149.09 ? 225 CYS A CA  1 
ATOM   1395 C  C   . CYS A 1 233 ? 20.787  44.419 -25.786 1.00 149.02 ? 225 CYS A C   1 
ATOM   1396 O  O   . CYS A 1 233 ? 21.231  45.547 -25.567 1.00 150.76 ? 225 CYS A O   1 
ATOM   1397 C  CB  . CYS A 1 233 ? 21.967  42.713 -24.383 1.00 147.59 ? 225 CYS A CB  1 
ATOM   1398 S  SG  . CYS A 1 233 ? 22.895  41.164 -24.276 1.00 152.61 ? 225 CYS A SG  1 
ATOM   1399 N  N   . SER A 1 234 ? 19.500  44.181 -26.014 1.00 134.50 ? 226 SER A N   1 
ATOM   1400 C  CA  . SER A 1 234 ? 18.512  45.255 -26.016 1.00 132.96 ? 226 SER A CA  1 
ATOM   1401 C  C   . SER A 1 234 ? 17.269  44.856 -25.229 1.00 129.58 ? 226 SER A C   1 
ATOM   1402 O  O   . SER A 1 234 ? 16.940  43.674 -25.127 1.00 127.02 ? 226 SER A O   1 
ATOM   1403 C  CB  . SER A 1 234 ? 18.130  45.632 -27.449 1.00 137.71 ? 226 SER A CB  1 
ATOM   1404 O  OG  . SER A 1 234 ? 17.537  44.537 -28.125 1.00 142.47 ? 226 SER A OG  1 
ATOM   1405 N  N   . VAL A 1 235 ? 16.579  45.849 -24.678 1.00 130.10 ? 227 VAL A N   1 
ATOM   1406 C  CA  . VAL A 1 235 ? 15.408  45.603 -23.845 1.00 125.73 ? 227 VAL A CA  1 
ATOM   1407 C  C   . VAL A 1 235 ? 14.164  45.315 -24.678 1.00 126.44 ? 227 VAL A C   1 
ATOM   1408 O  O   . VAL A 1 235 ? 13.825  46.071 -25.589 1.00 128.45 ? 227 VAL A O   1 
ATOM   1409 C  CB  . VAL A 1 235 ? 15.117  46.802 -22.922 1.00 127.29 ? 227 VAL A CB  1 
ATOM   1410 C  CG1 . VAL A 1 235 ? 13.979  46.475 -21.968 1.00 123.12 ? 227 VAL A CG1 1 
ATOM   1411 C  CG2 . VAL A 1 235 ? 16.363  47.185 -22.150 1.00 128.44 ? 227 VAL A CG2 1 
ATOM   1412 N  N   . VAL A 1 236 ? 13.490  44.213 -24.362 1.00 122.88 ? 228 VAL A N   1 
ATOM   1413 C  CA  . VAL A 1 236 ? 12.220  43.885 -24.996 1.00 121.24 ? 228 VAL A CA  1 
ATOM   1414 C  C   . VAL A 1 236 ? 11.074  43.985 -23.992 1.00 119.28 ? 228 VAL A C   1 
ATOM   1415 O  O   . VAL A 1 236 ? 9.997   44.480 -24.318 1.00 119.39 ? 228 VAL A O   1 
ATOM   1416 C  CB  . VAL A 1 236 ? 12.240  42.472 -25.623 1.00 123.32 ? 228 VAL A CB  1 
ATOM   1417 C  CG1 . VAL A 1 236 ? 12.935  42.501 -26.975 1.00 127.14 ? 228 VAL A CG1 1 
ATOM   1418 C  CG2 . VAL A 1 236 ? 12.909  41.473 -24.688 1.00 122.16 ? 228 VAL A CG2 1 
ATOM   1419 N  N   . LEU A 1 237 ? 11.317  43.524 -22.768 1.00 114.07 ? 229 LEU A N   1 
ATOM   1420 C  CA  . LEU A 1 237 ? 10.304  43.565 -21.719 1.00 109.98 ? 229 LEU A CA  1 
ATOM   1421 C  C   . LEU A 1 237 ? 10.855  44.182 -20.439 1.00 110.79 ? 229 LEU A C   1 
ATOM   1422 O  O   . LEU A 1 237 ? 12.052  44.102 -20.164 1.00 112.31 ? 229 LEU A O   1 
ATOM   1423 C  CB  . LEU A 1 237 ? 9.768   42.160 -21.432 1.00 107.18 ? 229 LEU A CB  1 
ATOM   1424 C  CG  . LEU A 1 237 ? 9.024   41.455 -22.567 1.00 110.23 ? 229 LEU A CG  1 
ATOM   1425 C  CD1 . LEU A 1 237 ? 8.534   40.088 -22.118 1.00 107.79 ? 229 LEU A CD1 1 
ATOM   1426 C  CD2 . LEU A 1 237 ? 7.865   42.305 -23.057 1.00 112.69 ? 229 LEU A CD2 1 
ATOM   1427 N  N   . GLY A 1 238 ? 9.968   44.794 -19.661 1.00 108.74 ? 230 GLY A N   1 
ATOM   1428 C  CA  . GLY A 1 238 ? 10.342  45.430 -18.411 1.00 108.49 ? 230 GLY A CA  1 
ATOM   1429 C  C   . GLY A 1 238 ? 9.228   46.326 -17.905 1.00 111.39 ? 230 GLY A C   1 
ATOM   1430 O  O   . GLY A 1 238 ? 8.098   46.239 -18.388 1.00 111.22 ? 230 GLY A O   1 
ATOM   1431 N  N   . PRO A 1 239 ? 9.533   47.184 -16.919 1.00 108.63 ? 231 PRO A N   1 
ATOM   1432 C  CA  . PRO A 1 239 ? 8.558   48.167 -16.432 1.00 109.91 ? 231 PRO A CA  1 
ATOM   1433 C  C   . PRO A 1 239 ? 8.113   49.115 -17.543 1.00 117.32 ? 231 PRO A C   1 
ATOM   1434 O  O   . PRO A 1 239 ? 8.950   49.562 -18.331 1.00 119.29 ? 231 PRO A O   1 
ATOM   1435 C  CB  . PRO A 1 239 ? 9.328   48.919 -15.342 1.00 111.80 ? 231 PRO A CB  1 
ATOM   1436 C  CG  . PRO A 1 239 ? 10.383  47.960 -14.896 1.00 112.14 ? 231 PRO A CG  1 
ATOM   1437 C  CD  . PRO A 1 239 ? 10.778  47.205 -16.132 1.00 109.31 ? 231 PRO A CD  1 
ATOM   1438 N  N   . LYS A 1 240 ? 6.813   49.395 -17.601 1.00 117.80 ? 232 LYS A N   1 
ATOM   1439 C  CA  . LYS A 1 240 ? 6.221   50.262 -18.622 1.00 121.35 ? 232 LYS A CA  1 
ATOM   1440 C  C   . LYS A 1 240 ? 6.408   49.715 -20.039 1.00 125.74 ? 232 LYS A C   1 
ATOM   1441 O  O   . LYS A 1 240 ? 6.286   50.453 -21.019 1.00 128.08 ? 232 LYS A O   1 
ATOM   1442 C  CB  . LYS A 1 240 ? 6.797   51.680 -18.525 1.00 125.80 ? 232 LYS A CB  1 
ATOM   1443 N  N   . TRP A 1 241 ? 6.701   48.422 -20.140 1.00 118.80 ? 233 TRP A N   1 
ATOM   1444 C  CA  . TRP A 1 241 ? 6.822   47.749 -21.430 1.00 119.81 ? 233 TRP A CA  1 
ATOM   1445 C  C   . TRP A 1 241 ? 6.425   46.279 -21.302 1.00 116.10 ? 233 TRP A C   1 
ATOM   1446 O  O   . TRP A 1 241 ? 7.285   45.396 -21.312 1.00 114.14 ? 233 TRP A O   1 
ATOM   1447 C  CB  . TRP A 1 241 ? 8.248   47.869 -21.976 1.00 122.00 ? 233 TRP A CB  1 
ATOM   1448 C  CG  . TRP A 1 241 ? 8.335   48.627 -23.271 1.00 126.96 ? 233 TRP A CG  1 
ATOM   1449 C  CD1 . TRP A 1 241 ? 7.316   49.266 -23.917 1.00 130.40 ? 233 TRP A CD1 1 
ATOM   1450 C  CD2 . TRP A 1 241 ? 9.504   48.821 -24.080 1.00 129.71 ? 233 TRP A CD2 1 
ATOM   1451 N  NE1 . TRP A 1 241 ? 7.776   49.847 -25.074 1.00 133.58 ? 233 TRP A NE1 1 
ATOM   1452 C  CE2 . TRP A 1 241 ? 9.116   49.588 -25.198 1.00 135.10 ? 233 TRP A CE2 1 
ATOM   1453 C  CE3 . TRP A 1 241 ? 10.840  48.421 -23.967 1.00 131.12 ? 233 TRP A CE3 1 
ATOM   1454 C  CZ2 . TRP A 1 241 ? 10.015  49.963 -26.195 1.00 138.01 ? 233 TRP A CZ2 1 
ATOM   1455 C  CZ3 . TRP A 1 241 ? 11.731  48.796 -24.959 1.00 135.43 ? 233 TRP A CZ3 1 
ATOM   1456 C  CH2 . TRP A 1 241 ? 11.315  49.558 -26.057 1.00 138.55 ? 233 TRP A CH2 1 
ATOM   1457 N  N   . PRO A 1 242 ? 5.114   46.015 -21.185 1.00 106.28 ? 234 PRO A N   1 
ATOM   1458 C  CA  . PRO A 1 242 ? 4.596   44.664 -20.938 1.00 103.51 ? 234 PRO A CA  1 
ATOM   1459 C  C   . PRO A 1 242 ? 4.642   43.752 -22.161 1.00 105.61 ? 234 PRO A C   1 
ATOM   1460 O  O   . PRO A 1 242 ? 4.700   42.534 -22.003 1.00 103.55 ? 234 PRO A O   1 
ATOM   1461 C  CB  . PRO A 1 242 ? 3.148   44.924 -20.520 1.00 105.23 ? 234 PRO A CB  1 
ATOM   1462 C  CG  . PRO A 1 242 ? 2.780   46.168 -21.244 1.00 111.02 ? 234 PRO A CG  1 
ATOM   1463 C  CD  . PRO A 1 242 ? 4.030   47.010 -21.269 1.00 109.23 ? 234 PRO A CD  1 
ATOM   1464 N  N   . SER A 1 243 ? 4.610   44.329 -23.358 1.00 105.18 ? 235 SER A N   1 
ATOM   1465 C  CA  . SER A 1 243 ? 4.622   43.535 -24.583 1.00 105.47 ? 235 SER A CA  1 
ATOM   1466 C  C   . SER A 1 243 ? 5.593   44.099 -25.609 1.00 109.83 ? 235 SER A C   1 
ATOM   1467 O  O   . SER A 1 243 ? 5.949   45.276 -25.558 1.00 111.22 ? 235 SER A O   1 
ATOM   1468 C  CB  . SER A 1 243 ? 3.218   43.456 -25.183 1.00 108.31 ? 235 SER A CB  1 
ATOM   1469 O  OG  . SER A 1 243 ? 2.717   44.749 -25.472 1.00 115.36 ? 235 SER A OG  1 
ATOM   1470 N  N   . HIS A 1 244 ? 6.014   43.252 -26.543 1.00 113.31 ? 236 HIS A N   1 
ATOM   1471 C  CA  . HIS A 1 244 ? 6.947   43.666 -27.582 1.00 116.35 ? 236 HIS A CA  1 
ATOM   1472 C  C   . HIS A 1 244 ? 6.925   42.706 -28.767 1.00 120.76 ? 236 HIS A C   1 
ATOM   1473 O  O   . HIS A 1 244 ? 7.038   41.491 -28.596 1.00 119.05 ? 236 HIS A O   1 
ATOM   1474 C  CB  . HIS A 1 244 ? 8.365   43.766 -27.018 1.00 116.67 ? 236 HIS A CB  1 
ATOM   1475 C  CG  . HIS A 1 244 ? 9.272   44.650 -27.816 1.00 122.08 ? 236 HIS A CG  1 
ATOM   1476 N  ND1 . HIS A 1 244 ? 9.986   44.197 -28.904 1.00 125.24 ? 236 HIS A ND1 1 
ATOM   1477 C  CD2 . HIS A 1 244 ? 9.581   45.961 -27.682 1.00 125.23 ? 236 HIS A CD2 1 
ATOM   1478 C  CE1 . HIS A 1 244 ? 10.696  45.192 -29.407 1.00 128.14 ? 236 HIS A CE1 1 
ATOM   1479 N  NE2 . HIS A 1 244 ? 10.468  46.273 -28.684 1.00 128.29 ? 236 HIS A NE2 1 
ATOM   1480 N  N   . TYR A 1 245 ? 6.777   43.259 -29.967 1.00 121.87 ? 237 TYR A N   1 
ATOM   1481 C  CA  . TYR A 1 245 ? 6.802   42.466 -31.190 1.00 123.56 ? 237 TYR A CA  1 
ATOM   1482 C  C   . TYR A 1 245 ? 8.200   41.910 -31.442 1.00 127.19 ? 237 TYR A C   1 
ATOM   1483 O  O   . TYR A 1 245 ? 9.198   42.577 -31.171 1.00 128.12 ? 237 TYR A O   1 
ATOM   1484 C  CB  . TYR A 1 245 ? 6.340   43.304 -32.385 1.00 127.68 ? 237 TYR A CB  1 
ATOM   1485 C  CG  . TYR A 1 245 ? 4.845   43.536 -32.443 1.00 129.07 ? 237 TYR A CG  1 
ATOM   1486 C  CD1 . TYR A 1 245 ? 4.235   44.482 -31.630 1.00 129.28 ? 237 TYR A CD1 1 
ATOM   1487 C  CD2 . TYR A 1 245 ? 4.046   42.812 -33.319 1.00 131.27 ? 237 TYR A CD2 1 
ATOM   1488 C  CE1 . TYR A 1 245 ? 2.869   44.696 -31.683 1.00 130.63 ? 237 TYR A CE1 1 
ATOM   1489 C  CE2 . TYR A 1 245 ? 2.680   43.019 -33.380 1.00 132.63 ? 237 TYR A CE2 1 
ATOM   1490 C  CZ  . TYR A 1 245 ? 2.097   43.962 -32.560 1.00 135.81 ? 237 TYR A CZ  1 
ATOM   1491 O  OH  . TYR A 1 245 ? 0.738   44.170 -32.618 1.00 137.17 ? 237 TYR A OH  1 
ATOM   1492 N  N   . LEU A 1 246 ? 8.266   40.688 -31.960 1.00 121.15 ? 238 LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 246 ? 9.546   40.041 -32.230 1.00 123.05 ? 238 LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 246 ? 9.883   40.042 -33.717 1.00 131.05 ? 238 LEU A C   1 
ATOM   1495 O  O   . LEU A 1 246 ? 9.002   39.893 -34.564 1.00 132.44 ? 238 LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 246 ? 9.543   38.606 -31.700 1.00 120.75 ? 238 LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 246 ? 9.536   38.459 -30.179 1.00 119.51 ? 238 LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 246 ? 9.712   37.002 -29.785 1.00 118.36 ? 238 LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 246 ? 10.621  39.323 -29.554 1.00 121.13 ? 238 LEU A CD2 1 
ATOM   1500 N  N   . MET A 1 247 ? 11.163  40.211 -34.027 1.00 136.21 ? 239 MET A N   1 
ATOM   1501 C  CA  . MET A 1 247 ? 11.616  40.193 -35.411 1.00 140.40 ? 239 MET A CA  1 
ATOM   1502 C  C   . MET A 1 247 ? 12.409  38.923 -35.698 1.00 142.30 ? 239 MET A C   1 
ATOM   1503 O  O   . MET A 1 247 ? 13.623  38.871 -35.496 1.00 143.85 ? 239 MET A O   1 
ATOM   1504 C  CB  . MET A 1 247 ? 12.460  41.429 -35.722 1.00 145.42 ? 239 MET A CB  1 
ATOM   1505 C  CG  . MET A 1 247 ? 11.724  42.744 -35.510 1.00 147.54 ? 239 MET A CG  1 
ATOM   1506 S  SD  . MET A 1 247 ? 10.174  42.832 -36.427 1.00 148.40 ? 239 MET A SD  1 
ATOM   1507 C  CE  . MET A 1 247 ? 10.764  42.653 -38.110 1.00 151.20 ? 239 MET A CE  1 
ATOM   1508 N  N   . VAL A 1 248 ? 11.703  37.899 -36.164 1.00 134.85 ? 240 VAL A N   1 
ATOM   1509 C  CA  . VAL A 1 248 ? 12.309  36.614 -36.492 1.00 135.88 ? 240 VAL A CA  1 
ATOM   1510 C  C   . VAL A 1 248 ? 12.191  36.369 -37.996 1.00 141.41 ? 240 VAL A C   1 
ATOM   1511 O  O   . VAL A 1 248 ? 11.258  36.860 -38.629 1.00 141.89 ? 240 VAL A O   1 
ATOM   1512 C  CB  . VAL A 1 248 ? 11.636  35.462 -35.712 1.00 134.45 ? 240 VAL A CB  1 
ATOM   1513 C  CG1 . VAL A 1 248 ? 12.654  34.414 -35.312 1.00 135.31 ? 240 VAL A CG1 1 
ATOM   1514 C  CG2 . VAL A 1 248 ? 10.922  35.996 -34.481 1.00 130.59 ? 240 VAL A CG2 1 
ATOM   1515 N  N   . PRO A 1 249 ? 13.156  35.644 -38.584 1.00 132.58 ? 241 PRO A N   1 
ATOM   1516 C  CA  . PRO A 1 249 ? 13.010  35.265 -39.992 1.00 135.46 ? 241 PRO A CA  1 
ATOM   1517 C  C   . PRO A 1 249 ? 12.375  33.888 -40.162 1.00 137.32 ? 241 PRO A C   1 
ATOM   1518 O  O   . PRO A 1 249 ? 12.234  33.148 -39.189 1.00 134.88 ? 241 PRO A O   1 
ATOM   1519 C  CB  . PRO A 1 249 ? 14.451  35.263 -40.496 1.00 140.08 ? 241 PRO A CB  1 
ATOM   1520 C  CG  . PRO A 1 249 ? 15.238  34.842 -39.303 1.00 141.04 ? 241 PRO A CG  1 
ATOM   1521 C  CD  . PRO A 1 249 ? 14.530  35.421 -38.098 1.00 134.57 ? 241 PRO A CD  1 
ATOM   1522 N  N   . GLY A 1 250 ? 11.995  33.557 -41.392 1.00 137.21 ? 242 GLY A N   1 
ATOM   1523 C  CA  . GLY A 1 250 ? 11.463  32.241 -41.698 1.00 137.20 ? 242 GLY A CA  1 
ATOM   1524 C  C   . GLY A 1 250 ? 12.578  31.216 -41.763 1.00 141.61 ? 242 GLY A C   1 
ATOM   1525 O  O   . GLY A 1 250 ? 13.743  31.570 -41.943 1.00 143.86 ? 242 GLY A O   1 
ATOM   1526 N  N   . GLY A 1 251 ? 12.225  29.943 -41.618 1.00 134.97 ? 243 GLY A N   1 
ATOM   1527 C  CA  . GLY A 1 251 ? 13.210  28.877 -41.628 1.00 137.11 ? 243 GLY A CA  1 
ATOM   1528 C  C   . GLY A 1 251 ? 13.556  28.404 -40.230 1.00 137.35 ? 243 GLY A C   1 
ATOM   1529 O  O   . GLY A 1 251 ? 12.821  28.666 -39.276 1.00 133.24 ? 243 GLY A O   1 
ATOM   1530 N  N   . LYS A 1 252 ? 14.676  27.700 -40.109 1.00 131.36 ? 244 LYS A N   1 
ATOM   1531 C  CA  . LYS A 1 252 ? 15.156  27.246 -38.810 1.00 128.97 ? 244 LYS A CA  1 
ATOM   1532 C  C   . LYS A 1 252 ? 15.944  28.357 -38.122 1.00 131.16 ? 244 LYS A C   1 
ATOM   1533 O  O   . LYS A 1 252 ? 17.056  28.685 -38.536 1.00 133.35 ? 244 LYS A O   1 
ATOM   1534 C  CB  . LYS A 1 252 ? 16.020  25.992 -38.962 1.00 132.54 ? 244 LYS A CB  1 
ATOM   1535 N  N   . HIS A 1 253 ? 15.361  28.934 -37.075 1.00 134.88 ? 245 HIS A N   1 
ATOM   1536 C  CA  . HIS A 1 253 ? 15.986  30.048 -36.371 1.00 134.22 ? 245 HIS A CA  1 
ATOM   1537 C  C   . HIS A 1 253 ? 15.668  30.040 -34.875 1.00 132.23 ? 245 HIS A C   1 
ATOM   1538 O  O   . HIS A 1 253 ? 14.502  30.048 -34.475 1.00 128.76 ? 245 HIS A O   1 
ATOM   1539 C  CB  . HIS A 1 253 ? 15.543  31.375 -36.994 1.00 134.77 ? 245 HIS A CB  1 
ATOM   1540 C  CG  . HIS A 1 253 ? 16.160  32.582 -36.357 1.00 136.41 ? 245 HIS A CG  1 
ATOM   1541 N  ND1 . HIS A 1 253 ? 15.699  33.119 -35.174 1.00 133.94 ? 245 HIS A ND1 1 
ATOM   1542 C  CD2 . HIS A 1 253 ? 17.198  33.364 -36.742 1.00 140.30 ? 245 HIS A CD2 1 
ATOM   1543 C  CE1 . HIS A 1 253 ? 16.426  34.174 -34.855 1.00 134.21 ? 245 HIS A CE1 1 
ATOM   1544 N  NE2 . HIS A 1 253 ? 17.344  34.344 -35.791 1.00 138.30 ? 245 HIS A NE2 1 
ATOM   1545 N  N   . ASN A 1 254 ? 16.712  30.021 -34.052 1.00 134.84 ? 246 ASN A N   1 
ATOM   1546 C  CA  . ASN A 1 254 ? 16.554  30.124 -32.606 1.00 131.91 ? 246 ASN A CA  1 
ATOM   1547 C  C   . ASN A 1 254 ? 16.956  31.515 -32.121 1.00 132.90 ? 246 ASN A C   1 
ATOM   1548 O  O   . ASN A 1 254 ? 17.717  32.213 -32.791 1.00 135.06 ? 246 ASN A O   1 
ATOM   1549 C  CB  . ASN A 1 254 ? 17.379  29.050 -31.894 1.00 134.37 ? 246 ASN A CB  1 
ATOM   1550 C  CG  . ASN A 1 254 ? 18.869  29.228 -32.099 1.00 161.08 ? 246 ASN A CG  1 
ATOM   1551 O  OD1 . ASN A 1 254 ? 19.550  29.846 -31.279 1.00 160.01 ? 246 ASN A OD1 1 
ATOM   1552 N  ND2 . ASN A 1 254 ? 19.385  28.689 -33.198 1.00 161.79 ? 246 ASN A ND2 1 
ATOM   1553 N  N   . MET A 1 255 ? 16.444  31.913 -30.960 1.00 131.77 ? 247 MET A N   1 
ATOM   1554 C  CA  . MET A 1 255 ? 16.693  33.251 -30.430 1.00 130.30 ? 247 MET A CA  1 
ATOM   1555 C  C   . MET A 1 255 ? 16.893  33.217 -28.917 1.00 129.01 ? 247 MET A C   1 
ATOM   1556 O  O   . MET A 1 255 ? 16.115  32.592 -28.198 1.00 126.44 ? 247 MET A O   1 
ATOM   1557 C  CB  . MET A 1 255 ? 15.535  34.186 -30.790 1.00 129.48 ? 247 MET A CB  1 
ATOM   1558 C  CG  . MET A 1 255 ? 15.743  35.635 -30.382 1.00 131.17 ? 247 MET A CG  1 
ATOM   1559 S  SD  . MET A 1 255 ? 14.385  36.698 -30.912 1.00 131.98 ? 247 MET A SD  1 
ATOM   1560 C  CE  . MET A 1 255 ? 14.402  36.412 -32.680 1.00 133.45 ? 247 MET A CE  1 
ATOM   1561 N  N   . ASP A 1 256 ? 17.932  33.895 -28.435 1.00 122.43 ? 248 ASP A N   1 
ATOM   1562 C  CA  . ASP A 1 256 ? 18.251  33.890 -27.009 1.00 120.05 ? 248 ASP A CA  1 
ATOM   1563 C  C   . ASP A 1 256 ? 17.723  35.117 -26.270 1.00 117.93 ? 248 ASP A C   1 
ATOM   1564 O  O   . ASP A 1 256 ? 17.780  36.239 -26.775 1.00 117.95 ? 248 ASP A O   1 
ATOM   1565 C  CB  . ASP A 1 256 ? 19.764  33.785 -26.800 1.00 124.09 ? 248 ASP A CB  1 
ATOM   1566 C  CG  . ASP A 1 256 ? 20.303  32.406 -27.121 1.00 130.42 ? 248 ASP A CG  1 
ATOM   1567 O  OD1 . ASP A 1 256 ? 19.506  31.446 -27.145 1.00 129.26 ? 248 ASP A OD1 1 
ATOM   1568 O  OD2 . ASP A 1 256 ? 21.526  32.280 -27.342 1.00 136.00 ? 248 ASP A OD2 1 
ATOM   1569 N  N   . PHE A 1 257 ? 17.212  34.884 -25.065 1.00 117.87 ? 249 PHE A N   1 
ATOM   1570 C  CA  . PHE A 1 257 ? 16.762  35.957 -24.189 1.00 114.33 ? 249 PHE A CA  1 
ATOM   1571 C  C   . PHE A 1 257 ? 17.410  35.823 -22.817 1.00 116.02 ? 249 PHE A C   1 
ATOM   1572 O  O   . PHE A 1 257 ? 17.595  34.713 -22.315 1.00 116.18 ? 249 PHE A O   1 
ATOM   1573 C  CB  . PHE A 1 257 ? 15.239  35.948 -24.048 1.00 110.69 ? 249 PHE A CB  1 
ATOM   1574 C  CG  . PHE A 1 257 ? 14.506  36.169 -25.340 1.00 111.29 ? 249 PHE A CG  1 
ATOM   1575 C  CD1 . PHE A 1 257 ? 14.264  37.452 -25.803 1.00 112.69 ? 249 PHE A CD1 1 
ATOM   1576 C  CD2 . PHE A 1 257 ? 14.049  35.095 -26.085 1.00 112.48 ? 249 PHE A CD2 1 
ATOM   1577 C  CE1 . PHE A 1 257 ? 13.587  37.658 -26.989 1.00 113.43 ? 249 PHE A CE1 1 
ATOM   1578 C  CE2 . PHE A 1 257 ? 13.371  35.295 -27.271 1.00 114.18 ? 249 PHE A CE2 1 
ATOM   1579 C  CZ  . PHE A 1 257 ? 13.139  36.578 -27.722 1.00 113.10 ? 249 PHE A CZ  1 
ATOM   1580 N  N   . TYR A 1 258 ? 17.755  36.954 -22.213 1.00 112.82 ? 250 TYR A N   1 
ATOM   1581 C  CA  . TYR A 1 258 ? 18.305  36.957 -20.863 1.00 112.58 ? 250 TYR A CA  1 
ATOM   1582 C  C   . TYR A 1 258 ? 17.367  37.682 -19.905 1.00 110.54 ? 250 TYR A C   1 
ATOM   1583 O  O   . TYR A 1 258 ? 16.986  38.830 -20.138 1.00 109.45 ? 250 TYR A O   1 
ATOM   1584 C  CB  . TYR A 1 258 ? 19.695  37.595 -20.849 1.00 116.92 ? 250 TYR A CB  1 
ATOM   1585 C  CG  . TYR A 1 258 ? 20.754  36.732 -21.497 1.00 121.96 ? 250 TYR A CG  1 
ATOM   1586 C  CD1 . TYR A 1 258 ? 21.372  35.711 -20.788 1.00 123.84 ? 250 TYR A CD1 1 
ATOM   1587 C  CD2 . TYR A 1 258 ? 21.132  36.933 -22.819 1.00 125.21 ? 250 TYR A CD2 1 
ATOM   1588 C  CE1 . TYR A 1 258 ? 22.338  34.916 -21.374 1.00 127.74 ? 250 TYR A CE1 1 
ATOM   1589 C  CE2 . TYR A 1 258 ? 22.098  36.142 -23.413 1.00 129.23 ? 250 TYR A CE2 1 
ATOM   1590 C  CZ  . TYR A 1 258 ? 22.697  35.136 -22.686 1.00 135.58 ? 250 TYR A CZ  1 
ATOM   1591 O  OH  . TYR A 1 258 ? 23.659  34.347 -23.273 1.00 142.30 ? 250 TYR A OH  1 
ATOM   1592 N  N   . VAL A 1 259 ? 17.000  37.000 -18.824 1.00 109.80 ? 251 VAL A N   1 
ATOM   1593 C  CA  . VAL A 1 259 ? 15.997  37.502 -17.891 1.00 104.95 ? 251 VAL A CA  1 
ATOM   1594 C  C   . VAL A 1 259 ? 16.600  37.863 -16.531 1.00 105.84 ? 251 VAL A C   1 
ATOM   1595 O  O   . VAL A 1 259 ? 17.423  37.123 -15.993 1.00 108.07 ? 251 VAL A O   1 
ATOM   1596 C  CB  . VAL A 1 259 ? 14.873  36.463 -17.696 1.00 103.92 ? 251 VAL A CB  1 
ATOM   1597 C  CG1 . VAL A 1 259 ? 13.792  37.000 -16.777 1.00 99.33  ? 251 VAL A CG1 1 
ATOM   1598 C  CG2 . VAL A 1 259 ? 14.283  36.066 -19.042 1.00 104.24 ? 251 VAL A CG2 1 
ATOM   1599 N  N   . GLU A 1 260 ? 16.187  39.006 -15.985 1.00 103.42 ? 252 GLU A N   1 
ATOM   1600 C  CA  . GLU A 1 260 ? 16.626  39.439 -14.660 1.00 103.37 ? 252 GLU A CA  1 
ATOM   1601 C  C   . GLU A 1 260 ? 15.433  39.828 -13.785 1.00 101.67 ? 252 GLU A C   1 
ATOM   1602 O  O   . GLU A 1 260 ? 14.408  40.286 -14.292 1.00 99.32  ? 252 GLU A O   1 
ATOM   1603 C  CB  . GLU A 1 260 ? 17.601  40.618 -14.770 1.00 107.18 ? 252 GLU A CB  1 
ATOM   1604 C  CG  . GLU A 1 260 ? 17.000  41.877 -15.384 1.00 112.58 ? 252 GLU A CG  1 
ATOM   1605 C  CD  . GLU A 1 260 ? 17.935  43.073 -15.317 1.00 127.81 ? 252 GLU A CD  1 
ATOM   1606 O  OE1 . GLU A 1 260 ? 18.993  42.970 -14.662 1.00 126.09 ? 252 GLU A OE1 1 
ATOM   1607 O  OE2 . GLU A 1 260 ? 17.610  44.118 -15.920 1.00 126.73 ? 252 GLU A OE2 1 
ATOM   1608 N  N   . ALA A 1 261 ? 15.567  39.639 -12.474 1.00 95.66  ? 253 ALA A N   1 
ATOM   1609 C  CA  . ALA A 1 261 ? 14.526  40.047 -11.533 1.00 93.41  ? 253 ALA A CA  1 
ATOM   1610 C  C   . ALA A 1 261 ? 14.881  41.388 -10.901 1.00 96.03  ? 253 ALA A C   1 
ATOM   1611 O  O   . ALA A 1 261 ? 16.057  41.713 -10.740 1.00 99.10  ? 253 ALA A O   1 
ATOM   1612 C  CB  . ALA A 1 261 ? 14.325  38.992 -10.459 1.00 90.74  ? 253 ALA A CB  1 
ATOM   1613 N  N   . LEU A 1 262 ? 13.863  42.162 -10.538 1.00 96.85  ? 254 LEU A N   1 
ATOM   1614 C  CA  . LEU A 1 262 ? 14.085  43.503 -10.011 1.00 98.14  ? 254 LEU A CA  1 
ATOM   1615 C  C   . LEU A 1 262 ? 13.560  43.666 -8.584  1.00 100.15 ? 254 LEU A C   1 
ATOM   1616 O  O   . LEU A 1 262 ? 13.718  44.727 -7.978  1.00 101.64 ? 254 LEU A O   1 
ATOM   1617 C  CB  . LEU A 1 262 ? 13.431  44.545 -10.924 1.00 98.19  ? 254 LEU A CB  1 
ATOM   1618 C  CG  . LEU A 1 262 ? 13.609  44.365 -12.435 1.00 101.60 ? 254 LEU A CG  1 
ATOM   1619 C  CD1 . LEU A 1 262 ? 12.904  45.477 -13.198 1.00 102.53 ? 254 LEU A CD1 1 
ATOM   1620 C  CD2 . LEU A 1 262 ? 15.080  44.298 -12.819 1.00 105.46 ? 254 LEU A CD2 1 
ATOM   1621 N  N   . ALA A 1 263 ? 12.940  42.619 -8.048  1.00 93.93  ? 255 ALA A N   1 
ATOM   1622 C  CA  . ALA A 1 263 ? 12.336  42.701 -6.721  1.00 93.33  ? 255 ALA A CA  1 
ATOM   1623 C  C   . ALA A 1 263 ? 12.306  41.357 -5.996  1.00 95.10  ? 255 ALA A C   1 
ATOM   1624 O  O   . ALA A 1 263 ? 11.940  40.335 -6.577  1.00 93.41  ? 255 ALA A O   1 
ATOM   1625 C  CB  . ALA A 1 263 ? 10.927  43.265 -6.829  1.00 92.28  ? 255 ALA A CB  1 
ATOM   1626 N  N   . PHE A 1 264 ? 12.692  41.371 -4.723  1.00 90.78  ? 256 PHE A N   1 
ATOM   1627 C  CA  . PHE A 1 264 ? 12.587  40.193 -3.866  1.00 90.19  ? 256 PHE A CA  1 
ATOM   1628 C  C   . PHE A 1 264 ? 11.127  39.903 -3.528  1.00 89.62  ? 256 PHE A C   1 
ATOM   1629 O  O   . PHE A 1 264 ? 10.288  40.804 -3.574  1.00 89.50  ? 256 PHE A O   1 
ATOM   1630 C  CB  . PHE A 1 264 ? 13.390  40.388 -2.575  1.00 93.84  ? 256 PHE A CB  1 
ATOM   1631 C  CG  . PHE A 1 264 ? 14.842  40.020 -2.695  1.00 98.27  ? 256 PHE A CG  1 
ATOM   1632 C  CD1 . PHE A 1 264 ? 15.776  40.953 -3.114  1.00 101.73 ? 256 PHE A CD1 1 
ATOM   1633 C  CD2 . PHE A 1 264 ? 15.276  38.743 -2.376  1.00 101.63 ? 256 PHE A CD2 1 
ATOM   1634 C  CE1 . PHE A 1 264 ? 17.113  40.619 -3.221  1.00 106.95 ? 256 PHE A CE1 1 
ATOM   1635 C  CE2 . PHE A 1 264 ? 16.613  38.402 -2.480  1.00 106.03 ? 256 PHE A CE2 1 
ATOM   1636 C  CZ  . PHE A 1 264 ? 17.532  39.342 -2.904  1.00 107.50 ? 256 PHE A CZ  1 
ATOM   1637 N  N   . PRO A 1 265 ? 10.816  38.638 -3.201  1.00 86.49  ? 257 PRO A N   1 
ATOM   1638 C  CA  . PRO A 1 265 ? 9.470   38.289 -2.735  1.00 84.03  ? 257 PRO A CA  1 
ATOM   1639 C  C   . PRO A 1 265 ? 9.106   39.025 -1.451  1.00 86.90  ? 257 PRO A C   1 
ATOM   1640 O  O   . PRO A 1 265 ? 9.917   39.089 -0.528  1.00 88.34  ? 257 PRO A O   1 
ATOM   1641 C  CB  . PRO A 1 265 ? 9.562   36.781 -2.492  1.00 84.12  ? 257 PRO A CB  1 
ATOM   1642 C  CG  . PRO A 1 265 ? 10.653  36.325 -3.388  1.00 87.62  ? 257 PRO A CG  1 
ATOM   1643 C  CD  . PRO A 1 265 ? 11.654  37.443 -3.397  1.00 88.00  ? 257 PRO A CD  1 
ATOM   1644 N  N   . ASP A 1 266 ? 7.897   39.573 -1.400  1.00 88.91  ? 258 ASP A N   1 
ATOM   1645 C  CA  . ASP A 1 266 ? 7.448   40.329 -0.241  1.00 91.18  ? 258 ASP A CA  1 
ATOM   1646 C  C   . ASP A 1 266 ? 5.966   40.063 0.011   1.00 94.15  ? 258 ASP A C   1 
ATOM   1647 O  O   . ASP A 1 266 ? 5.406   39.094 -0.502  1.00 92.57  ? 258 ASP A O   1 
ATOM   1648 C  CB  . ASP A 1 266 ? 7.707   41.825 -0.449  1.00 94.15  ? 258 ASP A CB  1 
ATOM   1649 C  CG  . ASP A 1 266 ? 7.767   42.598 0.855   1.00 107.68 ? 258 ASP A CG  1 
ATOM   1650 O  OD1 . ASP A 1 266 ? 7.969   41.967 1.915   1.00 109.32 ? 258 ASP A OD1 1 
ATOM   1651 O  OD2 . ASP A 1 266 ? 7.612   43.837 0.819   1.00 114.69 ? 258 ASP A OD2 1 
ATOM   1652 N  N   . THR A 1 267 ? 5.337   40.925 0.801   1.00 98.12  ? 259 THR A N   1 
ATOM   1653 C  CA  . THR A 1 267 ? 3.920   40.797 1.111   1.00 100.28 ? 259 THR A CA  1 
ATOM   1654 C  C   . THR A 1 267 ? 3.050   41.135 -0.095  1.00 103.74 ? 259 THR A C   1 
ATOM   1655 O  O   . THR A 1 267 ? 1.862   40.812 -0.125  1.00 106.25 ? 259 THR A O   1 
ATOM   1656 C  CB  . THR A 1 267 ? 3.522   41.708 2.286   1.00 107.72 ? 259 THR A CB  1 
ATOM   1657 O  OG1 . THR A 1 267 ? 2.132   41.527 2.583   1.00 106.55 ? 259 THR A OG1 1 
ATOM   1658 C  CG2 . THR A 1 267 ? 3.778   43.168 1.938   1.00 113.58 ? 259 THR A CG2 1 
ATOM   1659 N  N   . ASP A 1 268 ? 3.644   41.787 -1.088  1.00 101.74 ? 260 ASP A N   1 
ATOM   1660 C  CA  . ASP A 1 268 ? 2.908   42.202 -2.275  1.00 101.57 ? 260 ASP A CA  1 
ATOM   1661 C  C   . ASP A 1 268 ? 3.416   41.487 -3.521  1.00 101.09 ? 260 ASP A C   1 
ATOM   1662 O  O   . ASP A 1 268 ? 3.010   41.804 -4.639  1.00 103.21 ? 260 ASP A O   1 
ATOM   1663 C  CB  . ASP A 1 268 ? 3.004   43.719 -2.459  1.00 103.48 ? 260 ASP A CB  1 
ATOM   1664 C  CG  . ASP A 1 268 ? 4.439   44.213 -2.511  1.00 112.02 ? 260 ASP A CG  1 
ATOM   1665 O  OD1 . ASP A 1 268 ? 5.319   43.556 -1.915  1.00 111.74 ? 260 ASP A OD1 1 
ATOM   1666 O  OD2 . ASP A 1 268 ? 4.685   45.261 -3.146  1.00 117.58 ? 260 ASP A OD2 1 
ATOM   1667 N  N   . PHE A 1 269 ? 4.302   40.516 -3.321  1.00 93.69  ? 261 PHE A N   1 
ATOM   1668 C  CA  . PHE A 1 269 ? 4.887   39.778 -4.433  1.00 90.22  ? 261 PHE A CA  1 
ATOM   1669 C  C   . PHE A 1 269 ? 5.306   38.376 -4.002  1.00 91.01  ? 261 PHE A C   1 
ATOM   1670 O  O   . PHE A 1 269 ? 6.373   38.195 -3.419  1.00 90.35  ? 261 PHE A O   1 
ATOM   1671 C  CB  . PHE A 1 269 ? 6.084   40.543 -5.004  1.00 90.04  ? 261 PHE A CB  1 
ATOM   1672 C  CG  . PHE A 1 269 ? 6.797   39.822 -6.113  1.00 88.46  ? 261 PHE A CG  1 
ATOM   1673 C  CD1 . PHE A 1 269 ? 6.097   39.319 -7.198  1.00 88.52  ? 261 PHE A CD1 1 
ATOM   1674 C  CD2 . PHE A 1 269 ? 8.172   39.664 -6.079  1.00 89.10  ? 261 PHE A CD2 1 
ATOM   1675 C  CE1 . PHE A 1 269 ? 6.756   38.659 -8.220  1.00 87.51  ? 261 PHE A CE1 1 
ATOM   1676 C  CE2 . PHE A 1 269 ? 8.836   39.008 -7.098  1.00 89.76  ? 261 PHE A CE2 1 
ATOM   1677 C  CZ  . PHE A 1 269 ? 8.127   38.505 -8.170  1.00 87.36  ? 261 PHE A CZ  1 
ATOM   1678 N  N   . PRO A 1 270 ? 4.453   37.378 -4.288  1.00 85.74  ? 262 PRO A N   1 
ATOM   1679 C  CA  . PRO A 1 270 ? 4.687   35.970 -3.944  1.00 84.45  ? 262 PRO A CA  1 
ATOM   1680 C  C   . PRO A 1 270 ? 6.003   35.433 -4.497  1.00 85.07  ? 262 PRO A C   1 
ATOM   1681 O  O   . PRO A 1 270 ? 6.619   34.566 -3.877  1.00 85.34  ? 262 PRO A O   1 
ATOM   1682 C  CB  . PRO A 1 270 ? 3.498   35.251 -4.587  1.00 85.91  ? 262 PRO A CB  1 
ATOM   1683 C  CG  . PRO A 1 270 ? 2.431   36.283 -4.650  1.00 91.58  ? 262 PRO A CG  1 
ATOM   1684 C  CD  . PRO A 1 270 ? 3.143   37.574 -4.932  1.00 88.54  ? 262 PRO A CD  1 
ATOM   1685 N  N   . GLY A 1 271 ? 6.418   35.936 -5.656  1.00 85.94  ? 263 GLY A N   1 
ATOM   1686 C  CA  . GLY A 1 271 ? 7.708   35.581 -6.217  1.00 85.23  ? 263 GLY A CA  1 
ATOM   1687 C  C   . GLY A 1 271 ? 7.652   34.816 -7.525  1.00 85.79  ? 263 GLY A C   1 
ATOM   1688 O  O   . GLY A 1 271 ? 8.612   34.134 -7.886  1.00 86.58  ? 263 GLY A O   1 
ATOM   1689 N  N   . LEU A 1 272 ? 6.539   34.926 -8.244  1.00 81.62  ? 264 LEU A N   1 
ATOM   1690 C  CA  . LEU A 1 272 ? 6.400   34.232 -9.521  1.00 81.17  ? 264 LEU A CA  1 
ATOM   1691 C  C   . LEU A 1 272 ? 6.295   35.195 -10.702 1.00 84.42  ? 264 LEU A C   1 
ATOM   1692 O  O   . LEU A 1 272 ? 5.602   36.210 -10.632 1.00 85.64  ? 264 LEU A O   1 
ATOM   1693 C  CB  . LEU A 1 272 ? 5.182   33.306 -9.500  1.00 80.58  ? 264 LEU A CB  1 
ATOM   1694 C  CG  . LEU A 1 272 ? 5.296   32.056 -8.626  1.00 82.07  ? 264 LEU A CG  1 
ATOM   1695 C  CD1 . LEU A 1 272 ? 4.068   31.174 -8.788  1.00 82.33  ? 264 LEU A CD1 1 
ATOM   1696 C  CD2 . LEU A 1 272 ? 6.563   31.278 -8.952  1.00 82.86  ? 264 LEU A CD2 1 
ATOM   1697 N  N   . ILE A 1 273 ? 7.000   34.863 -11.781 1.00 82.80  ? 265 ILE A N   1 
ATOM   1698 C  CA  . ILE A 1 273 ? 6.947   35.623 -13.027 1.00 83.90  ? 265 ILE A CA  1 
ATOM   1699 C  C   . ILE A 1 273 ? 6.596   34.691 -14.181 1.00 86.19  ? 265 ILE A C   1 
ATOM   1700 O  O   . ILE A 1 273 ? 7.156   33.601 -14.299 1.00 86.42  ? 265 ILE A O   1 
ATOM   1701 C  CB  . ILE A 1 273 ? 8.287   36.324 -13.335 1.00 87.17  ? 265 ILE A CB  1 
ATOM   1702 C  CG1 . ILE A 1 273 ? 8.780   37.119 -12.124 1.00 87.18  ? 265 ILE A CG1 1 
ATOM   1703 C  CG2 . ILE A 1 273 ? 8.150   37.231 -14.553 1.00 89.34  ? 265 ILE A CG2 1 
ATOM   1704 C  CD1 . ILE A 1 273 ? 7.911   38.305 -11.776 1.00 89.44  ? 265 ILE A CD1 1 
ATOM   1705 N  N   . THR A 1 274 ? 5.672   35.120 -15.034 1.00 85.17  ? 266 THR A N   1 
ATOM   1706 C  CA  . THR A 1 274 ? 5.228   34.285 -16.142 1.00 86.02  ? 266 THR A CA  1 
ATOM   1707 C  C   . THR A 1 274 ? 5.368   35.003 -17.481 1.00 92.94  ? 266 THR A C   1 
ATOM   1708 O  O   . THR A 1 274 ? 4.647   35.960 -17.760 1.00 94.71  ? 266 THR A O   1 
ATOM   1709 C  CB  . THR A 1 274 ? 3.765   33.847 -15.957 1.00 86.22  ? 266 THR A CB  1 
ATOM   1710 O  OG1 . THR A 1 274 ? 3.588   33.311 -14.640 1.00 87.37  ? 266 THR A OG1 1 
ATOM   1711 C  CG2 . THR A 1 274 ? 3.387   32.796 -16.990 1.00 82.72  ? 266 THR A CG2 1 
ATOM   1712 N  N   . LEU A 1 275 ? 6.300   34.533 -18.305 1.00 88.06  ? 267 LEU A N   1 
ATOM   1713 C  CA  . LEU A 1 275 ? 6.513   35.106 -19.631 1.00 89.39  ? 267 LEU A CA  1 
ATOM   1714 C  C   . LEU A 1 275 ? 5.769   34.291 -20.683 1.00 93.35  ? 267 LEU A C   1 
ATOM   1715 O  O   . LEU A 1 275 ? 5.691   33.068 -20.583 1.00 93.20  ? 267 LEU A O   1 
ATOM   1716 C  CB  . LEU A 1 275 ? 8.007   35.166 -19.952 1.00 90.40  ? 267 LEU A CB  1 
ATOM   1717 C  CG  . LEU A 1 275 ? 8.873   35.816 -18.870 1.00 91.63  ? 267 LEU A CG  1 
ATOM   1718 C  CD1 . LEU A 1 275 ? 10.331  35.864 -19.297 1.00 94.61  ? 267 LEU A CD1 1 
ATOM   1719 C  CD2 . LEU A 1 275 ? 8.365   37.209 -18.534 1.00 91.21  ? 267 LEU A CD2 1 
ATOM   1720 N  N   . THR A 1 276 ? 5.226   34.966 -21.691 1.00 91.73  ? 268 THR A N   1 
ATOM   1721 C  CA  . THR A 1 276 ? 4.377   34.299 -22.675 1.00 93.50  ? 268 THR A CA  1 
ATOM   1722 C  C   . THR A 1 276 ? 4.699   34.718 -24.107 1.00 98.65  ? 268 THR A C   1 
ATOM   1723 O  O   . THR A 1 276 ? 4.879   35.901 -24.397 1.00 99.39  ? 268 THR A O   1 
ATOM   1724 C  CB  . THR A 1 276 ? 2.883   34.581 -22.399 1.00 97.62  ? 268 THR A CB  1 
ATOM   1725 O  OG1 . THR A 1 276 ? 2.565   34.199 -21.056 1.00 95.47  ? 268 THR A OG1 1 
ATOM   1726 C  CG2 . THR A 1 276 ? 1.995   33.810 -23.365 1.00 97.92  ? 268 THR A CG2 1 
ATOM   1727 N  N   . ILE A 1 277 ? 4.776   33.734 -24.997 1.00 92.99  ? 269 ILE A N   1 
ATOM   1728 C  CA  . ILE A 1 277 ? 4.916   33.995 -26.422 1.00 95.36  ? 269 ILE A CA  1 
ATOM   1729 C  C   . ILE A 1 277 ? 3.555   33.785 -27.086 1.00 98.27  ? 269 ILE A C   1 
ATOM   1730 O  O   . ILE A 1 277 ? 2.765   32.952 -26.640 1.00 96.85  ? 269 ILE A O   1 
ATOM   1731 C  CB  . ILE A 1 277 ? 5.990   33.085 -27.070 1.00 99.06  ? 269 ILE A CB  1 
ATOM   1732 C  CG1 . ILE A 1 277 ? 6.380   33.604 -28.454 1.00 102.38 ? 269 ILE A CG1 1 
ATOM   1733 C  CG2 . ILE A 1 277 ? 5.521   31.638 -27.136 1.00 100.53 ? 269 ILE A CG2 1 
ATOM   1734 C  CD1 . ILE A 1 277 ? 6.988   34.982 -28.428 1.00 109.59 ? 269 ILE A CD1 1 
ATOM   1735 N  N   . SER A 1 278 ? 3.270   34.558 -28.130 1.00 96.57  ? 270 SER A N   1 
ATOM   1736 C  CA  . SER A 1 278 ? 1.982   34.465 -28.813 1.00 98.33  ? 270 SER A CA  1 
ATOM   1737 C  C   . SER A 1 278 ? 2.126   34.509 -30.331 1.00 103.70 ? 270 SER A C   1 
ATOM   1738 O  O   . SER A 1 278 ? 2.843   35.351 -30.873 1.00 104.46 ? 270 SER A O   1 
ATOM   1739 C  CB  . SER A 1 278 ? 1.049   35.588 -28.352 1.00 99.48  ? 270 SER A CB  1 
ATOM   1740 O  OG  . SER A 1 278 ? 0.680   35.427 -26.993 1.00 100.29 ? 270 SER A OG  1 
ATOM   1741 N  N   . LEU A 1 279 ? 1.436   33.599 -31.011 1.00 101.89 ? 271 LEU A N   1 
ATOM   1742 C  CA  . LEU A 1 279 ? 1.426   33.568 -32.470 1.00 104.75 ? 271 LEU A CA  1 
ATOM   1743 C  C   . LEU A 1 279 ? 0.149   34.207 -33.005 1.00 108.85 ? 271 LEU A C   1 
ATOM   1744 O  O   . LEU A 1 279 ? -0.954  33.749 -32.707 1.00 109.10 ? 271 LEU A O   1 
ATOM   1745 C  CB  . LEU A 1 279 ? 1.557   32.133 -32.980 1.00 105.81 ? 271 LEU A CB  1 
ATOM   1746 C  CG  . LEU A 1 279 ? 1.514   31.946 -34.498 1.00 111.87 ? 271 LEU A CG  1 
ATOM   1747 C  CD1 . LEU A 1 279 ? 2.608   32.760 -35.171 1.00 112.77 ? 271 LEU A CD1 1 
ATOM   1748 C  CD2 . LEU A 1 279 ? 1.638   30.474 -34.859 1.00 114.85 ? 271 LEU A CD2 1 
ATOM   1749 N  N   . LEU A 1 280 ? 0.301   35.264 -33.796 1.00 111.72 ? 272 LEU A N   1 
ATOM   1750 C  CA  . LEU A 1 280 ? -0.848  36.021 -34.281 1.00 114.12 ? 272 LEU A CA  1 
ATOM   1751 C  C   . LEU A 1 280 ? -1.028  35.914 -35.791 1.00 120.48 ? 272 LEU A C   1 
ATOM   1752 O  O   . LEU A 1 280 ? -0.055  35.841 -36.541 1.00 121.28 ? 272 LEU A O   1 
ATOM   1753 C  CB  . LEU A 1 280 ? -0.714  37.493 -33.882 1.00 113.59 ? 272 LEU A CB  1 
ATOM   1754 C  CG  . LEU A 1 280 ? -0.627  37.789 -32.384 1.00 112.84 ? 272 LEU A CG  1 
ATOM   1755 C  CD1 . LEU A 1 280 ? -0.283  39.249 -32.144 1.00 112.76 ? 272 LEU A CD1 1 
ATOM   1756 C  CD2 . LEU A 1 280 ? -1.932  37.428 -31.699 1.00 112.85 ? 272 LEU A CD2 1 
ATOM   1757 N  N   . ASP A 1 281 ? -2.284  35.906 -36.229 1.00 121.91 ? 273 ASP A N   1 
ATOM   1758 C  CA  . ASP A 1 281 ? -2.608  35.909 -37.651 1.00 125.46 ? 273 ASP A CA  1 
ATOM   1759 C  C   . ASP A 1 281 ? -2.973  37.327 -38.085 1.00 129.62 ? 273 ASP A C   1 
ATOM   1760 O  O   . ASP A 1 281 ? -3.861  37.952 -37.504 1.00 129.83 ? 273 ASP A O   1 
ATOM   1761 C  CB  . ASP A 1 281 ? -3.755  34.937 -37.946 1.00 127.99 ? 273 ASP A CB  1 
ATOM   1762 C  CG  . ASP A 1 281 ? -3.869  34.588 -39.421 1.00 136.48 ? 273 ASP A CG  1 
ATOM   1763 O  OD1 . ASP A 1 281 ? -3.660  35.478 -40.272 1.00 137.99 ? 273 ASP A OD1 1 
ATOM   1764 O  OD2 . ASP A 1 281 ? -4.168  33.415 -39.731 1.00 141.79 ? 273 ASP A OD2 1 
ATOM   1765 N  N   . THR A 1 282 ? -2.283  37.831 -39.103 1.00 127.82 ? 274 THR A N   1 
ATOM   1766 C  CA  . THR A 1 282 ? -2.499  39.197 -39.572 1.00 129.52 ? 274 THR A CA  1 
ATOM   1767 C  C   . THR A 1 282 ? -2.743  39.261 -41.078 1.00 135.01 ? 274 THR A C   1 
ATOM   1768 O  O   . THR A 1 282 ? -2.422  40.259 -41.724 1.00 136.68 ? 274 THR A O   1 
ATOM   1769 C  CB  . THR A 1 282 ? -1.300  40.101 -39.228 1.00 134.06 ? 274 THR A CB  1 
ATOM   1770 O  OG1 . THR A 1 282 ? -0.097  39.515 -39.740 1.00 135.76 ? 274 THR A OG1 1 
ATOM   1771 C  CG2 . THR A 1 282 ? -1.172  40.271 -37.722 1.00 129.24 ? 274 THR A CG2 1 
ATOM   1772 N  N   . SER A 1 283 ? -3.315  38.196 -41.631 1.00 135.87 ? 275 SER A N   1 
ATOM   1773 C  CA  . SER A 1 283 ? -3.575  38.121 -43.066 1.00 139.28 ? 275 SER A CA  1 
ATOM   1774 C  C   . SER A 1 283 ? -4.648  39.116 -43.500 1.00 143.88 ? 275 SER A C   1 
ATOM   1775 O  O   . SER A 1 283 ? -4.638  39.600 -44.632 1.00 147.47 ? 275 SER A O   1 
ATOM   1776 C  CB  . SER A 1 283 ? -3.989  36.702 -43.460 1.00 142.08 ? 275 SER A CB  1 
ATOM   1777 O  OG  . SER A 1 283 ? -5.168  36.309 -42.778 1.00 146.84 ? 275 SER A OG  1 
ATOM   1778 N  N   . ASN A 1 284 ? -5.576  39.411 -42.595 1.00 141.55 ? 276 ASN A N   1 
ATOM   1779 C  CA  . ASN A 1 284 ? -6.615  40.398 -42.858 1.00 143.39 ? 276 ASN A CA  1 
ATOM   1780 C  C   . ASN A 1 284 ? -6.169  41.786 -42.416 1.00 144.09 ? 276 ASN A C   1 
ATOM   1781 O  O   . ASN A 1 284 ? -6.035  42.055 -41.222 1.00 141.19 ? 276 ASN A O   1 
ATOM   1782 C  CB  . ASN A 1 284 ? -7.917  40.012 -42.155 1.00 142.88 ? 276 ASN A CB  1 
ATOM   1783 N  N   . LEU A 1 285 ? -5.939  42.662 -43.389 1.00 149.57 ? 277 LEU A N   1 
ATOM   1784 C  CA  . LEU A 1 285 ? -5.418  43.998 -43.127 1.00 149.32 ? 277 LEU A CA  1 
ATOM   1785 C  C   . LEU A 1 285 ? -6.386  44.843 -42.302 1.00 150.59 ? 277 LEU A C   1 
ATOM   1786 O  O   . LEU A 1 285 ? -5.972  45.591 -41.416 1.00 148.99 ? 277 LEU A O   1 
ATOM   1787 C  CB  . LEU A 1 285 ? -5.107  44.711 -44.445 1.00 153.26 ? 277 LEU A CB  1 
ATOM   1788 C  CG  . LEU A 1 285 ? -3.831  45.552 -44.494 1.00 156.35 ? 277 LEU A CG  1 
ATOM   1789 C  CD1 . LEU A 1 285 ? -2.606  44.655 -44.443 1.00 154.02 ? 277 LEU A CD1 1 
ATOM   1790 C  CD2 . LEU A 1 285 ? -3.807  46.426 -45.737 1.00 161.89 ? 277 LEU A CD2 1 
ATOM   1791 N  N   . GLU A 1 286 ? -7.676  44.715 -42.597 1.00 149.52 ? 278 GLU A N   1 
ATOM   1792 C  CA  . GLU A 1 286 ? -8.699  45.541 -41.963 1.00 151.21 ? 278 GLU A CA  1 
ATOM   1793 C  C   . GLU A 1 286 ? -9.095  45.026 -40.581 1.00 147.14 ? 278 GLU A C   1 
ATOM   1794 O  O   . GLU A 1 286 ? -9.484  45.802 -39.708 1.00 146.48 ? 278 GLU A O   1 
ATOM   1795 C  CB  . GLU A 1 286 ? -9.938  45.626 -42.863 1.00 163.23 ? 278 GLU A CB  1 
ATOM   1796 C  CG  . GLU A 1 286 ? -10.702 44.313 -43.046 1.00 161.67 ? 278 GLU A CG  1 
ATOM   1797 C  CD  . GLU A 1 286 ? -10.035 43.341 -44.010 1.00 161.20 ? 278 GLU A CD  1 
ATOM   1798 O  OE1 . GLU A 1 286 ? -8.798  43.400 -44.182 1.00 159.91 ? 278 GLU A OE1 1 
ATOM   1799 O  OE2 . GLU A 1 286 ? -10.757 42.512 -44.605 1.00 162.55 ? 278 GLU A OE2 1 
ATOM   1800 N  N   . LEU A 1 287 ? -8.995  43.717 -40.386 1.00 146.65 ? 279 LEU A N   1 
ATOM   1801 C  CA  . LEU A 1 287 ? -9.401  43.101 -39.130 1.00 143.66 ? 279 LEU A CA  1 
ATOM   1802 C  C   . LEU A 1 287 ? -8.244  43.060 -38.136 1.00 143.29 ? 279 LEU A C   1 
ATOM   1803 O  O   . LEU A 1 287 ? -7.091  42.883 -38.529 1.00 142.50 ? 279 LEU A O   1 
ATOM   1804 C  CB  . LEU A 1 287 ? -9.936  41.690 -39.383 1.00 143.21 ? 279 LEU A CB  1 
ATOM   1805 C  CG  . LEU A 1 287 ? -11.120 41.580 -40.346 1.00 148.24 ? 279 LEU A CG  1 
ATOM   1806 C  CD1 . LEU A 1 287 ? -11.419 40.123 -40.666 1.00 147.83 ? 279 LEU A CD1 1 
ATOM   1807 C  CD2 . LEU A 1 287 ? -12.348 42.267 -39.768 1.00 149.80 ? 279 LEU A CD2 1 
ATOM   1808 N  N   . PRO A 1 288 ? -8.550  43.229 -36.839 1.00 138.81 ? 280 PRO A N   1 
ATOM   1809 C  CA  . PRO A 1 288 ? -7.530  43.166 -35.785 1.00 135.97 ? 280 PRO A CA  1 
ATOM   1810 C  C   . PRO A 1 288 ? -6.844  41.802 -35.719 1.00 136.91 ? 280 PRO A C   1 
ATOM   1811 O  O   . PRO A 1 288 ? -7.382  40.819 -36.230 1.00 137.67 ? 280 PRO A O   1 
ATOM   1812 C  CB  . PRO A 1 288 ? -8.326  43.441 -34.503 1.00 135.92 ? 280 PRO A CB  1 
ATOM   1813 C  CG  . PRO A 1 288 ? -9.742  43.127 -34.850 1.00 139.74 ? 280 PRO A CG  1 
ATOM   1814 C  CD  . PRO A 1 288 ? -9.890  43.500 -36.292 1.00 140.99 ? 280 PRO A CD  1 
ATOM   1815 N  N   . GLU A 1 289 ? -5.670  41.755 -35.096 1.00 125.60 ? 281 GLU A N   1 
ATOM   1816 C  CA  . GLU A 1 289 ? -4.873  40.533 -35.032 1.00 123.73 ? 281 GLU A CA  1 
ATOM   1817 C  C   . GLU A 1 289 ? -5.586  39.418 -34.273 1.00 124.39 ? 281 GLU A C   1 
ATOM   1818 O  O   . GLU A 1 289 ? -6.166  39.647 -33.212 1.00 123.57 ? 281 GLU A O   1 
ATOM   1819 C  CB  . GLU A 1 289 ? -3.517  40.820 -34.383 1.00 116.99 ? 281 GLU A CB  1 
ATOM   1820 N  N   . ALA A 1 290 ? -5.537  38.211 -34.828 1.00 118.26 ? 282 ALA A N   1 
ATOM   1821 C  CA  . ALA A 1 290 ? -6.167  37.050 -34.210 1.00 117.16 ? 282 ALA A CA  1 
ATOM   1822 C  C   . ALA A 1 290 ? -5.119  36.108 -33.629 1.00 117.23 ? 282 ALA A C   1 
ATOM   1823 O  O   . ALA A 1 290 ? -4.081  35.868 -34.243 1.00 117.09 ? 282 ALA A O   1 
ATOM   1824 C  CB  . ALA A 1 290 ? -7.037  36.318 -35.219 1.00 120.04 ? 282 ALA A CB  1 
ATOM   1825 N  N   . VAL A 1 291 ? -5.399  35.573 -32.446 1.00 112.16 ? 283 VAL A N   1 
ATOM   1826 C  CA  . VAL A 1 291 ? -4.462  34.687 -31.765 1.00 109.27 ? 283 VAL A CA  1 
ATOM   1827 C  C   . VAL A 1 291 ? -4.591  33.255 -32.271 1.00 111.89 ? 283 VAL A C   1 
ATOM   1828 O  O   . VAL A 1 291 ? -5.697  32.743 -32.437 1.00 113.35 ? 283 VAL A O   1 
ATOM   1829 C  CB  . VAL A 1 291 ? -4.678  34.709 -30.242 1.00 108.99 ? 283 VAL A CB  1 
ATOM   1830 C  CG1 . VAL A 1 291 ? -3.588  33.919 -29.536 1.00 105.82 ? 283 VAL A CG1 1 
ATOM   1831 C  CG2 . VAL A 1 291 ? -4.703  36.139 -29.743 1.00 108.81 ? 283 VAL A CG2 1 
ATOM   1832 N  N   . VAL A 1 292 ? -3.452  32.615 -32.515 1.00 104.90 ? 284 VAL A N   1 
ATOM   1833 C  CA  . VAL A 1 292 ? -3.434  31.247 -33.016 1.00 104.94 ? 284 VAL A CA  1 
ATOM   1834 C  C   . VAL A 1 292 ? -2.801  30.290 -32.007 1.00 103.45 ? 284 VAL A C   1 
ATOM   1835 O  O   . VAL A 1 292 ? -3.226  29.140 -31.879 1.00 103.44 ? 284 VAL A O   1 
ATOM   1836 C  CB  . VAL A 1 292 ? -2.667  31.148 -34.350 1.00 108.86 ? 284 VAL A CB  1 
ATOM   1837 C  CG1 . VAL A 1 292 ? -2.901  29.793 -35.001 1.00 110.85 ? 284 VAL A CG1 1 
ATOM   1838 C  CG2 . VAL A 1 292 ? -3.085  32.269 -35.287 1.00 111.02 ? 284 VAL A CG2 1 
ATOM   1839 N  N   . PHE A 1 293 ? -1.791  30.769 -31.287 1.00 100.19 ? 285 PHE A N   1 
ATOM   1840 C  CA  . PHE A 1 293 ? -1.033  29.914 -30.380 1.00 98.25  ? 285 PHE A CA  1 
ATOM   1841 C  C   . PHE A 1 293 ? -0.335  30.702 -29.271 1.00 97.39  ? 285 PHE A C   1 
ATOM   1842 O  O   . PHE A 1 293 ? 0.183   31.796 -29.503 1.00 97.16  ? 285 PHE A O   1 
ATOM   1843 C  CB  . PHE A 1 293 ? -0.004  29.103 -31.174 1.00 99.94  ? 285 PHE A CB  1 
ATOM   1844 C  CG  . PHE A 1 293 ? 0.927   28.290 -30.318 1.00 98.53  ? 285 PHE A CG  1 
ATOM   1845 C  CD1 . PHE A 1 293 ? 0.521   27.079 -29.784 1.00 99.42  ? 285 PHE A CD1 1 
ATOM   1846 C  CD2 . PHE A 1 293 ? 2.216   28.731 -30.062 1.00 97.57  ? 285 PHE A CD2 1 
ATOM   1847 C  CE1 . PHE A 1 293 ? 1.378   26.327 -29.002 1.00 98.48  ? 285 PHE A CE1 1 
ATOM   1848 C  CE2 . PHE A 1 293 ? 3.077   27.985 -29.281 1.00 97.75  ? 285 PHE A CE2 1 
ATOM   1849 C  CZ  . PHE A 1 293 ? 2.658   26.781 -28.750 1.00 96.80  ? 285 PHE A CZ  1 
ATOM   1850 N  N   . GLN A 1 294 ? -0.328  30.134 -28.067 1.00 95.40  ? 286 GLN A N   1 
ATOM   1851 C  CA  . GLN A 1 294 ? 0.362   30.731 -26.926 1.00 92.04  ? 286 GLN A CA  1 
ATOM   1852 C  C   . GLN A 1 294 ? 1.167   29.692 -26.148 1.00 93.23  ? 286 GLN A C   1 
ATOM   1853 O  O   . GLN A 1 294 ? 0.739   28.547 -26.000 1.00 93.55  ? 286 GLN A O   1 
ATOM   1854 C  CB  . GLN A 1 294 ? -0.632  31.413 -25.984 1.00 91.73  ? 286 GLN A CB  1 
ATOM   1855 C  CG  . GLN A 1 294 ? -1.125  32.769 -26.456 1.00 97.28  ? 286 GLN A CG  1 
ATOM   1856 C  CD  . GLN A 1 294 ? -1.948  33.486 -25.402 1.00 105.42 ? 286 GLN A CD  1 
ATOM   1857 O  OE1 . GLN A 1 294 ? -2.808  32.888 -24.754 1.00 97.95  ? 286 GLN A OE1 1 
ATOM   1858 N  NE2 . GLN A 1 294 ? -1.681  34.774 -25.219 1.00 107.38 ? 286 GLN A NE2 1 
ATOM   1859 N  N   . ASP A 1 295 ? 2.331   30.100 -25.651 1.00 96.88  ? 287 ASP A N   1 
ATOM   1860 C  CA  . ASP A 1 295 ? 3.155   29.233 -24.813 1.00 95.84  ? 287 ASP A CA  1 
ATOM   1861 C  C   . ASP A 1 295 ? 3.869   30.059 -23.746 1.00 94.32  ? 287 ASP A C   1 
ATOM   1862 O  O   . ASP A 1 295 ? 4.245   31.207 -23.986 1.00 92.94  ? 287 ASP A O   1 
ATOM   1863 C  CB  . ASP A 1 295 ? 4.168   28.461 -25.658 1.00 100.17 ? 287 ASP A CB  1 
ATOM   1864 C  CG  . ASP A 1 295 ? 4.812   27.319 -24.895 1.00 110.57 ? 287 ASP A CG  1 
ATOM   1865 O  OD1 . ASP A 1 295 ? 4.141   26.741 -24.014 1.00 109.47 ? 287 ASP A OD1 1 
ATOM   1866 O  OD2 . ASP A 1 295 ? 5.987   26.999 -25.174 1.00 117.52 ? 287 ASP A OD2 1 
ATOM   1867 N  N   . SER A 1 296 ? 4.059   29.473 -22.568 1.00 91.62  ? 288 SER A N   1 
ATOM   1868 C  CA  . SER A 1 296 ? 4.580   30.226 -21.434 1.00 89.40  ? 288 SER A CA  1 
ATOM   1869 C  C   . SER A 1 296 ? 5.655   29.489 -20.640 1.00 91.41  ? 288 SER A C   1 
ATOM   1870 O  O   . SER A 1 296 ? 5.787   28.268 -20.723 1.00 93.28  ? 288 SER A O   1 
ATOM   1871 C  CB  . SER A 1 296 ? 3.434   30.608 -20.494 1.00 89.92  ? 288 SER A CB  1 
ATOM   1872 O  OG  . SER A 1 296 ? 2.415   31.306 -21.189 1.00 97.70  ? 288 SER A OG  1 
ATOM   1873 N  N   . VAL A 1 297 ? 6.422   30.259 -19.874 1.00 87.58  ? 289 VAL A N   1 
ATOM   1874 C  CA  . VAL A 1 297 ? 7.382   29.719 -18.919 1.00 87.13  ? 289 VAL A CA  1 
ATOM   1875 C  C   . VAL A 1 297 ? 7.263   30.483 -17.603 1.00 86.44  ? 289 VAL A C   1 
ATOM   1876 O  O   . VAL A 1 297 ? 7.105   31.705 -17.598 1.00 86.10  ? 289 VAL A O   1 
ATOM   1877 C  CB  . VAL A 1 297 ? 8.831   29.798 -19.444 1.00 92.19  ? 289 VAL A CB  1 
ATOM   1878 C  CG1 . VAL A 1 297 ? 9.059   28.765 -20.537 1.00 95.43  ? 289 VAL A CG1 1 
ATOM   1879 C  CG2 . VAL A 1 297 ? 9.146   31.199 -19.948 1.00 92.17  ? 289 VAL A CG2 1 
ATOM   1880 N  N   . VAL A 1 298 ? 7.328   29.764 -16.487 1.00 83.40  ? 290 VAL A N   1 
ATOM   1881 C  CA  . VAL A 1 298 ? 7.138   30.388 -15.181 1.00 80.54  ? 290 VAL A CA  1 
ATOM   1882 C  C   . VAL A 1 298 ? 8.426   30.421 -14.366 1.00 83.80  ? 290 VAL A C   1 
ATOM   1883 O  O   . VAL A 1 298 ? 8.993   29.379 -14.035 1.00 85.81  ? 290 VAL A O   1 
ATOM   1884 C  CB  . VAL A 1 298 ? 6.052   29.666 -14.365 1.00 80.61  ? 290 VAL A CB  1 
ATOM   1885 C  CG1 . VAL A 1 298 ? 5.817   30.385 -13.047 1.00 78.69  ? 290 VAL A CG1 1 
ATOM   1886 C  CG2 . VAL A 1 298 ? 4.761   29.581 -15.162 1.00 80.83  ? 290 VAL A CG2 1 
ATOM   1887 N  N   . PHE A 1 299 ? 8.880   31.628 -14.044 1.00 79.95  ? 291 PHE A N   1 
ATOM   1888 C  CA  . PHE A 1 299 ? 10.072  31.811 -13.225 1.00 81.39  ? 291 PHE A CA  1 
ATOM   1889 C  C   . PHE A 1 299 ? 9.707   32.064 -11.768 1.00 81.91  ? 291 PHE A C   1 
ATOM   1890 O  O   . PHE A 1 299 ? 8.688   32.689 -11.473 1.00 80.30  ? 291 PHE A O   1 
ATOM   1891 C  CB  . PHE A 1 299 ? 10.916  32.975 -13.752 1.00 84.19  ? 291 PHE A CB  1 
ATOM   1892 C  CG  . PHE A 1 299 ? 11.610  32.687 -15.052 1.00 88.16  ? 291 PHE A CG  1 
ATOM   1893 C  CD1 . PHE A 1 299 ? 10.964  32.894 -16.260 1.00 88.95  ? 291 PHE A CD1 1 
ATOM   1894 C  CD2 . PHE A 1 299 ? 12.914  32.220 -15.066 1.00 93.43  ? 291 PHE A CD2 1 
ATOM   1895 C  CE1 . PHE A 1 299 ? 11.603  32.632 -17.457 1.00 92.60  ? 291 PHE A CE1 1 
ATOM   1896 C  CE2 . PHE A 1 299 ? 13.559  31.958 -16.260 1.00 98.38  ? 291 PHE A CE2 1 
ATOM   1897 C  CZ  . PHE A 1 299 ? 12.902  32.164 -17.458 1.00 96.25  ? 291 PHE A CZ  1 
ATOM   1898 N  N   . ARG A 1 300 ? 10.542  31.575 -10.859 1.00 82.11  ? 292 ARG A N   1 
ATOM   1899 C  CA  . ARG A 1 300 ? 10.393  31.895 -9.446  1.00 80.25  ? 292 ARG A CA  1 
ATOM   1900 C  C   . ARG A 1 300 ? 11.598  32.685 -8.963  1.00 85.71  ? 292 ARG A C   1 
ATOM   1901 O  O   . ARG A 1 300 ? 12.742  32.281 -9.171  1.00 89.47  ? 292 ARG A O   1 
ATOM   1902 C  CB  . ARG A 1 300 ? 10.217  30.630 -8.607  1.00 78.24  ? 292 ARG A CB  1 
ATOM   1903 C  CG  . ARG A 1 300 ? 10.291  30.863 -7.106  1.00 80.81  ? 292 ARG A CG  1 
ATOM   1904 C  CD  . ARG A 1 300 ? 9.235   30.056 -6.368  1.00 84.42  ? 292 ARG A CD  1 
ATOM   1905 N  NE  . ARG A 1 300 ? 8.273   30.922 -5.692  1.00 85.09  ? 292 ARG A NE  1 
ATOM   1906 C  CZ  . ARG A 1 300 ? 7.023   30.573 -5.407  1.00 91.52  ? 292 ARG A CZ  1 
ATOM   1907 N  NH1 . ARG A 1 300 ? 6.573   29.372 -5.745  1.00 86.76  ? 292 ARG A NH1 1 
ATOM   1908 N  NH2 . ARG A 1 300 ? 6.218   31.427 -4.789  1.00 82.76  ? 292 ARG A NH2 1 
ATOM   1909 N  N   . VAL A 1 301 ? 11.333  33.817 -8.324  1.00 84.68  ? 293 VAL A N   1 
ATOM   1910 C  CA  . VAL A 1 301 ? 12.393  34.670 -7.810  1.00 86.67  ? 293 VAL A CA  1 
ATOM   1911 C  C   . VAL A 1 301 ? 13.015  34.061 -6.556  1.00 94.52  ? 293 VAL A C   1 
ATOM   1912 O  O   . VAL A 1 301 ? 12.320  33.793 -5.574  1.00 95.61  ? 293 VAL A O   1 
ATOM   1913 C  CB  . VAL A 1 301 ? 11.872  36.078 -7.494  1.00 90.82  ? 293 VAL A CB  1 
ATOM   1914 C  CG1 . VAL A 1 301 ? 13.022  36.994 -7.139  1.00 92.63  ? 293 VAL A CG1 1 
ATOM   1915 C  CG2 . VAL A 1 301 ? 11.102  36.628 -8.682  1.00 91.11  ? 293 VAL A CG2 1 
ATOM   1916 N  N   . ALA A 1 302 ? 14.326  33.841 -6.599  1.00 90.75  ? 294 ALA A N   1 
ATOM   1917 C  CA  . ALA A 1 302 ? 15.041  33.223 -5.488  1.00 91.31  ? 294 ALA A CA  1 
ATOM   1918 C  C   . ALA A 1 302 ? 15.023  34.108 -4.248  1.00 96.02  ? 294 ALA A C   1 
ATOM   1919 O  O   . ALA A 1 302 ? 15.280  35.309 -4.330  1.00 99.19  ? 294 ALA A O   1 
ATOM   1920 C  CB  . ALA A 1 302 ? 16.469  32.910 -5.890  1.00 94.83  ? 294 ALA A CB  1 
ATOM   1921 N  N   . PRO A 1 303 ? 14.720  33.507 -3.088  1.00 83.88  ? 295 PRO A N   1 
ATOM   1922 C  CA  . PRO A 1 303 ? 14.595  34.237 -1.824  1.00 82.87  ? 295 PRO A CA  1 
ATOM   1923 C  C   . PRO A 1 303 ? 15.936  34.499 -1.141  1.00 88.79  ? 295 PRO A C   1 
ATOM   1924 O  O   . PRO A 1 303 ? 16.964  33.976 -1.570  1.00 88.56  ? 295 PRO A O   1 
ATOM   1925 C  CB  . PRO A 1 303 ? 13.735  33.302 -0.977  1.00 84.25  ? 295 PRO A CB  1 
ATOM   1926 C  CG  . PRO A 1 303 ? 14.116  31.942 -1.452  1.00 88.04  ? 295 PRO A CG  1 
ATOM   1927 C  CD  . PRO A 1 303 ? 14.407  32.075 -2.928  1.00 84.07  ? 295 PRO A CD  1 
ATOM   1928 N  N   . TRP A 1 304 ? 15.910  35.303 -0.082  1.00 98.16  ? 296 TRP A N   1 
ATOM   1929 C  CA  . TRP A 1 304 ? 17.105  35.595 0.700   1.00 98.96  ? 296 TRP A CA  1 
ATOM   1930 C  C   . TRP A 1 304 ? 17.256  34.588 1.839   1.00 102.25 ? 296 TRP A C   1 
ATOM   1931 O  O   . TRP A 1 304 ? 16.333  34.393 2.630   1.00 102.09 ? 296 TRP A O   1 
ATOM   1932 C  CB  . TRP A 1 304 ? 17.050  37.024 1.245   1.00 97.85  ? 296 TRP A CB  1 
ATOM   1933 C  CG  . TRP A 1 304 ? 18.261  37.418 2.032   1.00 99.00  ? 296 TRP A CG  1 
ATOM   1934 C  CD1 . TRP A 1 304 ? 19.508  37.672 1.542   1.00 101.95 ? 296 TRP A CD1 1 
ATOM   1935 C  CD2 . TRP A 1 304 ? 18.340  37.613 3.450   1.00 98.85  ? 296 TRP A CD2 1 
ATOM   1936 N  NE1 . TRP A 1 304 ? 20.359  38.009 2.565   1.00 101.52 ? 296 TRP A NE1 1 
ATOM   1937 C  CE2 . TRP A 1 304 ? 19.667  37.980 3.747   1.00 102.98 ? 296 TRP A CE2 1 
ATOM   1938 C  CE3 . TRP A 1 304 ? 17.418  37.512 4.496   1.00 100.28 ? 296 TRP A CE3 1 
ATOM   1939 C  CZ2 . TRP A 1 304 ? 20.096  38.242 5.046   1.00 102.49 ? 296 TRP A CZ2 1 
ATOM   1940 C  CZ3 . TRP A 1 304 ? 17.845  37.775 5.785   1.00 101.65 ? 296 TRP A CZ3 1 
ATOM   1941 C  CH2 . TRP A 1 304 ? 19.172  38.138 6.048   1.00 102.34 ? 296 TRP A CH2 1 
ATOM   1942 N  N   . ILE A 1 305 ? 18.420  33.949 1.914   1.00 92.28  ? 297 ILE A N   1 
ATOM   1943 C  CA  . ILE A 1 305 ? 18.655  32.894 2.895   1.00 91.92  ? 297 ILE A CA  1 
ATOM   1944 C  C   . ILE A 1 305 ? 19.811  33.232 3.836   1.00 98.57  ? 297 ILE A C   1 
ATOM   1945 O  O   . ILE A 1 305 ? 20.861  33.701 3.398   1.00 98.61  ? 297 ILE A O   1 
ATOM   1946 C  CB  . ILE A 1 305 ? 18.944  31.543 2.201   1.00 94.26  ? 297 ILE A CB  1 
ATOM   1947 C  CG1 . ILE A 1 305 ? 17.761  31.129 1.324   1.00 94.01  ? 297 ILE A CG1 1 
ATOM   1948 C  CG2 . ILE A 1 305 ? 19.240  30.457 3.221   1.00 95.52  ? 297 ILE A CG2 1 
ATOM   1949 C  CD1 . ILE A 1 305 ? 18.068  31.125 -0.154  1.00 101.59 ? 297 ILE A CD1 1 
ATOM   1950 N  N   . MET A 1 306 ? 19.609  32.992 5.129   1.00 93.88  ? 298 MET A N   1 
ATOM   1951 C  CA  . MET A 1 306 ? 20.642  33.237 6.131   1.00 94.78  ? 298 MET A CA  1 
ATOM   1952 C  C   . MET A 1 306 ? 21.535  32.017 6.342   1.00 101.68 ? 298 MET A C   1 
ATOM   1953 O  O   . MET A 1 306 ? 21.189  30.904 5.943   1.00 101.45 ? 298 MET A O   1 
ATOM   1954 C  CB  . MET A 1 306 ? 20.011  33.642 7.463   1.00 97.29  ? 298 MET A CB  1 
ATOM   1955 C  CG  . MET A 1 306 ? 19.255  34.956 7.422   1.00 101.63 ? 298 MET A CG  1 
ATOM   1956 S  SD  . MET A 1 306 ? 18.669  35.468 9.047   1.00 106.53 ? 298 MET A SD  1 
ATOM   1957 C  CE  . MET A 1 306 ? 20.202  35.459 9.973   1.00 102.93 ? 298 MET A CE  1 
ATOM   1958 N  N   . THR A 1 307 ? 22.682  32.236 6.977   1.00 101.23 ? 299 THR A N   1 
ATOM   1959 C  CA  . THR A 1 307 ? 23.615  31.158 7.293   1.00 101.78 ? 299 THR A CA  1 
ATOM   1960 C  C   . THR A 1 307 ? 23.923  31.114 8.789   1.00 107.19 ? 299 THR A C   1 
ATOM   1961 O  O   . THR A 1 307 ? 24.368  32.109 9.364   1.00 107.09 ? 299 THR A O   1 
ATOM   1962 C  CB  . THR A 1 307 ? 24.934  31.305 6.510   1.00 111.27 ? 299 THR A CB  1 
ATOM   1963 O  OG1 . THR A 1 307 ? 25.419  32.648 6.634   1.00 112.88 ? 299 THR A OG1 1 
ATOM   1964 C  CG2 . THR A 1 307 ? 24.718  30.989 5.039   1.00 108.57 ? 299 THR A CG2 1 
ATOM   1965 N  N   . PRO A 1 308 ? 23.681  29.956 9.424   1.00 104.06 ? 300 PRO A N   1 
ATOM   1966 C  CA  . PRO A 1 308 ? 23.932  29.755 10.855  1.00 104.83 ? 300 PRO A CA  1 
ATOM   1967 C  C   . PRO A 1 308 ? 25.416  29.571 11.163  1.00 113.64 ? 300 PRO A C   1 
ATOM   1968 O  O   . PRO A 1 308 ? 26.206  29.371 10.243  1.00 114.07 ? 300 PRO A O   1 
ATOM   1969 C  CB  . PRO A 1 308 ? 23.142  28.482 11.169  1.00 105.90 ? 300 PRO A CB  1 
ATOM   1970 C  CG  . PRO A 1 308 ? 23.156  27.725 9.891   1.00 109.47 ? 300 PRO A CG  1 
ATOM   1971 C  CD  . PRO A 1 308 ? 23.109  28.755 8.791   1.00 105.12 ? 300 PRO A CD  1 
ATOM   1972 N  N   . ASN A 1 309 ? 25.778  29.627 12.442  1.00 107.00 ? 301 ASN A N   1 
ATOM   1973 C  CA  . ASN A 1 309 ? 27.175  29.531 12.857  1.00 107.87 ? 301 ASN A CA  1 
ATOM   1974 C  C   . ASN A 1 309 ? 27.820  28.190 12.516  1.00 114.97 ? 301 ASN A C   1 
ATOM   1975 O  O   . ASN A 1 309 ? 29.044  28.088 12.427  1.00 114.97 ? 301 ASN A O   1 
ATOM   1976 C  CB  . ASN A 1 309 ? 27.299  29.784 14.362  1.00 108.96 ? 301 ASN A CB  1 
ATOM   1977 C  CG  . ASN A 1 309 ? 26.853  31.177 14.760  1.00 132.16 ? 301 ASN A CG  1 
ATOM   1978 O  OD1 . ASN A 1 309 ? 27.093  32.148 14.044  1.00 127.36 ? 301 ASN A OD1 1 
ATOM   1979 N  ND2 . ASN A 1 309 ? 26.197  31.280 15.911  1.00 123.38 ? 301 ASN A ND2 1 
ATOM   1980 N  N   . THR A 1 310 ? 26.997  27.163 12.329  1.00 108.39 ? 302 THR A N   1 
ATOM   1981 C  CA  . THR A 1 310 ? 27.502  25.824 12.040  1.00 109.66 ? 302 THR A CA  1 
ATOM   1982 C  C   . THR A 1 310 ? 28.125  25.730 10.650  1.00 116.82 ? 302 THR A C   1 
ATOM   1983 O  O   . THR A 1 310 ? 28.914  24.826 10.377  1.00 118.17 ? 302 THR A O   1 
ATOM   1984 C  CB  . THR A 1 310 ? 26.392  24.765 12.156  1.00 120.66 ? 302 THR A CB  1 
ATOM   1985 O  OG1 . THR A 1 310 ? 25.309  25.105 11.281  1.00 122.59 ? 302 THR A OG1 1 
ATOM   1986 C  CG2 . THR A 1 310 ? 25.882  24.687 13.585  1.00 120.19 ? 302 THR A CG2 1 
ATOM   1987 N  N   . GLN A 1 311 ? 27.765  26.664 9.774   1.00 115.11 ? 303 GLN A N   1 
ATOM   1988 C  CA  . GLN A 1 311 ? 28.327  26.711 8.428   1.00 114.48 ? 303 GLN A CA  1 
ATOM   1989 C  C   . GLN A 1 311 ? 29.749  27.270 8.452   1.00 119.57 ? 303 GLN A C   1 
ATOM   1990 O  O   . GLN A 1 311 ? 30.053  28.166 9.241   1.00 120.25 ? 303 GLN A O   1 
ATOM   1991 C  CB  . GLN A 1 311 ? 27.443  27.553 7.505   1.00 115.10 ? 303 GLN A CB  1 
ATOM   1992 C  CG  . GLN A 1 311 ? 26.070  26.953 7.235   1.00 114.13 ? 303 GLN A CG  1 
ATOM   1993 C  CD  . GLN A 1 311 ? 26.129  25.742 6.323   1.00 116.56 ? 303 GLN A CD  1 
ATOM   1994 O  OE1 . GLN A 1 311 ? 25.620  24.672 6.658   1.00 105.83 ? 303 GLN A OE1 1 
ATOM   1995 N  NE2 . GLN A 1 311 ? 26.746  25.908 5.159   1.00 106.53 ? 303 GLN A NE2 1 
ATOM   1996 N  N   . PRO A 1 312 ? 30.629  26.729 7.593   1.00 118.41 ? 304 PRO A N   1 
ATOM   1997 C  CA  . PRO A 1 312 ? 32.017  27.197 7.491   1.00 117.79 ? 304 PRO A CA  1 
ATOM   1998 C  C   . PRO A 1 312 ? 32.100  28.661 7.069   1.00 120.35 ? 304 PRO A C   1 
ATOM   1999 O  O   . PRO A 1 312 ? 31.312  29.095 6.229   1.00 119.05 ? 304 PRO A O   1 
ATOM   2000 C  CB  . PRO A 1 312 ? 32.618  26.284 6.417   1.00 119.85 ? 304 PRO A CB  1 
ATOM   2001 C  CG  . PRO A 1 312 ? 31.753  25.071 6.417   1.00 124.71 ? 304 PRO A CG  1 
ATOM   2002 C  CD  . PRO A 1 312 ? 30.374  25.568 6.724   1.00 120.18 ? 304 PRO A CD  1 
ATOM   2003 N  N   . PRO A 1 313 ? 33.046  29.416 7.650   1.00 121.05 ? 305 PRO A N   1 
ATOM   2004 C  CA  . PRO A 1 313 ? 33.198  30.840 7.348   1.00 121.98 ? 305 PRO A CA  1 
ATOM   2005 C  C   . PRO A 1 313 ? 34.130  31.099 6.166   1.00 130.10 ? 305 PRO A C   1 
ATOM   2006 O  O   . PRO A 1 313 ? 35.263  30.620 6.152   1.00 130.38 ? 305 PRO A O   1 
ATOM   2007 C  CB  . PRO A 1 313 ? 33.786  31.407 8.644   1.00 123.25 ? 305 PRO A CB  1 
ATOM   2008 C  CG  . PRO A 1 313 ? 34.424  30.225 9.355   1.00 126.96 ? 305 PRO A CG  1 
ATOM   2009 C  CD  . PRO A 1 313 ? 34.050  28.956 8.622   1.00 122.44 ? 305 PRO A CD  1 
ATOM   2010 N  N   . GLN A 1 314 ? 33.646  31.856 5.187   1.00 125.46 ? 306 GLN A N   1 
ATOM   2011 C  CA  . GLN A 1 314 ? 34.438  32.190 4.010   1.00 126.36 ? 306 GLN A CA  1 
ATOM   2012 C  C   . GLN A 1 314 ? 35.349  33.384 4.266   1.00 133.77 ? 306 GLN A C   1 
ATOM   2013 O  O   . GLN A 1 314 ? 36.473  33.437 3.768   1.00 134.61 ? 306 GLN A O   1 
ATOM   2014 C  CB  . GLN A 1 314 ? 33.529  32.485 2.815   1.00 127.51 ? 306 GLN A CB  1 
ATOM   2015 C  CG  . GLN A 1 314 ? 32.784  31.280 2.272   1.00 134.03 ? 306 GLN A CG  1 
ATOM   2016 C  CD  . GLN A 1 314 ? 31.858  31.645 1.129   1.00 144.76 ? 306 GLN A CD  1 
ATOM   2017 O  OE1 . GLN A 1 314 ? 31.343  32.762 1.067   1.00 132.30 ? 306 GLN A OE1 1 
ATOM   2018 N  NE2 . GLN A 1 314 ? 31.647  30.707 0.213   1.00 140.06 ? 306 GLN A NE2 1 
ATOM   2019 N  N   . GLU A 1 315 ? 34.857  34.342 5.046   1.00 128.74 ? 307 GLU A N   1 
ATOM   2020 C  CA  . GLU A 1 315 ? 35.580  35.587 5.269   1.00 129.71 ? 307 GLU A CA  1 
ATOM   2021 C  C   . GLU A 1 315 ? 35.166  36.243 6.583   1.00 136.54 ? 307 GLU A C   1 
ATOM   2022 O  O   . GLU A 1 315 ? 34.022  36.114 7.017   1.00 137.10 ? 307 GLU A O   1 
ATOM   2023 C  CB  . GLU A 1 315 ? 35.343  36.546 4.100   1.00 131.15 ? 307 GLU A CB  1 
ATOM   2024 C  CG  . GLU A 1 315 ? 36.253  37.762 4.079   1.00 144.44 ? 307 GLU A CG  1 
ATOM   2025 C  CD  . GLU A 1 315 ? 36.003  38.652 2.878   1.00 170.86 ? 307 GLU A CD  1 
ATOM   2026 O  OE1 . GLU A 1 315 ? 35.073  38.355 2.098   1.00 167.27 ? 307 GLU A OE1 1 
ATOM   2027 O  OE2 . GLU A 1 315 ? 36.737  39.649 2.712   1.00 166.10 ? 307 GLU A OE2 1 
ATOM   2028 N  N   . VAL A 1 316 ? 36.105  36.942 7.214   1.00 140.11 ? 308 VAL A N   1 
ATOM   2029 C  CA  . VAL A 1 316 ? 35.826  37.667 8.448   1.00 140.44 ? 308 VAL A CA  1 
ATOM   2030 C  C   . VAL A 1 316 ? 36.044  39.164 8.252   1.00 143.61 ? 308 VAL A C   1 
ATOM   2031 O  O   . VAL A 1 316 ? 37.082  39.591 7.746   1.00 146.47 ? 308 VAL A O   1 
ATOM   2032 C  CB  . VAL A 1 316 ? 36.706  37.170 9.610   1.00 143.79 ? 308 VAL A CB  1 
ATOM   2033 C  CG1 . VAL A 1 316 ? 36.519  38.049 10.838  1.00 144.95 ? 308 VAL A CG1 1 
ATOM   2034 C  CG2 . VAL A 1 316 ? 36.381  35.722 9.934   1.00 142.51 ? 308 VAL A CG2 1 
ATOM   2035 N  N   . TYR A 1 317 ? 35.055  39.955 8.657   1.00 145.18 ? 309 TYR A N   1 
ATOM   2036 C  CA  . TYR A 1 317 ? 35.093  41.400 8.470   1.00 147.53 ? 309 TYR A CA  1 
ATOM   2037 C  C   . TYR A 1 317 ? 35.328  42.103 9.804   1.00 158.43 ? 309 TYR A C   1 
ATOM   2038 O  O   . TYR A 1 317 ? 34.830  41.664 10.840  1.00 156.83 ? 309 TYR A O   1 
ATOM   2039 C  CB  . TYR A 1 317 ? 33.792  41.890 7.826   1.00 144.52 ? 309 TYR A CB  1 
ATOM   2040 C  CG  . TYR A 1 317 ? 33.572  41.400 6.406   1.00 144.27 ? 309 TYR A CG  1 
ATOM   2041 C  CD1 . TYR A 1 317 ? 33.339  40.054 6.139   1.00 144.17 ? 309 TYR A CD1 1 
ATOM   2042 C  CD2 . TYR A 1 317 ? 33.583  42.285 5.335   1.00 145.47 ? 309 TYR A CD2 1 
ATOM   2043 C  CE1 . TYR A 1 317 ? 33.138  39.605 4.848   1.00 143.43 ? 309 TYR A CE1 1 
ATOM   2044 C  CE2 . TYR A 1 317 ? 33.379  41.843 4.040   1.00 145.09 ? 309 TYR A CE2 1 
ATOM   2045 C  CZ  . TYR A 1 317 ? 33.157  40.502 3.803   1.00 149.94 ? 309 TYR A CZ  1 
ATOM   2046 O  OH  . TYR A 1 317 ? 32.954  40.056 2.516   1.00 148.02 ? 309 TYR A OH  1 
ATOM   2047 N  N   . ALA A 1 318 ? 36.092  43.192 9.775   1.00 161.61 ? 310 ALA A N   1 
ATOM   2048 C  CA  . ALA A 1 318 ? 36.423  43.921 10.995  1.00 166.10 ? 310 ALA A CA  1 
ATOM   2049 C  C   . ALA A 1 318 ? 36.647  45.408 10.729  1.00 175.15 ? 310 ALA A C   1 
ATOM   2050 O  O   . ALA A 1 318 ? 37.029  45.803 9.628   1.00 175.11 ? 310 ALA A O   1 
ATOM   2051 C  CB  . ALA A 1 318 ? 37.653  43.314 11.652  1.00 171.20 ? 310 ALA A CB  1 
ATOM   2052 N  N   . CYS A 1 319 ? 36.407  46.227 11.749  1.00 178.89 ? 311 CYS A N   1 
ATOM   2053 C  CA  . CYS A 1 319 ? 36.593  47.669 11.639  1.00 182.38 ? 311 CYS A CA  1 
ATOM   2054 C  C   . CYS A 1 319 ? 36.888  48.293 12.999  1.00 189.38 ? 311 CYS A C   1 
ATOM   2055 O  O   . CYS A 1 319 ? 36.318  47.893 14.014  1.00 187.49 ? 311 CYS A O   1 
ATOM   2056 C  CB  . CYS A 1 319 ? 35.357  48.323 11.016  1.00 179.30 ? 311 CYS A CB  1 
ATOM   2057 S  SG  . CYS A 1 319 ? 33.821  48.049 11.930  1.00 179.16 ? 311 CYS A SG  1 
ATOM   2058 N  N   . PHE A 1 322 ? 41.862  52.743 15.865  1.00 204.15 ? 314 PHE A N   1 
ATOM   2059 C  CA  . PHE A 1 322 ? 41.373  53.619 16.922  1.00 205.98 ? 314 PHE A CA  1 
ATOM   2060 C  C   . PHE A 1 322 ? 41.539  52.972 18.293  1.00 208.40 ? 314 PHE A C   1 
ATOM   2061 O  O   . PHE A 1 322 ? 42.170  53.540 19.185  1.00 214.75 ? 314 PHE A O   1 
ATOM   2062 C  CB  . PHE A 1 322 ? 39.905  53.980 16.687  1.00 199.57 ? 314 PHE A CB  1 
ATOM   2063 N  N   . GLU A 1 323 ? 40.971  51.782 18.461  1.00 212.78 ? 315 GLU A N   1 
ATOM   2064 C  CA  . GLU A 1 323 ? 41.072  51.077 19.731  1.00 214.83 ? 315 GLU A CA  1 
ATOM   2065 C  C   . GLU A 1 323 ? 41.339  49.593 19.527  1.00 214.02 ? 315 GLU A C   1 
ATOM   2066 O  O   . GLU A 1 323 ? 41.379  49.111 18.393  1.00 211.43 ? 315 GLU A O   1 
ATOM   2067 C  CB  . GLU A 1 323 ? 39.796  51.267 20.553  1.00 216.82 ? 315 GLU A CB  1 
ATOM   2068 N  N   . ASN A 1 324 ? 41.515  48.890 20.644  1.00 211.19 ? 316 ASN A N   1 
ATOM   2069 C  CA  . ASN A 1 324 ? 41.744  47.446 20.679  1.00 210.80 ? 316 ASN A CA  1 
ATOM   2070 C  C   . ASN A 1 324 ? 42.698  46.939 19.595  1.00 210.90 ? 316 ASN A C   1 
ATOM   2071 O  O   . ASN A 1 324 ? 42.424  45.945 18.920  1.00 206.94 ? 316 ASN A O   1 
ATOM   2072 C  CB  . ASN A 1 324 ? 40.401  46.698 20.605  1.00 204.86 ? 316 ASN A CB  1 
ATOM   2073 C  CG  . ASN A 1 324 ? 39.698  46.857 19.264  1.00 198.84 ? 316 ASN A CG  1 
ATOM   2074 O  OD1 . ASN A 1 324 ? 38.934  47.799 19.054  1.00 196.32 ? 316 ASN A OD1 1 
ATOM   2075 N  ND2 . ASN A 1 324 ? 39.951  45.924 18.355  1.00 197.15 ? 316 ASN A ND2 1 
ATOM   2076 N  N   . GLU A 1 325 ? 43.824  47.632 19.438  1.00 206.30 ? 317 GLU A N   1 
ATOM   2077 C  CA  . GLU A 1 325 ? 44.837  47.235 18.461  1.00 207.25 ? 317 GLU A CA  1 
ATOM   2078 C  C   . GLU A 1 325 ? 45.405  45.865 18.794  1.00 208.49 ? 317 GLU A C   1 
ATOM   2079 O  O   . GLU A 1 325 ? 45.805  45.109 17.909  1.00 206.84 ? 317 GLU A O   1 
ATOM   2080 C  CB  . GLU A 1 325 ? 45.975  48.254 18.396  1.00 218.33 ? 317 GLU A CB  1 
ATOM   2081 C  CG  . GLU A 1 325 ? 45.663  49.484 17.568  1.00 217.54 ? 317 GLU A CG  1 
ATOM   2082 C  CD  . GLU A 1 325 ? 44.568  50.324 18.175  1.00 215.48 ? 317 GLU A CD  1 
ATOM   2083 O  OE1 . GLU A 1 325 ? 44.619  50.566 19.400  1.00 219.20 ? 317 GLU A OE1 1 
ATOM   2084 O  OE2 . GLU A 1 325 ? 43.643  50.724 17.435  1.00 210.29 ? 317 GLU A OE2 1 
ATOM   2085 N  N   . ASP A 1 326 ? 45.449  45.556 20.083  1.00 201.65 ? 318 ASP A N   1 
ATOM   2086 C  CA  . ASP A 1 326 ? 45.921  44.258 20.539  1.00 202.93 ? 318 ASP A CA  1 
ATOM   2087 C  C   . ASP A 1 326 ? 44.879  43.179 20.258  1.00 196.95 ? 318 ASP A C   1 
ATOM   2088 O  O   . ASP A 1 326 ? 45.210  42.005 20.095  1.00 196.07 ? 318 ASP A O   1 
ATOM   2089 C  CB  . ASP A 1 326 ? 46.259  44.306 22.032  1.00 208.66 ? 318 ASP A CB  1 
ATOM   2090 C  CG  . ASP A 1 326 ? 45.198  45.020 22.852  1.00 206.30 ? 318 ASP A CG  1 
ATOM   2091 O  OD1 . ASP A 1 326 ? 44.082  45.235 22.336  1.00 199.10 ? 318 ASP A OD1 1 
ATOM   2092 O  OD2 . ASP A 1 326 ? 45.480  45.362 24.019  1.00 212.08 ? 318 ASP A OD2 1 
ATOM   2093 N  N   . PHE A 1 327 ? 43.616  43.589 20.198  1.00 195.55 ? 319 PHE A N   1 
ATOM   2094 C  CA  . PHE A 1 327 ? 42.528  42.660 19.929  1.00 190.03 ? 319 PHE A CA  1 
ATOM   2095 C  C   . PHE A 1 327 ? 42.472  42.300 18.449  1.00 185.47 ? 319 PHE A C   1 
ATOM   2096 O  O   . PHE A 1 327 ? 42.047  41.204 18.089  1.00 181.76 ? 319 PHE A O   1 
ATOM   2097 C  CB  . PHE A 1 327 ? 41.191  43.248 20.379  1.00 185.84 ? 319 PHE A CB  1 
ATOM   2098 N  N   . LEU A 1 328 ? 42.897  43.230 17.597  1.00 180.04 ? 320 LEU A N   1 
ATOM   2099 C  CA  . LEU A 1 328 ? 43.036  42.954 16.171  1.00 177.26 ? 320 LEU A CA  1 
ATOM   2100 C  C   . LEU A 1 328 ? 44.013  41.805 15.958  1.00 179.24 ? 320 LEU A C   1 
ATOM   2101 O  O   . LEU A 1 328 ? 43.852  40.998 15.044  1.00 175.77 ? 320 LEU A O   1 
ATOM   2102 C  CB  . LEU A 1 328 ? 43.511  44.194 15.411  1.00 179.65 ? 320 LEU A CB  1 
ATOM   2103 C  CG  . LEU A 1 328 ? 42.458  45.013 14.662  1.00 175.14 ? 320 LEU A CG  1 
ATOM   2104 C  CD1 . LEU A 1 328 ? 41.719  45.958 15.596  1.00 175.26 ? 320 LEU A CD1 1 
ATOM   2105 C  CD2 . LEU A 1 328 ? 43.097  45.776 13.512  1.00 177.13 ? 320 LEU A CD2 1 
ATOM   2106 N  N   . LYS A 1 329 ? 45.028  41.744 16.814  1.00 186.26 ? 321 LYS A N   1 
ATOM   2107 C  CA  . LYS A 1 329 ? 45.999  40.660 16.781  1.00 188.27 ? 321 LYS A CA  1 
ATOM   2108 C  C   . LYS A 1 329 ? 45.343  39.338 17.163  1.00 187.24 ? 321 LYS A C   1 
ATOM   2109 O  O   . LYS A 1 329 ? 45.461  38.348 16.442  1.00 184.31 ? 321 LYS A O   1 
ATOM   2110 C  CB  . LYS A 1 329 ? 47.170  40.957 17.719  1.00 198.24 ? 321 LYS A CB  1 
ATOM   2111 N  N   . SER A 1 330 ? 44.644  39.333 18.295  1.00 183.71 ? 322 SER A N   1 
ATOM   2112 C  CA  . SER A 1 330 ? 43.978  38.130 18.788  1.00 179.88 ? 322 SER A CA  1 
ATOM   2113 C  C   . SER A 1 330 ? 42.880  37.666 17.837  1.00 175.37 ? 322 SER A C   1 
ATOM   2114 O  O   . SER A 1 330 ? 42.506  36.493 17.830  1.00 172.43 ? 322 SER A O   1 
ATOM   2115 C  CB  . SER A 1 330 ? 43.396  38.374 20.182  1.00 184.29 ? 322 SER A CB  1 
ATOM   2116 O  OG  . SER A 1 330 ? 42.408  39.390 20.154  1.00 189.60 ? 322 SER A OG  1 
ATOM   2117 N  N   . VAL A 1 331 ? 42.363  38.597 17.042  1.00 176.80 ? 323 VAL A N   1 
ATOM   2118 C  CA  . VAL A 1 331 ? 41.371  38.274 16.026  1.00 170.80 ? 323 VAL A CA  1 
ATOM   2119 C  C   . VAL A 1 331 ? 42.042  37.648 14.805  1.00 170.46 ? 323 VAL A C   1 
ATOM   2120 O  O   . VAL A 1 331 ? 41.580  36.631 14.287  1.00 167.04 ? 323 VAL A O   1 
ATOM   2121 C  CB  . VAL A 1 331 ? 40.569  39.527 15.600  1.00 168.32 ? 323 VAL A CB  1 
ATOM   2122 C  CG1 . VAL A 1 331 ? 39.885  39.303 14.263  1.00 163.33 ? 323 VAL A CG1 1 
ATOM   2123 C  CG2 . VAL A 1 331 ? 39.549  39.893 16.669  1.00 167.05 ? 323 VAL A CG2 1 
ATOM   2124 N  N   . THR A 1 332 ? 43.143  38.250 14.362  1.00 166.47 ? 324 THR A N   1 
ATOM   2125 C  CA  . THR A 1 332 ? 43.866  37.758 13.192  1.00 166.86 ? 324 THR A CA  1 
ATOM   2126 C  C   . THR A 1 332 ? 44.491  36.387 13.439  1.00 168.25 ? 324 THR A C   1 
ATOM   2127 O  O   . THR A 1 332 ? 44.660  35.602 12.507  1.00 166.78 ? 324 THR A O   1 
ATOM   2128 C  CB  . THR A 1 332 ? 44.970  38.740 12.751  1.00 171.64 ? 324 THR A CB  1 
ATOM   2129 O  OG1 . THR A 1 332 ? 45.713  39.175 13.896  1.00 176.98 ? 324 THR A OG1 1 
ATOM   2130 C  CG2 . THR A 1 332 ? 44.361  39.950 12.058  1.00 169.69 ? 324 THR A CG2 1 
ATOM   2131 N  N   . THR A 1 333 ? 44.830  36.100 14.692  1.00 165.92 ? 325 THR A N   1 
ATOM   2132 C  CA  . THR A 1 333 ? 45.372  34.792 15.049  1.00 167.38 ? 325 THR A CA  1 
ATOM   2133 C  C   . THR A 1 333 ? 44.314  33.704 14.890  1.00 162.25 ? 325 THR A C   1 
ATOM   2134 O  O   . THR A 1 333 ? 44.610  32.599 14.436  1.00 161.77 ? 325 THR A O   1 
ATOM   2135 C  CB  . THR A 1 333 ? 45.905  34.765 16.497  1.00 172.11 ? 325 THR A CB  1 
ATOM   2136 O  OG1 . THR A 1 333 ? 44.888  35.231 17.393  1.00 170.45 ? 325 THR A OG1 1 
ATOM   2137 C  CG2 . THR A 1 333 ? 47.140  35.643 16.633  1.00 178.21 ? 325 THR A CG2 1 
ATOM   2138 N  N   . LEU A 1 334 ? 43.080  34.030 15.262  1.00 165.88 ? 326 LEU A N   1 
ATOM   2139 C  CA  . LEU A 1 334 ? 41.984  33.070 15.221  1.00 161.05 ? 326 LEU A CA  1 
ATOM   2140 C  C   . LEU A 1 334 ? 41.584  32.737 13.786  1.00 159.53 ? 326 LEU A C   1 
ATOM   2141 O  O   . LEU A 1 334 ? 41.276  31.587 13.470  1.00 156.56 ? 326 LEU A O   1 
ATOM   2142 C  CB  . LEU A 1 334 ? 40.778  33.608 15.994  1.00 158.92 ? 326 LEU A CB  1 
ATOM   2143 C  CG  . LEU A 1 334 ? 39.713  32.585 16.393  1.00 160.80 ? 326 LEU A CG  1 
ATOM   2144 C  CD1 . LEU A 1 334 ? 40.295  31.557 17.351  1.00 164.24 ? 326 LEU A CD1 1 
ATOM   2145 C  CD2 . LEU A 1 334 ? 38.511  33.276 17.013  1.00 161.17 ? 326 LEU A CD2 1 
ATOM   2146 N  N   . ALA A 1 335 ? 41.590  33.747 12.922  1.00 158.76 ? 327 ALA A N   1 
ATOM   2147 C  CA  . ALA A 1 335 ? 41.238  33.554 11.520  1.00 155.66 ? 327 ALA A CA  1 
ATOM   2148 C  C   . ALA A 1 335 ? 42.307  32.741 10.799  1.00 157.93 ? 327 ALA A C   1 
ATOM   2149 O  O   . ALA A 1 335 ? 41.997  31.904 9.950   1.00 155.64 ? 327 ALA A O   1 
ATOM   2150 C  CB  . ALA A 1 335 ? 41.037  34.894 10.832  1.00 154.95 ? 327 ALA A CB  1 
ATOM   2151 N  N   . MET A 1 336 ? 43.566  32.993 11.143  1.00 158.76 ? 328 MET A N   1 
ATOM   2152 C  CA  . MET A 1 336 ? 44.683  32.258 10.563  1.00 161.36 ? 328 MET A CA  1 
ATOM   2153 C  C   . MET A 1 336 ? 44.720  30.828 11.087  1.00 165.09 ? 328 MET A C   1 
ATOM   2154 O  O   . MET A 1 336 ? 45.216  29.923 10.418  1.00 165.27 ? 328 MET A O   1 
ATOM   2155 C  CB  . MET A 1 336 ? 46.006  32.967 10.862  1.00 169.27 ? 328 MET A CB  1 
ATOM   2156 N  N   . LYS A 1 337 ? 44.191  30.633 12.290  1.00 163.21 ? 329 LYS A N   1 
ATOM   2157 C  CA  . LYS A 1 337 ? 44.143  29.311 12.901  1.00 163.01 ? 329 LYS A CA  1 
ATOM   2158 C  C   . LYS A 1 337 ? 43.024  28.469 12.298  1.00 161.94 ? 329 LYS A C   1 
ATOM   2159 O  O   . LYS A 1 337 ? 43.187  27.269 12.075  1.00 161.22 ? 329 LYS A O   1 
ATOM   2160 C  CB  . LYS A 1 337 ? 43.958  29.424 14.416  1.00 167.19 ? 329 LYS A CB  1 
ATOM   2161 N  N   . ALA A 1 338 ? 41.887  29.106 12.035  1.00 161.73 ? 330 ALA A N   1 
ATOM   2162 C  CA  . ALA A 1 338 ? 40.733  28.417 11.469  1.00 157.52 ? 330 ALA A CA  1 
ATOM   2163 C  C   . ALA A 1 338 ? 40.790  28.400 9.947   1.00 158.74 ? 330 ALA A C   1 
ATOM   2164 O  O   . ALA A 1 338 ? 39.841  27.967 9.290   1.00 154.99 ? 330 ALA A O   1 
ATOM   2165 C  CB  . ALA A 1 338 ? 39.444  29.071 11.942  1.00 154.44 ? 330 ALA A CB  1 
ATOM   2166 N  N   . LYS A 1 339 ? 41.908  28.873 9.400   1.00 163.62 ? 331 LYS A N   1 
ATOM   2167 C  CA  . LYS A 1 339 ? 42.114  28.955 7.955   1.00 163.13 ? 331 LYS A CA  1 
ATOM   2168 C  C   . LYS A 1 339 ? 40.994  29.732 7.268   1.00 162.98 ? 331 LYS A C   1 
ATOM   2169 O  O   . LYS A 1 339 ? 40.326  29.217 6.373   1.00 159.84 ? 331 LYS A O   1 
ATOM   2170 C  CB  . LYS A 1 339 ? 42.233  27.554 7.346   1.00 165.64 ? 331 LYS A CB  1 
ATOM   2171 N  N   . CYS A 1 340 ? 40.797  30.974 7.699   1.00 158.55 ? 332 CYS A N   1 
ATOM   2172 C  CA  . CYS A 1 340 ? 39.763  31.831 7.131   1.00 155.48 ? 332 CYS A CA  1 
ATOM   2173 C  C   . CYS A 1 340 ? 40.320  33.202 6.762   1.00 159.81 ? 332 CYS A C   1 
ATOM   2174 O  O   . CYS A 1 340 ? 41.111  33.781 7.507   1.00 162.47 ? 332 CYS A O   1 
ATOM   2175 C  CB  . CYS A 1 340 ? 38.597  31.985 8.109   1.00 153.72 ? 332 CYS A CB  1 
ATOM   2176 S  SG  . CYS A 1 340 ? 37.330  33.152 7.567   1.00 154.41 ? 332 CYS A SG  1 
ATOM   2177 N  N   . LYS A 1 341 ? 39.900  33.717 5.609   1.00 153.13 ? 333 LYS A N   1 
ATOM   2178 C  CA  . LYS A 1 341 ? 40.369  35.012 5.126   1.00 154.60 ? 333 LYS A CA  1 
ATOM   2179 C  C   . LYS A 1 341 ? 39.819  36.158 5.973   1.00 157.63 ? 333 LYS A C   1 
ATOM   2180 O  O   . LYS A 1 341 ? 38.644  36.166 6.336   1.00 154.06 ? 333 LYS A O   1 
ATOM   2181 C  CB  . LYS A 1 341 ? 39.979  35.205 3.657   1.00 155.18 ? 333 LYS A CB  1 
ATOM   2182 C  CG  . LYS A 1 341 ? 40.355  36.562 3.075   1.00 162.65 ? 333 LYS A CG  1 
ATOM   2183 C  CD  . LYS A 1 341 ? 40.029  36.632 1.590   1.00 166.44 ? 333 LYS A CD  1 
ATOM   2184 C  CE  . LYS A 1 341 ? 40.178  38.048 1.055   1.00 170.29 ? 333 LYS A CE  1 
ATOM   2185 N  NZ  . LYS A 1 341 ? 39.235  38.991 1.719   1.00 169.63 ? 333 LYS A NZ  1 
ATOM   2186 N  N   . LEU A 1 342 ? 40.679  37.123 6.286   1.00 155.55 ? 334 LEU A N   1 
ATOM   2187 C  CA  . LEU A 1 342 ? 40.285  38.275 7.088   1.00 155.71 ? 334 LEU A CA  1 
ATOM   2188 C  C   . LEU A 1 342 ? 40.527  39.568 6.314   1.00 163.16 ? 334 LEU A C   1 
ATOM   2189 O  O   . LEU A 1 342 ? 41.547  39.716 5.641   1.00 167.17 ? 334 LEU A O   1 
ATOM   2190 C  CB  . LEU A 1 342 ? 41.053  38.289 8.414   1.00 159.33 ? 334 LEU A CB  1 
ATOM   2191 C  CG  . LEU A 1 342 ? 40.471  39.051 9.610   1.00 163.78 ? 334 LEU A CG  1 
ATOM   2192 C  CD1 . LEU A 1 342 ? 41.089  38.537 10.897  1.00 167.04 ? 334 LEU A CD1 1 
ATOM   2193 C  CD2 . LEU A 1 342 ? 40.685  40.554 9.496   1.00 168.33 ? 334 LEU A CD2 1 
ATOM   2194 N  N   . THR A 1 343 ? 39.583  40.498 6.412   1.00 161.88 ? 335 THR A N   1 
ATOM   2195 C  CA  . THR A 1 343 ? 39.704  41.791 5.748   1.00 163.69 ? 335 THR A CA  1 
ATOM   2196 C  C   . THR A 1 343 ? 39.159  42.898 6.647   1.00 168.27 ? 335 THR A C   1 
ATOM   2197 O  O   . THR A 1 343 ? 38.177  42.696 7.362   1.00 164.91 ? 335 THR A O   1 
ATOM   2198 C  CB  . THR A 1 343 ? 38.958  41.806 4.396   1.00 171.19 ? 335 THR A CB  1 
ATOM   2199 O  OG1 . THR A 1 343 ? 39.274  40.618 3.659   1.00 172.61 ? 335 THR A OG1 1 
ATOM   2200 C  CG2 . THR A 1 343 ? 39.350  43.027 3.573   1.00 173.03 ? 335 THR A CG2 1 
ATOM   2201 N  N   . ILE A 1 344 ? 39.801  44.063 6.615   1.00 165.26 ? 336 ILE A N   1 
ATOM   2202 C  CA  . ILE A 1 344 ? 39.386  45.187 7.449   1.00 165.49 ? 336 ILE A CA  1 
ATOM   2203 C  C   . ILE A 1 344 ? 38.443  46.120 6.694   1.00 166.76 ? 336 ILE A C   1 
ATOM   2204 O  O   . ILE A 1 344 ? 38.866  47.138 6.142   1.00 169.17 ? 336 ILE A O   1 
ATOM   2205 C  CB  . ILE A 1 344 ? 40.599  45.994 7.951   1.00 174.75 ? 336 ILE A CB  1 
ATOM   2206 C  CG1 . ILE A 1 344 ? 41.712  45.050 8.409   1.00 178.56 ? 336 ILE A CG1 1 
ATOM   2207 C  CG2 . ILE A 1 344 ? 40.184  46.938 9.076   1.00 176.00 ? 336 ILE A CG2 1 
ATOM   2208 C  CD1 . ILE A 1 344 ? 41.333  44.185 9.595   1.00 182.65 ? 336 ILE A CD1 1 
ATOM   2209 N  N   . GLN A 1 357 ? 28.455  46.618 11.583  1.00 148.39 ? 349 GLN A N   1 
ATOM   2210 C  CA  . GLN A 1 357 ? 28.506  45.167 11.452  1.00 148.19 ? 349 GLN A CA  1 
ATOM   2211 C  C   . GLN A 1 357 ? 27.268  44.520 12.063  1.00 150.57 ? 349 GLN A C   1 
ATOM   2212 O  O   . GLN A 1 357 ? 26.695  43.590 11.494  1.00 150.13 ? 349 GLN A O   1 
ATOM   2213 C  CB  . GLN A 1 357 ? 29.771  44.612 12.110  1.00 149.75 ? 349 GLN A CB  1 
ATOM   2214 N  N   . ASP A 1 358 ? 26.858  45.022 13.224  1.00 146.92 ? 350 ASP A N   1 
ATOM   2215 C  CA  . ASP A 1 358 ? 25.665  44.523 13.898  1.00 146.21 ? 350 ASP A CA  1 
ATOM   2216 C  C   . ASP A 1 358 ? 24.400  45.095 13.266  1.00 148.32 ? 350 ASP A C   1 
ATOM   2217 O  O   . ASP A 1 358 ? 23.288  44.690 13.605  1.00 148.43 ? 350 ASP A O   1 
ATOM   2218 C  CB  . ASP A 1 358 ? 25.708  44.863 15.389  1.00 148.10 ? 350 ASP A CB  1 
ATOM   2219 N  N   . GLU A 1 359 ? 24.577  46.040 12.347  1.00 147.29 ? 351 GLU A N   1 
ATOM   2220 C  CA  . GLU A 1 359 ? 23.450  46.673 11.673  1.00 145.58 ? 351 GLU A CA  1 
ATOM   2221 C  C   . GLU A 1 359 ? 23.134  45.964 10.357  1.00 142.74 ? 351 GLU A C   1 
ATOM   2222 O  O   . GLU A 1 359 ? 22.213  46.350 9.637   1.00 143.26 ? 351 GLU A O   1 
ATOM   2223 C  CB  . GLU A 1 359 ? 23.742  48.155 11.419  1.00 152.60 ? 351 GLU A CB  1 
ATOM   2224 C  CG  . GLU A 1 359 ? 22.507  49.000 11.132  1.00 165.28 ? 351 GLU A CG  1 
ATOM   2225 C  CD  . GLU A 1 359 ? 22.842  50.327 10.483  1.00 192.08 ? 351 GLU A CD  1 
ATOM   2226 O  OE1 . GLU A 1 359 ? 22.741  50.421 9.241   1.00 175.71 ? 351 GLU A OE1 1 
ATOM   2227 O  OE2 . GLU A 1 359 ? 23.202  51.276 11.211  1.00 193.17 ? 351 GLU A OE2 1 
ATOM   2228 N  N   . MET A 1 360 ? 23.896  44.923 10.043  1.00 140.42 ? 352 MET A N   1 
ATOM   2229 C  CA  . MET A 1 360 ? 23.696  44.207 8.789   1.00 135.74 ? 352 MET A CA  1 
ATOM   2230 C  C   . MET A 1 360 ? 23.849  42.699 8.957   1.00 128.03 ? 352 MET A C   1 
ATOM   2231 O  O   . MET A 1 360 ? 24.491  42.227 9.895   1.00 126.62 ? 352 MET A O   1 
ATOM   2232 C  CB  . MET A 1 360 ? 24.672  44.714 7.723   1.00 142.45 ? 352 MET A CB  1 
ATOM   2233 C  CG  . MET A 1 360 ? 26.106  44.242 7.900   1.00 148.76 ? 352 MET A CG  1 
ATOM   2234 S  SD  . MET A 1 360 ? 27.164  44.792 6.547   1.00 158.71 ? 352 MET A SD  1 
ATOM   2235 C  CE  . MET A 1 360 ? 28.699  43.958 6.940   1.00 156.73 ? 352 MET A CE  1 
ATOM   2236 N  N   . GLU A 1 361 ? 23.248  41.952 8.037   1.00 122.97 ? 353 GLU A N   1 
ATOM   2237 C  CA  . GLU A 1 361 ? 23.325  40.497 8.043   1.00 116.58 ? 353 GLU A CA  1 
ATOM   2238 C  C   . GLU A 1 361 ? 23.692  40.003 6.648   1.00 115.04 ? 353 GLU A C   1 
ATOM   2239 O  O   . GLU A 1 361 ? 23.051  40.376 5.666   1.00 113.35 ? 353 GLU A O   1 
ATOM   2240 C  CB  . GLU A 1 361 ? 21.996  39.887 8.494   1.00 114.09 ? 353 GLU A CB  1 
ATOM   2241 C  CG  . GLU A 1 361 ? 22.067  38.407 8.832   1.00 118.41 ? 353 GLU A CG  1 
ATOM   2242 C  CD  . GLU A 1 361 ? 22.564  38.154 10.243  1.00 132.98 ? 353 GLU A CD  1 
ATOM   2243 O  OE1 . GLU A 1 361 ? 22.402  39.048 11.101  1.00 124.54 ? 353 GLU A OE1 1 
ATOM   2244 O  OE2 . GLU A 1 361 ? 23.115  37.062 10.494  1.00 122.53 ? 353 GLU A OE2 1 
ATOM   2245 N  N   . ILE A 1 362 ? 24.725  39.172 6.560   1.00 111.71 ? 354 ILE A N   1 
ATOM   2246 C  CA  . ILE A 1 362 ? 25.185  38.679 5.267   1.00 110.68 ? 354 ILE A CA  1 
ATOM   2247 C  C   . ILE A 1 362 ? 24.515  37.361 4.893   1.00 108.18 ? 354 ILE A C   1 
ATOM   2248 O  O   . ILE A 1 362 ? 24.796  36.318 5.486   1.00 106.47 ? 354 ILE A O   1 
ATOM   2249 C  CB  . ILE A 1 362 ? 26.713  38.484 5.243   1.00 116.66 ? 354 ILE A CB  1 
ATOM   2250 C  CG1 . ILE A 1 362 ? 27.424  39.775 5.655   1.00 122.07 ? 354 ILE A CG1 1 
ATOM   2251 C  CG2 . ILE A 1 362 ? 27.168  38.038 3.861   1.00 117.81 ? 354 ILE A CG2 1 
ATOM   2252 C  CD1 . ILE A 1 362 ? 28.933  39.658 5.695   1.00 134.83 ? 354 ILE A CD1 1 
ATOM   2253 N  N   . GLY A 1 363 ? 23.627  37.418 3.905   1.00 110.22 ? 355 GLY A N   1 
ATOM   2254 C  CA  . GLY A 1 363 ? 22.960  36.231 3.401   1.00 104.95 ? 355 GLY A CA  1 
ATOM   2255 C  C   . GLY A 1 363 ? 23.393  35.910 1.983   1.00 104.57 ? 355 GLY A C   1 
ATOM   2256 O  O   . GLY A 1 363 ? 24.493  36.277 1.568   1.00 106.63 ? 355 GLY A O   1 
ATOM   2257 N  N   . TYR A 1 364 ? 22.531  35.226 1.235   1.00 103.57 ? 356 TYR A N   1 
ATOM   2258 C  CA  . TYR A 1 364 ? 22.842  34.867 -0.145  1.00 102.17 ? 356 TYR A CA  1 
ATOM   2259 C  C   . TYR A 1 364 ? 21.602  34.476 -0.939  1.00 102.83 ? 356 TYR A C   1 
ATOM   2260 O  O   . TYR A 1 364 ? 20.560  34.148 -0.372  1.00 101.16 ? 356 TYR A O   1 
ATOM   2261 C  CB  . TYR A 1 364 ? 23.849  33.714 -0.184  1.00 101.27 ? 356 TYR A CB  1 
ATOM   2262 C  CG  . TYR A 1 364 ? 23.266  32.381 0.230   1.00 97.95  ? 356 TYR A CG  1 
ATOM   2263 C  CD1 . TYR A 1 364 ? 23.146  32.041 1.570   1.00 98.22  ? 356 TYR A CD1 1 
ATOM   2264 C  CD2 . TYR A 1 364 ? 22.835  31.462 -0.720  1.00 96.83  ? 356 TYR A CD2 1 
ATOM   2265 C  CE1 . TYR A 1 364 ? 22.613  30.825 1.954   1.00 95.26  ? 356 TYR A CE1 1 
ATOM   2266 C  CE2 . TYR A 1 364 ? 22.299  30.245 -0.345  1.00 94.99  ? 356 TYR A CE2 1 
ATOM   2267 C  CZ  . TYR A 1 364 ? 22.192  29.932 0.993   1.00 99.36  ? 356 TYR A CZ  1 
ATOM   2268 O  OH  . TYR A 1 364 ? 21.661  28.720 1.370   1.00 95.81  ? 356 TYR A OH  1 
ATOM   2269 N  N   . ILE A 1 365 ? 21.730  34.514 -2.261  1.00 97.07  ? 357 ILE A N   1 
ATOM   2270 C  CA  . ILE A 1 365 ? 20.715  33.977 -3.156  1.00 95.48  ? 357 ILE A CA  1 
ATOM   2271 C  C   . ILE A 1 365 ? 21.394  32.998 -4.110  1.00 97.38  ? 357 ILE A C   1 
ATOM   2272 O  O   . ILE A 1 365 ? 22.551  33.197 -4.484  1.00 98.63  ? 357 ILE A O   1 
ATOM   2273 C  CB  . ILE A 1 365 ? 19.992  35.085 -3.949  1.00 101.28 ? 357 ILE A CB  1 
ATOM   2274 C  CG1 . ILE A 1 365 ? 20.989  35.903 -4.774  1.00 105.16 ? 357 ILE A CG1 1 
ATOM   2275 C  CG2 . ILE A 1 365 ? 19.218  35.996 -3.008  1.00 102.56 ? 357 ILE A CG2 1 
ATOM   2276 C  CD1 . ILE A 1 365 ? 20.345  36.993 -5.606  1.00 116.91 ? 357 ILE A CD1 1 
ATOM   2277 N  N   . GLN A 1 366 ? 20.699  31.932 -4.495  1.00 96.86  ? 358 GLN A N   1 
ATOM   2278 C  CA  . GLN A 1 366 ? 21.326  30.935 -5.357  1.00 95.60  ? 358 GLN A CA  1 
ATOM   2279 C  C   . GLN A 1 366 ? 20.407  30.364 -6.434  1.00 100.51 ? 358 GLN A C   1 
ATOM   2280 O  O   . GLN A 1 366 ? 19.209  30.164 -6.227  1.00 98.23  ? 358 GLN A O   1 
ATOM   2281 C  CB  . GLN A 1 366 ? 21.896  29.790 -4.514  1.00 93.79  ? 358 GLN A CB  1 
ATOM   2282 C  CG  . GLN A 1 366 ? 20.864  28.952 -3.788  1.00 95.36  ? 358 GLN A CG  1 
ATOM   2283 C  CD  . GLN A 1 366 ? 21.408  27.599 -3.374  1.00 103.86 ? 358 GLN A CD  1 
ATOM   2284 O  OE1 . GLN A 1 366 ? 22.577  27.289 -3.606  1.00 96.40  ? 358 GLN A OE1 1 
ATOM   2285 N  NE2 . GLN A 1 366 ? 20.560  26.783 -2.759  1.00 97.12  ? 358 GLN A NE2 1 
ATOM   2286 N  N   . ALA A 1 367 ? 21.007  30.110 -7.591  1.00 102.16 ? 359 ALA A N   1 
ATOM   2287 C  CA  . ALA A 1 367 ? 20.333  29.501 -8.728  1.00 102.33 ? 359 ALA A CA  1 
ATOM   2288 C  C   . ALA A 1 367 ? 21.237  28.394 -9.268  1.00 107.52 ? 359 ALA A C   1 
ATOM   2289 O  O   . ALA A 1 367 ? 22.416  28.343 -8.914  1.00 107.18 ? 359 ALA A O   1 
ATOM   2290 C  CB  . ALA A 1 367 ? 20.038  30.545 -9.794  1.00 106.35 ? 359 ALA A CB  1 
ATOM   2291 N  N   . PRO A 1 368 ? 20.695  27.494 -10.111 1.00 99.19  ? 360 PRO A N   1 
ATOM   2292 C  CA  . PRO A 1 368 ? 21.534  26.422 -10.663 1.00 99.09  ? 360 PRO A CA  1 
ATOM   2293 C  C   . PRO A 1 368 ? 22.759  26.922 -11.433 1.00 107.32 ? 360 PRO A C   1 
ATOM   2294 O  O   . PRO A 1 368 ? 23.734  26.182 -11.568 1.00 107.49 ? 360 PRO A O   1 
ATOM   2295 C  CB  . PRO A 1 368 ? 20.577  25.683 -11.601 1.00 100.26 ? 360 PRO A CB  1 
ATOM   2296 C  CG  . PRO A 1 368 ? 19.240  25.896 -10.994 1.00 103.55 ? 360 PRO A CG  1 
ATOM   2297 C  CD  . PRO A 1 368 ? 19.273  27.296 -10.449 1.00 100.53 ? 360 PRO A CD  1 
ATOM   2298 N  N   . HIS A 1 369 ? 22.712  28.158 -11.920 1.00 97.80  ? 361 HIS A N   1 
ATOM   2299 C  CA  . HIS A 1 369 ? 23.820  28.711 -12.693 1.00 100.06 ? 361 HIS A CA  1 
ATOM   2300 C  C   . HIS A 1 369 ? 24.733  29.618 -11.867 1.00 104.97 ? 361 HIS A C   1 
ATOM   2301 O  O   . HIS A 1 369 ? 25.952  29.592 -12.038 1.00 106.60 ? 361 HIS A O   1 
ATOM   2302 C  CB  . HIS A 1 369 ? 23.289  29.483 -13.902 1.00 104.10 ? 361 HIS A CB  1 
ATOM   2303 C  CG  . HIS A 1 369 ? 22.199  30.453 -13.567 1.00 108.48 ? 361 HIS A CG  1 
ATOM   2304 N  ND1 . HIS A 1 369 ? 20.874  30.083 -13.481 1.00 108.61 ? 361 HIS A ND1 1 
ATOM   2305 C  CD2 . HIS A 1 369 ? 22.235  31.781 -13.298 1.00 113.08 ? 361 HIS A CD2 1 
ATOM   2306 C  CE1 . HIS A 1 369 ? 20.141  31.139 -13.175 1.00 109.82 ? 361 HIS A CE1 1 
ATOM   2307 N  NE2 . HIS A 1 369 ? 20.944  32.182 -13.057 1.00 112.77 ? 361 HIS A NE2 1 
ATOM   2308 N  N   . LYS A 1 370 ? 24.154  30.417 -10.974 1.00 99.18  ? 362 LYS A N   1 
ATOM   2309 C  CA  . LYS A 1 370 ? 24.949  31.362 -10.192 1.00 101.52 ? 362 LYS A CA  1 
ATOM   2310 C  C   . LYS A 1 370 ? 24.544  31.395 -8.719  1.00 103.86 ? 362 LYS A C   1 
ATOM   2311 O  O   . LYS A 1 370 ? 23.369  31.250 -8.379  1.00 100.96 ? 362 LYS A O   1 
ATOM   2312 C  CB  . LYS A 1 370 ? 24.839  32.766 -10.795 1.00 108.34 ? 362 LYS A CB  1 
ATOM   2313 C  CG  . LYS A 1 370 ? 25.894  33.753 -10.304 1.00 127.47 ? 362 LYS A CG  1 
ATOM   2314 C  CD  . LYS A 1 370 ? 27.302  33.216 -10.521 1.00 141.70 ? 362 LYS A CD  1 
ATOM   2315 C  CE  . LYS A 1 370 ? 28.241  34.293 -11.051 1.00 161.07 ? 362 LYS A CE  1 
ATOM   2316 N  NZ  . LYS A 1 370 ? 28.278  35.505 -10.187 1.00 174.49 ? 362 LYS A NZ  1 
ATOM   2317 N  N   . THR A 1 371 ? 25.536  31.584 -7.853  1.00 109.13 ? 363 THR A N   1 
ATOM   2318 C  CA  . THR A 1 371 ? 25.311  31.728 -6.418  1.00 107.15 ? 363 THR A CA  1 
ATOM   2319 C  C   . THR A 1 371 ? 26.206  32.835 -5.866  1.00 114.98 ? 363 THR A C   1 
ATOM   2320 O  O   . THR A 1 371 ? 27.426  32.792 -6.030  1.00 117.70 ? 363 THR A O   1 
ATOM   2321 C  CB  . THR A 1 371 ? 25.589  30.417 -5.658  1.00 105.44 ? 363 THR A CB  1 
ATOM   2322 O  OG1 . THR A 1 371 ? 24.694  29.396 -6.116  1.00 101.83 ? 363 THR A OG1 1 
ATOM   2323 C  CG2 . THR A 1 371 ? 25.406  30.615 -4.160  1.00 97.04  ? 363 THR A CG2 1 
ATOM   2324 N  N   . LEU A 1 372 ? 25.600  33.825 -5.217  1.00 108.40 ? 364 LEU A N   1 
ATOM   2325 C  CA  . LEU A 1 372 ? 26.346  34.974 -4.710  1.00 112.12 ? 364 LEU A CA  1 
ATOM   2326 C  C   . LEU A 1 372 ? 25.806  35.473 -3.368  1.00 115.90 ? 364 LEU A C   1 
ATOM   2327 O  O   . LEU A 1 372 ? 24.612  35.355 -3.094  1.00 113.44 ? 364 LEU A O   1 
ATOM   2328 C  CB  . LEU A 1 372 ? 26.332  36.107 -5.744  1.00 116.25 ? 364 LEU A CB  1 
ATOM   2329 C  CG  . LEU A 1 372 ? 25.001  36.501 -6.393  1.00 120.75 ? 364 LEU A CG  1 
ATOM   2330 C  CD1 . LEU A 1 372 ? 24.246  37.520 -5.551  1.00 121.32 ? 364 LEU A CD1 1 
ATOM   2331 C  CD2 . LEU A 1 372 ? 25.240  37.034 -7.797  1.00 128.10 ? 364 LEU A CD2 1 
ATOM   2332 N  N   . PRO A 1 373 ? 26.693  36.029 -2.525  1.00 112.82 ? 365 PRO A N   1 
ATOM   2333 C  CA  . PRO A 1 373 ? 26.303  36.585 -1.223  1.00 111.87 ? 365 PRO A CA  1 
ATOM   2334 C  C   . PRO A 1 373 ? 25.553  37.911 -1.343  1.00 114.98 ? 365 PRO A C   1 
ATOM   2335 O  O   . PRO A 1 373 ? 25.891  38.739 -2.190  1.00 116.32 ? 365 PRO A O   1 
ATOM   2336 C  CB  . PRO A 1 373 ? 27.646  36.786 -0.517  1.00 116.80 ? 365 PRO A CB  1 
ATOM   2337 C  CG  . PRO A 1 373 ? 28.616  36.991 -1.625  1.00 125.16 ? 365 PRO A CG  1 
ATOM   2338 C  CD  . PRO A 1 373 ? 28.151  36.090 -2.733  1.00 118.03 ? 365 PRO A CD  1 
ATOM   2339 N  N   . VAL A 1 374 ? 24.544  38.098 -0.499  1.00 110.29 ? 366 VAL A N   1 
ATOM   2340 C  CA  . VAL A 1 374 ? 23.752  39.325 -0.477  1.00 112.50 ? 366 VAL A CA  1 
ATOM   2341 C  C   . VAL A 1 374 ? 23.624  39.832 0.956   1.00 117.23 ? 366 VAL A C   1 
ATOM   2342 O  O   . VAL A 1 374 ? 23.286  39.065 1.856   1.00 114.06 ? 366 VAL A O   1 
ATOM   2343 C  CB  . VAL A 1 374 ? 22.340  39.107 -1.065  1.00 110.55 ? 366 VAL A CB  1 
ATOM   2344 C  CG1 . VAL A 1 374 ? 21.510  40.377 -0.951  1.00 113.28 ? 366 VAL A CG1 1 
ATOM   2345 C  CG2 . VAL A 1 374 ? 22.423  38.641 -2.512  1.00 110.81 ? 366 VAL A CG2 1 
ATOM   2346 N  N   . VAL A 1 375 ? 23.894  41.116 1.175   1.00 115.31 ? 367 VAL A N   1 
ATOM   2347 C  CA  . VAL A 1 375 ? 23.807  41.673 2.522   1.00 115.98 ? 367 VAL A CA  1 
ATOM   2348 C  C   . VAL A 1 375 ? 22.486  42.406 2.766   1.00 121.60 ? 367 VAL A C   1 
ATOM   2349 O  O   . VAL A 1 375 ? 22.130  43.339 2.046   1.00 124.57 ? 367 VAL A O   1 
ATOM   2350 C  CB  . VAL A 1 375 ? 24.989  42.634 2.820   1.00 125.94 ? 367 VAL A CB  1 
ATOM   2351 C  CG1 . VAL A 1 375 ? 25.205  43.618 1.677   1.00 130.65 ? 367 VAL A CG1 1 
ATOM   2352 C  CG2 . VAL A 1 375 ? 24.765  43.365 4.138   1.00 127.10 ? 367 VAL A CG2 1 
ATOM   2353 N  N   . PHE A 1 376 ? 21.757  41.961 3.786   1.00 118.61 ? 368 PHE A N   1 
ATOM   2354 C  CA  . PHE A 1 376 ? 20.536  42.633 4.216   1.00 119.13 ? 368 PHE A CA  1 
ATOM   2355 C  C   . PHE A 1 376 ? 20.897  43.697 5.245   1.00 131.02 ? 368 PHE A C   1 
ATOM   2356 O  O   . PHE A 1 376 ? 21.421  43.385 6.314   1.00 129.30 ? 368 PHE A O   1 
ATOM   2357 C  CB  . PHE A 1 376 ? 19.539  41.628 4.804   1.00 115.60 ? 368 PHE A CB  1 
ATOM   2358 C  CG  . PHE A 1 376 ? 18.131  42.154 4.927   1.00 116.18 ? 368 PHE A CG  1 
ATOM   2359 C  CD1 . PHE A 1 376 ? 17.776  43.381 4.391   1.00 121.99 ? 368 PHE A CD1 1 
ATOM   2360 C  CD2 . PHE A 1 376 ? 17.162  41.412 5.584   1.00 114.18 ? 368 PHE A CD2 1 
ATOM   2361 C  CE1 . PHE A 1 376 ? 16.482  43.858 4.508   1.00 122.97 ? 368 PHE A CE1 1 
ATOM   2362 C  CE2 . PHE A 1 376 ? 15.868  41.883 5.704   1.00 117.11 ? 368 PHE A CE2 1 
ATOM   2363 C  CZ  . PHE A 1 376 ? 15.527  43.107 5.165   1.00 118.65 ? 368 PHE A CZ  1 
ATOM   2364 N  N   . ASP A 1 377 ? 20.626  44.955 4.917   1.00 124.43 ? 369 ASP A N   1 
ATOM   2365 C  CA  . ASP A 1 377 ? 20.964  46.054 5.812   1.00 129.77 ? 369 ASP A CA  1 
ATOM   2366 C  C   . ASP A 1 377 ? 19.741  46.531 6.588   1.00 135.35 ? 369 ASP A C   1 
ATOM   2367 O  O   . ASP A 1 377 ? 18.686  46.789 6.009   1.00 134.81 ? 369 ASP A O   1 
ATOM   2368 C  CB  . ASP A 1 377 ? 21.580  47.213 5.028   1.00 138.38 ? 369 ASP A CB  1 
ATOM   2369 C  CG  . ASP A 1 377 ? 22.200  48.260 5.931   1.00 163.08 ? 369 ASP A CG  1 
ATOM   2370 O  OD1 . ASP A 1 377 ? 23.368  48.081 6.335   1.00 165.76 ? 369 ASP A OD1 1 
ATOM   2371 O  OD2 . ASP A 1 377 ? 21.519  49.261 6.239   1.00 175.59 ? 369 ASP A OD2 1 
ATOM   2372 N  N   . SER A 1 378 ? 19.891  46.641 7.903   1.00 138.10 ? 370 SER A N   1 
ATOM   2373 C  CA  . SER A 1 378 ? 18.808  47.092 8.771   1.00 139.43 ? 370 SER A CA  1 
ATOM   2374 C  C   . SER A 1 378 ? 18.479  48.561 8.531   1.00 152.75 ? 370 SER A C   1 
ATOM   2375 O  O   . SER A 1 378 ? 19.366  49.354 8.217   1.00 156.61 ? 370 SER A O   1 
ATOM   2376 C  CB  . SER A 1 378 ? 19.180  46.870 10.240  1.00 142.11 ? 370 SER A CB  1 
ATOM   2377 O  OG  . SER A 1 378 ? 18.268  47.516 11.111  1.00 153.04 ? 370 SER A OG  1 
ATOM   2378 N  N   . PRO A 1 379 ? 17.196  48.928 8.677   1.00 150.64 ? 371 PRO A N   1 
ATOM   2379 C  CA  . PRO A 1 379 ? 16.779  50.330 8.573   1.00 156.33 ? 371 PRO A CA  1 
ATOM   2380 C  C   . PRO A 1 379 ? 17.395  51.193 9.673   1.00 163.60 ? 371 PRO A C   1 
ATOM   2381 O  O   . PRO A 1 379 ? 17.519  52.407 9.507   1.00 168.50 ? 371 PRO A O   1 
ATOM   2382 C  CB  . PRO A 1 379 ? 15.255  50.258 8.719   1.00 157.06 ? 371 PRO A CB  1 
ATOM   2383 C  CG  . PRO A 1 379 ? 14.996  48.960 9.410   1.00 155.91 ? 371 PRO A CG  1 
ATOM   2384 C  CD  . PRO A 1 379 ? 16.050  48.030 8.903   1.00 148.72 ? 371 PRO A CD  1 
ATOM   2385 N  N   . ARG A 1 380 ? 17.778  50.566 10.782  1.00 159.53 ? 372 ARG A N   1 
ATOM   2386 C  CA  . ARG A 1 380 ? 18.406  51.276 11.890  1.00 161.71 ? 372 ARG A CA  1 
ATOM   2387 C  C   . ARG A 1 380 ? 19.869  51.581 11.589  1.00 168.20 ? 372 ARG A C   1 
ATOM   2388 O  O   . ARG A 1 380 ? 20.203  52.674 11.135  1.00 172.36 ? 372 ARG A O   1 
ATOM   2389 C  CB  . ARG A 1 380 ? 18.296  50.462 13.181  1.00 157.51 ? 372 ARG A CB  1 
ATOM   2390 N  N   . LYS A 1 390 ? 24.308  53.871 2.704   1.00 162.51 ? 382 LYS A N   1 
ATOM   2391 C  CA  . LYS A 1 390 ? 25.567  53.166 2.494   1.00 161.72 ? 382 LYS A CA  1 
ATOM   2392 C  C   . LYS A 1 390 ? 25.324  51.709 2.112   1.00 157.89 ? 382 LYS A C   1 
ATOM   2393 O  O   . LYS A 1 390 ? 24.927  50.895 2.945   1.00 152.31 ? 382 LYS A O   1 
ATOM   2394 C  CB  . LYS A 1 390 ? 26.441  53.244 3.747   1.00 161.91 ? 382 LYS A CB  1 
ATOM   2395 N  N   . ARG A 1 391 ? 25.566  51.390 0.845   1.00 163.05 ? 383 ARG A N   1 
ATOM   2396 C  CA  . ARG A 1 391 ? 25.369  50.036 0.343   1.00 155.78 ? 383 ARG A CA  1 
ATOM   2397 C  C   . ARG A 1 391 ? 26.667  49.463 -0.214  1.00 157.77 ? 383 ARG A C   1 
ATOM   2398 O  O   . ARG A 1 391 ? 27.322  50.087 -1.049  1.00 163.63 ? 383 ARG A O   1 
ATOM   2399 C  CB  . ARG A 1 391 ? 24.283  50.018 -0.733  1.00 155.90 ? 383 ARG A CB  1 
ATOM   2400 N  N   . VAL A 1 392 ? 27.035  48.274 0.251   1.00 162.28 ? 384 VAL A N   1 
ATOM   2401 C  CA  . VAL A 1 392 ? 28.262  47.633 -0.201  1.00 162.87 ? 384 VAL A CA  1 
ATOM   2402 C  C   . VAL A 1 392 ? 27.993  46.772 -1.432  1.00 160.49 ? 384 VAL A C   1 
ATOM   2403 O  O   . VAL A 1 392 ? 28.021  45.543 -1.364  1.00 156.72 ? 384 VAL A O   1 
ATOM   2404 C  CB  . VAL A 1 392 ? 28.891  46.765 0.907   1.00 163.83 ? 384 VAL A CB  1 
ATOM   2405 C  CG1 . VAL A 1 392 ? 30.353  46.477 0.589   1.00 166.37 ? 384 VAL A CG1 1 
ATOM   2406 C  CG2 . VAL A 1 392 ? 28.771  47.460 2.253   1.00 165.20 ? 384 VAL A CG2 1 
ATOM   2407 N  N   . MET A 1 393 ? 27.719  47.427 -2.556  1.00 159.53 ? 385 MET A N   1 
ATOM   2408 C  CA  . MET A 1 393 ? 27.502  46.724 -3.815  1.00 156.78 ? 385 MET A CA  1 
ATOM   2409 C  C   . MET A 1 393 ? 28.837  46.477 -4.511  1.00 160.41 ? 385 MET A C   1 
ATOM   2410 O  O   . MET A 1 393 ? 29.743  47.308 -4.446  1.00 165.03 ? 385 MET A O   1 
ATOM   2411 C  CB  . MET A 1 393 ? 26.570  47.517 -4.734  1.00 158.98 ? 385 MET A CB  1 
ATOM   2412 C  CG  . MET A 1 393 ? 25.304  48.038 -4.069  1.00 159.86 ? 385 MET A CG  1 
ATOM   2413 S  SD  . MET A 1 393 ? 24.191  48.810 -5.263  1.00 163.19 ? 385 MET A SD  1 
ATOM   2414 C  CE  . MET A 1 393 ? 23.150  49.792 -4.187  1.00 162.09 ? 385 MET A CE  1 
ATOM   2415 N  N   . GLY A 1 394 ? 28.955  45.332 -5.175  1.00 153.94 ? 386 GLY A N   1 
ATOM   2416 C  CA  . GLY A 1 394 ? 30.171  44.981 -5.888  1.00 154.67 ? 386 GLY A CA  1 
ATOM   2417 C  C   . GLY A 1 394 ? 30.014  43.691 -6.669  1.00 151.49 ? 386 GLY A C   1 
ATOM   2418 O  O   . GLY A 1 394 ? 28.932  43.102 -6.678  1.00 147.90 ? 386 GLY A O   1 
ATOM   2419 N  N   . PRO A 1 395 ? 31.092  43.244 -7.333  1.00 154.50 ? 387 PRO A N   1 
ATOM   2420 C  CA  . PRO A 1 395 ? 31.073  41.996 -8.106  1.00 150.73 ? 387 PRO A CA  1 
ATOM   2421 C  C   . PRO A 1 395 ? 30.753  40.791 -7.226  1.00 147.18 ? 387 PRO A C   1 
ATOM   2422 O  O   . PRO A 1 395 ? 31.500  40.508 -6.289  1.00 147.15 ? 387 PRO A O   1 
ATOM   2423 C  CB  . PRO A 1 395 ? 32.496  41.907 -8.671  1.00 154.00 ? 387 PRO A CB  1 
ATOM   2424 C  CG  . PRO A 1 395 ? 33.322  42.770 -7.774  1.00 160.13 ? 387 PRO A CG  1 
ATOM   2425 C  CD  . PRO A 1 395 ? 32.417  43.887 -7.356  1.00 159.30 ? 387 PRO A CD  1 
ATOM   2426 N  N   . ASP A 1 396 ? 29.654  40.105 -7.533  1.00 145.29 ? 388 ASP A N   1 
ATOM   2427 C  CA  . ASP A 1 396 ? 29.164  38.993 -6.721  1.00 140.81 ? 388 ASP A CA  1 
ATOM   2428 C  C   . ASP A 1 396 ? 28.943  39.406 -5.268  1.00 142.95 ? 388 ASP A C   1 
ATOM   2429 O  O   . ASP A 1 396 ? 29.377  38.716 -4.346  1.00 141.61 ? 388 ASP A O   1 
ATOM   2430 C  CB  . ASP A 1 396 ? 30.126  37.803 -6.784  1.00 139.87 ? 388 ASP A CB  1 
ATOM   2431 C  CG  . ASP A 1 396 ? 30.005  37.021 -8.076  1.00 142.74 ? 388 ASP A CG  1 
ATOM   2432 O  OD1 . ASP A 1 396 ? 29.491  37.580 -9.068  1.00 143.54 ? 388 ASP A OD1 1 
ATOM   2433 O  OD2 . ASP A 1 396 ? 30.424  35.845 -8.099  1.00 144.05 ? 388 ASP A OD2 1 
ATOM   2434 N  N   . PHE A 1 397 ? 28.274  40.537 -5.070  1.00 134.59 ? 389 PHE A N   1 
ATOM   2435 C  CA  . PHE A 1 397 ? 27.919  40.992 -3.730  1.00 134.39 ? 389 PHE A CA  1 
ATOM   2436 C  C   . PHE A 1 397 ? 26.615  41.781 -3.780  1.00 135.00 ? 389 PHE A C   1 
ATOM   2437 O  O   . PHE A 1 397 ? 26.597  42.953 -4.158  1.00 137.04 ? 389 PHE A O   1 
ATOM   2438 C  CB  . PHE A 1 397 ? 29.043  41.839 -3.127  1.00 139.37 ? 389 PHE A CB  1 
ATOM   2439 C  CG  . PHE A 1 397 ? 29.253  41.612 -1.654  1.00 140.30 ? 389 PHE A CG  1 
ATOM   2440 C  CD1 . PHE A 1 397 ? 29.882  40.464 -1.201  1.00 140.15 ? 389 PHE A CD1 1 
ATOM   2441 C  CD2 . PHE A 1 397 ? 28.828  42.548 -0.724  1.00 143.79 ? 389 PHE A CD2 1 
ATOM   2442 C  CE1 . PHE A 1 397 ? 30.079  40.249 0.150   1.00 142.31 ? 389 PHE A CE1 1 
ATOM   2443 C  CE2 . PHE A 1 397 ? 29.024  42.338 0.631   1.00 144.58 ? 389 PHE A CE2 1 
ATOM   2444 C  CZ  . PHE A 1 397 ? 29.650  41.188 1.067   1.00 143.00 ? 389 PHE A CZ  1 
ATOM   2445 N  N   . GLY A 1 398 ? 25.524  41.123 -3.401  1.00 127.01 ? 390 GLY A N   1 
ATOM   2446 C  CA  . GLY A 1 398 ? 24.202  41.713 -3.489  1.00 126.51 ? 390 GLY A CA  1 
ATOM   2447 C  C   . GLY A 1 398 ? 23.843  42.615 -2.324  1.00 129.73 ? 390 GLY A C   1 
ATOM   2448 O  O   . GLY A 1 398 ? 24.525  42.627 -1.300  1.00 130.14 ? 390 GLY A O   1 
ATOM   2449 N  N   . TYR A 1 399 ? 22.760  43.369 -2.484  1.00 132.14 ? 391 TYR A N   1 
ATOM   2450 C  CA  . TYR A 1 399 ? 22.297  44.289 -1.451  1.00 132.65 ? 391 TYR A CA  1 
ATOM   2451 C  C   . TYR A 1 399 ? 20.781  44.460 -1.510  1.00 134.44 ? 391 TYR A C   1 
ATOM   2452 O  O   . TYR A 1 399 ? 20.218  44.719 -2.574  1.00 134.75 ? 391 TYR A O   1 
ATOM   2453 C  CB  . TYR A 1 399 ? 22.988  45.647 -1.598  1.00 136.95 ? 391 TYR A CB  1 
ATOM   2454 C  CG  . TYR A 1 399 ? 22.642  46.636 -0.507  1.00 137.99 ? 391 TYR A CG  1 
ATOM   2455 C  CD1 . TYR A 1 399 ? 23.337  46.642 0.695   1.00 139.10 ? 391 TYR A CD1 1 
ATOM   2456 C  CD2 . TYR A 1 399 ? 21.626  47.566 -0.681  1.00 139.00 ? 391 TYR A CD2 1 
ATOM   2457 C  CE1 . TYR A 1 399 ? 23.027  47.543 1.694   1.00 140.27 ? 391 TYR A CE1 1 
ATOM   2458 C  CE2 . TYR A 1 399 ? 21.309  48.472 0.312   1.00 140.31 ? 391 TYR A CE2 1 
ATOM   2459 C  CZ  . TYR A 1 399 ? 22.013  48.455 1.498   1.00 144.43 ? 391 TYR A CZ  1 
ATOM   2460 O  OH  . TYR A 1 399 ? 21.704  49.354 2.494   1.00 146.99 ? 391 TYR A OH  1 
ATOM   2461 N  N   . VAL A 1 400 ? 20.125  44.315 -0.364  1.00 133.28 ? 392 VAL A N   1 
ATOM   2462 C  CA  . VAL A 1 400 ? 18.676  44.456 -0.288  1.00 132.48 ? 392 VAL A CA  1 
ATOM   2463 C  C   . VAL A 1 400 ? 18.292  45.241 0.968   1.00 137.52 ? 392 VAL A C   1 
ATOM   2464 O  O   . VAL A 1 400 ? 18.925  45.096 2.015   1.00 136.99 ? 392 VAL A O   1 
ATOM   2465 C  CB  . VAL A 1 400 ? 17.977  43.072 -0.300  1.00 129.87 ? 392 VAL A CB  1 
ATOM   2466 C  CG1 . VAL A 1 400 ? 18.481  42.199 0.842   1.00 127.32 ? 392 VAL A CG1 1 
ATOM   2467 C  CG2 . VAL A 1 400 ? 16.462  43.220 -0.250  1.00 127.97 ? 392 VAL A CG2 1 
ATOM   2468 N  N   . THR A 1 401 ? 17.273  46.089 0.855   1.00 148.47 ? 393 THR A N   1 
ATOM   2469 C  CA  . THR A 1 401 ? 16.825  46.900 1.984   1.00 149.35 ? 393 THR A CA  1 
ATOM   2470 C  C   . THR A 1 401 ? 15.303  46.988 2.060   1.00 151.85 ? 393 THR A C   1 
ATOM   2471 O  O   . THR A 1 401 ? 14.640  47.344 1.084   1.00 153.37 ? 393 THR A O   1 
ATOM   2472 C  CB  . THR A 1 401 ? 17.403  48.327 1.914   1.00 158.25 ? 393 THR A CB  1 
ATOM   2473 O  OG1 . THR A 1 401 ? 18.821  48.278 2.106   1.00 159.75 ? 393 THR A OG1 1 
ATOM   2474 C  CG2 . THR A 1 401 ? 16.785  49.210 2.989   1.00 157.33 ? 393 THR A CG2 1 
ATOM   2475 N  N   . ARG A 1 402 ? 14.757  46.662 3.228   1.00 182.94 ? 394 ARG A N   1 
ATOM   2476 C  CA  . ARG A 1 402 ? 13.318  46.732 3.455   1.00 180.61 ? 394 ARG A CA  1 
ATOM   2477 C  C   . ARG A 1 402 ? 13.011  47.158 4.887   1.00 185.14 ? 394 ARG A C   1 
ATOM   2478 O  O   . ARG A 1 402 ? 13.823  47.819 5.535   1.00 187.55 ? 394 ARG A O   1 
ATOM   2479 C  CB  . ARG A 1 402 ? 12.660  45.385 3.155   1.00 64.79  ? 394 ARG A CB  1 
ATOM   2480 N  N   . ILE A 1 409 ? 11.008  53.681 13.686  1.00 171.24 ? 401 ILE A N   1 
ATOM   2481 C  CA  . ILE A 1 409 ? 12.035  52.660 13.854  1.00 168.27 ? 401 ILE A CA  1 
ATOM   2482 C  C   . ILE A 1 409 ? 12.188  52.259 15.317  1.00 171.66 ? 401 ILE A C   1 
ATOM   2483 O  O   . ILE A 1 409 ? 12.442  53.100 16.179  1.00 174.50 ? 401 ILE A O   1 
ATOM   2484 C  CB  . ILE A 1 409 ? 13.399  53.139 13.315  1.00 172.79 ? 401 ILE A CB  1 
ATOM   2485 C  CG1 . ILE A 1 409 ? 13.341  53.304 11.795  1.00 171.31 ? 401 ILE A CG1 1 
ATOM   2486 C  CG2 . ILE A 1 409 ? 14.501  52.164 13.703  1.00 172.27 ? 401 ILE A CG2 1 
ATOM   2487 C  CD1 . ILE A 1 409 ? 14.665  53.693 11.172  1.00 177.67 ? 401 ILE A CD1 1 
ATOM   2488 N  N   . SER A 1 410 ? 12.027  50.969 15.589  1.00 163.76 ? 402 SER A N   1 
ATOM   2489 C  CA  . SER A 1 410 ? 12.188  50.444 16.938  1.00 162.25 ? 402 SER A CA  1 
ATOM   2490 C  C   . SER A 1 410 ? 13.583  49.854 17.126  1.00 163.10 ? 402 SER A C   1 
ATOM   2491 O  O   . SER A 1 410 ? 14.315  49.648 16.158  1.00 161.30 ? 402 SER A O   1 
ATOM   2492 C  CB  . SER A 1 410 ? 11.120  49.388 17.233  1.00 161.83 ? 402 SER A CB  1 
ATOM   2493 O  OG  . SER A 1 410 ? 11.232  48.903 18.560  1.00 166.80 ? 402 SER A OG  1 
ATOM   2494 N  N   . GLY A 1 411 ? 13.943  49.583 18.377  1.00 158.69 ? 403 GLY A N   1 
ATOM   2495 C  CA  . GLY A 1 411 ? 15.247  49.030 18.696  1.00 156.62 ? 403 GLY A CA  1 
ATOM   2496 C  C   . GLY A 1 411 ? 15.343  47.543 18.419  1.00 153.78 ? 403 GLY A C   1 
ATOM   2497 O  O   . GLY A 1 411 ? 16.400  46.937 18.588  1.00 152.07 ? 403 GLY A O   1 
ATOM   2498 N  N   . LEU A 1 412 ? 14.231  46.952 17.993  1.00 146.92 ? 404 LEU A N   1 
ATOM   2499 C  CA  . LEU A 1 412 ? 14.190  45.531 17.670  1.00 142.75 ? 404 LEU A CA  1 
ATOM   2500 C  C   . LEU A 1 412 ? 14.307  45.316 16.167  1.00 145.85 ? 404 LEU A C   1 
ATOM   2501 O  O   . LEU A 1 412 ? 14.185  44.194 15.678  1.00 144.03 ? 404 LEU A O   1 
ATOM   2502 C  CB  . LEU A 1 412 ? 12.901  44.898 18.199  1.00 141.46 ? 404 LEU A CB  1 
ATOM   2503 C  CG  . LEU A 1 412 ? 12.970  44.186 19.553  1.00 145.31 ? 404 LEU A CG  1 
ATOM   2504 C  CD1 . LEU A 1 412 ? 13.747  45.007 20.570  1.00 148.63 ? 404 LEU A CD1 1 
ATOM   2505 C  CD2 . LEU A 1 412 ? 11.570  43.892 20.067  1.00 145.70 ? 404 LEU A CD2 1 
ATOM   2506 N  N   . ASP A 1 413 ? 14.544  46.403 15.442  1.00 132.00 ? 405 ASP A N   1 
ATOM   2507 C  CA  . ASP A 1 413 ? 14.668  46.350 13.991  1.00 130.58 ? 405 ASP A CA  1 
ATOM   2508 C  C   . ASP A 1 413 ? 16.110  46.093 13.570  1.00 133.88 ? 405 ASP A C   1 
ATOM   2509 O  O   . ASP A 1 413 ? 16.386  45.829 12.400  1.00 133.10 ? 405 ASP A O   1 
ATOM   2510 C  CB  . ASP A 1 413 ? 14.156  47.648 13.363  1.00 134.12 ? 405 ASP A CB  1 
ATOM   2511 C  CG  . ASP A 1 413 ? 12.687  47.888 13.645  1.00 138.16 ? 405 ASP A CG  1 
ATOM   2512 O  OD1 . ASP A 1 413 ? 11.927  46.900 13.717  1.00 136.33 ? 405 ASP A OD1 1 
ATOM   2513 O  OD2 . ASP A 1 413 ? 12.293  49.063 13.797  1.00 142.68 ? 405 ASP A OD2 1 
ATOM   2514 N  N   . SER A 1 414 ? 17.025  46.177 14.529  1.00 132.37 ? 406 SER A N   1 
ATOM   2515 C  CA  . SER A 1 414 ? 18.430  45.896 14.266  1.00 134.15 ? 406 SER A CA  1 
ATOM   2516 C  C   . SER A 1 414 ? 18.619  44.395 14.086  1.00 131.66 ? 406 SER A C   1 
ATOM   2517 O  O   . SER A 1 414 ? 17.819  43.601 14.581  1.00 128.17 ? 406 SER A O   1 
ATOM   2518 C  CB  . SER A 1 414 ? 19.311  46.424 15.398  1.00 140.78 ? 406 SER A CB  1 
ATOM   2519 O  OG  . SER A 1 414 ? 20.666  46.513 14.991  1.00 149.12 ? 406 SER A OG  1 
ATOM   2520 N  N   . PHE A 1 415 ? 19.676  44.005 13.381  1.00 129.31 ? 407 PHE A N   1 
ATOM   2521 C  CA  . PHE A 1 415 ? 19.847  42.607 13.005  1.00 126.43 ? 407 PHE A CA  1 
ATOM   2522 C  C   . PHE A 1 415 ? 20.690  41.820 14.004  1.00 129.13 ? 407 PHE A C   1 
ATOM   2523 O  O   . PHE A 1 415 ? 21.161  40.724 13.702  1.00 128.66 ? 407 PHE A O   1 
ATOM   2524 C  CB  . PHE A 1 415 ? 20.453  42.509 11.604  1.00 128.18 ? 407 PHE A CB  1 
ATOM   2525 C  CG  . PHE A 1 415 ? 19.477  42.822 10.502  1.00 126.07 ? 407 PHE A CG  1 
ATOM   2526 C  CD1 . PHE A 1 415 ? 18.144  43.067 10.791  1.00 124.52 ? 407 PHE A CD1 1 
ATOM   2527 C  CD2 . PHE A 1 415 ? 19.886  42.858 9.180   1.00 127.88 ? 407 PHE A CD2 1 
ATOM   2528 C  CE1 . PHE A 1 415 ? 17.241  43.352 9.787   1.00 122.78 ? 407 PHE A CE1 1 
ATOM   2529 C  CE2 . PHE A 1 415 ? 18.984  43.141 8.170   1.00 127.17 ? 407 PHE A CE2 1 
ATOM   2530 C  CZ  . PHE A 1 415 ? 17.661  43.388 8.475   1.00 123.05 ? 407 PHE A CZ  1 
ATOM   2531 N  N   . GLY A 1 416 ? 20.873  42.381 15.194  1.00 125.19 ? 408 GLY A N   1 
ATOM   2532 C  CA  . GLY A 1 416 ? 21.421  41.625 16.304  1.00 125.87 ? 408 GLY A CA  1 
ATOM   2533 C  C   . GLY A 1 416 ? 20.278  40.816 16.885  1.00 123.02 ? 408 GLY A C   1 
ATOM   2534 O  O   . GLY A 1 416 ? 20.477  39.788 17.533  1.00 122.73 ? 408 GLY A O   1 
ATOM   2535 N  N   . ASN A 1 417 ? 19.066  41.302 16.632  1.00 122.70 ? 409 ASN A N   1 
ATOM   2536 C  CA  . ASN A 1 417 ? 17.837  40.625 17.022  1.00 118.44 ? 409 ASN A CA  1 
ATOM   2537 C  C   . ASN A 1 417 ? 17.441  39.596 15.965  1.00 116.61 ? 409 ASN A C   1 
ATOM   2538 O  O   . ASN A 1 417 ? 16.401  38.951 16.068  1.00 113.69 ? 409 ASN A O   1 
ATOM   2539 C  CB  . ASN A 1 417 ? 16.714  41.650 17.228  1.00 116.29 ? 409 ASN A CB  1 
ATOM   2540 C  CG  . ASN A 1 417 ? 15.507  41.072 17.948  1.00 116.48 ? 409 ASN A CG  1 
ATOM   2541 O  OD1 . ASN A 1 417 ? 14.554  40.614 17.318  1.00 110.90 ? 409 ASN A OD1 1 
ATOM   2542 N  ND2 . ASN A 1 417 ? 15.536  41.106 19.273  1.00 110.30 ? 409 ASN A ND2 1 
ATOM   2543 N  N   . LEU A 1 418 ? 18.288  39.442 14.950  1.00 114.66 ? 410 LEU A N   1 
ATOM   2544 C  CA  . LEU A 1 418 ? 18.006  38.539 13.838  1.00 111.18 ? 410 LEU A CA  1 
ATOM   2545 C  C   . LEU A 1 418 ? 19.057  37.438 13.715  1.00 113.88 ? 410 LEU A C   1 
ATOM   2546 O  O   . LEU A 1 418 ? 20.216  37.707 13.400  1.00 116.79 ? 410 LEU A O   1 
ATOM   2547 C  CB  . LEU A 1 418 ? 17.920  39.331 12.531  1.00 110.94 ? 410 LEU A CB  1 
ATOM   2548 C  CG  . LEU A 1 418 ? 17.717  38.546 11.235  1.00 111.61 ? 410 LEU A CG  1 
ATOM   2549 C  CD1 . LEU A 1 418 ? 16.464  37.698 11.316  1.00 107.46 ? 410 LEU A CD1 1 
ATOM   2550 C  CD2 . LEU A 1 418 ? 17.648  39.492 10.046  1.00 113.50 ? 410 LEU A CD2 1 
ATOM   2551 N  N   . GLU A 1 419 ? 18.643  36.198 13.960  1.00 101.21 ? 411 GLU A N   1 
ATOM   2552 C  CA  . GLU A 1 419 ? 19.543  35.050 13.871  1.00 103.12 ? 411 GLU A CA  1 
ATOM   2553 C  C   . GLU A 1 419 ? 18.849  33.851 13.232  1.00 100.94 ? 411 GLU A C   1 
ATOM   2554 O  O   . GLU A 1 419 ? 17.644  33.882 12.981  1.00 98.05  ? 411 GLU A O   1 
ATOM   2555 C  CB  . GLU A 1 419 ? 20.072  34.673 15.256  1.00 106.32 ? 411 GLU A CB  1 
ATOM   2556 C  CG  . GLU A 1 419 ? 21.133  35.618 15.803  1.00 118.38 ? 411 GLU A CG  1 
ATOM   2557 C  CD  . GLU A 1 419 ? 22.503  35.374 15.196  1.00 139.30 ? 411 GLU A CD  1 
ATOM   2558 O  OE1 . GLU A 1 419 ? 23.208  36.360 14.897  1.00 144.82 ? 411 GLU A OE1 1 
ATOM   2559 O  OE2 . GLU A 1 419 ? 22.877  34.194 15.028  1.00 135.20 ? 411 GLU A OE2 1 
ATOM   2560 N  N   . VAL A 1 420 ? 19.613  32.794 12.973  1.00 96.54  ? 412 VAL A N   1 
ATOM   2561 C  CA  . VAL A 1 420 ? 19.057  31.596 12.354  1.00 92.98  ? 412 VAL A CA  1 
ATOM   2562 C  C   . VAL A 1 420 ? 19.671  30.323 12.943  1.00 96.88  ? 412 VAL A C   1 
ATOM   2563 O  O   . VAL A 1 420 ? 20.856  30.283 13.282  1.00 101.35 ? 412 VAL A O   1 
ATOM   2564 C  CB  . VAL A 1 420 ? 19.253  31.622 10.818  1.00 94.12  ? 412 VAL A CB  1 
ATOM   2565 C  CG1 . VAL A 1 420 ? 20.732  31.608 10.455  1.00 98.51  ? 412 VAL A CG1 1 
ATOM   2566 C  CG2 . VAL A 1 420 ? 18.512  30.467 10.153  1.00 90.71  ? 412 VAL A CG2 1 
ATOM   2567 N  N   . SER A 1 421 ? 18.843  29.290 13.074  1.00 89.17  ? 413 SER A N   1 
ATOM   2568 C  CA  . SER A 1 421 ? 19.250  28.014 13.652  1.00 90.69  ? 413 SER A CA  1 
ATOM   2569 C  C   . SER A 1 421 ? 19.882  27.097 12.605  1.00 95.17  ? 413 SER A C   1 
ATOM   2570 O  O   . SER A 1 421 ? 19.744  27.338 11.407  1.00 94.65  ? 413 SER A O   1 
ATOM   2571 C  CB  . SER A 1 421 ? 18.041  27.324 14.290  1.00 89.33  ? 413 SER A CB  1 
ATOM   2572 O  OG  . SER A 1 421 ? 17.125  26.891 13.299  1.00 87.36  ? 413 SER A OG  1 
ATOM   2573 N  N   . PRO A 1 422 ? 20.592  26.048 13.055  1.00 97.03  ? 414 PRO A N   1 
ATOM   2574 C  CA  . PRO A 1 422 ? 21.092  25.009 12.146  1.00 97.50  ? 414 PRO A CA  1 
ATOM   2575 C  C   . PRO A 1 422 ? 19.950  24.179 11.560  1.00 96.09  ? 414 PRO A C   1 
ATOM   2576 O  O   . PRO A 1 422 ? 18.821  24.300 12.037  1.00 93.27  ? 414 PRO A O   1 
ATOM   2577 C  CB  . PRO A 1 422 ? 21.987  24.152 13.051  1.00 102.62 ? 414 PRO A CB  1 
ATOM   2578 C  CG  . PRO A 1 422 ? 22.348  25.042 14.187  1.00 106.96 ? 414 PRO A CG  1 
ATOM   2579 C  CD  . PRO A 1 422 ? 21.142  25.892 14.412  1.00 101.01 ? 414 PRO A CD  1 
ATOM   2580 N  N   . PRO A 1 423 ? 20.232  23.358 10.533  1.00 96.49  ? 415 PRO A N   1 
ATOM   2581 C  CA  . PRO A 1 423 ? 19.205  22.460 9.989   1.00 94.47  ? 415 PRO A CA  1 
ATOM   2582 C  C   . PRO A 1 423 ? 18.602  21.544 11.053  1.00 98.81  ? 415 PRO A C   1 
ATOM   2583 O  O   . PRO A 1 423 ? 19.336  20.837 11.746  1.00 102.00 ? 415 PRO A O   1 
ATOM   2584 C  CB  . PRO A 1 423 ? 19.971  21.647 8.943   1.00 97.05  ? 415 PRO A CB  1 
ATOM   2585 C  CG  . PRO A 1 423 ? 21.064  22.544 8.509   1.00 101.08 ? 415 PRO A CG  1 
ATOM   2586 C  CD  . PRO A 1 423 ? 21.468  23.326 9.730   1.00 99.73  ? 415 PRO A CD  1 
ATOM   2587 N  N   . VAL A 1 424 ? 17.279  21.571 11.184  1.00 98.66  ? 416 VAL A N   1 
ATOM   2588 C  CA  . VAL A 1 424 ? 16.584  20.747 12.170  1.00 99.63  ? 416 VAL A CA  1 
ATOM   2589 C  C   . VAL A 1 424 ? 15.344  20.078 11.583  1.00 100.80 ? 416 VAL A C   1 
ATOM   2590 O  O   . VAL A 1 424 ? 14.877  20.444 10.503  1.00 98.22  ? 416 VAL A O   1 
ATOM   2591 C  CB  . VAL A 1 424 ? 16.156  21.573 13.404  1.00 101.88 ? 416 VAL A CB  1 
ATOM   2592 C  CG1 . VAL A 1 424 ? 17.373  22.074 14.167  1.00 104.75 ? 416 VAL A CG1 1 
ATOM   2593 C  CG2 . VAL A 1 424 ? 15.265  22.732 12.986  1.00 98.57  ? 416 VAL A CG2 1 
ATOM   2594 N  N   . THR A 1 425 ? 14.819  19.093 12.305  1.00 102.40 ? 417 THR A N   1 
ATOM   2595 C  CA  . THR A 1 425 ? 13.576  18.430 11.929  1.00 101.22 ? 417 THR A CA  1 
ATOM   2596 C  C   . THR A 1 425 ? 12.616  18.430 13.116  1.00 104.38 ? 417 THR A C   1 
ATOM   2597 O  O   . THR A 1 425 ? 12.894  17.816 14.146  1.00 107.83 ? 417 THR A O   1 
ATOM   2598 C  CB  . THR A 1 425 ? 13.815  16.984 11.460  1.00 109.43 ? 417 THR A CB  1 
ATOM   2599 O  OG1 . THR A 1 425 ? 14.765  16.978 10.387  1.00 110.57 ? 417 THR A OG1 1 
ATOM   2600 C  CG2 . THR A 1 425 ? 12.512  16.358 10.984  1.00 108.12 ? 417 THR A CG2 1 
ATOM   2601 N  N   . VAL A 1 426 ? 11.489  19.119 12.965  1.00 98.91  ? 418 VAL A N   1 
ATOM   2602 C  CA  . VAL A 1 426 ? 10.567  19.329 14.077  1.00 99.34  ? 418 VAL A CA  1 
ATOM   2603 C  C   . VAL A 1 426 ? 9.243   18.590 13.897  1.00 100.66 ? 418 VAL A C   1 
ATOM   2604 O  O   . VAL A 1 426 ? 8.342   19.077 13.211  1.00 98.10  ? 418 VAL A O   1 
ATOM   2605 C  CB  . VAL A 1 426 ? 10.267  20.827 14.272  1.00 100.06 ? 418 VAL A CB  1 
ATOM   2606 C  CG1 . VAL A 1 426 ? 9.575   21.063 15.607  1.00 101.76 ? 418 VAL A CG1 1 
ATOM   2607 C  CG2 . VAL A 1 426 ? 11.547  21.639 14.181  1.00 99.98  ? 418 VAL A CG2 1 
ATOM   2608 N  N   . ARG A 1 427 ? 9.137   17.421 14.527  1.00 105.63 ? 419 ARG A N   1 
ATOM   2609 C  CA  . ARG A 1 427 ? 7.911   16.623 14.521  1.00 106.17 ? 419 ARG A CA  1 
ATOM   2610 C  C   . ARG A 1 427 ? 7.396   16.351 13.112  1.00 106.32 ? 419 ARG A C   1 
ATOM   2611 O  O   . ARG A 1 427 ? 6.230   16.605 12.810  1.00 105.19 ? 419 ARG A O   1 
ATOM   2612 C  CB  . ARG A 1 427 ? 6.820   17.316 15.344  1.00 103.05 ? 419 ARG A CB  1 
ATOM   2613 N  N   . GLY A 1 428 ? 8.270   15.840 12.252  1.00 106.59 ? 420 GLY A N   1 
ATOM   2614 C  CA  . GLY A 1 428 ? 7.892   15.529 10.887  1.00 105.54 ? 420 GLY A CA  1 
ATOM   2615 C  C   . GLY A 1 428 ? 8.441   16.512 9.869   1.00 104.93 ? 420 GLY A C   1 
ATOM   2616 O  O   . GLY A 1 428 ? 9.168   16.123 8.956   1.00 105.77 ? 420 GLY A O   1 
ATOM   2617 N  N   . LYS A 1 429 ? 8.091   17.786 10.025  1.00 100.75 ? 421 LYS A N   1 
ATOM   2618 C  CA  . LYS A 1 429 ? 8.521   18.823 9.091   1.00 97.57  ? 421 LYS A CA  1 
ATOM   2619 C  C   . LYS A 1 429 ? 10.043  18.976 9.103   1.00 100.13 ? 421 LYS A C   1 
ATOM   2620 O  O   . LYS A 1 429 ? 10.657  19.060 10.166  1.00 100.82 ? 421 LYS A O   1 
ATOM   2621 C  CB  . LYS A 1 429 ? 7.853   20.158 9.429   1.00 96.17  ? 421 LYS A CB  1 
ATOM   2622 C  CG  . LYS A 1 429 ? 7.970   21.219 8.342   1.00 96.86  ? 421 LYS A CG  1 
ATOM   2623 C  CD  . LYS A 1 429 ? 7.069   20.908 7.154   1.00 100.06 ? 421 LYS A CD  1 
ATOM   2624 C  CE  . LYS A 1 429 ? 7.187   21.973 6.071   1.00 99.62  ? 421 LYS A CE  1 
ATOM   2625 N  NZ  . LYS A 1 429 ? 8.559   22.034 5.493   1.00 102.54 ? 421 LYS A NZ  1 
ATOM   2626 N  N   . GLU A 1 430 ? 10.646  19.000 7.917   1.00 95.18  ? 422 GLU A N   1 
ATOM   2627 C  CA  . GLU A 1 430 ? 12.094  19.148 7.800   1.00 96.48  ? 422 GLU A CA  1 
ATOM   2628 C  C   . GLU A 1 430 ? 12.482  20.577 7.435   1.00 94.92  ? 422 GLU A C   1 
ATOM   2629 O  O   . GLU A 1 430 ? 11.921  21.166 6.512   1.00 92.05  ? 422 GLU A O   1 
ATOM   2630 C  CB  . GLU A 1 430 ? 12.659  18.173 6.758   1.00 99.52  ? 422 GLU A CB  1 
ATOM   2631 C  CG  . GLU A 1 430 ? 14.176  18.259 6.597   1.00 111.05 ? 422 GLU A CG  1 
ATOM   2632 C  CD  . GLU A 1 430 ? 14.739  17.234 5.625   1.00 128.04 ? 422 GLU A CD  1 
ATOM   2633 O  OE1 . GLU A 1 430 ? 15.979  17.176 5.478   1.00 123.77 ? 422 GLU A OE1 1 
ATOM   2634 O  OE2 . GLU A 1 430 ? 13.948  16.488 5.010   1.00 126.43 ? 422 GLU A OE2 1 
ATOM   2635 N  N   . TYR A 1 431 ? 13.443  21.126 8.170   1.00 92.62  ? 423 TYR A N   1 
ATOM   2636 C  CA  . TYR A 1 431 ? 13.972  22.455 7.885   1.00 91.48  ? 423 TYR A CA  1 
ATOM   2637 C  C   . TYR A 1 431 ? 15.467  22.373 7.596   1.00 95.89  ? 423 TYR A C   1 
ATOM   2638 O  O   . TYR A 1 431 ? 16.288  22.649 8.472   1.00 97.39  ? 423 TYR A O   1 
ATOM   2639 C  CB  . TYR A 1 431 ? 13.707  23.408 9.052   1.00 91.44  ? 423 TYR A CB  1 
ATOM   2640 C  CG  . TYR A 1 431 ? 12.239  23.614 9.350   1.00 90.33  ? 423 TYR A CG  1 
ATOM   2641 C  CD1 . TYR A 1 431 ? 11.544  24.684 8.806   1.00 88.27  ? 423 TYR A CD1 1 
ATOM   2642 C  CD2 . TYR A 1 431 ? 11.548  22.736 10.175  1.00 92.69  ? 423 TYR A CD2 1 
ATOM   2643 C  CE1 . TYR A 1 431 ? 10.200  24.876 9.075   1.00 86.32  ? 423 TYR A CE1 1 
ATOM   2644 C  CE2 . TYR A 1 431 ? 10.206  22.919 10.450  1.00 92.26  ? 423 TYR A CE2 1 
ATOM   2645 C  CZ  . TYR A 1 431 ? 9.536   23.990 9.897   1.00 92.46  ? 423 TYR A CZ  1 
ATOM   2646 O  OH  . TYR A 1 431 ? 8.198   24.177 10.167  1.00 93.09  ? 423 TYR A OH  1 
ATOM   2647 N  N   . PRO A 1 432 ? 15.822  21.993 6.358   1.00 93.05  ? 424 PRO A N   1 
ATOM   2648 C  CA  . PRO A 1 432 ? 17.216  21.770 5.959   1.00 95.79  ? 424 PRO A CA  1 
ATOM   2649 C  C   . PRO A 1 432 ? 17.999  23.069 5.804   1.00 98.75  ? 424 PRO A C   1 
ATOM   2650 O  O   . PRO A 1 432 ? 19.216  23.034 5.619   1.00 102.01 ? 424 PRO A O   1 
ATOM   2651 C  CB  . PRO A 1 432 ? 17.080  21.051 4.617   1.00 97.43  ? 424 PRO A CB  1 
ATOM   2652 C  CG  . PRO A 1 432 ? 15.802  21.560 4.060   1.00 96.89  ? 424 PRO A CG  1 
ATOM   2653 C  CD  . PRO A 1 432 ? 14.889  21.770 5.239   1.00 92.21  ? 424 PRO A CD  1 
ATOM   2654 N  N   . LEU A 1 433 ? 17.305  24.199 5.876   1.00 93.62  ? 425 LEU A N   1 
ATOM   2655 C  CA  . LEU A 1 433 ? 17.953  25.500 5.787   1.00 94.35  ? 425 LEU A CA  1 
ATOM   2656 C  C   . LEU A 1 433 ? 17.842  26.245 7.114   1.00 96.27  ? 425 LEU A C   1 
ATOM   2657 O  O   . LEU A 1 433 ? 18.146  27.435 7.196   1.00 96.87  ? 425 LEU A O   1 
ATOM   2658 C  CB  . LEU A 1 433 ? 17.342  26.328 4.656   1.00 92.93  ? 425 LEU A CB  1 
ATOM   2659 C  CG  . LEU A 1 433 ? 17.385  25.693 3.263   1.00 95.74  ? 425 LEU A CG  1 
ATOM   2660 C  CD1 . LEU A 1 433 ? 16.717  26.594 2.235   1.00 94.21  ? 425 LEU A CD1 1 
ATOM   2661 C  CD2 . LEU A 1 433 ? 18.817  25.379 2.855   1.00 100.68 ? 425 LEU A CD2 1 
ATOM   2662 N  N   . GLY A 1 434 ? 17.406  25.533 8.149   1.00 93.29  ? 426 GLY A N   1 
ATOM   2663 C  CA  . GLY A 1 434 ? 17.265  26.108 9.474   1.00 93.11  ? 426 GLY A CA  1 
ATOM   2664 C  C   . GLY A 1 434 ? 16.030  26.978 9.605   1.00 92.35  ? 426 GLY A C   1 
ATOM   2665 O  O   . GLY A 1 434 ? 15.232  27.083 8.673   1.00 90.07  ? 426 GLY A O   1 
ATOM   2666 N  N   . ARG A 1 435 ? 15.870  27.600 10.769  1.00 88.53  ? 427 ARG A N   1 
ATOM   2667 C  CA  . ARG A 1 435 ? 14.753  28.509 11.000  1.00 85.39  ? 427 ARG A CA  1 
ATOM   2668 C  C   . ARG A 1 435 ? 15.238  29.858 11.523  1.00 88.59  ? 427 ARG A C   1 
ATOM   2669 O  O   . ARG A 1 435 ? 16.095  29.922 12.404  1.00 91.30  ? 427 ARG A O   1 
ATOM   2670 C  CB  . ARG A 1 435 ? 13.750  27.897 11.982  1.00 83.33  ? 427 ARG A CB  1 
ATOM   2671 C  CG  . ARG A 1 435 ? 13.111  26.606 11.496  1.00 82.89  ? 427 ARG A CG  1 
ATOM   2672 C  CD  . ARG A 1 435 ? 11.944  26.190 12.379  1.00 82.80  ? 427 ARG A CD  1 
ATOM   2673 N  NE  . ARG A 1 435 ? 10.846  27.151 12.320  1.00 81.39  ? 427 ARG A NE  1 
ATOM   2674 C  CZ  . ARG A 1 435 ? 9.632   26.928 12.812  1.00 88.59  ? 427 ARG A CZ  1 
ATOM   2675 N  NH1 . ARG A 1 435 ? 8.694   27.860 12.716  1.00 83.96  ? 427 ARG A NH1 1 
ATOM   2676 N  NH2 . ARG A 1 435 ? 9.353   25.772 13.400  1.00 84.45  ? 427 ARG A NH2 1 
ATOM   2677 N  N   . ILE A 1 436 ? 14.685  30.932 10.969  1.00 85.06  ? 428 ILE A N   1 
ATOM   2678 C  CA  . ILE A 1 436 ? 15.017  32.284 11.403  1.00 86.07  ? 428 ILE A CA  1 
ATOM   2679 C  C   . ILE A 1 436 ? 14.450  32.565 12.796  1.00 89.26  ? 428 ILE A C   1 
ATOM   2680 O  O   . ILE A 1 436 ? 13.307  32.220 13.094  1.00 87.44  ? 428 ILE A O   1 
ATOM   2681 C  CB  . ILE A 1 436 ? 14.491  33.334 10.398  1.00 85.75  ? 428 ILE A CB  1 
ATOM   2682 C  CG1 . ILE A 1 436 ? 15.359  33.339 9.138   1.00 87.13  ? 428 ILE A CG1 1 
ATOM   2683 C  CG2 . ILE A 1 436 ? 14.463  34.722 11.018  1.00 86.07  ? 428 ILE A CG2 1 
ATOM   2684 C  CD1 . ILE A 1 436 ? 14.966  34.391 8.131   1.00 87.50  ? 428 ILE A CD1 1 
ATOM   2685 N  N   . LEU A 1 437 ? 15.264  33.179 13.649  1.00 86.85  ? 429 LEU A N   1 
ATOM   2686 C  CA  . LEU A 1 437 ? 14.852  33.507 15.009  1.00 87.83  ? 429 LEU A CA  1 
ATOM   2687 C  C   . LEU A 1 437 ? 14.954  35.008 15.271  1.00 90.98  ? 429 LEU A C   1 
ATOM   2688 O  O   . LEU A 1 437 ? 16.022  35.598 15.112  1.00 92.98  ? 429 LEU A O   1 
ATOM   2689 C  CB  . LEU A 1 437 ? 15.710  32.743 16.022  1.00 90.54  ? 429 LEU A CB  1 
ATOM   2690 C  CG  . LEU A 1 437 ? 15.751  31.218 15.902  1.00 92.68  ? 429 LEU A CG  1 
ATOM   2691 C  CD1 . LEU A 1 437 ? 16.900  30.644 16.714  1.00 96.06  ? 429 LEU A CD1 1 
ATOM   2692 C  CD2 . LEU A 1 437 ? 14.433  30.615 16.351  1.00 92.11  ? 429 LEU A CD2 1 
ATOM   2693 N  N   . PHE A 1 438 ? 13.843  35.625 15.662  1.00 92.51  ? 430 PHE A N   1 
ATOM   2694 C  CA  . PHE A 1 438 ? 13.868  37.023 16.088  1.00 93.56  ? 430 PHE A CA  1 
ATOM   2695 C  C   . PHE A 1 438 ? 13.018  37.229 17.340  1.00 97.77  ? 430 PHE A C   1 
ATOM   2696 O  O   . PHE A 1 438 ? 12.170  36.401 17.670  1.00 96.85  ? 430 PHE A O   1 
ATOM   2697 C  CB  . PHE A 1 438 ? 13.403  37.954 14.962  1.00 93.05  ? 430 PHE A CB  1 
ATOM   2698 C  CG  . PHE A 1 438 ? 11.946  37.825 14.616  1.00 91.94  ? 430 PHE A CG  1 
ATOM   2699 C  CD1 . PHE A 1 438 ? 11.005  38.667 15.188  1.00 94.88  ? 430 PHE A CD1 1 
ATOM   2700 C  CD2 . PHE A 1 438 ? 11.521  36.877 13.701  1.00 91.01  ? 430 PHE A CD2 1 
ATOM   2701 C  CE1 . PHE A 1 438 ? 9.666   38.554 14.864  1.00 94.52  ? 430 PHE A CE1 1 
ATOM   2702 C  CE2 . PHE A 1 438 ? 10.185  36.760 13.373  1.00 91.57  ? 430 PHE A CE2 1 
ATOM   2703 C  CZ  . PHE A 1 438 ? 9.256   37.599 13.955  1.00 92.06  ? 430 PHE A CZ  1 
ATOM   2704 N  N   . GLY A 1 439 ? 13.252  38.341 18.031  1.00 97.77  ? 431 GLY A N   1 
ATOM   2705 C  CA  . GLY A 1 439 ? 12.623  38.585 19.316  1.00 99.49  ? 431 GLY A CA  1 
ATOM   2706 C  C   . GLY A 1 439 ? 11.388  39.461 19.269  1.00 102.48 ? 431 GLY A C   1 
ATOM   2707 O  O   . GLY A 1 439 ? 11.194  40.240 18.335  1.00 101.40 ? 431 GLY A O   1 
ATOM   2708 N  N   . ASP A 1 440 ? 10.555  39.332 20.296  1.00 102.59 ? 432 ASP A N   1 
ATOM   2709 C  CA  . ASP A 1 440 ? 9.310   40.081 20.384  1.00 103.91 ? 432 ASP A CA  1 
ATOM   2710 C  C   . ASP A 1 440 ? 8.797   40.066 21.819  1.00 108.91 ? 432 ASP A C   1 
ATOM   2711 O  O   . ASP A 1 440 ? 9.277   39.294 22.647  1.00 108.76 ? 432 ASP A O   1 
ATOM   2712 C  CB  . ASP A 1 440 ? 8.264   39.490 19.436  1.00 103.77 ? 432 ASP A CB  1 
ATOM   2713 C  CG  . ASP A 1 440 ? 7.303   40.532 18.903  1.00 116.62 ? 432 ASP A CG  1 
ATOM   2714 O  OD1 . ASP A 1 440 ? 7.673   41.246 17.946  1.00 120.30 ? 432 ASP A OD1 1 
ATOM   2715 O  OD2 . ASP A 1 440 ? 6.175   40.630 19.431  1.00 119.74 ? 432 ASP A OD2 1 
ATOM   2716 N  N   . SER A 1 441 ? 7.825   40.921 22.115  1.00 107.56 ? 433 SER A N   1 
ATOM   2717 C  CA  . SER A 1 441 ? 7.191   40.913 23.426  1.00 110.29 ? 433 SER A CA  1 
ATOM   2718 C  C   . SER A 1 441 ? 6.276   39.699 23.553  1.00 113.91 ? 433 SER A C   1 
ATOM   2719 O  O   . SER A 1 441 ? 5.885   39.104 22.550  1.00 112.88 ? 433 SER A O   1 
ATOM   2720 C  CB  . SER A 1 441 ? 6.405   42.205 23.653  1.00 115.64 ? 433 SER A CB  1 
ATOM   2721 O  OG  . SER A 1 441 ? 5.482   42.433 22.602  1.00 123.06 ? 433 SER A OG  1 
ATOM   2722 N  N   . CYS A 1 442 ? 5.941   39.327 24.784  1.00 114.11 ? 434 CYS A N   1 
ATOM   2723 C  CA  . CYS A 1 442 ? 5.047   38.196 25.012  1.00 114.07 ? 434 CYS A CA  1 
ATOM   2724 C  C   . CYS A 1 442 ? 3.612   38.549 24.637  1.00 114.04 ? 434 CYS A C   1 
ATOM   2725 O  O   . CYS A 1 442 ? 2.840   37.685 24.219  1.00 113.13 ? 434 CYS A O   1 
ATOM   2726 C  CB  . CYS A 1 442 ? 5.116   37.735 26.468  1.00 116.79 ? 434 CYS A CB  1 
ATOM   2727 S  SG  . CYS A 1 442 ? 6.533   36.675 26.829  1.00 119.02 ? 434 CYS A SG  1 
ATOM   2728 N  N   . TYR A 1 443 ? 3.261   39.821 24.789  1.00 107.53 ? 435 TYR A N   1 
ATOM   2729 C  CA  . TYR A 1 443 ? 1.961   40.322 24.359  1.00 107.86 ? 435 TYR A CA  1 
ATOM   2730 C  C   . TYR A 1 443 ? 2.013   41.841 24.214  1.00 112.05 ? 435 TYR A C   1 
ATOM   2731 O  O   . TYR A 1 443 ? 2.682   42.517 24.995  1.00 113.61 ? 435 TYR A O   1 
ATOM   2732 C  CB  . TYR A 1 443 ? 0.859   39.903 25.341  1.00 109.47 ? 435 TYR A CB  1 
ATOM   2733 C  CG  . TYR A 1 443 ? 0.909   40.589 26.688  1.00 113.08 ? 435 TYR A CG  1 
ATOM   2734 C  CD1 . TYR A 1 443 ? 1.838   40.213 27.649  1.00 112.95 ? 435 TYR A CD1 1 
ATOM   2735 C  CD2 . TYR A 1 443 ? 0.012   41.602 27.005  1.00 117.49 ? 435 TYR A CD2 1 
ATOM   2736 C  CE1 . TYR A 1 443 ? 1.881   40.835 28.884  1.00 116.94 ? 435 TYR A CE1 1 
ATOM   2737 C  CE2 . TYR A 1 443 ? 0.046   42.228 28.237  1.00 121.63 ? 435 TYR A CE2 1 
ATOM   2738 C  CZ  . TYR A 1 443 ? 0.982   41.841 29.173  1.00 121.31 ? 435 TYR A CZ  1 
ATOM   2739 O  OH  . TYR A 1 443 ? 1.022   42.460 30.402  1.00 125.65 ? 435 TYR A OH  1 
ATOM   2740 N  N   . PRO A 1 444 ? 1.314   42.380 23.203  1.00 111.83 ? 436 PRO A N   1 
ATOM   2741 C  CA  . PRO A 1 444 ? 1.357   43.812 22.883  1.00 113.49 ? 436 PRO A CA  1 
ATOM   2742 C  C   . PRO A 1 444 ? 0.746   44.704 23.963  1.00 119.42 ? 436 PRO A C   1 
ATOM   2743 O  O   . PRO A 1 444 ? -0.460  44.650 24.197  1.00 121.13 ? 436 PRO A O   1 
ATOM   2744 C  CB  . PRO A 1 444 ? 0.538   43.909 21.587  1.00 114.47 ? 436 PRO A CB  1 
ATOM   2745 C  CG  . PRO A 1 444 ? 0.470   42.516 21.054  1.00 114.03 ? 436 PRO A CG  1 
ATOM   2746 C  CD  . PRO A 1 444 ? 0.469   41.634 22.257  1.00 111.53 ? 436 PRO A CD  1 
ATOM   2747 N  N   . SER A 1 445 ? 1.577   45.519 24.606  1.00 120.55 ? 437 SER A N   1 
ATOM   2748 C  CA  . SER A 1 445 ? 1.095   46.516 25.557  1.00 126.35 ? 437 SER A CA  1 
ATOM   2749 C  C   . SER A 1 445 ? 1.591   47.901 25.149  1.00 129.63 ? 437 SER A C   1 
ATOM   2750 O  O   . SER A 1 445 ? 2.328   48.035 24.172  1.00 128.22 ? 437 SER A O   1 
ATOM   2751 C  CB  . SER A 1 445 ? 1.551   46.180 26.979  1.00 127.37 ? 437 SER A CB  1 
ATOM   2752 O  OG  . SER A 1 445 ? 2.964   46.152 27.073  1.00 128.72 ? 437 SER A OG  1 
ATOM   2753 N  N   . ASN A 1 446 ? 1.185   48.926 25.893  1.00 130.99 ? 438 ASN A N   1 
ATOM   2754 C  CA  . ASN A 1 446 ? 1.615   50.292 25.607  1.00 135.32 ? 438 ASN A CA  1 
ATOM   2755 C  C   . ASN A 1 446 ? 3.123   50.470 25.747  1.00 134.13 ? 438 ASN A C   1 
ATOM   2756 O  O   . ASN A 1 446 ? 3.726   51.291 25.056  1.00 135.74 ? 438 ASN A O   1 
ATOM   2757 C  CB  . ASN A 1 446 ? 0.899   51.286 26.525  1.00 142.61 ? 438 ASN A CB  1 
ATOM   2758 C  CG  . ASN A 1 446 ? -0.565  51.457 26.176  1.00 148.33 ? 438 ASN A CG  1 
ATOM   2759 O  OD1 . ASN A 1 446 ? -1.434  50.809 26.758  1.00 145.53 ? 438 ASN A OD1 1 
ATOM   2760 N  ND2 . ASN A 1 446 ? -0.846  52.338 25.222  1.00 148.22 ? 438 ASN A ND2 1 
ATOM   2761 N  N   . ASP A 1 447 ? 3.728   49.695 26.642  1.00 135.63 ? 439 ASP A N   1 
ATOM   2762 C  CA  . ASP A 1 447 ? 5.151   49.828 26.928  1.00 135.13 ? 439 ASP A CA  1 
ATOM   2763 C  C   . ASP A 1 447 ? 5.966   48.672 26.349  1.00 129.72 ? 439 ASP A C   1 
ATOM   2764 O  O   . ASP A 1 447 ? 7.126   48.479 26.713  1.00 129.14 ? 439 ASP A O   1 
ATOM   2765 C  CB  . ASP A 1 447 ? 5.381   49.920 28.439  1.00 138.36 ? 439 ASP A CB  1 
ATOM   2766 C  CG  . ASP A 1 447 ? 4.473   50.937 29.109  1.00 148.38 ? 439 ASP A CG  1 
ATOM   2767 O  OD1 . ASP A 1 447 ? 4.004   51.867 28.420  1.00 151.17 ? 439 ASP A OD1 1 
ATOM   2768 O  OD2 . ASP A 1 447 ? 4.227   50.805 30.327  1.00 153.69 ? 439 ASP A OD2 1 
ATOM   2769 N  N   . SER A 1 448 ? 5.359   47.908 25.447  1.00 127.50 ? 440 SER A N   1 
ATOM   2770 C  CA  . SER A 1 448 ? 6.039   46.771 24.835  1.00 123.51 ? 440 SER A CA  1 
ATOM   2771 C  C   . SER A 1 448 ? 6.578   47.123 23.452  1.00 124.08 ? 440 SER A C   1 
ATOM   2772 O  O   . SER A 1 448 ? 6.010   47.958 22.748  1.00 125.33 ? 440 SER A O   1 
ATOM   2773 C  CB  . SER A 1 448 ? 5.098   45.570 24.739  1.00 123.60 ? 440 SER A CB  1 
ATOM   2774 O  OG  . SER A 1 448 ? 3.980   45.865 23.921  1.00 129.73 ? 440 SER A OG  1 
ATOM   2775 N  N   . ARG A 1 449 ? 7.675   46.477 23.069  1.00 123.95 ? 441 ARG A N   1 
ATOM   2776 C  CA  . ARG A 1 449 ? 8.298   46.717 21.773  1.00 122.86 ? 441 ARG A CA  1 
ATOM   2777 C  C   . ARG A 1 449 ? 8.107   45.525 20.841  1.00 123.33 ? 441 ARG A C   1 
ATOM   2778 O  O   . ARG A 1 449 ? 7.747   44.433 21.281  1.00 122.09 ? 441 ARG A O   1 
ATOM   2779 C  CB  . ARG A 1 449 ? 9.791   47.013 21.942  1.00 122.34 ? 441 ARG A CB  1 
ATOM   2780 C  CG  . ARG A 1 449 ? 10.096  48.196 22.849  1.00 127.29 ? 441 ARG A CG  1 
ATOM   2781 C  CD  . ARG A 1 449 ? 11.593  48.351 23.080  1.00 127.64 ? 441 ARG A CD  1 
ATOM   2782 N  NE  . ARG A 1 449 ? 12.155  47.224 23.819  1.00 127.28 ? 441 ARG A NE  1 
ATOM   2783 C  CZ  . ARG A 1 449 ? 13.440  47.105 24.139  1.00 138.38 ? 441 ARG A CZ  1 
ATOM   2784 N  NH1 . ARG A 1 449 ? 14.305  48.045 23.784  1.00 136.82 ? 441 ARG A NH1 1 
ATOM   2785 N  NH2 . ARG A 1 449 ? 13.861  46.044 24.813  1.00 129.55 ? 441 ARG A NH2 1 
ATOM   2786 N  N   . GLN A 1 450 ? 8.350   45.743 19.553  1.00 121.37 ? 442 GLN A N   1 
ATOM   2787 C  CA  . GLN A 1 450 ? 8.267   44.675 18.565  1.00 118.16 ? 442 GLN A CA  1 
ATOM   2788 C  C   . GLN A 1 450 ? 9.074   45.027 17.321  1.00 120.01 ? 442 GLN A C   1 
ATOM   2789 O  O   . GLN A 1 450 ? 9.316   46.202 17.040  1.00 122.79 ? 442 GLN A O   1 
ATOM   2790 C  CB  . GLN A 1 450 ? 6.812   44.401 18.175  1.00 118.60 ? 442 GLN A CB  1 
ATOM   2791 C  CG  . GLN A 1 450 ? 6.189   45.494 17.320  1.00 126.35 ? 442 GLN A CG  1 
ATOM   2792 C  CD  . GLN A 1 450 ? 5.047   44.989 16.458  1.00 132.96 ? 442 GLN A CD  1 
ATOM   2793 O  OE1 . GLN A 1 450 ? 4.095   44.387 16.955  1.00 129.65 ? 442 GLN A OE1 1 
ATOM   2794 N  NE2 . GLN A 1 450 ? 5.142   45.227 15.155  1.00 127.31 ? 442 GLN A NE2 1 
ATOM   2795 N  N   . MET A 1 451 ? 9.493   44.006 16.581  1.00 117.35 ? 443 MET A N   1 
ATOM   2796 C  CA  . MET A 1 451 ? 10.122  44.228 15.287  1.00 115.78 ? 443 MET A CA  1 
ATOM   2797 C  C   . MET A 1 451 ? 9.073   44.739 14.310  1.00 117.88 ? 443 MET A C   1 
ATOM   2798 O  O   . MET A 1 451 ? 7.928   44.282 14.332  1.00 116.90 ? 443 MET A O   1 
ATOM   2799 C  CB  . MET A 1 451 ? 10.773  42.943 14.766  1.00 113.72 ? 443 MET A CB  1 
ATOM   2800 C  CG  . MET A 1 451 ? 11.343  43.059 13.359  1.00 114.70 ? 443 MET A CG  1 
ATOM   2801 S  SD  . MET A 1 451 ? 12.157  41.551 12.796  1.00 113.95 ? 443 MET A SD  1 
ATOM   2802 C  CE  . MET A 1 451 ? 13.644  41.574 13.794  1.00 114.57 ? 443 MET A CE  1 
ATOM   2803 N  N   . HIS A 1 452 ? 9.465   45.697 13.472  1.00 112.75 ? 444 HIS A N   1 
ATOM   2804 C  CA  . HIS A 1 452 ? 8.568   46.286 12.483  1.00 113.40 ? 444 HIS A CA  1 
ATOM   2805 C  C   . HIS A 1 452 ? 7.892   45.201 11.652  1.00 110.37 ? 444 HIS A C   1 
ATOM   2806 O  O   . HIS A 1 452 ? 8.544   44.263 11.192  1.00 107.08 ? 444 HIS A O   1 
ATOM   2807 C  CB  . HIS A 1 452 ? 9.335   47.254 11.577  1.00 116.30 ? 444 HIS A CB  1 
ATOM   2808 C  CG  . HIS A 1 452 ? 8.459   48.180 10.794  1.00 120.90 ? 444 HIS A CG  1 
ATOM   2809 N  ND1 . HIS A 1 452 ? 7.080   48.143 10.865  1.00 121.04 ? 444 HIS A ND1 1 
ATOM   2810 C  CD2 . HIS A 1 452 ? 8.759   49.175 9.926   1.00 126.02 ? 444 HIS A CD2 1 
ATOM   2811 C  CE1 . HIS A 1 452 ? 6.574   49.070 10.075  1.00 123.82 ? 444 HIS A CE1 1 
ATOM   2812 N  NE2 . HIS A 1 452 ? 7.573   49.712 9.493   1.00 127.12 ? 444 HIS A NE2 1 
ATOM   2813 N  N   . GLN A 1 453 ? 6.579   45.332 11.482  1.00 108.74 ? 445 GLN A N   1 
ATOM   2814 C  CA  . GLN A 1 453 ? 5.778   44.343 10.768  1.00 105.93 ? 445 GLN A CA  1 
ATOM   2815 C  C   . GLN A 1 453 ? 6.244   44.165 9.328   1.00 106.20 ? 445 GLN A C   1 
ATOM   2816 O  O   . GLN A 1 453 ? 6.111   43.085 8.752   1.00 103.26 ? 445 GLN A O   1 
ATOM   2817 C  CB  . GLN A 1 453 ? 4.301   44.742 10.788  1.00 109.12 ? 445 GLN A CB  1 
ATOM   2818 C  CG  . GLN A 1 453 ? 3.366   43.645 10.316  1.00 115.16 ? 445 GLN A CG  1 
ATOM   2819 C  CD  . GLN A 1 453 ? 3.448   42.408 11.188  1.00 123.72 ? 445 GLN A CD  1 
ATOM   2820 O  OE1 . GLN A 1 453 ? 3.554   42.503 12.411  1.00 120.94 ? 445 GLN A OE1 1 
ATOM   2821 N  NE2 . GLN A 1 453 ? 3.406   41.238 10.561  1.00 118.60 ? 445 GLN A NE2 1 
ATOM   2822 N  N   . ALA A 1 454 ? 6.786   45.233 8.753   1.00 107.99 ? 446 ALA A N   1 
ATOM   2823 C  CA  . ALA A 1 454 ? 7.310   45.191 7.394   1.00 106.60 ? 446 ALA A CA  1 
ATOM   2824 C  C   . ALA A 1 454 ? 8.509   44.251 7.304   1.00 105.19 ? 446 ALA A C   1 
ATOM   2825 O  O   . ALA A 1 454 ? 8.699   43.566 6.299   1.00 102.98 ? 446 ALA A O   1 
ATOM   2826 C  CB  . ALA A 1 454 ? 7.691   46.587 6.929   1.00 111.14 ? 446 ALA A CB  1 
ATOM   2827 N  N   . LEU A 1 455 ? 9.314   44.224 8.363   1.00 105.23 ? 447 LEU A N   1 
ATOM   2828 C  CA  . LEU A 1 455 ? 10.470  43.337 8.426   1.00 103.26 ? 447 LEU A CA  1 
ATOM   2829 C  C   . LEU A 1 455 ? 10.044  41.885 8.625   1.00 100.94 ? 447 LEU A C   1 
ATOM   2830 O  O   . LEU A 1 455 ? 10.581  40.983 7.981   1.00 98.68  ? 447 LEU A O   1 
ATOM   2831 C  CB  . LEU A 1 455 ? 11.419  43.765 9.549   1.00 105.77 ? 447 LEU A CB  1 
ATOM   2832 C  CG  . LEU A 1 455 ? 12.599  44.651 9.143   1.00 112.23 ? 447 LEU A CG  1 
ATOM   2833 C  CD1 . LEU A 1 455 ? 13.366  45.129 10.366  1.00 115.11 ? 447 LEU A CD1 1 
ATOM   2834 C  CD2 . LEU A 1 455 ? 13.524  43.904 8.195   1.00 113.64 ? 447 LEU A CD2 1 
ATOM   2835 N  N   . GLN A 1 456 ? 9.081   41.664 9.517   1.00 96.72  ? 448 GLN A N   1 
ATOM   2836 C  CA  . GLN A 1 456 ? 8.584   40.319 9.789   1.00 93.56  ? 448 GLN A CA  1 
ATOM   2837 C  C   . GLN A 1 456 ? 7.961   39.700 8.541   1.00 92.63  ? 448 GLN A C   1 
ATOM   2838 O  O   . GLN A 1 456 ? 8.094   38.499 8.304   1.00 90.01  ? 448 GLN A O   1 
ATOM   2839 C  CB  . GLN A 1 456 ? 7.557   40.336 10.925  1.00 95.46  ? 448 GLN A CB  1 
ATOM   2840 C  CG  . GLN A 1 456 ? 8.060   40.919 12.236  1.00 98.51  ? 448 GLN A CG  1 
ATOM   2841 C  CD  . GLN A 1 456 ? 7.061   40.745 13.366  1.00 109.88 ? 448 GLN A CD  1 
ATOM   2842 O  OE1 . GLN A 1 456 ? 6.363   39.734 13.442  1.00 108.52 ? 448 GLN A OE1 1 
ATOM   2843 N  NE2 . GLN A 1 456 ? 6.983   41.737 14.246  1.00 107.96 ? 448 GLN A NE2 1 
ATOM   2844 N  N   . ASP A 1 457 ? 7.282   40.527 7.751   1.00 94.84  ? 449 ASP A N   1 
ATOM   2845 C  CA  . ASP A 1 457 ? 6.633   40.063 6.528   1.00 93.21  ? 449 ASP A CA  1 
ATOM   2846 C  C   . ASP A 1 457 ? 7.651   39.601 5.490   1.00 92.37  ? 449 ASP A C   1 
ATOM   2847 O  O   . ASP A 1 457 ? 7.438   38.594 4.813   1.00 89.85  ? 449 ASP A O   1 
ATOM   2848 C  CB  . ASP A 1 457 ? 5.748   41.163 5.933   1.00 96.93  ? 449 ASP A CB  1 
ATOM   2849 C  CG  . ASP A 1 457 ? 4.472   41.381 6.726   1.00 107.48 ? 449 ASP A CG  1 
ATOM   2850 O  OD1 . ASP A 1 457 ? 4.111   40.497 7.532   1.00 108.25 ? 449 ASP A OD1 1 
ATOM   2851 O  OD2 . ASP A 1 457 ? 3.824   42.433 6.536   1.00 112.97 ? 449 ASP A OD2 1 
ATOM   2852 N  N   . PHE A 1 458 ? 8.753   40.337 5.369   1.00 86.34  ? 450 PHE A N   1 
ATOM   2853 C  CA  . PHE A 1 458 ? 9.795   40.006 4.400   1.00 85.78  ? 450 PHE A CA  1 
ATOM   2854 C  C   . PHE A 1 458 ? 10.415  38.646 4.693   1.00 86.74  ? 450 PHE A C   1 
ATOM   2855 O  O   . PHE A 1 458 ? 10.625  37.845 3.786   1.00 84.82  ? 450 PHE A O   1 
ATOM   2856 C  CB  . PHE A 1 458 ? 10.883  41.084 4.385   1.00 89.59  ? 450 PHE A CB  1 
ATOM   2857 C  CG  . PHE A 1 458 ? 12.031  40.776 3.459   1.00 91.39  ? 450 PHE A CG  1 
ATOM   2858 C  CD1 . PHE A 1 458 ? 11.904  40.958 2.092   1.00 93.48  ? 450 PHE A CD1 1 
ATOM   2859 C  CD2 . PHE A 1 458 ? 13.238  40.310 3.958   1.00 93.39  ? 450 PHE A CD2 1 
ATOM   2860 C  CE1 . PHE A 1 458 ? 12.955  40.676 1.239   1.00 95.54  ? 450 PHE A CE1 1 
ATOM   2861 C  CE2 . PHE A 1 458 ? 14.293  40.027 3.109   1.00 96.65  ? 450 PHE A CE2 1 
ATOM   2862 C  CZ  . PHE A 1 458 ? 14.151  40.211 1.748   1.00 96.17  ? 450 PHE A CZ  1 
ATOM   2863 N  N   . LEU A 1 459 ? 10.705  38.393 5.966   1.00 85.44  ? 451 LEU A N   1 
ATOM   2864 C  CA  . LEU A 1 459 ? 11.320  37.137 6.378   1.00 84.18  ? 451 LEU A CA  1 
ATOM   2865 C  C   . LEU A 1 459 ? 10.377  35.957 6.166   1.00 84.88  ? 451 LEU A C   1 
ATOM   2866 O  O   . LEU A 1 459 ? 10.811  34.858 5.817   1.00 84.21  ? 451 LEU A O   1 
ATOM   2867 C  CB  . LEU A 1 459 ? 11.749  37.207 7.844   1.00 84.87  ? 451 LEU A CB  1 
ATOM   2868 C  CG  . LEU A 1 459 ? 12.829  38.236 8.178   1.00 89.35  ? 451 LEU A CG  1 
ATOM   2869 C  CD1 . LEU A 1 459 ? 13.178  38.192 9.656   1.00 90.04  ? 451 LEU A CD1 1 
ATOM   2870 C  CD2 . LEU A 1 459 ? 14.064  37.997 7.327   1.00 91.40  ? 451 LEU A CD2 1 
ATOM   2871 N  N   . SER A 1 460 ? 9.087   36.191 6.378   1.00 82.16  ? 452 SER A N   1 
ATOM   2872 C  CA  . SER A 1 460 ? 8.084   35.152 6.190   1.00 81.07  ? 452 SER A CA  1 
ATOM   2873 C  C   . SER A 1 460 ? 7.800   34.932 4.710   1.00 81.82  ? 452 SER A C   1 
ATOM   2874 O  O   . SER A 1 460 ? 7.366   33.855 4.305   1.00 80.68  ? 452 SER A O   1 
ATOM   2875 C  CB  . SER A 1 460 ? 6.792   35.509 6.930   1.00 85.88  ? 452 SER A CB  1 
ATOM   2876 O  OG  . SER A 1 460 ? 7.004   35.567 8.331   1.00 96.00  ? 452 SER A OG  1 
ATOM   2877 N  N   . ALA A 1 461 ? 8.052   35.961 3.906   1.00 81.16  ? 453 ALA A N   1 
ATOM   2878 C  CA  . ALA A 1 461 ? 7.818   35.886 2.468   1.00 80.12  ? 453 ALA A CA  1 
ATOM   2879 C  C   . ALA A 1 461 ? 8.903   35.072 1.772   1.00 80.58  ? 453 ALA A C   1 
ATOM   2880 O  O   . ALA A 1 461 ? 8.697   34.570 0.666   1.00 79.51  ? 453 ALA A O   1 
ATOM   2881 C  CB  . ALA A 1 461 ? 7.739   37.280 1.870   1.00 82.57  ? 453 ALA A CB  1 
ATOM   2882 N  N   . GLN A 1 462 ? 10.058  34.947 2.418   1.00 78.55  ? 454 GLN A N   1 
ATOM   2883 C  CA  . GLN A 1 462 ? 11.154  34.166 1.858   1.00 79.26  ? 454 GLN A CA  1 
ATOM   2884 C  C   . GLN A 1 462 ? 10.850  32.676 1.973   1.00 80.84  ? 454 GLN A C   1 
ATOM   2885 O  O   . GLN A 1 462 ? 11.446  31.858 1.272   1.00 81.85  ? 454 GLN A O   1 
ATOM   2886 C  CB  . GLN A 1 462 ? 12.473  34.504 2.551   1.00 82.40  ? 454 GLN A CB  1 
ATOM   2887 C  CG  . GLN A 1 462 ? 12.806  35.986 2.549   1.00 81.12  ? 454 GLN A CG  1 
ATOM   2888 C  CD  . GLN A 1 462 ? 12.590  36.634 1.194   1.00 83.19  ? 454 GLN A CD  1 
ATOM   2889 O  OE1 . GLN A 1 462 ? 13.275  36.315 0.224   1.00 83.92  ? 454 GLN A OE1 1 
ATOM   2890 N  NE2 . GLN A 1 462 ? 11.629  37.549 1.122   1.00 83.80  ? 454 GLN A NE2 1 
ATOM   2891 N  N   . GLN A 1 463 ? 9.935   32.341 2.881   1.00 79.85  ? 455 GLN A N   1 
ATOM   2892 C  CA  . GLN A 1 463 ? 9.316   31.016 2.956   1.00 78.40  ? 455 GLN A CA  1 
ATOM   2893 C  C   . GLN A 1 463 ? 10.259  29.890 3.402   1.00 82.20  ? 455 GLN A C   1 
ATOM   2894 O  O   . GLN A 1 463 ? 9.926   29.125 4.308   1.00 83.42  ? 455 GLN A O   1 
ATOM   2895 C  CB  . GLN A 1 463 ? 8.695   30.665 1.598   1.00 78.62  ? 455 GLN A CB  1 
ATOM   2896 C  CG  . GLN A 1 463 ? 7.344   29.973 1.669   1.00 84.53  ? 455 GLN A CG  1 
ATOM   2897 C  CD  . GLN A 1 463 ? 6.628   29.973 0.329   1.00 92.23  ? 455 GLN A CD  1 
ATOM   2898 O  OE1 . GLN A 1 463 ? 6.772   30.904 -0.464  1.00 91.26  ? 455 GLN A OE1 1 
ATOM   2899 N  NE2 . GLN A 1 463 ? 5.857   28.923 0.068   1.00 85.39  ? 455 GLN A NE2 1 
ATOM   2900 N  N   . VAL A 1 464 ? 11.428  29.794 2.772   1.00 79.42  ? 456 VAL A N   1 
ATOM   2901 C  CA  . VAL A 1 464 ? 12.338  28.666 2.983   1.00 80.68  ? 456 VAL A CA  1 
ATOM   2902 C  C   . VAL A 1 464 ? 12.815  28.495 4.428   1.00 84.94  ? 456 VAL A C   1 
ATOM   2903 O  O   . VAL A 1 464 ? 13.119  27.382 4.855   1.00 86.38  ? 456 VAL A O   1 
ATOM   2904 C  CB  . VAL A 1 464 ? 13.580  28.780 2.077   1.00 85.07  ? 456 VAL A CB  1 
ATOM   2905 C  CG1 . VAL A 1 464 ? 13.219  28.449 0.637   1.00 84.73  ? 456 VAL A CG1 1 
ATOM   2906 C  CG2 . VAL A 1 464 ? 14.191  30.169 2.182   1.00 86.87  ? 456 VAL A CG2 1 
ATOM   2907 N  N   . GLN A 1 465 ? 12.883  29.590 5.178   1.00 82.86  ? 457 GLN A N   1 
ATOM   2908 C  CA  . GLN A 1 465 ? 13.296  29.523 6.577   1.00 84.20  ? 457 GLN A CA  1 
ATOM   2909 C  C   . GLN A 1 465 ? 12.211  30.079 7.490   1.00 85.00  ? 457 GLN A C   1 
ATOM   2910 O  O   . GLN A 1 465 ? 12.172  31.281 7.753   1.00 85.76  ? 457 GLN A O   1 
ATOM   2911 C  CB  . GLN A 1 465 ? 14.603  30.289 6.791   1.00 87.65  ? 457 GLN A CB  1 
ATOM   2912 C  CG  . GLN A 1 465 ? 15.794  29.716 6.047   1.00 91.48  ? 457 GLN A CG  1 
ATOM   2913 C  CD  . GLN A 1 465 ? 16.971  30.669 6.032   1.00 97.49  ? 457 GLN A CD  1 
ATOM   2914 O  OE1 . GLN A 1 465 ? 16.817  31.857 5.745   1.00 96.94  ? 457 GLN A OE1 1 
ATOM   2915 N  NE2 . GLN A 1 465 ? 18.154  30.156 6.347   1.00 86.68  ? 457 GLN A NE2 1 
ATOM   2916 N  N   . ALA A 1 466 ? 11.337  29.197 7.970   1.00 83.30  ? 458 ALA A N   1 
ATOM   2917 C  CA  . ALA A 1 466 ? 10.207  29.592 8.808   1.00 82.99  ? 458 ALA A CA  1 
ATOM   2918 C  C   . ALA A 1 466 ? 10.658  30.339 10.059  1.00 87.32  ? 458 ALA A C   1 
ATOM   2919 O  O   . ALA A 1 466 ? 11.352  29.781 10.906  1.00 89.55  ? 458 ALA A O   1 
ATOM   2920 C  CB  . ALA A 1 466 ? 9.385   28.371 9.194   1.00 83.65  ? 458 ALA A CB  1 
ATOM   2921 N  N   . PRO A 1 467 ? 10.262  31.613 10.174  1.00 81.59  ? 459 PRO A N   1 
ATOM   2922 C  CA  . PRO A 1 467 ? 10.634  32.455 11.315  1.00 83.25  ? 459 PRO A CA  1 
ATOM   2923 C  C   . PRO A 1 467 ? 9.951   32.023 12.611  1.00 87.10  ? 459 PRO A C   1 
ATOM   2924 O  O   . PRO A 1 467 ? 8.781   31.635 12.599  1.00 86.78  ? 459 PRO A O   1 
ATOM   2925 C  CB  . PRO A 1 467 ? 10.162  33.851 10.892  1.00 84.01  ? 459 PRO A CB  1 
ATOM   2926 C  CG  . PRO A 1 467 ? 9.949   33.765 9.410   1.00 84.72  ? 459 PRO A CG  1 
ATOM   2927 C  CD  . PRO A 1 467 ? 9.502   32.367 9.165   1.00 80.96  ? 459 PRO A CD  1 
ATOM   2928 N  N   . VAL A 1 468 ? 10.688  32.086 13.715  1.00 83.45  ? 460 VAL A N   1 
ATOM   2929 C  CA  . VAL A 1 468 ? 10.136  31.793 15.033  1.00 85.79  ? 460 VAL A CA  1 
ATOM   2930 C  C   . VAL A 1 468 ? 10.224  33.025 15.923  1.00 88.66  ? 460 VAL A C   1 
ATOM   2931 O  O   . VAL A 1 468 ? 11.295  33.611 16.085  1.00 89.08  ? 460 VAL A O   1 
ATOM   2932 C  CB  . VAL A 1 468 ? 10.866  30.624 15.715  1.00 89.78  ? 460 VAL A CB  1 
ATOM   2933 C  CG1 . VAL A 1 468 ? 10.235  30.319 17.066  1.00 92.90  ? 460 VAL A CG1 1 
ATOM   2934 C  CG2 . VAL A 1 468 ? 10.843  29.398 14.826  1.00 88.25  ? 460 VAL A CG2 1 
ATOM   2935 N  N   . LYS A 1 469 ? 9.095   33.417 16.498  1.00 86.48  ? 461 LYS A N   1 
ATOM   2936 C  CA  . LYS A 1 469 ? 9.055   34.594 17.352  1.00 87.38  ? 461 LYS A CA  1 
ATOM   2937 C  C   . LYS A 1 469 ? 9.459   34.237 18.780  1.00 91.97  ? 461 LYS A C   1 
ATOM   2938 O  O   . LYS A 1 469 ? 8.800   33.432 19.439  1.00 93.70  ? 461 LYS A O   1 
ATOM   2939 C  CB  . LYS A 1 469 ? 7.660   35.221 17.329  1.00 89.16  ? 461 LYS A CB  1 
ATOM   2940 C  CG  . LYS A 1 469 ? 7.672   36.733 17.230  1.00 90.64  ? 461 LYS A CG  1 
ATOM   2941 C  CD  . LYS A 1 469 ? 6.265   37.296 17.132  1.00 95.87  ? 461 LYS A CD  1 
ATOM   2942 C  CE  . LYS A 1 469 ? 5.572   36.835 15.860  1.00 102.04 ? 461 LYS A CE  1 
ATOM   2943 N  NZ  . LYS A 1 469 ? 4.218   37.439 15.723  1.00 109.74 ? 461 LYS A NZ  1 
ATOM   2944 N  N   . LEU A 1 470 ? 10.552  34.831 19.249  1.00 88.98  ? 462 LEU A N   1 
ATOM   2945 C  CA  . LEU A 1 470 ? 11.027  34.587 20.605  1.00 90.64  ? 462 LEU A CA  1 
ATOM   2946 C  C   . LEU A 1 470 ? 10.731  35.775 21.515  1.00 95.40  ? 462 LEU A C   1 
ATOM   2947 O  O   . LEU A 1 470 ? 10.241  36.811 21.063  1.00 95.69  ? 462 LEU A O   1 
ATOM   2948 C  CB  . LEU A 1 470 ? 12.528  34.287 20.606  1.00 90.75  ? 462 LEU A CB  1 
ATOM   2949 C  CG  . LEU A 1 470 ? 12.988  33.045 19.841  1.00 91.46  ? 462 LEU A CG  1 
ATOM   2950 C  CD1 . LEU A 1 470 ? 14.475  32.803 20.063  1.00 93.06  ? 462 LEU A CD1 1 
ATOM   2951 C  CD2 . LEU A 1 470 ? 12.172  31.826 20.245  1.00 93.01  ? 462 LEU A CD2 1 
ATOM   2952 N  N   . TYR A 1 471 ? 11.028  35.612 22.801  1.00 99.91  ? 463 TYR A N   1 
ATOM   2953 C  CA  . TYR A 1 471 ? 10.818  36.671 23.782  1.00 101.32 ? 463 TYR A CA  1 
ATOM   2954 C  C   . TYR A 1 471 ? 12.144  37.322 24.162  1.00 105.58 ? 463 TYR A C   1 
ATOM   2955 O  O   . TYR A 1 471 ? 13.029  36.666 24.711  1.00 106.24 ? 463 TYR A O   1 
ATOM   2956 C  CB  . TYR A 1 471 ? 10.118  36.116 25.025  1.00 103.32 ? 463 TYR A CB  1 
ATOM   2957 C  CG  . TYR A 1 471 ? 9.844   37.148 26.096  1.00 105.71 ? 463 TYR A CG  1 
ATOM   2958 C  CD1 . TYR A 1 471 ? 9.305   38.386 25.773  1.00 106.79 ? 463 TYR A CD1 1 
ATOM   2959 C  CD2 . TYR A 1 471 ? 10.108  36.877 27.432  1.00 107.96 ? 463 TYR A CD2 1 
ATOM   2960 C  CE1 . TYR A 1 471 ? 9.047   39.330 26.748  1.00 108.91 ? 463 TYR A CE1 1 
ATOM   2961 C  CE2 . TYR A 1 471 ? 9.853   37.815 28.415  1.00 110.38 ? 463 TYR A CE2 1 
ATOM   2962 C  CZ  . TYR A 1 471 ? 9.323   39.039 28.068  1.00 114.68 ? 463 TYR A CZ  1 
ATOM   2963 O  OH  . TYR A 1 471 ? 9.067   39.975 29.043  1.00 118.46 ? 463 TYR A OH  1 
ATOM   2964 N  N   . SER A 1 472 ? 12.280  38.611 23.867  1.00 105.87 ? 464 SER A N   1 
ATOM   2965 C  CA  . SER A 1 472 ? 13.527  39.319 24.138  1.00 108.09 ? 464 SER A CA  1 
ATOM   2966 C  C   . SER A 1 472 ? 13.287  40.762 24.569  1.00 113.36 ? 464 SER A C   1 
ATOM   2967 O  O   . SER A 1 472 ? 14.228  41.545 24.696  1.00 115.40 ? 464 SER A O   1 
ATOM   2968 C  CB  . SER A 1 472 ? 14.432  39.292 22.904  1.00 108.61 ? 464 SER A CB  1 
ATOM   2969 O  OG  . SER A 1 472 ? 13.896  40.090 21.862  1.00 112.30 ? 464 SER A OG  1 
ATOM   2970 N  N   . ASP A 1 473 ? 12.024  41.104 24.800  1.00 112.56 ? 465 ASP A N   1 
ATOM   2971 C  CA  . ASP A 1 473 ? 11.650  42.457 25.196  1.00 114.68 ? 465 ASP A CA  1 
ATOM   2972 C  C   . ASP A 1 473 ? 12.087  42.756 26.629  1.00 120.43 ? 465 ASP A C   1 
ATOM   2973 O  O   . ASP A 1 473 ? 12.083  43.909 27.064  1.00 123.47 ? 465 ASP A O   1 
ATOM   2974 C  CB  . ASP A 1 473 ? 10.139  42.655 25.048  1.00 115.35 ? 465 ASP A CB  1 
ATOM   2975 C  CG  . ASP A 1 473 ? 9.719   44.102 25.222  1.00 126.27 ? 465 ASP A CG  1 
ATOM   2976 O  OD1 . ASP A 1 473 ? 10.126  44.943 24.395  1.00 128.02 ? 465 ASP A OD1 1 
ATOM   2977 O  OD2 . ASP A 1 473 ? 8.973   44.396 26.179  1.00 131.45 ? 465 ASP A OD2 1 
ATOM   2978 N  N   . TRP A 1 474 ? 12.469  41.711 27.356  1.00 119.52 ? 466 TRP A N   1 
ATOM   2979 C  CA  . TRP A 1 474 ? 12.910  41.860 28.736  1.00 122.22 ? 466 TRP A CA  1 
ATOM   2980 C  C   . TRP A 1 474 ? 14.274  42.540 28.817  1.00 127.50 ? 466 TRP A C   1 
ATOM   2981 O  O   . TRP A 1 474 ? 14.524  43.337 29.721  1.00 130.99 ? 466 TRP A O   1 
ATOM   2982 C  CB  . TRP A 1 474 ? 12.948  40.498 29.432  1.00 120.84 ? 466 TRP A CB  1 
ATOM   2983 C  CG  . TRP A 1 474 ? 13.762  39.466 28.716  1.00 119.57 ? 466 TRP A CG  1 
ATOM   2984 C  CD1 . TRP A 1 474 ? 13.393  38.751 27.615  1.00 118.56 ? 466 TRP A CD1 1 
ATOM   2985 C  CD2 . TRP A 1 474 ? 15.077  39.020 29.063  1.00 120.87 ? 466 TRP A CD2 1 
ATOM   2986 N  NE1 . TRP A 1 474 ? 14.401  37.892 27.249  1.00 118.02 ? 466 TRP A NE1 1 
ATOM   2987 C  CE2 . TRP A 1 474 ? 15.446  38.037 28.123  1.00 121.41 ? 466 TRP A CE2 1 
ATOM   2988 C  CE3 . TRP A 1 474 ? 15.980  39.357 30.075  1.00 124.48 ? 466 TRP A CE3 1 
ATOM   2989 C  CZ2 . TRP A 1 474 ? 16.678  37.389 28.165  1.00 122.30 ? 466 TRP A CZ2 1 
ATOM   2990 C  CZ3 . TRP A 1 474 ? 17.203  38.713 30.114  1.00 126.54 ? 466 TRP A CZ3 1 
ATOM   2991 C  CH2 . TRP A 1 474 ? 17.540  37.740 29.167  1.00 125.29 ? 466 TRP A CH2 1 
ATOM   2992 N  N   . LEU A 1 475 ? 15.148  42.229 27.864  1.00 122.51 ? 467 LEU A N   1 
ATOM   2993 C  CA  . LEU A 1 475 ? 16.482  42.821 27.817  1.00 124.92 ? 467 LEU A CA  1 
ATOM   2994 C  C   . LEU A 1 475 ? 16.427  44.323 27.556  1.00 130.43 ? 467 LEU A C   1 
ATOM   2995 O  O   . LEU A 1 475 ? 15.429  44.838 27.051  1.00 129.24 ? 467 LEU A O   1 
ATOM   2996 C  CB  . LEU A 1 475 ? 17.327  42.137 26.741  1.00 123.34 ? 467 LEU A CB  1 
ATOM   2997 C  CG  . LEU A 1 475 ? 17.718  40.686 27.022  1.00 124.90 ? 467 LEU A CG  1 
ATOM   2998 C  CD1 . LEU A 1 475 ? 17.749  39.882 25.734  1.00 122.32 ? 467 LEU A CD1 1 
ATOM   2999 C  CD2 . LEU A 1 475 ? 19.065  40.625 27.725  1.00 129.66 ? 467 LEU A CD2 1 
ATOM   3000 N  N   . SER A 1 476 ? 17.503  45.021 27.907  1.00 130.99 ? 468 SER A N   1 
ATOM   3001 C  CA  . SER A 1 476 ? 17.590  46.457 27.673  1.00 133.62 ? 468 SER A CA  1 
ATOM   3002 C  C   . SER A 1 476 ? 17.714  46.739 26.183  1.00 134.33 ? 468 SER A C   1 
ATOM   3003 O  O   . SER A 1 476 ? 16.973  47.551 25.629  1.00 133.86 ? 468 SER A O   1 
ATOM   3004 C  CB  . SER A 1 476 ? 18.775  47.061 28.431  1.00 140.02 ? 468 SER A CB  1 
ATOM   3005 O  OG  . SER A 1 476 ? 18.788  48.473 28.317  1.00 148.03 ? 468 SER A OG  1 
ATOM   3006 N  N   . VAL A 1 477 ? 18.656  46.058 25.540  1.00 130.79 ? 469 VAL A N   1 
ATOM   3007 C  CA  . VAL A 1 477 ? 18.838  46.184 24.103  1.00 129.95 ? 469 VAL A CA  1 
ATOM   3008 C  C   . VAL A 1 477 ? 17.682  45.494 23.383  1.00 128.67 ? 469 VAL A C   1 
ATOM   3009 O  O   . VAL A 1 477 ? 17.018  46.094 22.538  1.00 128.47 ? 469 VAL A O   1 
ATOM   3010 C  CB  . VAL A 1 477 ? 20.179  45.583 23.649  1.00 132.98 ? 469 VAL A CB  1 
ATOM   3011 C  CG1 . VAL A 1 477 ? 20.518  46.050 22.244  1.00 133.22 ? 469 VAL A CG1 1 
ATOM   3012 C  CG2 . VAL A 1 477 ? 21.283  45.973 24.619  1.00 137.31 ? 469 VAL A CG2 1 
ATOM   3013 N  N   . GLY A 1 478 ? 17.441  44.233 23.730  1.00 126.13 ? 470 GLY A N   1 
ATOM   3014 C  CA  . GLY A 1 478 ? 16.309  43.499 23.195  1.00 122.31 ? 470 GLY A CA  1 
ATOM   3015 C  C   . GLY A 1 478 ? 16.663  42.543 22.073  1.00 122.06 ? 470 GLY A C   1 
ATOM   3016 O  O   . GLY A 1 478 ? 15.782  41.919 21.479  1.00 118.58 ? 470 GLY A O   1 
ATOM   3017 N  N   . HIS A 1 479 ? 17.954  42.426 21.782  1.00 120.82 ? 471 HIS A N   1 
ATOM   3018 C  CA  . HIS A 1 479 ? 18.424  41.543 20.718  1.00 118.67 ? 471 HIS A CA  1 
ATOM   3019 C  C   . HIS A 1 479 ? 18.458  40.090 21.187  1.00 117.66 ? 471 HIS A C   1 
ATOM   3020 O  O   . HIS A 1 479 ? 18.613  39.820 22.376  1.00 118.57 ? 471 HIS A O   1 
ATOM   3021 C  CB  . HIS A 1 479 ? 19.806  41.983 20.230  1.00 122.62 ? 471 HIS A CB  1 
ATOM   3022 C  CG  . HIS A 1 479 ? 19.811  43.321 19.555  1.00 126.35 ? 471 HIS A CG  1 
ATOM   3023 N  ND1 . HIS A 1 479 ? 20.879  43.775 18.815  1.00 130.31 ? 471 HIS A ND1 1 
ATOM   3024 C  CD2 . HIS A 1 479 ? 18.876  44.300 19.510  1.00 127.05 ? 471 HIS A CD2 1 
ATOM   3025 C  CE1 . HIS A 1 479 ? 20.603  44.979 18.340  1.00 131.23 ? 471 HIS A CE1 1 
ATOM   3026 N  NE2 . HIS A 1 479 ? 19.395  45.319 18.748  1.00 129.57 ? 471 HIS A NE2 1 
ATOM   3027 N  N   . VAL A 1 480 ? 18.310  39.158 20.251  1.00 109.30 ? 472 VAL A N   1 
ATOM   3028 C  CA  . VAL A 1 480 ? 18.245  37.742 20.598  1.00 108.42 ? 472 VAL A CA  1 
ATOM   3029 C  C   . VAL A 1 480 ? 19.627  37.110 20.739  1.00 113.52 ? 472 VAL A C   1 
ATOM   3030 O  O   . VAL A 1 480 ? 19.784  36.094 21.412  1.00 113.39 ? 472 VAL A O   1 
ATOM   3031 C  CB  . VAL A 1 480 ? 17.441  36.938 19.553  1.00 107.19 ? 472 VAL A CB  1 
ATOM   3032 C  CG1 . VAL A 1 480 ? 16.016  37.440 19.489  1.00 105.30 ? 472 VAL A CG1 1 
ATOM   3033 C  CG2 . VAL A 1 480 ? 18.100  37.021 18.186  1.00 106.14 ? 472 VAL A CG2 1 
ATOM   3034 N  N   . ASP A 1 481 ? 20.628  37.720 20.113  1.00 111.87 ? 473 ASP A N   1 
ATOM   3035 C  CA  . ASP A 1 481 ? 21.971  37.151 20.095  1.00 115.31 ? 473 ASP A CA  1 
ATOM   3036 C  C   . ASP A 1 481 ? 22.665  37.291 21.444  1.00 119.50 ? 473 ASP A C   1 
ATOM   3037 O  O   . ASP A 1 481 ? 23.685  36.651 21.694  1.00 122.58 ? 473 ASP A O   1 
ATOM   3038 C  CB  . ASP A 1 481 ? 22.817  37.813 19.005  1.00 119.17 ? 473 ASP A CB  1 
ATOM   3039 C  CG  . ASP A 1 481 ? 23.124  39.269 19.307  1.00 132.52 ? 473 ASP A CG  1 
ATOM   3040 O  OD1 . ASP A 1 481 ? 22.332  39.910 20.030  1.00 131.96 ? 473 ASP A OD1 1 
ATOM   3041 O  OD2 . ASP A 1 481 ? 24.157  39.775 18.819  1.00 142.65 ? 473 ASP A OD2 1 
ATOM   3042 N  N   . GLU A 1 482 ? 22.109  38.130 22.312  1.00 115.44 ? 474 GLU A N   1 
ATOM   3043 C  CA  . GLU A 1 482 ? 22.729  38.393 23.605  1.00 117.65 ? 474 GLU A CA  1 
ATOM   3044 C  C   . GLU A 1 482 ? 22.221  37.455 24.698  1.00 119.63 ? 474 GLU A C   1 
ATOM   3045 O  O   . GLU A 1 482 ? 22.506  37.664 25.876  1.00 122.58 ? 474 GLU A O   1 
ATOM   3046 C  CB  . GLU A 1 482 ? 22.501  39.848 24.022  1.00 118.94 ? 474 GLU A CB  1 
ATOM   3047 C  CG  . GLU A 1 482 ? 21.054  40.192 24.308  1.00 120.92 ? 474 GLU A CG  1 
ATOM   3048 C  CD  . GLU A 1 482 ? 20.857  41.653 24.664  1.00 134.88 ? 474 GLU A CD  1 
ATOM   3049 O  OE1 . GLU A 1 482 ? 21.550  42.144 25.581  1.00 134.71 ? 474 GLU A OE1 1 
ATOM   3050 O  OE2 . GLU A 1 482 ? 20.010  42.310 24.024  1.00 131.14 ? 474 GLU A OE2 1 
ATOM   3051 N  N   . PHE A 1 483 ? 21.474  36.424 24.314  1.00 117.22 ? 475 PHE A N   1 
ATOM   3052 C  CA  . PHE A 1 483 ? 21.054  35.413 25.282  1.00 117.24 ? 475 PHE A CA  1 
ATOM   3053 C  C   . PHE A 1 483 ? 20.934  34.028 24.646  1.00 118.53 ? 475 PHE A C   1 
ATOM   3054 O  O   . PHE A 1 483 ? 20.447  33.092 25.278  1.00 119.08 ? 475 PHE A O   1 
ATOM   3055 C  CB  . PHE A 1 483 ? 19.732  35.819 25.952  1.00 116.34 ? 475 PHE A CB  1 
ATOM   3056 C  CG  . PHE A 1 483 ? 18.504  35.505 25.142  1.00 113.51 ? 475 PHE A CG  1 
ATOM   3057 C  CD1 . PHE A 1 483 ? 18.131  36.307 24.077  1.00 112.81 ? 475 PHE A CD1 1 
ATOM   3058 C  CD2 . PHE A 1 483 ? 17.702  34.423 25.469  1.00 114.30 ? 475 PHE A CD2 1 
ATOM   3059 C  CE1 . PHE A 1 483 ? 16.994  36.020 23.341  1.00 110.24 ? 475 PHE A CE1 1 
ATOM   3060 C  CE2 . PHE A 1 483 ? 16.568  34.132 24.737  1.00 112.97 ? 475 PHE A CE2 1 
ATOM   3061 C  CZ  . PHE A 1 483 ? 16.213  34.933 23.672  1.00 109.26 ? 475 PHE A CZ  1 
ATOM   3062 N  N   . LEU A 1 484 ? 21.392  33.894 23.404  1.00 109.74 ? 476 LEU A N   1 
ATOM   3063 C  CA  . LEU A 1 484 ? 21.441  32.586 22.753  1.00 108.46 ? 476 LEU A CA  1 
ATOM   3064 C  C   . LEU A 1 484 ? 22.489  32.539 21.645  1.00 108.91 ? 476 LEU A C   1 
ATOM   3065 O  O   . LEU A 1 484 ? 22.835  33.565 21.058  1.00 109.17 ? 476 LEU A O   1 
ATOM   3066 C  CB  . LEU A 1 484 ? 20.067  32.209 22.187  1.00 105.28 ? 476 LEU A CB  1 
ATOM   3067 C  CG  . LEU A 1 484 ? 19.578  32.915 20.918  1.00 102.91 ? 476 LEU A CG  1 
ATOM   3068 C  CD1 . LEU A 1 484 ? 19.872  32.096 19.663  1.00 101.69 ? 476 LEU A CD1 1 
ATOM   3069 C  CD2 . LEU A 1 484 ? 18.095  33.223 21.022  1.00 101.06 ? 476 LEU A CD2 1 
ATOM   3070 N  N   . SER A 1 485 ? 22.979  31.335 21.359  1.00 104.33 ? 477 SER A N   1 
ATOM   3071 C  CA  . SER A 1 485 ? 23.956  31.124 20.296  1.00 106.82 ? 477 SER A CA  1 
ATOM   3072 C  C   . SER A 1 485 ? 24.078  29.641 19.951  1.00 109.66 ? 477 SER A C   1 
ATOM   3073 O  O   . SER A 1 485 ? 23.640  28.779 20.715  1.00 109.38 ? 477 SER A O   1 
ATOM   3074 C  CB  . SER A 1 485 ? 25.322  31.682 20.700  1.00 114.34 ? 477 SER A CB  1 
ATOM   3075 O  OG  . SER A 1 485 ? 26.260  31.553 19.646  1.00 122.98 ? 477 SER A OG  1 
ATOM   3076 N  N   . PHE A 1 486 ? 24.677  29.352 18.798  1.00 107.05 ? 478 PHE A N   1 
ATOM   3077 C  CA  . PHE A 1 486 ? 24.864  27.976 18.345  1.00 107.43 ? 478 PHE A CA  1 
ATOM   3078 C  C   . PHE A 1 486 ? 26.331  27.662 18.066  1.00 116.18 ? 478 PHE A C   1 
ATOM   3079 O  O   . PHE A 1 486 ? 27.075  28.509 17.571  1.00 117.50 ? 478 PHE A O   1 
ATOM   3080 C  CB  . PHE A 1 486 ? 24.037  27.709 17.087  1.00 103.45 ? 478 PHE A CB  1 
ATOM   3081 C  CG  . PHE A 1 486 ? 22.553  27.736 17.315  1.00 100.11 ? 478 PHE A CG  1 
ATOM   3082 C  CD1 . PHE A 1 486 ? 21.881  26.597 17.726  1.00 100.78 ? 478 PHE A CD1 1 
ATOM   3083 C  CD2 . PHE A 1 486 ? 21.828  28.898 17.109  1.00 97.56  ? 478 PHE A CD2 1 
ATOM   3084 C  CE1 . PHE A 1 486 ? 20.515  26.617 17.931  1.00 98.01  ? 478 PHE A CE1 1 
ATOM   3085 C  CE2 . PHE A 1 486 ? 20.462  28.925 17.314  1.00 95.20  ? 478 PHE A CE2 1 
ATOM   3086 C  CZ  . PHE A 1 486 ? 19.805  27.783 17.726  1.00 95.39  ? 478 PHE A CZ  1 
ATOM   3087 N  N   . VAL A 1 487 ? 26.738  26.435 18.382  1.00 118.72 ? 479 VAL A N   1 
ATOM   3088 C  CA  . VAL A 1 487 ? 28.106  25.984 18.138  1.00 122.23 ? 479 VAL A CA  1 
ATOM   3089 C  C   . VAL A 1 487 ? 28.132  24.604 17.485  1.00 125.56 ? 479 VAL A C   1 
ATOM   3090 O  O   . VAL A 1 487 ? 27.270  23.769 17.756  1.00 124.04 ? 479 VAL A O   1 
ATOM   3091 C  CB  . VAL A 1 487 ? 28.932  25.937 19.443  1.00 127.97 ? 479 VAL A CB  1 
ATOM   3092 C  CG1 . VAL A 1 487 ? 29.277  27.342 19.908  1.00 129.24 ? 479 VAL A CG1 1 
ATOM   3093 C  CG2 . VAL A 1 487 ? 28.188  25.167 20.526  1.00 126.96 ? 479 VAL A CG2 1 
ATOM   3094 N  N   . PRO A 1 488 ? 29.123  24.366 16.612  1.00 123.67 ? 480 PRO A N   1 
ATOM   3095 C  CA  . PRO A 1 488 ? 29.291  23.063 15.958  1.00 123.76 ? 480 PRO A CA  1 
ATOM   3096 C  C   . PRO A 1 488 ? 29.675  21.959 16.942  1.00 130.38 ? 480 PRO A C   1 
ATOM   3097 O  O   . PRO A 1 488 ? 30.651  22.101 17.679  1.00 133.99 ? 480 PRO A O   1 
ATOM   3098 C  CB  . PRO A 1 488 ? 30.426  23.314 14.958  1.00 126.34 ? 480 PRO A CB  1 
ATOM   3099 C  CG  . PRO A 1 488 ? 30.452  24.794 14.763  1.00 127.92 ? 480 PRO A CG  1 
ATOM   3100 C  CD  . PRO A 1 488 ? 30.063  25.369 16.085  1.00 125.84 ? 480 PRO A CD  1 
ATOM   3101 N  N   . ALA A 1 489 ? 28.910  20.871 16.947  1.00 135.31 ? 481 ALA A N   1 
ATOM   3102 C  CA  . ALA A 1 489 ? 29.200  19.729 17.808  1.00 138.99 ? 481 ALA A CA  1 
ATOM   3103 C  C   . ALA A 1 489 ? 29.628  18.524 16.973  1.00 143.34 ? 481 ALA A C   1 
ATOM   3104 O  O   . ALA A 1 489 ? 29.257  18.415 15.804  1.00 140.22 ? 481 ALA A O   1 
ATOM   3105 C  CB  . ALA A 1 489 ? 27.987  19.386 18.661  1.00 137.60 ? 481 ALA A CB  1 
ATOM   3106 N  N   . PRO A 1 490 ? 30.419  17.616 17.567  1.00 144.93 ? 482 PRO A N   1 
ATOM   3107 C  CA  . PRO A 1 490 ? 30.868  16.434 16.822  1.00 147.24 ? 482 PRO A CA  1 
ATOM   3108 C  C   . PRO A 1 490 ? 29.800  15.344 16.706  1.00 148.62 ? 482 PRO A C   1 
ATOM   3109 O  O   . PRO A 1 490 ? 29.725  14.679 15.671  1.00 148.04 ? 482 PRO A O   1 
ATOM   3110 C  CB  . PRO A 1 490 ? 32.061  15.939 17.643  1.00 153.98 ? 482 PRO A CB  1 
ATOM   3111 C  CG  . PRO A 1 490 ? 31.775  16.395 19.030  1.00 156.56 ? 482 PRO A CG  1 
ATOM   3112 C  CD  . PRO A 1 490 ? 31.054  17.709 18.895  1.00 149.44 ? 482 PRO A CD  1 
ATOM   3113 N  N   . ASP A 1 491 ? 28.985  15.169 17.743  1.00 151.19 ? 483 ASP A N   1 
ATOM   3114 C  CA  . ASP A 1 491 ? 28.009  14.082 17.769  1.00 150.53 ? 483 ASP A CA  1 
ATOM   3115 C  C   . ASP A 1 491 ? 26.563  14.574 17.786  1.00 146.07 ? 483 ASP A C   1 
ATOM   3116 O  O   . ASP A 1 491 ? 26.304  15.776 17.716  1.00 142.34 ? 483 ASP A O   1 
ATOM   3117 C  CB  . ASP A 1 491 ? 28.257  13.182 18.982  1.00 156.45 ? 483 ASP A CB  1 
ATOM   3118 C  CG  . ASP A 1 491 ? 28.203  13.944 20.291  1.00 165.77 ? 483 ASP A CG  1 
ATOM   3119 O  OD1 . ASP A 1 491 ? 29.276  14.312 20.812  1.00 174.49 ? 483 ASP A OD1 1 
ATOM   3120 O  OD2 . ASP A 1 491 ? 27.086  14.179 20.799  1.00 163.19 ? 483 ASP A OD2 1 
ATOM   3121 N  N   . ARG A 1 492 ? 25.635  13.623 17.889  1.00 142.51 ? 484 ARG A N   1 
ATOM   3122 C  CA  . ARG A 1 492 ? 24.197  13.894 17.884  1.00 137.54 ? 484 ARG A CA  1 
ATOM   3123 C  C   . ARG A 1 492 ? 23.769  14.694 16.658  1.00 133.79 ? 484 ARG A C   1 
ATOM   3124 O  O   . ARG A 1 492 ? 24.005  14.286 15.522  1.00 132.93 ? 484 ARG A O   1 
ATOM   3125 C  CB  . ARG A 1 492 ? 23.774  14.632 19.159  1.00 136.76 ? 484 ARG A CB  1 
ATOM   3126 C  CG  . ARG A 1 492 ? 23.924  13.821 20.436  1.00 145.59 ? 484 ARG A CG  1 
ATOM   3127 C  CD  . ARG A 1 492 ? 23.336  14.560 21.630  1.00 148.49 ? 484 ARG A CD  1 
ATOM   3128 N  NE  . ARG A 1 492 ? 23.798  14.010 22.902  1.00 158.67 ? 484 ARG A NE  1 
ATOM   3129 C  CZ  . ARG A 1 492 ? 23.215  12.999 23.539  1.00 169.49 ? 484 ARG A CZ  1 
ATOM   3130 N  NH1 . ARG A 1 492 ? 23.709  12.568 24.693  1.00 168.50 ? 484 ARG A NH1 1 
ATOM   3131 N  NH2 . ARG A 1 492 ? 22.141  12.418 23.024  1.00 157.59 ? 484 ARG A NH2 1 
ATOM   3132 N  N   . LYS A 1 493 ? 23.138  15.838 16.902  1.00 130.34 ? 485 LYS A N   1 
ATOM   3133 C  CA  . LYS A 1 493 ? 22.650  16.698 15.830  1.00 125.11 ? 485 LYS A CA  1 
ATOM   3134 C  C   . LYS A 1 493 ? 23.798  17.349 15.066  1.00 128.26 ? 485 LYS A C   1 
ATOM   3135 O  O   . LYS A 1 493 ? 23.634  17.771 13.922  1.00 126.12 ? 485 LYS A O   1 
ATOM   3136 C  CB  . LYS A 1 493 ? 21.723  17.779 16.394  1.00 122.21 ? 485 LYS A CB  1 
ATOM   3137 C  CG  . LYS A 1 493 ? 20.244  17.416 16.417  1.00 120.16 ? 485 LYS A CG  1 
ATOM   3138 C  CD  . LYS A 1 493 ? 19.978  16.163 17.234  1.00 130.83 ? 485 LYS A CD  1 
ATOM   3139 C  CE  . LYS A 1 493 ? 18.502  16.022 17.562  1.00 134.74 ? 485 LYS A CE  1 
ATOM   3140 N  NZ  . LYS A 1 493 ? 18.048  17.076 18.515  1.00 137.26 ? 485 LYS A NZ  1 
ATOM   3141 N  N   . GLY A 1 494 ? 24.958  17.427 15.707  1.00 130.04 ? 486 GLY A N   1 
ATOM   3142 C  CA  . GLY A 1 494 ? 26.115  18.060 15.106  1.00 131.59 ? 486 GLY A CA  1 
ATOM   3143 C  C   . GLY A 1 494 ? 26.265  19.490 15.580  1.00 133.20 ? 486 GLY A C   1 
ATOM   3144 O  O   . GLY A 1 494 ? 27.168  20.209 15.152  1.00 134.62 ? 486 GLY A O   1 
ATOM   3145 N  N   . PHE A 1 495 ? 25.370  19.905 16.469  1.00 124.10 ? 487 PHE A N   1 
ATOM   3146 C  CA  . PHE A 1 495 ? 25.424  21.249 17.026  1.00 123.42 ? 487 PHE A CA  1 
ATOM   3147 C  C   . PHE A 1 495 ? 24.907  21.273 18.458  1.00 125.39 ? 487 PHE A C   1 
ATOM   3148 O  O   . PHE A 1 495 ? 24.306  20.308 18.931  1.00 124.47 ? 487 PHE A O   1 
ATOM   3149 C  CB  . PHE A 1 495 ? 24.624  22.227 16.159  1.00 120.29 ? 487 PHE A CB  1 
ATOM   3150 C  CG  . PHE A 1 495 ? 23.131  22.068 16.273  1.00 117.35 ? 487 PHE A CG  1 
ATOM   3151 C  CD1 . PHE A 1 495 ? 22.449  21.180 15.458  1.00 115.64 ? 487 PHE A CD1 1 
ATOM   3152 C  CD2 . PHE A 1 495 ? 22.407  22.824 17.184  1.00 118.38 ? 487 PHE A CD2 1 
ATOM   3153 C  CE1 . PHE A 1 495 ? 21.075  21.043 15.557  1.00 113.77 ? 487 PHE A CE1 1 
ATOM   3154 C  CE2 . PHE A 1 495 ? 21.037  22.687 17.289  1.00 115.40 ? 487 PHE A CE2 1 
ATOM   3155 C  CZ  . PHE A 1 495 ? 20.370  21.796 16.474  1.00 111.90 ? 487 PHE A CZ  1 
ATOM   3156 N  N   . ARG A 1 496 ? 25.151  22.386 19.140  1.00 122.74 ? 488 ARG A N   1 
ATOM   3157 C  CA  . ARG A 1 496 ? 24.622  22.611 20.479  1.00 122.91 ? 488 ARG A CA  1 
ATOM   3158 C  C   . ARG A 1 496 ? 24.021  24.008 20.559  1.00 122.43 ? 488 ARG A C   1 
ATOM   3159 O  O   . ARG A 1 496 ? 24.423  24.909 19.822  1.00 122.42 ? 488 ARG A O   1 
ATOM   3160 C  CB  . ARG A 1 496 ? 25.713  22.448 21.540  1.00 126.69 ? 488 ARG A CB  1 
ATOM   3161 C  CG  . ARG A 1 496 ? 26.487  21.144 21.459  1.00 134.88 ? 488 ARG A CG  1 
ATOM   3162 C  CD  . ARG A 1 496 ? 25.642  19.956 21.882  1.00 137.05 ? 488 ARG A CD  1 
ATOM   3163 N  NE  . ARG A 1 496 ? 26.274  18.691 21.520  1.00 139.83 ? 488 ARG A NE  1 
ATOM   3164 C  CZ  . ARG A 1 496 ? 25.817  17.496 21.880  1.00 143.42 ? 488 ARG A CZ  1 
ATOM   3165 N  NH1 . ARG A 1 496 ? 24.724  17.400 22.624  1.00 133.26 ? 488 ARG A NH1 1 
ATOM   3166 N  NH2 . ARG A 1 496 ? 26.456  16.398 21.500  1.00 135.26 ? 488 ARG A NH2 1 
ATOM   3167 N  N   . LEU A 1 497 ? 23.055  24.185 21.453  1.00 114.94 ? 489 LEU A N   1 
ATOM   3168 C  CA  . LEU A 1 497 ? 22.443  25.489 21.664  1.00 112.05 ? 489 LEU A CA  1 
ATOM   3169 C  C   . LEU A 1 497 ? 22.979  26.123 22.940  1.00 116.79 ? 489 LEU A C   1 
ATOM   3170 O  O   . LEU A 1 497 ? 22.788  25.593 24.035  1.00 118.21 ? 489 LEU A O   1 
ATOM   3171 C  CB  . LEU A 1 497 ? 20.920  25.367 21.730  1.00 107.91 ? 489 LEU A CB  1 
ATOM   3172 C  CG  . LEU A 1 497 ? 20.157  26.607 22.203  1.00 106.63 ? 489 LEU A CG  1 
ATOM   3173 C  CD1 . LEU A 1 497 ? 20.411  27.796 21.288  1.00 104.33 ? 489 LEU A CD1 1 
ATOM   3174 C  CD2 . LEU A 1 497 ? 18.673  26.306 22.301  1.00 103.49 ? 489 LEU A CD2 1 
ATOM   3175 N  N   . LEU A 1 498 ? 23.657  27.256 22.794  1.00 112.84 ? 490 LEU A N   1 
ATOM   3176 C  CA  . LEU A 1 498 ? 24.224  27.948 23.945  1.00 115.13 ? 490 LEU A CA  1 
ATOM   3177 C  C   . LEU A 1 498 ? 23.246  28.968 24.514  1.00 115.13 ? 490 LEU A C   1 
ATOM   3178 O  O   . LEU A 1 498 ? 22.867  29.923 23.838  1.00 112.85 ? 490 LEU A O   1 
ATOM   3179 C  CB  . LEU A 1 498 ? 25.539  28.635 23.571  1.00 117.75 ? 490 LEU A CB  1 
ATOM   3180 C  CG  . LEU A 1 498 ? 26.668  27.737 23.057  1.00 122.91 ? 490 LEU A CG  1 
ATOM   3181 C  CD1 . LEU A 1 498 ? 27.995  28.479 23.099  1.00 126.45 ? 490 LEU A CD1 1 
ATOM   3182 C  CD2 . LEU A 1 498 ? 26.745  26.438 23.847  1.00 124.82 ? 490 LEU A CD2 1 
ATOM   3183 N  N   . LEU A 1 499 ? 22.840  28.754 25.761  1.00 116.84 ? 491 LEU A N   1 
ATOM   3184 C  CA  . LEU A 1 499 ? 21.946  29.674 26.450  1.00 114.73 ? 491 LEU A CA  1 
ATOM   3185 C  C   . LEU A 1 499 ? 22.594  30.215 27.719  1.00 120.32 ? 491 LEU A C   1 
ATOM   3186 O  O   . LEU A 1 499 ? 23.198  29.462 28.485  1.00 123.02 ? 491 LEU A O   1 
ATOM   3187 C  CB  . LEU A 1 499 ? 20.623  28.985 26.794  1.00 112.75 ? 491 LEU A CB  1 
ATOM   3188 C  CG  . LEU A 1 499 ? 19.592  28.805 25.681  1.00 110.67 ? 491 LEU A CG  1 
ATOM   3189 C  CD1 . LEU A 1 499 ? 18.441  27.943 26.168  1.00 109.38 ? 491 LEU A CD1 1 
ATOM   3190 C  CD2 . LEU A 1 499 ? 19.082  30.155 25.211  1.00 107.90 ? 491 LEU A CD2 1 
ATOM   3191 N  N   . ALA A 1 500 ? 22.472  31.521 27.935  1.00 119.71 ? 492 ALA A N   1 
ATOM   3192 C  CA  . ALA A 1 500 ? 22.949  32.134 29.168  1.00 122.40 ? 492 ALA A CA  1 
ATOM   3193 C  C   . ALA A 1 500 ? 22.167  31.570 30.347  1.00 125.35 ? 492 ALA A C   1 
ATOM   3194 O  O   . ALA A 1 500 ? 20.976  31.286 30.225  1.00 122.89 ? 492 ALA A O   1 
ATOM   3195 C  CB  . ALA A 1 500 ? 22.813  33.646 29.104  1.00 121.98 ? 492 ALA A CB  1 
ATOM   3196 N  N   . SER A 1 501 ? 22.837  31.400 31.482  1.00 131.74 ? 493 SER A N   1 
ATOM   3197 C  CA  . SER A 1 501 ? 22.194  30.816 32.652  1.00 132.86 ? 493 SER A CA  1 
ATOM   3198 C  C   . SER A 1 501 ? 22.739  31.389 33.953  1.00 139.86 ? 493 SER A C   1 
ATOM   3199 O  O   . SER A 1 501 ? 23.885  31.127 34.321  1.00 140.80 ? 493 SER A O   1 
ATOM   3200 C  CB  . SER A 1 501 ? 22.360  29.295 32.648  1.00 135.67 ? 493 SER A CB  1 
ATOM   3201 O  OG  . SER A 1 501 ? 21.793  28.717 33.812  1.00 142.27 ? 493 SER A OG  1 
ATOM   3202 N  N   . PRO A 1 502 ? 21.914  32.181 34.654  1.00 138.51 ? 494 PRO A N   1 
ATOM   3203 C  CA  . PRO A 1 502 ? 22.267  32.724 35.970  1.00 141.62 ? 494 PRO A CA  1 
ATOM   3204 C  C   . PRO A 1 502 ? 22.477  31.621 37.000  1.00 148.37 ? 494 PRO A C   1 
ATOM   3205 O  O   . PRO A 1 502 ? 23.337  31.745 37.871  1.00 149.28 ? 494 PRO A O   1 
ATOM   3206 C  CB  . PRO A 1 502 ? 21.053  33.587 36.334  1.00 143.74 ? 494 PRO A CB  1 
ATOM   3207 C  CG  . PRO A 1 502 ? 20.390  33.889 35.032  1.00 145.32 ? 494 PRO A CG  1 
ATOM   3208 C  CD  . PRO A 1 502 ? 20.607  32.673 34.189  1.00 139.11 ? 494 PRO A CD  1 
ATOM   3209 N  N   . ARG A 1 503 ? 21.692  30.554 36.889  1.00 140.24 ? 495 ARG A N   1 
ATOM   3210 C  CA  . ARG A 1 503 ? 21.795  29.421 37.802  1.00 143.14 ? 495 ARG A CA  1 
ATOM   3211 C  C   . ARG A 1 503 ? 23.142  28.725 37.646  1.00 149.26 ? 495 ARG A C   1 
ATOM   3212 O  O   . ARG A 1 503 ? 23.730  28.261 38.623  1.00 152.81 ? 495 ARG A O   1 
ATOM   3213 C  CB  . ARG A 1 503 ? 20.651  28.433 37.561  1.00 140.97 ? 495 ARG A CB  1 
ATOM   3214 C  CG  . ARG A 1 503 ? 20.656  27.233 38.494  1.00 149.75 ? 495 ARG A CG  1 
ATOM   3215 C  CD  . ARG A 1 503 ? 19.347  26.464 38.410  1.00 156.86 ? 495 ARG A CD  1 
ATOM   3216 N  NE  . ARG A 1 503 ? 18.203  27.290 38.789  1.00 162.23 ? 495 ARG A NE  1 
ATOM   3217 C  CZ  . ARG A 1 503 ? 17.749  27.416 40.033  1.00 170.40 ? 495 ARG A CZ  1 
ATOM   3218 N  NH1 . ARG A 1 503 ? 16.701  28.189 40.282  1.00 159.96 ? 495 ARG A NH1 1 
ATOM   3219 N  NH2 . ARG A 1 503 ? 18.343  26.770 41.027  1.00 165.18 ? 495 ARG A NH2 1 
ATOM   3220 N  N   . SER A 1 504 ? 23.622  28.661 36.408  1.00 144.76 ? 496 SER A N   1 
ATOM   3221 C  CA  . SER A 1 504 ? 24.924  28.080 36.110  1.00 147.67 ? 496 SER A CA  1 
ATOM   3222 C  C   . SER A 1 504 ? 26.045  28.912 36.724  1.00 151.91 ? 496 SER A C   1 
ATOM   3223 O  O   . SER A 1 504 ? 27.016  28.372 37.253  1.00 155.44 ? 496 SER A O   1 
ATOM   3224 C  CB  . SER A 1 504 ? 25.120  27.960 34.595  1.00 147.90 ? 496 SER A CB  1 
ATOM   3225 O  OG  . SER A 1 504 ? 26.421  27.497 34.278  1.00 155.76 ? 496 SER A OG  1 
ATOM   3226 N  N   . CYS A 1 505 ? 25.896  30.232 36.657  1.00 150.64 ? 497 CYS A N   1 
ATOM   3227 C  CA  . CYS A 1 505 ? 26.906  31.145 37.181  1.00 152.46 ? 497 CYS A CA  1 
ATOM   3228 C  C   . CYS A 1 505 ? 26.934  31.142 38.706  1.00 155.82 ? 497 CYS A C   1 
ATOM   3229 O  O   . CYS A 1 505 ? 28.005  31.187 39.314  1.00 158.73 ? 497 CYS A O   1 
ATOM   3230 C  CB  . CYS A 1 505 ? 26.663  32.566 36.668  1.00 149.99 ? 497 CYS A CB  1 
ATOM   3231 S  SG  . CYS A 1 505 ? 27.899  33.770 37.209  1.00 155.08 ? 497 CYS A SG  1 
ATOM   3232 N  N   . TYR A 1 506 ? 25.756  31.089 39.321  1.00 153.14 ? 498 TYR A N   1 
ATOM   3233 C  CA  . TYR A 1 506 ? 25.652  31.108 40.777  1.00 155.14 ? 498 TYR A CA  1 
ATOM   3234 C  C   . TYR A 1 506 ? 26.217  29.843 41.411  1.00 160.59 ? 498 TYR A C   1 
ATOM   3235 O  O   . TYR A 1 506 ? 26.815  29.897 42.486  1.00 163.94 ? 498 TYR A O   1 
ATOM   3236 C  CB  . TYR A 1 506 ? 24.196  31.296 41.207  1.00 153.10 ? 498 TYR A CB  1 
ATOM   3237 C  CG  . TYR A 1 506 ? 23.824  32.735 41.476  1.00 152.59 ? 498 TYR A CG  1 
ATOM   3238 C  CD1 . TYR A 1 506 ? 23.515  33.598 40.434  1.00 149.77 ? 498 TYR A CD1 1 
ATOM   3239 C  CD2 . TYR A 1 506 ? 23.782  33.232 42.772  1.00 156.04 ? 498 TYR A CD2 1 
ATOM   3240 C  CE1 . TYR A 1 506 ? 23.175  34.915 40.674  1.00 149.36 ? 498 TYR A CE1 1 
ATOM   3241 C  CE2 . TYR A 1 506 ? 23.443  34.548 43.022  1.00 155.88 ? 498 TYR A CE2 1 
ATOM   3242 C  CZ  . TYR A 1 506 ? 23.140  35.385 41.968  1.00 155.45 ? 498 TYR A CZ  1 
ATOM   3243 O  OH  . TYR A 1 506 ? 22.801  36.696 42.207  1.00 154.72 ? 498 TYR A OH  1 
ATOM   3244 N  N   . LYS A 1 507 ? 26.022  28.709 40.744  1.00 156.66 ? 499 LYS A N   1 
ATOM   3245 C  CA  . LYS A 1 507 ? 26.491  27.430 41.262  1.00 159.73 ? 499 LYS A CA  1 
ATOM   3246 C  C   . LYS A 1 507 ? 28.012  27.407 41.378  1.00 166.72 ? 499 LYS A C   1 
ATOM   3247 O  O   . LYS A 1 507 ? 28.557  26.892 42.353  1.00 170.39 ? 499 LYS A O   1 
ATOM   3248 C  CB  . LYS A 1 507 ? 26.012  26.278 40.376  1.00 158.95 ? 499 LYS A CB  1 
ATOM   3249 C  CG  . LYS A 1 507 ? 26.383  24.902 40.907  1.00 165.31 ? 499 LYS A CG  1 
ATOM   3250 C  CD  . LYS A 1 507 ? 25.789  23.789 40.061  1.00 170.80 ? 499 LYS A CD  1 
ATOM   3251 C  CE  . LYS A 1 507 ? 26.095  22.426 40.663  1.00 182.34 ? 499 LYS A CE  1 
ATOM   3252 N  NZ  . LYS A 1 507 ? 25.484  21.314 39.884  1.00 186.30 ? 499 LYS A NZ  1 
ATOM   3253 N  N   . LEU A 1 508 ? 28.690  27.973 40.383  1.00 165.04 ? 500 LEU A N   1 
ATOM   3254 C  CA  . LEU A 1 508 ? 30.146  28.059 40.404  1.00 168.57 ? 500 LEU A CA  1 
ATOM   3255 C  C   . LEU A 1 508 ? 30.628  28.916 41.569  1.00 171.35 ? 500 LEU A C   1 
ATOM   3256 O  O   . LEU A 1 508 ? 31.527  28.521 42.309  1.00 174.82 ? 500 LEU A O   1 
ATOM   3257 C  CB  . LEU A 1 508 ? 30.676  28.631 39.087  1.00 167.39 ? 500 LEU A CB  1 
ATOM   3258 C  CG  . LEU A 1 508 ? 32.194  28.828 39.015  1.00 174.39 ? 500 LEU A CG  1 
ATOM   3259 C  CD1 . LEU A 1 508 ? 32.917  27.489 38.952  1.00 178.96 ? 500 LEU A CD1 1 
ATOM   3260 C  CD2 . LEU A 1 508 ? 32.577  29.709 37.835  1.00 173.79 ? 500 LEU A CD2 1 
ATOM   3261 N  N   . PHE A 1 509 ? 30.017  30.087 41.726  1.00 164.24 ? 501 PHE A N   1 
ATOM   3262 C  CA  . PHE A 1 509 ? 30.405  31.034 42.767  1.00 167.34 ? 501 PHE A CA  1 
ATOM   3263 C  C   . PHE A 1 509 ? 30.174  30.473 44.170  1.00 172.31 ? 501 PHE A C   1 
ATOM   3264 O  O   . PHE A 1 509 ? 30.985  30.689 45.070  1.00 176.11 ? 501 PHE A O   1 
ATOM   3265 C  CB  . PHE A 1 509 ? 29.643  32.352 42.595  1.00 164.10 ? 501 PHE A CB  1 
ATOM   3266 C  CG  . PHE A 1 509 ? 30.286  33.306 41.622  1.00 162.66 ? 501 PHE A CG  1 
ATOM   3267 C  CD1 . PHE A 1 509 ? 30.657  32.886 40.354  1.00 163.02 ? 501 PHE A CD1 1 
ATOM   3268 C  CD2 . PHE A 1 509 ? 30.509  34.627 41.974  1.00 163.60 ? 501 PHE A CD2 1 
ATOM   3269 C  CE1 . PHE A 1 509 ? 31.246  33.764 39.460  1.00 162.68 ? 501 PHE A CE1 1 
ATOM   3270 C  CE2 . PHE A 1 509 ? 31.096  35.510 41.085  1.00 164.27 ? 501 PHE A CE2 1 
ATOM   3271 C  CZ  . PHE A 1 509 ? 31.465  35.077 39.826  1.00 162.23 ? 501 PHE A CZ  1 
ATOM   3272 N  N   . GLN A 1 510 ? 29.071  29.752 44.350  1.00 179.68 ? 502 GLN A N   1 
ATOM   3273 C  CA  . GLN A 1 510 ? 28.774  29.127 45.635  1.00 182.24 ? 502 GLN A CA  1 
ATOM   3274 C  C   . GLN A 1 510 ? 29.712  27.955 45.895  1.00 189.33 ? 502 GLN A C   1 
ATOM   3275 O  O   . GLN A 1 510 ? 30.101  27.697 47.034  1.00 193.00 ? 502 GLN A O   1 
ATOM   3276 C  CB  . GLN A 1 510 ? 27.319  28.653 45.686  1.00 166.59 ? 502 GLN A CB  1 
ATOM   3277 C  CG  . GLN A 1 510 ? 26.898  28.088 47.036  1.00 171.12 ? 502 GLN A CG  1 
ATOM   3278 C  CD  . GLN A 1 510 ? 26.905  29.136 48.132  1.00 173.89 ? 502 GLN A CD  1 
ATOM   3279 O  OE1 . GLN A 1 510 ? 27.616  29.006 49.129  1.00 178.92 ? 502 GLN A OE1 1 
ATOM   3280 N  NE2 . GLN A 1 510 ? 26.108  30.183 47.953  1.00 170.92 ? 502 GLN A NE2 1 
ATOM   3281 N  N   . GLU A 1 511 ? 30.069  27.247 44.828  1.00 176.94 ? 503 GLU A N   1 
ATOM   3282 C  CA  . GLU A 1 511 ? 30.969  26.105 44.929  1.00 181.17 ? 503 GLU A CA  1 
ATOM   3283 C  C   . GLU A 1 511 ? 32.394  26.550 45.239  1.00 187.64 ? 503 GLU A C   1 
ATOM   3284 O  O   . GLU A 1 511 ? 33.151  25.828 45.887  1.00 191.64 ? 503 GLU A O   1 
ATOM   3285 C  CB  . GLU A 1 511 ? 30.946  25.286 43.636  1.00 180.60 ? 503 GLU A CB  1 
ATOM   3286 N  N   . GLN A 1 512 ? 32.755  27.740 44.771  1.00 180.48 ? 504 GLN A N   1 
ATOM   3287 C  CA  . GLN A 1 512 ? 34.083  28.287 45.017  1.00 183.97 ? 504 GLN A CA  1 
ATOM   3288 C  C   . GLN A 1 512 ? 34.154  28.946 46.392  1.00 189.47 ? 504 GLN A C   1 
ATOM   3289 O  O   . GLN A 1 512 ? 35.232  29.079 46.973  1.00 193.78 ? 504 GLN A O   1 
ATOM   3290 C  CB  . GLN A 1 512 ? 34.465  29.288 43.924  1.00 182.29 ? 504 GLN A CB  1 
ATOM   3291 C  CG  . GLN A 1 512 ? 34.684  28.652 42.557  1.00 190.56 ? 504 GLN A CG  1 
ATOM   3292 C  CD  . GLN A 1 512 ? 35.845  27.675 42.545  1.00 206.12 ? 504 GLN A CD  1 
ATOM   3293 O  OE1 . GLN A 1 512 ? 36.822  27.844 43.275  1.00 207.00 ? 504 GLN A OE1 1 
ATOM   3294 N  NE2 . GLN A 1 512 ? 35.742  26.643 41.715  1.00 202.16 ? 504 GLN A NE2 1 
ATOM   3295 N  N   . GLN A 1 513 ? 32.999  29.358 46.906  1.00 183.01 ? 505 GLN A N   1 
ATOM   3296 C  CA  . GLN A 1 513 ? 32.915  29.899 48.257  1.00 185.17 ? 505 GLN A CA  1 
ATOM   3297 C  C   . GLN A 1 513 ? 33.136  28.775 49.262  1.00 190.98 ? 505 GLN A C   1 
ATOM   3298 O  O   . GLN A 1 513 ? 33.786  28.960 50.290  1.00 195.43 ? 505 GLN A O   1 
ATOM   3299 C  CB  . GLN A 1 513 ? 31.563  30.577 48.490  1.00 182.15 ? 505 GLN A CB  1 
ATOM   3300 C  CG  . GLN A 1 513 ? 31.479  31.393 49.771  1.00 185.77 ? 505 GLN A CG  1 
ATOM   3301 C  CD  . GLN A 1 513 ? 30.114  32.024 49.971  1.00 184.79 ? 505 GLN A CD  1 
ATOM   3302 O  OE1 . GLN A 1 513 ? 29.942  33.229 49.792  1.00 181.47 ? 505 GLN A OE1 1 
ATOM   3303 N  NE2 . GLN A 1 513 ? 29.136  31.209 50.347  1.00 183.36 ? 505 GLN A NE2 1 
ATOM   3304 N  N   . ASN A 1 514 ? 32.591  27.605 48.946  1.00 189.07 ? 506 ASN A N   1 
ATOM   3305 C  CA  . ASN A 1 514 ? 32.788  26.414 49.761  1.00 193.36 ? 506 ASN A CA  1 
ATOM   3306 C  C   . ASN A 1 514 ? 34.212  25.887 49.617  1.00 200.80 ? 506 ASN A C   1 
ATOM   3307 O  O   . ASN A 1 514 ? 34.722  25.190 50.495  1.00 205.30 ? 506 ASN A O   1 
ATOM   3308 C  CB  . ASN A 1 514 ? 31.776  25.332 49.377  1.00 191.55 ? 506 ASN A CB  1 
ATOM   3309 C  CG  . ASN A 1 514 ? 30.339  25.776 49.586  1.00 200.87 ? 506 ASN A CG  1 
ATOM   3310 O  OD1 . ASN A 1 514 ? 30.076  26.941 49.883  1.00 196.53 ? 506 ASN A OD1 1 
ATOM   3311 N  ND2 . ASN A 1 514 ? 29.402  24.847 49.428  1.00 194.66 ? 506 ASN A ND2 1 
ATOM   3312 N  N   . GLU A 1 515 ? 34.850  26.238 48.504  1.00 195.82 ? 507 GLU A N   1 
ATOM   3313 C  CA  . GLU A 1 515 ? 36.216  25.810 48.224  1.00 199.74 ? 507 GLU A CA  1 
ATOM   3314 C  C   . GLU A 1 515 ? 37.242  26.679 48.947  1.00 205.10 ? 507 GLU A C   1 
ATOM   3315 O  O   . GLU A 1 515 ? 38.445  26.434 48.859  1.00 208.41 ? 507 GLU A O   1 
ATOM   3316 C  CB  . GLU A 1 515 ? 36.485  25.834 46.718  1.00 198.27 ? 507 GLU A CB  1 
ATOM   3317 N  N   . GLY A 1 516 ? 36.762  27.695 49.657  1.00 204.86 ? 508 GLY A N   1 
ATOM   3318 C  CA  . GLY A 1 516 ? 37.632  28.554 50.439  1.00 207.88 ? 508 GLY A CA  1 
ATOM   3319 C  C   . GLY A 1 516 ? 38.059  29.817 49.716  1.00 208.42 ? 508 GLY A C   1 
ATOM   3320 O  O   . GLY A 1 516 ? 38.555  30.757 50.338  1.00 209.65 ? 508 GLY A O   1 
ATOM   3321 N  N   . HIS A 1 517 ? 37.865  29.845 48.401  1.00 197.03 ? 509 HIS A N   1 
ATOM   3322 C  CA  . HIS A 1 517 ? 38.260  30.996 47.596  1.00 194.34 ? 509 HIS A CA  1 
ATOM   3323 C  C   . HIS A 1 517 ? 37.117  31.999 47.454  1.00 189.53 ? 509 HIS A C   1 
ATOM   3324 O  O   . HIS A 1 517 ? 36.945  32.614 46.402  1.00 185.22 ? 509 HIS A O   1 
ATOM   3325 C  CB  . HIS A 1 517 ? 38.735  30.545 46.215  1.00 192.09 ? 509 HIS A CB  1 
ATOM   3326 N  N   . GLY A 1 518 ? 36.345  32.165 48.524  1.00 193.67 ? 510 GLY A N   1 
ATOM   3327 C  CA  . GLY A 1 518 ? 35.226  33.091 48.527  1.00 190.07 ? 510 GLY A CA  1 
ATOM   3328 C  C   . GLY A 1 518 ? 35.643  34.532 48.757  1.00 193.98 ? 510 GLY A C   1 
ATOM   3329 O  O   . GLY A 1 518 ? 34.799  35.414 48.913  1.00 191.52 ? 510 GLY A O   1 
ATOM   3330 N  N   . GLU A 1 519 ? 36.950  34.771 48.783  1.00 191.44 ? 511 GLU A N   1 
ATOM   3331 C  CA  . GLU A 1 519 ? 37.479  36.119 48.949  1.00 192.76 ? 511 GLU A CA  1 
ATOM   3332 C  C   . GLU A 1 519 ? 37.957  36.685 47.617  1.00 194.58 ? 511 GLU A C   1 
ATOM   3333 O  O   . GLU A 1 519 ? 38.473  37.801 47.558  1.00 195.08 ? 511 GLU A O   1 
ATOM   3334 C  CB  . GLU A 1 519 ? 38.623  36.127 49.965  1.00 199.46 ? 511 GLU A CB  1 
ATOM   3335 C  CG  . GLU A 1 519 ? 38.182  35.919 51.405  1.00 209.17 ? 511 GLU A CG  1 
ATOM   3336 C  CD  . GLU A 1 519 ? 37.437  37.115 51.968  1.00 217.37 ? 511 GLU A CD  1 
ATOM   3337 O  OE1 . GLU A 1 519 ? 37.624  38.235 51.448  1.00 200.67 ? 511 GLU A OE1 1 
ATOM   3338 O  OE2 . GLU A 1 519 ? 36.662  36.934 52.931  1.00 215.14 ? 511 GLU A OE2 1 
ATOM   3339 N  N   . ALA A 1 520 ? 37.779  35.908 46.553  1.00 194.77 ? 512 ALA A N   1 
ATOM   3340 C  CA  . ALA A 1 520 ? 38.212  36.310 45.220  1.00 193.56 ? 512 ALA A CA  1 
ATOM   3341 C  C   . ALA A 1 520 ? 37.491  37.572 44.759  1.00 193.48 ? 512 ALA A C   1 
ATOM   3342 O  O   . ALA A 1 520 ? 36.269  37.673 44.861  1.00 190.10 ? 512 ALA A O   1 
ATOM   3343 C  CB  . ALA A 1 520 ? 37.986  35.181 44.228  1.00 192.29 ? 512 ALA A CB  1 
ATOM   3344 N  N   . LEU A 1 521 ? 38.258  38.531 44.252  1.00 204.40 ? 513 LEU A N   1 
ATOM   3345 C  CA  . LEU A 1 521 ? 37.699  39.800 43.801  1.00 202.05 ? 513 LEU A CA  1 
ATOM   3346 C  C   . LEU A 1 521 ? 37.565  39.847 42.282  1.00 202.24 ? 513 LEU A C   1 
ATOM   3347 O  O   . LEU A 1 521 ? 38.544  39.663 41.557  1.00 203.82 ? 513 LEU A O   1 
ATOM   3348 C  CB  . LEU A 1 521 ? 38.565  40.966 44.286  1.00 205.09 ? 513 LEU A CB  1 
ATOM   3349 N  N   . LEU A 1 522 ? 36.349  40.094 41.807  1.00 209.61 ? 514 LEU A N   1 
ATOM   3350 C  CA  . LEU A 1 522 ? 36.102  40.226 40.377  1.00 206.51 ? 514 LEU A CA  1 
ATOM   3351 C  C   . LEU A 1 522 ? 36.603  41.575 39.885  1.00 208.13 ? 514 LEU A C   1 
ATOM   3352 O  O   . LEU A 1 522 ? 37.057  42.400 40.679  1.00 211.44 ? 514 LEU A O   1 
ATOM   3353 C  CB  . LEU A 1 522 ? 34.611  40.065 40.064  1.00 168.03 ? 514 LEU A CB  1 
ATOM   3354 N  N   . PHE A 1 523 ? 36.529  41.784 38.573  1.00 209.81 ? 515 PHE A N   1 
ATOM   3355 C  CA  . PHE A 1 523 ? 36.885  43.064 37.963  1.00 211.95 ? 515 PHE A CA  1 
ATOM   3356 C  C   . PHE A 1 523 ? 38.351  43.403 38.202  1.00 219.44 ? 515 PHE A C   1 
ATOM   3357 O  O   . PHE A 1 523 ? 38.727  44.574 38.266  1.00 221.57 ? 515 PHE A O   1 
ATOM   3358 C  CB  . PHE A 1 523 ? 35.998  44.190 38.503  1.00 211.46 ? 515 PHE A CB  1 
ATOM   3359 C  CG  . PHE A 1 523 ? 34.580  44.145 38.011  1.00 205.29 ? 515 PHE A CG  1 
ATOM   3360 C  CD1 . PHE A 1 523 ? 33.990  45.274 37.477  1.00 201.65 ? 515 PHE A CD1 1 
ATOM   3361 C  CD2 . PHE A 1 523 ? 33.837  42.979 38.086  1.00 202.05 ? 515 PHE A CD2 1 
ATOM   3362 C  CE1 . PHE A 1 523 ? 32.687  45.242 37.026  1.00 198.04 ? 515 PHE A CE1 1 
ATOM   3363 C  CE2 . PHE A 1 523 ? 32.540  42.938 37.635  1.00 197.40 ? 515 PHE A CE2 1 
ATOM   3364 C  CZ  . PHE A 1 523 ? 31.962  44.072 37.104  1.00 195.06 ? 515 PHE A CZ  1 
ATOM   3365 N  N   . GLU A 1 524 ? 39.174  42.371 38.342  1.00 226.75 ? 516 GLU A N   1 
ATOM   3366 C  CA  . GLU A 1 524 ? 40.588  42.561 38.621  1.00 234.20 ? 516 GLU A CA  1 
ATOM   3367 C  C   . GLU A 1 524 ? 41.356  42.850 37.339  1.00 235.84 ? 516 GLU A C   1 
ATOM   3368 O  O   . GLU A 1 524 ? 41.007  42.354 36.268  1.00 232.72 ? 516 GLU A O   1 
ATOM   3369 C  CB  . GLU A 1 524 ? 41.166  41.331 39.322  1.00 192.06 ? 516 GLU A CB  1 
ATOM   3370 N  N   . GLY A 1 525 ? 42.401  43.662 37.456  1.00 244.35 ? 517 GLY A N   1 
ATOM   3371 C  CA  . GLY A 1 525 ? 43.231  44.014 36.319  1.00 246.68 ? 517 GLY A CA  1 
ATOM   3372 C  C   . GLY A 1 525 ? 42.518  44.916 35.331  1.00 244.06 ? 517 GLY A C   1 
ATOM   3373 O  O   . GLY A 1 525 ? 42.846  44.940 34.146  1.00 243.51 ? 517 GLY A O   1 
ATOM   3374 N  N   . ILE A 1 526 ? 41.539  45.666 35.823  1.00 244.37 ? 518 ILE A N   1 
ATOM   3375 C  CA  . ILE A 1 526 ? 40.764  46.563 34.976  1.00 242.12 ? 518 ILE A CA  1 
ATOM   3376 C  C   . ILE A 1 526 ? 41.090  48.015 35.315  1.00 246.07 ? 518 ILE A C   1 
ATOM   3377 O  O   . ILE A 1 526 ? 41.281  48.360 36.481  1.00 249.31 ? 518 ILE A O   1 
ATOM   3378 C  CB  . ILE A 1 526 ? 39.252  46.305 35.134  1.00 237.42 ? 518 ILE A CB  1 
ATOM   3379 C  CG1 . ILE A 1 526 ? 38.952  44.814 34.972  1.00 235.55 ? 518 ILE A CG1 1 
ATOM   3380 C  CG2 . ILE A 1 526 ? 38.452  47.102 34.122  1.00 233.83 ? 518 ILE A CG2 1 
ATOM   3381 C  CD1 . ILE A 1 526 ? 39.365  44.253 33.633  1.00 234.95 ? 518 ILE A CD1 1 
ATOM   3382 N  N   . LYS A 1 527 ? 41.161  48.858 34.289  1.00 253.39 ? 519 LYS A N   1 
ATOM   3383 C  CA  . LYS A 1 527 ? 41.524  50.259 34.468  1.00 257.60 ? 519 LYS A CA  1 
ATOM   3384 C  C   . LYS A 1 527 ? 40.521  51.000 35.344  1.00 257.20 ? 519 LYS A C   1 
ATOM   3385 O  O   . LYS A 1 527 ? 40.893  51.629 36.335  1.00 261.42 ? 519 LYS A O   1 
ATOM   3386 C  CB  . LYS A 1 527 ? 41.640  50.957 33.111  1.00 200.49 ? 519 LYS A CB  1 
ATOM   3387 N  N   . LYS A 1 528 ? 39.247  50.915 34.976  1.00 245.10 ? 520 LYS A N   1 
ATOM   3388 C  CA  . LYS A 1 528 ? 38.196  51.634 35.684  1.00 244.74 ? 520 LYS A CA  1 
ATOM   3389 C  C   . LYS A 1 528 ? 37.059  50.702 36.080  1.00 240.73 ? 520 LYS A C   1 
ATOM   3390 O  O   . LYS A 1 528 ? 36.081  50.553 35.349  1.00 236.57 ? 520 LYS A O   1 
ATOM   3391 C  CB  . LYS A 1 528 ? 37.661  52.777 34.821  1.00 196.67 ? 520 LYS A CB  1 
ATOM   3392 N  N   . LYS A 1 529 ? 37.191  50.077 37.244  1.00 243.09 ? 521 LYS A N   1 
ATOM   3393 C  CA  . LYS A 1 529 ? 36.192  49.127 37.712  1.00 239.47 ? 521 LYS A CA  1 
ATOM   3394 C  C   . LYS A 1 529 ? 36.274  48.942 39.222  1.00 242.34 ? 521 LYS A C   1 
ATOM   3395 O  O   . LYS A 1 529 ? 37.301  49.223 39.839  1.00 247.08 ? 521 LYS A O   1 
ATOM   3396 C  CB  . LYS A 1 529 ? 36.366  47.782 37.008  1.00 180.65 ? 521 LYS A CB  1 
ATOM   3397 N  N   . LYS A 1 530 ? 35.182  48.470 39.813  1.00 213.34 ? 522 LYS A N   1 
ATOM   3398 C  CA  . LYS A 1 530 ? 35.130  48.244 41.252  1.00 215.60 ? 522 LYS A CA  1 
ATOM   3399 C  C   . LYS A 1 530 ? 35.234  46.759 41.575  1.00 212.99 ? 522 LYS A C   1 
ATOM   3400 O  O   . LYS A 1 530 ? 34.540  45.933 40.982  1.00 208.64 ? 522 LYS A O   1 
ATOM   3401 C  CB  . LYS A 1 530 ? 33.843  48.826 41.841  1.00 197.50 ? 522 LYS A CB  1 
ATOM   3402 N  N   . GLN A 1 531 ? 36.111  46.431 42.518  1.00 208.86 ? 523 GLN A N   1 
ATOM   3403 C  CA  . GLN A 1 531 ? 36.322  45.050 42.933  1.00 208.70 ? 523 GLN A CA  1 
ATOM   3404 C  C   . GLN A 1 531 ? 35.099  44.489 43.651  1.00 207.40 ? 523 GLN A C   1 
ATOM   3405 O  O   . GLN A 1 531 ? 34.524  45.143 44.522  1.00 207.97 ? 523 GLN A O   1 
ATOM   3406 C  CB  . GLN A 1 531 ? 37.553  44.947 43.837  1.00 214.11 ? 523 GLN A CB  1 
ATOM   3407 N  N   . GLN A 1 532 ? 34.705  43.276 43.275  1.00 196.44 ? 524 GLN A N   1 
ATOM   3408 C  CA  . GLN A 1 532 ? 33.563  42.610 43.888  1.00 193.97 ? 524 GLN A CA  1 
ATOM   3409 C  C   . GLN A 1 532 ? 33.939  41.202 44.341  1.00 196.08 ? 524 GLN A C   1 
ATOM   3410 O  O   . GLN A 1 532 ? 34.446  40.404 43.553  1.00 195.60 ? 524 GLN A O   1 
ATOM   3411 C  CB  . GLN A 1 532 ? 32.383  42.550 42.912  1.00 190.06 ? 524 GLN A CB  1 
ATOM   3412 C  CG  . GLN A 1 532 ? 31.947  43.898 42.344  1.00 194.50 ? 524 GLN A CG  1 
ATOM   3413 C  CD  . GLN A 1 532 ? 31.092  44.705 43.307  1.00 203.02 ? 524 GLN A CD  1 
ATOM   3414 O  OE1 . GLN A 1 532 ? 31.224  44.590 44.525  1.00 204.59 ? 524 GLN A OE1 1 
ATOM   3415 N  NE2 . GLN A 1 532 ? 30.203  45.525 42.758  1.00 193.36 ? 524 GLN A NE2 1 
ATOM   3416 N  N   . LYS A 1 533 ? 33.686  40.900 45.610  1.00 177.59 ? 525 LYS A N   1 
ATOM   3417 C  CA  . LYS A 1 533 ? 34.019  39.591 46.164  1.00 179.69 ? 525 LYS A CA  1 
ATOM   3418 C  C   . LYS A 1 533 ? 32.896  38.580 45.950  1.00 176.23 ? 525 LYS A C   1 
ATOM   3419 O  O   . LYS A 1 533 ? 31.721  38.940 45.912  1.00 173.58 ? 525 LYS A O   1 
ATOM   3420 C  CB  . LYS A 1 533 ? 34.345  39.713 47.656  1.00 185.33 ? 525 LYS A CB  1 
ATOM   3421 C  CG  . LYS A 1 533 ? 35.756  40.209 47.929  1.00 189.76 ? 525 LYS A CG  1 
ATOM   3422 C  CD  . LYS A 1 533 ? 35.811  41.156 49.118  1.00 194.19 ? 525 LYS A CD  1 
ATOM   3423 C  CE  . LYS A 1 533 ? 35.480  40.452 50.423  1.00 197.64 ? 525 LYS A CE  1 
ATOM   3424 N  NZ  . LYS A 1 533 ? 35.680  41.356 51.591  1.00 202.62 ? 525 LYS A NZ  1 
ATOM   3425 N  N   . ILE A 1 534 ? 33.271  37.314 45.802  1.00 175.01 ? 526 ILE A N   1 
ATOM   3426 C  CA  . ILE A 1 534 ? 32.303  36.241 45.612  1.00 172.30 ? 526 ILE A CA  1 
ATOM   3427 C  C   . ILE A 1 534 ? 31.385  36.123 46.828  1.00 174.28 ? 526 ILE A C   1 
ATOM   3428 O  O   . ILE A 1 534 ? 30.185  35.881 46.691  1.00 171.40 ? 526 ILE A O   1 
ATOM   3429 C  CB  . ILE A 1 534 ? 33.011  34.892 45.342  1.00 175.40 ? 526 ILE A CB  1 
ATOM   3430 C  CG1 . ILE A 1 534 ? 33.617  34.886 43.936  1.00 174.33 ? 526 ILE A CG1 1 
ATOM   3431 C  CG2 . ILE A 1 534 ? 32.049  33.726 45.499  1.00 174.07 ? 526 ILE A CG2 1 
ATOM   3432 C  CD1 . ILE A 1 534 ? 34.212  33.555 43.526  1.00 179.45 ? 526 ILE A CD1 1 
ATOM   3433 N  N   . LYS A 1 535 ? 31.955  36.325 48.011  1.00 173.85 ? 527 LYS A N   1 
ATOM   3434 C  CA  . LYS A 1 535 ? 31.206  36.243 49.261  1.00 176.69 ? 527 LYS A CA  1 
ATOM   3435 C  C   . LYS A 1 535 ? 30.021  37.206 49.307  1.00 174.52 ? 527 LYS A C   1 
ATOM   3436 O  O   . LYS A 1 535 ? 28.888  36.792 49.550  1.00 173.40 ? 527 LYS A O   1 
ATOM   3437 C  CB  . LYS A 1 535 ? 32.132  36.512 50.452  1.00 182.82 ? 527 LYS A CB  1 
ATOM   3438 N  N   . ASN A 1 536 ? 30.282  38.488 49.071  1.00 180.05 ? 528 ASN A N   1 
ATOM   3439 C  CA  . ASN A 1 536 ? 29.237  39.501 49.181  1.00 177.74 ? 528 ASN A CA  1 
ATOM   3440 C  C   . ASN A 1 536 ? 28.401  39.643 47.909  1.00 174.37 ? 528 ASN A C   1 
ATOM   3441 O  O   . ASN A 1 536 ? 27.401  40.363 47.892  1.00 171.99 ? 528 ASN A O   1 
ATOM   3442 C  CB  . ASN A 1 536 ? 29.842  40.854 49.571  1.00 179.74 ? 528 ASN A CB  1 
ATOM   3443 C  CG  . ASN A 1 536 ? 31.009  41.256 48.689  1.00 182.47 ? 528 ASN A CG  1 
ATOM   3444 O  OD1 . ASN A 1 536 ? 30.988  41.055 47.476  1.00 173.25 ? 528 ASN A OD1 1 
ATOM   3445 N  ND2 . ASN A 1 536 ? 32.038  41.830 49.301  1.00 183.53 ? 528 ASN A ND2 1 
ATOM   3446 N  N   . ILE A 1 537 ? 28.810  38.954 46.848  1.00 175.57 ? 529 ILE A N   1 
ATOM   3447 C  CA  . ILE A 1 537 ? 28.016  38.898 45.626  1.00 170.02 ? 529 ILE A CA  1 
ATOM   3448 C  C   . ILE A 1 537 ? 26.892  37.886 45.803  1.00 168.53 ? 529 ILE A C   1 
ATOM   3449 O  O   . ILE A 1 537 ? 25.767  38.099 45.349  1.00 165.30 ? 529 ILE A O   1 
ATOM   3450 C  CB  . ILE A 1 537 ? 28.867  38.513 44.402  1.00 167.39 ? 529 ILE A CB  1 
ATOM   3451 N  N   . LEU A 1 538 ? 27.212  36.784 46.473  1.00 169.94 ? 530 LEU A N   1 
ATOM   3452 C  CA  . LEU A 1 538 ? 26.232  35.754 46.788  1.00 169.08 ? 530 LEU A CA  1 
ATOM   3453 C  C   . LEU A 1 538 ? 25.326  36.193 47.933  1.00 173.06 ? 530 LEU A C   1 
ATOM   3454 O  O   . LEU A 1 538 ? 24.216  35.685 48.086  1.00 171.80 ? 530 LEU A O   1 
ATOM   3455 C  CB  . LEU A 1 538 ? 26.931  34.443 47.151  1.00 171.67 ? 530 LEU A CB  1 
ATOM   3456 C  CG  . LEU A 1 538 ? 27.723  33.752 46.041  1.00 173.43 ? 530 LEU A CG  1 
ATOM   3457 C  CD1 . LEU A 1 538 ? 28.610  32.667 46.624  1.00 177.61 ? 530 LEU A CD1 1 
ATOM   3458 C  CD2 . LEU A 1 538 ? 26.780  33.169 45.006  1.00 170.06 ? 530 LEU A CD2 1 
ATOM   3459 N  N   . SER A 1 539 ? 25.806  37.137 48.737  1.00 166.29 ? 531 SER A N   1 
ATOM   3460 C  CA  . SER A 1 539 ? 25.045  37.613 49.886  1.00 169.76 ? 531 SER A CA  1 
ATOM   3461 C  C   . SER A 1 539 ? 24.143  38.784 49.510  1.00 167.61 ? 531 SER A C   1 
ATOM   3462 O  O   . SER A 1 539 ? 23.460  39.349 50.364  1.00 170.51 ? 531 SER A O   1 
ATOM   3463 C  CB  . SER A 1 539 ? 25.982  38.021 51.025  1.00 175.47 ? 531 SER A CB  1 
ATOM   3464 O  OG  . SER A 1 539 ? 26.515  39.315 50.812  1.00 175.73 ? 531 SER A OG  1 
ATOM   3465 N  N   . ASN A 1 540 ? 24.145  39.148 48.232  1.00 167.88 ? 532 ASN A N   1 
ATOM   3466 C  CA  . ASN A 1 540 ? 23.302  40.235 47.748  1.00 165.17 ? 532 ASN A CA  1 
ATOM   3467 C  C   . ASN A 1 540 ? 21.902  39.735 47.407  1.00 164.17 ? 532 ASN A C   1 
ATOM   3468 O  O   . ASN A 1 540 ? 21.715  38.996 46.440  1.00 160.70 ? 532 ASN A O   1 
ATOM   3469 C  CB  . ASN A 1 540 ? 23.937  40.907 46.529  1.00 162.24 ? 532 ASN A CB  1 
ATOM   3470 C  CG  . ASN A 1 540 ? 23.281  42.232 46.187  1.00 167.44 ? 532 ASN A CG  1 
ATOM   3471 O  OD1 . ASN A 1 540 ? 22.453  42.740 46.943  1.00 162.90 ? 532 ASN A OD1 1 
ATOM   3472 N  ND2 . ASN A 1 540 ? 23.657  42.804 45.049  1.00 159.97 ? 532 ASN A ND2 1 
ATOM   3473 N  N   . LYS A 1 541 ? 20.924  40.143 48.210  1.00 166.29 ? 533 LYS A N   1 
ATOM   3474 C  CA  . LYS A 1 541 ? 19.545  39.699 48.034  1.00 164.41 ? 533 LYS A CA  1 
ATOM   3475 C  C   . LYS A 1 541 ? 18.875  40.388 46.849  1.00 159.90 ? 533 LYS A C   1 
ATOM   3476 O  O   . LYS A 1 541 ? 17.879  39.897 46.317  1.00 157.00 ? 533 LYS A O   1 
ATOM   3477 C  CB  . LYS A 1 541 ? 18.738  39.953 49.309  1.00 169.27 ? 533 LYS A CB  1 
ATOM   3478 N  N   . THR A 1 542 ? 19.423  41.527 46.443  1.00 162.97 ? 534 THR A N   1 
ATOM   3479 C  CA  . THR A 1 542 ? 18.867  42.286 45.330  1.00 159.78 ? 534 THR A CA  1 
ATOM   3480 C  C   . THR A 1 542 ? 19.257  41.652 43.999  1.00 159.73 ? 534 THR A C   1 
ATOM   3481 O  O   . THR A 1 542 ? 18.416  41.458 43.120  1.00 156.94 ? 534 THR A O   1 
ATOM   3482 C  CB  . THR A 1 542 ? 19.343  43.752 45.351  1.00 165.46 ? 534 THR A CB  1 
ATOM   3483 O  OG1 . THR A 1 542 ? 19.458  44.202 46.707  1.00 171.15 ? 534 THR A OG1 1 
ATOM   3484 C  CG2 . THR A 1 542 ? 18.364  44.644 44.602  1.00 161.24 ? 534 THR A CG2 1 
ATOM   3485 N  N   . LEU A 1 543 ? 20.539  41.328 43.864  1.00 157.12 ? 535 LEU A N   1 
ATOM   3486 C  CA  . LEU A 1 543 ? 21.071  40.750 42.635  1.00 154.76 ? 535 LEU A CA  1 
ATOM   3487 C  C   . LEU A 1 543 ? 20.551  39.335 42.404  1.00 155.31 ? 535 LEU A C   1 
ATOM   3488 O  O   . LEU A 1 543 ? 20.393  38.899 41.264  1.00 152.29 ? 535 LEU A O   1 
ATOM   3489 C  CB  . LEU A 1 543 ? 22.600  40.738 42.676  1.00 157.04 ? 535 LEU A CB  1 
ATOM   3490 C  CG  . LEU A 1 543 ? 23.320  40.525 41.344  1.00 157.68 ? 535 LEU A CG  1 
ATOM   3491 C  CD1 . LEU A 1 543 ? 23.253  41.788 40.501  1.00 155.78 ? 535 LEU A CD1 1 
ATOM   3492 C  CD2 . LEU A 1 543 ? 24.761  40.096 41.567  1.00 162.03 ? 535 LEU A CD2 1 
ATOM   3493 N  N   . ARG A 1 544 ? 20.290  38.624 43.497  1.00 156.89 ? 536 ARG A N   1 
ATOM   3494 C  CA  . ARG A 1 544 ? 19.870  37.229 43.434  1.00 155.83 ? 536 ARG A CA  1 
ATOM   3495 C  C   . ARG A 1 544 ? 18.418  37.108 42.985  1.00 154.53 ? 536 ARG A C   1 
ATOM   3496 O  O   . ARG A 1 544 ? 18.018  36.099 42.402  1.00 152.97 ? 536 ARG A O   1 
ATOM   3497 C  CB  . ARG A 1 544 ? 20.066  36.558 44.797  1.00 159.64 ? 536 ARG A CB  1 
ATOM   3498 C  CG  . ARG A 1 544 ? 20.231  35.047 44.741  1.00 165.58 ? 536 ARG A CG  1 
ATOM   3499 C  CD  . ARG A 1 544 ? 21.164  34.558 45.842  1.00 173.99 ? 536 ARG A CD  1 
ATOM   3500 N  NE  . ARG A 1 544 ? 21.564  33.167 45.644  1.00 178.48 ? 536 ARG A NE  1 
ATOM   3501 C  CZ  . ARG A 1 544 ? 22.553  32.572 46.303  1.00 189.82 ? 536 ARG A CZ  1 
ATOM   3502 N  NH1 . ARG A 1 544 ? 23.253  33.247 47.206  1.00 183.87 ? 536 ARG A NH1 1 
ATOM   3503 N  NH2 . ARG A 1 544 ? 22.848  31.303 46.056  1.00 183.97 ? 536 ARG A NH2 1 
ATOM   3504 N  N   . GLU A 1 545 ? 17.633  38.146 43.253  1.00 162.02 ? 537 GLU A N   1 
ATOM   3505 C  CA  . GLU A 1 545 ? 16.229  38.163 42.863  1.00 159.06 ? 537 GLU A CA  1 
ATOM   3506 C  C   . GLU A 1 545 ? 16.092  38.485 41.380  1.00 156.70 ? 537 GLU A C   1 
ATOM   3507 O  O   . GLU A 1 545 ? 15.240  37.929 40.687  1.00 153.62 ? 537 GLU A O   1 
ATOM   3508 C  CB  . GLU A 1 545 ? 15.453  39.179 43.703  1.00 161.10 ? 537 GLU A CB  1 
ATOM   3509 C  CG  . GLU A 1 545 ? 14.127  38.663 44.234  1.00 167.76 ? 537 GLU A CG  1 
ATOM   3510 C  CD  . GLU A 1 545 ? 13.516  39.588 45.269  1.00 180.69 ? 537 GLU A CD  1 
ATOM   3511 O  OE1 . GLU A 1 545 ? 13.768  40.810 45.201  1.00 181.57 ? 537 GLU A OE1 1 
ATOM   3512 O  OE2 . GLU A 1 545 ? 12.790  39.091 46.157  1.00 171.82 ? 537 GLU A OE2 1 
ATOM   3513 N  N   . HIS A 1 546 ? 16.948  39.381 40.900  1.00 150.47 ? 538 HIS A N   1 
ATOM   3514 C  CA  . HIS A 1 546 ? 16.918  39.810 39.507  1.00 147.18 ? 538 HIS A CA  1 
ATOM   3515 C  C   . HIS A 1 546 ? 17.389  38.703 38.571  1.00 147.97 ? 538 HIS A C   1 
ATOM   3516 O  O   . HIS A 1 546 ? 16.803  38.484 37.510  1.00 144.92 ? 538 HIS A O   1 
ATOM   3517 C  CB  . HIS A 1 546 ? 17.777  41.061 39.317  1.00 148.33 ? 538 HIS A CB  1 
ATOM   3518 C  CG  . HIS A 1 546 ? 17.308  42.239 40.112  1.00 152.00 ? 538 HIS A CG  1 
ATOM   3519 N  ND1 . HIS A 1 546 ? 17.976  43.445 40.121  1.00 154.63 ? 538 HIS A ND1 1 
ATOM   3520 C  CD2 . HIS A 1 546 ? 16.235  42.398 40.923  1.00 153.85 ? 538 HIS A CD2 1 
ATOM   3521 C  CE1 . HIS A 1 546 ? 17.336  44.295 40.903  1.00 155.85 ? 538 HIS A CE1 1 
ATOM   3522 N  NE2 . HIS A 1 546 ? 16.276  43.685 41.402  1.00 155.61 ? 538 HIS A NE2 1 
ATOM   3523 N  N   . ASN A 1 547 ? 18.448  38.005 38.967  1.00 142.81 ? 539 ASN A N   1 
ATOM   3524 C  CA  . ASN A 1 547 ? 18.962  36.897 38.173  1.00 141.98 ? 539 ASN A CA  1 
ATOM   3525 C  C   . ASN A 1 547 ? 18.058  35.673 38.283  1.00 144.60 ? 539 ASN A C   1 
ATOM   3526 O  O   . ASN A 1 547 ? 18.214  34.702 37.541  1.00 143.89 ? 539 ASN A O   1 
ATOM   3527 C  CB  . ASN A 1 547 ? 20.390  36.552 38.599  1.00 144.13 ? 539 ASN A CB  1 
ATOM   3528 C  CG  . ASN A 1 547 ? 21.395  37.603 38.163  1.00 156.07 ? 539 ASN A CG  1 
ATOM   3529 O  OD1 . ASN A 1 547 ? 21.275  38.180 37.082  1.00 155.20 ? 539 ASN A OD1 1 
ATOM   3530 N  ND2 . ASN A 1 547 ? 22.388  37.862 39.006  1.00 151.63 ? 539 ASN A ND2 1 
ATOM   3531 N  N   . SER A 1 548 ? 17.112  35.730 39.216  1.00 144.67 ? 540 SER A N   1 
ATOM   3532 C  CA  . SER A 1 548 ? 16.086  34.703 39.338  1.00 143.53 ? 540 SER A CA  1 
ATOM   3533 C  C   . SER A 1 548 ? 14.954  35.005 38.367  1.00 141.31 ? 540 SER A C   1 
ATOM   3534 O  O   . SER A 1 548 ? 14.292  34.099 37.859  1.00 139.78 ? 540 SER A O   1 
ATOM   3535 C  CB  . SER A 1 548 ? 15.557  34.628 40.771  1.00 147.62 ? 540 SER A CB  1 
ATOM   3536 O  OG  . SER A 1 548 ? 14.563  33.626 40.896  1.00 150.55 ? 540 SER A OG  1 
ATOM   3537 N  N   . PHE A 1 549 ? 14.744  36.292 38.116  1.00 138.83 ? 541 PHE A N   1 
ATOM   3538 C  CA  . PHE A 1 549 ? 13.735  36.740 37.168  1.00 134.95 ? 541 PHE A CA  1 
ATOM   3539 C  C   . PHE A 1 549 ? 14.216  36.569 35.731  1.00 134.90 ? 541 PHE A C   1 
ATOM   3540 O  O   . PHE A 1 549 ? 13.457  36.140 34.861  1.00 132.04 ? 541 PHE A O   1 
ATOM   3541 C  CB  . PHE A 1 549 ? 13.363  38.202 37.429  1.00 135.54 ? 541 PHE A CB  1 
ATOM   3542 C  CG  . PHE A 1 549 ? 12.654  38.856 36.281  1.00 132.53 ? 541 PHE A CG  1 
ATOM   3543 C  CD1 . PHE A 1 549 ? 11.328  38.563 36.012  1.00 131.76 ? 541 PHE A CD1 1 
ATOM   3544 C  CD2 . PHE A 1 549 ? 13.315  39.762 35.467  1.00 132.26 ? 541 PHE A CD2 1 
ATOM   3545 C  CE1 . PHE A 1 549 ? 10.673  39.160 34.953  1.00 129.17 ? 541 PHE A CE1 1 
ATOM   3546 C  CE2 . PHE A 1 549 ? 12.665  40.362 34.407  1.00 130.75 ? 541 PHE A CE2 1 
ATOM   3547 C  CZ  . PHE A 1 549 ? 11.342  40.061 34.150  1.00 127.58 ? 541 PHE A CZ  1 
ATOM   3548 N  N   . VAL A 1 550 ? 15.477  36.912 35.487  1.00 128.84 ? 542 VAL A N   1 
ATOM   3549 C  CA  . VAL A 1 550 ? 16.070  36.760 34.163  1.00 127.07 ? 542 VAL A CA  1 
ATOM   3550 C  C   . VAL A 1 550 ? 16.088  35.294 33.746  1.00 128.57 ? 542 VAL A C   1 
ATOM   3551 O  O   . VAL A 1 550 ? 15.768  34.959 32.604  1.00 125.82 ? 542 VAL A O   1 
ATOM   3552 C  CB  . VAL A 1 550 ? 17.504  37.329 34.119  1.00 131.13 ? 542 VAL A CB  1 
ATOM   3553 C  CG1 . VAL A 1 550 ? 18.244  36.831 32.887  1.00 130.05 ? 542 VAL A CG1 1 
ATOM   3554 C  CG2 . VAL A 1 550 ? 17.473  38.849 34.157  1.00 130.80 ? 542 VAL A CG2 1 
ATOM   3555 N  N   . GLU A 1 551 ? 16.450  34.426 34.685  1.00 127.56 ? 543 GLU A N   1 
ATOM   3556 C  CA  . GLU A 1 551 ? 16.478  32.990 34.435  1.00 127.53 ? 543 GLU A CA  1 
ATOM   3557 C  C   . GLU A 1 551 ? 15.103  32.491 34.006  1.00 125.14 ? 543 GLU A C   1 
ATOM   3558 O  O   . GLU A 1 551 ? 14.991  31.585 33.184  1.00 123.21 ? 543 GLU A O   1 
ATOM   3559 C  CB  . GLU A 1 551 ? 16.950  32.233 35.679  1.00 131.87 ? 543 GLU A CB  1 
ATOM   3560 C  CG  . GLU A 1 551 ? 17.107  30.735 35.467  1.00 140.84 ? 543 GLU A CG  1 
ATOM   3561 C  CD  . GLU A 1 551 ? 16.440  29.918 36.555  1.00 156.28 ? 543 GLU A CD  1 
ATOM   3562 O  OE1 . GLU A 1 551 ? 15.905  30.523 37.507  1.00 154.88 ? 543 GLU A OE1 1 
ATOM   3563 O  OE2 . GLU A 1 551 ? 16.447  28.672 36.456  1.00 154.25 ? 543 GLU A OE2 1 
ATOM   3564 N  N   . ARG A 1 552 ? 14.060  33.104 34.558  1.00 123.18 ? 544 ARG A N   1 
ATOM   3565 C  CA  . ARG A 1 552 ? 12.686  32.732 34.241  1.00 121.14 ? 544 ARG A CA  1 
ATOM   3566 C  C   . ARG A 1 552 ? 12.330  33.095 32.800  1.00 120.32 ? 544 ARG A C   1 
ATOM   3567 O  O   . ARG A 1 552 ? 11.537  32.406 32.156  1.00 118.67 ? 544 ARG A O   1 
ATOM   3568 C  CB  . ARG A 1 552 ? 11.720  33.406 35.216  1.00 121.86 ? 544 ARG A CB  1 
ATOM   3569 C  CG  . ARG A 1 552 ? 10.308  32.844 35.199  1.00 127.50 ? 544 ARG A CG  1 
ATOM   3570 C  CD  . ARG A 1 552 ? 9.607   33.119 36.523  1.00 134.80 ? 544 ARG A CD  1 
ATOM   3571 N  NE  . ARG A 1 552 ? 8.249   32.583 36.558  1.00 138.91 ? 544 ARG A NE  1 
ATOM   3572 C  CZ  . ARG A 1 552 ? 7.507   32.504 37.658  1.00 151.86 ? 544 ARG A CZ  1 
ATOM   3573 N  NH1 . ARG A 1 552 ? 7.993   32.921 38.820  1.00 150.29 ? 544 ARG A NH1 1 
ATOM   3574 N  NH2 . ARG A 1 552 ? 6.280   32.004 37.597  1.00 144.43 ? 544 ARG A NH2 1 
ATOM   3575 N  N   . CYS A 1 553 ? 12.923  34.176 32.299  1.00 117.45 ? 545 CYS A N   1 
ATOM   3576 C  CA  . CYS A 1 553 ? 12.710  34.601 30.919  1.00 113.61 ? 545 CYS A CA  1 
ATOM   3577 C  C   . CYS A 1 553 ? 13.384  33.646 29.947  1.00 113.19 ? 545 CYS A C   1 
ATOM   3578 O  O   . CYS A 1 553 ? 12.765  33.175 28.994  1.00 111.26 ? 545 CYS A O   1 
ATOM   3579 C  CB  . CYS A 1 553 ? 13.241  36.018 30.697  1.00 113.55 ? 545 CYS A CB  1 
ATOM   3580 S  SG  . CYS A 1 553 ? 12.403  37.299 31.653  1.00 116.45 ? 545 CYS A SG  1 
ATOM   3581 N  N   . ILE A 1 554 ? 14.661  33.373 30.193  1.00 105.89 ? 546 ILE A N   1 
ATOM   3582 C  CA  . ILE A 1 554 ? 15.433  32.467 29.353  1.00 104.79 ? 546 ILE A CA  1 
ATOM   3583 C  C   . ILE A 1 554 ? 14.823  31.066 29.389  1.00 104.81 ? 546 ILE A C   1 
ATOM   3584 O  O   . ILE A 1 554 ? 14.825  30.357 28.384  1.00 102.81 ? 546 ILE A O   1 
ATOM   3585 C  CB  . ILE A 1 554 ? 16.912  32.424 29.794  1.00 107.51 ? 546 ILE A CB  1 
ATOM   3586 C  CG1 . ILE A 1 554 ? 17.517  33.828 29.731  1.00 107.73 ? 546 ILE A CG1 1 
ATOM   3587 C  CG2 . ILE A 1 554 ? 17.715  31.464 28.928  1.00 106.94 ? 546 ILE A CG2 1 
ATOM   3588 C  CD1 . ILE A 1 554 ? 18.978  33.887 30.106  1.00 110.51 ? 546 ILE A CD1 1 
ATOM   3589 N  N   . ASP A 1 555 ? 14.278  30.686 30.542  1.00 109.70 ? 547 ASP A N   1 
ATOM   3590 C  CA  . ASP A 1 555 ? 13.592  29.404 30.681  1.00 109.35 ? 547 ASP A CA  1 
ATOM   3591 C  C   . ASP A 1 555 ? 12.349  29.331 29.794  1.00 107.63 ? 547 ASP A C   1 
ATOM   3592 O  O   . ASP A 1 555 ? 12.001  28.262 29.293  1.00 107.65 ? 547 ASP A O   1 
ATOM   3593 C  CB  . ASP A 1 555 ? 13.203  29.151 32.141  1.00 112.67 ? 547 ASP A CB  1 
ATOM   3594 C  CG  . ASP A 1 555 ? 14.358  28.626 32.974  1.00 127.11 ? 547 ASP A CG  1 
ATOM   3595 O  OD1 . ASP A 1 555 ? 15.311  28.066 32.391  1.00 128.93 ? 547 ASP A OD1 1 
ATOM   3596 O  OD2 . ASP A 1 555 ? 14.309  28.766 34.214  1.00 134.34 ? 547 ASP A OD2 1 
ATOM   3597 N  N   . TRP A 1 556 ? 11.683  30.467 29.607  1.00 105.49 ? 548 TRP A N   1 
ATOM   3598 C  CA  . TRP A 1 556 ? 10.513  30.537 28.735  1.00 102.56 ? 548 TRP A CA  1 
ATOM   3599 C  C   . TRP A 1 556 ? 10.916  30.317 27.281  1.00 100.39 ? 548 TRP A C   1 
ATOM   3600 O  O   . TRP A 1 556 ? 10.313  29.509 26.572  1.00 98.51  ? 548 TRP A O   1 
ATOM   3601 C  CB  . TRP A 1 556 ? 9.800   31.883 28.891  1.00 102.16 ? 548 TRP A CB  1 
ATOM   3602 C  CG  . TRP A 1 556 ? 8.737   32.137 27.858  1.00 99.09  ? 548 TRP A CG  1 
ATOM   3603 C  CD1 . TRP A 1 556 ? 8.871   32.848 26.701  1.00 96.18  ? 548 TRP A CD1 1 
ATOM   3604 C  CD2 . TRP A 1 556 ? 7.378   31.683 27.894  1.00 98.93  ? 548 TRP A CD2 1 
ATOM   3605 N  NE1 . TRP A 1 556 ? 7.681   32.863 26.015  1.00 94.17  ? 548 TRP A NE1 1 
ATOM   3606 C  CE2 . TRP A 1 556 ? 6.749   32.155 26.726  1.00 95.79  ? 548 TRP A CE2 1 
ATOM   3607 C  CE3 . TRP A 1 556 ? 6.634   30.923 28.801  1.00 101.41 ? 548 TRP A CE3 1 
ATOM   3608 C  CZ2 . TRP A 1 556 ? 5.410   31.892 26.440  1.00 95.03  ? 548 TRP A CZ2 1 
ATOM   3609 C  CZ3 . TRP A 1 556 ? 5.306   30.663 28.517  1.00 100.72 ? 548 TRP A CZ3 1 
ATOM   3610 C  CH2 . TRP A 1 556 ? 4.708   31.146 27.345  1.00 97.52  ? 548 TRP A CH2 1 
ATOM   3611 N  N   . ASN A 1 557 ? 11.940  31.045 26.846  1.00 99.48  ? 549 ASN A N   1 
ATOM   3612 C  CA  . ASN A 1 557 ? 12.492  30.886 25.506  1.00 98.17  ? 549 ASN A CA  1 
ATOM   3613 C  C   . ASN A 1 557 ? 13.116  29.508 25.326  1.00 103.27 ? 549 ASN A C   1 
ATOM   3614 O  O   . ASN A 1 557 ? 13.140  28.965 24.221  1.00 101.58 ? 549 ASN A O   1 
ATOM   3615 C  CB  . ASN A 1 557 ? 13.528  31.977 25.225  1.00 96.14  ? 549 ASN A CB  1 
ATOM   3616 C  CG  . ASN A 1 557 ? 12.901  33.349 25.065  1.00 103.40 ? 549 ASN A CG  1 
ATOM   3617 O  OD1 . ASN A 1 557 ? 12.791  33.867 23.954  1.00 101.41 ? 549 ASN A OD1 1 
ATOM   3618 N  ND2 . ASN A 1 557 ? 12.478  33.940 26.175  1.00 96.60  ? 549 ASN A ND2 1 
ATOM   3619 N  N   . ARG A 1 558 ? 13.619  28.954 26.425  1.00 101.81 ? 550 ARG A N   1 
ATOM   3620 C  CA  . ARG A 1 558 ? 14.216  27.624 26.429  1.00 103.23 ? 550 ARG A CA  1 
ATOM   3621 C  C   . ARG A 1 558 ? 13.210  26.584 25.952  1.00 102.65 ? 550 ARG A C   1 
ATOM   3622 O  O   . ARG A 1 558 ? 13.528  25.737 25.121  1.00 101.79 ? 550 ARG A O   1 
ATOM   3623 C  CB  . ARG A 1 558 ? 14.719  27.272 27.832  1.00 106.47 ? 550 ARG A CB  1 
ATOM   3624 C  CG  . ARG A 1 558 ? 15.512  25.981 27.925  1.00 111.24 ? 550 ARG A CG  1 
ATOM   3625 C  CD  . ARG A 1 558 ? 15.871  25.679 29.373  1.00 114.10 ? 550 ARG A CD  1 
ATOM   3626 N  NE  . ARG A 1 558 ? 16.861  24.613 29.488  1.00 121.43 ? 550 ARG A NE  1 
ATOM   3627 C  CZ  . ARG A 1 558 ? 18.172  24.820 29.568  1.00 133.00 ? 550 ARG A CZ  1 
ATOM   3628 N  NH1 . ARG A 1 558 ? 18.651  26.056 29.546  1.00 129.27 ? 550 ARG A NH1 1 
ATOM   3629 N  NH2 . ARG A 1 558 ? 19.003  23.793 29.670  1.00 125.86 ? 550 ARG A NH2 1 
ATOM   3630 N  N   . GLU A 1 559 ? 11.993  26.666 26.478  1.00 105.02 ? 551 GLU A N   1 
ATOM   3631 C  CA  . GLU A 1 559 ? 10.933  25.732 26.117  1.00 103.39 ? 551 GLU A CA  1 
ATOM   3632 C  C   . GLU A 1 559 ? 10.322  26.088 24.767  1.00 102.87 ? 551 GLU A C   1 
ATOM   3633 O  O   . GLU A 1 559 ? 9.735   25.237 24.098  1.00 100.84 ? 551 GLU A O   1 
ATOM   3634 C  CB  . GLU A 1 559 ? 9.851   25.710 27.198  1.00 104.61 ? 551 GLU A CB  1 
ATOM   3635 C  CG  . GLU A 1 559 ? 10.371  25.344 28.576  1.00 117.50 ? 551 GLU A CG  1 
ATOM   3636 C  CD  . GLU A 1 559 ? 11.031  23.978 28.604  1.00 137.94 ? 551 GLU A CD  1 
ATOM   3637 O  OE1 . GLU A 1 559 ? 10.444  23.022 28.055  1.00 139.53 ? 551 GLU A OE1 1 
ATOM   3638 O  OE2 . GLU A 1 559 ? 12.140  23.864 29.168  1.00 135.91 ? 551 GLU A OE2 1 
ATOM   3639 N  N   . LEU A 1 560 ? 10.461  27.350 24.374  1.00 102.75 ? 552 LEU A N   1 
ATOM   3640 C  CA  . LEU A 1 560 ? 9.975   27.803 23.076  1.00 99.07  ? 552 LEU A CA  1 
ATOM   3641 C  C   . LEU A 1 560 ? 10.834  27.206 21.968  1.00 99.75  ? 552 LEU A C   1 
ATOM   3642 O  O   . LEU A 1 560 ? 10.319  26.701 20.970  1.00 96.45  ? 552 LEU A O   1 
ATOM   3643 C  CB  . LEU A 1 560 ? 9.984   29.331 22.996  1.00 98.69  ? 552 LEU A CB  1 
ATOM   3644 C  CG  . LEU A 1 560 ? 8.689   30.000 22.530  1.00 99.12  ? 552 LEU A CG  1 
ATOM   3645 C  CD1 . LEU A 1 560 ? 7.553   29.719 23.504  1.00 100.04 ? 552 LEU A CD1 1 
ATOM   3646 C  CD2 . LEU A 1 560 ? 8.890   31.498 22.355  1.00 100.81 ? 552 LEU A CD2 1 
ATOM   3647 N  N   . LEU A 1 561 ? 12.149  27.259 22.161  1.00 94.88  ? 553 LEU A N   1 
ATOM   3648 C  CA  . LEU A 1 561 ? 13.095  26.703 21.201  1.00 95.22  ? 553 LEU A CA  1 
ATOM   3649 C  C   . LEU A 1 561 ? 13.035  25.179 21.174  1.00 99.43  ? 553 LEU A C   1 
ATOM   3650 O  O   . LEU A 1 561 ? 13.224  24.563 20.127  1.00 98.83  ? 553 LEU A O   1 
ATOM   3651 C  CB  . LEU A 1 561 ? 14.517  27.167 21.523  1.00 97.82  ? 553 LEU A CB  1 
ATOM   3652 C  CG  . LEU A 1 561 ? 14.800  28.658 21.332  1.00 98.63  ? 553 LEU A CG  1 
ATOM   3653 C  CD1 . LEU A 1 561 ? 16.206  29.006 21.791  1.00 101.53 ? 553 LEU A CD1 1 
ATOM   3654 C  CD2 . LEU A 1 561 ? 14.604  29.048 19.880  1.00 96.99  ? 553 LEU A CD2 1 
ATOM   3655 N  N   . LYS A 1 562 ? 12.773  24.574 22.328  1.00 102.55 ? 554 LYS A N   1 
ATOM   3656 C  CA  . LYS A 1 562 ? 12.659  23.121 22.422  1.00 102.43 ? 554 LYS A CA  1 
ATOM   3657 C  C   . LYS A 1 562 ? 11.477  22.599 21.612  1.00 101.85 ? 554 LYS A C   1 
ATOM   3658 O  O   . LYS A 1 562 ? 11.476  21.451 21.166  1.00 102.11 ? 554 LYS A O   1 
ATOM   3659 C  CB  . LYS A 1 562 ? 12.521  22.683 23.883  1.00 105.43 ? 554 LYS A CB  1 
ATOM   3660 C  CG  . LYS A 1 562 ? 13.834  22.637 24.648  1.00 112.47 ? 554 LYS A CG  1 
ATOM   3661 C  CD  . LYS A 1 562 ? 13.609  22.404 26.137  1.00 117.25 ? 554 LYS A CD  1 
ATOM   3662 C  CE  . LYS A 1 562 ? 12.978  21.047 26.407  1.00 121.08 ? 554 LYS A CE  1 
ATOM   3663 N  NZ  . LYS A 1 562 ? 12.813  20.798 27.867  1.00 126.12 ? 554 LYS A NZ  1 
ATOM   3664 N  N   . ARG A 1 563 ? 10.476  23.451 21.419  1.00 104.88 ? 555 ARG A N   1 
ATOM   3665 C  CA  . ARG A 1 563 ? 9.246   23.050 20.749  1.00 101.44 ? 555 ARG A CA  1 
ATOM   3666 C  C   . ARG A 1 563 ? 9.262   23.407 19.265  1.00 100.78 ? 555 ARG A C   1 
ATOM   3667 O  O   . ARG A 1 563 ? 8.723   22.671 18.436  1.00 97.74  ? 555 ARG A O   1 
ATOM   3668 C  CB  . ARG A 1 563 ? 8.042   23.703 21.430  1.00 101.12 ? 555 ARG A CB  1 
ATOM   3669 C  CG  . ARG A 1 563 ? 6.694   23.159 20.987  1.00 104.87 ? 555 ARG A CG  1 
ATOM   3670 C  CD  . ARG A 1 563 ? 5.567   24.031 21.511  1.00 110.75 ? 555 ARG A CD  1 
ATOM   3671 N  NE  . ARG A 1 563 ? 5.624   25.374 20.940  1.00 118.41 ? 555 ARG A NE  1 
ATOM   3672 C  CZ  . ARG A 1 563 ? 4.905   26.404 21.371  1.00 133.34 ? 555 ARG A CZ  1 
ATOM   3673 N  NH1 . ARG A 1 563 ? 4.071   26.253 22.391  1.00 132.55 ? 555 ARG A NH1 1 
ATOM   3674 N  NH2 . ARG A 1 563 ? 5.025   27.589 20.786  1.00 125.76 ? 555 ARG A NH2 1 
ATOM   3675 N  N   . GLU A 1 564 ? 9.883   24.534 18.930  1.00 92.46  ? 556 GLU A N   1 
ATOM   3676 C  CA  . GLU A 1 564 ? 9.885   25.017 17.553  1.00 89.03  ? 556 GLU A CA  1 
ATOM   3677 C  C   . GLU A 1 564 ? 11.128  24.590 16.776  1.00 90.65  ? 556 GLU A C   1 
ATOM   3678 O  O   . GLU A 1 564 ? 11.213  24.805 15.568  1.00 87.43  ? 556 GLU A O   1 
ATOM   3679 C  CB  . GLU A 1 564 ? 9.755   26.542 17.527  1.00 89.87  ? 556 GLU A CB  1 
ATOM   3680 C  CG  . GLU A 1 564 ? 8.385   27.056 17.945  1.00 95.16  ? 556 GLU A CG  1 
ATOM   3681 C  CD  . GLU A 1 564 ? 7.288   26.661 16.971  1.00 105.22 ? 556 GLU A CD  1 
ATOM   3682 O  OE1 . GLU A 1 564 ? 7.455   26.895 15.754  1.00 98.05  ? 556 GLU A OE1 1 
ATOM   3683 O  OE2 . GLU A 1 564 ? 6.259   26.115 17.422  1.00 103.47 ? 556 GLU A OE2 1 
ATOM   3684 N  N   . LEU A 1 565 ? 12.092  23.991 17.468  1.00 89.37  ? 557 LEU A N   1 
ATOM   3685 C  CA  . LEU A 1 565 ? 13.287  23.477 16.809  1.00 90.69  ? 557 LEU A CA  1 
ATOM   3686 C  C   . LEU A 1 565 ? 13.456  21.987 17.075  1.00 96.59  ? 557 LEU A C   1 
ATOM   3687 O  O   . LEU A 1 565 ? 14.391  21.362 16.575  1.00 98.43  ? 557 LEU A O   1 
ATOM   3688 C  CB  . LEU A 1 565 ? 14.534  24.238 17.266  1.00 94.17  ? 557 LEU A CB  1 
ATOM   3689 C  CG  . LEU A 1 565 ? 14.633  25.698 16.827  1.00 95.27  ? 557 LEU A CG  1 
ATOM   3690 C  CD1 . LEU A 1 565 ? 15.859  26.365 17.431  1.00 98.87  ? 557 LEU A CD1 1 
ATOM   3691 C  CD2 . LEU A 1 565 ? 14.665  25.787 15.311  1.00 93.67  ? 557 LEU A CD2 1 
ATOM   3692 N  N   . GLY A 1 566 ? 12.540  21.426 17.860  1.00 98.79  ? 558 GLY A N   1 
ATOM   3693 C  CA  . GLY A 1 566 ? 12.573  20.015 18.196  1.00 100.99 ? 558 GLY A CA  1 
ATOM   3694 C  C   . GLY A 1 566 ? 13.854  19.630 18.907  1.00 109.81 ? 558 GLY A C   1 
ATOM   3695 O  O   . GLY A 1 566 ? 14.593  18.759 18.449  1.00 111.43 ? 558 GLY A O   1 
ATOM   3696 N  N   . LEU A 1 567 ? 14.121  20.287 20.030  1.00 102.65 ? 559 LEU A N   1 
ATOM   3697 C  CA  . LEU A 1 567 ? 15.359  20.061 20.763  1.00 107.31 ? 559 LEU A CA  1 
ATOM   3698 C  C   . LEU A 1 567 ? 15.110  19.373 22.100  1.00 112.17 ? 559 LEU A C   1 
ATOM   3699 O  O   . LEU A 1 567 ? 14.186  19.728 22.832  1.00 111.03 ? 559 LEU A O   1 
ATOM   3700 C  CB  . LEU A 1 567 ? 16.090  21.386 20.993  1.00 109.18 ? 559 LEU A CB  1 
ATOM   3701 C  CG  . LEU A 1 567 ? 16.366  22.251 19.762  1.00 110.25 ? 559 LEU A CG  1 
ATOM   3702 C  CD1 . LEU A 1 567 ? 16.897  23.613 20.179  1.00 112.15 ? 559 LEU A CD1 1 
ATOM   3703 C  CD2 . LEU A 1 567 ? 17.339  21.562 18.817  1.00 112.83 ? 559 LEU A CD2 1 
ATOM   3704 N  N   . ALA A 1 568 ? 15.940  18.382 22.405  1.00 119.02 ? 560 ALA A N   1 
ATOM   3705 C  CA  . ALA A 1 568 ? 15.934  17.755 23.720  1.00 121.08 ? 560 ALA A CA  1 
ATOM   3706 C  C   . ALA A 1 568 ? 16.919  18.487 24.626  1.00 125.76 ? 560 ALA A C   1 
ATOM   3707 O  O   . ALA A 1 568 ? 17.747  19.261 24.147  1.00 126.42 ? 560 ALA A O   1 
ATOM   3708 C  CB  . ALA A 1 568 ? 16.287  16.281 23.616  1.00 123.32 ? 560 ALA A CB  1 
ATOM   3709 N  N   . GLU A 1 569 ? 16.832  18.242 25.930  1.00 118.15 ? 561 GLU A N   1 
ATOM   3710 C  CA  . GLU A 1 569 ? 17.730  18.883 26.887  1.00 121.02 ? 561 GLU A CA  1 
ATOM   3711 C  C   . GLU A 1 569 ? 19.178  18.449 26.680  1.00 127.36 ? 561 GLU A C   1 
ATOM   3712 O  O   . GLU A 1 569 ? 20.107  19.103 27.155  1.00 129.95 ? 561 GLU A O   1 
ATOM   3713 C  CB  . GLU A 1 569 ? 17.293  18.578 28.322  1.00 123.15 ? 561 GLU A CB  1 
ATOM   3714 C  CG  . GLU A 1 569 ? 16.138  19.433 28.821  1.00 122.65 ? 561 GLU A CG  1 
ATOM   3715 C  CD  . GLU A 1 569 ? 16.553  20.864 29.119  1.00 126.97 ? 561 GLU A CD  1 
ATOM   3716 O  OE1 . GLU A 1 569 ? 17.766  21.114 29.283  1.00 122.09 ? 561 GLU A OE1 1 
ATOM   3717 O  OE2 . GLU A 1 569 ? 15.664  21.738 29.191  1.00 117.71 ? 561 GLU A OE2 1 
ATOM   3718 N  N   . SER A 1 570 ? 19.362  17.346 25.959  1.00 129.67 ? 562 SER A N   1 
ATOM   3719 C  CA  . SER A 1 570 ? 20.689  16.805 25.693  1.00 133.37 ? 562 SER A CA  1 
ATOM   3720 C  C   . SER A 1 570 ? 21.377  17.532 24.541  1.00 136.24 ? 562 SER A C   1 
ATOM   3721 O  O   . SER A 1 570 ? 22.463  17.144 24.112  1.00 139.58 ? 562 SER A O   1 
ATOM   3722 C  CB  . SER A 1 570 ? 20.600  15.309 25.386  1.00 135.29 ? 562 SER A CB  1 
ATOM   3723 O  OG  . SER A 1 570 ? 19.763  15.069 24.267  1.00 134.81 ? 562 SER A OG  1 
ATOM   3724 N  N   . ASP A 1 571 ? 20.735  18.584 24.044  1.00 129.50 ? 563 ASP A N   1 
ATOM   3725 C  CA  . ASP A 1 571 ? 21.295  19.391 22.966  1.00 128.84 ? 563 ASP A CA  1 
ATOM   3726 C  C   . ASP A 1 571 ? 21.568  20.816 23.433  1.00 131.77 ? 563 ASP A C   1 
ATOM   3727 O  O   . ASP A 1 571 ? 22.103  21.633 22.683  1.00 131.77 ? 563 ASP A O   1 
ATOM   3728 C  CB  . ASP A 1 571 ? 20.352  19.415 21.760  1.00 125.21 ? 563 ASP A CB  1 
ATOM   3729 C  CG  . ASP A 1 571 ? 20.147  18.042 21.150  1.00 132.01 ? 563 ASP A CG  1 
ATOM   3730 O  OD1 . ASP A 1 571 ? 21.013  17.607 20.362  1.00 134.28 ? 563 ASP A OD1 1 
ATOM   3731 O  OD2 . ASP A 1 571 ? 19.117  17.403 21.453  1.00 133.96 ? 563 ASP A OD2 1 
ATOM   3732 N  N   . ILE A 1 572 ? 21.195  21.110 24.674  1.00 125.81 ? 564 ILE A N   1 
ATOM   3733 C  CA  . ILE A 1 572 ? 21.345  22.455 25.216  1.00 125.78 ? 564 ILE A CA  1 
ATOM   3734 C  C   . ILE A 1 572 ? 22.485  22.525 26.226  1.00 131.31 ? 564 ILE A C   1 
ATOM   3735 O  O   . ILE A 1 572 ? 22.643  21.632 27.057  1.00 132.91 ? 564 ILE A O   1 
ATOM   3736 C  CB  . ILE A 1 572 ? 20.047  22.937 25.893  1.00 124.80 ? 564 ILE A CB  1 
ATOM   3737 C  CG1 . ILE A 1 572 ? 18.834  22.622 25.017  1.00 120.72 ? 564 ILE A CG1 1 
ATOM   3738 C  CG2 . ILE A 1 572 ? 20.126  24.426 26.201  1.00 125.10 ? 564 ILE A CG2 1 
ATOM   3739 C  CD1 . ILE A 1 572 ? 17.513  23.012 25.644  1.00 119.18 ? 564 ILE A CD1 1 
ATOM   3740 N  N   . ILE A 1 573 ? 23.278  23.589 26.144  1.00 126.27 ? 565 ILE A N   1 
ATOM   3741 C  CA  . ILE A 1 573 ? 24.358  23.817 27.098  1.00 130.75 ? 565 ILE A CA  1 
ATOM   3742 C  C   . ILE A 1 573 ? 24.185  25.159 27.799  1.00 133.43 ? 565 ILE A C   1 
ATOM   3743 O  O   . ILE A 1 573 ? 24.083  26.202 27.151  1.00 131.28 ? 565 ILE A O   1 
ATOM   3744 C  CB  . ILE A 1 573 ? 25.740  23.783 26.423  1.00 135.39 ? 565 ILE A CB  1 
ATOM   3745 C  CG1 . ILE A 1 573 ? 25.941  22.466 25.673  1.00 136.04 ? 565 ILE A CG1 1 
ATOM   3746 C  CG2 . ILE A 1 573 ? 26.840  23.983 27.457  1.00 140.35 ? 565 ILE A CG2 1 
ATOM   3747 C  CD1 . ILE A 1 573 ? 27.286  22.354 24.988  1.00 142.81 ? 565 ILE A CD1 1 
ATOM   3748 N  N   . ASP A 1 574 ? 24.154  25.126 29.127  1.00 136.36 ? 566 ASP A N   1 
ATOM   3749 C  CA  . ASP A 1 574 ? 23.989  26.338 29.916  1.00 136.10 ? 566 ASP A CA  1 
ATOM   3750 C  C   . ASP A 1 574 ? 25.331  27.018 30.169  1.00 141.33 ? 566 ASP A C   1 
ATOM   3751 O  O   . ASP A 1 574 ? 26.275  26.394 30.656  1.00 144.97 ? 566 ASP A O   1 
ATOM   3752 C  CB  . ASP A 1 574 ? 23.295  26.020 31.242  1.00 137.86 ? 566 ASP A CB  1 
ATOM   3753 C  CG  . ASP A 1 574 ? 21.924  25.398 31.048  1.00 142.55 ? 566 ASP A CG  1 
ATOM   3754 O  OD1 . ASP A 1 574 ? 20.969  26.144 30.743  1.00 140.54 ? 566 ASP A OD1 1 
ATOM   3755 O  OD2 . ASP A 1 574 ? 21.799  24.165 31.203  1.00 146.24 ? 566 ASP A OD2 1 
ATOM   3756 N  N   . ILE A 1 575 ? 25.406  28.302 29.832  1.00 134.35 ? 567 ILE A N   1 
ATOM   3757 C  CA  . ILE A 1 575 ? 26.629  29.079 30.008  1.00 136.53 ? 567 ILE A CA  1 
ATOM   3758 C  C   . ILE A 1 575 ? 26.455  30.110 31.125  1.00 138.22 ? 567 ILE A C   1 
ATOM   3759 O  O   . ILE A 1 575 ? 25.473  30.856 31.140  1.00 134.26 ? 567 ILE A O   1 
ATOM   3760 C  CB  . ILE A 1 575 ? 27.044  29.785 28.693  1.00 137.12 ? 567 ILE A CB  1 
ATOM   3761 C  CG1 . ILE A 1 575 ? 27.905  28.855 27.833  1.00 139.43 ? 567 ILE A CG1 1 
ATOM   3762 C  CG2 . ILE A 1 575 ? 27.823  31.061 28.975  1.00 139.02 ? 567 ILE A CG2 1 
ATOM   3763 C  CD1 . ILE A 1 575 ? 27.165  27.671 27.254  1.00 140.59 ? 567 ILE A CD1 1 
ATOM   3764 N  N   . PRO A 1 576 ? 27.411  30.144 32.070  1.00 142.41 ? 568 PRO A N   1 
ATOM   3765 C  CA  . PRO A 1 576 ? 27.385  31.048 33.227  1.00 142.85 ? 568 PRO A CA  1 
ATOM   3766 C  C   . PRO A 1 576 ? 27.327  32.520 32.825  1.00 143.19 ? 568 PRO A C   1 
ATOM   3767 O  O   . PRO A 1 576 ? 28.175  32.988 32.064  1.00 144.40 ? 568 PRO A O   1 
ATOM   3768 C  CB  . PRO A 1 576 ? 28.700  30.732 33.950  1.00 148.12 ? 568 PRO A CB  1 
ATOM   3769 C  CG  . PRO A 1 576 ? 29.565  30.091 32.920  1.00 152.08 ? 568 PRO A CG  1 
ATOM   3770 C  CD  . PRO A 1 576 ? 28.628  29.316 32.053  1.00 147.07 ? 568 PRO A CD  1 
ATOM   3771 N  N   . GLN A 1 577 ? 26.330  33.232 33.345  1.00 141.72 ? 569 GLN A N   1 
ATOM   3772 C  CA  . GLN A 1 577 ? 26.100  34.632 33.002  1.00 139.01 ? 569 GLN A CA  1 
ATOM   3773 C  C   . GLN A 1 577 ? 25.031  35.229 33.908  1.00 139.46 ? 569 GLN A C   1 
ATOM   3774 O  O   . GLN A 1 577 ? 24.024  34.584 34.188  1.00 137.58 ? 569 GLN A O   1 
ATOM   3775 C  CB  . GLN A 1 577 ? 25.674  34.765 31.537  1.00 136.36 ? 569 GLN A CB  1 
ATOM   3776 C  CG  . GLN A 1 577 ? 25.366  36.184 31.101  1.00 140.38 ? 569 GLN A CG  1 
ATOM   3777 C  CD  . GLN A 1 577 ? 26.591  37.074 31.113  1.00 152.81 ? 569 GLN A CD  1 
ATOM   3778 O  OE1 . GLN A 1 577 ? 27.649  36.703 30.604  1.00 154.35 ? 569 GLN A OE1 1 
ATOM   3779 N  NE2 . GLN A 1 577 ? 26.455  38.258 31.698  1.00 145.27 ? 569 GLN A NE2 1 
ATOM   3780 N  N   . LEU A 1 578 ? 25.242  36.458 34.366  1.00 142.57 ? 570 LEU A N   1 
ATOM   3781 C  CA  . LEU A 1 578 ? 24.223  37.138 35.158  1.00 141.37 ? 570 LEU A CA  1 
ATOM   3782 C  C   . LEU A 1 578 ? 24.052  38.591 34.730  1.00 142.16 ? 570 LEU A C   1 
ATOM   3783 O  O   . LEU A 1 578 ? 24.946  39.185 34.126  1.00 142.97 ? 570 LEU A O   1 
ATOM   3784 C  CB  . LEU A 1 578 ? 24.550  37.051 36.651  1.00 145.02 ? 570 LEU A CB  1 
ATOM   3785 C  CG  . LEU A 1 578 ? 26.010  36.947 37.097  1.00 151.67 ? 570 LEU A CG  1 
ATOM   3786 C  CD1 . LEU A 1 578 ? 26.764  38.238 36.845  1.00 151.84 ? 570 LEU A CD1 1 
ATOM   3787 C  CD2 . LEU A 1 578 ? 26.084  36.564 38.568  1.00 156.51 ? 570 LEU A CD2 1 
ATOM   3788 N  N   . PHE A 1 579 ? 22.891  39.154 35.050  1.00 146.22 ? 571 PHE A N   1 
ATOM   3789 C  CA  . PHE A 1 579 ? 22.510  40.470 34.555  1.00 144.00 ? 571 PHE A CA  1 
ATOM   3790 C  C   . PHE A 1 579 ? 22.149  41.434 35.681  1.00 147.69 ? 571 PHE A C   1 
ATOM   3791 O  O   . PHE A 1 579 ? 21.764  41.017 36.772  1.00 149.10 ? 571 PHE A O   1 
ATOM   3792 C  CB  . PHE A 1 579 ? 21.326  40.347 33.590  1.00 140.86 ? 571 PHE A CB  1 
ATOM   3793 C  CG  . PHE A 1 579 ? 21.580  39.430 32.426  1.00 140.03 ? 571 PHE A CG  1 
ATOM   3794 C  CD1 . PHE A 1 579 ? 21.452  38.058 32.567  1.00 142.20 ? 571 PHE A CD1 1 
ATOM   3795 C  CD2 . PHE A 1 579 ? 21.932  39.940 31.188  1.00 139.26 ? 571 PHE A CD2 1 
ATOM   3796 C  CE1 . PHE A 1 579 ? 21.679  37.211 31.501  1.00 141.74 ? 571 PHE A CE1 1 
ATOM   3797 C  CE2 . PHE A 1 579 ? 22.160  39.096 30.116  1.00 139.65 ? 571 PHE A CE2 1 
ATOM   3798 C  CZ  . PHE A 1 579 ? 22.033  37.730 30.273  1.00 139.29 ? 571 PHE A CZ  1 
ATOM   3799 N  N   . LYS A 1 580 ? 22.273  42.727 35.403  1.00 153.81 ? 572 LYS A N   1 
ATOM   3800 C  CA  . LYS A 1 580 ? 21.851  43.756 36.345  1.00 154.89 ? 572 LYS A CA  1 
ATOM   3801 C  C   . LYS A 1 580 ? 20.673  44.534 35.769  1.00 154.07 ? 572 LYS A C   1 
ATOM   3802 O  O   . LYS A 1 580 ? 20.695  44.934 34.605  1.00 151.64 ? 572 LYS A O   1 
ATOM   3803 C  CB  . LYS A 1 580 ? 23.007  44.703 36.674  1.00 159.46 ? 572 LYS A CB  1 
ATOM   3804 N  N   . LEU A 1 581 ? 19.641  44.736 36.581  1.00 158.33 ? 573 LEU A N   1 
ATOM   3805 C  CA  . LEU A 1 581 ? 18.468  45.483 36.144  1.00 156.04 ? 573 LEU A CA  1 
ATOM   3806 C  C   . LEU A 1 581 ? 18.788  46.962 35.968  1.00 159.31 ? 573 LEU A C   1 
ATOM   3807 O  O   . LEU A 1 581 ? 19.486  47.560 36.787  1.00 161.83 ? 573 LEU A O   1 
ATOM   3808 C  CB  . LEU A 1 581 ? 17.316  45.315 37.137  1.00 157.14 ? 573 LEU A CB  1 
ATOM   3809 C  CG  . LEU A 1 581 ? 16.496  44.029 37.031  1.00 158.51 ? 573 LEU A CG  1 
ATOM   3810 C  CD1 . LEU A 1 581 ? 15.310  44.081 37.979  1.00 164.35 ? 573 LEU A CD1 1 
ATOM   3811 C  CD2 . LEU A 1 581 ? 16.024  43.826 35.603  1.00 152.71 ? 573 LEU A CD2 1 
ATOM   3812 N  N   . LYS A 1 582 ? 18.276  47.543 34.888  1.00 160.72 ? 574 LYS A N   1 
ATOM   3813 C  CA  . LYS A 1 582 ? 18.454  48.963 34.613  1.00 161.34 ? 574 LYS A CA  1 
ATOM   3814 C  C   . LYS A 1 582 ? 17.124  49.691 34.776  1.00 163.93 ? 574 LYS A C   1 
ATOM   3815 O  O   . LYS A 1 582 ? 16.148  49.103 35.243  1.00 164.89 ? 574 LYS A O   1 
ATOM   3816 C  CB  . LYS A 1 582 ? 19.014  49.174 33.206  1.00 146.91 ? 574 LYS A CB  1 
ATOM   3817 N  N   . GLU A 1 583 ? 17.083  50.965 34.395  1.00 163.86 ? 575 GLU A N   1 
ATOM   3818 C  CA  . GLU A 1 583 ? 15.846  51.736 34.477  1.00 163.97 ? 575 GLU A CA  1 
ATOM   3819 C  C   . GLU A 1 583 ? 14.787  51.108 33.580  1.00 162.01 ? 575 GLU A C   1 
ATOM   3820 O  O   . GLU A 1 583 ? 15.117  50.478 32.573  1.00 159.38 ? 575 GLU A O   1 
ATOM   3821 C  CB  . GLU A 1 583 ? 16.074  53.199 34.090  1.00 167.42 ? 575 GLU A CB  1 
ATOM   3822 C  CG  . GLU A 1 583 ? 16.426  53.419 32.628  1.00 169.15 ? 575 GLU A CG  1 
ATOM   3823 C  CD  . GLU A 1 583 ? 17.848  53.011 32.306  1.00 181.06 ? 575 GLU A CD  1 
ATOM   3824 O  OE1 . GLU A 1 583 ? 18.770  53.811 32.569  1.00 184.66 ? 575 GLU A OE1 1 
ATOM   3825 O  OE2 . GLU A 1 583 ? 18.043  51.888 31.798  1.00 172.15 ? 575 GLU A OE2 1 
ATOM   3826 N  N   . PHE A 1 584 ? 13.523  51.276 33.963  1.00 169.63 ? 576 PHE A N   1 
ATOM   3827 C  CA  . PHE A 1 584 ? 12.398  50.621 33.296  1.00 166.25 ? 576 PHE A CA  1 
ATOM   3828 C  C   . PHE A 1 584 ? 12.535  49.102 33.367  1.00 165.23 ? 576 PHE A C   1 
ATOM   3829 O  O   . PHE A 1 584 ? 12.045  48.384 32.495  1.00 161.10 ? 576 PHE A O   1 
ATOM   3830 C  CB  . PHE A 1 584 ? 12.280  51.080 31.839  1.00 164.77 ? 576 PHE A CB  1 
ATOM   3831 C  CG  . PHE A 1 584 ? 11.656  52.436 31.679  1.00 166.92 ? 576 PHE A CG  1 
ATOM   3832 C  CD1 . PHE A 1 584 ? 10.447  52.733 32.287  1.00 170.00 ? 576 PHE A CD1 1 
ATOM   3833 C  CD2 . PHE A 1 584 ? 12.280  53.416 30.924  1.00 168.64 ? 576 PHE A CD2 1 
ATOM   3834 C  CE1 . PHE A 1 584 ? 9.868   53.979 32.140  1.00 171.70 ? 576 PHE A CE1 1 
ATOM   3835 C  CE2 . PHE A 1 584 ? 11.707  54.666 30.775  1.00 171.43 ? 576 PHE A CE2 1 
ATOM   3836 C  CZ  . PHE A 1 584 ? 10.499  54.947 31.384  1.00 171.44 ? 576 PHE A CZ  1 
ATOM   3837 N  N   . SER A 1 585 ? 13.214  48.631 34.412  1.00 154.38 ? 577 SER A N   1 
ATOM   3838 C  CA  . SER A 1 585 ? 13.364  47.205 34.696  1.00 153.49 ? 577 SER A CA  1 
ATOM   3839 C  C   . SER A 1 585 ? 13.990  46.416 33.547  1.00 152.82 ? 577 SER A C   1 
ATOM   3840 O  O   . SER A 1 585 ? 13.754  45.216 33.409  1.00 151.65 ? 577 SER A O   1 
ATOM   3841 C  CB  . SER A 1 585 ? 12.006  46.597 35.057  1.00 154.46 ? 577 SER A CB  1 
ATOM   3842 O  OG  . SER A 1 585 ? 11.442  47.244 36.184  1.00 161.83 ? 577 SER A OG  1 
ATOM   3843 N  N   . LYS A 1 586 ? 14.791  47.091 32.730  1.00 150.06 ? 578 LYS A N   1 
ATOM   3844 C  CA  . LYS A 1 586 ? 15.455  46.447 31.602  1.00 147.68 ? 578 LYS A CA  1 
ATOM   3845 C  C   . LYS A 1 586 ? 16.737  45.749 32.051  1.00 152.59 ? 578 LYS A C   1 
ATOM   3846 O  O   . LYS A 1 586 ? 17.257  46.030 33.131  1.00 155.66 ? 578 LYS A O   1 
ATOM   3847 C  CB  . LYS A 1 586 ? 15.755  47.472 30.510  1.00 147.39 ? 578 LYS A CB  1 
ATOM   3848 C  CG  . LYS A 1 586 ? 14.513  48.055 29.851  1.00 147.38 ? 578 LYS A CG  1 
ATOM   3849 C  CD  . LYS A 1 586 ? 13.734  46.993 29.089  1.00 145.62 ? 578 LYS A CD  1 
ATOM   3850 C  CE  . LYS A 1 586 ? 12.306  46.875 29.602  1.00 147.51 ? 578 LYS A CE  1 
ATOM   3851 N  NZ  . LYS A 1 586 ? 11.498  45.919 28.792  1.00 148.51 ? 578 LYS A NZ  1 
ATOM   3852 N  N   . ALA A 1 587 ? 17.248  44.846 31.219  1.00 136.13 ? 579 ALA A N   1 
ATOM   3853 C  CA  . ALA A 1 587 ? 18.367  43.999 31.620  1.00 138.22 ? 579 ALA A CA  1 
ATOM   3854 C  C   . ALA A 1 587 ? 19.630  44.212 30.788  1.00 141.27 ? 579 ALA A C   1 
ATOM   3855 O  O   . ALA A 1 587 ? 19.610  44.098 29.563  1.00 137.71 ? 579 ALA A O   1 
ATOM   3856 C  CB  . ALA A 1 587 ? 17.953  42.536 31.562  1.00 137.63 ? 579 ALA A CB  1 
ATOM   3857 N  N   . GLU A 1 588 ? 20.727  44.518 31.474  1.00 144.42 ? 580 GLU A N   1 
ATOM   3858 C  CA  . GLU A 1 588 ? 22.050  44.550 30.861  1.00 146.06 ? 580 GLU A CA  1 
ATOM   3859 C  C   . GLU A 1 588 ? 22.932  43.485 31.498  1.00 151.26 ? 580 GLU A C   1 
ATOM   3860 O  O   . GLU A 1 588 ? 22.709  43.094 32.642  1.00 152.63 ? 580 GLU A O   1 
ATOM   3861 C  CB  . GLU A 1 588 ? 22.700  45.926 31.016  1.00 148.81 ? 580 GLU A CB  1 
ATOM   3862 C  CG  . GLU A 1 588 ? 22.162  46.998 30.089  1.00 155.49 ? 580 GLU A CG  1 
ATOM   3863 C  CD  . GLU A 1 588 ? 22.938  48.298 30.203  1.00 173.43 ? 580 GLU A CD  1 
ATOM   3864 O  OE1 . GLU A 1 588 ? 23.785  48.409 31.115  1.00 172.13 ? 580 GLU A OE1 1 
ATOM   3865 O  OE2 . GLU A 1 588 ? 22.705  49.207 29.378  1.00 171.67 ? 580 GLU A OE2 1 
ATOM   3866 N  N   . ALA A 1 589 ? 23.936  43.021 30.760  1.00 144.84 ? 581 ALA A N   1 
ATOM   3867 C  CA  . ALA A 1 589 ? 24.876  42.036 31.286  1.00 147.72 ? 581 ALA A CA  1 
ATOM   3868 C  C   . ALA A 1 589 ? 25.733  42.640 32.397  1.00 153.53 ? 581 ALA A C   1 
ATOM   3869 O  O   . ALA A 1 589 ? 26.266  43.740 32.250  1.00 154.00 ? 581 ALA A O   1 
ATOM   3870 C  CB  . ALA A 1 589 ? 25.756  41.496 30.171  1.00 148.51 ? 581 ALA A CB  1 
ATOM   3871 N  N   . PHE A 1 590 ? 25.864  41.920 33.507  1.00 149.38 ? 582 PHE A N   1 
ATOM   3872 C  CA  . PHE A 1 590 ? 26.649  42.406 34.636  1.00 153.15 ? 582 PHE A CA  1 
ATOM   3873 C  C   . PHE A 1 590 ? 28.140  42.354 34.313  1.00 158.38 ? 582 PHE A C   1 
ATOM   3874 O  O   . PHE A 1 590 ? 28.892  43.255 34.673  1.00 160.37 ? 582 PHE A O   1 
ATOM   3875 C  CB  . PHE A 1 590 ? 26.349  41.596 35.897  1.00 155.80 ? 582 PHE A CB  1 
ATOM   3876 C  CG  . PHE A 1 590 ? 26.809  42.256 37.167  1.00 159.85 ? 582 PHE A CG  1 
ATOM   3877 C  CD1 . PHE A 1 590 ? 26.943  43.633 37.238  1.00 161.89 ? 582 PHE A CD1 1 
ATOM   3878 C  CD2 . PHE A 1 590 ? 27.117  41.500 38.286  1.00 163.61 ? 582 PHE A CD2 1 
ATOM   3879 C  CE1 . PHE A 1 590 ? 27.367  44.245 38.404  1.00 165.58 ? 582 PHE A CE1 1 
ATOM   3880 C  CE2 . PHE A 1 590 ? 27.544  42.106 39.456  1.00 168.27 ? 582 PHE A CE2 1 
ATOM   3881 C  CZ  . PHE A 1 590 ? 27.669  43.480 39.514  1.00 167.72 ? 582 PHE A CZ  1 
ATOM   3882 N  N   . PHE A 1 591 ? 28.561  41.283 33.647  1.00 148.11 ? 583 PHE A N   1 
ATOM   3883 C  CA  . PHE A 1 591 ? 29.900  41.210 33.073  1.00 150.36 ? 583 PHE A CA  1 
ATOM   3884 C  C   . PHE A 1 591 ? 29.742  40.854 31.594  1.00 149.77 ? 583 PHE A C   1 
ATOM   3885 O  O   . PHE A 1 591 ? 28.699  40.321 31.214  1.00 146.32 ? 583 PHE A O   1 
ATOM   3886 C  CB  . PHE A 1 591 ? 30.783  40.199 33.831  1.00 155.02 ? 583 PHE A CB  1 
ATOM   3887 C  CG  . PHE A 1 591 ? 30.321  38.767 33.738  1.00 154.94 ? 583 PHE A CG  1 
ATOM   3888 C  CD1 . PHE A 1 591 ? 30.608  37.992 32.622  1.00 156.53 ? 583 PHE A CD1 1 
ATOM   3889 C  CD2 . PHE A 1 591 ? 29.640  38.182 34.790  1.00 156.06 ? 583 PHE A CD2 1 
ATOM   3890 C  CE1 . PHE A 1 591 ? 30.192  36.674 32.548  1.00 156.50 ? 583 PHE A CE1 1 
ATOM   3891 C  CE2 . PHE A 1 591 ? 29.226  36.866 34.723  1.00 157.09 ? 583 PHE A CE2 1 
ATOM   3892 C  CZ  . PHE A 1 591 ? 29.501  36.111 33.602  1.00 155.76 ? 583 PHE A CZ  1 
ATOM   3893 N  N   . PRO A 1 592 ? 30.757  41.163 30.757  1.00 147.30 ? 584 PRO A N   1 
ATOM   3894 C  CA  . PRO A 1 592 ? 30.682  40.947 29.303  1.00 145.61 ? 584 PRO A CA  1 
ATOM   3895 C  C   . PRO A 1 592 ? 30.044  39.619 28.896  1.00 146.74 ? 584 PRO A C   1 
ATOM   3896 O  O   . PRO A 1 592 ? 30.481  38.555 29.334  1.00 148.48 ? 584 PRO A O   1 
ATOM   3897 C  CB  . PRO A 1 592 ? 32.156  40.997 28.862  1.00 149.86 ? 584 PRO A CB  1 
ATOM   3898 C  CG  . PRO A 1 592 ? 32.971  41.079 30.137  1.00 155.10 ? 584 PRO A CG  1 
ATOM   3899 C  CD  . PRO A 1 592 ? 32.068  41.713 31.134  1.00 151.74 ? 584 PRO A CD  1 
ATOM   3900 N  N   . ASN A 1 593 ? 29.009  39.704 28.065  1.00 140.95 ? 585 ASN A N   1 
ATOM   3901 C  CA  . ASN A 1 593 ? 28.226  38.542 27.662  1.00 138.94 ? 585 ASN A CA  1 
ATOM   3902 C  C   . ASN A 1 593 ? 29.055  37.505 26.908  1.00 143.07 ? 585 ASN A C   1 
ATOM   3903 O  O   . ASN A 1 593 ? 29.587  37.783 25.833  1.00 143.17 ? 585 ASN A O   1 
ATOM   3904 C  CB  . ASN A 1 593 ? 27.042  38.991 26.805  1.00 134.12 ? 585 ASN A CB  1 
ATOM   3905 C  CG  . ASN A 1 593 ? 25.922  37.976 26.781  1.00 141.36 ? 585 ASN A CG  1 
ATOM   3906 O  OD1 . ASN A 1 593 ? 25.673  37.282 27.766  1.00 137.71 ? 585 ASN A OD1 1 
ATOM   3907 N  ND2 . ASN A 1 593 ? 25.237  37.886 25.650  1.00 134.01 ? 585 ASN A ND2 1 
ATOM   3908 N  N   . MET A 1 594 ? 29.156  36.307 27.478  1.00 134.86 ? 586 MET A N   1 
ATOM   3909 C  CA  . MET A 1 594 ? 29.992  35.253 26.912  1.00 137.27 ? 586 MET A CA  1 
ATOM   3910 C  C   . MET A 1 594 ? 29.254  34.377 25.908  1.00 136.91 ? 586 MET A C   1 
ATOM   3911 O  O   . MET A 1 594 ? 29.873  33.804 25.013  1.00 137.86 ? 586 MET A O   1 
ATOM   3912 C  CB  . MET A 1 594 ? 30.563  34.371 28.024  1.00 141.89 ? 586 MET A CB  1 
ATOM   3913 C  CG  . MET A 1 594 ? 31.669  35.016 28.836  1.00 146.78 ? 586 MET A CG  1 
ATOM   3914 S  SD  . MET A 1 594 ? 32.494  33.819 29.903  1.00 153.07 ? 586 MET A SD  1 
ATOM   3915 C  CE  . MET A 1 594 ? 31.152  33.359 30.996  1.00 148.65 ? 586 MET A CE  1 
ATOM   3916 N  N   . VAL A 1 595 ? 27.939  34.260 26.064  1.00 134.12 ? 587 VAL A N   1 
ATOM   3917 C  CA  . VAL A 1 595 ? 27.151  33.408 25.179  1.00 131.76 ? 587 VAL A CA  1 
ATOM   3918 C  C   . VAL A 1 595 ? 27.164  33.980 23.760  1.00 132.53 ? 587 VAL A C   1 
ATOM   3919 O  O   . VAL A 1 595 ? 27.140  33.235 22.781  1.00 132.69 ? 587 VAL A O   1 
ATOM   3920 C  CB  . VAL A 1 595 ? 25.697  33.238 25.692  1.00 130.05 ? 587 VAL A CB  1 
ATOM   3921 C  CG1 . VAL A 1 595 ? 24.978  34.578 25.768  1.00 126.81 ? 587 VAL A CG1 1 
ATOM   3922 C  CG2 . VAL A 1 595 ? 24.930  32.252 24.822  1.00 127.86 ? 587 VAL A CG2 1 
ATOM   3923 N  N   . ASN A 1 596 ? 27.228  35.305 23.659  1.00 134.60 ? 588 ASN A N   1 
ATOM   3924 C  CA  . ASN A 1 596 ? 27.443  35.971 22.382  1.00 133.49 ? 588 ASN A CA  1 
ATOM   3925 C  C   . ASN A 1 596 ? 28.931  35.981 22.061  1.00 140.31 ? 588 ASN A C   1 
ATOM   3926 O  O   . ASN A 1 596 ? 29.746  36.385 22.889  1.00 142.44 ? 588 ASN A O   1 
ATOM   3927 C  CB  . ASN A 1 596 ? 26.890  37.399 22.415  1.00 130.20 ? 588 ASN A CB  1 
ATOM   3928 C  CG  . ASN A 1 596 ? 26.871  38.055 21.043  1.00 140.19 ? 588 ASN A CG  1 
ATOM   3929 O  OD1 . ASN A 1 596 ? 27.478  37.562 20.091  1.00 139.07 ? 588 ASN A OD1 1 
ATOM   3930 N  ND2 . ASN A 1 596 ? 26.174  39.180 20.940  1.00 132.02 ? 588 ASN A ND2 1 
ATOM   3931 N  N   . MET A 1 597 ? 29.286  35.541 20.859  1.00 130.83 ? 589 MET A N   1 
ATOM   3932 C  CA  . MET A 1 597 ? 30.692  35.418 20.495  1.00 134.21 ? 589 MET A CA  1 
ATOM   3933 C  C   . MET A 1 597 ? 30.915  35.389 18.986  1.00 137.14 ? 589 MET A C   1 
ATOM   3934 O  O   . MET A 1 597 ? 30.017  35.702 18.203  1.00 134.69 ? 589 MET A O   1 
ATOM   3935 C  CB  . MET A 1 597 ? 31.283  34.155 21.123  1.00 138.34 ? 589 MET A CB  1 
ATOM   3936 C  CG  . MET A 1 597 ? 30.670  32.869 20.592  1.00 139.30 ? 589 MET A CG  1 
ATOM   3937 S  SD  . MET A 1 597 ? 31.312  31.384 21.388  1.00 144.68 ? 589 MET A SD  1 
ATOM   3938 C  CE  . MET A 1 597 ? 30.428  31.421 22.947  1.00 141.16 ? 589 MET A CE  1 
ATOM   3939 N  N   . LEU A 1 598 ? 32.129  35.011 18.594  1.00 138.25 ? 590 LEU A N   1 
ATOM   3940 C  CA  . LEU A 1 598 ? 32.490  34.869 17.191  1.00 137.51 ? 590 LEU A CA  1 
ATOM   3941 C  C   . LEU A 1 598 ? 32.865  33.420 16.892  1.00 139.56 ? 590 LEU A C   1 
ATOM   3942 O  O   . LEU A 1 598 ? 33.938  32.958 17.278  1.00 142.35 ? 590 LEU A O   1 
ATOM   3943 C  CB  . LEU A 1 598 ? 33.650  35.800 16.840  1.00 139.61 ? 590 LEU A CB  1 
ATOM   3944 C  CG  . LEU A 1 598 ? 34.015  35.888 15.360  1.00 142.08 ? 590 LEU A CG  1 
ATOM   3945 C  CD1 . LEU A 1 598 ? 32.993  36.733 14.621  1.00 138.14 ? 590 LEU A CD1 1 
ATOM   3946 C  CD2 . LEU A 1 598 ? 35.418  36.445 15.179  1.00 147.43 ? 590 LEU A CD2 1 
ATOM   3947 N  N   . VAL A 1 599 ? 31.979  32.702 16.210  1.00 134.61 ? 591 VAL A N   1 
ATOM   3948 C  CA  . VAL A 1 599 ? 32.205  31.290 15.925  1.00 135.17 ? 591 VAL A CA  1 
ATOM   3949 C  C   . VAL A 1 599 ? 32.730  31.067 14.509  1.00 136.98 ? 591 VAL A C   1 
ATOM   3950 O  O   . VAL A 1 599 ? 32.014  31.275 13.529  1.00 133.97 ? 591 VAL A O   1 
ATOM   3951 C  CB  . VAL A 1 599 ? 30.919  30.467 16.114  1.00 134.37 ? 591 VAL A CB  1 
ATOM   3952 C  CG1 . VAL A 1 599 ? 31.181  29.002 15.802  1.00 135.05 ? 591 VAL A CG1 1 
ATOM   3953 C  CG2 . VAL A 1 599 ? 30.391  30.631 17.530  1.00 134.64 ? 591 VAL A CG2 1 
ATOM   3954 N  N   . LEU A 1 600 ? 33.985  30.640 14.414  1.00 134.58 ? 592 LEU A N   1 
ATOM   3955 C  CA  . LEU A 1 600 ? 34.602  30.344 13.127  1.00 134.65 ? 592 LEU A CA  1 
ATOM   3956 C  C   . LEU A 1 600 ? 34.964  28.866 13.029  1.00 138.72 ? 592 LEU A C   1 
ATOM   3957 O  O   . LEU A 1 600 ? 36.140  28.508 12.966  1.00 142.60 ? 592 LEU A O   1 
ATOM   3958 C  CB  . LEU A 1 600 ? 35.848  31.207 12.916  1.00 137.35 ? 592 LEU A CB  1 
ATOM   3959 C  CG  . LEU A 1 600 ? 35.657  32.715 13.082  1.00 138.09 ? 592 LEU A CG  1 
ATOM   3960 C  CD1 . LEU A 1 600 ? 36.959  33.453 12.816  1.00 140.85 ? 592 LEU A CD1 1 
ATOM   3961 C  CD2 . LEU A 1 600 ? 34.551  33.221 12.171  1.00 134.93 ? 592 LEU A CD2 1 
ATOM   3962 N  N   . GLY A 1 601 ? 33.946  28.012 13.021  1.00 140.60 ? 593 GLY A N   1 
ATOM   3963 C  CA  . GLY A 1 601 ? 34.158  26.578 12.959  1.00 141.95 ? 593 GLY A CA  1 
ATOM   3964 C  C   . GLY A 1 601 ? 34.491  25.990 14.317  1.00 146.50 ? 593 GLY A C   1 
ATOM   3965 O  O   . GLY A 1 601 ? 33.770  26.206 15.291  1.00 144.72 ? 593 GLY A O   1 
ATOM   3966 N  N   . LYS A 1 602 ? 35.591  25.247 14.383  1.00 149.82 ? 594 LYS A N   1 
ATOM   3967 C  CA  . LYS A 1 602 ? 36.027  24.630 15.631  1.00 152.78 ? 594 LYS A CA  1 
ATOM   3968 C  C   . LYS A 1 602 ? 36.653  25.651 16.576  1.00 156.50 ? 594 LYS A C   1 
ATOM   3969 O  O   . LYS A 1 602 ? 36.926  25.348 17.737  1.00 158.56 ? 594 LYS A O   1 
ATOM   3970 C  CB  . LYS A 1 602 ? 37.025  23.502 15.352  1.00 158.07 ? 594 LYS A CB  1 
ATOM   3971 C  CG  . LYS A 1 602 ? 36.470  22.103 15.574  1.00 166.14 ? 594 LYS A CG  1 
ATOM   3972 C  CD  . LYS A 1 602 ? 35.401  21.754 14.552  1.00 166.62 ? 594 LYS A CD  1 
ATOM   3973 C  CE  . LYS A 1 602 ? 34.734  20.427 14.879  1.00 170.82 ? 594 LYS A CE  1 
ATOM   3974 N  NZ  . LYS A 1 602 ? 33.975  20.486 16.160  1.00 170.99 ? 594 LYS A NZ  1 
ATOM   3975 N  N   . HIS A 1 603 ? 36.878  26.860 16.074  1.00 150.43 ? 595 HIS A N   1 
ATOM   3976 C  CA  . HIS A 1 603 ? 37.548  27.893 16.854  1.00 152.53 ? 595 HIS A CA  1 
ATOM   3977 C  C   . HIS A 1 603 ? 36.586  28.970 17.338  1.00 151.77 ? 595 HIS A C   1 
ATOM   3978 O  O   . HIS A 1 603 ? 35.918  29.629 16.542  1.00 148.22 ? 595 HIS A O   1 
ATOM   3979 C  CB  . HIS A 1 603 ? 38.673  28.522 16.032  1.00 154.96 ? 595 HIS A CB  1 
ATOM   3980 C  CG  . HIS A 1 603 ? 39.788  27.575 15.725  1.00 161.11 ? 595 HIS A CG  1 
ATOM   3981 N  ND1 . HIS A 1 603 ? 40.789  27.866 14.823  1.00 164.36 ? 595 HIS A ND1 1 
ATOM   3982 C  CD2 . HIS A 1 603 ? 40.061  26.339 16.204  1.00 164.83 ? 595 HIS A CD2 1 
ATOM   3983 C  CE1 . HIS A 1 603 ? 41.629  26.848 14.759  1.00 167.96 ? 595 HIS A CE1 1 
ATOM   3984 N  NE2 . HIS A 1 603 ? 41.210  25.909 15.588  1.00 168.46 ? 595 HIS A NE2 1 
ATOM   3985 N  N   . LEU A 1 604 ? 36.528  29.143 18.655  1.00 149.15 ? 596 LEU A N   1 
ATOM   3986 C  CA  . LEU A 1 604 ? 35.654  30.136 19.264  1.00 144.82 ? 596 LEU A CA  1 
ATOM   3987 C  C   . LEU A 1 604 ? 36.423  31.409 19.593  1.00 146.81 ? 596 LEU A C   1 
ATOM   3988 O  O   . LEU A 1 604 ? 37.653  31.408 19.641  1.00 151.56 ? 596 LEU A O   1 
ATOM   3989 C  CB  . LEU A 1 604 ? 35.004  29.572 20.527  1.00 143.96 ? 596 LEU A CB  1 
ATOM   3990 C  CG  . LEU A 1 604 ? 34.220  28.268 20.371  1.00 143.16 ? 596 LEU A CG  1 
ATOM   3991 C  CD1 . LEU A 1 604 ? 33.812  27.732 21.728  1.00 143.72 ? 596 LEU A CD1 1 
ATOM   3992 C  CD2 . LEU A 1 604 ? 32.998  28.467 19.490  1.00 140.13 ? 596 LEU A CD2 1 
ATOM   3993 N  N   . GLY A 1 605 ? 35.691  32.494 19.818  1.00 146.69 ? 597 GLY A N   1 
ATOM   3994 C  CA  . GLY A 1 605 ? 36.295  33.771 20.150  1.00 147.71 ? 597 GLY A CA  1 
ATOM   3995 C  C   . GLY A 1 605 ? 35.515  34.474 21.241  1.00 149.29 ? 597 GLY A C   1 
ATOM   3996 O  O   . GLY A 1 605 ? 35.188  35.653 21.121  1.00 147.81 ? 597 GLY A O   1 
ATOM   3997 N  N   . ILE A 1 606 ? 35.216  33.735 22.305  1.00 145.89 ? 598 ILE A N   1 
ATOM   3998 C  CA  . ILE A 1 606 ? 34.430  34.238 23.427  1.00 144.24 ? 598 ILE A CA  1 
ATOM   3999 C  C   . ILE A 1 606 ? 35.051  35.492 24.039  1.00 147.68 ? 598 ILE A C   1 
ATOM   4000 O  O   . ILE A 1 606 ? 36.269  35.587 24.151  1.00 150.45 ? 598 ILE A O   1 
ATOM   4001 C  CB  . ILE A 1 606 ? 34.287  33.160 24.529  1.00 147.45 ? 598 ILE A CB  1 
ATOM   4002 C  CG1 . ILE A 1 606 ? 34.073  31.776 23.910  1.00 147.97 ? 598 ILE A CG1 1 
ATOM   4003 C  CG2 . ILE A 1 606 ? 33.161  33.504 25.494  1.00 145.18 ? 598 ILE A CG2 1 
ATOM   4004 C  CD1 . ILE A 1 606 ? 35.316  30.910 23.904  1.00 156.20 ? 598 ILE A CD1 1 
ATOM   4005 N  N   . PRO A 1 607 ? 34.213  36.474 24.407  1.00 150.26 ? 599 PRO A N   1 
ATOM   4006 C  CA  . PRO A 1 607 ? 34.706  37.623 25.173  1.00 151.33 ? 599 PRO A CA  1 
ATOM   4007 C  C   . PRO A 1 607 ? 35.264  37.196 26.526  1.00 156.72 ? 599 PRO A C   1 
ATOM   4008 O  O   . PRO A 1 607 ? 34.655  36.365 27.199  1.00 156.21 ? 599 PRO A O   1 
ATOM   4009 C  CB  . PRO A 1 607 ? 33.459  38.493 25.351  1.00 148.47 ? 599 PRO A CB  1 
ATOM   4010 C  CG  . PRO A 1 607 ? 32.565  38.111 24.223  1.00 148.10 ? 599 PRO A CG  1 
ATOM   4011 C  CD  . PRO A 1 607 ? 32.815  36.653 23.978  1.00 147.16 ? 599 PRO A CD  1 
ATOM   4012 N  N   . LYS A 1 608 ? 36.406  37.753 26.915  1.00 156.58 ? 600 LYS A N   1 
ATOM   4013 C  CA  . LYS A 1 608 ? 37.010  37.417 28.198  1.00 159.35 ? 600 LYS A CA  1 
ATOM   4014 C  C   . LYS A 1 608 ? 36.172  37.994 29.335  1.00 159.68 ? 600 LYS A C   1 
ATOM   4015 O  O   . LYS A 1 608 ? 35.986  39.208 29.419  1.00 157.50 ? 600 LYS A O   1 
ATOM   4016 C  CB  . LYS A 1 608 ? 38.447  37.934 28.270  1.00 164.38 ? 600 LYS A CB  1 
ATOM   4017 C  CG  . LYS A 1 608 ? 39.316  37.200 29.276  1.00 172.99 ? 600 LYS A CG  1 
ATOM   4018 C  CD  . LYS A 1 608 ? 40.772  37.614 29.151  1.00 177.22 ? 600 LYS A CD  1 
ATOM   4019 C  CE  . LYS A 1 608 ? 41.664  36.753 30.029  1.00 180.30 ? 600 LYS A CE  1 
ATOM   4020 N  NZ  . LYS A 1 608 ? 41.636  35.325 29.608  1.00 182.53 ? 600 LYS A NZ  1 
ATOM   4021 N  N   . PRO A 1 609 ? 35.664  37.118 30.214  1.00 161.35 ? 601 PRO A N   1 
ATOM   4022 C  CA  . PRO A 1 609 ? 34.725  37.504 31.274  1.00 159.90 ? 601 PRO A CA  1 
ATOM   4023 C  C   . PRO A 1 609 ? 35.353  38.349 32.378  1.00 166.42 ? 601 PRO A C   1 
ATOM   4024 O  O   . PRO A 1 609 ? 34.629  39.086 33.049  1.00 164.56 ? 601 PRO A O   1 
ATOM   4025 C  CB  . PRO A 1 609 ? 34.266  36.157 31.836  1.00 161.21 ? 601 PRO A CB  1 
ATOM   4026 C  CG  . PRO A 1 609 ? 35.409  35.246 31.582  1.00 167.30 ? 601 PRO A CG  1 
ATOM   4027 C  CD  . PRO A 1 609 ? 35.980  35.680 30.260  1.00 164.46 ? 601 PRO A CD  1 
ATOM   4028 N  N   . PHE A 1 610 ? 36.668  38.235 32.557  1.00 172.14 ? 602 PHE A N   1 
ATOM   4029 C  CA  . PHE A 1 610 ? 37.381  38.917 33.638  1.00 175.25 ? 602 PHE A CA  1 
ATOM   4030 C  C   . PHE A 1 610 ? 36.810  38.540 35.001  1.00 179.23 ? 602 PHE A C   1 
ATOM   4031 O  O   . PHE A 1 610 ? 36.780  39.359 35.920  1.00 179.94 ? 602 PHE A O   1 
ATOM   4032 C  CB  . PHE A 1 610 ? 37.336  40.436 33.450  1.00 174.71 ? 602 PHE A CB  1 
ATOM   4033 C  CG  . PHE A 1 610 ? 38.085  40.918 32.244  1.00 176.09 ? 602 PHE A CG  1 
ATOM   4034 C  CD1 . PHE A 1 610 ? 39.245  40.283 31.834  1.00 181.18 ? 602 PHE A CD1 1 
ATOM   4035 C  CD2 . PHE A 1 610 ? 37.626  42.002 31.515  1.00 174.62 ? 602 PHE A CD2 1 
ATOM   4036 C  CE1 . PHE A 1 610 ? 39.937  40.724 30.724  1.00 182.38 ? 602 PHE A CE1 1 
ATOM   4037 C  CE2 . PHE A 1 610 ? 38.313  42.448 30.403  1.00 176.88 ? 602 PHE A CE2 1 
ATOM   4038 C  CZ  . PHE A 1 610 ? 39.470  41.807 30.007  1.00 179.14 ? 602 PHE A CZ  1 
ATOM   4039 N  N   . GLY A 1 611 ? 36.358  37.296 35.123  1.00 172.59 ? 603 GLY A N   1 
ATOM   4040 C  CA  . GLY A 1 611 ? 35.800  36.804 36.368  1.00 173.59 ? 603 GLY A CA  1 
ATOM   4041 C  C   . GLY A 1 611 ? 36.870  36.638 37.429  1.00 181.32 ? 603 GLY A C   1 
ATOM   4042 O  O   . GLY A 1 611 ? 38.061  36.690 37.118  1.00 184.01 ? 603 GLY A O   1 
ATOM   4043 N  N   . PRO A 1 612 ? 36.449  36.441 38.689  1.00 180.53 ? 604 PRO A N   1 
ATOM   4044 C  CA  . PRO A 1 612 ? 37.348  36.288 39.840  1.00 184.75 ? 604 PRO A CA  1 
ATOM   4045 C  C   . PRO A 1 612 ? 38.425  35.230 39.619  1.00 190.59 ? 604 PRO A C   1 
ATOM   4046 O  O   . PRO A 1 612 ? 38.125  34.129 39.156  1.00 189.87 ? 604 PRO A O   1 
ATOM   4047 C  CB  . PRO A 1 612 ? 36.400  35.871 40.967  1.00 185.21 ? 604 PRO A CB  1 
ATOM   4048 C  CG  . PRO A 1 612 ? 35.095  36.474 40.589  1.00 183.23 ? 604 PRO A CG  1 
ATOM   4049 C  CD  . PRO A 1 612 ? 35.031  36.382 39.090  1.00 178.32 ? 604 PRO A CD  1 
ATOM   4050 N  N   . VAL A 1 613 ? 39.666  35.572 39.948  1.00 183.21 ? 605 VAL A N   1 
ATOM   4051 C  CA  . VAL A 1 613 ? 40.797  34.676 39.739  1.00 186.47 ? 605 VAL A CA  1 
ATOM   4052 C  C   . VAL A 1 613 ? 40.928  33.663 40.868  1.00 191.15 ? 605 VAL A C   1 
ATOM   4053 O  O   . VAL A 1 613 ? 40.956  34.027 42.044  1.00 192.49 ? 605 VAL A O   1 
ATOM   4054 C  CB  . VAL A 1 613 ? 42.119  35.457 39.615  1.00 191.69 ? 605 VAL A CB  1 
ATOM   4055 C  CG1 . VAL A 1 613 ? 43.294  34.500 39.478  1.00 195.83 ? 605 VAL A CG1 1 
ATOM   4056 C  CG2 . VAL A 1 613 ? 42.062  36.414 38.435  1.00 188.90 ? 605 VAL A CG2 1 
ATOM   4057 N  N   . ILE A 1 614 ? 41.002  32.387 40.504  1.00 190.17 ? 606 ILE A N   1 
ATOM   4058 C  CA  . ILE A 1 614 ? 41.159  31.319 41.481  1.00 193.24 ? 606 ILE A CA  1 
ATOM   4059 C  C   . ILE A 1 614 ? 42.231  30.338 41.026  1.00 198.91 ? 606 ILE A C   1 
ATOM   4060 O  O   . ILE A 1 614 ? 42.075  29.662 40.007  1.00 197.80 ? 606 ILE A O   1 
ATOM   4061 C  CB  . ILE A 1 614 ? 39.837  30.569 41.717  1.00 192.20 ? 606 ILE A CB  1 
ATOM   4062 C  CG1 . ILE A 1 614 ? 38.799  31.513 42.329  1.00 188.90 ? 606 ILE A CG1 1 
ATOM   4063 C  CG2 . ILE A 1 614 ? 40.062  29.364 42.620  1.00 196.26 ? 606 ILE A CG2 1 
ATOM   4064 C  CD1 . ILE A 1 614 ? 37.394  30.973 42.319  1.00 188.04 ? 606 ILE A CD1 1 
ATOM   4065 N  N   . ASN A 1 615 ? 43.319  30.280 41.790  1.00 192.38 ? 607 ASN A N   1 
ATOM   4066 C  CA  . ASN A 1 615 ? 44.452  29.407 41.500  1.00 197.40 ? 607 ASN A CA  1 
ATOM   4067 C  C   . ASN A 1 615 ? 45.013  29.633 40.097  1.00 196.20 ? 607 ASN A C   1 
ATOM   4068 O  O   . ASN A 1 615 ? 45.157  28.693 39.315  1.00 196.57 ? 607 ASN A O   1 
ATOM   4069 C  CB  . ASN A 1 615 ? 44.055  27.939 41.678  1.00 198.51 ? 607 ASN A CB  1 
ATOM   4070 C  CG  . ASN A 1 615 ? 45.252  27.033 41.888  1.00 217.59 ? 607 ASN A CG  1 
ATOM   4071 O  OD1 . ASN A 1 615 ? 46.281  27.454 42.419  1.00 218.89 ? 607 ASN A OD1 1 
ATOM   4072 N  ND2 . ASN A 1 615 ? 45.124  25.779 41.470  1.00 211.76 ? 607 ASN A ND2 1 
ATOM   4073 N  N   . GLY A 1 616 ? 45.318  30.888 39.782  1.00 195.52 ? 608 GLY A N   1 
ATOM   4074 C  CA  . GLY A 1 616 ? 45.946  31.224 38.518  1.00 195.13 ? 608 GLY A CA  1 
ATOM   4075 C  C   . GLY A 1 616 ? 44.998  31.716 37.441  1.00 188.38 ? 608 GLY A C   1 
ATOM   4076 O  O   . GLY A 1 616 ? 45.096  32.861 36.996  1.00 186.68 ? 608 GLY A O   1 
ATOM   4077 N  N   . ARG A 1 617 ? 44.079  30.853 37.018  1.00 191.11 ? 609 ARG A N   1 
ATOM   4078 C  CA  . ARG A 1 617 ? 43.195  31.164 35.899  1.00 186.21 ? 609 ARG A CA  1 
ATOM   4079 C  C   . ARG A 1 617 ? 41.776  31.512 36.343  1.00 183.32 ? 609 ARG A C   1 
ATOM   4080 O  O   . ARG A 1 617 ? 41.337  31.124 37.426  1.00 183.33 ? 609 ARG A O   1 
ATOM   4081 C  CB  . ARG A 1 617 ? 43.152  29.990 34.919  1.00 186.58 ? 609 ARG A CB  1 
ATOM   4082 N  N   . CYS A 1 618 ? 41.067  32.247 35.491  1.00 184.79 ? 610 CYS A N   1 
ATOM   4083 C  CA  . CYS A 1 618 ? 39.690  32.645 35.764  1.00 180.50 ? 610 CYS A CA  1 
ATOM   4084 C  C   . CYS A 1 618 ? 38.761  31.436 35.819  1.00 182.34 ? 610 CYS A C   1 
ATOM   4085 O  O   . CYS A 1 618 ? 38.776  30.589 34.926  1.00 182.07 ? 610 CYS A O   1 
ATOM   4086 C  CB  . CYS A 1 618 ? 39.203  33.635 34.703  1.00 176.46 ? 610 CYS A CB  1 
ATOM   4087 S  SG  . CYS A 1 618 ? 37.436  34.003 34.777  1.00 173.03 ? 610 CYS A SG  1 
ATOM   4088 N  N   . CYS A 1 619 ? 37.951  31.367 36.870  1.00 183.39 ? 611 CYS A N   1 
ATOM   4089 C  CA  . CYS A 1 619 ? 37.068  30.225 37.089  1.00 182.66 ? 611 CYS A CA  1 
ATOM   4090 C  C   . CYS A 1 619 ? 35.916  30.183 36.087  1.00 178.98 ? 611 CYS A C   1 
ATOM   4091 O  O   . CYS A 1 619 ? 35.418  29.107 35.754  1.00 178.18 ? 611 CYS A O   1 
ATOM   4092 C  CB  . CYS A 1 619 ? 36.519  30.245 38.519  1.00 183.69 ? 611 CYS A CB  1 
ATOM   4093 S  SG  . CYS A 1 619 ? 35.628  31.752 38.966  1.00 182.45 ? 611 CYS A SG  1 
ATOM   4094 N  N   . LEU A 1 620 ? 35.495  31.352 35.613  1.00 169.75 ? 612 LEU A N   1 
ATOM   4095 C  CA  . LEU A 1 620 ? 34.446  31.426 34.601  1.00 164.79 ? 612 LEU A CA  1 
ATOM   4096 C  C   . LEU A 1 620 ? 34.913  30.796 33.294  1.00 166.84 ? 612 LEU A C   1 
ATOM   4097 O  O   . LEU A 1 620 ? 34.185  30.023 32.673  1.00 164.33 ? 612 LEU A O   1 
ATOM   4098 C  CB  . LEU A 1 620 ? 34.016  32.877 34.365  1.00 161.59 ? 612 LEU A CB  1 
ATOM   4099 C  CG  . LEU A 1 620 ? 33.177  33.535 35.463  1.00 162.62 ? 612 LEU A CG  1 
ATOM   4100 C  CD1 . LEU A 1 620 ? 32.809  34.960 35.079  1.00 159.64 ? 612 LEU A CD1 1 
ATOM   4101 C  CD2 . LEU A 1 620 ? 31.927  32.716 35.743  1.00 162.06 ? 612 LEU A CD2 1 
ATOM   4102 N  N   . GLU A 1 621 ? 36.134  31.128 32.886  1.00 163.35 ? 613 GLU A N   1 
ATOM   4103 C  CA  . GLU A 1 621 ? 36.723  30.563 31.678  1.00 163.92 ? 613 GLU A CA  1 
ATOM   4104 C  C   . GLU A 1 621 ? 36.937  29.065 31.839  1.00 168.38 ? 613 GLU A C   1 
ATOM   4105 O  O   . GLU A 1 621 ? 36.788  28.298 30.888  1.00 167.97 ? 613 GLU A O   1 
ATOM   4106 C  CB  . GLU A 1 621 ? 38.051  31.251 31.352  1.00 167.20 ? 613 GLU A CB  1 
ATOM   4107 C  CG  . GLU A 1 621 ? 37.974  32.766 31.330  1.00 170.38 ? 613 GLU A CG  1 
ATOM   4108 C  CD  . GLU A 1 621 ? 39.269  33.411 30.879  1.00 178.54 ? 613 GLU A CD  1 
ATOM   4109 O  OE1 . GLU A 1 621 ? 40.051  32.744 30.170  1.00 170.03 ? 613 GLU A OE1 1 
ATOM   4110 O  OE2 . GLU A 1 621 ? 39.504  34.583 31.238  1.00 174.08 ? 613 GLU A OE2 1 
ATOM   4111 N  N   . GLU A 1 622 ? 37.284  28.662 33.058  1.00 176.89 ? 614 GLU A N   1 
ATOM   4112 C  CA  . GLU A 1 622 ? 37.547  27.265 33.375  1.00 179.57 ? 614 GLU A CA  1 
ATOM   4113 C  C   . GLU A 1 622 ? 36.296  26.413 33.175  1.00 178.60 ? 614 GLU A C   1 
ATOM   4114 O  O   . GLU A 1 622 ? 36.374  25.291 32.678  1.00 179.46 ? 614 GLU A O   1 
ATOM   4115 C  CB  . GLU A 1 622 ? 38.055  27.137 34.812  1.00 162.41 ? 614 GLU A CB  1 
ATOM   4116 C  CG  . GLU A 1 622 ? 38.752  25.818 35.121  1.00 167.87 ? 614 GLU A CG  1 
ATOM   4117 C  CD  . GLU A 1 622 ? 39.994  25.602 34.276  1.00 171.39 ? 614 GLU A CD  1 
ATOM   4118 O  OE1 . GLU A 1 622 ? 41.089  26.041 34.694  1.00 175.67 ? 614 GLU A OE1 1 
ATOM   4119 O  OE2 . GLU A 1 622 ? 39.877  24.994 33.188  1.00 170.16 ? 614 GLU A OE2 1 
ATOM   4120 N  N   . LYS A 1 623 ? 35.143  26.956 33.555  1.00 166.10 ? 615 LYS A N   1 
ATOM   4121 C  CA  . LYS A 1 623 ? 33.878  26.246 33.396  1.00 163.00 ? 615 LYS A CA  1 
ATOM   4122 C  C   . LYS A 1 623 ? 33.393  26.311 31.952  1.00 162.28 ? 615 LYS A C   1 
ATOM   4123 O  O   . LYS A 1 623 ? 32.878  25.329 31.417  1.00 161.31 ? 615 LYS A O   1 
ATOM   4124 C  CB  . LYS A 1 623 ? 32.812  26.814 34.334  1.00 161.52 ? 615 LYS A CB  1 
ATOM   4125 C  CG  . LYS A 1 623 ? 31.504  26.039 34.314  1.00 163.64 ? 615 LYS A CG  1 
ATOM   4126 C  CD  . LYS A 1 623 ? 30.520  26.573 35.340  1.00 166.56 ? 615 LYS A CD  1 
ATOM   4127 C  CE  . LYS A 1 623 ? 29.240  25.751 35.356  1.00 167.97 ? 615 LYS A CE  1 
ATOM   4128 N  NZ  . LYS A 1 623 ? 28.270  26.243 36.375  1.00 169.64 ? 615 LYS A NZ  1 
ATOM   4129 N  N   . VAL A 1 624 ? 33.558  27.475 31.331  1.00 160.02 ? 616 VAL A N   1 
ATOM   4130 C  CA  . VAL A 1 624 ? 33.201  27.659 29.928  1.00 156.82 ? 616 VAL A CA  1 
ATOM   4131 C  C   . VAL A 1 624 ? 34.000  26.701 29.049  1.00 160.45 ? 616 VAL A C   1 
ATOM   4132 O  O   . VAL A 1 624 ? 33.450  26.069 28.147  1.00 157.95 ? 616 VAL A O   1 
ATOM   4133 C  CB  . VAL A 1 624 ? 33.433  29.116 29.475  1.00 157.70 ? 616 VAL A CB  1 
ATOM   4134 C  CG1 . VAL A 1 624 ? 33.505  29.211 27.958  1.00 156.29 ? 616 VAL A CG1 1 
ATOM   4135 C  CG2 . VAL A 1 624 ? 32.336  30.019 30.020  1.00 154.00 ? 616 VAL A CG2 1 
ATOM   4136 N  N   . CYS A 1 625 ? 35.295  26.583 29.329  1.00 158.32 ? 617 CYS A N   1 
ATOM   4137 C  CA  . CYS A 1 625 ? 36.148  25.644 28.608  1.00 160.95 ? 617 CYS A CA  1 
ATOM   4138 C  C   . CYS A 1 625 ? 35.767  24.200 28.922  1.00 162.51 ? 617 CYS A C   1 
ATOM   4139 O  O   . CYS A 1 625 ? 35.775  23.348 28.038  1.00 162.15 ? 617 CYS A O   1 
ATOM   4140 C  CB  . CYS A 1 625 ? 37.623  25.882 28.941  1.00 166.07 ? 617 CYS A CB  1 
ATOM   4141 S  SG  . CYS A 1 625 ? 38.319  27.396 28.235  1.00 167.63 ? 617 CYS A SG  1 
ATOM   4142 N  N   . SER A 1 626 ? 35.420  23.934 30.179  1.00 151.68 ? 618 SER A N   1 
ATOM   4143 C  CA  . SER A 1 626 ? 35.062  22.583 30.609  1.00 153.98 ? 618 SER A CA  1 
ATOM   4144 C  C   . SER A 1 626 ? 33.825  22.062 29.885  1.00 149.57 ? 618 SER A C   1 
ATOM   4145 O  O   . SER A 1 626 ? 33.605  20.853 29.806  1.00 151.48 ? 618 SER A O   1 
ATOM   4146 C  CB  . SER A 1 626 ? 34.821  22.546 32.119  1.00 155.89 ? 618 SER A CB  1 
ATOM   4147 O  OG  . SER A 1 626 ? 33.600  23.183 32.452  1.00 151.04 ? 618 SER A OG  1 
ATOM   4148 N  N   . LEU A 1 627 ? 33.020  22.983 29.366  1.00 152.33 ? 619 LEU A N   1 
ATOM   4149 C  CA  . LEU A 1 627 ? 31.791  22.631 28.670  1.00 147.85 ? 619 LEU A CA  1 
ATOM   4150 C  C   . LEU A 1 627 ? 31.988  22.606 27.156  1.00 146.15 ? 619 LEU A C   1 
ATOM   4151 O  O   . LEU A 1 627 ? 31.285  21.887 26.445  1.00 144.32 ? 619 LEU A O   1 
ATOM   4152 C  CB  . LEU A 1 627 ? 30.675  23.613 29.035  1.00 142.96 ? 619 LEU A CB  1 
ATOM   4153 C  CG  . LEU A 1 627 ? 30.223  23.647 30.497  1.00 144.18 ? 619 LEU A CG  1 
ATOM   4154 C  CD1 . LEU A 1 627 ? 29.354  24.866 30.757  1.00 139.94 ? 619 LEU A CD1 1 
ATOM   4155 C  CD2 . LEU A 1 627 ? 29.477  22.371 30.859  1.00 145.24 ? 619 LEU A CD2 1 
ATOM   4156 N  N   . LEU A 1 628 ? 32.948  23.387 26.668  1.00 151.05 ? 620 LEU A N   1 
ATOM   4157 C  CA  . LEU A 1 628 ? 33.136  23.552 25.230  1.00 149.66 ? 620 LEU A CA  1 
ATOM   4158 C  C   . LEU A 1 628 ? 34.298  22.728 24.672  1.00 155.69 ? 620 LEU A C   1 
ATOM   4159 O  O   . LEU A 1 628 ? 34.249  22.288 23.524  1.00 154.58 ? 620 LEU A O   1 
ATOM   4160 C  CB  . LEU A 1 628 ? 33.336  25.031 24.896  1.00 148.69 ? 620 LEU A CB  1 
ATOM   4161 C  CG  . LEU A 1 628 ? 32.102  25.906 25.128  1.00 147.42 ? 620 LEU A CG  1 
ATOM   4162 C  CD1 . LEU A 1 628 ? 32.440  27.379 24.993  1.00 147.13 ? 620 LEU A CD1 1 
ATOM   4163 C  CD2 . LEU A 1 628 ? 30.985  25.523 24.169  1.00 145.50 ? 620 LEU A CD2 1 
ATOM   4164 N  N   . GLU A 1 629 ? 35.339  22.522 25.474  1.00 160.07 ? 621 GLU A N   1 
ATOM   4165 C  CA  . GLU A 1 629 ? 36.471  21.691 25.053  1.00 163.50 ? 621 GLU A CA  1 
ATOM   4166 C  C   . GLU A 1 629 ? 36.084  20.240 24.705  1.00 165.47 ? 621 GLU A C   1 
ATOM   4167 O  O   . GLU A 1 629 ? 36.589  19.701 23.721  1.00 166.27 ? 621 GLU A O   1 
ATOM   4168 C  CB  . GLU A 1 629 ? 37.568  21.688 26.126  1.00 156.61 ? 621 GLU A CB  1 
ATOM   4169 C  CG  . GLU A 1 629 ? 38.358  22.982 26.220  1.00 156.95 ? 621 GLU A CG  1 
ATOM   4170 C  CD  . GLU A 1 629 ? 39.321  22.988 27.389  1.00 162.33 ? 621 GLU A CD  1 
ATOM   4171 O  OE1 . GLU A 1 629 ? 39.044  22.302 28.397  1.00 164.07 ? 621 GLU A OE1 1 
ATOM   4172 O  OE2 . GLU A 1 629 ? 40.362  23.674 27.296  1.00 165.09 ? 621 GLU A OE2 1 
ATOM   4173 N  N   . PRO A 1 630 ? 35.196  19.599 25.499  1.00 156.35 ? 622 PRO A N   1 
ATOM   4174 C  CA  . PRO A 1 630 ? 34.793  18.238 25.112  1.00 157.06 ? 622 PRO A CA  1 
ATOM   4175 C  C   . PRO A 1 630 ? 34.083  18.152 23.758  1.00 154.93 ? 622 PRO A C   1 
ATOM   4176 O  O   . PRO A 1 630 ? 33.953  17.057 23.210  1.00 155.06 ? 622 PRO A O   1 
ATOM   4177 C  CB  . PRO A 1 630 ? 33.843  17.824 26.240  1.00 156.07 ? 622 PRO A CB  1 
ATOM   4178 C  CG  . PRO A 1 630 ? 34.290  18.615 27.409  1.00 160.42 ? 622 PRO A CG  1 
ATOM   4179 C  CD  . PRO A 1 630 ? 34.699  19.941 26.846  1.00 156.95 ? 622 PRO A CD  1 
ATOM   4180 N  N   . LEU A 1 631 ? 33.625  19.284 23.234  1.00 154.26 ? 623 LEU A N   1 
ATOM   4181 C  CA  . LEU A 1 631 ? 33.028  19.321 21.904  1.00 150.54 ? 623 LEU A CA  1 
ATOM   4182 C  C   . LEU A 1 631 ? 34.114  19.370 20.836  1.00 154.12 ? 623 LEU A C   1 
ATOM   4183 O  O   . LEU A 1 631 ? 33.868  19.066 19.669  1.00 152.49 ? 623 LEU A O   1 
ATOM   4184 C  CB  . LEU A 1 631 ? 32.096  20.524 21.760  1.00 144.82 ? 623 LEU A CB  1 
ATOM   4185 C  CG  . LEU A 1 631 ? 30.805  20.504 22.579  1.00 144.81 ? 623 LEU A CG  1 
ATOM   4186 C  CD1 . LEU A 1 631 ? 30.047  21.811 22.408  1.00 141.54 ? 623 LEU A CD1 1 
ATOM   4187 C  CD2 . LEU A 1 631 ? 29.937  19.323 22.176  1.00 144.63 ? 623 LEU A CD2 1 
ATOM   4188 N  N   . GLY A 1 632 ? 35.318  19.753 21.250  1.00 155.56 ? 624 GLY A N   1 
ATOM   4189 C  CA  . GLY A 1 632 ? 36.431  19.910 20.333  1.00 157.94 ? 624 GLY A CA  1 
ATOM   4190 C  C   . GLY A 1 632 ? 36.579  21.353 19.894  1.00 158.08 ? 624 GLY A C   1 
ATOM   4191 O  O   . GLY A 1 632 ? 37.058  21.633 18.795  1.00 157.70 ? 624 GLY A O   1 
ATOM   4192 N  N   . LEU A 1 633 ? 36.169  22.272 20.762  1.00 154.29 ? 625 LEU A N   1 
ATOM   4193 C  CA  . LEU A 1 633 ? 36.188  23.693 20.439  1.00 152.46 ? 625 LEU A CA  1 
ATOM   4194 C  C   . LEU A 1 633 ? 37.319  24.424 21.156  1.00 157.90 ? 625 LEU A C   1 
ATOM   4195 O  O   . LEU A 1 633 ? 37.348  24.491 22.385  1.00 158.45 ? 625 LEU A O   1 
ATOM   4196 C  CB  . LEU A 1 633 ? 34.844  24.333 20.793  1.00 148.21 ? 625 LEU A CB  1 
ATOM   4197 C  CG  . LEU A 1 633 ? 33.601  23.640 20.231  1.00 146.54 ? 625 LEU A CG  1 
ATOM   4198 C  CD1 . LEU A 1 633 ? 32.338  24.337 20.708  1.00 142.58 ? 625 LEU A CD1 1 
ATOM   4199 C  CD2 . LEU A 1 633 ? 33.652  23.592 18.712  1.00 146.30 ? 625 LEU A CD2 1 
ATOM   4200 N  N   . GLN A 1 634 ? 38.249  24.970 20.378  1.00 156.75 ? 626 GLN A N   1 
ATOM   4201 C  CA  . GLN A 1 634 ? 39.369  25.723 20.930  1.00 159.93 ? 626 GLN A CA  1 
ATOM   4202 C  C   . GLN A 1 634 ? 38.932  27.124 21.344  1.00 159.16 ? 626 GLN A C   1 
ATOM   4203 O  O   . GLN A 1 634 ? 38.605  27.958 20.500  1.00 155.20 ? 626 GLN A O   1 
ATOM   4204 C  CB  . GLN A 1 634 ? 40.513  25.803 19.918  1.00 163.07 ? 626 GLN A CB  1 
ATOM   4205 N  N   . CYS A 1 635 ? 38.930  27.373 22.650  1.00 160.05 ? 627 CYS A N   1 
ATOM   4206 C  CA  . CYS A 1 635 ? 38.487  28.653 23.191  1.00 158.06 ? 627 CYS A CA  1 
ATOM   4207 C  C   . CYS A 1 635 ? 39.598  29.695 23.161  1.00 161.66 ? 627 CYS A C   1 
ATOM   4208 O  O   . CYS A 1 635 ? 40.745  29.406 23.502  1.00 165.77 ? 627 CYS A O   1 
ATOM   4209 C  CB  . CYS A 1 635 ? 37.980  28.478 24.623  1.00 158.63 ? 627 CYS A CB  1 
ATOM   4210 S  SG  . CYS A 1 635 ? 36.667  27.252 24.802  1.00 158.52 ? 627 CYS A SG  1 
ATOM   4211 N  N   . THR A 1 636 ? 39.249  30.911 22.754  1.00 160.82 ? 628 THR A N   1 
ATOM   4212 C  CA  . THR A 1 636 ? 40.207  32.008 22.701  1.00 161.92 ? 628 THR A CA  1 
ATOM   4213 C  C   . THR A 1 636 ? 39.547  33.299 23.175  1.00 160.65 ? 628 THR A C   1 
ATOM   4214 O  O   . THR A 1 636 ? 38.861  33.975 22.409  1.00 157.22 ? 628 THR A O   1 
ATOM   4215 C  CB  . THR A 1 636 ? 40.769  32.198 21.279  1.00 166.96 ? 628 THR A CB  1 
ATOM   4216 O  OG1 . THR A 1 636 ? 41.249  30.943 20.780  1.00 169.29 ? 628 THR A OG1 1 
ATOM   4217 C  CG2 . THR A 1 636 ? 41.909  33.205 21.283  1.00 168.75 ? 628 THR A CG2 1 
ATOM   4218 N  N   . PHE A 1 637 ? 39.758  33.631 24.445  1.00 160.91 ? 629 PHE A N   1 
ATOM   4219 C  CA  . PHE A 1 637 ? 39.107  34.782 25.060  1.00 158.06 ? 629 PHE A CA  1 
ATOM   4220 C  C   . PHE A 1 637 ? 39.759  36.098 24.643  1.00 161.14 ? 629 PHE A C   1 
ATOM   4221 O  O   . PHE A 1 637 ? 40.984  36.220 24.623  1.00 164.53 ? 629 PHE A O   1 
ATOM   4222 C  CB  . PHE A 1 637 ? 39.116  34.643 26.584  1.00 160.51 ? 629 PHE A CB  1 
ATOM   4223 C  CG  . PHE A 1 637 ? 38.432  33.399 27.081  1.00 161.09 ? 629 PHE A CG  1 
ATOM   4224 C  CD1 . PHE A 1 637 ? 39.135  32.212 27.214  1.00 165.52 ? 629 PHE A CD1 1 
ATOM   4225 C  CD2 . PHE A 1 637 ? 37.085  33.413 27.409  1.00 159.35 ? 629 PHE A CD2 1 
ATOM   4226 C  CE1 . PHE A 1 637 ? 38.511  31.065 27.667  1.00 166.94 ? 629 PHE A CE1 1 
ATOM   4227 C  CE2 . PHE A 1 637 ? 36.455  32.268 27.863  1.00 159.64 ? 629 PHE A CE2 1 
ATOM   4228 C  CZ  . PHE A 1 637 ? 37.169  31.093 27.990  1.00 162.35 ? 629 PHE A CZ  1 
ATOM   4229 N  N   . ILE A 1 638 ? 38.925  37.081 24.313  1.00 160.78 ? 630 ILE A N   1 
ATOM   4230 C  CA  . ILE A 1 638 ? 39.397  38.359 23.793  1.00 160.97 ? 630 ILE A CA  1 
ATOM   4231 C  C   . ILE A 1 638 ? 39.342  39.464 24.846  1.00 165.00 ? 630 ILE A C   1 
ATOM   4232 O  O   . ILE A 1 638 ? 38.335  39.632 25.533  1.00 162.46 ? 630 ILE A O   1 
ATOM   4233 C  CB  . ILE A 1 638 ? 38.577  38.792 22.560  1.00 158.76 ? 630 ILE A CB  1 
ATOM   4234 C  CG1 . ILE A 1 638 ? 38.716  37.755 21.444  1.00 158.91 ? 630 ILE A CG1 1 
ATOM   4235 C  CG2 . ILE A 1 638 ? 39.017  40.163 22.071  1.00 158.92 ? 630 ILE A CG2 1 
ATOM   4236 C  CD1 . ILE A 1 638 ? 38.028  38.150 20.158  1.00 160.36 ? 630 ILE A CD1 1 
ATOM   4237 N  N   . ASN A 1 639 ? 40.435  40.214 24.956  1.00 171.41 ? 631 ASN A N   1 
ATOM   4238 C  CA  . ASN A 1 639 ? 40.567  41.281 25.945  1.00 174.34 ? 631 ASN A CA  1 
ATOM   4239 C  C   . ASN A 1 639 ? 39.501  42.371 25.821  1.00 178.46 ? 631 ASN A C   1 
ATOM   4240 O  O   . ASN A 1 639 ? 38.942  42.812 26.825  1.00 176.83 ? 631 ASN A O   1 
ATOM   4241 C  CB  . ASN A 1 639 ? 41.963  41.903 25.844  1.00 181.17 ? 631 ASN A CB  1 
ATOM   4242 C  CG  . ASN A 1 639 ? 42.173  43.036 26.830  1.00 204.52 ? 631 ASN A CG  1 
ATOM   4243 O  OD1 . ASN A 1 639 ? 42.494  44.159 26.443  1.00 198.99 ? 631 ASN A OD1 1 
ATOM   4244 N  ND2 . ASN A 1 639 ? 41.991  42.745 28.113  1.00 197.81 ? 631 ASN A ND2 1 
ATOM   4245 N  N   . ASP A 1 640 ? 39.222  42.802 24.595  1.00 176.17 ? 632 ASP A N   1 
ATOM   4246 C  CA  . ASP A 1 640 ? 38.211  43.831 24.358  1.00 174.94 ? 632 ASP A CA  1 
ATOM   4247 C  C   . ASP A 1 640 ? 37.319  43.496 23.166  1.00 176.22 ? 632 ASP A C   1 
ATOM   4248 O  O   . ASP A 1 640 ? 37.552  43.973 22.056  1.00 176.42 ? 632 ASP A O   1 
ATOM   4249 C  CB  . ASP A 1 640 ? 38.871  45.196 24.135  1.00 180.86 ? 632 ASP A CB  1 
ATOM   4250 C  CG  . ASP A 1 640 ? 39.167  45.923 25.433  1.00 189.13 ? 632 ASP A CG  1 
ATOM   4251 O  OD1 . ASP A 1 640 ? 40.256  45.707 26.002  1.00 188.11 ? 632 ASP A OD1 1 
ATOM   4252 O  OD2 . ASP A 1 640 ? 38.313  46.717 25.879  1.00 196.87 ? 632 ASP A OD2 1 
ATOM   4253 N  N   . PHE A 1 641 ? 36.296  42.681 23.402  1.00 170.57 ? 633 PHE A N   1 
ATOM   4254 C  CA  . PHE A 1 641 ? 35.347  42.320 22.353  1.00 167.96 ? 633 PHE A CA  1 
ATOM   4255 C  C   . PHE A 1 641 ? 34.349  43.459 22.142  1.00 172.10 ? 633 PHE A C   1 
ATOM   4256 O  O   . PHE A 1 641 ? 34.125  43.895 21.012  1.00 170.36 ? 633 PHE A O   1 
ATOM   4257 C  CB  . PHE A 1 641 ? 34.621  41.015 22.708  1.00 166.64 ? 633 PHE A CB  1 
ATOM   4258 C  CG  . PHE A 1 641 ? 34.072  40.265 21.515  1.00 165.79 ? 633 PHE A CG  1 
ATOM   4259 C  CD1 . PHE A 1 641 ? 33.302  40.906 20.557  1.00 166.41 ? 633 PHE A CD1 1 
ATOM   4260 C  CD2 . PHE A 1 641 ? 34.328  38.912 21.356  1.00 168.58 ? 633 PHE A CD2 1 
ATOM   4261 C  CE1 . PHE A 1 641 ? 32.801  40.216 19.470  1.00 165.09 ? 633 PHE A CE1 1 
ATOM   4262 C  CE2 . PHE A 1 641 ? 33.827  38.218 20.270  1.00 169.32 ? 633 PHE A CE2 1 
ATOM   4263 C  CZ  . PHE A 1 641 ? 33.064  38.871 19.327  1.00 164.60 ? 633 PHE A CZ  1 
ATOM   4264 N  N   . PHE A 1 642 ? 33.758  43.944 23.230  1.00 177.09 ? 634 PHE A N   1 
ATOM   4265 C  CA  . PHE A 1 642 ? 32.766  45.012 23.144  1.00 178.57 ? 634 PHE A CA  1 
ATOM   4266 C  C   . PHE A 1 642 ? 33.338  46.362 23.566  1.00 181.31 ? 634 PHE A C   1 
ATOM   4267 O  O   . PHE A 1 642 ? 34.193  46.443 24.450  1.00 177.55 ? 634 PHE A O   1 
ATOM   4268 C  CB  . PHE A 1 642 ? 31.542  44.674 23.997  1.00 156.45 ? 634 PHE A CB  1 
ATOM   4269 C  CG  . PHE A 1 642 ? 30.884  43.380 23.620  1.00 155.58 ? 634 PHE A CG  1 
ATOM   4270 C  CD1 . PHE A 1 642 ? 30.158  43.280 22.448  1.00 159.91 ? 634 PHE A CD1 1 
ATOM   4271 C  CD2 . PHE A 1 642 ? 30.989  42.266 24.438  1.00 150.50 ? 634 PHE A CD2 1 
ATOM   4272 C  CE1 . PHE A 1 642 ? 29.554  42.096 22.094  1.00 159.23 ? 634 PHE A CE1 1 
ATOM   4273 C  CE2 . PHE A 1 642 ? 30.385  41.077 24.089  1.00 149.76 ? 634 PHE A CE2 1 
ATOM   4274 C  CZ  . PHE A 1 642 ? 29.666  40.993 22.914  1.00 154.14 ? 634 PHE A CZ  1 
ATOM   4275 N  N   . THR A 1 643 ? 32.858  47.420 22.923  1.00 180.51 ? 635 THR A N   1 
ATOM   4276 C  CA  . THR A 1 643 ? 33.311  48.771 23.227  1.00 180.17 ? 635 THR A CA  1 
ATOM   4277 C  C   . THR A 1 643 ? 32.142  49.676 23.602  1.00 181.80 ? 635 THR A C   1 
ATOM   4278 O  O   . THR A 1 643 ? 31.005  49.443 23.193  1.00 182.59 ? 635 THR A O   1 
ATOM   4279 C  CB  . THR A 1 643 ? 34.069  49.392 22.039  1.00 190.46 ? 635 THR A CB  1 
ATOM   4280 O  OG1 . THR A 1 643 ? 33.182  49.535 20.923  1.00 195.04 ? 635 THR A OG1 1 
ATOM   4281 C  CG2 . THR A 1 643 ? 35.245  48.516 21.638  1.00 191.00 ? 635 THR A CG2 1 
ATOM   4282 N  N   . TYR A 1 644 ? 32.434  50.711 24.382  1.00 194.55 ? 636 TYR A N   1 
ATOM   4283 C  CA  . TYR A 1 644 ? 31.410  51.633 24.857  1.00 193.71 ? 636 TYR A CA  1 
ATOM   4284 C  C   . TYR A 1 644 ? 31.469  52.949 24.086  1.00 199.06 ? 636 TYR A C   1 
ATOM   4285 O  O   . TYR A 1 644 ? 32.546  53.423 23.725  1.00 201.88 ? 636 TYR A O   1 
ATOM   4286 C  CB  . TYR A 1 644 ? 31.576  51.882 26.360  1.00 178.23 ? 636 TYR A CB  1 
ATOM   4287 C  CG  . TYR A 1 644 ? 30.275  51.981 27.134  1.00 174.75 ? 636 TYR A CG  1 
ATOM   4288 C  CD1 . TYR A 1 644 ? 29.162  52.608 26.590  1.00 177.45 ? 636 TYR A CD1 1 
ATOM   4289 C  CD2 . TYR A 1 644 ? 30.164  51.443 28.409  1.00 168.83 ? 636 TYR A CD2 1 
ATOM   4290 C  CE1 . TYR A 1 644 ? 27.976  52.699 27.297  1.00 174.35 ? 636 TYR A CE1 1 
ATOM   4291 C  CE2 . TYR A 1 644 ? 28.985  51.527 29.122  1.00 165.72 ? 636 TYR A CE2 1 
ATOM   4292 C  CZ  . TYR A 1 644 ? 27.894  52.155 28.563  1.00 168.50 ? 636 TYR A CZ  1 
ATOM   4293 O  OH  . TYR A 1 644 ? 26.719  52.239 29.274  1.00 165.47 ? 636 TYR A OH  1 
ATOM   4294 N  N   . HIS A 1 645 ? 30.301  53.530 23.832  1.00 193.50 ? 637 HIS A N   1 
ATOM   4295 C  CA  . HIS A 1 645 ? 30.202  54.780 23.087  1.00 196.20 ? 637 HIS A CA  1 
ATOM   4296 C  C   . HIS A 1 645 ? 29.525  55.865 23.917  1.00 195.91 ? 637 HIS A C   1 
ATOM   4297 O  O   . HIS A 1 645 ? 28.608  55.578 24.687  1.00 189.56 ? 637 HIS A O   1 
ATOM   4298 C  CB  . HIS A 1 645 ? 29.437  54.561 21.779  1.00 200.21 ? 637 HIS A CB  1 
ATOM   4299 C  CG  . HIS A 1 645 ? 30.227  53.840 20.730  1.00 206.91 ? 637 HIS A CG  1 
ATOM   4300 N  ND1 . HIS A 1 645 ? 30.913  54.500 19.736  1.00 212.31 ? 637 HIS A ND1 1 
ATOM   4301 C  CD2 . HIS A 1 645 ? 30.441  52.519 20.525  1.00 208.68 ? 637 HIS A CD2 1 
ATOM   4302 C  CE1 . HIS A 1 645 ? 31.517  53.616 18.959  1.00 215.52 ? 637 HIS A CE1 1 
ATOM   4303 N  NE2 . HIS A 1 645 ? 31.247  52.408 19.416  1.00 213.58 ? 637 HIS A NE2 1 
ATOM   4304 N  N   . ILE A 1 646 ? 29.987  57.102 23.750  1.00 201.77 ? 638 ILE A N   1 
ATOM   4305 C  CA  . ILE A 1 646 ? 29.440  58.262 24.455  1.00 200.61 ? 638 ILE A CA  1 
ATOM   4306 C  C   . ILE A 1 646 ? 29.464  58.075 25.971  1.00 194.23 ? 638 ILE A C   1 
ATOM   4307 O  O   . ILE A 1 646 ? 28.498  57.616 26.576  1.00 190.60 ? 638 ILE A O   1 
ATOM   4308 C  CB  . ILE A 1 646 ? 27.995  58.573 24.003  1.00 192.29 ? 638 ILE A CB  1 
ATOM   4309 C  CG1 . ILE A 1 646 ? 27.901  58.580 22.474  1.00 198.49 ? 638 ILE A CG1 1 
ATOM   4310 C  CG2 . ILE A 1 646 ? 27.528  59.901 24.582  1.00 191.97 ? 638 ILE A CG2 1 
ATOM   4311 C  CD1 . ILE A 1 646 ? 26.515  58.863 21.948  1.00 200.55 ? 638 ILE A CD1 1 
ATOM   4312 N  N   . GLY A 1 649 ? 25.908  56.026 24.795  1.00 183.81 ? 641 GLY A N   1 
ATOM   4313 C  CA  . GLY A 1 649 ? 25.633  54.939 25.716  1.00 178.25 ? 641 GLY A CA  1 
ATOM   4314 C  C   . GLY A 1 649 ? 25.230  53.659 25.011  1.00 178.86 ? 641 GLY A C   1 
ATOM   4315 O  O   . GLY A 1 649 ? 24.231  53.034 25.364  1.00 176.16 ? 641 GLY A O   1 
ATOM   4316 N  N   . GLU A 1 650 ? 26.013  53.265 24.013  1.00 176.41 ? 642 GLU A N   1 
ATOM   4317 C  CA  . GLU A 1 650 ? 25.715  52.070 23.232  1.00 179.33 ? 642 GLU A CA  1 
ATOM   4318 C  C   . GLU A 1 650 ? 26.887  51.091 23.225  1.00 182.44 ? 642 GLU A C   1 
ATOM   4319 O  O   . GLU A 1 650 ? 28.020  51.466 22.925  1.00 184.37 ? 642 GLU A O   1 
ATOM   4320 C  CB  . GLU A 1 650 ? 25.343  52.452 21.798  1.00 168.67 ? 642 GLU A CB  1 
ATOM   4321 N  N   . VAL A 1 651 ? 26.603  49.836 23.560  1.00 165.50 ? 643 VAL A N   1 
ATOM   4322 C  CA  . VAL A 1 651 ? 27.613  48.782 23.558  1.00 165.29 ? 643 VAL A CA  1 
ATOM   4323 C  C   . VAL A 1 651 ? 27.543  47.974 22.266  1.00 172.80 ? 643 VAL A C   1 
ATOM   4324 O  O   . VAL A 1 651 ? 26.536  47.325 21.987  1.00 172.52 ? 643 VAL A O   1 
ATOM   4325 C  CB  . VAL A 1 651 ? 27.441  47.836 24.758  1.00 161.46 ? 643 VAL A CB  1 
ATOM   4326 C  CG1 . VAL A 1 651 ? 28.464  46.716 24.700  1.00 159.05 ? 643 VAL A CG1 1 
ATOM   4327 C  CG2 . VAL A 1 651 ? 27.554  48.610 26.064  1.00 159.01 ? 643 VAL A CG2 1 
ATOM   4328 N  N   . HIS A 1 652 ? 28.617  48.013 21.482  1.00 163.91 ? 644 HIS A N   1 
ATOM   4329 C  CA  . HIS A 1 652 ? 28.626  47.370 20.171  1.00 168.53 ? 644 HIS A CA  1 
ATOM   4330 C  C   . HIS A 1 652 ? 29.790  46.398 19.984  1.00 171.84 ? 644 HIS A C   1 
ATOM   4331 O  O   . HIS A 1 652 ? 30.715  46.349 20.794  1.00 168.32 ? 644 HIS A O   1 
ATOM   4332 C  CB  . HIS A 1 652 ? 28.671  48.431 19.066  1.00 174.68 ? 644 HIS A CB  1 
ATOM   4333 C  CG  . HIS A 1 652 ? 27.457  49.307 19.018  1.00 175.93 ? 644 HIS A CG  1 
ATOM   4334 N  ND1 . HIS A 1 652 ? 26.250  48.941 19.571  1.00 173.28 ? 644 HIS A ND1 1 
ATOM   4335 C  CD2 . HIS A 1 652 ? 27.267  50.535 18.478  1.00 180.17 ? 644 HIS A CD2 1 
ATOM   4336 C  CE1 . HIS A 1 652 ? 25.367  49.905 19.376  1.00 174.80 ? 644 HIS A CE1 1 
ATOM   4337 N  NE2 . HIS A 1 652 ? 25.960  50.883 18.715  1.00 179.34 ? 644 HIS A NE2 1 
ATOM   4338 N  N   . ALA A 1 653 ? 29.723  45.626 18.904  1.00 157.06 ? 645 ALA A N   1 
ATOM   4339 C  CA  . ALA A 1 653 ? 30.810  44.742 18.501  1.00 157.67 ? 645 ALA A CA  1 
ATOM   4340 C  C   . ALA A 1 653 ? 31.118  44.968 17.025  1.00 164.43 ? 645 ALA A C   1 
ATOM   4341 O  O   . ALA A 1 653 ? 30.209  45.166 16.219  1.00 167.88 ? 645 ALA A O   1 
ATOM   4342 C  CB  . ALA A 1 653 ? 30.450  43.290 18.761  1.00 154.04 ? 645 ALA A CB  1 
ATOM   4343 N  N   . GLY A 1 654 ? 32.399  44.937 16.671  1.00 161.45 ? 646 GLY A N   1 
ATOM   4344 C  CA  . GLY A 1 654 ? 32.817  45.297 15.328  1.00 163.50 ? 646 GLY A CA  1 
ATOM   4345 C  C   . GLY A 1 654 ? 32.985  44.147 14.353  1.00 166.00 ? 646 GLY A C   1 
ATOM   4346 O  O   . GLY A 1 654 ? 33.301  44.366 13.184  1.00 168.21 ? 646 GLY A O   1 
ATOM   4347 N  N   . THR A 1 655 ? 32.769  42.922 14.820  1.00 158.78 ? 647 THR A N   1 
ATOM   4348 C  CA  . THR A 1 655 ? 33.005  41.749 13.984  1.00 157.07 ? 647 THR A CA  1 
ATOM   4349 C  C   . THR A 1 655 ? 31.762  41.301 13.220  1.00 156.43 ? 647 THR A C   1 
ATOM   4350 O  O   . THR A 1 655 ? 30.640  41.398 13.716  1.00 154.08 ? 647 THR A O   1 
ATOM   4351 C  CB  . THR A 1 655 ? 33.519  40.563 14.818  1.00 165.90 ? 647 THR A CB  1 
ATOM   4352 O  OG1 . THR A 1 655 ? 33.817  41.003 16.148  1.00 163.91 ? 647 THR A OG1 1 
ATOM   4353 C  CG2 . THR A 1 655 ? 34.772  39.976 14.188  1.00 169.55 ? 647 THR A CG2 1 
ATOM   4354 N  N   . ASN A 1 656 ? 31.982  40.806 12.006  1.00 151.19 ? 648 ASN A N   1 
ATOM   4355 C  CA  . ASN A 1 656 ? 30.913  40.254 11.184  1.00 146.98 ? 648 ASN A CA  1 
ATOM   4356 C  C   . ASN A 1 656 ? 31.471  39.176 10.261  1.00 148.10 ? 648 ASN A C   1 
ATOM   4357 O  O   . ASN A 1 656 ? 32.610  39.274 9.803   1.00 151.42 ? 648 ASN A O   1 
ATOM   4358 C  CB  . ASN A 1 656 ? 30.229  41.354 10.374  1.00 149.13 ? 648 ASN A CB  1 
ATOM   4359 C  CG  . ASN A 1 656 ? 28.810  40.992 9.984   1.00 177.67 ? 648 ASN A CG  1 
ATOM   4360 O  OD1 . ASN A 1 656 ? 28.439  39.819 9.966   1.00 168.09 ? 648 ASN A OD1 1 
ATOM   4361 N  ND2 . ASN A 1 656 ? 28.007  42.002 9.672   1.00 172.50 ? 648 ASN A ND2 1 
ATOM   4362 N  N   . VAL A 1 657 ? 30.675  38.147 9.989   1.00 139.24 ? 649 VAL A N   1 
ATOM   4363 C  CA  . VAL A 1 657 ? 31.172  36.989 9.252   1.00 138.83 ? 649 VAL A CA  1 
ATOM   4364 C  C   . VAL A 1 657 ? 30.414  36.720 7.954   1.00 138.32 ? 649 VAL A C   1 
ATOM   4365 O  O   . VAL A 1 657 ? 29.221  37.003 7.843   1.00 134.87 ? 649 VAL A O   1 
ATOM   4366 C  CB  . VAL A 1 657 ? 31.107  35.711 10.113  1.00 142.15 ? 649 VAL A CB  1 
ATOM   4367 C  CG1 . VAL A 1 657 ? 32.196  34.735 9.695   1.00 144.53 ? 649 VAL A CG1 1 
ATOM   4368 C  CG2 . VAL A 1 657 ? 31.234  36.051 11.585  1.00 142.88 ? 649 VAL A CG2 1 
ATOM   4369 N  N   . ARG A 1 658 ? 31.128  36.172 6.976   1.00 134.86 ? 650 ARG A N   1 
ATOM   4370 C  CA  . ARG A 1 658 ? 30.517  35.646 5.761   1.00 132.45 ? 650 ARG A CA  1 
ATOM   4371 C  C   . ARG A 1 658 ? 30.774  34.145 5.688   1.00 134.47 ? 650 ARG A C   1 
ATOM   4372 O  O   . ARG A 1 658 ? 31.921  33.704 5.743   1.00 137.25 ? 650 ARG A O   1 
ATOM   4373 C  CB  . ARG A 1 658 ? 31.067  36.350 4.518   1.00 133.91 ? 650 ARG A CB  1 
ATOM   4374 C  CG  . ARG A 1 658 ? 30.556  35.773 3.207   1.00 136.83 ? 650 ARG A CG  1 
ATOM   4375 C  CD  . ARG A 1 658 ? 30.959  36.636 2.020   1.00 145.82 ? 650 ARG A CD  1 
ATOM   4376 N  NE  . ARG A 1 658 ? 32.406  36.685 1.834   1.00 158.07 ? 650 ARG A NE  1 
ATOM   4377 C  CZ  . ARG A 1 658 ? 33.086  35.863 1.041   1.00 173.75 ? 650 ARG A CZ  1 
ATOM   4378 N  NH1 . ARG A 1 658 ? 32.451  34.922 0.356   1.00 153.94 ? 650 ARG A NH1 1 
ATOM   4379 N  NH2 . ARG A 1 658 ? 34.402  35.982 0.931   1.00 168.34 ? 650 ARG A NH2 1 
ATOM   4380 N  N   . ARG A 1 659 ? 29.708  33.361 5.572   1.00 126.67 ? 651 ARG A N   1 
ATOM   4381 C  CA  . ARG A 1 659 ? 29.835  31.908 5.601   1.00 126.10 ? 651 ARG A CA  1 
ATOM   4382 C  C   . ARG A 1 659 ? 29.416  31.247 4.294   1.00 128.59 ? 651 ARG A C   1 
ATOM   4383 O  O   . ARG A 1 659 ? 28.692  31.833 3.490   1.00 126.85 ? 651 ARG A O   1 
ATOM   4384 C  CB  . ARG A 1 659 ? 29.016  31.327 6.756   1.00 123.87 ? 651 ARG A CB  1 
ATOM   4385 C  CG  . ARG A 1 659 ? 29.634  31.554 8.123   1.00 128.09 ? 651 ARG A CG  1 
ATOM   4386 C  CD  . ARG A 1 659 ? 28.703  31.104 9.233   1.00 129.02 ? 651 ARG A CD  1 
ATOM   4387 N  NE  . ARG A 1 659 ? 28.551  32.135 10.255  1.00 140.10 ? 651 ARG A NE  1 
ATOM   4388 C  CZ  . ARG A 1 659 ? 29.296  32.217 11.352  1.00 152.21 ? 651 ARG A CZ  1 
ATOM   4389 N  NH1 . ARG A 1 659 ? 30.249  31.323 11.579  1.00 132.70 ? 651 ARG A NH1 1 
ATOM   4390 N  NH2 . ARG A 1 659 ? 29.087  33.194 12.224  1.00 139.61 ? 651 ARG A NH2 1 
ATOM   4391 N  N   . LYS A 1 660 ? 29.881  30.017 4.097   1.00 125.67 ? 652 LYS A N   1 
ATOM   4392 C  CA  . LYS A 1 660 ? 29.556  29.247 2.903   1.00 125.12 ? 652 LYS A CA  1 
ATOM   4393 C  C   . LYS A 1 660 ? 28.089  28.829 2.905   1.00 123.28 ? 652 LYS A C   1 
ATOM   4394 O  O   . LYS A 1 660 ? 27.610  28.239 3.873   1.00 120.43 ? 652 LYS A O   1 
ATOM   4395 C  CB  . LYS A 1 660 ? 30.454  28.012 2.802   1.00 130.58 ? 652 LYS A CB  1 
ATOM   4396 C  CG  . LYS A 1 660 ? 30.309  27.243 1.498   1.00 145.94 ? 652 LYS A CG  1 
ATOM   4397 C  CD  . LYS A 1 660 ? 30.950  25.864 1.580   1.00 160.05 ? 652 LYS A CD  1 
ATOM   4398 C  CE  . LYS A 1 660 ? 29.934  24.790 1.955   1.00 167.83 ? 652 LYS A CE  1 
ATOM   4399 N  NZ  . LYS A 1 660 ? 29.292  25.030 3.278   1.00 170.63 ? 652 LYS A NZ  1 
ATOM   4400 N  N   . PRO A 1 661 ? 27.371  29.140 1.814   1.00 117.65 ? 653 PRO A N   1 
ATOM   4401 C  CA  . PRO A 1 661 ? 25.955  28.793 1.649   1.00 113.90 ? 653 PRO A CA  1 
ATOM   4402 C  C   . PRO A 1 661 ? 25.699  27.290 1.724   1.00 118.66 ? 653 PRO A C   1 
ATOM   4403 O  O   . PRO A 1 661 ? 26.625  26.494 1.573   1.00 120.81 ? 653 PRO A O   1 
ATOM   4404 C  CB  . PRO A 1 661 ? 25.626  29.327 0.251   1.00 115.37 ? 653 PRO A CB  1 
ATOM   4405 C  CG  . PRO A 1 661 ? 26.626  30.401 0.014   1.00 122.30 ? 653 PRO A CG  1 
ATOM   4406 C  CD  . PRO A 1 661 ? 27.878  29.931 0.681   1.00 120.89 ? 653 PRO A CD  1 
ATOM   4407 N  N   . PHE A 1 662 ? 24.443  26.918 1.951   1.00 113.79 ? 654 PHE A N   1 
ATOM   4408 C  CA  . PHE A 1 662 ? 24.053  25.517 2.069   1.00 114.41 ? 654 PHE A CA  1 
ATOM   4409 C  C   . PHE A 1 662 ? 24.261  24.729 0.780   1.00 121.41 ? 654 PHE A C   1 
ATOM   4410 O  O   . PHE A 1 662 ? 24.046  25.242 -0.318  1.00 121.11 ? 654 PHE A O   1 
ATOM   4411 C  CB  . PHE A 1 662 ? 22.587  25.410 2.492   1.00 112.92 ? 654 PHE A CB  1 
ATOM   4412 C  CG  . PHE A 1 662 ? 22.346  25.727 3.937   1.00 113.12 ? 654 PHE A CG  1 
ATOM   4413 C  CD1 . PHE A 1 662 ? 22.191  24.710 4.863   1.00 116.14 ? 654 PHE A CD1 1 
ATOM   4414 C  CD2 . PHE A 1 662 ? 22.271  27.039 4.370   1.00 114.08 ? 654 PHE A CD2 1 
ATOM   4415 C  CE1 . PHE A 1 662 ? 21.966  24.995 6.193   1.00 115.16 ? 654 PHE A CE1 1 
ATOM   4416 C  CE2 . PHE A 1 662 ? 22.046  27.330 5.701   1.00 114.97 ? 654 PHE A CE2 1 
ATOM   4417 C  CZ  . PHE A 1 662 ? 21.893  26.306 6.613   1.00 112.76 ? 654 PHE A CZ  1 
ATOM   4418 N  N   . SER A 1 663 ? 24.675  23.475 0.928   1.00 120.03 ? 655 SER A N   1 
ATOM   4419 C  CA  . SER A 1 663 ? 24.771  22.561 -0.201  1.00 121.81 ? 655 SER A CA  1 
ATOM   4420 C  C   . SER A 1 663 ? 23.373  22.177 -0.671  1.00 121.55 ? 655 SER A C   1 
ATOM   4421 O  O   . SER A 1 663 ? 23.160  21.866 -1.842  1.00 122.20 ? 655 SER A O   1 
ATOM   4422 C  CB  . SER A 1 663 ? 25.567  21.312 0.178   1.00 129.64 ? 655 SER A CB  1 
ATOM   4423 O  OG  . SER A 1 663 ? 26.867  21.652 0.625   1.00 142.31 ? 655 SER A OG  1 
ATOM   4424 N  N   . PHE A 1 664 ? 22.425  22.198 0.261   1.00 114.02 ? 656 PHE A N   1 
ATOM   4425 C  CA  . PHE A 1 664 ? 21.029  21.906 -0.041  1.00 111.01 ? 656 PHE A CA  1 
ATOM   4426 C  C   . PHE A 1 664 ? 20.422  23.036 -0.863  1.00 114.38 ? 656 PHE A C   1 
ATOM   4427 O  O   . PHE A 1 664 ? 20.413  24.189 -0.433  1.00 113.80 ? 656 PHE A O   1 
ATOM   4428 C  CB  . PHE A 1 664 ? 20.234  21.700 1.253   1.00 109.88 ? 656 PHE A CB  1 
ATOM   4429 C  CG  . PHE A 1 664 ? 18.845  21.159 1.041   1.00 108.89 ? 656 PHE A CG  1 
ATOM   4430 C  CD1 . PHE A 1 664 ? 17.787  22.009 0.764   1.00 109.55 ? 656 PHE A CD1 1 
ATOM   4431 C  CD2 . PHE A 1 664 ? 18.596  19.799 1.134   1.00 111.58 ? 656 PHE A CD2 1 
ATOM   4432 C  CE1 . PHE A 1 664 ? 16.510  21.512 0.572   1.00 108.93 ? 656 PHE A CE1 1 
ATOM   4433 C  CE2 . PHE A 1 664 ? 17.322  19.297 0.946   1.00 112.89 ? 656 PHE A CE2 1 
ATOM   4434 C  CZ  . PHE A 1 664 ? 16.278  20.155 0.665   1.00 108.30 ? 656 PHE A CZ  1 
ATOM   4435 N  N   . LYS A 1 665 ? 19.920  22.702 -2.048  1.00 109.74 ? 657 LYS A N   1 
ATOM   4436 C  CA  . LYS A 1 665 ? 19.280  23.689 -2.911  1.00 106.51 ? 657 LYS A CA  1 
ATOM   4437 C  C   . LYS A 1 665 ? 17.901  24.056 -2.368  1.00 103.99 ? 657 LYS A C   1 
ATOM   4438 O  O   . LYS A 1 665 ? 17.077  23.181 -2.105  1.00 101.32 ? 657 LYS A O   1 
ATOM   4439 C  CB  . LYS A 1 665 ? 19.172  23.159 -4.339  1.00 110.52 ? 657 LYS A CB  1 
ATOM   4440 C  CG  . LYS A 1 665 ? 20.501  22.714 -4.937  1.00 127.27 ? 657 LYS A CG  1 
ATOM   4441 C  CD  . LYS A 1 665 ? 21.507  23.854 -4.974  1.00 137.42 ? 657 LYS A CD  1 
ATOM   4442 C  CE  . LYS A 1 665 ? 22.824  23.414 -5.596  1.00 145.73 ? 657 LYS A CE  1 
ATOM   4443 N  NZ  . LYS A 1 665 ? 23.495  22.353 -4.795  1.00 150.57 ? 657 LYS A NZ  1 
ATOM   4444 N  N   . TRP A 1 666 ? 17.655  25.354 -2.212  1.00 98.37  ? 658 TRP A N   1 
ATOM   4445 C  CA  . TRP A 1 666 ? 16.454  25.846 -1.538  1.00 95.29  ? 658 TRP A CA  1 
ATOM   4446 C  C   . TRP A 1 666 ? 15.149  25.435 -2.218  1.00 97.89  ? 658 TRP A C   1 
ATOM   4447 O  O   . TRP A 1 666 ? 14.108  25.347 -1.568  1.00 95.07  ? 658 TRP A O   1 
ATOM   4448 C  CB  . TRP A 1 666 ? 16.504  27.374 -1.419  1.00 92.97  ? 658 TRP A CB  1 
ATOM   4449 C  CG  . TRP A 1 666 ? 16.482  28.097 -2.736  1.00 94.48  ? 658 TRP A CG  1 
ATOM   4450 C  CD1 . TRP A 1 666 ? 17.559  28.537 -3.447  1.00 99.55  ? 658 TRP A CD1 1 
ATOM   4451 C  CD2 . TRP A 1 666 ? 15.323  28.471 -3.493  1.00 92.73  ? 658 TRP A CD2 1 
ATOM   4452 N  NE1 . TRP A 1 666 ? 17.145  29.158 -4.600  1.00 99.10  ? 658 TRP A NE1 1 
ATOM   4453 C  CE2 . TRP A 1 666 ? 15.776  29.130 -4.652  1.00 97.83  ? 658 TRP A CE2 1 
ATOM   4454 C  CE3 . TRP A 1 666 ? 13.947  28.311 -3.303  1.00 91.54  ? 658 TRP A CE3 1 
ATOM   4455 C  CZ2 . TRP A 1 666 ? 14.903  29.628 -5.617  1.00 95.87  ? 658 TRP A CZ2 1 
ATOM   4456 C  CZ3 . TRP A 1 666 ? 13.083  28.804 -4.262  1.00 92.07  ? 658 TRP A CZ3 1 
ATOM   4457 C  CH2 . TRP A 1 666 ? 13.564  29.456 -5.404  1.00 94.01  ? 658 TRP A CH2 1 
ATOM   4458 N  N   . TRP A 1 667 ? 15.204  25.182 -3.521  1.00 96.78  ? 659 TRP A N   1 
ATOM   4459 C  CA  . TRP A 1 667 ? 13.997  24.876 -4.281  1.00 96.74  ? 659 TRP A CA  1 
ATOM   4460 C  C   . TRP A 1 667 ? 13.568  23.418 -4.140  1.00 104.10 ? 659 TRP A C   1 
ATOM   4461 O  O   . TRP A 1 667 ? 12.589  22.994 -4.753  1.00 103.85 ? 659 TRP A O   1 
ATOM   4462 C  CB  . TRP A 1 667 ? 14.203  25.217 -5.759  1.00 96.68  ? 659 TRP A CB  1 
ATOM   4463 C  CG  . TRP A 1 667 ? 15.410  24.572 -6.367  1.00 100.44 ? 659 TRP A CG  1 
ATOM   4464 C  CD1 . TRP A 1 667 ? 15.516  23.287 -6.811  1.00 105.51 ? 659 TRP A CD1 1 
ATOM   4465 C  CD2 . TRP A 1 667 ? 16.681  25.186 -6.608  1.00 101.83 ? 659 TRP A CD2 1 
ATOM   4466 N  NE1 . TRP A 1 667 ? 16.775  23.061 -7.310  1.00 108.08 ? 659 TRP A NE1 1 
ATOM   4467 C  CE2 . TRP A 1 667 ? 17.510  24.212 -7.197  1.00 109.04 ? 659 TRP A CE2 1 
ATOM   4468 C  CE3 . TRP A 1 667 ? 17.199  26.465 -6.381  1.00 102.44 ? 659 TRP A CE3 1 
ATOM   4469 C  CZ2 . TRP A 1 667 ? 18.829  24.475 -7.563  1.00 110.93 ? 659 TRP A CZ2 1 
ATOM   4470 C  CZ3 . TRP A 1 667 ? 18.509  26.724 -6.744  1.00 106.52 ? 659 TRP A CZ3 1 
ATOM   4471 C  CH2 . TRP A 1 667 ? 19.309  25.734 -7.326  1.00 110.26 ? 659 TRP A CH2 1 
ATOM   4472 N  N   . ASN A 1 668 ? 14.294  22.657 -3.327  1.00 103.49 ? 660 ASN A N   1 
ATOM   4473 C  CA  . ASN A 1 668 ? 14.016  21.233 -3.172  1.00 105.14 ? 660 ASN A CA  1 
ATOM   4474 C  C   . ASN A 1 668 ? 13.126  20.908 -1.976  1.00 109.52 ? 660 ASN A C   1 
ATOM   4475 O  O   . ASN A 1 668 ? 12.527  19.835 -1.919  1.00 110.38 ? 660 ASN A O   1 
ATOM   4476 C  CB  . ASN A 1 668 ? 15.325  20.451 -3.064  1.00 107.06 ? 660 ASN A CB  1 
ATOM   4477 C  CG  . ASN A 1 668 ? 16.008  20.274 -4.405  1.00 117.65 ? 660 ASN A CG  1 
ATOM   4478 O  OD1 . ASN A 1 668 ? 15.349  20.088 -5.428  1.00 105.06 ? 660 ASN A OD1 1 
ATOM   4479 N  ND2 . ASN A 1 668 ? 17.334  20.331 -4.407  1.00 111.69 ? 660 ASN A ND2 1 
ATOM   4480 N  N   . MET A 1 669 ? 13.044  21.826 -1.020  1.00 105.77 ? 661 MET A N   1 
ATOM   4481 C  CA  . MET A 1 669 ? 12.171  21.630 0.131   1.00 105.72 ? 661 MET A CA  1 
ATOM   4482 C  C   . MET A 1 669 ? 10.750  22.063 -0.207  1.00 112.07 ? 661 MET A C   1 
ATOM   4483 O  O   . MET A 1 669 ? 10.541  22.931 -1.054  1.00 111.89 ? 661 MET A O   1 
ATOM   4484 C  CB  . MET A 1 669 ? 12.686  22.401 1.349   1.00 106.99 ? 661 MET A CB  1 
ATOM   4485 C  CG  . MET A 1 669 ? 12.716  23.908 1.167   1.00 108.88 ? 661 MET A CG  1 
ATOM   4486 S  SD  . MET A 1 669 ? 13.210  24.783 2.664   1.00 113.41 ? 661 MET A SD  1 
ATOM   4487 C  CE  . MET A 1 669 ? 11.901  24.305 3.790   1.00 108.07 ? 661 MET A CE  1 
ATOM   4488 N  N   . VAL A 1 670 ? 9.776   21.445 0.453   1.00 110.38 ? 662 VAL A N   1 
ATOM   4489 C  CA  . VAL A 1 670 ? 8.374   21.787 0.251   1.00 109.13 ? 662 VAL A CA  1 
ATOM   4490 C  C   . VAL A 1 670 ? 7.809   22.463 1.497   1.00 114.98 ? 662 VAL A C   1 
ATOM   4491 O  O   . VAL A 1 670 ? 7.413   21.787 2.446   1.00 116.26 ? 662 VAL A O   1 
ATOM   4492 C  CB  . VAL A 1 670 ? 7.530   20.540 -0.085  1.00 113.01 ? 662 VAL A CB  1 
ATOM   4493 C  CG1 . VAL A 1 670 ? 6.091   20.933 -0.394  1.00 111.40 ? 662 VAL A CG1 1 
ATOM   4494 C  CG2 . VAL A 1 670 ? 8.143   19.788 -1.254  1.00 114.41 ? 662 VAL A CG2 1 
ATOM   4495 N  N   . PRO A 1 671 ? 7.781   23.806 1.499   1.00 109.88 ? 663 PRO A N   1 
ATOM   4496 C  CA  . PRO A 1 671 ? 7.300   24.599 2.636   1.00 109.89 ? 663 PRO A CA  1 
ATOM   4497 C  C   . PRO A 1 671 ? 5.862   24.263 3.021   1.00 137.52 ? 663 PRO A C   1 
ATOM   4498 O  O   . PRO A 1 671 ? 5.456   24.440 4.169   1.00 135.43 ? 663 PRO A O   1 
ATOM   4499 C  CB  . PRO A 1 671 ? 7.401   26.041 2.126   1.00 109.82 ? 663 PRO A CB  1 
ATOM   4500 C  CG  . PRO A 1 671 ? 8.433   25.992 1.056   1.00 113.89 ? 663 PRO A CG  1 
ATOM   4501 C  CD  . PRO A 1 671 ? 8.259   24.659 0.398   1.00 110.40 ? 663 PRO A CD  1 
ATOM   4502 O  OXT . PRO A 1 671 ? 5.075   23.805 2.193   1.00 168.03 ? 663 PRO A OXT 1 
HETATM 4503 CA CA  . CA  B 2 .   ? 22.497  38.572 13.926  1.00 142.99 ? 701 CA  A CA  1 
HETATM 4504 CA CA  . CA  C 2 .   ? 24.775  41.513 -11.856 1.00 146.09 ? 702 CA  A CA  1 
HETATM 4505 CA CA  . CA  D 2 .   ? 27.832  38.409 -10.902 1.00 145.60 ? 703 CA  A CA  1 
HETATM 4506 CA CA  . CA  E 2 .   ? 21.509  46.684 -16.054 1.00 136.96 ? 704 CA  A CA  1 
HETATM 4507 C  C8  . 3Z0 F 3 .   ? 31.869  45.258 32.888  1.00 158.64 ? 705 3Z0 A C8  1 
HETATM 4508 C  C7  . 3Z0 F 3 .   ? 30.648  44.668 32.681  1.00 158.57 ? 705 3Z0 A C7  1 
HETATM 4509 C  C5  . 3Z0 F 3 .   ? 28.983  44.064 30.787  1.00 157.62 ? 705 3Z0 A C5  1 
HETATM 4510 C  C15 . 3Z0 F 3 .   ? 27.137  42.514 25.414  1.00 145.06 ? 705 3Z0 A C15 1 
HETATM 4511 C  C17 . 3Z0 F 3 .   ? 24.956  43.589 25.332  1.00 144.48 ? 705 3Z0 A C17 1 
HETATM 4512 C  C9  . 3Z0 F 3 .   ? 32.546  45.735 31.793  1.00 158.67 ? 705 3Z0 A C9  1 
HETATM 4513 C  C6  . 3Z0 F 3 .   ? 30.154  44.578 31.398  1.00 158.33 ? 705 3Z0 A C6  1 
HETATM 4514 C  C16 . 3Z0 F 3 .   ? 25.914  42.745 24.827  1.00 142.67 ? 705 3Z0 A C16 1 
HETATM 4515 C  C14 . 3Z0 F 3 .   ? 27.385  43.192 26.591  1.00 147.44 ? 705 3Z0 A C14 1 
HETATM 4516 C  C21 . 3Z0 F 3 .   ? 26.433  44.044 27.110  1.00 147.89 ? 705 3Z0 A C21 1 
HETATM 4517 C  C18 . 3Z0 F 3 .   ? 25.222  44.253 26.502  1.00 146.07 ? 705 3Z0 A C18 1 
HETATM 4518 C  C4  . 3Z0 F 3 .   ? 29.099  44.292 29.434  1.00 156.34 ? 705 3Z0 A C4  1 
HETATM 4519 C  C11 . 3Z0 F 3 .   ? 30.945  45.102 30.399  1.00 158.38 ? 705 3Z0 A C11 1 
HETATM 4520 C  C12 . 3Z0 F 3 .   ? 28.223  43.987 28.371  1.00 152.15 ? 705 3Z0 A C12 1 
HETATM 4521 C  C24 . 3Z0 F 3 .   ? 25.618  42.049 23.583  1.00 138.39 ? 705 3Z0 A C24 1 
HETATM 4522 C  C28 . 3Z0 F 3 .   ? 24.342  44.915 21.878  1.00 133.45 ? 705 3Z0 A C28 1 
HETATM 4523 C  C29 . 3Z0 F 3 .   ? 24.140  44.365 20.489  1.00 133.04 ? 705 3Z0 A C29 1 
HETATM 4524 C  C27 . 3Z0 F 3 .   ? 25.522  44.232 22.520  1.00 134.23 ? 705 3Z0 A C27 1 
HETATM 4525 C  C32 . 3Z0 F 3 .   ? 25.046  42.190 21.215  1.00 133.82 ? 705 3Z0 A C32 1 
HETATM 4526 C  C30 . 3Z0 F 3 .   ? 23.873  42.883 20.567  1.00 132.54 ? 705 3Z0 A C30 1 
HETATM 4527 C  C1  . 3Z0 F 3 .   ? 32.113  44.661 27.663  1.00 157.78 ? 705 3Z0 A C1  1 
HETATM 4528 C  C23 . 3Z0 F 3 .   ? 26.378  45.484 29.165  1.00 149.06 ? 705 3Z0 A C23 1 
HETATM 4529 C  C20 . 3Z0 F 3 .   ? 23.659  46.043 26.284  1.00 144.01 ? 705 3Z0 A C20 1 
HETATM 4530 C  C2  . 3Z0 F 3 .   ? 30.787  45.330 27.922  1.00 157.74 ? 705 3Z0 A C2  1 
HETATM 4531 N  N10 . 3Z0 F 3 .   ? 32.136  45.687 30.524  1.00 158.62 ? 705 3Z0 A N10 1 
HETATM 4532 N  N13 . 3Z0 F 3 .   ? 28.502  43.165 27.386  1.00 149.74 ? 705 3Z0 A N13 1 
HETATM 4533 N  N22 . 3Z0 F 3 .   ? 26.985  44.543 28.251  1.00 149.66 ? 705 3Z0 A N22 1 
HETATM 4534 N  N3  . 3Z0 F 3 .   ? 30.291  44.920 29.216  1.00 157.74 ? 705 3Z0 A N3  1 
HETATM 4535 N  N26 . 3Z0 F 3 .   ? 25.349  42.808 22.475  1.00 135.19 ? 705 3Z0 A N26 1 
HETATM 4536 N  N31 . 3Z0 F 3 .   ? 23.814  42.395 19.170  1.00 130.85 ? 705 3Z0 A N31 1 
HETATM 4537 O  O25 . 3Z0 F 3 .   ? 25.624  40.827 23.556  1.00 137.59 ? 705 3Z0 A O25 1 
HETATM 4538 O  O19 . 3Z0 F 3 .   ? 24.354  45.126 27.113  1.00 145.09 ? 705 3Z0 A O19 1 
HETATM 4539 O  O   . HOH G 4 .   ? -2.002  42.143 -18.088 1.00 78.43  ? 801 HOH A O   1 
HETATM 4540 O  O   . HOH G 4 .   ? 6.443   34.948 23.228  1.00 103.12 ? 802 HOH A O   1 
HETATM 4541 O  O   . HOH G 4 .   ? 20.187  52.357 7.894   1.00 161.71 ? 803 HOH A O   1 
HETATM 4542 O  O   . HOH G 4 .   ? 24.952  35.051 19.688  1.00 109.35 ? 804 HOH A O   1 
HETATM 4543 O  O   . HOH G 4 .   ? 16.843  18.529 8.569   1.00 92.66  ? 805 HOH A O   1 
HETATM 4544 O  O   . HOH G 4 .   ? 2.380   33.868 -12.159 1.00 82.00  ? 806 HOH A O   1 
HETATM 4545 O  O   . HOH G 4 .   ? 8.319   44.047 -3.263  1.00 102.57 ? 807 HOH A O   1 
HETATM 4546 O  O   . HOH G 4 .   ? 6.600   33.595 -1.061  1.00 83.59  ? 808 HOH A O   1 
HETATM 4547 O  O   . HOH G 4 .   ? -24.514 13.217 -54.539 1.00 135.71 ? 809 HOH A O   1 
HETATM 4548 O  O   . HOH G 4 .   ? 6.662   29.903 14.721  1.00 94.97  ? 810 HOH A O   1 
HETATM 4549 O  O   . HOH G 4 .   ? 20.394  27.062 0.239   1.00 96.48  ? 811 HOH A O   1 
HETATM 4550 O  O   . HOH G 4 .   ? 3.963   36.360 -8.477  1.00 88.41  ? 812 HOH A O   1 
HETATM 4551 O  O   . HOH G 4 .   ? 24.041  46.674 -16.380 1.00 144.40 ? 813 HOH A O   1 
HETATM 4552 O  O   . HOH G 4 .   ? 9.684   32.296 -1.925  1.00 76.38  ? 814 HOH A O   1 
HETATM 4553 O  O   . HOH G 4 .   ? 16.576  46.217 -2.337  1.00 122.13 ? 815 HOH A O   1 
HETATM 4554 O  O   . HOH G 4 .   ? 4.499   22.806 -5.039  1.00 64.44  ? 816 HOH A O   1 
HETATM 4555 O  O   . HOH G 4 .   ? 4.340   28.538 -2.111  1.00 88.68  ? 817 HOH A O   1 
HETATM 4556 O  O   . HOH G 4 .   ? 23.803  40.544 12.964  1.00 121.43 ? 818 HOH A O   1 
HETATM 4557 O  O   . HOH G 4 .   ? 24.547  39.304 15.232  1.00 126.79 ? 819 HOH A O   1 
HETATM 4558 O  O   . HOH G 4 .   ? 13.111  32.312 4.784   1.00 83.52  ? 820 HOH A O   1 
HETATM 4559 O  O   . HOH G 4 .   ? 21.211  44.416 -15.133 1.00 130.82 ? 821 HOH A O   1 
HETATM 4560 O  O   . HOH G 4 .   ? 18.916  46.131 -15.664 1.00 131.82 ? 822 HOH A O   1 
HETATM 4561 O  O   . HOH G 4 .   ? 10.611  32.748 -4.081  1.00 82.45  ? 823 HOH A O   1 
HETATM 4562 O  O   . HOH G 4 .   ? 18.131  31.971 -3.298  1.00 96.07  ? 824 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLN A 11  ? 2.0587 1.7600 1.4171 0.0883  -0.0232 -0.0797 3   GLN A N   
2    C  CA  . GLN A 11  ? 2.0600 1.7462 1.4116 0.0733  -0.0030 -0.0775 3   GLN A CA  
3    C  C   . GLN A 11  ? 2.0946 1.8326 1.4367 0.0647  0.0025  -0.1081 3   GLN A C   
4    O  O   . GLN A 11  ? 2.1007 1.8354 1.4442 0.0458  0.0215  -0.1229 3   GLN A O   
5    C  CB  . GLN A 11  ? 1.5740 1.2177 0.9427 0.0501  0.0171  -0.0773 3   GLN A CB  
6    N  N   . GLY A 12  ? 1.9734 1.7579 1.3068 0.0797  -0.0164 -0.1187 4   GLY A N   
7    C  CA  . GLY A 12  ? 1.9753 1.8127 1.2989 0.0722  -0.0137 -0.1471 4   GLY A CA  
8    C  C   . GLY A 12  ? 1.9890 1.8601 1.2945 0.0938  -0.0377 -0.1410 4   GLY A C   
9    O  O   . GLY A 12  ? 1.9947 1.8506 1.2976 0.1160  -0.0614 -0.1181 4   GLY A O   
10   N  N   . THR A 13  ? 1.8941 1.8086 1.1864 0.0862  -0.0342 -0.1611 5   THR A N   
11   C  CA  . THR A 13  ? 1.9070 1.8560 1.1802 0.1025  -0.0585 -0.1559 5   THR A CA  
12   C  C   . THR A 13  ? 1.9146 1.9217 1.1806 0.0907  -0.0535 -0.1892 5   THR A C   
13   O  O   . THR A 13  ? 1.9188 1.9312 1.1783 0.0702  -0.0304 -0.2037 5   THR A O   
14   C  CB  . THR A 13  ? 2.0073 1.9327 1.2574 0.1054  -0.0624 -0.1224 5   THR A CB  
15   O  OG1 . THR A 13  ? 2.0371 2.0031 1.2642 0.1105  -0.0820 -0.1219 5   THR A OG1 
16   C  CG2 . THR A 13  ? 2.0059 1.9148 1.2544 0.0843  -0.0297 -0.1261 5   THR A CG2 
17   N  N   . LEU A 14  ? 1.8377 1.8884 1.1062 0.1050  -0.0769 -0.2031 6   LEU A N   
18   C  CA  . LEU A 14  ? 1.8404 1.9505 1.1034 0.0946  -0.0750 -0.2347 6   LEU A CA  
19   C  C   . LEU A 14  ? 1.8997 2.0360 1.1380 0.1051  -0.0970 -0.2243 6   LEU A C   
20   O  O   . LEU A 14  ? 1.9149 2.0524 1.1514 0.1293  -0.1303 -0.2085 6   LEU A O   
21   C  CB  . LEU A 14  ? 1.8206 1.9737 1.1056 0.1001  -0.0850 -0.2627 6   LEU A CB  
22   C  CG  . LEU A 14  ? 1.8576 2.0762 1.1399 0.0861  -0.0817 -0.2976 6   LEU A CG  
23   C  CD1 . LEU A 14  ? 1.8495 2.0615 1.1299 0.0511  -0.0494 -0.3153 6   LEU A CD1 
24   C  CD2 . LEU A 14  ? 1.8559 2.1279 1.1603 0.0984  -0.0989 -0.3223 6   LEU A CD2 
25   N  N   . ILE A 15  ? 1.8797 2.0361 1.0987 0.0860  -0.0807 -0.2338 7   ILE A N   
26   C  CA  . ILE A 15  ? 1.9109 2.0967 1.1027 0.0892  -0.0993 -0.2240 7   ILE A CA  
27   C  C   . ILE A 15  ? 1.9516 2.1994 1.1407 0.0819  -0.1023 -0.2574 7   ILE A C   
28   O  O   . ILE A 15  ? 1.9315 2.1967 1.1272 0.0619  -0.0773 -0.2871 7   ILE A O   
29   C  CB  . ILE A 15  ? 1.9404 2.1125 1.1083 0.0724  -0.0801 -0.2094 7   ILE A CB  
30   C  CG1 . ILE A 15  ? 1.9163 2.0301 1.0925 0.0739  -0.0674 -0.1842 7   ILE A CG1 
31   C  CG2 . ILE A 15  ? 1.9986 2.1945 1.1353 0.0749  -0.1055 -0.1872 7   ILE A CG2 
32   C  CD1 . ILE A 15  ? 1.9426 2.0505 1.1020 0.0574  -0.0445 -0.1768 7   ILE A CD1 
33   N  N   . ARG A 16  ? 1.9496 2.2287 1.1288 0.0973  -0.1357 -0.2515 8   ARG A N   
34   C  CA  . ARG A 16  ? 1.9724 2.3135 1.1487 0.0921  -0.1424 -0.2810 8   ARG A CA  
35   C  C   . ARG A 16  ? 2.0589 2.4234 1.2009 0.0833  -0.1534 -0.2691 8   ARG A C   
36   O  O   . ARG A 16  ? 2.0954 2.4526 1.2231 0.0977  -0.1872 -0.2405 8   ARG A O   
37   C  CB  . ARG A 16  ? 1.9661 2.3357 1.1652 0.1184  -0.1751 -0.2919 8   ARG A CB  
38   C  CG  . ARG A 16  ? 1.9364 2.2806 1.1665 0.1321  -0.1727 -0.2950 8   ARG A CG  
39   C  CD  . ARG A 16  ? 1.9240 2.3163 1.1807 0.1552  -0.1993 -0.3197 8   ARG A CD  
40   N  NE  . ARG A 16  ? 1.9244 2.2917 1.2080 0.1735  -0.2047 -0.3179 8   ARG A NE  
41   C  CZ  . ARG A 16  ? 1.9502 2.3609 1.2635 0.1926  -0.2209 -0.3449 8   ARG A CZ  
42   N  NH1 . ARG A 16  ? 1.7953 2.2768 1.1165 0.1964  -0.2336 -0.3752 8   ARG A NH1 
43   N  NH2 . ARG A 16  ? 1.8462 2.2339 1.1819 0.2077  -0.2242 -0.3433 8   ARG A NH2 
44   N  N   . VAL A 17  ? 1.9956 2.3876 1.1234 0.0581  -0.1271 -0.2911 9   VAL A N   
45   C  CA  . VAL A 17  ? 2.0311 2.4523 1.1245 0.0451  -0.1332 -0.2836 9   VAL A CA  
46   C  C   . VAL A 17  ? 2.1021 2.5821 1.1911 0.0458  -0.1537 -0.3041 9   VAL A C   
47   O  O   . VAL A 17  ? 2.0892 2.5967 1.1993 0.0453  -0.1473 -0.3358 9   VAL A O   
48   C  CB  . VAL A 17  ? 2.0384 2.4600 1.1174 0.0184  -0.0944 -0.2986 9   VAL A CB  
49   C  CG1 . VAL A 17  ? 2.0122 2.3826 1.0916 0.0185  -0.0790 -0.2741 9   VAL A CG1 
50   C  CG2 . VAL A 17  ? 2.0173 2.4505 1.1152 0.0050  -0.0684 -0.3399 9   VAL A CG2 
51   N  N   . THR A 18  ? 2.0194 2.5207 1.0801 0.0445  -0.1799 -0.2845 10  THR A N   
52   C  CA  . THR A 18  ? 2.0607 2.6173 1.1148 0.0450  -0.2034 -0.3001 10  THR A CA  
53   C  C   . THR A 18  ? 2.1200 2.7079 1.1338 0.0193  -0.1993 -0.2952 10  THR A C   
54   O  O   . THR A 18  ? 2.1246 2.6930 1.1128 0.0092  -0.1985 -0.2661 10  THR A O   
55   C  CB  . THR A 18  ? 2.1514 2.7054 1.2160 0.0756  -0.2555 -0.2803 10  THR A CB  
56   O  OG1 . THR A 18  ? 2.1896 2.8002 1.2533 0.0779  -0.2784 -0.2996 10  THR A OG1 
57   C  CG2 . THR A 18  ? 2.1825 2.7004 1.2195 0.0779  -0.2846 -0.2323 10  THR A CG2 
58   N  N   . PRO A 19  ? 2.0615 2.7027 1.0687 0.0063  -0.1957 -0.3246 11  PRO A N   
59   C  CA  . PRO A 19  ? 2.0870 2.7639 1.0556 -0.0205 -0.1892 -0.3252 11  PRO A CA  
60   C  C   . PRO A 19  ? 2.1736 2.8625 1.1130 -0.0194 -0.2326 -0.2884 11  PRO A C   
61   O  O   . PRO A 19  ? 2.1865 2.8934 1.0891 -0.0435 -0.2278 -0.2751 11  PRO A O   
62   C  CB  . PRO A 19  ? 2.1007 2.8278 1.0752 -0.0315 -0.1783 -0.3672 11  PRO A CB  
63   C  CG  . PRO A 19  ? 2.1311 2.8630 1.1416 -0.0062 -0.1995 -0.3770 11  PRO A CG  
64   C  CD  . PRO A 19  ? 2.0656 2.7405 1.1003 0.0122  -0.1944 -0.3609 11  PRO A CD  
65   N  N   . GLU A 20  ? 2.1166 2.7972 1.0723 0.0073  -0.2763 -0.2734 12  GLU A N   
66   C  CA  . GLU A 20  ? 2.1827 2.8696 1.1127 0.0091  -0.3266 -0.2382 12  GLU A CA  
67   C  C   . GLU A 20  ? 2.2206 2.8610 1.1274 0.0046  -0.3405 -0.1902 12  GLU A C   
68   O  O   . GLU A 20  ? 2.2619 2.9102 1.1324 -0.0108 -0.3721 -0.1569 12  GLU A O   
69   C  CB  . GLU A 20  ? 2.2256 2.9161 1.1854 0.0432  -0.3734 -0.2416 12  GLU A CB  
70   C  CG  . GLU A 20  ? 2.2893 2.9396 1.2916 0.0753  -0.3736 -0.2473 12  GLU A CG  
71   N  N   . GLN A 21  ? 2.1551 2.7484 1.0811 0.0147  -0.3179 -0.1852 13  GLN A N   
72   C  CA  . GLN A 21  ? 2.1586 2.7071 1.0651 0.0101  -0.3290 -0.1401 13  GLN A CA  
73   C  C   . GLN A 21  ? 2.1202 2.6410 1.0380 0.0038  -0.2791 -0.1479 13  GLN A C   
74   O  O   . GLN A 21  ? 2.0752 2.5769 1.0296 0.0205  -0.2566 -0.1739 13  GLN A O   
75   C  CB  . GLN A 21  ? 2.2024 2.7040 1.1251 0.0419  -0.3816 -0.1109 13  GLN A CB  
76   N  N   . PRO A 22  ? 2.0561 2.5778 0.9426 -0.0218 -0.2633 -0.1255 14  PRO A N   
77   C  CA  . PRO A 22  ? 2.0262 2.5239 0.9235 -0.0274 -0.2187 -0.1320 14  PRO A CA  
78   C  C   . PRO A 22  ? 2.0021 2.4346 0.9259 -0.0024 -0.2291 -0.1098 14  PRO A C   
79   O  O   . PRO A 22  ? 2.0248 2.4283 0.9410 0.0096  -0.2737 -0.0723 14  PRO A O   
80   C  CB  . PRO A 22  ? 2.0610 2.5850 0.9156 -0.0594 -0.2124 -0.1071 14  PRO A CB  
81   C  CG  . PRO A 22  ? 2.1098 2.6427 0.9323 -0.0658 -0.2668 -0.0673 14  PRO A CG  
82   C  CD  . PRO A 22  ? 2.1087 2.6580 0.9477 -0.0481 -0.2895 -0.0915 14  PRO A CD  
83   N  N   . THR A 23  ? 2.0143 2.4217 0.9680 0.0045  -0.1910 -0.1326 15  THR A N   
84   C  CA  . THR A 23  ? 1.9852 2.3325 0.9653 0.0268  -0.1969 -0.1150 15  THR A CA  
85   C  C   . THR A 23  ? 1.9722 2.2916 0.9452 0.0149  -0.1723 -0.0939 15  THR A C   
86   O  O   . THR A 23  ? 1.9566 2.2932 0.9311 -0.0009 -0.1312 -0.1177 15  THR A O   
87   C  CB  . THR A 23  ? 1.9312 2.2668 0.9534 0.0437  -0.1768 -0.1528 15  THR A CB  
88   N  N   . HIS A 24  ? 1.9515 2.2281 0.9180 0.0232  -0.1999 -0.0504 16  HIS A N   
89   C  CA  . HIS A 24  ? 1.9451 2.1938 0.9073 0.0135  -0.1802 -0.0268 16  HIS A CA  
90   C  C   . HIS A 24  ? 1.9075 2.0961 0.9063 0.0373  -0.1750 -0.0254 16  HIS A C   
91   O  O   . HIS A 24  ? 1.9073 2.0639 0.9184 0.0603  -0.2091 -0.0127 16  HIS A O   
92   C  CB  . HIS A 24  ? 1.9898 2.2356 0.9125 -0.0015 -0.2150 0.0258  16  HIS A CB  
93   C  CG  . HIS A 24  ? 2.0306 2.3388 0.9131 -0.0303 -0.2209 0.0286  16  HIS A CG  
94   N  ND1 . HIS A 24  ? 2.0477 2.3910 0.9229 -0.0294 -0.2396 0.0104  16  HIS A ND1 
95   C  CD2 . HIS A 24  ? 2.0589 2.4059 0.9059 -0.0627 -0.2105 0.0468  16  HIS A CD2 
96   C  CE1 . HIS A 24  ? 2.0852 2.4823 0.9209 -0.0604 -0.2410 0.0185  16  HIS A CE1 
97   N  NE2 . HIS A 24  ? 2.0930 2.4961 0.9105 -0.0817 -0.2230 0.0400  16  HIS A NE2 
98   N  N   . ALA A 25  ? 1.9434 2.1176 0.9602 0.0321  -0.1339 -0.0400 17  ALA A N   
99   C  CA  . ALA A 25  ? 1.9029 2.0227 0.9544 0.0508  -0.1256 -0.0411 17  ALA A CA  
100  C  C   . ALA A 25  ? 1.8981 1.9880 0.9533 0.0428  -0.1014 -0.0233 17  ALA A C   
101  O  O   . ALA A 25  ? 1.8893 2.0077 0.9365 0.0245  -0.0717 -0.0356 17  ALA A O   
102  C  CB  . ALA A 25  ? 1.8701 1.9981 0.9525 0.0561  -0.1012 -0.0883 17  ALA A CB  
103  N  N   . VAL A 26  ? 1.8567 1.8914 0.9255 0.0578  -0.1152 0.0035  18  VAL A N   
104  C  CA  . VAL A 26  ? 1.8426 1.8438 0.9194 0.0528  -0.0946 0.0218  18  VAL A CA  
105  C  C   . VAL A 26  ? 1.8020 1.7748 0.9179 0.0603  -0.0638 -0.0088 18  VAL A C   
106  O  O   . VAL A 26  ? 1.7838 1.7412 0.9207 0.0747  -0.0716 -0.0252 18  VAL A O   
107  C  CB  . VAL A 26  ? 1.8546 1.8073 0.9219 0.0622  -0.1288 0.0716  18  VAL A CB  
108  C  CG1 . VAL A 26  ? 1.8483 1.7799 0.9152 0.0508  -0.1085 0.0952  18  VAL A CG1 
109  C  CG2 . VAL A 26  ? 1.9008 1.8718 0.9305 0.0568  -0.1722 0.1026  18  VAL A CG2 
110  N  N   . CYS A 27  ? 1.8655 1.8342 0.9916 0.0495  -0.0308 -0.0172 19  CYS A N   
111  C  CA  . CYS A 27  ? 1.8259 1.7628 0.9877 0.0529  -0.0045 -0.0436 19  CYS A CA  
112  C  C   . CYS A 27  ? 1.8136 1.7078 0.9889 0.0530  0.0081  -0.0209 19  CYS A C   
113  O  O   . CYS A 27  ? 1.8168 1.7298 0.9823 0.0424  0.0221  -0.0133 19  CYS A O   
114  C  CB  . CYS A 27  ? 1.8304 1.8029 0.9994 0.0407  0.0238  -0.0900 19  CYS A CB  
115  S  SG  . CYS A 27  ? 1.8665 1.8807 1.0298 0.0399  0.0139  -0.1243 19  CYS A SG  
116  N  N   . VAL A 28  ? 1.7960 1.6378 0.9943 0.0642  0.0034  -0.0116 20  VAL A N   
117  C  CA  . VAL A 28  ? 1.7774 1.5738 0.9912 0.0648  0.0143  0.0098  20  VAL A CA  
118  C  C   . VAL A 28  ? 1.7880 1.5703 1.0320 0.0582  0.0451  -0.0233 20  VAL A C   
119  O  O   . VAL A 28  ? 1.7762 1.5461 1.0386 0.0582  0.0488  -0.0490 20  VAL A O   
120  C  CB  . VAL A 28  ? 1.7911 1.5353 1.0139 0.0791  -0.0078 0.0377  20  VAL A CB  
121  C  CG1 . VAL A 28  ? 1.7738 1.4704 1.0133 0.0779  0.0044  0.0593  20  VAL A CG1 
122  C  CG2 . VAL A 28  ? 1.8190 1.5679 1.0134 0.0876  -0.0449 0.0709  20  VAL A CG2 
123  N  N   . LEU A 29  ? 1.7901 1.5761 1.0394 0.0517  0.0646  -0.0230 21  LEU A N   
124  C  CA  . LEU A 29  ? 1.7851 1.5538 1.0648 0.0473  0.0893  -0.0548 21  LEU A CA  
125  C  C   . LEU A 29  ? 1.7898 1.4948 1.0969 0.0508  0.0874  -0.0480 21  LEU A C   
126  O  O   . LEU A 29  ? 1.7641 1.4325 1.0740 0.0565  0.0792  -0.0129 21  LEU A O   
127  C  CB  . LEU A 29  ? 1.7977 1.5828 1.0815 0.0439  0.1067  -0.0526 21  LEU A CB  
128  C  CG  . LEU A 29  ? 1.8398 1.6970 1.0961 0.0361  0.1118  -0.0603 21  LEU A CG  
129  C  CD1 . LEU A 29  ? 1.8443 1.7211 1.1023 0.0325  0.1245  -0.0462 21  LEU A CD1 
130  C  CD2 . LEU A 29  ? 1.8702 1.7636 1.1314 0.0314  0.1261  -0.1124 21  LEU A CD2 
131  N  N   . GLY A 30  ? 1.7799 1.4731 1.1048 0.0446  0.0934  -0.0806 22  GLY A N   
132  C  CA  . GLY A 30  ? 1.7703 1.4091 1.1188 0.0418  0.0913  -0.0766 22  GLY A CA  
133  C  C   . GLY A 30  ? 1.7941 1.4390 1.1391 0.0399  0.0776  -0.0840 22  GLY A C   
134  O  O   . GLY A 30  ? 1.7800 1.3913 1.1425 0.0323  0.0763  -0.0866 22  GLY A O   
135  N  N   . THR A 31  ? 1.8211 1.5130 1.1435 0.0456  0.0664  -0.0881 23  THR A N   
136  C  CA  . THR A 31  ? 1.8073 1.5165 1.1278 0.0467  0.0521  -0.0983 23  THR A CA  
137  C  C   . THR A 31  ? 1.8714 1.6233 1.1876 0.0348  0.0581  -0.1376 23  THR A C   
138  O  O   . THR A 31  ? 1.8875 1.6733 1.1891 0.0334  0.0642  -0.1502 23  THR A O   
139  C  CB  . THR A 31  ? 1.8316 1.5591 1.1326 0.0649  0.0276  -0.0735 23  THR A CB  
140  O  OG1 . THR A 31  ? 1.8648 1.6344 1.1412 0.0664  0.0245  -0.0739 23  THR A OG1 
141  C  CG2 . THR A 31  ? 1.7907 1.4727 1.0935 0.0756  0.0185  -0.0334 23  THR A CG2 
142  N  N   . LEU A 32  ? 1.8238 1.5774 1.1516 0.0239  0.0560  -0.1569 24  LEU A N   
143  C  CA  . LEU A 32  ? 1.8467 1.6399 1.1702 0.0095  0.0597  -0.1931 24  LEU A CA  
144  C  C   . LEU A 32  ? 1.8661 1.7163 1.1697 0.0213  0.0452  -0.1972 24  LEU A C   
145  O  O   . LEU A 32  ? 1.8385 1.6973 1.1404 0.0368  0.0272  -0.1813 24  LEU A O   
146  C  CB  . LEU A 32  ? 1.7479 1.5303 1.0877 -0.0104 0.0597  -0.2092 24  LEU A CB  
147  N  N   . THR A 33  ? 1.8557 1.7439 1.1451 0.0147  0.0508  -0.2200 25  THR A N   
148  C  CA  . THR A 33  ? 1.8619 1.8047 1.1312 0.0239  0.0360  -0.2239 25  THR A CA  
149  C  C   . THR A 33  ? 1.9198 1.9053 1.1864 0.0080  0.0391  -0.2612 25  THR A C   
150  O  O   . THR A 33  ? 1.9516 1.9386 1.2160 -0.0077 0.0542  -0.2844 25  THR A O   
151  C  CB  . THR A 33  ? 1.9282 1.8872 1.1746 0.0306  0.0362  -0.2097 25  THR A CB  
152  O  OG1 . THR A 33  ? 1.9320 1.8518 1.1799 0.0410  0.0343  -0.1743 25  THR A OG1 
153  C  CG2 . THR A 33  ? 1.9080 1.9159 1.1328 0.0402  0.0142  -0.2060 25  THR A CG2 
154  N  N   . GLN A 34  ? 1.8859 1.9076 1.1536 0.0127  0.0231  -0.2685 26  GLN A N   
155  C  CA  . GLN A 34  ? 1.9029 1.9720 1.1674 -0.0031 0.0239  -0.3021 26  GLN A CA  
156  C  C   . GLN A 34  ? 1.9583 2.0823 1.2030 0.0091  0.0081  -0.3052 26  GLN A C   
157  O  O   . GLN A 34  ? 1.9569 2.0833 1.1946 0.0311  -0.0105 -0.2808 26  GLN A O   
158  C  CB  . GLN A 34  ? 1.8921 1.9724 1.1751 -0.0121 0.0188  -0.3139 26  GLN A CB  
159  N  N   . LEU A 35  ? 1.8786 2.0437 1.1136 -0.0067 0.0128  -0.3344 27  LEU A N   
160  C  CA  . LEU A 35  ? 1.8955 2.1141 1.1106 0.0010  -0.0017 -0.3391 27  LEU A CA  
161  C  C   . LEU A 35  ? 1.9234 2.1958 1.1455 -0.0006 -0.0152 -0.3614 27  LEU A C   
162  O  O   . LEU A 35  ? 1.9157 2.1979 1.1487 -0.0213 -0.0053 -0.3852 27  LEU A O   
163  C  CB  . LEU A 35  ? 1.9265 2.1588 1.1214 -0.0146 0.0134  -0.3556 27  LEU A CB  
164  C  CG  . LEU A 35  ? 1.9647 2.1737 1.1456 -0.0092 0.0216  -0.3351 27  LEU A CG  
165  C  CD1 . LEU A 35  ? 1.9949 2.2304 1.1578 -0.0252 0.0368  -0.3603 27  LEU A CD1 
166  C  CD2 . LEU A 35  ? 1.9848 2.2047 1.1510 0.0107  -0.0021 -0.3011 27  LEU A CD2 
167  N  N   . ASP A 36  ? 1.9256 2.2339 1.1411 0.0201  -0.0403 -0.3530 28  ASP A N   
168  C  CA  . ASP A 36  ? 1.9380 2.3074 1.1608 0.0229  -0.0563 -0.3757 28  ASP A CA  
169  C  C   . ASP A 36  ? 2.0189 2.4335 1.2179 0.0180  -0.0633 -0.3862 28  ASP A C   
170  O  O   . ASP A 36  ? 2.0346 2.4597 1.2201 0.0363  -0.0861 -0.3677 28  ASP A O   
171  C  CB  . ASP A 36  ? 1.9376 2.3148 1.1768 0.0543  -0.0852 -0.3625 28  ASP A CB  
172  C  CG  . ASP A 36  ? 2.0133 2.4588 1.2689 0.0590  -0.1004 -0.3916 28  ASP A CG  
173  O  OD1 . ASP A 36  ? 2.0318 2.5218 1.2813 0.0375  -0.0910 -0.4178 28  ASP A OD1 
174  O  OD2 . ASP A 36  ? 2.0469 2.5041 1.3226 0.0849  -0.1227 -0.3899 28  ASP A OD2 
175  N  N   . ILE A 37  ? 2.0657 2.5049 1.2580 -0.0085 -0.0462 -0.4146 29  ILE A N   
176  C  CA  . ILE A 37  ? 2.1079 2.5911 1.2764 -0.0166 -0.0504 -0.4272 29  ILE A CA  
177  C  C   . ILE A 37  ? 2.1665 2.7159 1.3422 -0.0208 -0.0632 -0.4537 29  ILE A C   
178  O  O   . ILE A 37  ? 2.1975 2.7906 1.3558 -0.0237 -0.0730 -0.4627 29  ILE A O   
179  C  CB  . ILE A 37  ? 1.8892 2.3557 1.0415 -0.0429 -0.0237 -0.4431 29  ILE A CB  
180  N  N   . CYS A 38  ? 2.1355 2.6970 1.3367 -0.0227 -0.0633 -0.4662 30  CYS A N   
181  C  CA  . CYS A 38  ? 2.1527 2.7849 1.3638 -0.0299 -0.0730 -0.4942 30  CYS A CA  
182  C  C   . CYS A 38  ? 2.1837 2.8604 1.4069 0.0038  -0.1060 -0.4906 30  CYS A C   
183  O  O   . CYS A 38  ? 2.2108 2.9503 1.4325 0.0040  -0.1201 -0.5092 30  CYS A O   
184  C  CB  . CYS A 38  ? 2.1381 2.7748 1.3704 -0.0509 -0.0598 -0.5107 30  CYS A CB  
185  S  SG  . CYS A 38  ? 2.1794 2.7713 1.3991 -0.0957 -0.0300 -0.5223 30  CYS A SG  
186  N  N   . SER A 39  ? 2.0731 2.7152 1.3091 0.0328  -0.1206 -0.4673 31  SER A N   
187  C  CA  . SER A 39  ? 2.0827 2.7578 1.3358 0.0688  -0.1567 -0.4657 31  SER A CA  
188  C  C   . SER A 39  ? 2.1554 2.8535 1.3887 0.0819  -0.1838 -0.4573 31  SER A C   
189  O  O   . SER A 39  ? 2.1786 2.9260 1.4264 0.1044  -0.2148 -0.4691 31  SER A O   
190  C  CB  . SER A 39  ? 2.0808 2.7005 1.3470 0.0958  -0.1682 -0.4391 31  SER A CB  
191  O  OG  . SER A 39  ? 2.1594 2.7145 1.4007 0.0944  -0.1630 -0.4050 31  SER A OG  
192  N  N   . SER A 40  ? 2.0856 2.7511 1.2865 0.0673  -0.1736 -0.4381 32  SER A N   
193  C  CA  . SER A 40  ? 2.1330 2.8177 1.3097 0.0737  -0.1991 -0.4255 32  SER A CA  
194  C  C   . SER A 40  ? 2.1715 2.8829 1.3207 0.0411  -0.1774 -0.4408 32  SER A C   
195  O  O   . SER A 40  ? 2.2031 2.9145 1.3225 0.0356  -0.1860 -0.4247 32  SER A O   
196  C  CB  . SER A 40  ? 2.1669 2.7940 1.3254 0.0875  -0.2150 -0.3831 32  SER A CB  
197  O  OG  . SER A 40  ? 2.2095 2.8113 1.3921 0.1199  -0.2419 -0.3691 32  SER A OG  
198  N  N   . ALA A 41  ? 2.1812 2.9160 1.3390 0.0174  -0.1509 -0.4718 33  ALA A N   
199  C  CA  . ALA A 41  ? 2.1958 2.9549 1.3299 -0.0140 -0.1314 -0.4914 33  ALA A CA  
200  C  C   . ALA A 41  ? 2.2637 3.0955 1.3954 -0.0136 -0.1530 -0.5103 33  ALA A C   
201  O  O   . ALA A 41  ? 2.2492 3.1205 1.4071 0.0053  -0.1745 -0.5206 33  ALA A O   
202  C  CB  . ALA A 41  ? 2.1754 2.9207 1.3181 -0.0419 -0.0989 -0.5145 33  ALA A CB  
203  N  N   . PRO A 42  ? 2.3952 3.2485 1.4968 -0.0338 -0.1480 -0.5168 34  PRO A N   
204  C  CA  . PRO A 42  ? 2.4113 3.3347 1.5092 -0.0380 -0.1661 -0.5363 34  PRO A CA  
205  C  C   . PRO A 42  ? 2.3923 3.3611 1.5139 -0.0514 -0.1566 -0.5703 34  PRO A C   
206  O  O   . PRO A 42  ? 2.3825 3.3308 1.5045 -0.0770 -0.1278 -0.5845 34  PRO A O   
207  C  CB  . PRO A 42  ? 2.3150 3.2425 1.3744 -0.0652 -0.1514 -0.5400 34  PRO A CB  
208  C  CG  . PRO A 42  ? 2.3204 3.1884 1.3629 -0.0632 -0.1398 -0.5131 34  PRO A CG  
209  C  CD  . PRO A 42  ? 2.2880 3.1062 1.3579 -0.0519 -0.1273 -0.5065 34  PRO A CD  
210  N  N   . GLU A 43  ? 2.4124 3.4440 1.5538 -0.0353 -0.1833 -0.5831 35  GLU A N   
211  C  CA  . GLU A 43  ? 2.3959 3.4733 1.5719 -0.0482 -0.1747 -0.6080 35  GLU A CA  
212  C  C   . GLU A 43  ? 2.4126 3.5000 1.5817 -0.0877 -0.1518 -0.6204 35  GLU A C   
213  O  O   . GLU A 43  ? 2.4016 3.5048 1.5920 -0.1105 -0.1359 -0.6355 35  GLU A O   
214  C  CB  . GLU A 43  ? 2.2676 3.4111 1.4745 -0.0187 -0.2092 -0.6172 35  GLU A CB  
215  N  N   . ASP A 44  ? 2.3731 3.4523 1.5114 -0.0971 -0.1519 -0.6134 36  ASP A N   
216  C  CA  . ASP A 44  ? 2.3810 3.4669 1.5110 -0.1320 -0.1330 -0.6262 36  ASP A CA  
217  C  C   . ASP A 44  ? 2.4004 3.4231 1.5131 -0.1567 -0.1025 -0.6284 36  ASP A C   
218  O  O   . ASP A 44  ? 2.4077 3.4258 1.5169 -0.1865 -0.0868 -0.6423 36  ASP A O   
219  C  CB  . ASP A 44  ? 2.4193 3.5292 1.5254 -0.1325 -0.1470 -0.6204 36  ASP A CB  
220  N  N   . CYS A 45  ? 2.3561 3.3300 1.4586 -0.1431 -0.0966 -0.6158 37  CYS A N   
221  C  CA  . CYS A 45  ? 2.3420 3.2546 1.4308 -0.1617 -0.0701 -0.6192 37  CYS A CA  
222  C  C   . CYS A 45  ? 2.3685 3.2618 1.4801 -0.1773 -0.0580 -0.6296 37  CYS A C   
223  O  O   . CYS A 45  ? 2.3424 3.2493 1.4755 -0.1627 -0.0665 -0.6254 37  CYS A O   
224  C  CB  . CYS A 45  ? 2.3185 3.1907 1.3863 -0.1420 -0.0687 -0.6005 37  CYS A CB  
225  N  N   . THR A 46  ? 2.2646 3.1265 1.3704 -0.2080 -0.0404 -0.6439 38  THR A N   
226  C  CA  . THR A 46  ? 2.2702 3.1123 1.3922 -0.2311 -0.0322 -0.6526 38  THR A CA  
227  C  C   . THR A 46  ? 2.2989 3.0662 1.4082 -0.2403 -0.0157 -0.6546 38  THR A C   
228  O  O   . THR A 46  ? 2.2923 3.0326 1.4116 -0.2581 -0.0110 -0.6579 38  THR A O   
229  C  CB  . THR A 46  ? 2.3588 3.2278 1.4858 -0.2654 -0.0321 -0.6691 38  THR A CB  
230  O  OG1 . THR A 46  ? 2.3692 3.2077 1.4726 -0.2807 -0.0237 -0.6805 38  THR A OG1 
231  C  CG2 . THR A 46  ? 2.3538 3.3014 1.4968 -0.2567 -0.0478 -0.6693 38  THR A CG2 
232  N  N   . SER A 47  ? 2.3193 3.0563 1.4071 -0.2295 -0.0079 -0.6531 39  SER A N   
233  C  CA  . SER A 47  ? 2.3175 2.9874 1.3957 -0.2352 0.0077  -0.6589 39  SER A CA  
234  C  C   . SER A 47  ? 2.3159 2.9651 1.3857 -0.2062 0.0127  -0.6398 39  SER A C   
235  O  O   . SER A 47  ? 2.3005 2.9910 1.3587 -0.1890 0.0029  -0.6284 39  SER A O   
236  C  CB  . SER A 47  ? 2.3872 3.0311 1.4554 -0.2625 0.0152  -0.6833 39  SER A CB  
237  O  OG  . SER A 47  ? 2.4816 3.1380 1.5598 -0.2922 0.0082  -0.6937 39  SER A OG  
238  N  N   . PHE A 48  ? 2.3342 2.9185 1.4121 -0.2022 0.0258  -0.6337 40  PHE A N   
239  C  CA  . PHE A 48  ? 2.3083 2.8721 1.3807 -0.1782 0.0322  -0.6139 40  PHE A CA  
240  C  C   . PHE A 48  ? 2.3370 2.8373 1.4152 -0.1816 0.0493  -0.6226 40  PHE A C   
241  O  O   . PHE A 48  ? 2.3538 2.8121 1.4456 -0.1986 0.0527  -0.6365 40  PHE A O   
242  C  CB  . PHE A 48  ? 2.2840 2.8455 1.3716 -0.1514 0.0214  -0.5782 40  PHE A CB  
243  C  CG  . PHE A 48  ? 2.2777 2.7845 1.3918 -0.1489 0.0264  -0.5659 40  PHE A CG  
244  C  CD1 . PHE A 48  ? 2.3221 2.8111 1.4491 -0.1732 0.0293  -0.5828 40  PHE A CD1 
245  C  CD2 . PHE A 48  ? 2.2597 2.7332 1.3837 -0.1248 0.0262  -0.5353 40  PHE A CD2 
246  C  CE1 . PHE A 48  ? 2.3117 2.7519 1.4609 -0.1738 0.0325  -0.5695 40  PHE A CE1 
247  C  CE2 . PHE A 48  ? 2.2611 2.6853 1.4085 -0.1232 0.0304  -0.5233 40  PHE A CE2 
248  C  CZ  . PHE A 48  ? 2.2667 2.6748 1.4267 -0.1478 0.0338  -0.5405 40  PHE A CZ  
249  N  N   . SER A 49  ? 2.2725 2.7688 1.3405 -0.1666 0.0579  -0.6144 41  SER A N   
250  C  CA  . SER A 49  ? 2.2743 2.7194 1.3506 -0.1645 0.0737  -0.6242 41  SER A CA  
251  C  C   . SER A 49  ? 2.2509 2.6939 1.3249 -0.1418 0.0787  -0.5949 41  SER A C   
252  O  O   . SER A 49  ? 2.2332 2.7216 1.2879 -0.1337 0.0708  -0.5765 41  SER A O   
253  C  CB  . SER A 49  ? 2.3400 2.7959 1.4009 -0.1798 0.0823  -0.6654 41  SER A CB  
254  O  OG  . SER A 49  ? 2.4298 2.8321 1.5060 -0.1774 0.0941  -0.6825 41  SER A OG  
255  N  N   . ILE A 50  ? 2.2344 2.6242 1.3273 -0.1333 0.0893  -0.5890 42  ILE A N   
256  C  CA  . ILE A 50  ? 2.1939 2.5787 1.2863 -0.1142 0.0935  -0.5581 42  ILE A CA  
257  C  C   . ILE A 50  ? 2.2026 2.5704 1.2993 -0.1112 0.1118  -0.5763 42  ILE A C   
258  O  O   . ILE A 50  ? 2.2176 2.5394 1.3349 -0.1153 0.1189  -0.6005 42  ILE A O   
259  C  CB  . ILE A 50  ? 2.1880 2.5280 1.3034 -0.1011 0.0867  -0.5233 42  ILE A CB  
260  C  CG1 . ILE A 50  ? 2.1676 2.5277 1.2850 -0.1017 0.0684  -0.5114 42  ILE A CG1 
261  C  CG2 . ILE A 50  ? 2.1746 2.5117 1.2855 -0.0832 0.0874  -0.4882 42  ILE A CG2 
262  C  CD1 . ILE A 50  ? 2.2088 2.5428 1.3451 -0.1183 0.0675  -0.5294 42  ILE A CD1 
263  N  N   . ASN A 51  ? 2.1187 2.5262 1.1962 -0.1050 0.1172  -0.5650 43  ASN A N   
264  C  CA  . ASN A 51  ? 2.1138 2.5168 1.1973 -0.0993 0.1350  -0.5782 43  ASN A CA  
265  C  C   . ASN A 51  ? 2.1000 2.5087 1.1785 -0.0873 0.1344  -0.5344 43  ASN A C   
266  O  O   . ASN A 51  ? 2.0830 2.5213 1.1399 -0.0870 0.1198  -0.5009 43  ASN A O   
267  C  CB  . ASN A 51  ? 2.0629 2.5229 1.1247 -0.1099 0.1453  -0.6174 43  ASN A CB  
268  C  CG  . ASN A 51  ? 2.0790 2.5416 1.1522 -0.1030 0.1645  -0.6418 43  ASN A CG  
269  O  OD1 . ASN A 51  ? 2.0901 2.5108 1.1894 -0.0994 0.1707  -0.6765 43  ASN A OD1 
270  N  ND2 . ASN A 51  ? 2.0835 2.5974 1.1377 -0.1019 0.1715  -0.6243 43  ASN A ND2 
271  N  N   . ALA A 52  ? 1.9842 2.3628 1.0830 -0.0779 0.1475  -0.5342 44  ALA A N   
272  C  CA  . ALA A 52  ? 1.9690 2.3490 1.0640 -0.0687 0.1469  -0.4917 44  ALA A CA  
273  C  C   . ALA A 52  ? 1.9831 2.3809 1.0853 -0.0656 0.1671  -0.5090 44  ALA A C   
274  O  O   . ALA A 52  ? 2.0041 2.4076 1.1189 -0.0667 0.1807  -0.5570 44  ALA A O   
275  C  CB  . ALA A 52  ? 1.9344 2.2480 1.0535 -0.0571 0.1372  -0.4583 44  ALA A CB  
276  N  N   . SER A 53  ? 1.9550 2.3636 1.0500 -0.0616 0.1672  -0.4709 45  SER A N   
277  C  CA  . SER A 53  ? 1.9658 2.4007 1.0682 -0.0592 0.1862  -0.4829 45  SER A CA  
278  C  C   . SER A 53  ? 1.9647 2.3357 1.1116 -0.0442 0.1963  -0.5024 45  SER A C   
279  O  O   . SER A 53  ? 1.9541 2.2564 1.1215 -0.0378 0.1863  -0.4890 45  SER A O   
280  C  CB  . SER A 53  ? 1.9604 2.4208 1.0408 -0.0629 0.1799  -0.4304 45  SER A CB  
281  O  OG  . SER A 53  ? 1.9610 2.3545 1.0583 -0.0510 0.1679  -0.3885 45  SER A OG  
282  N  N   . PRO A 54  ? 1.9651 2.3620 1.1280 -0.0391 0.2148  -0.5359 46  PRO A N   
283  C  CA  . PRO A 54  ? 1.9581 2.2964 1.1655 -0.0234 0.2218  -0.5561 46  PRO A CA  
284  C  C   . PRO A 54  ? 1.9232 2.1989 1.1471 -0.0150 0.2141  -0.5061 46  PRO A C   
285  O  O   . PRO A 54  ? 1.9196 2.1234 1.1764 -0.0064 0.2101  -0.5123 46  PRO A O   
286  C  CB  . PRO A 54  ? 1.9806 2.3830 1.1950 -0.0190 0.2416  -0.5894 46  PRO A CB  
287  C  CG  . PRO A 54  ? 2.0092 2.4943 1.1877 -0.0342 0.2463  -0.6128 46  PRO A CG  
288  C  CD  . PRO A 54  ? 1.9961 2.4841 1.1370 -0.0484 0.2292  -0.5636 46  PRO A CD  
289  N  N   . GLY A 55  ? 1.9441 2.2454 1.1438 -0.0193 0.2095  -0.4564 47  GLY A N   
290  C  CA  . GLY A 55  ? 1.9300 2.1754 1.1416 -0.0117 0.2009  -0.4077 47  GLY A CA  
291  C  C   . GLY A 55  ? 1.9614 2.1417 1.1785 -0.0100 0.1832  -0.3881 47  GLY A C   
292  O  O   . GLY A 55  ? 1.9466 2.0654 1.1850 -0.0021 0.1778  -0.3631 47  GLY A O   
293  N  N   . VAL A 56  ? 1.9297 2.1290 1.1276 -0.0184 0.1743  -0.4007 48  VAL A N   
294  C  CA  . VAL A 56  ? 1.9214 2.0749 1.1237 -0.0187 0.1581  -0.3878 48  VAL A CA  
295  C  C   . VAL A 56  ? 1.9927 2.1089 1.2193 -0.0225 0.1612  -0.4301 48  VAL A C   
296  O  O   . VAL A 56  ? 2.0171 2.1627 1.2400 -0.0287 0.1684  -0.4728 48  VAL A O   
297  C  CB  . VAL A 56  ? 1.9353 2.1325 1.1038 -0.0260 0.1426  -0.3742 48  VAL A CB  
298  C  CG1 . VAL A 56  ? 1.9254 2.0866 1.1024 -0.0256 0.1271  -0.3684 48  VAL A CG1 
299  C  CG2 . VAL A 56  ? 1.9178 2.1418 1.0606 -0.0246 0.1318  -0.3277 48  VAL A CG2 
300  N  N   . VAL A 57  ? 1.9637 2.0151 1.2136 -0.0209 0.1537  -0.4177 49  VAL A N   
301  C  CA  . VAL A 57  ? 2.0128 2.0212 1.2838 -0.0296 0.1515  -0.4508 49  VAL A CA  
302  C  C   . VAL A 57  ? 2.0483 2.0465 1.3124 -0.0410 0.1368  -0.4416 49  VAL A C   
303  O  O   . VAL A 57  ? 2.0072 1.9900 1.2716 -0.0370 0.1279  -0.4057 49  VAL A O   
304  C  CB  . VAL A 57  ? 2.0634 2.0037 1.3696 -0.0239 0.1537  -0.4486 49  VAL A CB  
305  C  CG1 . VAL A 57  ? 2.1186 2.0089 1.4435 -0.0374 0.1452  -0.4788 49  VAL A CG1 
306  C  CG2 . VAL A 57  ? 2.0766 2.0342 1.3942 -0.0110 0.1683  -0.4632 49  VAL A CG2 
307  N  N   . VAL A 58  ? 2.0944 2.1046 1.3529 -0.0555 0.1336  -0.4761 50  VAL A N   
308  C  CA  . VAL A 58  ? 2.0931 2.1071 1.3443 -0.0692 0.1205  -0.4724 50  VAL A CA  
309  C  C   . VAL A 58  ? 2.1728 2.1317 1.4443 -0.0874 0.1137  -0.4894 50  VAL A C   
310  O  O   . VAL A 58  ? 2.2253 2.1654 1.5038 -0.0963 0.1146  -0.5244 50  VAL A O   
311  C  CB  . VAL A 58  ? 2.1251 2.2029 1.3493 -0.0772 0.1184  -0.4939 50  VAL A CB  
312  C  CG1 . VAL A 58  ? 2.1080 2.1990 1.3267 -0.0897 0.1046  -0.4889 50  VAL A CG1 
313  C  CG2 . VAL A 58  ? 2.0912 2.2235 1.2920 -0.0641 0.1218  -0.4762 50  VAL A CG2 
314  N  N   . ASP A 59  ? 2.1424 2.0763 1.4226 -0.0943 0.1045  -0.4647 51  ASP A N   
315  C  CA  . ASP A 59  ? 2.1860 2.0738 1.4803 -0.1186 0.0948  -0.4748 51  ASP A CA  
316  C  C   . ASP A 59  ? 2.1852 2.1099 1.4674 -0.1364 0.0846  -0.4728 51  ASP A C   
317  O  O   . ASP A 59  ? 2.1428 2.0668 1.4307 -0.1369 0.0794  -0.4474 51  ASP A O   
318  C  CB  . ASP A 59  ? 2.2020 2.0262 1.5204 -0.1165 0.0931  -0.4493 51  ASP A CB  
319  C  CG  . ASP A 59  ? 2.3533 2.1340 1.6903 -0.1043 0.0999  -0.4597 51  ASP A CG  
320  O  OD1 . ASP A 59  ? 2.4243 2.2117 1.7599 -0.1046 0.1023  -0.4954 51  ASP A OD1 
321  O  OD2 . ASP A 59  ? 2.3798 2.1219 1.7340 -0.0936 0.1021  -0.4344 51  ASP A OD2 
322  N  N   . ILE A 60  ? 2.1637 2.1249 1.4300 -0.1508 0.0816  -0.5017 52  ILE A N   
323  C  CA  . ILE A 60  ? 2.1474 2.1555 1.4020 -0.1679 0.0724  -0.5040 52  ILE A CA  
324  C  C   . ILE A 60  ? 2.2149 2.1926 1.4751 -0.2048 0.0613  -0.5180 52  ILE A C   
325  O  O   . ILE A 60  ? 2.2710 2.2059 1.5342 -0.2192 0.0578  -0.5402 52  ILE A O   
326  C  CB  . ILE A 60  ? 2.1705 2.2448 1.4015 -0.1642 0.0738  -0.5242 52  ILE A CB  
327  C  CG1 . ILE A 60  ? 2.1761 2.3058 1.3981 -0.1785 0.0635  -0.5260 52  ILE A CG1 
328  C  CG2 . ILE A 60  ? 2.2283 2.2886 1.4528 -0.1763 0.0765  -0.5608 52  ILE A CG2 
329  C  CD1 . ILE A 60  ? 2.2375 2.4341 1.4372 -0.1732 0.0626  -0.5411 52  ILE A CD1 
330  N  N   . ALA A 61  ? 2.2075 2.2086 1.4692 -0.2210 0.0536  -0.5053 53  ALA A N   
331  C  CA  . ALA A 61  ? 2.2502 2.2310 1.5137 -0.2625 0.0413  -0.5134 53  ALA A CA  
332  C  C   . ALA A 61  ? 2.2360 2.2889 1.4910 -0.2799 0.0351  -0.5142 53  ALA A C   
333  O  O   . ALA A 61  ? 2.1676 2.2720 1.4237 -0.2560 0.0385  -0.5023 53  ALA A O   
334  C  CB  . ALA A 61  ? 2.2599 2.1722 1.5426 -0.2720 0.0374  -0.4919 53  ALA A CB  
335  N  N   . SER A 74  ? 2.5857 2.7836 1.6765 -0.3206 0.0318  -0.8290 66  SER A N   
336  C  CA  . SER A 74  ? 2.5270 2.6914 1.6421 -0.2983 0.0399  -0.7988 66  SER A CA  
337  C  C   . SER A 74  ? 2.5032 2.7293 1.6145 -0.2784 0.0519  -0.7631 66  SER A C   
338  O  O   . SER A 74  ? 2.4906 2.7027 1.6166 -0.2537 0.0617  -0.7389 66  SER A O   
339  C  CB  . SER A 74  ? 2.5395 2.6662 1.6690 -0.2722 0.0494  -0.8189 66  SER A CB  
340  O  OG  . SER A 74  ? 2.5499 2.6432 1.7029 -0.2521 0.0565  -0.7889 66  SER A OG  
341  N  N   . THR A 75  ? 2.5934 2.8859 1.6854 -0.2890 0.0485  -0.7604 67  THR A N   
342  C  CA  . THR A 75  ? 2.5451 2.8948 1.6346 -0.2704 0.0530  -0.7289 67  THR A CA  
343  C  C   . THR A 75  ? 2.5783 2.9348 1.6792 -0.2850 0.0426  -0.7068 67  THR A C   
344  O  O   . THR A 75  ? 2.6151 2.9664 1.7136 -0.3174 0.0314  -0.7192 67  THR A O   
345  C  CB  . THR A 75  ? 2.5528 2.9785 1.6159 -0.2682 0.0539  -0.7396 67  THR A CB  
346  O  OG1 . THR A 75  ? 2.5069 2.9812 1.5697 -0.2496 0.0519  -0.7083 67  THR A OG1 
347  C  CG2 . THR A 75  ? 2.5232 2.9732 1.5717 -0.3010 0.0422  -0.7640 67  THR A CG2 
348  N  N   . TRP A 76  ? 2.5134 2.8839 1.6262 -0.2623 0.0451  -0.6749 68  TRP A N   
349  C  CA  . TRP A 76  ? 2.4989 2.8738 1.6274 -0.2717 0.0372  -0.6552 68  TRP A CA  
350  C  C   . TRP A 76  ? 2.5066 2.9641 1.6280 -0.2737 0.0284  -0.6538 68  TRP A C   
351  O  O   . TRP A 76  ? 2.4871 2.9923 1.5947 -0.2563 0.0281  -0.6550 68  TRP A O   
352  C  CB  . TRP A 76  ? 2.4439 2.7842 1.5921 -0.2449 0.0428  -0.6242 68  TRP A CB  
353  C  CG  . TRP A 76  ? 2.4731 2.7421 1.6295 -0.2372 0.0519  -0.6261 68  TRP A CG  
354  C  CD1 . TRP A 76  ? 2.4738 2.7330 1.6296 -0.2086 0.0628  -0.6179 68  TRP A CD1 
355  C  CD2 . TRP A 76  ? 2.5238 2.7242 1.6908 -0.2592 0.0485  -0.6384 68  TRP A CD2 
356  N  NE1 . TRP A 76  ? 2.5031 2.6970 1.6717 -0.2087 0.0685  -0.6269 68  TRP A NE1 
357  C  CE2 . TRP A 76  ? 2.5599 2.7127 1.7362 -0.2382 0.0583  -0.6396 68  TRP A CE2 
358  C  CE3 . TRP A 76  ? 2.5764 2.7517 1.7456 -0.2965 0.0356  -0.6476 68  TRP A CE3 
359  C  CZ2 . TRP A 76  ? 2.6084 2.6869 1.7995 -0.2489 0.0542  -0.6520 68  TRP A CZ2 
360  C  CZ3 . TRP A 76  ? 2.6416 2.7379 1.8220 -0.3105 0.0295  -0.6563 68  TRP A CZ3 
361  C  CH2 . TRP A 76  ? 2.6569 2.7041 1.8496 -0.2847 0.0381  -0.6595 68  TRP A CH2 
362  N  N   . PRO A 77  ? 2.4688 2.9467 1.5998 -0.2964 0.0198  -0.6518 69  PRO A N   
363  C  CA  . PRO A 77  ? 2.4644 3.0270 1.5915 -0.3029 0.0102  -0.6582 69  PRO A CA  
364  C  C   . PRO A 77  ? 2.4321 3.0396 1.5755 -0.2705 0.0052  -0.6378 69  PRO A C   
365  O  O   . PRO A 77  ? 2.4310 3.1086 1.5794 -0.2755 -0.0046 -0.6445 69  PRO A O   
366  C  CB  . PRO A 77  ? 2.5168 3.0814 1.6469 -0.3475 0.0032  -0.6679 69  PRO A CB  
367  C  CG  . PRO A 77  ? 2.5699 3.0426 1.7075 -0.3611 0.0065  -0.6608 69  PRO A CG  
368  C  CD  . PRO A 77  ? 2.4976 2.9245 1.6430 -0.3210 0.0174  -0.6453 69  PRO A CD  
369  N  N   . LEU A 78  ? 2.4461 3.0151 1.5982 -0.2380 0.0099  -0.6149 70  LEU A N   
370  C  CA  . LEU A 78  ? 2.3941 2.9958 1.5598 -0.2034 0.0009  -0.5951 70  LEU A CA  
371  C  C   . LEU A 78  ? 2.4048 3.0425 1.5928 -0.2091 -0.0068 -0.5944 70  LEU A C   
372  O  O   . LEU A 78  ? 2.3764 3.0702 1.5755 -0.1858 -0.0199 -0.5923 70  LEU A O   
373  C  CB  . LEU A 78  ? 2.0235 2.6859 1.1750 -0.1858 -0.0102 -0.5999 70  LEU A CB  
374  N  N   . ASP A 79  ? 2.3260 2.9337 1.5211 -0.2405 -0.0008 -0.5975 71  ASP A N   
375  C  CA  . ASP A 79  ? 2.2930 2.9348 1.5084 -0.2503 -0.0057 -0.5961 71  ASP A CA  
376  C  C   . ASP A 79  ? 2.2487 2.8582 1.4830 -0.2160 -0.0058 -0.5713 71  ASP A C   
377  O  O   . ASP A 79  ? 2.2354 2.7732 1.4670 -0.2025 0.0020  -0.5534 71  ASP A O   
378  C  CB  . ASP A 79  ? 2.3464 2.9609 1.5591 -0.3003 -0.0018 -0.6027 71  ASP A CB  
379  C  CG  . ASP A 79  ? 2.3957 3.0563 1.6263 -0.3178 -0.0061 -0.6024 71  ASP A CG  
380  O  OD1 . ASP A 79  ? 2.4023 3.1456 1.6330 -0.3378 -0.0127 -0.6212 71  ASP A OD1 
381  O  OD2 . ASP A 79  ? 2.4079 3.0266 1.6525 -0.3126 -0.0026 -0.5842 71  ASP A OD2 
382  N  N   . PRO A 80  ? 2.2873 2.9527 1.5417 -0.2009 -0.0154 -0.5722 72  PRO A N   
383  C  CA  . PRO A 80  ? 2.2286 2.8648 1.5014 -0.1684 -0.0182 -0.5505 72  PRO A CA  
384  C  C   . PRO A 80  ? 2.2353 2.7947 1.5124 -0.1866 -0.0059 -0.5332 72  PRO A C   
385  O  O   . PRO A 80  ? 2.2011 2.7101 1.4861 -0.1601 -0.0048 -0.5103 72  PRO A O   
386  C  CB  . PRO A 80  ? 2.2092 2.9307 1.5041 -0.1605 -0.0305 -0.5658 72  PRO A CB  
387  C  CG  . PRO A 80  ? 2.2775 3.0760 1.5647 -0.1686 -0.0384 -0.5909 72  PRO A CG  
388  C  CD  . PRO A 80  ? 2.3005 3.0652 1.5624 -0.2084 -0.0262 -0.5961 72  PRO A CD  
389  N  N   . GLY A 81  ? 2.2700 2.8187 1.5411 -0.2329 0.0006  -0.5426 73  GLY A N   
390  C  CA  . GLY A 81  ? 2.2697 2.7478 1.5455 -0.2552 0.0079  -0.5268 73  GLY A CA  
391  C  C   . GLY A 81  ? 2.3129 2.6980 1.5802 -0.2487 0.0163  -0.5127 73  GLY A C   
392  O  O   . GLY A 81  ? 2.3127 2.6325 1.5867 -0.2610 0.0205  -0.4975 73  GLY A O   
393  N  N   . VAL A 82  ? 2.2969 2.6794 1.5502 -0.2299 0.0183  -0.5188 74  VAL A N   
394  C  CA  . VAL A 82  ? 2.3116 2.6190 1.5581 -0.2226 0.0272  -0.5111 74  VAL A CA  
395  C  C   . VAL A 82  ? 2.2764 2.5454 1.5335 -0.1852 0.0306  -0.4834 74  VAL A C   
396  O  O   . VAL A 82  ? 2.2294 2.5351 1.4910 -0.1557 0.0236  -0.4731 74  VAL A O   
397  C  CB  . VAL A 82  ? 2.0476 2.3735 1.2737 -0.2179 0.0291  -0.5294 74  VAL A CB  
398  C  CG1 . VAL A 82  ? 2.0329 2.4040 1.2540 -0.1801 0.0247  -0.5215 74  VAL A CG1 
399  C  CG2 . VAL A 82  ? 2.0720 2.3273 1.2931 -0.2202 0.0384  -0.5321 74  VAL A CG2 
400  N  N   . GLU A 83  ? 2.1595 2.3536 1.4216 -0.1870 0.0387  -0.4715 75  GLU A N   
401  C  CA  . GLU A 83  ? 2.1108 2.2650 1.3821 -0.1557 0.0424  -0.4438 75  GLU A CA  
402  C  C   . GLU A 83  ? 2.1335 2.2535 1.3957 -0.1400 0.0515  -0.4423 75  GLU A C   
403  O  O   . GLU A 83  ? 2.1707 2.2419 1.4352 -0.1544 0.0583  -0.4516 75  GLU A O   
404  C  CB  . GLU A 83  ? 2.1155 2.2151 1.4044 -0.1688 0.0439  -0.4271 75  GLU A CB  
405  C  CG  . GLU A 83  ? 2.1485 2.2856 1.4488 -0.1745 0.0362  -0.4215 75  GLU A CG  
406  C  CD  . GLU A 83  ? 2.2923 2.3746 1.6085 -0.1782 0.0381  -0.3982 75  GLU A CD  
407  O  OE1 . GLU A 83  ? 2.3327 2.3986 1.6534 -0.2147 0.0365  -0.4009 75  GLU A OE1 
408  O  OE2 . GLU A 83  ? 2.1927 2.2479 1.5151 -0.1469 0.0394  -0.3756 75  GLU A OE2 
409  N  N   . VAL A 84  ? 2.0174 2.1652 1.2696 -0.1111 0.0495  -0.4314 76  VAL A N   
410  C  CA  . VAL A 84  ? 2.0242 2.1527 1.2661 -0.0969 0.0586  -0.4277 76  VAL A CA  
411  C  C   . VAL A 84  ? 2.0251 2.1078 1.2776 -0.0763 0.0615  -0.3958 76  VAL A C   
412  O  O   . VAL A 84  ? 1.9860 2.0824 1.2372 -0.0550 0.0517  -0.3718 76  VAL A O   
413  C  CB  . VAL A 84  ? 2.0443 2.2310 1.2641 -0.0834 0.0529  -0.4312 76  VAL A CB  
414  C  CG1 . VAL A 84  ? 2.0519 2.2274 1.2590 -0.0742 0.0635  -0.4288 76  VAL A CG1 
415  C  CG2 . VAL A 84  ? 2.0745 2.3094 1.2837 -0.1037 0.0493  -0.4621 76  VAL A CG2 
416  N  N   . THR A 85  ? 2.0135 2.0407 1.2772 -0.0824 0.0726  -0.3963 77  THR A N   
417  C  CA  . THR A 85  ? 1.9860 1.9678 1.2614 -0.0658 0.0764  -0.3668 77  THR A CA  
418  C  C   . THR A 85  ? 2.0234 2.0048 1.2896 -0.0524 0.0867  -0.3651 77  THR A C   
419  O  O   . THR A 85  ? 2.0602 2.0484 1.3219 -0.0611 0.0954  -0.3934 77  THR A O   
420  C  CB  . THR A 85  ? 2.0489 1.9679 1.3468 -0.0815 0.0796  -0.3653 77  THR A CB  
421  O  OG1 . THR A 85  ? 2.0491 1.9784 1.3518 -0.1030 0.0711  -0.3727 77  THR A OG1 
422  C  CG2 . THR A 85  ? 1.9989 1.8763 1.3095 -0.0646 0.0808  -0.3310 77  THR A CG2 
423  N  N   . LEU A 86  ? 1.9578 1.9344 1.2209 -0.0326 0.0846  -0.3330 78  LEU A N   
424  C  CA  . LEU A 86  ? 1.9620 1.9470 1.2149 -0.0229 0.0941  -0.3275 78  LEU A CA  
425  C  C   . LEU A 86  ? 1.9762 1.9104 1.2465 -0.0144 0.1012  -0.3046 78  LEU A C   
426  O  O   . LEU A 86  ? 1.9409 1.8421 1.2220 -0.0083 0.0936  -0.2772 78  LEU A O   
427  C  CB  . LEU A 86  ? 1.9419 1.9752 1.1684 -0.0113 0.0825  -0.3071 78  LEU A CB  
428  C  CG  . LEU A 86  ? 1.9841 2.0757 1.1896 -0.0182 0.0757  -0.3289 78  LEU A CG  
429  C  CD1 . LEU A 86  ? 1.9778 2.1091 1.1565 -0.0082 0.0618  -0.3041 78  LEU A CD1 
430  C  CD2 . LEU A 86  ? 2.0358 2.1426 1.2387 -0.0332 0.0917  -0.3692 78  LEU A CD2 
431  N  N   . THR A 87  ? 1.9218 1.8541 1.1958 -0.0136 0.1156  -0.3182 79  THR A N   
432  C  CA  . THR A 87  ? 1.9155 1.8079 1.2070 -0.0050 0.1233  -0.2994 79  THR A CA  
433  C  C   . THR A 87  ? 1.9451 1.8769 1.2250 0.0009  0.1351  -0.3030 79  THR A C   
434  O  O   . THR A 87  ? 1.9677 1.9330 1.2432 -0.0042 0.1446  -0.3394 79  THR A O   
435  C  CB  . THR A 87  ? 1.9922 1.8276 1.3146 -0.0129 0.1286  -0.3198 79  THR A CB  
436  O  OG1 . THR A 87  ? 1.9878 1.7981 1.3164 -0.0259 0.1176  -0.3203 79  THR A OG1 
437  C  CG2 . THR A 87  ? 1.9730 1.7639 1.3158 -0.0031 0.1333  -0.2952 79  THR A CG2 
438  N  N   . MET A 88  ? 1.9030 1.8344 1.1770 0.0100  0.1338  -0.2660 80  MET A N   
439  C  CA  . MET A 88  ? 1.9059 1.8832 1.1663 0.0115  0.1444  -0.2649 80  MET A CA  
440  C  C   . MET A 88  ? 1.9389 1.8880 1.2266 0.0178  0.1581  -0.2655 80  MET A C   
441  O  O   . MET A 88  ? 1.9248 1.8188 1.2311 0.0232  0.1538  -0.2402 80  MET A O   
442  C  CB  . MET A 88  ? 1.9013 1.9080 1.1300 0.0128  0.1299  -0.2214 80  MET A CB  
443  C  CG  . MET A 88  ? 1.9297 1.9716 1.1318 0.0084  0.1137  -0.2226 80  MET A CG  
444  S  SD  . MET A 88  ? 1.9660 2.0427 1.1285 0.0078  0.0906  -0.1737 80  MET A SD  
445  C  CE  . MET A 88  ? 1.9584 2.0955 1.1045 -0.0048 0.1103  -0.1815 80  MET A CE  
446  N  N   . LYS A 89  ? 1.8756 1.8666 1.1665 0.0175  0.1741  -0.2965 81  LYS A N   
447  C  CA  . LYS A 89  ? 1.8939 1.8664 1.2162 0.0257  0.1872  -0.3081 81  LYS A CA  
448  C  C   . LYS A 89  ? 1.9033 1.8779 1.2212 0.0294  0.1876  -0.2625 81  LYS A C   
449  O  O   . LYS A 89  ? 1.9052 1.8265 1.2496 0.0365  0.1874  -0.2464 81  LYS A O   
450  C  CB  . LYS A 89  ? 1.9444 1.9731 1.2719 0.0264  0.2035  -0.3594 81  LYS A CB  
451  N  N   . VAL A 90  ? 1.9133 1.9488 1.1965 0.0221  0.1862  -0.2400 82  VAL A N   
452  C  CA  . VAL A 90  ? 1.9021 1.9461 1.1764 0.0210  0.1846  -0.1958 82  VAL A CA  
453  C  C   . VAL A 90  ? 1.9026 1.9764 1.1321 0.0101  0.1661  -0.1515 82  VAL A C   
454  O  O   . VAL A 90  ? 1.8896 1.9844 1.0955 0.0047  0.1554  -0.1575 82  VAL A O   
455  C  CB  . VAL A 90  ? 1.8071 1.9104 1.0918 0.0202  0.2056  -0.2192 82  VAL A CB  
456  N  N   . ALA A 91  ? 1.8703 1.9437 1.0883 0.0063  0.1595  -0.1062 83  ALA A N   
457  C  CA  . ALA A 91  ? 1.8629 1.9550 1.0381 -0.0053 0.1356  -0.0583 83  ALA A CA  
458  C  C   . ALA A 91  ? 1.9087 2.0891 1.0485 -0.0239 0.1383  -0.0698 83  ALA A C   
459  O  O   . ALA A 91  ? 1.9214 2.1608 1.0681 -0.0298 0.1621  -0.1040 83  ALA A O   
460  C  CB  . ALA A 91  ? 1.8636 1.9348 1.0347 -0.0084 0.1276  -0.0086 83  ALA A CB  
461  N  N   . SER A 92  ? 1.8793 2.0699 0.9820 -0.0329 0.1121  -0.0424 84  SER A N   
462  C  CA  . SER A 92  ? 1.9052 2.1769 0.9689 -0.0544 0.1093  -0.0462 84  SER A CA  
463  C  C   . SER A 92  ? 1.9343 2.2580 0.9705 -0.0770 0.1080  -0.0111 84  SER A C   
464  O  O   . SER A 92  ? 1.9335 2.2192 0.9643 -0.0784 0.0916  0.0367  84  SER A O   
465  C  CB  . SER A 92  ? 1.9186 2.1795 0.9526 -0.0567 0.0763  -0.0249 84  SER A CB  
466  O  OG  . SER A 92  ? 1.9449 2.1787 1.0006 -0.0409 0.0798  -0.0623 84  SER A OG  
467  N  N   . GLY A 93  ? 1.8640 2.2779 0.8816 -0.0967 0.1248  -0.0357 85  GLY A N   
468  C  CA  . GLY A 93  ? 1.8921 2.3734 0.8773 -0.1254 0.1232  -0.0040 85  GLY A CA  
469  C  C   . GLY A 93  ? 1.9297 2.4366 0.8593 -0.1516 0.0883  0.0392  85  GLY A C   
470  O  O   . GLY A 93  ? 1.9568 2.4931 0.8515 -0.1785 0.0714  0.0869  85  GLY A O   
471  N  N   . SER A 94  ? 1.9913 2.4867 0.9125 -0.1452 0.0751  0.0232  86  SER A N   
472  C  CA  . SER A 94  ? 2.0284 2.5391 0.9007 -0.1662 0.0370  0.0613  86  SER A CA  
473  C  C   . SER A 94  ? 2.0342 2.4718 0.9168 -0.1414 0.0108  0.0631  86  SER A C   
474  O  O   . SER A 94  ? 2.0074 2.4023 0.9308 -0.1138 0.0282  0.0258  86  SER A O   
475  C  CB  . SER A 94  ? 2.0622 2.6735 0.9038 -0.1935 0.0491  0.0337  86  SER A CB  
476  O  OG  . SER A 94  ? 2.1424 2.8335 0.9770 -0.2162 0.0757  0.0253  86  SER A OG  
477  N  N   . THR A 95  ? 2.0305 2.4561 0.8766 -0.1523 -0.0333 0.1060  87  THR A N   
478  C  CA  . THR A 95  ? 2.0206 2.3863 0.8770 -0.1278 -0.0618 0.1069  87  THR A CA  
479  C  C   . THR A 95  ? 2.0199 2.4246 0.8797 -0.1248 -0.0486 0.0572  87  THR A C   
480  O  O   . THR A 95  ? 2.0551 2.5255 0.8800 -0.1499 -0.0540 0.0552  87  THR A O   
481  C  CB  . THR A 95  ? 2.0720 2.4107 0.8906 -0.1377 -0.1188 0.1661  87  THR A CB  
482  O  OG1 . THR A 95  ? 2.0694 2.3508 0.8913 -0.1333 -0.1354 0.2104  87  THR A OG1 
483  C  CG2 . THR A 95  ? 2.0762 2.3736 0.9057 -0.1124 -0.1480 0.1568  87  THR A CG2 
484  N  N   . GLY A 96  ? 1.9374 2.3026 0.8380 -0.0968 -0.0323 0.0185  88  GLY A N   
485  C  CA  . GLY A 96  ? 1.9346 2.3300 0.8417 -0.0934 -0.0198 -0.0295 88  GLY A CA  
486  C  C   . GLY A 96  ? 1.9411 2.4047 0.8478 -0.1089 0.0200  -0.0744 88  GLY A C   
487  O  O   . GLY A 96  ? 1.9629 2.4814 0.8498 -0.1224 0.0224  -0.0989 88  GLY A O   
488  N  N   . ASP A 97  ? 1.9654 2.4266 0.8955 -0.1059 0.0500  -0.0873 89  ASP A N   
489  C  CA  . ASP A 97  ? 1.9734 2.4998 0.9088 -0.1164 0.0869  -0.1349 89  ASP A CA  
490  C  C   . ASP A 97  ? 1.9517 2.4576 0.9241 -0.0977 0.1099  -0.1942 89  ASP A C   
491  O  O   . ASP A 97  ? 1.9598 2.5107 0.9421 -0.1014 0.1380  -0.2420 89  ASP A O   
492  C  CB  . ASP A 97  ? 1.9683 2.5073 0.9154 -0.1203 0.1070  -0.1264 89  ASP A CB  
493  C  CG  . ASP A 97  ? 2.0042 2.4582 0.9919 -0.0951 0.1095  -0.1153 89  ASP A CG  
494  O  OD1 . ASP A 97  ? 2.0067 2.3965 1.0163 -0.0751 0.1005  -0.1220 89  ASP A OD1 
495  O  OD2 . ASP A 97  ? 2.0450 2.5010 1.0423 -0.0972 0.1207  -0.1004 89  ASP A OD2 
496  N  N   . GLN A 98  ? 1.9424 2.3820 0.9347 -0.0788 0.0957  -0.1918 90  GLN A N   
497  C  CA  . GLN A 98  ? 1.9264 2.3437 0.9487 -0.0663 0.1112  -0.2420 90  GLN A CA  
498  C  C   . GLN A 98  ? 1.9320 2.3523 0.9397 -0.0668 0.0899  -0.2449 90  GLN A C   
499  O  O   . GLN A 98  ? 1.9304 2.3286 0.9255 -0.0625 0.0600  -0.2058 90  GLN A O   
500  C  CB  . GLN A 98  ? 1.8910 2.2302 0.9558 -0.0460 0.1177  -0.2428 90  GLN A CB  
501  C  CG  . GLN A 98  ? 1.8835 2.2141 0.9676 -0.0429 0.1368  -0.2393 90  GLN A CG  
502  C  CD  . GLN A 98  ? 1.9939 2.3620 1.0954 -0.0445 0.1664  -0.2945 90  GLN A CD  
503  O  OE1 . GLN A 98  ? 1.9646 2.3730 1.0570 -0.0513 0.1730  -0.3336 90  GLN A OE1 
504  N  NE2 . GLN A 98  ? 1.9240 2.2787 1.0522 -0.0369 0.1828  -0.2997 90  GLN A NE2 
505  N  N   . LYS A 99  ? 1.9363 2.3842 0.9470 -0.0711 0.1034  -0.2927 91  LYS A N   
506  C  CA  . LYS A 99  ? 1.9454 2.4102 0.9401 -0.0747 0.0851  -0.2992 91  LYS A CA  
507  C  C   . LYS A 99  ? 1.9265 2.3559 0.9508 -0.0652 0.0919  -0.3365 91  LYS A C   
508  O  O   . LYS A 99  ? 1.9194 2.3272 0.9698 -0.0620 0.1143  -0.3707 91  LYS A O   
509  C  CB  . LYS A 99  ? 1.9826 2.5271 0.9422 -0.0963 0.0895  -0.3176 91  LYS A CB  
510  C  CG  . LYS A 99  ? 2.0078 2.5994 0.9340 -0.1137 0.0844  -0.2834 91  LYS A CG  
511  C  CD  . LYS A 99  ? 2.0449 2.7222 0.9389 -0.1379 0.0949  -0.3098 91  LYS A CD  
512  N  N   . VAL A 100 ? 1.9273 2.3521 0.9473 -0.0618 0.0700  -0.3295 92  VAL A N   
513  C  CA  . VAL A 100 ? 1.9147 2.3206 0.9560 -0.0592 0.0736  -0.3636 92  VAL A CA  
514  C  C   . VAL A 100 ? 1.9327 2.3861 0.9515 -0.0679 0.0578  -0.3741 92  VAL A C   
515  O  O   . VAL A 100 ? 1.9343 2.3973 0.9398 -0.0626 0.0304  -0.3438 92  VAL A O   
516  C  CB  . VAL A 100 ? 1.8809 2.2263 0.9513 -0.0436 0.0633  -0.3461 92  VAL A CB  
517  C  CG1 . VAL A 100 ? 1.8725 2.2125 0.9585 -0.0470 0.0628  -0.3775 92  VAL A CG1 
518  C  CG2 . VAL A 100 ? 1.8633 2.1577 0.9588 -0.0367 0.0801  -0.3404 92  VAL A CG2 
519  N  N   . GLN A 101 ? 1.9628 2.4446 0.9782 -0.0805 0.0725  -0.4177 93  GLN A N   
520  C  CA  . GLN A 101 ? 1.9811 2.5105 0.9753 -0.0907 0.0593  -0.4307 93  GLN A CA  
521  C  C   . GLN A 101 ? 2.0116 2.5218 1.0272 -0.0896 0.0559  -0.4542 93  GLN A C   
522  O  O   . GLN A 101 ? 2.0069 2.4912 1.0414 -0.0948 0.0732  -0.4864 93  GLN A O   
523  C  CB  . GLN A 101 ? 2.0153 2.5991 0.9855 -0.1089 0.0755  -0.4632 93  GLN A CB  
524  C  CG  . GLN A 101 ? 2.1486 2.7869 1.0914 -0.1216 0.0601  -0.4710 93  GLN A CG  
525  C  CD  . GLN A 101 ? 2.3114 3.0047 1.2304 -0.1408 0.0772  -0.5069 93  GLN A CD  
526  O  OE1 . GLN A 101 ? 2.2813 2.9664 1.2127 -0.1424 0.1017  -0.5416 93  GLN A OE1 
527  N  NE2 . GLN A 101 ? 2.2757 3.0257 1.1610 -0.1548 0.0625  -0.5001 93  GLN A NE2 
528  N  N   . ILE A 102 ? 2.0405 2.5653 1.0533 -0.0838 0.0311  -0.4381 94  ILE A N   
529  C  CA  . ILE A 102 ? 2.0523 2.5739 1.0835 -0.0853 0.0261  -0.4592 94  ILE A CA  
530  C  C   . ILE A 102 ? 2.1241 2.7047 1.1338 -0.0977 0.0157  -0.4780 94  ILE A C   
531  O  O   . ILE A 102 ? 2.1370 2.7504 1.1310 -0.0918 -0.0083 -0.4565 94  ILE A O   
532  C  CB  . ILE A 102 ? 2.0567 2.5535 1.1094 -0.0663 0.0060  -0.4327 94  ILE A CB  
533  C  CG1 . ILE A 102 ? 2.0328 2.4705 1.1050 -0.0546 0.0150  -0.4110 94  ILE A CG1 
534  C  CG2 . ILE A 102 ? 2.0632 2.5681 1.1350 -0.0719 0.0033  -0.4575 94  ILE A CG2 
535  C  CD1 . ILE A 102 ? 2.0991 2.5290 1.1579 -0.0413 0.0007  -0.3690 94  ILE A CD1 
536  N  N   . SER A 103 ? 2.1340 2.7253 1.1431 -0.1153 0.0309  -0.5178 95  SER A N   
537  C  CA  . SER A 103 ? 2.1643 2.8113 1.1523 -0.1298 0.0233  -0.5388 95  SER A CA  
538  C  C   . SER A 103 ? 2.2051 2.8593 1.2100 -0.1352 0.0148  -0.5560 95  SER A C   
539  O  O   . SER A 103 ? 2.1975 2.8153 1.2237 -0.1418 0.0257  -0.5722 95  SER A O   
540  C  CB  . SER A 103 ? 2.2066 2.8694 1.1769 -0.1482 0.0443  -0.5740 95  SER A CB  
541  O  OG  . SER A 103 ? 2.2687 2.8847 1.2606 -0.1534 0.0624  -0.6013 95  SER A OG  
542  N  N   . TYR A 104 ? 2.1833 2.8875 1.1784 -0.1343 -0.0065 -0.5520 96  TYR A N   
543  C  CA  . TYR A 104 ? 2.1952 2.9222 1.2056 -0.1401 -0.0160 -0.5690 96  TYR A CA  
544  C  C   . TYR A 104 ? 2.2381 3.0060 1.2316 -0.1640 -0.0125 -0.6002 96  TYR A C   
545  O  O   . TYR A 104 ? 2.2465 3.0375 1.2197 -0.1691 -0.0128 -0.5982 96  TYR A O   
546  C  CB  . TYR A 104 ? 2.2089 2.9646 1.2291 -0.1185 -0.0455 -0.5453 96  TYR A CB  
547  C  CG  . TYR A 104 ? 2.2005 2.9130 1.2406 -0.0936 -0.0527 -0.5140 96  TYR A CG  
548  C  CD1 . TYR A 104 ? 2.1929 2.8719 1.2626 -0.0903 -0.0447 -0.5172 96  TYR A CD1 
549  C  CD2 . TYR A 104 ? 2.2081 2.9131 1.2354 -0.0763 -0.0695 -0.4799 96  TYR A CD2 
550  C  CE1 . TYR A 104 ? 2.1731 2.8126 1.2603 -0.0679 -0.0513 -0.4895 96  TYR A CE1 
551  C  CE2 . TYR A 104 ? 2.1914 2.8538 1.2356 -0.0542 -0.0781 -0.4509 96  TYR A CE2 
552  C  CZ  . TYR A 104 ? 2.2294 2.8594 1.3042 -0.0489 -0.0681 -0.4570 96  TYR A CZ  
553  O  OH  . TYR A 104 ? 2.2331 2.8210 1.3242 -0.0273 -0.0766 -0.4293 96  TYR A OH  
554  N  N   . TYR A 105 ? 2.1761 2.9420 1.1901 -0.1786 -0.0100 -0.6192 97  TYR A N   
555  C  CA  . TYR A 105 ? 2.1996 2.9888 1.2129 -0.2001 -0.0084 -0.6391 97  TYR A CA  
556  C  C   . TYR A 105 ? 2.2276 3.0524 1.2618 -0.2064 -0.0225 -0.6430 97  TYR A C   
557  O  O   . TYR A 105 ? 2.2192 3.0265 1.2719 -0.2173 -0.0184 -0.6517 97  TYR A O   
558  C  CB  . TYR A 105 ? 2.2234 2.9678 1.2365 -0.2200 0.0115  -0.6649 97  TYR A CB  
559  C  CG  . TYR A 105 ? 2.2244 2.9358 1.2242 -0.2120 0.0273  -0.6660 97  TYR A CG  
560  C  CD1 . TYR A 105 ? 2.2440 2.9788 1.2242 -0.2118 0.0318  -0.6673 97  TYR A CD1 
561  C  CD2 . TYR A 105 ? 2.2165 2.8777 1.2244 -0.2058 0.0379  -0.6662 97  TYR A CD2 
562  C  CE1 . TYR A 105 ? 2.2388 2.9534 1.2097 -0.2053 0.0471  -0.6698 97  TYR A CE1 
563  C  CE2 . TYR A 105 ? 2.2146 2.8514 1.2137 -0.1977 0.0528  -0.6689 97  TYR A CE2 
564  C  CZ  . TYR A 105 ? 2.2722 2.9385 1.2536 -0.1972 0.0577  -0.6711 97  TYR A CZ  
565  O  OH  . TYR A 105 ? 2.2682 2.9198 1.2436 -0.1898 0.0734  -0.6750 97  TYR A OH  
566  N  N   . PRO A 111 ? 2.1826 3.1107 1.0969 -0.2031 -0.0382 -0.5955 103 PRO A N   
567  C  CA  . PRO A 111 ? 2.1520 3.0388 1.0753 -0.1873 -0.0321 -0.5862 103 PRO A CA  
568  C  C   . PRO A 111 ? 2.1585 3.0517 1.0612 -0.1720 -0.0503 -0.5507 103 PRO A C   
569  O  O   . PRO A 111 ? 2.1780 3.0990 1.0544 -0.1794 -0.0589 -0.5349 103 PRO A O   
570  C  CB  . PRO A 111 ? 2.1613 3.0126 1.0857 -0.1972 -0.0017 -0.6087 103 PRO A CB  
571  C  CG  . PRO A 111 ? 2.1963 3.0618 1.1233 -0.2173 0.0065  -0.6381 103 PRO A CG  
572  C  CD  . PRO A 111 ? 2.1989 3.1133 1.1214 -0.2215 -0.0158 -0.6290 103 PRO A CD  
573  N  N   . VAL A 112 ? 2.1293 2.9971 1.0428 -0.1528 -0.0581 -0.5373 104 VAL A N   
574  C  CA  . VAL A 112 ? 2.1239 2.9809 1.0276 -0.1359 -0.0785 -0.4968 104 VAL A CA  
575  C  C   . VAL A 112 ? 2.1115 2.9093 1.0326 -0.1253 -0.0599 -0.4844 104 VAL A C   
576  O  O   . VAL A 112 ? 2.0847 2.8475 1.0355 -0.1189 -0.0470 -0.4977 104 VAL A O   
577  C  CB  . VAL A 112 ? 2.1648 3.0310 1.0863 -0.1135 -0.1156 -0.4766 104 VAL A CB  
578  N  N   . LYS A 113 ? 2.0816 2.8711 0.9831 -0.1259 -0.0596 -0.4577 105 LYS A N   
579  C  CA  . LYS A 113 ? 2.0632 2.8019 0.9787 -0.1178 -0.0409 -0.4459 105 LYS A CA  
580  C  C   . LYS A 113 ? 2.0494 2.7543 0.9743 -0.0959 -0.0663 -0.4007 105 LYS A C   
581  O  O   . LYS A 113 ? 2.0707 2.7945 0.9771 -0.0924 -0.0985 -0.3710 105 LYS A O   
582  C  CB  . LYS A 113 ? 2.0882 2.8443 0.9777 -0.1353 -0.0188 -0.4515 105 LYS A CB  
583  N  N   . ALA A 114 ? 2.0483 2.7002 1.0017 -0.0820 -0.0542 -0.3957 106 ALA A N   
584  C  CA  . ALA A 114 ? 2.0350 2.6477 0.9988 -0.0611 -0.0754 -0.3551 106 ALA A CA  
585  C  C   . ALA A 114 ? 2.0299 2.6065 0.9926 -0.0631 -0.0546 -0.3392 106 ALA A C   
586  O  O   . ALA A 114 ? 2.0164 2.5739 0.9939 -0.0688 -0.0229 -0.3647 106 ALA A O   
587  C  CB  . ALA A 114 ? 2.0015 2.5872 1.0023 -0.0410 -0.0838 -0.3610 106 ALA A CB  
588  N  N   . LEU A 115 ? 1.9594 2.5262 0.9048 -0.0592 -0.0751 -0.2968 107 LEU A N   
589  C  CA  . LEU A 115 ? 1.9589 2.5025 0.8991 -0.0640 -0.0573 -0.2787 107 LEU A CA  
590  C  C   . LEU A 115 ? 1.9312 2.4127 0.8967 -0.0429 -0.0649 -0.2512 107 LEU A C   
591  O  O   . LEU A 115 ? 1.9213 2.3816 0.9003 -0.0239 -0.0932 -0.2359 107 LEU A O   
592  C  CB  . LEU A 115 ? 1.9987 2.5791 0.8967 -0.0821 -0.0728 -0.2480 107 LEU A CB  
593  C  CG  . LEU A 115 ? 2.0250 2.6656 0.8968 -0.1088 -0.0484 -0.2764 107 LEU A CG  
594  C  CD1 . LEU A 115 ? 2.0686 2.7539 0.8949 -0.1304 -0.0717 -0.2425 107 LEU A CD1 
595  C  CD2 . LEU A 115 ? 2.0115 2.6428 0.8979 -0.1124 -0.0075 -0.3004 107 LEU A CD2 
596  N  N   . LEU A 116 ? 1.9247 2.3800 0.8976 -0.0456 -0.0398 -0.2474 108 LEU A N   
597  C  CA  . LEU A 116 ? 1.8994 2.2951 0.8947 -0.0285 -0.0434 -0.2212 108 LEU A CA  
598  C  C   . LEU A 116 ? 1.9050 2.2923 0.8911 -0.0376 -0.0260 -0.2026 108 LEU A C   
599  O  O   . LEU A 116 ? 1.8979 2.2890 0.8952 -0.0448 0.0076  -0.2311 108 LEU A O   
600  C  CB  . LEU A 116 ? 1.8632 2.2225 0.8976 -0.0174 -0.0252 -0.2499 108 LEU A CB  
601  C  CG  . LEU A 116 ? 1.8352 2.1329 0.8949 -0.0018 -0.0246 -0.2275 108 LEU A CG  
602  C  CD1 . LEU A 116 ? 1.8353 2.1134 0.8940 0.0169  -0.0631 -0.1918 108 LEU A CD1 
603  C  CD2 . LEU A 116 ? 1.8057 2.0739 0.8995 0.0006  -0.0038 -0.2583 108 LEU A CD2 
604  N  N   . TYR A 117 ? 1.9112 2.2879 0.8777 -0.0375 -0.0512 -0.1556 109 TYR A N   
605  C  CA  . TYR A 117 ? 1.9181 2.2928 0.8741 -0.0484 -0.0375 -0.1333 109 TYR A CA  
606  C  C   . TYR A 117 ? 1.8878 2.1956 0.8720 -0.0305 -0.0362 -0.1128 109 TYR A C   
607  O  O   . TYR A 117 ? 1.8840 2.1522 0.8717 -0.0152 -0.0673 -0.0820 109 TYR A O   
608  C  CB  . TYR A 117 ? 1.9601 2.3670 0.8720 -0.0668 -0.0668 -0.0907 109 TYR A CB  
609  C  CG  . TYR A 117 ? 1.9937 2.4727 0.8735 -0.0901 -0.0654 -0.1089 109 TYR A CG  
610  C  CD1 . TYR A 117 ? 2.0082 2.5428 0.8728 -0.1128 -0.0339 -0.1295 109 TYR A CD1 
611  C  CD2 . TYR A 117 ? 2.0120 2.5071 0.8781 -0.0888 -0.0960 -0.1077 109 TYR A CD2 
612  C  CE1 . TYR A 117 ? 2.0404 2.6441 0.8745 -0.1354 -0.0321 -0.1477 109 TYR A CE1 
613  C  CE2 . TYR A 117 ? 2.0438 2.6048 0.8794 -0.1117 -0.0954 -0.1232 109 TYR A CE2 
614  C  CZ  . TYR A 117 ? 2.0586 2.6734 0.8770 -0.1358 -0.0629 -0.1428 109 TYR A CZ  
615  O  OH  . TYR A 117 ? 2.1006 2.7841 0.8875 -0.1599 -0.0617 -0.1597 109 TYR A OH  
616  N  N   . LEU A 118 ? 1.8847 2.1802 0.8902 -0.0315 -0.0017 -0.1317 110 LEU A N   
617  C  CA  . LEU A 118 ? 1.8543 2.0863 0.8894 -0.0160 0.0035  -0.1173 110 LEU A CA  
618  C  C   . LEU A 118 ? 1.8611 2.0903 0.8873 -0.0243 0.0106  -0.0870 110 LEU A C   
619  O  O   . LEU A 118 ? 1.8801 2.1602 0.8905 -0.0418 0.0290  -0.0972 110 LEU A O   
620  C  CB  . LEU A 118 ? 1.8263 2.0351 0.8985 -0.0095 0.0331  -0.1612 110 LEU A CB  
621  C  CG  . LEU A 118 ? 1.8170 2.0274 0.9011 -0.0043 0.0280  -0.1916 110 LEU A CG  
622  C  CD1 . LEU A 118 ? 1.7991 1.9877 0.9142 -0.0055 0.0555  -0.2327 110 LEU A CD1 
623  C  CD2 . LEU A 118 ? 1.8025 1.9787 0.8948 0.0127  -0.0016 -0.1666 110 LEU A CD2 
624  N  N   . THR A 119 ? 1.8882 2.0617 0.9250 -0.0122 -0.0039 -0.0513 111 THR A N   
625  C  CA  . THR A 119 ? 1.8917 2.0565 0.9231 -0.0196 0.0020  -0.0201 111 THR A CA  
626  C  C   . THR A 119 ? 1.8554 1.9575 0.9255 -0.0034 0.0167  -0.0212 111 THR A C   
627  O  O   . THR A 119 ? 1.8382 1.8869 0.9221 0.0129  -0.0020 -0.0055 111 THR A O   
628  C  CB  . THR A 119 ? 1.9200 2.0771 0.9171 -0.0263 -0.0379 0.0368  111 THR A CB  
629  O  OG1 . THR A 119 ? 1.9569 2.1680 0.9174 -0.0427 -0.0570 0.0401  111 THR A OG1 
630  C  CG2 . THR A 119 ? 1.9283 2.0891 0.9150 -0.0406 -0.0305 0.0689  111 THR A CG2 
631  N  N   . GLY A 120 ? 1.8776 1.9885 0.9660 -0.0078 0.0490  -0.0416 112 GLY A N   
632  C  CA  . GLY A 120 ? 1.8539 1.9066 0.9794 0.0051  0.0631  -0.0438 112 GLY A CA  
633  C  C   . GLY A 120 ? 1.8848 1.9102 1.0052 0.0043  0.0538  0.0038  112 GLY A C   
634  O  O   . GLY A 120 ? 1.9029 1.9697 1.0054 -0.0105 0.0603  0.0182  112 GLY A O   
635  N  N   . VAL A 121 ? 1.8847 1.8647 1.0402 0.0505  0.0454  -0.0894 113 VAL A N   
636  C  CA  . VAL A 121 ? 1.8273 1.8358 1.0230 0.0587  0.0638  -0.0487 113 VAL A CA  
637  C  C   . VAL A 121 ? 1.8401 1.7726 1.0582 0.0610  0.0658  -0.0553 113 VAL A C   
638  O  O   . VAL A 121 ? 1.8505 1.7042 1.0649 0.0455  0.0525  -0.0755 113 VAL A O   
639  C  CB  . VAL A 121 ? 1.8265 1.8719 1.0595 0.0353  0.0658  0.0047  113 VAL A CB  
640  C  CG1 . VAL A 121 ? 1.8478 1.9729 1.0548 0.0385  0.0655  0.0180  113 VAL A CG1 
641  C  CG2 . VAL A 121 ? 1.7979 1.7848 1.0543 0.0080  0.0503  0.0077  113 VAL A CG2 
642  N  N   . GLU A 122 ? 1.8511 1.8136 1.0912 0.0785  0.0825  -0.0375 114 GLU A N   
643  C  CA  . GLU A 122 ? 1.8273 1.7320 1.0905 0.0847  0.0852  -0.0402 114 GLU A CA  
644  C  C   . GLU A 122 ? 1.7562 1.6798 1.0751 0.0628  0.0938  0.0073  114 GLU A C   
645  O  O   . GLU A 122 ? 1.7296 1.7257 1.0651 0.0635  0.1086  0.0359  114 GLU A O   
646  C  CB  . GLU A 122 ? 1.8734 1.7976 1.1136 0.1282  0.0955  -0.0664 114 GLU A CB  
647  C  CG  . GLU A 122 ? 1.9725 1.8564 1.2379 0.1406  0.0998  -0.0645 114 GLU A CG  
648  C  CD  . GLU A 122 ? 2.1961 2.1164 1.4391 0.1908  0.1099  -0.0893 114 GLU A CD  
649  O  OE1 . GLU A 122 ? 2.2813 2.2295 1.4784 0.2194  0.1102  -0.1188 114 GLU A OE1 
650  O  OE2 . GLU A 122 ? 2.0760 2.0029 1.3461 0.2045  0.1172  -0.0806 114 GLU A OE2 
651  N  N   . ILE A 123 ? 1.7339 1.5917 1.0782 0.0411  0.0846  0.0152  115 ILE A N   
652  C  CA  . ILE A 123 ? 1.6696 1.5318 1.0626 0.0221  0.0905  0.0549  115 ILE A CA  
653  C  C   . ILE A 123 ? 1.6932 1.4905 1.1060 0.0240  0.0878  0.0457  115 ILE A C   
654  O  O   . ILE A 123 ? 1.6873 1.4246 1.1063 0.0070  0.0759  0.0418  115 ILE A O   
655  C  CB  . ILE A 123 ? 1.6554 1.5137 1.0635 -0.0059 0.0814  0.0822  115 ILE A CB  
656  C  CG1 . ILE A 123 ? 1.6835 1.5970 1.0624 -0.0049 0.0796  0.0865  115 ILE A CG1 
657  C  CG2 . ILE A 123 ? 1.6029 1.4677 1.0514 -0.0213 0.0888  0.1237  115 ILE A CG2 
658  C  CD1 . ILE A 123 ? 1.7152 1.7011 1.0933 -0.0002 0.0959  0.1163  115 ILE A CD1 
659  N  N   . SER A 124 ? 1.6665 1.4841 1.0887 0.0452  0.0990  0.0429  116 SER A N   
660  C  CA  . SER A 124 ? 1.6582 1.4199 1.0946 0.0531  0.0965  0.0340  116 SER A CA  
661  C  C   . SER A 124 ? 1.6459 1.4425 1.1300 0.0426  0.1062  0.0640  116 SER A C   
662  O  O   . SER A 124 ? 1.6375 1.5093 1.1328 0.0490  0.1196  0.0755  116 SER A O   
663  C  CB  . SER A 124 ? 1.7421 1.4858 1.1406 0.0951  0.0974  -0.0030 116 SER A CB  
664  O  OG  . SER A 124 ? 1.8166 1.6497 1.2158 0.1203  0.1119  -0.0022 116 SER A OG  
665  N  N   . LEU A 125 ? 1.6315 1.3772 1.1423 0.0239  0.0994  0.0756  117 LEU A N   
666  C  CA  . LEU A 125 ? 1.5889 1.3550 1.1418 0.0126  0.1059  0.0988  117 LEU A CA  
667  C  C   . LEU A 125 ? 1.6388 1.3779 1.1940 0.0369  0.1051  0.0800  117 LEU A C   
668  O  O   . LEU A 125 ? 1.6479 1.3141 1.1870 0.0426  0.0949  0.0641  117 LEU A O   
669  C  CB  . LEU A 125 ? 1.5362 1.2679 1.1146 -0.0189 0.0985  0.1232  117 LEU A CB  
670  C  CG  . LEU A 125 ? 1.5276 1.2791 1.1444 -0.0382 0.1043  0.1504  117 LEU A CG  
671  C  CD1 . LEU A 125 ? 1.5337 1.3563 1.1530 -0.0484 0.1176  0.1708  117 LEU A CD1 
672  C  CD2 . LEU A 125 ? 1.5167 1.2232 1.1483 -0.0601 0.0946  0.1686  117 LEU A CD2 
673  N  N   . CYS A 126 ? 1.6506 1.4524 1.2236 0.0505  0.1159  0.0829  118 CYS A N   
674  C  CA  . CYS A 126 ? 1.6789 1.4700 1.2473 0.0848  0.1153  0.0629  118 CYS A CA  
675  C  C   . CYS A 126 ? 1.6485 1.4717 1.2612 0.0733  0.1189  0.0790  118 CYS A C   
676  O  O   . CYS A 126 ? 1.6197 1.5075 1.2633 0.0464  0.1275  0.1009  118 CYS A O   
677  C  CB  . CYS A 126 ? 1.7406 1.5903 1.2811 0.1268  0.1233  0.0407  118 CYS A CB  
678  S  SG  . CYS A 126 ? 1.8149 1.6570 1.3057 0.1360  0.1218  0.0229  118 CYS A SG  
679  N  N   . ALA A 127 ? 1.6530 1.4279 1.2643 0.0919  0.1119  0.0679  119 ALA A N   
680  C  CA  . ALA A 127 ? 1.6209 1.4268 1.2701 0.0864  0.1134  0.0777  119 ALA A CA  
681  C  C   . ALA A 127 ? 1.6764 1.4535 1.3060 0.1311  0.1084  0.0573  119 ALA A C   
682  O  O   . ALA A 127 ? 1.7190 1.4296 1.3025 0.1603  0.1025  0.0382  119 ALA A O   
683  C  CB  . ALA A 127 ? 1.5655 1.3267 1.2424 0.0456  0.1071  0.0981  119 ALA A CB  
684  N  N   . ASP A 128 ? 1.5436 1.3666 1.2034 0.1362  0.1098  0.0612  120 ASP A N   
685  C  CA  . ASP A 128 ? 1.5732 1.3754 1.2131 0.1832  0.1045  0.0449  120 ASP A CA  
686  C  C   . ASP A 128 ? 1.5918 1.2835 1.2158 0.1763  0.0931  0.0476  120 ASP A C   
687  O  O   . ASP A 128 ? 1.5660 1.2578 1.2143 0.1689  0.0895  0.0558  120 ASP A O   
688  C  CB  . ASP A 128 ? 1.5651 1.4679 1.2444 0.1900  0.1091  0.0477  120 ASP A CB  
689  C  CG  . ASP A 128 ? 1.6355 1.5307 1.2909 0.2479  0.1035  0.0311  120 ASP A CG  
690  O  OD1 . ASP A 128 ? 1.6792 1.5071 1.2805 0.2920  0.0992  0.0145  120 ASP A OD1 
691  O  OD2 . ASP A 128 ? 1.6538 1.6069 1.3405 0.2499  0.1026  0.0343  120 ASP A OD2 
692  N  N   . ILE A 129 ? 1.6624 1.2651 1.2442 0.1764  0.0876  0.0400  121 ILE A N   
693  C  CA  . ILE A 129 ? 1.6385 1.1417 1.2032 0.1613  0.0781  0.0440  121 ILE A CA  
694  C  C   . ILE A 129 ? 1.7328 1.1716 1.2522 0.2059  0.0722  0.0315  121 ILE A C   
695  O  O   . ILE A 129 ? 1.7227 1.0870 1.2279 0.1955  0.0655  0.0379  121 ILE A O   
696  C  CB  . ILE A 129 ? 1.6546 1.0947 1.1932 0.1338  0.0740  0.0414  121 ILE A CB  
697  C  CG1 . ILE A 129 ? 1.7353 1.1287 1.2129 0.1679  0.0722  0.0169  121 ILE A CG1 
698  C  CG2 . ILE A 129 ? 1.6113 1.1122 1.1862 0.0975  0.0790  0.0552  121 ILE A CG2 
699  C  CD1 . ILE A 129 ? 1.8206 1.1531 1.2686 0.1387  0.0665  0.0102  121 ILE A CD1 
700  N  N   . THR A 130 ? 1.7106 1.1797 1.2042 0.2577  0.0749  0.0148  122 THR A N   
701  C  CA  . THR A 130 ? 1.7703 1.1742 1.2113 0.3108  0.0686  0.0028  122 THR A CA  
702  C  C   . THR A 130 ? 1.7964 1.2674 1.2678 0.3361  0.0691  0.0096  122 THR A C   
703  O  O   . THR A 130 ? 1.8367 1.2603 1.2676 0.3827  0.0632  0.0042  122 THR A O   
704  C  CB  . THR A 130 ? 1.8994 1.2933 1.2856 0.3656  0.0693  -0.0230 122 THR A CB  
705  O  OG1 . THR A 130 ? 1.8862 1.4152 1.3106 0.3773  0.0795  -0.0272 122 THR A OG1 
706  C  CG2 . THR A 130 ? 1.9131 1.2144 1.2534 0.3444  0.0653  -0.0343 122 THR A CG2 
707  N  N   . ARG A 131 ? 1.7100 1.2882 1.2483 0.3046  0.0753  0.0215  123 ARG A N   
708  C  CA  . ARG A 131 ? 1.6978 1.3542 1.2733 0.3166  0.0752  0.0269  123 ARG A CA  
709  C  C   . ARG A 131 ? 1.7736 1.4881 1.3254 0.3868  0.0756  0.0099  123 ARG A C   
710  O  O   . ARG A 131 ? 1.7716 1.4841 1.3123 0.4229  0.0696  0.0095  123 ARG A O   
711  C  CB  . ARG A 131 ? 1.6710 1.2537 1.2421 0.3047  0.0669  0.0391  123 ARG A CB  
712  C  CG  . ARG A 131 ? 1.6276 1.1459 1.2114 0.2455  0.0653  0.0531  123 ARG A CG  
713  C  CD  . ARG A 131 ? 1.6010 1.0363 1.1635 0.2421  0.0577  0.0626  123 ARG A CD  
714  N  NE  . ARG A 131 ? 1.5503 0.9314 1.1208 0.1902  0.0561  0.0737  123 ARG A NE  
715  C  CZ  . ARG A 131 ? 1.6398 0.9433 1.1863 0.1777  0.0509  0.0824  123 ARG A CZ  
716  N  NH1 . ARG A 131 ? 1.5560 0.8150 1.0644 0.2127  0.0468  0.0837  123 ARG A NH1 
717  N  NH2 . ARG A 131 ? 1.5288 0.8036 1.0868 0.1314  0.0500  0.0909  123 ARG A NH2 
718  N  N   . THR A 132 ? 1.6681 1.4405 1.2107 0.4094  0.0826  -0.0043 124 THR A N   
719  C  CA  . THR A 132 ? 1.6952 1.5351 1.2132 0.4828  0.0834  -0.0234 124 THR A CA  
720  C  C   . THR A 132 ? 1.6897 1.7033 1.2629 0.4743  0.0949  -0.0257 124 THR A C   
721  O  O   . THR A 132 ? 1.6845 1.7952 1.2540 0.5303  0.0967  -0.0403 124 THR A O   
722  C  CB  . THR A 132 ? 1.8279 1.5817 1.2701 0.5334  0.0807  -0.0445 124 THR A CB  
723  O  OG1 . THR A 132 ? 1.8270 1.6002 1.2778 0.4989  0.0885  -0.0475 124 THR A OG1 
724  C  CG2 . THR A 132 ? 1.8676 1.4446 1.2484 0.5364  0.0693  -0.0420 124 THR A CG2 
725  N  N   . GLY A 133 ? 1.6674 1.7216 1.2888 0.4041  0.1027  -0.0103 125 GLY A N   
726  C  CA  . GLY A 133 ? 1.6331 1.8435 1.3050 0.3809  0.1147  -0.0075 125 GLY A CA  
727  C  C   . GLY A 133 ? 1.6961 1.9349 1.3561 0.3726  0.1250  -0.0113 125 GLY A C   
728  O  O   . GLY A 133 ? 1.6588 2.0124 1.3583 0.3367  0.1367  -0.0026 125 GLY A O   
729  N  N   . LYS A 134 ? 1.7062 1.8390 1.3082 0.4032  0.1204  -0.0241 126 LYS A N   
730  C  CA  . LYS A 134 ? 1.7244 1.8743 1.3068 0.4004  0.1283  -0.0309 126 LYS A CA  
731  C  C   . LYS A 134 ? 1.7814 1.8190 1.3540 0.3483  0.1245  -0.0181 126 LYS A C   
732  O  O   . LYS A 134 ? 1.7943 1.7089 1.3451 0.3420  0.1135  -0.0161 126 LYS A O   
733  C  CB  . LYS A 134 ? 1.7976 1.9276 1.3154 0.4817  0.1256  -0.0620 126 LYS A CB  
734  N  N   . VAL A 135 ? 1.7149 1.8025 1.3024 0.3114  0.1339  -0.0086 127 VAL A N   
735  C  CA  . VAL A 135 ? 1.7227 1.7269 1.3055 0.2624  0.1306  0.0052  127 VAL A CA  
736  C  C   . VAL A 135 ? 1.8464 1.7501 1.3659 0.2915  0.1229  -0.0172 127 VAL A C   
737  O  O   . VAL A 135 ? 1.8659 1.8040 1.3512 0.3309  0.1270  -0.0381 127 VAL A O   
738  C  CB  . VAL A 135 ? 1.7113 1.8022 1.3255 0.2154  0.1429  0.0256  127 VAL A CB  
739  C  CG1 . VAL A 135 ? 1.7001 1.7092 1.3058 0.1729  0.1379  0.0396  127 VAL A CG1 
740  C  CG2 . VAL A 135 ? 1.6662 1.8431 1.3376 0.1770  0.1496  0.0476  127 VAL A CG2 
741  N  N   . LYS A 136 ? 1.9283 1.7111 1.4307 0.2703  0.1115  -0.0140 128 LYS A N   
742  C  CA  . LYS A 136 ? 2.0006 1.6777 1.4420 0.2851  0.1026  -0.0349 128 LYS A CA  
743  C  C   . LYS A 136 ? 2.0384 1.6750 1.4875 0.2292  0.0991  -0.0216 128 LYS A C   
744  O  O   . LYS A 136 ? 1.9771 1.6077 1.4664 0.1859  0.0976  0.0023  128 LYS A O   
745  C  CB  . LYS A 136 ? 2.0651 1.6289 1.4666 0.3126  0.0910  -0.0461 128 LYS A CB  
746  N  N   . PRO A 137 ? 2.1786 1.7907 1.5866 0.2336  0.0970  -0.0392 129 PRO A N   
747  C  CA  . PRO A 137 ? 2.1561 1.7454 1.5679 0.1860  0.0930  -0.0293 129 PRO A CA  
748  C  C   . PRO A 137 ? 2.1848 1.6677 1.5857 0.1564  0.0803  -0.0274 129 PRO A C   
749  O  O   . PRO A 137 ? 2.1990 1.6130 1.5820 0.1722  0.0748  -0.0338 129 PRO A O   
750  C  CB  . PRO A 137 ? 2.2264 1.8185 1.5879 0.2093  0.0927  -0.0564 129 PRO A CB  
751  C  CG  . PRO A 137 ? 2.3249 1.8777 1.6383 0.2685  0.0904  -0.0863 129 PRO A CG  
752  C  CD  . PRO A 137 ? 2.2592 1.8704 1.6121 0.2884  0.0975  -0.0719 129 PRO A CD  
753  N  N   . THR A 138 ? 2.2261 1.7027 1.6363 0.1143  0.0760  -0.0175 130 THR A N   
754  C  CA  . THR A 138 ? 2.2098 1.6059 1.6124 0.0812  0.0648  -0.0158 130 THR A CA  
755  C  C   . THR A 138 ? 2.3017 1.6375 1.6488 0.0745  0.0554  -0.0427 130 THR A C   
756  O  O   . THR A 138 ? 2.3411 1.5824 1.6477 0.0715  0.0467  -0.0585 130 THR A O   
757  C  CB  . THR A 138 ? 2.1626 1.5980 1.6161 0.0388  0.0645  0.0136  130 THR A CB  
758  O  OG1 . THR A 138 ? 2.1504 1.6492 1.6095 0.0292  0.0679  0.0199  130 THR A OG1 
759  C  CG2 . THR A 138 ? 2.0693 1.5439 1.5718 0.0395  0.0713  0.0371  130 THR A CG2 
760  N  N   . ALA A 140 ? 2.5768 1.4955 1.7410 0.1854  0.0352  -0.0801 132 ALA A N   
761  C  CA  . ALA A 140 ? 2.4952 1.5266 1.7293 0.1492  0.0413  -0.0642 132 ALA A CA  
762  C  C   . ALA A 140 ? 2.4949 1.4996 1.7392 0.0847  0.0351  -0.0557 132 ALA A C   
763  O  O   . ALA A 140 ? 2.3990 1.4729 1.7037 0.0528  0.0382  -0.0327 132 ALA A O   
764  C  CB  . ALA A 140 ? 2.5232 1.6222 1.7520 0.1717  0.0460  -0.0817 132 ALA A CB  
765  N  N   . VAL A 141 ? 2.6396 1.5445 1.8218 0.0662  0.0256  -0.0754 133 VAL A N   
766  C  CA  . VAL A 141 ? 2.6212 1.5109 1.8086 0.0030  0.0190  -0.0718 133 VAL A CA  
767  C  C   . VAL A 141 ? 2.6087 1.4626 1.8118 -0.0292 0.0176  -0.0492 133 VAL A C   
768  O  O   . VAL A 141 ? 2.5702 1.4462 1.7976 -0.0806 0.0144  -0.0395 133 VAL A O   
769  C  CB  . VAL A 141 ? 2.7541 1.5516 1.8662 -0.0137 0.0087  -0.1036 133 VAL A CB  
770  N  N   . LYS A 142 ? 2.6061 1.4131 1.7945 0.0036  0.0200  -0.0412 134 LYS A N   
771  C  CA  . LYS A 142 ? 2.5741 1.3442 1.7699 -0.0220 0.0193  -0.0196 134 LYS A CA  
772  C  C   . LYS A 142 ? 2.4707 1.3475 1.7493 -0.0308 0.0257  0.0068  134 LYS A C   
773  O  O   . LYS A 142 ? 2.4292 1.3040 1.7269 -0.0630 0.0251  0.0243  134 LYS A O   
774  C  CB  . LYS A 142 ? 2.6452 1.3211 1.7867 0.0207  0.0184  -0.0201 134 LYS A CB  
775  N  N   . ASP A 143 ? 2.4344 1.4025 1.7581 -0.0033 0.0318  0.0089  135 ASP A N   
776  C  CA  . ASP A 143 ? 2.3340 1.3928 1.7292 -0.0096 0.0371  0.0315  135 ASP A CA  
777  C  C   . ASP A 143 ? 2.2965 1.3936 1.7256 -0.0583 0.0342  0.0422  135 ASP A C   
778  O  O   . ASP A 143 ? 2.2656 1.3796 1.7256 -0.0760 0.0342  0.0590  135 ASP A O   
779  C  CB  . ASP A 143 ? 2.3197 1.4624 1.7479 0.0210  0.0442  0.0311  135 ASP A CB  
780  N  N   . GLN A 144 ? 2.2290 1.3460 1.6506 -0.0757 0.0313  0.0313  136 GLN A N   
781  C  CA  . GLN A 144 ? 2.1793 1.3404 1.6273 -0.1165 0.0270  0.0385  136 GLN A CA  
782  C  C   . GLN A 144 ? 2.0933 1.3329 1.6036 -0.1145 0.0307  0.0611  136 GLN A C   
783  O  O   . GLN A 144 ? 2.0647 1.3307 1.5995 -0.1398 0.0273  0.0717  136 GLN A O   
784  C  CB  . GLN A 144 ? 2.2159 1.3232 1.6394 -0.1559 0.0212  0.0374  136 GLN A CB  
785  C  CG  . GLN A 144 ? 2.2932 1.4371 1.7207 -0.1996 0.0143  0.0324  136 GLN A CG  
786  C  CD  . GLN A 144 ? 2.3720 1.5799 1.8475 -0.2218 0.0138  0.0517  136 GLN A CD  
787  O  OE1 . GLN A 144 ? 2.3398 1.5231 1.8153 -0.2361 0.0150  0.0612  136 GLN A OE1 
788  N  NE2 . GLN A 144 ? 2.2605 1.5512 1.7734 -0.2211 0.0120  0.0578  136 GLN A NE2 
789  N  N   . ARG A 145 ? 1.9357 1.2123 1.4680 -0.0846 0.0373  0.0671  137 ARG A N   
790  C  CA  . ARG A 145 ? 1.8588 1.1961 1.4420 -0.0830 0.0405  0.0871  137 ARG A CA  
791  C  C   . ARG A 145 ? 1.8125 1.1424 1.4190 -0.0915 0.0389  0.0988  137 ARG A C   
792  O  O   . ARG A 145 ? 1.7814 1.1487 1.4204 -0.1022 0.0369  0.1115  137 ARG A O   
793  C  CB  . ARG A 145 ? 1.8538 1.2398 1.4521 -0.0992 0.0373  0.0940  137 ARG A CB  
794  N  N   . THR A 146 ? 1.7943 1.0744 1.3798 -0.0830 0.0394  0.0943  138 THR A N   
795  C  CA  . THR A 146 ? 1.7425 1.0165 1.3449 -0.0887 0.0386  0.1050  138 THR A CA  
796  C  C   . THR A 146 ? 1.7223 0.9801 1.3216 -0.0582 0.0423  0.1053  138 THR A C   
797  O  O   . THR A 146 ? 1.7683 0.9796 1.3283 -0.0384 0.0431  0.0951  138 THR A O   
798  C  CB  . THR A 146 ? 1.7864 1.0161 1.3604 -0.1177 0.0342  0.1030  138 THR A CB  
799  O  OG1 . THR A 146 ? 1.7761 1.0434 1.3619 -0.1466 0.0299  0.1030  138 THR A OG1 
800  C  CG2 . THR A 146 ? 1.7438 0.9686 1.3298 -0.1198 0.0348  0.1147  138 THR A CG2 
801  N  N   . TRP A 147 ? 1.4663 0.7630 1.1038 -0.0521 0.0436  0.1156  139 TRP A N   
802  C  CA  . TRP A 147 ? 1.4485 0.7466 1.0884 -0.0240 0.0461  0.1154  139 TRP A CA  
803  C  C   . TRP A 147 ? 1.4810 0.7286 1.0943 -0.0221 0.0437  0.1186  139 TRP A C   
804  O  O   . TRP A 147 ? 1.4631 0.7089 1.0847 -0.0454 0.0414  0.1266  139 TRP A O   
805  C  CB  . TRP A 147 ? 1.3832 0.7412 1.0711 -0.0231 0.0473  0.1228  139 TRP A CB  
806  C  CG  . TRP A 147 ? 1.3899 0.7792 1.0860 0.0036  0.0509  0.1184  139 TRP A CG  
807  C  CD1 . TRP A 147 ? 1.4109 0.8457 1.1198 0.0104  0.0559  0.1155  139 TRP A CD1 
808  C  CD2 . TRP A 147 ? 1.4014 0.7894 1.0926 0.0274  0.0500  0.1167  139 TRP A CD2 
809  N  NE1 . TRP A 147 ? 1.4252 0.8949 1.1408 0.0354  0.0581  0.1106  139 TRP A NE1 
810  C  CE2 . TRP A 147 ? 1.4436 0.8847 1.1481 0.0486  0.0539  0.1108  139 TRP A CE2 
811  C  CE3 . TRP A 147 ? 1.4172 0.7703 1.0927 0.0327  0.0464  0.1207  139 TRP A CE3 
812  C  CZ2 . TRP A 147 ? 1.4616 0.9263 1.1660 0.0777  0.0530  0.1068  139 TRP A CZ2 
813  C  CZ3 . TRP A 147 ? 1.4487 0.8163 1.1205 0.0626  0.0457  0.1188  139 TRP A CZ3 
814  C  CH2 . TRP A 147 ? 1.4675 0.8924 1.1544 0.0863  0.0483  0.1109  139 TRP A CH2 
815  N  N   . THR A 148 ? 1.4837 0.6927 1.0619 0.0080  0.0444  0.1132  140 THR A N   
816  C  CA  . THR A 148 ? 1.5138 0.6616 1.0547 0.0126  0.0422  0.1192  140 THR A CA  
817  C  C   . THR A 148 ? 1.5607 0.7129 1.0930 0.0566  0.0424  0.1191  140 THR A C   
818  O  O   . THR A 148 ? 1.5813 0.7426 1.1017 0.0909  0.0437  0.1085  140 THR A O   
819  C  CB  . THR A 148 ? 1.6204 0.6776 1.0983 0.0026  0.0400  0.1132  140 THR A CB  
820  O  OG1 . THR A 148 ? 1.6387 0.6847 1.0944 0.0283  0.0406  0.0971  140 THR A OG1 
821  C  CG2 . THR A 148 ? 1.6108 0.6668 1.0944 -0.0477 0.0384  0.1155  140 THR A CG2 
822  N  N   . TRP A 149 ? 1.5041 0.6583 1.0417 0.0575  0.0410  0.1304  141 TRP A N   
823  C  CA  . TRP A 149 ? 1.5304 0.6948 1.0585 0.0998  0.0398  0.1315  141 TRP A CA  
824  C  C   . TRP A 149 ? 1.6443 0.7199 1.1001 0.1331  0.0379  0.1299  141 TRP A C   
825  O  O   . TRP A 149 ? 1.6838 0.6752 1.0926 0.1134  0.0371  0.1311  141 TRP A O   
826  C  CB  . TRP A 149 ? 1.4997 0.6846 1.0451 0.0909  0.0382  0.1442  141 TRP A CB  
827  C  CG  . TRP A 149 ? 1.4397 0.7044 1.0491 0.0677  0.0383  0.1431  141 TRP A CG  
828  C  CD1 . TRP A 149 ? 1.4235 0.6988 1.0563 0.0297  0.0387  0.1466  141 TRP A CD1 
829  C  CD2 . TRP A 149 ? 1.4116 0.7529 1.0644 0.0822  0.0371  0.1369  141 TRP A CD2 
830  N  NE1 . TRP A 149 ? 1.3744 0.7161 1.0575 0.0240  0.0373  0.1431  141 TRP A NE1 
831  C  CE2 . TRP A 149 ? 1.3907 0.7707 1.0867 0.0514  0.0363  0.1369  141 TRP A CE2 
832  C  CE3 . TRP A 149 ? 1.4401 0.8238 1.0976 0.1180  0.0358  0.1301  141 TRP A CE3 
833  C  CZ2 . TRP A 149 ? 1.3579 0.8023 1.0967 0.0510  0.0342  0.1303  141 TRP A CZ2 
834  C  CZ3 . TRP A 149 ? 1.4201 0.8828 1.1263 0.1133  0.0341  0.1233  141 TRP A CZ3 
835  C  CH2 . TRP A 149 ? 1.3754 0.8605 1.1195 0.0779  0.0332  0.1233  141 TRP A CH2 
836  N  N   . GLY A 150 ? 1.6416 0.7353 1.0852 0.1842  0.0363  0.1264  142 GLY A N   
837  C  CA  . GLY A 150 ? 1.7321 0.7357 1.0999 0.2269  0.0329  0.1265  142 GLY A CA  
838  C  C   . GLY A 150 ? 1.8089 0.8096 1.1511 0.2714  0.0327  0.1074  142 GLY A C   
839  O  O   . GLY A 150 ? 1.7780 0.8462 1.1610 0.2619  0.0366  0.0949  142 GLY A O   
840  N  N   . PRO A 151 ? 1.8630 0.7842 1.1327 0.3235  0.0282  0.1056  143 PRO A N   
841  C  CA  . PRO A 151 ? 1.9289 0.8344 1.1589 0.3778  0.0269  0.0854  143 PRO A CA  
842  C  C   . PRO A 151 ? 2.0267 0.8522 1.2199 0.3515  0.0272  0.0726  143 PRO A C   
843  O  O   . PRO A 151 ? 2.0427 0.8908 1.2275 0.3814  0.0283  0.0520  143 PRO A O   
844  C  CB  . PRO A 151 ? 2.0307 0.8503 1.1824 0.4392  0.0201  0.0915  143 PRO A CB  
845  C  CG  . PRO A 151 ? 2.0220 0.8564 1.1929 0.4209  0.0191  0.1153  143 PRO A CG  
846  C  CD  . PRO A 151 ? 1.9139 0.7602 1.1326 0.3402  0.0238  0.1242  143 PRO A CD  
847  N  N   . CYS A 152 ? 2.1909 0.9322 1.3625 0.2954  0.0262  0.0836  144 CYS A N   
848  C  CA  . CYS A 152 ? 2.2269 0.8953 1.3639 0.2619  0.0252  0.0706  144 CYS A CA  
849  C  C   . CYS A 152 ? 2.1461 0.8991 1.3559 0.2015  0.0300  0.0706  144 CYS A C   
850  O  O   . CYS A 152 ? 2.1595 0.8697 1.3514 0.1629  0.0288  0.0621  144 CYS A O   
851  C  CB  . CYS A 152 ? 2.2967 0.8642 1.3798 0.2268  0.0199  0.0775  144 CYS A CB  
852  S  SG  . CYS A 152 ? 2.4354 0.9189 1.4351 0.2879  0.0124  0.0723  144 CYS A SG  
853  N  N   . GLY A 153 ? 1.8892 0.7598 1.1768 0.1945  0.0344  0.0795  145 GLY A N   
854  C  CA  . GLY A 153 ? 1.8027 0.7503 1.1555 0.1450  0.0381  0.0818  145 GLY A CA  
855  C  C   . GLY A 153 ? 1.7986 0.8276 1.1852 0.1599  0.0422  0.0675  145 GLY A C   
856  O  O   . GLY A 153 ? 1.8416 0.8915 1.2130 0.2098  0.0433  0.0558  145 GLY A O   
857  N  N   . GLN A 154 ? 1.7148 0.7944 1.1449 0.1183  0.0447  0.0694  146 GLN A N   
858  C  CA  . GLN A 154 ? 1.6864 0.8435 1.1471 0.1248  0.0496  0.0605  146 GLN A CA  
859  C  C   . GLN A 154 ? 1.6216 0.8647 1.1516 0.0920  0.0530  0.0741  146 GLN A C   
860  O  O   . GLN A 154 ? 1.5797 0.8138 1.1292 0.0580  0.0505  0.0860  146 GLN A O   
861  C  CB  . GLN A 154 ? 1.7325 0.8476 1.1567 0.1125  0.0481  0.0458  146 GLN A CB  
862  N  N   . GLY A 155 ? 1.5308 0.8557 1.0938 0.1028  0.0588  0.0722  147 GLY A N   
863  C  CA  . GLY A 155 ? 1.4535 0.8474 1.0730 0.0728  0.0617  0.0853  147 GLY A CA  
864  C  C   . GLY A 155 ? 1.4590 0.9381 1.1109 0.0895  0.0675  0.0853  147 GLY A C   
865  O  O   . GLY A 155 ? 1.4683 0.9630 1.1173 0.1195  0.0669  0.0807  147 GLY A O   
866  N  N   . ALA A 156 ? 1.3855 0.9230 1.0663 0.0683  0.0730  0.0914  148 ALA A N   
867  C  CA  . ALA A 156 ? 1.3909 1.0176 1.1026 0.0732  0.0798  0.0925  148 ALA A CA  
868  C  C   . ALA A 156 ? 1.3871 1.0413 1.1377 0.0551  0.0772  0.1012  148 ALA A C   
869  O  O   . ALA A 156 ? 1.3403 0.9530 1.1007 0.0318  0.0716  0.1097  148 ALA A O   
870  C  CB  . ALA A 156 ? 1.3843 1.0568 1.1077 0.0504  0.0871  0.0996  148 ALA A CB  
871  N  N   . ILE A 157 ? 1.2496 0.9806 1.0214 0.0665  0.0809  0.0969  149 ILE A N   
872  C  CA  . ILE A 157 ? 1.2212 0.9868 1.0287 0.0478  0.0777  0.1010  149 ILE A CA  
873  C  C   . ILE A 157 ? 1.2363 1.0691 1.0773 0.0090  0.0840  0.1094  149 ILE A C   
874  O  O   . ILE A 157 ? 1.2588 1.1566 1.1018 0.0113  0.0927  0.1080  149 ILE A O   
875  C  CB  . ILE A 157 ? 1.2719 1.0787 1.0782 0.0866  0.0750  0.0891  149 ILE A CB  
876  C  CG1 . ILE A 157 ? 1.2671 0.9918 1.0420 0.1121  0.0670  0.0876  149 ILE A CG1 
877  C  CG2 . ILE A 157 ? 1.2594 1.1374 1.1073 0.0639  0.0735  0.0892  149 ILE A CG2 
878  C  CD1 . ILE A 157 ? 1.3867 1.0551 1.1105 0.1508  0.0672  0.0802  149 ILE A CD1 
879  N  N   . LEU A 158 ? 1.2314 1.0447 1.0943 -0.0272 0.0795  0.1184  150 LEU A N   
880  C  CA  . LEU A 158 ? 1.2201 1.0744 1.1070 -0.0707 0.0838  0.1283  150 LEU A CA  
881  C  C   . LEU A 158 ? 1.2382 1.1250 1.1526 -0.0889 0.0784  0.1225  150 LEU A C   
882  O  O   . LEU A 158 ? 1.2289 1.0711 1.1439 -0.0823 0.0691  0.1181  150 LEU A O   
883  C  CB  . LEU A 158 ? 1.1904 0.9767 1.0681 -0.0991 0.0822  0.1446  150 LEU A CB  
884  C  CG  . LEU A 158 ? 1.2172 1.0163 1.1070 -0.1459 0.0856  0.1595  150 LEU A CG  
885  C  CD1 . LEU A 158 ? 1.2403 1.1192 1.1328 -0.1569 0.0983  0.1644  150 LEU A CD1 
886  C  CD2 . LEU A 158 ? 1.2159 0.9363 1.0884 -0.1604 0.0814  0.1753  150 LEU A CD2 
887  N  N   . LEU A 159 ? 1.1788 1.1492 1.1150 -0.1139 0.0841  0.1217  151 LEU A N   
888  C  CA  . LEU A 159 ? 1.1699 1.1806 1.1321 -0.1374 0.0783  0.1132  151 LEU A CA  
889  C  C   . LEU A 159 ? 1.2023 1.1727 1.1705 -0.1947 0.0761  0.1245  151 LEU A C   
890  O  O   . LEU A 159 ? 1.2237 1.1752 1.1817 -0.2219 0.0831  0.1414  151 LEU A O   
891  C  CB  . LEU A 159 ? 1.1855 1.3240 1.1687 -0.1338 0.0845  0.1025  151 LEU A CB  
892  C  CG  . LEU A 159 ? 1.2431 1.4323 1.2183 -0.0704 0.0844  0.0878  151 LEU A CG  
893  C  CD1 . LEU A 159 ? 1.2384 1.5696 1.2351 -0.0689 0.0920  0.0787  151 LEU A CD1 
894  C  CD2 . LEU A 159 ? 1.2719 1.4295 1.2450 -0.0422 0.0722  0.0771  151 LEU A CD2 
895  N  N   . VAL A 160 ? 1.3028 1.2554 1.2823 -0.2109 0.0659  0.1150  152 VAL A N   
896  C  CA  . VAL A 160 ? 1.3035 1.2156 1.2836 -0.2654 0.0621  0.1213  152 VAL A CA  
897  C  C   . VAL A 160 ? 1.3641 1.3687 1.3631 -0.3119 0.0696  0.1215  152 VAL A C   
898  O  O   . VAL A 160 ? 1.3654 1.4694 1.3881 -0.3056 0.0695  0.1052  152 VAL A O   
899  C  CB  . VAL A 160 ? 1.3254 1.1921 1.3086 -0.2672 0.0478  0.1063  152 VAL A CB  
900  C  CG1 . VAL A 160 ? 1.3490 1.1623 1.3246 -0.3229 0.0428  0.1102  152 VAL A CG1 
901  C  CG2 . VAL A 160 ? 1.3004 1.0888 1.2662 -0.2251 0.0416  0.1070  152 VAL A CG2 
902  N  N   . ASN A 161 ? 1.4612 1.4379 1.4479 -0.3589 0.0760  0.1409  153 ASN A N   
903  C  CA  . ASN A 161 ? 1.4709 1.5337 1.4723 -0.4143 0.0845  0.1449  153 ASN A CA  
904  C  C   . ASN A 161 ? 1.5133 1.5597 1.5216 -0.4663 0.0742  0.1334  153 ASN A C   
905  O  O   . ASN A 161 ? 1.5423 1.5234 1.5308 -0.5222 0.0738  0.1475  153 ASN A O   
906  C  CB  . ASN A 161 ? 1.4747 1.5096 1.4535 -0.4474 0.0963  0.1739  153 ASN A CB  
907  C  CG  . ASN A 161 ? 1.6373 1.8013 1.6333 -0.4841 0.1113  0.1798  153 ASN A CG  
908  O  OD1 . ASN A 161 ? 1.5484 1.8347 1.5748 -0.4714 0.1136  0.1607  153 ASN A OD1 
909  N  ND2 . ASN A 161 ? 1.6313 1.7749 1.6060 -0.5277 0.1218  0.2072  153 ASN A ND2 
910  N  N   . CYS A 162 ? 1.5153 1.6165 1.5469 -0.4473 0.0651  0.1074  154 CYS A N   
911  C  CA  . CYS A 162 ? 1.5356 1.6126 1.5709 -0.4882 0.0521  0.0904  154 CYS A CA  
912  C  C   . CYS A 162 ? 1.5622 1.7742 1.6285 -0.5342 0.0540  0.0753  154 CYS A C   
913  O  O   . CYS A 162 ? 1.5640 1.7885 1.6405 -0.5565 0.0417  0.0528  154 CYS A O   
914  C  CB  . CYS A 162 ? 1.5278 1.5626 1.5633 -0.4367 0.0380  0.0705  154 CYS A CB  
915  S  SG  . CYS A 162 ? 1.5264 1.6673 1.5844 -0.3608 0.0399  0.0569  154 CYS A SG  
916  N  N   . ASP A 163 ? 1.5383 1.8591 1.6196 -0.5489 0.0692  0.0860  155 ASP A N   
917  C  CA  . ASP A 163 ? 1.5287 1.9993 1.6421 -0.5954 0.0726  0.0727  155 ASP A CA  
918  C  C   . ASP A 163 ? 1.5910 2.0658 1.6947 -0.6829 0.0834  0.0937  155 ASP A C   
919  O  O   . ASP A 163 ? 1.6254 1.9631 1.6925 -0.7117 0.0838  0.1157  155 ASP A O   
920  C  CB  . ASP A 163 ? 1.5065 2.1320 1.6477 -0.5387 0.0813  0.0642  155 ASP A CB  
921  C  CG  . ASP A 163 ? 1.5606 2.2094 1.6916 -0.5239 0.0991  0.0876  155 ASP A CG  
922  O  OD1 . ASP A 163 ? 1.5828 2.1063 1.6826 -0.5269 0.1023  0.1100  155 ASP A OD1 
923  O  OD2 . ASP A 163 ? 1.5707 2.3691 1.7238 -0.5058 0.1094  0.0823  155 ASP A OD2 
924  N  N   . ARG A 164 ? 1.6050 2.2408 1.7390 -0.7241 0.0923  0.0881  156 ARG A N   
925  C  CA  . ARG A 164 ? 1.6337 2.2883 1.7591 -0.8188 0.1032  0.1080  156 ARG A CA  
926  C  C   . ARG A 164 ? 1.6482 2.5101 1.8088 -0.8346 0.1200  0.1086  156 ARG A C   
927  O  O   . ARG A 164 ? 1.6344 2.6264 1.8249 -0.8870 0.1189  0.0914  156 ARG A O   
928  C  CB  . ARG A 164 ? 1.6549 2.2589 1.7736 -0.8982 0.0894  0.0935  156 ARG A CB  
929  C  CG  . ARG A 164 ? 1.7262 2.2615 1.8122 -0.9995 0.0965  0.1198  156 ARG A CG  
930  C  CD  . ARG A 164 ? 1.7763 2.2373 1.8464 -1.0621 0.0788  0.0990  156 ARG A CD  
931  N  NE  . ARG A 164 ? 1.7197 2.3545 1.8329 -1.0917 0.0753  0.0686  156 ARG A NE  
932  C  CZ  . ARG A 164 ? 1.8003 2.4082 1.9077 -1.1289 0.0581  0.0406  156 ARG A CZ  
933  N  NH1 . ARG A 164 ? 1.7567 2.5372 1.9033 -1.1513 0.0555  0.0138  156 ARG A NH1 
934  N  NH2 . ARG A 164 ? 1.8431 2.2553 1.9036 -1.1383 0.0432  0.0381  156 ARG A NH2 
935  N  N   . ASP A 165 ? 1.5662 2.4652 1.7225 -0.7887 0.1353  0.1264  157 ASP A N   
936  C  CA  . ASP A 165 ? 1.5400 2.6400 1.7263 -0.7903 0.1522  0.1262  157 ASP A CA  
937  C  C   . ASP A 165 ? 1.6015 2.7589 1.7862 -0.9009 0.1657  0.1473  157 ASP A C   
938  O  O   . ASP A 165 ? 1.5810 2.9246 1.8013 -0.9397 0.1733  0.1363  157 ASP A O   
939  C  CB  . ASP A 165 ? 1.5440 2.6501 1.7176 -0.7115 0.1641  0.1384  157 ASP A CB  
940  C  CG  . ASP A 165 ? 1.6174 2.6591 1.7863 -0.6085 0.1516  0.1197  157 ASP A CG  
941  O  OD1 . ASP A 165 ? 1.5893 2.7529 1.7836 -0.5507 0.1488  0.0952  157 ASP A OD1 
942  O  OD2 . ASP A 165 ? 1.6921 2.5633 1.8293 -0.5856 0.1443  0.1303  157 ASP A OD2 
943  N  N   . ASN A 166 ? 1.7044 2.7030 1.8449 -0.9513 0.1686  0.1786  158 ASN A N   
944  C  CA  . ASN A 166 ? 1.7680 2.7527 1.8826 -1.0298 0.1727  0.1970  158 ASN A CA  
945  C  C   . ASN A 166 ? 1.8718 2.8569 1.9905 -1.0880 0.1567  0.1732  158 ASN A C   
946  O  O   . ASN A 166 ? 1.9048 2.7304 1.9971 -1.1064 0.1407  0.1679  158 ASN A O   
947  C  CB  . ASN A 166 ? 1.8442 2.6245 1.8991 -1.0419 0.1726  0.2314  158 ASN A CB  
948  N  N   . LEU A 167 ? 1.6761 2.8432 1.8247 -1.1132 0.1604  0.1573  159 LEU A N   
949  C  CA  . LEU A 167 ? 1.7340 2.9327 1.8897 -1.1673 0.1462  0.1312  159 LEU A CA  
950  C  C   . LEU A 167 ? 1.8814 2.9086 1.9827 -1.2408 0.1390  0.1468  159 LEU A C   
951  O  O   . LEU A 167 ? 1.9334 2.9031 2.0267 -1.2775 0.1233  0.1257  159 LEU A O   
952  C  CB  . LEU A 167 ? 1.7293 3.1628 1.9201 -1.1796 0.1533  0.1155  159 LEU A CB  
953  N  N   . GLU A 168 ? 1.8490 2.7953 1.9111 -1.2584 0.1502  0.1830  160 GLU A N   
954  C  CA  . GLU A 168 ? 1.9886 2.7741 1.9953 -1.3221 0.1447  0.2012  160 GLU A CA  
955  C  C   . GLU A 168 ? 2.0122 2.5709 1.9818 -1.2989 0.1299  0.2033  160 GLU A C   
956  O  O   . GLU A 168 ? 2.1004 2.5503 2.0435 -1.3374 0.1153  0.1910  160 GLU A O   
957  C  CB  . GLU A 168 ? 2.0486 2.8303 2.0250 -1.3441 0.1613  0.2401  160 GLU A CB  
958  C  CG  . GLU A 168 ? 2.2075 2.8516 2.1275 -1.4160 0.1574  0.2598  160 GLU A CG  
959  C  CD  . GLU A 168 ? 2.4077 3.1277 2.3339 -1.4900 0.1504  0.2370  160 GLU A CD  
960  O  OE1 . GLU A 168 ? 2.3513 2.9858 2.2709 -1.5033 0.1335  0.2125  160 GLU A OE1 
961  O  OE2 . GLU A 168 ? 2.4245 3.2924 2.3602 -1.5350 0.1616  0.2430  160 GLU A OE2 
962  N  N   . SER A 169 ? 2.0488 2.5394 2.0142 -1.2341 0.1335  0.2178  161 SER A N   
963  C  CA  . SER A 169 ? 2.0550 2.3432 1.9858 -1.2004 0.1194  0.2192  161 SER A CA  
964  C  C   . SER A 169 ? 2.0508 2.3301 2.0035 -1.1914 0.1011  0.1801  161 SER A C   
965  O  O   . SER A 169 ? 1.9513 2.3727 1.9550 -1.1661 0.1019  0.1570  161 SER A O   
966  C  CB  . SER A 169 ? 2.1148 2.3643 2.0430 -1.1308 0.1274  0.2389  161 SER A CB  
967  N  N   . SER A 170 ? 2.1249 2.2413 2.0381 -1.2090 0.0845  0.1719  162 SER A N   
968  C  CA  . SER A 170 ? 2.1114 2.2089 2.0390 -1.2029 0.0657  0.1333  162 SER A CA  
969  C  C   . SER A 170 ? 2.0876 2.0802 2.0094 -1.1319 0.0564  0.1284  162 SER A C   
970  O  O   . SER A 170 ? 2.0317 2.0519 1.9789 -1.1108 0.0441  0.0970  162 SER A O   
971  C  CB  . SER A 170 ? 2.2704 2.2512 2.1567 -1.2570 0.0515  0.1223  162 SER A CB  
972  O  OG  . SER A 170 ? 2.4110 2.1906 2.2381 -1.2403 0.0468  0.1445  162 SER A OG  
973  N  N   . ALA A 171 ? 2.1420 2.0202 2.0294 -1.0946 0.0620  0.1592  163 ALA A N   
974  C  CA  . ALA A 171 ? 2.1275 1.8983 2.0023 -1.0266 0.0534  0.1577  163 ALA A CA  
975  C  C   . ALA A 171 ? 2.0634 1.9473 1.9791 -0.9819 0.0645  0.1608  163 ALA A C   
976  O  O   . ALA A 171 ? 2.0090 2.0553 1.9623 -0.9976 0.0799  0.1655  163 ALA A O   
977  C  CB  . ALA A 171 ? 2.1966 1.7991 2.0149 -1.0016 0.0528  0.1873  163 ALA A CB  
978  N  N   . MET A 172 ? 2.0074 1.8066 1.9133 -0.9239 0.0566  0.1578  164 MET A N   
979  C  CA  . MET A 172 ? 1.9280 1.8142 1.8682 -0.8388 0.0634  0.1550  164 MET A CA  
980  C  C   . MET A 172 ? 1.9348 1.8309 1.8618 -0.8281 0.0814  0.1912  164 MET A C   
981  O  O   . MET A 172 ? 1.9902 1.7845 1.8728 -0.8682 0.0853  0.2209  164 MET A O   
982  C  CB  . MET A 172 ? 1.9368 1.7246 1.8671 -0.7625 0.0484  0.1395  164 MET A CB  
983  C  CG  . MET A 172 ? 1.8773 1.7649 1.8472 -0.6838 0.0498  0.1229  164 MET A CG  
984  S  SD  . MET A 172 ? 1.9004 1.6813 1.8579 -0.6104 0.0322  0.1042  164 MET A SD  
985  C  CE  . MET A 172 ? 1.9170 1.6465 1.8641 -0.6627 0.0137  0.0753  164 MET A CE  
986  N  N   . ASP A 173 ? 1.7733 1.7876 1.7337 -0.7723 0.0918  0.1886  165 ASP A N   
987  C  CA  . ASP A 173 ? 1.7634 1.8024 1.7127 -0.7578 0.1087  0.2180  165 ASP A CA  
988  C  C   . ASP A 173 ? 1.8295 1.7226 1.7389 -0.7116 0.1041  0.2365  165 ASP A C   
989  O  O   . ASP A 173 ? 1.8612 1.7207 1.7418 -0.7227 0.1145  0.2675  165 ASP A O   
990  C  CB  . ASP A 173 ? 1.7075 1.9043 1.6976 -0.7035 0.1188  0.2048  165 ASP A CB  
991  C  CG  . ASP A 173 ? 1.7369 2.1034 1.7669 -0.7443 0.1253  0.1891  165 ASP A CG  
992  O  OD1 . ASP A 173 ? 1.7800 2.1575 1.8046 -0.8295 0.1282  0.1978  165 ASP A OD1 
993  O  OD2 . ASP A 173 ? 1.7156 2.2053 1.7796 -0.6914 0.1272  0.1682  165 ASP A OD2 
994  N  N   . CYS A 174 ? 1.8706 1.6864 1.7781 -0.6600 0.0887  0.2176  166 CYS A N   
995  C  CA  . CYS A 174 ? 1.8755 1.5756 1.7517 -0.6097 0.0835  0.2307  166 CYS A CA  
996  C  C   . CYS A 174 ? 1.9616 1.5050 1.7880 -0.6399 0.0731  0.2457  166 CYS A C   
997  O  O   . CYS A 174 ? 1.9696 1.4144 1.7675 -0.5978 0.0662  0.2547  166 CYS A O   
998  C  CB  . CYS A 174 ? 1.8334 1.5333 1.7294 -0.5388 0.0731  0.2050  166 CYS A CB  
999  S  SG  . CYS A 174 ? 1.8766 1.5186 1.7759 -0.5430 0.0532  0.1744  166 CYS A SG  
1000 N  N   . GLU A 175 ? 2.0070 1.5278 1.8199 -0.7124 0.0714  0.2476  167 GLU A N   
1001 C  CA  . GLU A 175 ? 2.0748 1.4511 1.8423 -0.7218 0.0594  0.2530  167 GLU A CA  
1002 C  C   . GLU A 175 ? 2.1388 1.4784 1.8744 -0.7303 0.0692  0.2865  167 GLU A C   
1003 O  O   . GLU A 175 ? 2.2005 1.4229 1.8972 -0.7158 0.0606  0.2946  167 GLU A O   
1004 C  CB  . GLU A 175 ? 2.1614 1.5338 1.9334 -0.7729 0.0498  0.2288  167 GLU A CB  
1005 N  N   . ASP A 176 ? 2.0392 1.4841 1.7901 -0.7521 0.0874  0.3057  168 ASP A N   
1006 C  CA  . ASP A 176 ? 2.0723 1.4972 1.7934 -0.7631 0.0983  0.3387  168 ASP A CA  
1007 C  C   . ASP A 176 ? 2.0549 1.5183 1.7751 -0.7203 0.1092  0.3584  168 ASP A C   
1008 O  O   . ASP A 176 ? 2.0001 1.4912 1.7388 -0.6813 0.1073  0.3469  168 ASP A O   
1009 C  CB  . ASP A 176 ? 2.1020 1.6215 1.8351 -0.8335 0.1110  0.3458  168 ASP A CB  
1010 C  CG  . ASP A 176 ? 2.0641 1.7585 1.8460 -0.8476 0.1253  0.3376  168 ASP A CG  
1011 O  OD1 . ASP A 176 ? 2.0462 1.8084 1.8635 -0.8643 0.1205  0.3096  168 ASP A OD1 
1012 O  OD2 . ASP A 176 ? 2.0518 1.8224 1.8364 -0.8391 0.1415  0.3580  168 ASP A OD2 
1013 N  N   . ASP A 177 ? 2.0603 1.5238 1.7556 -0.7296 0.1205  0.3884  169 ASP A N   
1014 C  CA  . ASP A 177 ? 2.0257 1.5257 1.7142 -0.6920 0.1308  0.4076  169 ASP A CA  
1015 C  C   . ASP A 177 ? 2.0327 1.6576 1.7304 -0.7292 0.1520  0.4260  169 ASP A C   
1016 O  O   . ASP A 177 ? 2.0535 1.6675 1.7224 -0.7247 0.1605  0.4534  169 ASP A O   
1017 C  CB  . ASP A 177 ? 2.0858 1.4655 1.7295 -0.6514 0.1232  0.4274  169 ASP A CB  
1018 C  CG  . ASP A 177 ? 2.3583 1.6714 1.9666 -0.6872 0.1244  0.4489  169 ASP A CG  
1019 O  OD1 . ASP A 177 ? 2.4437 1.7691 2.0595 -0.7414 0.1249  0.4411  169 ASP A OD1 
1020 O  OD2 . ASP A 177 ? 2.4588 1.7078 2.0294 -0.6624 0.1247  0.4740  169 ASP A OD2 
1021 N  N   . GLU A 178 ? 1.9128 1.6662 1.6515 -0.7630 0.1607  0.4101  170 GLU A N   
1022 C  CA  . GLU A 178 ? 1.9020 1.7994 1.6559 -0.7937 0.1813  0.4224  170 GLU A CA  
1023 C  C   . GLU A 178 ? 1.8663 1.9258 1.6731 -0.8000 0.1901  0.3984  170 GLU A C   
1024 O  O   . GLU A 178 ? 1.8377 1.8981 1.6711 -0.8016 0.1792  0.3714  170 GLU A O   
1025 C  CB  . GLU A 178 ? 2.0974 1.9833 1.8344 -0.8542 0.1844  0.4364  170 GLU A CB  
1026 N  N   . VAL A 179 ? 1.8182 2.0208 1.6410 -0.7930 0.2091  0.4045  171 VAL A N   
1027 C  CA  . VAL A 179 ? 1.7625 2.1337 1.6395 -0.7692 0.2146  0.3713  171 VAL A CA  
1028 C  C   . VAL A 179 ? 1.8078 2.3175 1.7013 -0.8440 0.2309  0.3813  171 VAL A C   
1029 O  O   . VAL A 179 ? 1.8249 2.3993 1.7061 -0.8503 0.2448  0.3994  171 VAL A O   
1030 C  CB  . VAL A 179 ? 1.7486 2.1917 1.6343 -0.6867 0.2207  0.3583  171 VAL A CB  
1031 C  CG1 . VAL A 179 ? 1.7010 2.3050 1.6352 -0.6526 0.2240  0.3227  171 VAL A CG1 
1032 C  CG2 . VAL A 179 ? 1.7400 2.0477 1.6069 -0.6195 0.2046  0.3496  171 VAL A CG2 
1033 N  N   . LEU A 180 ? 1.8372 2.3860 1.7599 -0.8815 0.2227  0.3592  172 LEU A N   
1034 C  CA  . LEU A 180 ? 1.8538 2.5070 1.7901 -0.9393 0.2278  0.3575  172 LEU A CA  
1035 C  C   . LEU A 180 ? 1.8257 2.7082 1.8095 -0.9223 0.2428  0.3392  172 LEU A C   
1036 O  O   . LEU A 180 ? 1.8413 2.8253 1.8232 -0.9417 0.2550  0.3502  172 LEU A O   
1037 C  CB  . LEU A 180 ? 1.8774 2.4713 1.8186 -0.9885 0.2107  0.3398  172 LEU A CB  
1038 C  CG  . LEU A 180 ? 1.9739 2.3448 1.8679 -0.9979 0.1937  0.3507  172 LEU A CG  
1039 C  CD1 . LEU A 180 ? 2.0199 2.3541 1.9178 -1.0485 0.1785  0.3296  172 LEU A CD1 
1040 C  CD2 . LEU A 180 ? 2.0516 2.3273 1.8945 -1.0115 0.1994  0.3872  172 LEU A CD2 
1041 N  N   . ASP A 181 ? 1.7351 2.7017 1.7598 -0.8813 0.2415  0.3105  173 ASP A N   
1042 C  CA  . ASP A 181 ? 1.6797 2.8671 1.7499 -0.8505 0.2531  0.2872  173 ASP A CA  
1043 C  C   . ASP A 181 ? 1.6792 2.8829 1.7483 -0.7377 0.2527  0.2697  173 ASP A C   
1044 O  O   . ASP A 181 ? 1.6943 2.7473 1.7404 -0.6832 0.2397  0.2665  173 ASP A O   
1045 C  CB  . ASP A 181 ? 1.6660 2.9349 1.7796 -0.8616 0.2408  0.2531  173 ASP A CB  
1046 C  CG  . ASP A 181 ? 1.9038 3.1338 2.0081 -0.9473 0.2294  0.2548  173 ASP A CG  
1047 O  OD1 . ASP A 181 ? 1.9831 3.0316 2.0444 -0.9868 0.2213  0.2760  173 ASP A OD1 
1048 O  OD2 . ASP A 181 ? 1.9965 3.3751 2.1318 -0.9697 0.2274  0.2335  173 ASP A OD2 
1049 N  N   . SER A 182 ? 1.5573 2.9467 1.6488 -0.7042 0.2669  0.2572  174 SER A N   
1050 C  CA  . SER A 182 ? 1.5334 2.9482 1.6199 -0.5965 0.2663  0.2361  174 SER A CA  
1051 C  C   . SER A 182 ? 1.5435 2.9446 1.6505 -0.5264 0.2475  0.1989  174 SER A C   
1052 O  O   . SER A 182 ? 1.5445 2.8889 1.6353 -0.4393 0.2403  0.1827  174 SER A O   
1053 C  CB  . SER A 182 ? 1.5284 3.1509 1.6284 -0.5785 0.2867  0.2316  174 SER A CB  
1054 O  OG  . SER A 182 ? 1.6131 3.4188 1.7584 -0.6017 0.2897  0.2124  174 SER A OG  
1055 N  N   . GLU A 183 ? 1.4992 2.9506 1.6384 -0.5678 0.2394  0.1861  175 GLU A N   
1056 C  CA  . GLU A 183 ? 1.4785 2.9281 1.6371 -0.5078 0.2216  0.1530  175 GLU A CA  
1057 C  C   . GLU A 183 ? 1.5162 2.7521 1.6494 -0.4864 0.2035  0.1545  175 GLU A C   
1058 O  O   . GLU A 183 ? 1.5149 2.7178 1.6523 -0.4233 0.1892  0.1311  175 GLU A O   
1059 C  CB  . GLU A 183 ? 1.4670 3.0421 1.6671 -0.5646 0.2178  0.1385  175 GLU A CB  
1060 N  N   . ASP A 184 ? 1.4519 2.5471 1.5562 -0.5375 0.2045  0.1831  176 ASP A N   
1061 C  CA  . ASP A 184 ? 1.4654 2.3664 1.5451 -0.5225 0.1883  0.1862  176 ASP A CA  
1062 C  C   . ASP A 184 ? 1.4942 2.3144 1.5467 -0.4408 0.1862  0.1842  176 ASP A C   
1063 O  O   . ASP A 184 ? 1.4975 2.1907 1.5364 -0.4061 0.1719  0.1776  176 ASP A O   
1064 C  CB  . ASP A 184 ? 1.5074 2.2897 1.5615 -0.6038 0.1890  0.2172  176 ASP A CB  
1065 C  CG  . ASP A 184 ? 1.5704 2.1663 1.6013 -0.5900 0.1711  0.2175  176 ASP A CG  
1066 O  OD1 . ASP A 184 ? 1.5522 2.1301 1.5983 -0.5480 0.1570  0.1918  176 ASP A OD1 
1067 O  OD2 . ASP A 184 ? 1.6310 2.1031 1.6265 -0.6187 0.1711  0.2440  176 ASP A OD2 
1068 N  N   . LEU A 185 ? 1.4523 2.3508 1.4954 -0.4122 0.2005  0.1884  177 LEU A N   
1069 C  CA  . LEU A 185 ? 1.4615 2.2858 1.4740 -0.3419 0.1990  0.1853  177 LEU A CA  
1070 C  C   . LEU A 185 ? 1.4830 2.3053 1.4985 -0.2593 0.1874  0.1539  177 LEU A C   
1071 O  O   . LEU A 185 ? 1.5077 2.2276 1.4955 -0.2083 0.1804  0.1491  177 LEU A O   
1072 C  CB  . LEU A 185 ? 1.4655 2.3830 1.4645 -0.3323 0.2172  0.1945  177 LEU A CB  
1073 C  CG  . LEU A 185 ? 1.5151 2.4129 1.4964 -0.4041 0.2297  0.2314  177 LEU A CG  
1074 C  CD1 . LEU A 185 ? 1.5120 2.4978 1.4754 -0.3794 0.2465  0.2371  177 LEU A CD1 
1075 C  CD2 . LEU A 185 ? 1.5559 2.2666 1.5075 -0.4214 0.2185  0.2514  177 LEU A CD2 
1076 N  N   . GLN A 186 ? 1.3782 2.3139 1.4244 -0.2481 0.1849  0.1335  178 GLN A N   
1077 C  CA  . GLN A 186 ? 1.3739 2.3103 1.4184 -0.1689 0.1735  0.1062  178 GLN A CA  
1078 C  C   . GLN A 186 ? 1.4035 2.1870 1.4384 -0.1626 0.1563  0.1049  178 GLN A C   
1079 O  O   . GLN A 186 ? 1.4177 2.1439 1.4340 -0.0975 0.1470  0.0906  178 GLN A O   
1080 C  CB  . GLN A 186 ? 1.3553 2.4593 1.4353 -0.1605 0.1740  0.0864  178 GLN A CB  
1081 C  CG  . GLN A 186 ? 1.4985 2.7806 1.5930 -0.1677 0.1917  0.0858  178 GLN A CG  
1082 C  CD  . GLN A 186 ? 1.6228 3.0838 1.7591 -0.1782 0.1918  0.0686  178 GLN A CD  
1083 O  OE1 . GLN A 186 ? 1.5717 3.1109 1.7109 -0.1033 0.1860  0.0439  178 GLN A OE1 
1084 N  NE2 . GLN A 186 ? 1.5820 3.1077 1.7476 -0.2718 0.1976  0.0815  178 GLN A NE2 
1085 N  N   . ASP A 187 ? 1.3907 2.1069 1.4343 -0.2306 0.1522  0.1201  179 ASP A N   
1086 C  CA  . ASP A 187 ? 1.3920 1.9750 1.4281 -0.2284 0.1364  0.1183  179 ASP A CA  
1087 C  C   . ASP A 187 ? 1.4444 1.8838 1.4459 -0.2129 0.1340  0.1322  179 ASP A C   
1088 O  O   . ASP A 187 ? 1.4578 1.7974 1.4475 -0.1870 0.1221  0.1271  179 ASP A O   
1089 C  CB  . ASP A 187 ? 1.3882 1.9556 1.4430 -0.3032 0.1314  0.1248  179 ASP A CB  
1090 C  CG  . ASP A 187 ? 1.3778 2.0923 1.4688 -0.3260 0.1319  0.1085  179 ASP A CG  
1091 O  OD1 . ASP A 187 ? 1.3638 2.1547 1.4664 -0.2691 0.1275  0.0871  179 ASP A OD1 
1092 O  OD2 . ASP A 187 ? 1.3942 2.1480 1.4993 -0.4016 0.1362  0.1173  179 ASP A OD2 
1093 N  N   . MET A 188 ? 1.3312 1.7697 1.3164 -0.2297 0.1454  0.1499  180 MET A N   
1094 C  CA  . MET A 188 ? 1.3376 1.6550 1.2906 -0.2198 0.1431  0.1637  180 MET A CA  
1095 C  C   . MET A 188 ? 1.3861 1.6952 1.3152 -0.1527 0.1440  0.1506  180 MET A C   
1096 O  O   . MET A 188 ? 1.3967 1.8034 1.3266 -0.1207 0.1520  0.1383  180 MET A O   
1097 C  CB  . MET A 188 ? 1.3568 1.6678 1.2979 -0.2728 0.1536  0.1914  180 MET A CB  
1098 C  CG  . MET A 188 ? 1.3795 1.6693 1.3315 -0.3440 0.1519  0.2067  180 MET A CG  
1099 S  SD  . MET A 188 ? 1.4345 1.6977 1.3599 -0.4051 0.1640  0.2449  180 MET A SD  
1100 C  CE  . MET A 188 ? 1.4259 1.6519 1.3595 -0.4847 0.1583  0.2547  180 MET A CE  
1101 N  N   . SER A 189 ? 1.3572 1.5502 1.2624 -0.1319 0.1351  0.1520  181 SER A N   
1102 C  CA  . SER A 189 ? 1.3855 1.5488 1.2609 -0.0769 0.1343  0.1394  181 SER A CA  
1103 C  C   . SER A 189 ? 1.4360 1.6122 1.2898 -0.0829 0.1444  0.1505  181 SER A C   
1104 O  O   . SER A 189 ? 1.4248 1.5814 1.2785 -0.1279 0.1481  0.1733  181 SER A O   
1105 C  CB  . SER A 189 ? 1.1724 1.2154 1.0311 -0.0603 0.1211  0.1364  181 SER A CB  
1106 N  N   . LEU A 190 ? 1.3447 1.5497 1.1753 -0.0350 0.1482  0.1340  182 LEU A N   
1107 C  CA  . LEU A 190 ? 1.3589 1.5882 1.1664 -0.0344 0.1578  0.1401  182 LEU A CA  
1108 C  C   . LEU A 190 ? 1.4060 1.5287 1.1787 -0.0187 0.1497  0.1381  182 LEU A C   
1109 O  O   . LEU A 190 ? 1.4216 1.4742 1.1781 0.0139  0.1392  0.1214  182 LEU A O   
1110 C  CB  . LEU A 190 ? 1.3780 1.7135 1.1774 0.0100  0.1671  0.1200  182 LEU A CB  
1111 C  CG  . LEU A 190 ? 1.4239 1.8076 1.1988 0.0159  0.1786  0.1226  182 LEU A CG  
1112 C  CD1 . LEU A 190 ? 1.4012 1.8279 1.1921 -0.0488 0.1897  0.1549  182 LEU A CD1 
1113 C  CD2 . LEU A 190 ? 1.4547 1.9503 1.2219 0.0680  0.1869  0.0983  182 LEU A CD2 
1114 N  N   . MET A 191 ? 1.4820 1.5960 1.2415 -0.0445 0.1544  0.1563  183 MET A N   
1115 C  CA  . MET A 191 ? 1.4834 1.5170 1.2106 -0.0330 0.1471  0.1539  183 MET A CA  
1116 C  C   . MET A 191 ? 1.5367 1.6205 1.2409 -0.0341 0.1572  0.1605  183 MET A C   
1117 O  O   . MET A 191 ? 1.5309 1.6642 1.2446 -0.0703 0.1671  0.1856  183 MET A O   
1118 C  CB  . MET A 191 ? 1.4596 1.4081 1.1937 -0.0657 0.1373  0.1732  183 MET A CB  
1119 C  CG  . MET A 191 ? 1.4814 1.3626 1.1860 -0.0577 0.1290  0.1714  183 MET A CG  
1120 S  SD  . MET A 191 ? 1.4681 1.2680 1.1813 -0.0882 0.1175  0.1931  183 MET A SD  
1121 C  CE  . MET A 191 ? 1.4473 1.2842 1.1718 -0.1307 0.1273  0.2273  183 MET A CE  
1122 N  N   . THR A 192 ? 1.5119 1.5797 1.1816 0.0038  0.1545  0.1380  184 THR A N   
1123 C  CA  . THR A 192 ? 1.5306 1.6555 1.1750 0.0103  0.1640  0.1387  184 THR A CA  
1124 C  C   . THR A 192 ? 1.5518 1.6086 1.1640 0.0095  0.1551  0.1379  184 THR A C   
1125 O  O   . THR A 192 ? 1.5524 1.5259 1.1508 0.0227  0.1418  0.1213  184 THR A O   
1126 C  CB  . THR A 192 ? 1.6224 1.8120 1.2476 0.0617  0.1699  0.1074  184 THR A CB  
1127 O  OG1 . THR A 192 ? 1.6694 1.7732 1.2604 0.1016  0.1571  0.0769  184 THR A OG1 
1128 C  CG2 . THR A 192 ? 1.5804 1.8458 1.2379 0.0697  0.1765  0.1040  184 THR A CG2 
1129 N  N   . LEU A 193 ? 1.5497 1.6477 1.1487 -0.0082 0.1625  0.1569  185 LEU A N   
1130 C  CA  . LEU A 193 ? 1.5496 1.6054 1.1161 -0.0061 0.1545  0.1548  185 LEU A CA  
1131 C  C   . LEU A 193 ? 1.6114 1.7362 1.1445 0.0189  0.1631  0.1398  185 LEU A C   
1132 O  O   . LEU A 193 ? 1.6058 1.8074 1.1379 0.0030  0.1764  0.1623  185 LEU A O   
1133 C  CB  . LEU A 193 ? 1.5193 1.5511 1.0923 -0.0457 0.1526  0.1930  185 LEU A CB  
1134 C  CG  . LEU A 193 ? 1.5502 1.5519 1.0916 -0.0433 0.1434  0.1939  185 LEU A CG  
1135 C  CD1 . LEU A 193 ? 1.5408 1.4685 1.0733 -0.0271 0.1269  0.1643  185 LEU A CD1 
1136 C  CD2 . LEU A 193 ? 1.5363 1.5181 1.0801 -0.0748 0.1418  0.2347  185 LEU A CD2 
1137 N  N   . SER A 194 ? 1.5664 1.6605 1.0679 0.0572  0.1554  0.1014  186 SER A N   
1138 C  CA  . SER A 194 ? 1.6086 1.7595 1.0718 0.0880  0.1612  0.0792  186 SER A CA  
1139 C  C   . SER A 194 ? 1.6334 1.7457 1.0621 0.0825  0.1508  0.0734  186 SER A C   
1140 O  O   . SER A 194 ? 1.6382 1.6627 1.0562 0.0800  0.1351  0.0583  186 SER A O   
1141 C  CB  . SER A 194 ? 1.6409 1.7805 1.0814 0.1397  0.1587  0.0364  186 SER A CB  
1142 N  N   . THR A 195 ? 1.6520 1.8373 1.0629 0.0787  0.1598  0.0860  187 THR A N   
1143 C  CA  . THR A 195 ? 1.6711 1.8371 1.0492 0.0735  0.1500  0.0825  187 THR A CA  
1144 C  C   . THR A 195 ? 1.7460 1.9840 1.0815 0.1026  0.1567  0.0602  187 THR A C   
1145 O  O   . THR A 195 ? 1.7398 2.0742 1.0781 0.1080  0.1741  0.0738  187 THR A O   
1146 C  CB  . THR A 195 ? 1.7025 1.8738 1.0966 0.0337  0.1507  0.1305  187 THR A CB  
1147 O  OG1 . THR A 195 ? 1.7165 1.9663 1.1263 0.0172  0.1696  0.1653  187 THR A OG1 
1148 C  CG2 . THR A 195 ? 1.6455 1.7329 1.0710 0.0107  0.1392  0.1443  187 THR A CG2 
1149 N  N   . LYS A 196 ? 1.8015 1.9958 1.0965 0.1191  0.1425  0.0249  188 LYS A N   
1150 C  CA  . LYS A 196 ? 1.8417 2.0957 1.0899 0.1481  0.1457  -0.0017 188 LYS A CA  
1151 C  C   . LYS A 196 ? 1.8852 2.1246 1.1057 0.1320  0.1325  -0.0028 188 LYS A C   
1152 O  O   . LYS A 196 ? 1.9150 2.0802 1.1114 0.1336  0.1147  -0.0365 188 LYS A O   
1153 C  CB  . LYS A 196 ? 1.9026 2.1189 1.1150 0.1947  0.1403  -0.0569 188 LYS A CB  
1154 N  N   . THR A 197 ? 1.8114 2.1235 1.0333 0.1145  0.1410  0.0353  189 THR A N   
1155 C  CA  . THR A 197 ? 1.8278 2.1407 1.0259 0.1007  0.1287  0.0414  189 THR A CA  
1156 C  C   . THR A 197 ? 1.8862 2.3019 1.0489 0.1146  0.1396  0.0478  189 THR A C   
1157 O  O   . THR A 197 ? 1.8863 2.3765 1.0497 0.1282  0.1587  0.0557  189 THR A O   
1158 C  CB  . THR A 197 ? 1.8687 2.1535 1.1000 0.0645  0.1246  0.0912  189 THR A CB  
1159 O  OG1 . THR A 197 ? 1.8586 2.2057 1.1028 0.0507  0.1431  0.1413  189 THR A OG1 
1160 C  CG2 . THR A 197 ? 1.8202 2.0176 1.0902 0.0509  0.1172  0.0896  189 THR A CG2 
1161 N  N   . PRO A 198 ? 1.8801 2.3098 1.0111 0.1117  0.1275  0.0438  190 PRO A N   
1162 C  CA  . PRO A 198 ? 1.8983 2.4308 0.9967 0.1212  0.1387  0.0606  190 PRO A CA  
1163 C  C   . PRO A 198 ? 1.9028 2.4857 1.0235 0.0972  0.1576  0.1275  190 PRO A C   
1164 O  O   . PRO A 198 ? 1.8656 2.3943 1.0243 0.0710  0.1573  0.1612  190 PRO A O   
1165 C  CB  . PRO A 198 ? 1.9334 2.4595 1.0015 0.1167  0.1187  0.0500  190 PRO A CB  
1166 C  CG  . PRO A 198 ? 1.9782 2.4122 1.0473 0.1159  0.0983  0.0010  190 PRO A CG  
1167 C  CD  . PRO A 198 ? 1.9083 2.2731 1.0249 0.1040  0.1032  0.0138  190 PRO A CD  
1168 N  N   . LYS A 199 ? 1.9355 2.6188 1.0286 0.1047  0.1735  0.1459  191 LYS A N   
1169 C  CA  . LYS A 199 ? 1.9197 2.6520 1.0248 0.0770  0.1935  0.2102  191 LYS A CA  
1170 C  C   . LYS A 199 ? 1.9515 2.6458 1.0498 0.0523  0.1843  0.2602  191 LYS A C   
1171 O  O   . LYS A 199 ? 1.9326 2.5896 1.0547 0.0222  0.1906  0.3085  191 LYS A O   
1172 C  CB  . LYS A 199 ? 1.9585 2.8166 1.0309 0.0910  0.2142  0.2155  191 LYS A CB  
1173 N  N   . ASP A 200 ? 1.9852 2.6885 1.0478 0.0671  0.1684  0.2469  192 ASP A N   
1174 C  CA  . ASP A 200 ? 1.9908 2.6689 1.0399 0.0542  0.1578  0.2920  192 ASP A CA  
1175 C  C   . ASP A 200 ? 1.9857 2.5662 1.0644 0.0475  0.1356  0.2810  192 ASP A C   
1176 O  O   . ASP A 200 ? 1.9947 2.5535 1.0624 0.0458  0.1219  0.3069  192 ASP A O   
1177 C  CB  . ASP A 200 ? 2.0434 2.7922 1.0399 0.0751  0.1502  0.2845  192 ASP A CB  
1178 C  CG  . ASP A 200 ? 2.1211 2.8547 1.1078 0.0950  0.1268  0.2187  192 ASP A CG  
1179 O  OD1 . ASP A 200 ? 2.1647 2.8583 1.1538 0.0914  0.1058  0.2186  192 ASP A OD1 
1180 O  OD2 . ASP A 200 ? 2.1387 2.9009 1.1124 0.1139  0.1292  0.1664  192 ASP A OD2 
1181 N  N   . PHE A 201 ? 1.9242 2.4509 1.0384 0.0462  0.1325  0.2435  193 PHE A N   
1182 C  CA  . PHE A 201 ? 1.8995 2.3413 1.0420 0.0389  0.1127  0.2276  193 PHE A CA  
1183 C  C   . PHE A 201 ? 1.9166 2.3005 1.0878 0.0176  0.1138  0.2789  193 PHE A C   
1184 O  O   . PHE A 201 ? 1.9023 2.2322 1.0889 0.0144  0.0967  0.2784  193 PHE A O   
1185 C  CB  . PHE A 201 ? 1.8932 2.2911 1.0583 0.0443  0.1105  0.1754  193 PHE A CB  
1186 C  CG  . PHE A 201 ? 1.8690 2.1802 1.0674 0.0312  0.0946  0.1647  193 PHE A CG  
1187 C  CD1 . PHE A 201 ? 1.8948 2.1868 1.0831 0.0300  0.0729  0.1400  193 PHE A CD1 
1188 C  CD2 . PHE A 201 ? 1.8422 2.1001 1.0818 0.0183  0.1015  0.1786  193 PHE A CD2 
1189 C  CE1 . PHE A 201 ? 1.8747 2.0982 1.0937 0.0158  0.0597  0.1314  193 PHE A CE1 
1190 C  CE2 . PHE A 201 ? 1.8330 2.0175 1.1014 0.0072  0.0878  0.1695  193 PHE A CE2 
1191 C  CZ  . PHE A 201 ? 1.8299 1.9985 1.0882 0.0058  0.0676  0.1467  193 PHE A CZ  
1192 N  N   . PHE A 202 ? 1.9497 2.3473 1.1253 0.0021  0.1335  0.3223  194 PHE A N   
1193 C  CA  . PHE A 202 ? 1.9288 2.2588 1.1284 -0.0205 0.1352  0.3663  194 PHE A CA  
1194 C  C   . PHE A 202 ? 1.9816 2.3040 1.1477 -0.0257 0.1342  0.4244  194 PHE A C   
1195 O  O   . PHE A 202 ? 1.9730 2.2322 1.1483 -0.0441 0.1363  0.4638  194 PHE A O   
1196 C  CB  . PHE A 202 ? 1.9238 2.2585 1.1507 -0.0422 0.1560  0.3779  194 PHE A CB  
1197 C  CG  . PHE A 202 ? 1.8924 2.1765 1.1646 -0.0433 0.1515  0.3426  194 PHE A CG  
1198 C  CD1 . PHE A 202 ? 1.8925 2.1367 1.1742 -0.0266 0.1327  0.2993  194 PHE A CD1 
1199 C  CD2 . PHE A 202 ? 1.8943 2.1733 1.1975 -0.0638 0.1659  0.3541  194 PHE A CD2 
1200 C  CE1 . PHE A 202 ? 1.8686 2.0629 1.1865 -0.0278 0.1292  0.2706  194 PHE A CE1 
1201 C  CE2 . PHE A 202 ? 1.8796 2.1154 1.2214 -0.0617 0.1614  0.3234  194 PHE A CE2 
1202 C  CZ  . PHE A 202 ? 1.8460 2.0360 1.1934 -0.0425 0.1433  0.2829  194 PHE A CZ  
1203 N  N   . THR A 203 ? 2.0157 2.3969 1.1379 -0.0080 0.1304  0.4297  195 THR A N   
1204 C  CA  . THR A 203 ? 2.0578 2.4288 1.1397 -0.0066 0.1281  0.4866  195 THR A CA  
1205 C  C   . THR A 203 ? 2.0845 2.3986 1.1692 0.0108  0.1033  0.4875  195 THR A C   
1206 O  O   . THR A 203 ? 2.1191 2.3912 1.1769 0.0150  0.0987  0.5361  195 THR A O   
1207 C  CB  . THR A 203 ? 2.1779 2.6407 1.2075 0.0091  0.1329  0.4958  195 THR A CB  
1208 O  OG1 . THR A 203 ? 2.2494 2.6922 1.2343 0.0121  0.1307  0.5566  195 THR A OG1 
1209 C  CG2 . THR A 203 ? 2.1507 2.6603 1.1737 0.0370  0.1139  0.4404  195 THR A CG2 
1210 N  N   . ASN A 204 ? 2.0714 2.3837 1.1852 0.0212  0.0874  0.4340  196 ASN A N   
1211 C  CA  . ASN A 204 ? 2.0647 2.3451 1.1857 0.0371  0.0639  0.4281  196 ASN A CA  
1212 C  C   . ASN A 204 ? 2.0363 2.2552 1.2096 0.0262  0.0569  0.3973  196 ASN A C   
1213 O  O   . ASN A 204 ? 2.0338 2.2302 1.2197 0.0366  0.0388  0.3902  196 ASN A O   
1214 C  CB  . ASN A 204 ? 2.0125 2.3671 1.1099 0.0579  0.0474  0.3944  196 ASN A CB  
1215 C  CG  . ASN A 204 ? 1.9926 2.3932 1.0948 0.0525  0.0519  0.3386  196 ASN A CG  
1216 O  OD1 . ASN A 204 ? 1.9595 2.3289 1.0914 0.0379  0.0628  0.3164  196 ASN A OD1 
1217 N  ND2 . ASN A 204 ? 2.0200 2.4937 1.0884 0.0673  0.0425  0.3144  196 ASN A ND2 
1218 N  N   . HIS A 205 ? 1.8533 2.0532 1.0559 0.0071  0.0714  0.3794  197 HIS A N   
1219 C  CA  . HIS A 205 ? 1.8034 1.9427 1.0527 -0.0039 0.0673  0.3553  197 HIS A CA  
1220 C  C   . HIS A 205 ? 1.8277 1.9161 1.0978 -0.0241 0.0831  0.3858  197 HIS A C   
1221 O  O   . HIS A 205 ? 1.8512 1.9604 1.1025 -0.0353 0.0999  0.4171  197 HIS A O   
1222 C  CB  . HIS A 205 ? 1.7837 1.9404 1.0485 -0.0054 0.0664  0.2973  197 HIS A CB  
1223 C  CG  . HIS A 205 ? 1.8160 1.9996 1.0694 0.0042  0.0469  0.2594  197 HIS A CG  
1224 N  ND1 . HIS A 205 ? 1.7987 1.9521 1.0742 0.0012  0.0297  0.2458  197 HIS A ND1 
1225 C  CD2 . HIS A 205 ? 1.8623 2.1053 1.0836 0.0135  0.0416  0.2303  197 HIS A CD2 
1226 C  CE1 . HIS A 205 ? 1.8141 2.0093 1.0731 0.0040  0.0149  0.2110  197 HIS A CE1 
1227 N  NE2 . HIS A 205 ? 1.8555 2.1011 1.0804 0.0117  0.0210  0.1999  197 HIS A NE2 
1228 N  N   . THR A 206 ? 1.7592 1.7862 1.0671 -0.0317 0.0777  0.3759  198 THR A N   
1229 C  CA  . THR A 206 ? 1.7432 1.7205 1.0726 -0.0530 0.0900  0.3999  198 THR A CA  
1230 C  C   . THR A 206 ? 1.7179 1.6529 1.0931 -0.0595 0.0862  0.3682  198 THR A C   
1231 O  O   . THR A 206 ? 1.6975 1.6164 1.0865 -0.0489 0.0709  0.3420  198 THR A O   
1232 C  CB  . THR A 206 ? 1.8620 1.7825 1.1712 -0.0545 0.0860  0.4499  198 THR A CB  
1233 O  OG1 . THR A 206 ? 1.8524 1.7171 1.1834 -0.0797 0.0956  0.4666  198 THR A OG1 
1234 C  CG2 . THR A 206 ? 1.8645 1.7557 1.1756 -0.0303 0.0640  0.4429  198 THR A CG2 
1235 N  N   . LEU A 207 ? 1.6605 1.5843 1.0579 -0.0785 0.1006  0.3717  199 LEU A N   
1236 C  CA  . LEU A 207 ? 1.6159 1.5011 1.0542 -0.0841 0.0984  0.3464  199 LEU A CA  
1237 C  C   . LEU A 207 ? 1.6371 1.4598 1.0909 -0.1011 0.0988  0.3755  199 LEU A C   
1238 O  O   . LEU A 207 ? 1.6629 1.4781 1.1003 -0.1192 0.1085  0.4126  199 LEU A O   
1239 C  CB  . LEU A 207 ? 1.5977 1.5236 1.0507 -0.0872 0.1122  0.3208  199 LEU A CB  
1240 C  CG  . LEU A 207 ? 1.6320 1.5890 1.0757 -0.0665 0.1080  0.2757  199 LEU A CG  
1241 C  CD1 . LEU A 207 ? 1.6327 1.6315 1.0834 -0.0619 0.1228  0.2560  199 LEU A CD1 
1242 C  CD2 . LEU A 207 ? 1.6181 1.5237 1.0781 -0.0605 0.0918  0.2464  199 LEU A CD2 
1243 N  N   . VAL A 208 ? 1.6307 1.4064 1.1124 -0.0973 0.0880  0.3583  200 VAL A N   
1244 C  CA  . VAL A 208 ? 1.6244 1.3373 1.1202 -0.1104 0.0865  0.3787  200 VAL A CA  
1245 C  C   . VAL A 208 ? 1.6044 1.2972 1.1408 -0.1141 0.0850  0.3496  200 VAL A C   
1246 O  O   . VAL A 208 ? 1.5676 1.2619 1.1173 -0.0998 0.0758  0.3197  200 VAL A O   
1247 C  CB  . VAL A 208 ? 1.6793 1.3450 1.1558 -0.0935 0.0708  0.3983  200 VAL A CB  
1248 C  CG1 . VAL A 208 ? 1.6682 1.3569 1.1510 -0.0696 0.0559  0.3692  200 VAL A CG1 
1249 C  CG2 . VAL A 208 ? 1.6756 1.2680 1.1649 -0.1019 0.0669  0.4105  200 VAL A CG2 
1250 N  N   . LEU A 209 ? 1.6308 1.3074 1.1843 -0.1361 0.0941  0.3592  201 LEU A N   
1251 C  CA  . LEU A 209 ? 1.5898 1.2485 1.1797 -0.1391 0.0926  0.3356  201 LEU A CA  
1252 C  C   . LEU A 209 ? 1.6199 1.2093 1.2162 -0.1415 0.0818  0.3470  201 LEU A C   
1253 O  O   . LEU A 209 ? 1.6614 1.2120 1.2379 -0.1549 0.0823  0.3773  201 LEU A O   
1254 C  CB  . LEU A 209 ? 1.5780 1.2753 1.1849 -0.1597 0.1079  0.3341  201 LEU A CB  
1255 C  CG  . LEU A 209 ? 1.5722 1.2714 1.2140 -0.1561 0.1075  0.3056  201 LEU A CG  
1256 C  CD1 . LEU A 209 ? 1.5615 1.2839 1.2033 -0.1288 0.1047  0.2719  201 LEU A CD1 
1257 C  CD2 . LEU A 209 ? 1.5886 1.3309 1.2474 -0.1797 0.1212  0.3107  201 LEU A CD2 
1258 N  N   . HIS A 210 ? 1.4900 1.0599 1.1089 -0.1282 0.0721  0.3230  202 HIS A N   
1259 C  CA  . HIS A 210 ? 1.4959 1.0072 1.1192 -0.1237 0.0610  0.3294  202 HIS A CA  
1260 C  C   . HIS A 210 ? 1.4854 0.9865 1.1415 -0.1199 0.0565  0.3029  202 HIS A C   
1261 O  O   . HIS A 210 ? 1.4498 0.9819 1.1208 -0.1154 0.0589  0.2788  202 HIS A O   
1262 C  CB  . HIS A 210 ? 1.5372 1.0367 1.1375 -0.0992 0.0481  0.3379  202 HIS A CB  
1263 C  CG  . HIS A 210 ? 1.5472 1.0919 1.1528 -0.0840 0.0426  0.3132  202 HIS A CG  
1264 N  ND1 . HIS A 210 ? 1.5540 1.0966 1.1743 -0.0704 0.0311  0.2952  202 HIS A ND1 
1265 C  CD2 . HIS A 210 ? 1.5562 1.1492 1.1514 -0.0834 0.0467  0.3026  202 HIS A CD2 
1266 C  CE1 . HIS A 210 ? 1.5447 1.1293 1.1633 -0.0673 0.0285  0.2755  202 HIS A CE1 
1267 N  NE2 . HIS A 210 ? 1.5491 1.1605 1.1511 -0.0735 0.0370  0.2781  202 HIS A NE2 
1268 N  N   . VAL A 211 ? 1.5139 0.9656 1.1755 -0.1205 0.0496  0.3081  203 VAL A N   
1269 C  CA  . VAL A 211 ? 1.4817 0.9225 1.1711 -0.1158 0.0446  0.2861  203 VAL A CA  
1270 C  C   . VAL A 211 ? 1.5438 0.9444 1.2259 -0.0960 0.0309  0.2890  203 VAL A C   
1271 O  O   . VAL A 211 ? 1.5819 0.9474 1.2364 -0.0888 0.0259  0.3103  203 VAL A O   
1272 C  CB  . VAL A 211 ? 1.4896 0.9226 1.1974 -0.1387 0.0516  0.2839  203 VAL A CB  
1273 C  CG1 . VAL A 211 ? 1.5323 0.9085 1.2225 -0.1539 0.0488  0.3053  203 VAL A CG1 
1274 C  CG2 . VAL A 211 ? 1.4489 0.8848 1.1846 -0.1313 0.0478  0.2593  203 VAL A CG2 
1275 N  N   . ALA A 212 ? 1.5221 0.9289 1.2247 -0.0843 0.0247  0.2684  204 ALA A N   
1276 C  CA  . ALA A 212 ? 1.5526 0.9355 1.2510 -0.0615 0.0122  0.2673  204 ALA A CA  
1277 C  C   . ALA A 212 ? 1.6000 0.9178 1.2839 -0.0628 0.0083  0.2800  204 ALA A C   
1278 O  O   . ALA A 212 ? 1.5854 0.8834 1.2754 -0.0882 0.0152  0.2819  204 ALA A O   
1279 C  CB  . ALA A 212 ? 1.5318 0.9378 1.2562 -0.0557 0.0092  0.2438  204 ALA A CB  
1280 N  N   . ARG A 213 ? 1.6496 0.9348 1.3112 -0.0349 -0.0034 0.2872  205 ARG A N   
1281 C  CA  . ARG A 213 ? 1.6937 0.8988 1.3289 -0.0323 -0.0094 0.2989  205 ARG A CA  
1282 C  C   . ARG A 213 ? 1.7140 0.8963 1.3694 -0.0382 -0.0120 0.2785  205 ARG A C   
1283 O  O   . ARG A 213 ? 1.7448 0.8595 1.3823 -0.0507 -0.0146 0.2833  205 ARG A O   
1284 C  CB  . ARG A 213 ? 1.7460 0.9205 1.3455 0.0098  -0.0230 0.3102  205 ARG A CB  
1285 C  CG  . ARG A 213 ? 1.8250 0.9874 1.3870 0.0138  -0.0221 0.3392  205 ARG A CG  
1286 C  CD  . ARG A 213 ? 1.9215 1.0602 1.4463 0.0644  -0.0373 0.3492  205 ARG A CD  
1287 N  NE  . ARG A 213 ? 2.0125 1.1237 1.4919 0.0703  -0.0374 0.3815  205 ARG A NE  
1288 C  CZ  . ARG A 213 ? 2.1323 1.2753 1.5884 0.1104  -0.0467 0.3912  205 ARG A CZ  
1289 N  NH1 . ARG A 213 ? 2.0488 1.2593 1.5260 0.1450  -0.0562 0.3700  205 ARG A NH1 
1290 N  NH2 . ARG A 213 ? 2.0494 1.1642 1.4604 0.1148  -0.0462 0.4230  205 ARG A NH2 
1291 N  N   . SER A 214 ? 1.6696 0.9060 1.3584 -0.0315 -0.0116 0.2560  206 SER A N   
1292 C  CA  . SER A 214 ? 1.6654 0.8912 1.3732 -0.0335 -0.0142 0.2360  206 SER A CA  
1293 C  C   . SER A 214 ? 1.6584 0.8973 1.3889 -0.0699 -0.0037 0.2302  206 SER A C   
1294 O  O   . SER A 214 ? 1.6546 0.8725 1.3936 -0.0795 -0.0060 0.2180  206 SER A O   
1295 C  CB  . SER A 214 ? 1.6815 0.9623 1.4114 -0.0114 -0.0178 0.2174  206 SER A CB  
1296 O  OG  . SER A 214 ? 1.7106 1.0492 1.4609 -0.0260 -0.0089 0.2137  206 SER A OG  
1297 N  N   . GLU A 215 ? 1.5898 0.8689 1.3285 -0.0871 0.0069  0.2372  207 GLU A N   
1298 C  CA  . GLU A 215 ? 1.5373 0.8466 1.2981 -0.1136 0.0171  0.2303  207 GLU A CA  
1299 C  C   . GLU A 215 ? 1.5746 0.8648 1.3233 -0.1451 0.0238  0.2468  207 GLU A C   
1300 O  O   . GLU A 215 ? 1.5469 0.8669 1.3138 -0.1688 0.0312  0.2408  207 GLU A O   
1301 C  CB  . GLU A 215 ? 1.4996 0.8660 1.2733 -0.1101 0.0249  0.2243  207 GLU A CB  
1302 C  CG  . GLU A 215 ? 1.5184 0.9046 1.3002 -0.0889 0.0198  0.2105  207 GLU A CG  
1303 C  CD  . GLU A 215 ? 1.6221 1.0463 1.4060 -0.0898 0.0264  0.2046  207 GLU A CD  
1304 O  OE1 . GLU A 215 ? 1.5425 0.9809 1.3286 -0.0805 0.0232  0.1950  207 GLU A OE1 
1305 O  OE2 . GLU A 215 ? 1.6177 1.0570 1.3982 -0.1008 0.0348  0.2091  207 GLU A OE2 
1306 N  N   . MET A 216 ? 1.6345 0.8793 1.3504 -0.1454 0.0211  0.2686  208 MET A N   
1307 C  CA  . MET A 216 ? 1.6598 0.8898 1.3577 -0.1793 0.0294  0.2904  208 MET A CA  
1308 C  C   . MET A 216 ? 1.7007 0.8973 1.4000 -0.2151 0.0294  0.2878  208 MET A C   
1309 O  O   . MET A 216 ? 1.7068 0.9189 1.4036 -0.2536 0.0394  0.3006  208 MET A O   
1310 C  CB  . MET A 216 ? 1.7372 0.9139 1.3910 -0.1682 0.0248  0.3172  208 MET A CB  
1311 C  CG  . MET A 216 ? 1.8205 0.9088 1.4438 -0.1489 0.0101  0.3195  208 MET A CG  
1312 S  SD  . MET A 216 ? 1.9252 0.9596 1.4961 -0.1277 0.0048  0.3516  208 MET A SD  
1313 C  CE  . MET A 216 ? 1.9500 0.9079 1.5038 -0.0934 -0.0126 0.3388  208 MET A CE  
1314 N  N   . ASP A 217 ? 1.7001 0.8572 1.4026 -0.2046 0.0184  0.2700  209 ASP A N   
1315 C  CA  . ASP A 217 ? 1.7248 0.8455 1.4254 -0.2401 0.0160  0.2634  209 ASP A CA  
1316 C  C   . ASP A 217 ? 1.6723 0.8712 1.4171 -0.2557 0.0218  0.2408  209 ASP A C   
1317 O  O   . ASP A 217 ? 1.6851 0.8769 1.4355 -0.2891 0.0204  0.2317  209 ASP A O   
1318 C  CB  . ASP A 217 ? 1.7935 0.8311 1.4708 -0.2185 0.0000  0.2522  209 ASP A CB  
1319 C  CG  . ASP A 217 ? 1.8696 0.9350 1.5655 -0.1715 -0.0074 0.2314  209 ASP A CG  
1320 O  OD1 . ASP A 217 ? 1.8563 0.9672 1.5611 -0.1454 -0.0040 0.2363  209 ASP A OD1 
1321 O  OD2 . ASP A 217 ? 1.9120 0.9584 1.6132 -0.1628 -0.0163 0.2093  209 ASP A OD2 
1322 N  N   . LYS A 218 ? 1.5821 0.8532 1.3543 -0.2315 0.0275  0.2317  210 LYS A N   
1323 C  CA  . LYS A 218 ? 1.5259 0.8701 1.3342 -0.2357 0.0323  0.2119  210 LYS A CA  
1324 C  C   . LYS A 218 ? 1.5311 0.9490 1.3521 -0.2524 0.0466  0.2194  210 LYS A C   
1325 O  O   . LYS A 218 ? 1.5083 0.9924 1.3554 -0.2577 0.0513  0.2053  210 LYS A O   
1326 C  CB  . LYS A 218 ? 1.4955 0.8617 1.3191 -0.1953 0.0281  0.1950  210 LYS A CB  
1327 C  CG  . LYS A 218 ? 1.5281 0.8522 1.3491 -0.1782 0.0153  0.1801  210 LYS A CG  
1328 C  CD  . LYS A 218 ? 1.6228 0.8869 1.4160 -0.1558 0.0071  0.1898  210 LYS A CD  
1329 C  CE  . LYS A 218 ? 1.7710 1.0075 1.5623 -0.1317 -0.0049 0.1719  210 LYS A CE  
1330 N  NZ  . LYS A 218 ? 1.9344 1.1242 1.6982 -0.1021 -0.0135 0.1793  210 LYS A NZ  
1331 N  N   . VAL A 219 ? 1.5032 0.9148 1.3038 -0.2569 0.0532  0.2411  211 VAL A N   
1332 C  CA  . VAL A 219 ? 1.4921 0.9787 1.3011 -0.2644 0.0670  0.2468  211 VAL A CA  
1333 C  C   . VAL A 219 ? 1.5780 1.0536 1.3622 -0.2983 0.0751  0.2749  211 VAL A C   
1334 O  O   . VAL A 219 ? 1.6152 1.0169 1.3675 -0.2997 0.0696  0.2936  211 VAL A O   
1335 C  CB  . VAL A 219 ? 1.4887 0.9992 1.2974 -0.2243 0.0686  0.2405  211 VAL A CB  
1336 C  CG1 . VAL A 219 ? 1.5066 0.9630 1.2869 -0.2099 0.0631  0.2561  211 VAL A CG1 
1337 C  CG2 . VAL A 219 ? 1.4797 1.0682 1.2949 -0.2242 0.0817  0.2396  211 VAL A CG2 
1338 N  N   . ARG A 220 ? 1.5519 1.1045 1.3485 -0.3242 0.0882  0.2785  212 ARG A N   
1339 C  CA  . ARG A 220 ? 1.5932 1.1539 1.3664 -0.3577 0.0990  0.3070  212 ARG A CA  
1340 C  C   . ARG A 220 ? 1.6164 1.2787 1.4008 -0.3460 0.1132  0.3049  212 ARG A C   
1341 O  O   . ARG A 220 ? 1.5910 1.3336 1.4051 -0.3373 0.1179  0.2840  212 ARG A O   
1342 C  CB  . ARG A 220 ? 1.6278 1.1809 1.3988 -0.4173 0.1019  0.3171  212 ARG A CB  
1343 C  CG  . ARG A 220 ? 1.7226 1.2777 1.4637 -0.4603 0.1140  0.3513  212 ARG A CG  
1344 C  CD  . ARG A 220 ? 1.7791 1.3131 1.5123 -0.5283 0.1158  0.3618  212 ARG A CD  
1345 N  NE  . ARG A 220 ? 1.7961 1.1997 1.5019 -0.5348 0.0995  0.3620  212 ARG A NE  
1346 C  CZ  . ARG A 220 ? 1.8545 1.2402 1.5792 -0.5422 0.0888  0.3359  212 ARG A CZ  
1347 N  NH1 . ARG A 220 ? 1.6969 1.1894 1.4691 -0.5447 0.0925  0.3097  212 ARG A NH1 
1348 N  NH2 . ARG A 220 ? 1.8078 1.0833 1.5094 -0.5334 0.0736  0.3300  212 ARG A NH2 
1349 N  N   . VAL A 221 ? 1.5864 1.2458 1.3435 -0.3414 0.1193  0.3256  213 VAL A N   
1350 C  CA  . VAL A 221 ? 1.5768 1.3260 1.3376 -0.3237 0.1316  0.3212  213 VAL A CA  
1351 C  C   . VAL A 221 ? 1.6465 1.4469 1.3919 -0.3647 0.1471  0.3484  213 VAL A C   
1352 O  O   . VAL A 221 ? 1.6859 1.4256 1.3988 -0.3919 0.1472  0.3790  213 VAL A O   
1353 C  CB  . VAL A 221 ? 1.5927 1.3144 1.3340 -0.2795 0.1261  0.3175  213 VAL A CB  
1354 C  CG1 . VAL A 221 ? 1.5900 1.3977 1.3302 -0.2584 0.1373  0.3076  213 VAL A CG1 
1355 C  CG2 . VAL A 221 ? 1.5560 1.2307 1.3104 -0.2458 0.1119  0.2936  213 VAL A CG2 
1356 N  N   . PHE A 222 ? 1.5411 1.4550 1.3067 -0.3672 0.1604  0.3380  214 PHE A N   
1357 C  CA  . PHE A 222 ? 1.5679 1.5543 1.3220 -0.4061 0.1776  0.3623  214 PHE A CA  
1358 C  C   . PHE A 222 ? 1.6101 1.6709 1.3533 -0.3698 0.1875  0.3572  214 PHE A C   
1359 O  O   . PHE A 222 ? 1.5831 1.6726 1.3385 -0.3196 0.1839  0.3267  214 PHE A O   
1360 C  CB  . PHE A 222 ? 1.5692 1.6495 1.3555 -0.4458 0.1868  0.3553  214 PHE A CB  
1361 C  CG  . PHE A 222 ? 1.5848 1.5978 1.3776 -0.4915 0.1779  0.3599  214 PHE A CG  
1362 C  CD1 . PHE A 222 ? 1.6513 1.6109 1.4156 -0.5540 0.1816  0.3935  214 PHE A CD1 
1363 C  CD2 . PHE A 222 ? 1.5673 1.5660 1.3893 -0.4722 0.1654  0.3303  214 PHE A CD2 
1364 C  CE1 . PHE A 222 ? 1.6779 1.5651 1.4416 -0.5967 0.1720  0.3943  214 PHE A CE1 
1365 C  CE2 . PHE A 222 ? 1.5988 1.5368 1.4240 -0.5131 0.1562  0.3308  214 PHE A CE2 
1366 C  CZ  . PHE A 222 ? 1.6357 1.5152 1.4312 -0.5756 0.1591  0.3612  214 PHE A CZ  
1367 N  N   . GLN A 223 ? 1.6163 1.7029 1.3314 -0.3956 0.1997  0.3874  215 GLN A N   
1368 C  CA  . GLN A 223 ? 1.6192 1.7903 1.3214 -0.3659 0.2108  0.3827  215 GLN A CA  
1369 C  C   . GLN A 223 ? 1.6453 1.9534 1.3619 -0.3970 0.2309  0.3883  215 GLN A C   
1370 O  O   . GLN A 223 ? 1.6632 1.9828 1.3722 -0.4582 0.2405  0.4201  215 GLN A O   
1371 C  CB  . GLN A 223 ? 1.6603 1.7761 1.3172 -0.3643 0.2102  0.4115  215 GLN A CB  
1372 C  CG  . GLN A 223 ? 1.7701 1.9745 1.4091 -0.3359 0.2215  0.4066  215 GLN A CG  
1373 C  CD  . GLN A 223 ? 1.8780 2.0349 1.4705 -0.3357 0.2203  0.4367  215 GLN A CD  
1374 O  OE1 . GLN A 223 ? 1.8605 1.9178 1.4319 -0.3561 0.2115  0.4642  215 GLN A OE1 
1375 N  NE2 . GLN A 223 ? 1.7864 2.0151 1.3594 -0.3086 0.2282  0.4303  215 GLN A NE2 
1376 N  N   . ALA A 224 ? 1.6182 2.0300 1.3524 -0.3548 0.2369  0.3570  216 ALA A N   
1377 C  CA  . ALA A 224 ? 1.6150 2.1791 1.3671 -0.3745 0.2557  0.3564  216 ALA A CA  
1378 C  C   . ALA A 224 ? 1.6768 2.3177 1.3990 -0.3688 0.2715  0.3711  216 ALA A C   
1379 O  O   . ALA A 224 ? 1.6916 2.3039 1.3884 -0.3195 0.2666  0.3587  216 ALA A O   
1380 C  CB  . ALA A 224 ? 1.5926 2.2356 1.3774 -0.3254 0.2533  0.3134  216 ALA A CB  
1381 N  N   . THR A 225 ? 1.6406 2.3834 1.3647 -0.4224 0.2905  0.3971  217 THR A N   
1382 C  CA  . THR A 225 ? 1.6526 2.4837 1.3477 -0.4232 0.3079  0.4147  217 THR A CA  
1383 C  C   . THR A 225 ? 1.6399 2.6613 1.3605 -0.4149 0.3261  0.3962  217 THR A C   
1384 O  O   . THR A 225 ? 1.6412 2.7442 1.3936 -0.4622 0.3346  0.4013  217 THR A O   
1385 C  CB  . THR A 225 ? 1.7073 2.4957 1.3698 -0.4969 0.3173  0.4704  217 THR A CB  
1386 O  OG1 . THR A 225 ? 1.7249 2.3380 1.3633 -0.4997 0.2989  0.4864  217 THR A OG1 
1387 C  CG2 . THR A 225 ? 1.7422 2.6102 1.3681 -0.4910 0.3338  0.4902  217 THR A CG2 
1388 N  N   . LYS A 232 ? 1.6764 2.6348 1.5041 -0.7148 0.3150  0.4438  224 LYS A N   
1389 C  CA  . LYS A 232 ? 1.7015 2.5439 1.4786 -0.6964 0.3138  0.4706  224 LYS A CA  
1390 C  C   . LYS A 232 ? 1.7334 2.4329 1.4999 -0.6420 0.2950  0.4567  224 LYS A C   
1391 O  O   . LYS A 232 ? 1.7122 2.4205 1.4775 -0.5667 0.2904  0.4318  224 LYS A O   
1392 C  CB  . LYS A 232 ? 1.6867 2.6491 1.4513 -0.6564 0.3300  0.4703  224 LYS A CB  
1393 N  N   . CYS A 233 ? 1.8406 2.3996 1.5995 -0.6735 0.2799  0.4659  225 CYS A N   
1394 C  CA  . CYS A 233 ? 1.8316 2.2491 1.5841 -0.6195 0.2579  0.4484  225 CYS A CA  
1395 C  C   . CYS A 233 ? 1.9013 2.1503 1.6105 -0.6550 0.2476  0.4820  225 CYS A C   
1396 O  O   . CYS A 233 ? 1.9384 2.1487 1.6409 -0.7148 0.2471  0.4980  225 CYS A O   
1397 C  CB  . CYS A 233 ? 1.7933 2.2234 1.5910 -0.5968 0.2452  0.4084  225 CYS A CB  
1398 S  SG  . CYS A 233 ? 1.7850 2.3887 1.6249 -0.5340 0.2523  0.3651  225 CYS A SG  
1399 N  N   . SER A 234 ? 1.7609 1.9055 1.4438 -0.6039 0.2349  0.4829  226 SER A N   
1400 C  CA  . SER A 234 ? 1.8096 1.7951 1.4473 -0.6213 0.2232  0.5124  226 SER A CA  
1401 C  C   . SER A 234 ? 1.7990 1.6831 1.4413 -0.5620 0.2015  0.4876  226 SER A C   
1402 O  O   . SER A 234 ? 1.7444 1.6717 1.4100 -0.5041 0.1975  0.4567  226 SER A O   
1403 C  CB  . SER A 234 ? 1.8909 1.8586 1.4829 -0.6172 0.2305  0.5455  226 SER A CB  
1404 O  OG  . SER A 234 ? 1.9385 1.9502 1.5244 -0.5607 0.2317  0.5364  226 SER A OG  
1405 N  N   . VAL A 235 ? 1.8598 1.6077 1.4758 -0.5774 0.1875  0.5012  227 VAL A N   
1406 C  CA  . VAL A 235 ? 1.8330 1.4905 1.4535 -0.5261 0.1672  0.4788  227 VAL A CA  
1407 C  C   . VAL A 235 ? 1.8675 1.4805 1.4562 -0.4757 0.1608  0.4892  227 VAL A C   
1408 O  O   . VAL A 235 ? 1.9252 1.4882 1.4669 -0.4880 0.1631  0.5250  227 VAL A O   
1409 C  CB  . VAL A 235 ? 1.8970 1.4340 1.5054 -0.5464 0.1529  0.4799  227 VAL A CB  
1410 C  CG1 . VAL A 235 ? 1.8684 1.3290 1.4805 -0.4997 0.1340  0.4586  227 VAL A CG1 
1411 C  CG2 . VAL A 235 ? 1.8856 1.4698 1.5249 -0.5992 0.1577  0.4668  227 VAL A CG2 
1412 N  N   . VAL A 236 ? 1.8074 1.4409 1.4205 -0.4194 0.1524  0.4573  228 VAL A N   
1413 C  CA  . VAL A 236 ? 1.8074 1.4038 1.3954 -0.3725 0.1435  0.4607  228 VAL A CA  
1414 C  C   . VAL A 236 ? 1.8107 1.3192 1.4023 -0.3402 0.1237  0.4445  228 VAL A C   
1415 O  O   . VAL A 236 ? 1.8467 1.2850 1.4046 -0.3186 0.1132  0.4603  228 VAL A O   
1416 C  CB  . VAL A 236 ? 1.7962 1.4883 1.4009 -0.3353 0.1495  0.4373  228 VAL A CB  
1417 C  CG1 . VAL A 236 ? 1.8268 1.5941 1.4097 -0.3542 0.1670  0.4603  228 VAL A CG1 
1418 C  CG2 . VAL A 236 ? 1.7453 1.4990 1.3971 -0.3233 0.1509  0.3989  228 VAL A CG2 
1419 N  N   . LEU A 237 ? 1.7278 1.2474 1.3591 -0.3347 0.1188  0.4133  229 LEU A N   
1420 C  CA  . LEU A 237 ? 1.6967 1.1471 1.3350 -0.3054 0.1016  0.3957  229 LEU A CA  
1421 C  C   . LEU A 237 ? 1.7126 1.1281 1.3689 -0.3321 0.0971  0.3852  229 LEU A C   
1422 O  O   . LEU A 237 ? 1.7048 1.1777 1.3848 -0.3648 0.1067  0.3787  229 LEU A O   
1423 C  CB  . LEU A 237 ? 1.6366 1.1334 1.3022 -0.2624 0.0975  0.3638  229 LEU A CB  
1424 C  CG  . LEU A 237 ? 1.6721 1.1968 1.3194 -0.2332 0.0980  0.3662  229 LEU A CG  
1425 C  CD1 . LEU A 237 ? 1.6233 1.1784 1.2937 -0.1996 0.0929  0.3325  229 LEU A CD1 
1426 C  CD2 . LEU A 237 ? 1.7383 1.1956 1.3479 -0.2198 0.0876  0.3895  229 LEU A CD2 
1427 N  N   . GLY A 238 ? 1.7197 1.0480 1.3639 -0.3160 0.0818  0.3815  230 GLY A N   
1428 C  CA  . GLY A 238 ? 1.7272 1.0122 1.3826 -0.3370 0.0748  0.3684  230 GLY A CA  
1429 C  C   . GLY A 238 ? 1.8096 0.9875 1.4352 -0.3135 0.0580  0.3709  230 GLY A C   
1430 O  O   . GLY A 238 ? 1.8216 0.9765 1.4277 -0.2739 0.0513  0.3779  230 GLY A O   
1431 N  N   . PRO A 239 ? 1.7861 0.9219 1.4195 -0.3279 0.0510  0.3568  231 PRO A N   
1432 C  CA  . PRO A 239 ? 1.8358 0.8899 1.4505 -0.2958 0.0358  0.3510  231 PRO A CA  
1433 C  C   . PRO A 239 ? 1.9592 0.9641 1.5342 -0.2872 0.0356  0.3795  231 PRO A C   
1434 O  O   . PRO A 239 ? 1.9858 0.9979 1.5488 -0.3256 0.0467  0.4003  231 PRO A O   
1435 C  CB  . PRO A 239 ? 1.8661 0.8910 1.4908 -0.3278 0.0316  0.3328  231 PRO A CB  
1436 C  CG  . PRO A 239 ? 1.8332 0.9354 1.4921 -0.3611 0.0405  0.3206  231 PRO A CG  
1437 C  CD  . PRO A 239 ? 1.7758 0.9434 1.4340 -0.3738 0.0557  0.3429  231 PRO A CD  
1438 N  N   . LYS A 240 ? 1.9875 0.9478 1.5405 -0.2375 0.0231  0.3812  232 LYS A N   
1439 C  CA  . LYS A 240 ? 2.0634 0.9738 1.5735 -0.2195 0.0200  0.4090  232 LYS A CA  
1440 C  C   . LYS A 240 ? 2.1060 1.0671 1.6045 -0.2288 0.0326  0.4368  232 LYS A C   
1441 O  O   . LYS A 240 ? 2.1585 1.0870 1.6210 -0.2280 0.0344  0.4652  232 LYS A O   
1442 C  CB  . LYS A 240 ? 2.1528 0.9885 1.6384 -0.2480 0.0188  0.4174  232 LYS A CB  
1443 N  N   . TRP A 241 ? 1.9838 1.0219 1.5083 -0.2365 0.0410  0.4287  233 TRP A N   
1444 C  CA  . TRP A 241 ? 1.9833 1.0754 1.4937 -0.2417 0.0522  0.4504  233 TRP A CA  
1445 C  C   . TRP A 241 ? 1.9114 1.0610 1.4390 -0.2234 0.0518  0.4337  233 TRP A C   
1446 O  O   . TRP A 241 ? 1.8482 1.0773 1.4113 -0.2431 0.0638  0.4198  233 TRP A O   
1447 C  CB  . TRP A 241 ? 1.9960 1.1284 1.5112 -0.2965 0.0702  0.4648  233 TRP A CB  
1448 C  CG  . TRP A 241 ? 2.0770 1.1935 1.5533 -0.3057 0.0775  0.5003  233 TRP A CG  
1449 C  CD1 . TRP A 241 ? 2.1513 1.2147 1.5886 -0.2696 0.0683  0.5206  233 TRP A CD1 
1450 C  CD2 . TRP A 241 ? 2.0995 1.2587 1.5700 -0.3534 0.0956  0.5211  233 TRP A CD2 
1451 N  NE1 . TRP A 241 ? 2.2019 1.2653 1.6081 -0.2912 0.0797  0.5540  233 TRP A NE1 
1452 C  CE2 . TRP A 241 ? 2.1947 1.3175 1.6210 -0.3438 0.0972  0.5545  233 TRP A CE2 
1453 C  CE3 . TRP A 241 ? 2.0840 1.3161 1.5817 -0.4025 0.1107  0.5153  233 TRP A CE3 
1454 C  CZ2 . TRP A 241 ? 2.2275 1.3805 1.6357 -0.3832 0.1144  0.5819  233 TRP A CZ2 
1455 C  CZ3 . TRP A 241 ? 2.1309 1.4018 1.6132 -0.4416 0.1273  0.5411  233 TRP A CZ3 
1456 C  CH2 . TRP A 241 ? 2.1992 1.4283 1.6369 -0.4326 0.1295  0.5739  233 TRP A CH2 
1457 N  N   . PRO A 242 ? 1.7905 0.9334 1.3143 -0.1752 0.0389  0.4238  234 PRO A N   
1458 C  CA  . PRO A 242 ? 1.7157 0.9375 1.2797 -0.1498 0.0379  0.3940  234 PRO A CA  
1459 C  C   . PRO A 242 ? 1.7169 1.0143 1.2813 -0.1473 0.0469  0.3977  234 PRO A C   
1460 O  O   . PRO A 242 ? 1.6589 1.0200 1.2554 -0.1420 0.0505  0.3723  234 PRO A O   
1461 C  CB  . PRO A 242 ? 1.7520 0.9419 1.3045 -0.1047 0.0210  0.3873  234 PRO A CB  
1462 C  CG  . PRO A 242 ? 1.8683 0.9852 1.3647 -0.0941 0.0149  0.4205  234 PRO A CG  
1463 C  CD  . PRO A 242 ? 1.8645 0.9357 1.3502 -0.1395 0.0243  0.4371  234 PRO A CD  
1464 N  N   . SER A 243 ? 1.7290 1.0143 1.2531 -0.1500 0.0500  0.4287  235 SER A N   
1465 C  CA  . SER A 243 ? 1.7102 1.0681 1.2290 -0.1456 0.0577  0.4318  235 SER A CA  
1466 C  C   . SER A 243 ? 1.7737 1.1361 1.2633 -0.1778 0.0718  0.4643  235 SER A C   
1467 O  O   . SER A 243 ? 1.8244 1.1170 1.2845 -0.2000 0.0726  0.4920  235 SER A O   
1468 C  CB  . SER A 243 ? 1.7516 1.1160 1.2479 -0.1048 0.0448  0.4347  235 SER A CB  
1469 O  OG  . SER A 243 ? 1.8808 1.1720 1.3303 -0.0913 0.0364  0.4665  235 SER A OG  
1470 N  N   . HIS A 244 ? 1.7894 1.2324 1.2835 -0.1813 0.0829  0.4604  236 HIS A N   
1471 C  CA  . HIS A 244 ? 1.8281 1.2963 1.2963 -0.2117 0.0984  0.4904  236 HIS A CA  
1472 C  C   . HIS A 244 ? 1.8566 1.4126 1.3193 -0.1968 0.1054  0.4836  236 HIS A C   
1473 O  O   . HIS A 244 ? 1.8047 1.4201 1.2988 -0.1841 0.1070  0.4483  236 HIS A O   
1474 C  CB  . HIS A 244 ? 1.8166 1.3051 1.3111 -0.2557 0.1122  0.4873  236 HIS A CB  
1475 C  CG  . HIS A 244 ? 1.8958 1.3845 1.3580 -0.2989 0.1266  0.5263  236 HIS A CG  
1476 N  ND1 . HIS A 244 ? 1.9079 1.4863 1.3643 -0.3113 0.1430  0.5351  236 HIS A ND1 
1477 C  CD2 . HIS A 244 ? 1.9735 1.3812 1.4034 -0.3353 0.1273  0.5594  236 HIS A CD2 
1478 C  CE1 . HIS A 244 ? 1.9610 1.5221 1.3857 -0.3561 0.1544  0.5741  236 HIS A CE1 
1479 N  NE2 . HIS A 244 ? 2.0028 1.4580 1.4135 -0.3704 0.1450  0.5868  236 HIS A NE2 
1480 N  N   . TYR A 245 ? 1.8851 1.4432 1.3023 -0.1972 0.1089  0.5174  237 TYR A N   
1481 C  CA  . TYR A 245 ? 1.8822 1.5252 1.2872 -0.1844 0.1159  0.5130  237 TYR A CA  
1482 C  C   . TYR A 245 ? 1.8950 1.6175 1.3200 -0.2118 0.1358  0.5043  237 TYR A C   
1483 O  O   . TYR A 245 ? 1.9084 1.6229 1.3368 -0.2509 0.1475  0.5235  237 TYR A O   
1484 C  CB  . TYR A 245 ? 1.9595 1.5853 1.3065 -0.1781 0.1150  0.5556  237 TYR A CB  
1485 C  CG  . TYR A 245 ? 1.9981 1.5826 1.3233 -0.1358 0.0943  0.5573  237 TYR A CG  
1486 C  CD1 . TYR A 245 ? 2.0361 1.5254 1.3505 -0.1262 0.0811  0.5702  237 TYR A CD1 
1487 C  CD2 . TYR A 245 ? 2.0090 1.6558 1.3230 -0.1042 0.0873  0.5438  237 TYR A CD2 
1488 C  CE1 . TYR A 245 ? 2.0676 1.5333 1.3626 -0.0822 0.0621  0.5705  237 TYR A CE1 
1489 C  CE2 . TYR A 245 ? 2.0387 1.6653 1.3353 -0.0659 0.0680  0.5442  237 TYR A CE2 
1490 C  CZ  . TYR A 245 ? 2.1106 1.6507 1.3988 -0.0531 0.0558  0.5581  237 TYR A CZ  
1491 O  OH  . TYR A 245 ? 2.1358 1.6689 1.4072 -0.0098 0.0365  0.5574  237 TYR A OH  
1492 N  N   . LEU A 246 ? 1.7888 1.5899 1.2247 -0.1909 0.1391  0.4738  238 LEU A N   
1493 C  CA  . LEU A 246 ? 1.7786 1.6656 1.2313 -0.2048 0.1569  0.4601  238 LEU A CA  
1494 C  C   . LEU A 246 ? 1.8680 1.8268 1.2844 -0.2063 0.1696  0.4799  238 LEU A C   
1495 O  O   . LEU A 246 ? 1.8946 1.8572 1.2804 -0.1817 0.1616  0.4830  238 LEU A O   
1496 C  CB  . LEU A 246 ? 1.7277 1.6474 1.2129 -0.1768 0.1524  0.4085  238 LEU A CB  
1497 C  CG  . LEU A 246 ? 1.7156 1.5852 1.2400 -0.1784 0.1444  0.3875  238 LEU A CG  
1498 C  CD1 . LEU A 246 ? 1.6827 1.5854 1.2289 -0.1519 0.1427  0.3413  238 LEU A CD1 
1499 C  CD2 . LEU A 246 ? 1.7312 1.5979 1.2732 -0.2169 0.1551  0.4072  238 LEU A CD2 
1500 N  N   . MET A 247 ? 1.9102 1.9352 1.3301 -0.2358 0.1893  0.4927  239 MET A N   
1501 C  CA  . MET A 247 ? 1.9468 2.0546 1.3333 -0.2394 0.2042  0.5114  239 MET A CA  
1502 C  C   . MET A 247 ? 1.9288 2.1433 1.3346 -0.2180 0.2144  0.4706  239 MET A C   
1503 O  O   . MET A 247 ? 1.9185 2.2009 1.3463 -0.2388 0.2303  0.4682  239 MET A O   
1504 C  CB  . MET A 247 ? 2.0157 2.1275 1.3820 -0.2923 0.2208  0.5626  239 MET A CB  
1505 C  CG  . MET A 247 ? 2.0935 2.0847 1.4274 -0.3109 0.2104  0.6052  239 MET A CG  
1506 S  SD  . MET A 247 ? 2.1357 2.0831 1.4197 -0.2650 0.1930  0.6185  239 MET A SD  
1507 C  CE  . MET A 247 ? 2.1466 2.2084 1.3900 -0.2695 0.2126  0.6409  239 MET A CE  
1508 N  N   . VAL A 248 ? 1.8332 2.0625 1.2279 -0.1752 0.2043  0.4368  240 VAL A N   
1509 C  CA  . VAL A 248 ? 1.8161 2.1291 1.2176 -0.1454 0.2107  0.3933  240 VAL A CA  
1510 C  C   . VAL A 248 ? 1.8772 2.2607 1.2349 -0.1286 0.2166  0.3973  240 VAL A C   
1511 O  O   . VAL A 248 ? 1.9047 2.2559 1.2306 -0.1272 0.2081  0.4203  240 VAL A O   
1512 C  CB  . VAL A 248 ? 1.8089 2.0712 1.2284 -0.1103 0.1929  0.3432  240 VAL A CB  
1513 C  CG1 . VAL A 248 ? 1.7947 2.1111 1.2353 -0.0895 0.2005  0.3036  240 VAL A CG1 
1514 C  CG2 . VAL A 248 ? 1.7854 1.9466 1.2297 -0.1239 0.1787  0.3514  240 VAL A CG2 
1515 N  N   . PRO A 249 ? 1.7323 2.2187 1.0864 -0.1129 0.2312  0.3752  241 PRO A N   
1516 C  CA  . PRO A 249 ? 1.7598 2.3165 1.0706 -0.0906 0.2353  0.3706  241 PRO A CA  
1517 C  C   . PRO A 249 ? 1.7913 2.3365 1.0897 -0.0428 0.2197  0.3130  241 PRO A C   
1518 O  O   . PRO A 249 ? 1.7702 2.2611 1.0934 -0.0273 0.2088  0.2769  241 PRO A O   
1519 C  CB  . PRO A 249 ? 1.7765 2.4571 1.0890 -0.0995 0.2605  0.3770  241 PRO A CB  
1520 C  CG  . PRO A 249 ? 1.7729 2.4542 1.1318 -0.0980 0.2627  0.3510  241 PRO A CG  
1521 C  CD  . PRO A 249 ? 1.7231 2.2814 1.1085 -0.1207 0.2474  0.3642  241 PRO A CD  
1522 N  N   . GLY A 250 ? 1.7882 2.3809 1.0442 -0.0222 0.2184  0.3051  242 GLY A N   
1523 C  CA  . GLY A 250 ? 1.7972 2.3830 1.0328 0.0188  0.2041  0.2482  242 GLY A CA  
1524 C  C   . GLY A 250 ? 1.8309 2.4836 1.0662 0.0502  0.2151  0.2059  242 GLY A C   
1525 O  O   . GLY A 250 ? 1.8272 2.5668 1.0721 0.0423  0.2361  0.2239  242 GLY A O   
1526 N  N   . GLY A 251 ? 1.7648 2.3775 0.9861 0.0860  0.2006  0.1495  243 GLY A N   
1527 C  CA  . GLY A 251 ? 1.7792 2.4383 0.9919 0.1264  0.2077  0.1043  243 GLY A CA  
1528 C  C   . GLY A 251 ? 1.7927 2.3858 1.0401 0.1337  0.2030  0.0845  243 GLY A C   
1529 O  O   . GLY A 251 ? 1.7637 2.2625 1.0364 0.1105  0.1904  0.0951  243 GLY A O   
1530 N  N   . LYS A 252 ? 1.6988 2.3470 0.9451 0.1698  0.2129  0.0553  244 LYS A N   
1531 C  CA  . LYS A 252 ? 1.6751 2.2746 0.9508 0.1829  0.2097  0.0380  244 LYS A CA  
1532 C  C   . LYS A 252 ? 1.6685 2.3186 0.9965 0.1452  0.2251  0.0828  244 LYS A C   
1533 O  O   . LYS A 252 ? 1.6535 2.4236 0.9897 0.1460  0.2448  0.0954  244 LYS A O   
1534 C  CB  . LYS A 252 ? 1.7178 2.3535 0.9645 0.2456  0.2120  -0.0142 244 LYS A CB  
1535 N  N   . HIS A 253 ? 1.7338 2.2959 1.0952 0.1104  0.2159  0.1056  245 HIS A N   
1536 C  CA  . HIS A 253 ? 1.7001 2.2923 1.1074 0.0685  0.2275  0.1469  245 HIS A CA  
1537 C  C   . HIS A 253 ? 1.6959 2.1906 1.1374 0.0587  0.2149  0.1438  245 HIS A C   
1538 O  O   . HIS A 253 ? 1.6874 2.0787 1.1264 0.0485  0.1984  0.1443  245 HIS A O   
1539 C  CB  . HIS A 253 ? 1.7047 2.3060 1.1100 0.0187  0.2334  0.1996  245 HIS A CB  
1540 C  CG  . HIS A 253 ? 1.7065 2.3267 1.1495 -0.0309 0.2448  0.2429  245 HIS A CG  
1541 N  ND1 . HIS A 253 ? 1.6965 2.2229 1.1696 -0.0571 0.2341  0.2566  245 HIS A ND1 
1542 C  CD2 . HIS A 253 ? 1.7187 2.4407 1.1714 -0.0628 0.2658  0.2745  245 HIS A CD2 
1543 C  CE1 . HIS A 253 ? 1.6800 2.2418 1.1776 -0.1022 0.2467  0.2926  245 HIS A CE1 
1544 N  NE2 . HIS A 253 ? 1.6962 2.3763 1.1824 -0.1097 0.2663  0.3051  245 HIS A NE2 
1545 N  N   . ASN A 254 ? 1.7038 2.2421 1.1773 0.0626  0.2228  0.1401  246 ASN A N   
1546 C  CA  . ASN A 254 ? 1.6808 2.1426 1.1887 0.0512  0.2129  0.1407  246 ASN A CA  
1547 C  C   . ASN A 254 ? 1.6718 2.1592 1.2187 -0.0050 0.2221  0.1847  246 ASN A C   
1548 O  O   . ASN A 254 ? 1.6659 2.2495 1.2162 -0.0305 0.2392  0.2098  246 ASN A O   
1549 C  CB  . ASN A 254 ? 1.7043 2.1848 1.2164 0.0997  0.2117  0.1021  246 ASN A CB  
1550 C  CG  . ASN A 254 ? 1.9883 2.6133 1.5188 0.1070  0.2308  0.1045  246 ASN A CG  
1551 O  OD1 . ASN A 254 ? 1.9480 2.6124 1.5194 0.0812  0.2366  0.1210  246 ASN A OD1 
1552 N  ND2 . ASN A 254 ? 1.9784 2.6908 1.4782 0.1418  0.2405  0.0862  246 ASN A ND2 
1553 N  N   . MET A 255 ? 1.6780 2.0779 1.2506 -0.0262 0.2108  0.1936  247 MET A N   
1554 C  CA  . MET A 255 ? 1.6493 2.0492 1.2523 -0.0808 0.2162  0.2322  247 MET A CA  
1555 C  C   . MET A 255 ? 1.6349 1.9934 1.2737 -0.0829 0.2081  0.2217  247 MET A C   
1556 O  O   . MET A 255 ? 1.6320 1.9034 1.2689 -0.0596 0.1928  0.2013  247 MET A O   
1557 C  CB  . MET A 255 ? 1.6711 1.9908 1.2578 -0.1128 0.2089  0.2652  247 MET A CB  
1558 C  CG  . MET A 255 ? 1.6924 1.9947 1.2969 -0.1690 0.2137  0.3067  247 MET A CG  
1559 S  SD  . MET A 255 ? 1.7451 1.9509 1.3185 -0.1929 0.2042  0.3452  247 MET A SD  
1560 C  CE  . MET A 255 ? 1.7524 2.0353 1.2827 -0.1783 0.2150  0.3529  247 MET A CE  
1561 N  N   . ASP A 256 ? 1.5188 1.9441 1.1888 -0.1139 0.2185  0.2359  248 ASP A N   
1562 C  CA  . ASP A 256 ? 1.4846 1.8876 1.1890 -0.1160 0.2114  0.2247  248 ASP A CA  
1563 C  C   . ASP A 256 ? 1.4790 1.8020 1.1996 -0.1670 0.2045  0.2531  248 ASP A C   
1564 O  O   . ASP A 256 ? 1.4795 1.8073 1.1947 -0.2148 0.2120  0.2873  248 ASP A O   
1565 C  CB  . ASP A 256 ? 1.4830 2.0182 1.2137 -0.1148 0.2247  0.2156  248 ASP A CB  
1566 C  CG  . ASP A 256 ? 1.5468 2.1464 1.2623 -0.0476 0.2269  0.1780  248 ASP A CG  
1567 O  OD1 . ASP A 256 ? 1.5688 2.0865 1.2563 -0.0035 0.2149  0.1547  248 ASP A OD1 
1568 O  OD2 . ASP A 256 ? 1.5688 2.3010 1.2977 -0.0389 0.2403  0.1709  248 ASP A OD2 
1569 N  N   . PHE A 257 ? 1.4991 1.7448 1.2346 -0.1548 0.1900  0.2386  249 PHE A N   
1570 C  CA  . PHE A 257 ? 1.4741 1.6449 1.2251 -0.1945 0.1819  0.2580  249 PHE A CA  
1571 C  C   . PHE A 257 ? 1.4785 1.6659 1.2637 -0.1927 0.1775  0.2404  249 PHE A C   
1572 O  O   . PHE A 257 ? 1.4743 1.6760 1.2641 -0.1476 0.1731  0.2114  249 PHE A O   
1573 C  CB  . PHE A 257 ? 1.4731 1.5270 1.2055 -0.1825 0.1665  0.2600  249 PHE A CB  
1574 C  CG  . PHE A 257 ? 1.4978 1.5346 1.1960 -0.1842 0.1682  0.2782  249 PHE A CG  
1575 C  CD1 . PHE A 257 ? 1.5297 1.5379 1.2142 -0.2238 0.1708  0.3148  249 PHE A CD1 
1576 C  CD2 . PHE A 257 ? 1.5182 1.5626 1.1929 -0.1455 0.1662  0.2583  249 PHE A CD2 
1577 C  CE1 . PHE A 257 ? 1.5547 1.5505 1.2046 -0.2213 0.1717  0.3333  249 PHE A CE1 
1578 C  CE2 . PHE A 257 ? 1.5529 1.5897 1.1959 -0.1463 0.1667  0.2734  249 PHE A CE2 
1579 C  CZ  . PHE A 257 ? 1.5498 1.5662 1.1813 -0.1824 0.1696  0.3119  249 PHE A CZ  
1580 N  N   . TYR A 258 ? 1.4337 1.6148 1.2382 -0.2414 0.1778  0.2578  250 TYR A N   
1581 C  CA  . TYR A 258 ? 1.4152 1.6106 1.2518 -0.2443 0.1719  0.2415  250 TYR A CA  
1582 C  C   . TYR A 258 ? 1.4270 1.5079 1.2651 -0.2619 0.1572  0.2480  250 TYR A C   
1583 O  O   . TYR A 258 ? 1.4359 1.4610 1.2615 -0.3030 0.1563  0.2734  250 TYR A O   
1584 C  CB  . TYR A 258 ? 1.4252 1.7312 1.2860 -0.2877 0.1843  0.2488  250 TYR A CB  
1585 C  CG  . TYR A 258 ? 1.4418 1.8836 1.3084 -0.2588 0.1977  0.2341  250 TYR A CG  
1586 C  CD1 . TYR A 258 ? 1.4394 1.9423 1.3236 -0.2102 0.1945  0.2027  250 TYR A CD1 
1587 C  CD2 . TYR A 258 ? 1.4655 1.9757 1.3161 -0.2756 0.2133  0.2516  250 TYR A CD2 
1588 C  CE1 . TYR A 258 ? 1.4468 2.0747 1.3321 -0.1749 0.2057  0.1869  250 TYR A CE1 
1589 C  CE2 . TYR A 258 ? 1.4711 2.1134 1.3255 -0.2441 0.2257  0.2357  250 TYR A CE2 
1590 C  CZ  . TYR A 258 ? 1.5265 2.2269 1.3981 -0.1917 0.2215  0.2022  250 TYR A CZ  
1591 O  OH  . TYR A 258 ? 1.5675 2.4004 1.4390 -0.1521 0.2329  0.1842  250 TYR A OH  
1592 N  N   . VAL A 259 ? 1.4260 1.4709 1.2750 -0.2279 0.1455  0.2252  251 VAL A N   
1593 C  CA  . VAL A 259 ? 1.3987 1.3413 1.2475 -0.2336 0.1312  0.2269  251 VAL A CA  
1594 C  C   . VAL A 259 ? 1.3957 1.3528 1.2729 -0.2487 0.1254  0.2150  251 VAL A C   
1595 O  O   . VAL A 259 ? 1.3939 1.4223 1.2901 -0.2265 0.1269  0.1952  251 VAL A O   
1596 C  CB  . VAL A 259 ? 1.4111 1.2922 1.2452 -0.1866 0.1216  0.2123  251 VAL A CB  
1597 C  CG1 . VAL A 259 ? 1.3834 1.1731 1.2175 -0.1914 0.1080  0.2145  251 VAL A CG1 
1598 C  CG2 . VAL A 259 ? 1.4274 1.3003 1.2328 -0.1729 0.1259  0.2199  251 VAL A CG2 
1599 N  N   . GLU A 260 ? 1.3880 1.2771 1.2644 -0.2831 0.1178  0.2258  252 GLU A N   
1600 C  CA  . GLU A 260 ? 1.3788 1.2708 1.2782 -0.2995 0.1100  0.2124  252 GLU A CA  
1601 C  C   . GLU A 260 ? 1.3958 1.1815 1.2859 -0.2897 0.0950  0.2095  252 GLU A C   
1602 O  O   . GLU A 260 ? 1.4000 1.1082 1.2654 -0.2895 0.0914  0.2250  252 GLU A O   
1603 C  CB  . GLU A 260 ? 1.4125 1.3404 1.3194 -0.3623 0.1158  0.2246  252 GLU A CB  
1604 C  CG  . GLU A 260 ? 1.5220 1.3580 1.3977 -0.4025 0.1149  0.2526  252 GLU A CG  
1605 C  CD  . GLU A 260 ? 1.7091 1.5610 1.5860 -0.4721 0.1188  0.2638  252 GLU A CD  
1606 O  OE1 . GLU A 260 ? 1.6478 1.5874 1.5556 -0.4909 0.1206  0.2466  252 GLU A OE1 
1607 O  OE2 . GLU A 260 ? 1.7318 1.5077 1.5757 -0.5090 0.1196  0.2902  252 GLU A OE2 
1608 N  N   . ALA A 261 ? 1.3120 1.1020 1.2208 -0.2782 0.0863  0.1894  253 ALA A N   
1609 C  CA  . ALA A 261 ? 1.3147 1.0180 1.2165 -0.2690 0.0726  0.1841  253 ALA A CA  
1610 C  C   . ALA A 261 ? 1.3573 1.0306 1.2607 -0.3136 0.0663  0.1840  253 ALA A C   
1611 O  O   . ALA A 261 ? 1.3690 1.1068 1.2895 -0.3477 0.0705  0.1792  253 ALA A O   
1612 C  CB  . ALA A 261 ? 1.2717 0.9899 1.1861 -0.2270 0.0664  0.1631  253 ALA A CB  
1613 N  N   . LEU A 262 ? 1.4064 0.9837 1.2898 -0.3130 0.0555  0.1873  254 LEU A N   
1614 C  CA  . LEU A 262 ? 1.4437 0.9682 1.3169 -0.3539 0.0478  0.1863  254 LEU A CA  
1615 C  C   . LEU A 262 ? 1.4806 0.9665 1.3580 -0.3342 0.0333  0.1635  254 LEU A C   
1616 O  O   . LEU A 262 ? 1.5192 0.9567 1.3858 -0.3634 0.0245  0.1561  254 LEU A O   
1617 C  CB  . LEU A 262 ? 1.4886 0.9201 1.3220 -0.3722 0.0468  0.2118  254 LEU A CB  
1618 C  CG  . LEU A 262 ? 1.5274 0.9847 1.3483 -0.3822 0.0605  0.2383  254 LEU A CG  
1619 C  CD1 . LEU A 262 ? 1.5887 0.9435 1.3636 -0.3963 0.0572  0.2649  254 LEU A CD1 
1620 C  CD2 . LEU A 262 ? 1.5376 1.0910 1.3785 -0.4248 0.0735  0.2409  254 LEU A CD2 
1621 N  N   . ALA A 263 ? 1.3917 0.8966 1.2807 -0.2867 0.0309  0.1522  255 ALA A N   
1622 C  CA  . ALA A 263 ? 1.3934 0.8684 1.2842 -0.2643 0.0185  0.1327  255 ALA A CA  
1623 C  C   . ALA A 263 ? 1.3894 0.9234 1.3005 -0.2255 0.0195  0.1195  255 ALA A C   
1624 O  O   . ALA A 263 ? 1.3628 0.9137 1.2727 -0.1996 0.0262  0.1277  255 ALA A O   
1625 C  CB  . ALA A 263 ? 1.4196 0.8046 1.2822 -0.2440 0.0106  0.1400  255 ALA A CB  
1626 N  N   . PHE A 264 ? 1.3215 0.8814 1.2463 -0.2225 0.0121  0.0990  256 PHE A N   
1627 C  CA  . PHE A 264 ? 1.2962 0.8985 1.2321 -0.1842 0.0114  0.0884  256 PHE A CA  
1628 C  C   . PHE A 264 ? 1.3119 0.8609 1.2325 -0.1524 0.0069  0.0908  256 PHE A C   
1629 O  O   . PHE A 264 ? 1.3359 0.8234 1.2413 -0.1564 0.0007  0.0928  256 PHE A O   
1630 C  CB  . PHE A 264 ? 1.3217 0.9701 1.2737 -0.1899 0.0037  0.0665  256 PHE A CB  
1631 C  CG  . PHE A 264 ? 1.3398 1.0807 1.3133 -0.2032 0.0093  0.0613  256 PHE A CG  
1632 C  CD1 . PHE A 264 ? 1.3725 1.1382 1.3546 -0.2521 0.0107  0.0601  256 PHE A CD1 
1633 C  CD2 . PHE A 264 ? 1.3585 1.1629 1.3401 -0.1664 0.0128  0.0580  256 PHE A CD2 
1634 C  CE1 . PHE A 264 ? 1.3965 1.2660 1.4013 -0.2646 0.0162  0.0543  256 PHE A CE1 
1635 C  CE2 . PHE A 264 ? 1.3760 1.2761 1.3765 -0.1708 0.0172  0.0517  256 PHE A CE2 
1636 C  CZ  . PHE A 264 ? 1.3759 1.3173 1.3911 -0.2201 0.0191  0.0491  256 PHE A CZ  
1637 N  N   . PRO A 265 ? 1.2640 0.8368 1.1852 -0.1204 0.0099  0.0911  257 PRO A N   
1638 C  CA  . PRO A 265 ? 1.2487 0.7866 1.1573 -0.0958 0.0064  0.0926  257 PRO A CA  
1639 C  C   . PRO A 265 ? 1.2892 0.8146 1.1982 -0.0914 -0.0042 0.0770  257 PRO A C   
1640 O  O   . PRO A 265 ? 1.2919 0.8529 1.2116 -0.0936 -0.0082 0.0626  257 PRO A O   
1641 C  CB  . PRO A 265 ? 1.2408 0.8088 1.1467 -0.0709 0.0118  0.0951  257 PRO A CB  
1642 C  CG  . PRO A 265 ? 1.2718 0.8745 1.1827 -0.0764 0.0196  0.0992  257 PRO A CG  
1643 C  CD  . PRO A 265 ? 1.2625 0.8911 1.1900 -0.1057 0.0175  0.0921  257 PRO A CD  
1644 N  N   . ASP A 266 ? 1.3336 0.8150 1.2297 -0.0824 -0.0092 0.0782  258 ASP A N   
1645 C  CA  . ASP A 266 ? 1.3685 0.8356 1.2601 -0.0729 -0.0196 0.0612  258 ASP A CA  
1646 C  C   . ASP A 266 ? 1.4132 0.8702 1.2940 -0.0462 -0.0208 0.0647  258 ASP A C   
1647 O  O   . ASP A 266 ? 1.3895 0.8589 1.2689 -0.0388 -0.0135 0.0789  258 ASP A O   
1648 C  CB  . ASP A 266 ? 1.4265 0.8430 1.3079 -0.0943 -0.0276 0.0535  258 ASP A CB  
1649 C  CG  . ASP A 266 ? 1.6021 1.0102 1.4790 -0.0903 -0.0394 0.0284  258 ASP A CG  
1650 O  OD1 . ASP A 266 ? 1.6024 1.0607 1.4906 -0.0767 -0.0404 0.0171  258 ASP A OD1 
1651 O  OD2 . ASP A 266 ? 1.7178 1.0647 1.5754 -0.0995 -0.0484 0.0197  258 ASP A OD2 
1652 N  N   . THR A 267 ? 1.4730 0.9108 1.3445 -0.0326 -0.0303 0.0502  259 THR A N   
1653 C  CA  . THR A 267 ? 1.5014 0.9448 1.3640 -0.0058 -0.0318 0.0510  259 THR A CA  
1654 C  C   . THR A 267 ? 1.5595 0.9716 1.4107 -0.0015 -0.0312 0.0652  259 THR A C   
1655 O  O   . THR A 267 ? 1.5857 1.0183 1.4330 0.0173  -0.0304 0.0699  259 THR A O   
1656 C  CB  . THR A 267 ? 1.6013 1.0375 1.4542 0.0138  -0.0429 0.0281  259 THR A CB  
1657 O  OG1 . THR A 267 ? 1.5808 1.0403 1.4271 0.0418  -0.0431 0.0291  259 THR A OG1 
1658 C  CG2 . THR A 267 ? 1.7045 1.0716 1.5396 0.0067  -0.0531 0.0178  259 THR A CG2 
1659 N  N   . ASP A 268 ? 1.5507 0.9196 1.3954 -0.0203 -0.0316 0.0727  260 ASP A N   
1660 C  CA  . ASP A 268 ? 1.5646 0.9009 1.3938 -0.0147 -0.0320 0.0876  260 ASP A CA  
1661 C  C   . ASP A 268 ? 1.5529 0.8994 1.3887 -0.0361 -0.0216 0.1069  260 ASP A C   
1662 O  O   . ASP A 268 ? 1.5922 0.9146 1.4145 -0.0359 -0.0212 0.1212  260 ASP A O   
1663 C  CB  . ASP A 268 ? 1.6216 0.8847 1.4254 -0.0148 -0.0422 0.0829  260 ASP A CB  
1664 C  CG  . ASP A 268 ? 1.7383 0.9742 1.5437 -0.0522 -0.0417 0.0800  260 ASP A CG  
1665 O  OD1 . ASP A 268 ? 1.7113 0.9945 1.5399 -0.0676 -0.0373 0.0720  260 ASP A OD1 
1666 O  OD2 . ASP A 268 ? 1.8391 1.0083 1.6203 -0.0668 -0.0461 0.0864  260 ASP A OD2 
1667 N  N   . PHE A 269 ? 1.4409 0.8249 1.2940 -0.0502 -0.0140 0.1064  261 PHE A N   
1668 C  CA  . PHE A 269 ? 1.3910 0.7889 1.2481 -0.0659 -0.0042 0.1205  261 PHE A CA  
1669 C  C   . PHE A 269 ? 1.3830 0.8238 1.2512 -0.0629 0.0026  0.1183  261 PHE A C   
1670 O  O   . PHE A 269 ? 1.3639 0.8265 1.2426 -0.0686 0.0038  0.1104  261 PHE A O   
1671 C  CB  . PHE A 269 ? 1.3945 0.7749 1.2518 -0.0928 -0.0027 0.1239  261 PHE A CB  
1672 C  CG  . PHE A 269 ? 1.3644 0.7707 1.2261 -0.1065 0.0080  0.1363  261 PHE A CG  
1673 C  CD1 . PHE A 269 ? 1.3694 0.7734 1.2207 -0.0995 0.0123  0.1496  261 PHE A CD1 
1674 C  CD2 . PHE A 269 ? 1.3566 0.7970 1.2319 -0.1251 0.0132  0.1326  261 PHE A CD2 
1675 C  CE1 . PHE A 269 ? 1.3483 0.7766 1.2000 -0.1090 0.0218  0.1581  261 PHE A CE1 
1676 C  CE2 . PHE A 269 ? 1.3536 0.8255 1.2313 -0.1324 0.0232  0.1419  261 PHE A CE2 
1677 C  CZ  . PHE A 269 ? 1.3309 0.7929 1.1953 -0.1236 0.0275  0.1542  261 PHE A CZ  
1678 N  N   . PRO A 270 ? 1.3147 0.7662 1.1767 -0.0537 0.0065  0.1251  262 PRO A N   
1679 C  CA  . PRO A 270 ? 1.2918 0.7647 1.1522 -0.0496 0.0124  0.1255  262 PRO A CA  
1680 C  C   . PRO A 270 ? 1.2953 0.7790 1.1579 -0.0554 0.0187  0.1268  262 PRO A C   
1681 O  O   . PRO A 270 ? 1.2939 0.7938 1.1547 -0.0459 0.0211  0.1230  262 PRO A O   
1682 C  CB  . PRO A 270 ? 1.3156 0.7851 1.1633 -0.0492 0.0147  0.1339  262 PRO A CB  
1683 C  CG  . PRO A 270 ? 1.3885 0.8542 1.2368 -0.0436 0.0080  0.1339  262 PRO A CG  
1684 C  CD  . PRO A 270 ? 1.3568 0.7986 1.2086 -0.0470 0.0041  0.1324  262 PRO A CD  
1685 N  N   . GLY A 271 ? 1.3080 0.7862 1.1712 -0.0679 0.0215  0.1330  263 GLY A N   
1686 C  CA  . GLY A 271 ? 1.2895 0.7921 1.1568 -0.0731 0.0281  0.1331  263 GLY A CA  
1687 C  C   . GLY A 271 ? 1.3016 0.8029 1.1550 -0.0721 0.0350  0.1408  263 GLY A C   
1688 O  O   . GLY A 271 ? 1.3041 0.8302 1.1555 -0.0661 0.0409  0.1382  263 GLY A O   
1689 N  N   . LEU A 272 ? 1.2604 0.7383 1.1026 -0.0751 0.0336  0.1483  264 LEU A N   
1690 C  CA  . LEU A 272 ? 1.2602 0.7374 1.0866 -0.0753 0.0388  0.1532  264 LEU A CA  
1691 C  C   . LEU A 272 ? 1.3031 0.7776 1.1269 -0.0881 0.0398  0.1649  264 LEU A C   
1692 O  O   . LEU A 272 ? 1.3248 0.7799 1.1493 -0.0920 0.0339  0.1712  264 LEU A O   
1693 C  CB  . LEU A 272 ? 1.2640 0.7235 1.0741 -0.0703 0.0365  0.1518  264 LEU A CB  
1694 C  CG  . LEU A 272 ? 1.2899 0.7398 1.0885 -0.0600 0.0375  0.1445  264 LEU A CG  
1695 C  CD1 . LEU A 272 ? 1.3069 0.7362 1.0849 -0.0663 0.0358  0.1448  264 LEU A CD1 
1696 C  CD2 . LEU A 272 ? 1.3009 0.7578 1.0898 -0.0473 0.0432  0.1392  264 LEU A CD2 
1697 N  N   . ILE A 273 ? 1.2786 0.7722 1.0953 -0.0913 0.0472  0.1681  265 ILE A N   
1698 C  CA  . ILE A 273 ? 1.2951 0.7892 1.1034 -0.1034 0.0497  0.1821  265 ILE A CA  
1699 C  C   . ILE A 273 ? 1.3279 0.8306 1.1164 -0.0963 0.0533  0.1812  265 ILE A C   
1700 O  O   . ILE A 273 ? 1.3281 0.8455 1.1098 -0.0859 0.0580  0.1701  265 ILE A O   
1701 C  CB  . ILE A 273 ? 1.3245 0.8454 1.1420 -0.1208 0.0568  0.1885  265 ILE A CB  
1702 C  CG1 . ILE A 273 ? 1.3203 0.8358 1.1562 -0.1314 0.0525  0.1840  265 ILE A CG1 
1703 C  CG2 . ILE A 273 ? 1.3597 0.8721 1.1628 -0.1365 0.0594  0.2080  265 ILE A CG2 
1704 C  CD1 . ILE A 273 ? 1.3677 0.8327 1.1978 -0.1375 0.0433  0.1911  265 ILE A CD1 
1705 N  N   . THR A 274 ? 1.3226 0.8151 1.0982 -0.0992 0.0500  0.1915  266 THR A N   
1706 C  CA  . THR A 274 ? 1.3368 0.8397 1.0920 -0.0945 0.0515  0.1883  266 THR A CA  
1707 C  C   . THR A 274 ? 1.4238 0.9414 1.1661 -0.1013 0.0552  0.2046  266 THR A C   
1708 O  O   . THR A 274 ? 1.4529 0.9560 1.1895 -0.1034 0.0497  0.2194  266 THR A O   
1709 C  CB  . THR A 274 ? 1.3462 0.8359 1.0940 -0.0910 0.0427  0.1826  266 THR A CB  
1710 O  OG1 . THR A 274 ? 1.3622 0.8376 1.1199 -0.0881 0.0400  0.1720  266 THR A OG1 
1711 C  CG2 . THR A 274 ? 1.3066 0.8053 1.0312 -0.0906 0.0433  0.1734  266 THR A CG2 
1712 N  N   . LEU A 275 ? 1.3546 0.9024 1.0888 -0.1014 0.0644  0.2024  267 LEU A N   
1713 C  CA  . LEU A 275 ? 1.3693 0.9391 1.0880 -0.1087 0.0698  0.2189  267 LEU A CA  
1714 C  C   . LEU A 275 ? 1.4239 1.0047 1.1184 -0.0987 0.0674  0.2109  267 LEU A C   
1715 O  O   . LEU A 275 ? 1.4249 1.0044 1.1119 -0.0885 0.0665  0.1892  267 LEU A O   
1716 C  CB  . LEU A 275 ? 1.3661 0.9780 1.0906 -0.1166 0.0824  0.2216  267 LEU A CB  
1717 C  CG  . LEU A 275 ? 1.3731 0.9856 1.1229 -0.1304 0.0844  0.2241  267 LEU A CG  
1718 C  CD1 . LEU A 275 ? 1.3880 1.0618 1.1447 -0.1413 0.0973  0.2266  267 LEU A CD1 
1719 C  CD2 . LEU A 275 ? 1.3824 0.9504 1.1329 -0.1479 0.0781  0.2435  267 LEU A CD2 
1720 N  N   . THR A 276 ? 1.4066 0.9944 1.0843 -0.1016 0.0657  0.2282  268 THR A N   
1721 C  CA  . THR A 276 ? 1.4315 1.0349 1.0862 -0.0935 0.0610  0.2197  268 THR A CA  
1722 C  C   . THR A 276 ? 1.4930 1.1302 1.1250 -0.0948 0.0673  0.2359  268 THR A C   
1723 O  O   . THR A 276 ? 1.5053 1.1379 1.1331 -0.1028 0.0699  0.2635  268 THR A O   
1724 C  CB  . THR A 276 ? 1.4892 1.0764 1.1435 -0.0899 0.0476  0.2216  268 THR A CB  
1725 O  OG1 . THR A 276 ? 1.4635 1.0261 1.1378 -0.0905 0.0429  0.2081  268 THR A OG1 
1726 C  CG2 . THR A 276 ? 1.4918 1.1047 1.1241 -0.0862 0.0415  0.2089  268 THR A CG2 
1727 N  N   . ILE A 277 ? 1.4182 1.0846 1.0304 -0.0871 0.0696  0.2187  269 ILE A N   
1728 C  CA  . ILE A 277 ? 1.4436 1.1497 1.0301 -0.0855 0.0746  0.2312  269 ILE A CA  
1729 C  C   . ILE A 277 ? 1.4851 1.1971 1.0516 -0.0791 0.0621  0.2261  269 ILE A C   
1730 O  O   . ILE A 277 ? 1.4711 1.1684 1.0401 -0.0779 0.0526  0.2023  269 ILE A O   
1731 C  CB  . ILE A 277 ? 1.4812 1.2274 1.0554 -0.0774 0.0857  0.2131  269 ILE A CB  
1732 C  CG1 . ILE A 277 ? 1.5142 1.3109 1.0648 -0.0789 0.0944  0.2326  269 ILE A CG1 
1733 C  CG2 . ILE A 277 ? 1.5092 1.2435 1.0670 -0.0643 0.0785  0.1762  269 ILE A CG2 
1734 C  CD1 . ILE A 277 ? 1.6017 1.4019 1.1605 -0.0982 0.1032  0.2705  269 ILE A CD1 
1735 N  N   . SER A 278 ? 1.4625 1.1988 1.0078 -0.0768 0.0618  0.2495  270 SER A N   
1736 C  CA  . SER A 278 ? 1.4849 1.2403 1.0111 -0.0683 0.0489  0.2462  270 SER A CA  
1737 C  C   . SER A 278 ? 1.5478 1.3520 1.0403 -0.0621 0.0527  0.2548  270 SER A C   
1738 O  O   . SER A 278 ? 1.5580 1.3721 1.0388 -0.0647 0.0630  0.2844  270 SER A O   
1739 C  CB  . SER A 278 ? 1.5053 1.2371 1.0372 -0.0625 0.0386  0.2700  270 SER A CB  
1740 O  OG  . SER A 278 ? 1.5173 1.2154 1.0780 -0.0657 0.0331  0.2572  270 SER A OG  
1741 N  N   . LEU A 279 ? 1.5206 1.3558 0.9951 -0.0570 0.0444  0.2287  271 LEU A N   
1742 C  CA  . LEU A 279 ? 1.5508 1.4389 0.9905 -0.0487 0.0457  0.2326  271 LEU A CA  
1743 C  C   . LEU A 279 ? 1.5998 1.5118 1.0243 -0.0389 0.0314  0.2485  271 LEU A C   
1744 O  O   . LEU A 279 ? 1.5984 1.5172 1.0298 -0.0397 0.0170  0.2278  271 LEU A O   
1745 C  CB  . LEU A 279 ? 1.5629 1.4719 0.9854 -0.0475 0.0447  0.1897  271 LEU A CB  
1746 C  CG  . LEU A 279 ? 1.6326 1.6018 1.0164 -0.0376 0.0448  0.1857  271 LEU A CG  
1747 C  CD1 . LEU A 279 ? 1.6376 1.6369 1.0101 -0.0329 0.0617  0.2191  271 LEU A CD1 
1748 C  CD2 . LEU A 279 ? 1.6757 1.6494 1.0387 -0.0356 0.0420  0.1371  271 LEU A CD2 
1749 N  N   . LEU A 280 ? 1.6385 1.5666 1.0399 -0.0298 0.0354  0.2863  272 LEU A N   
1750 C  CA  . LEU A 280 ? 1.6687 1.6163 1.0509 -0.0123 0.0216  0.3072  272 LEU A CA  
1751 C  C   . LEU A 280 ? 1.7411 1.7537 1.0829 -0.0007 0.0200  0.3110  272 LEU A C   
1752 O  O   . LEU A 280 ? 1.7506 1.7838 1.0736 -0.0049 0.0340  0.3185  272 LEU A O   
1753 C  CB  . LEU A 280 ? 1.6805 1.5768 1.0588 -0.0056 0.0241  0.3529  272 LEU A CB  
1754 C  CG  . LEU A 280 ? 1.6802 1.5128 1.0944 -0.0136 0.0237  0.3511  272 LEU A CG  
1755 C  CD1 . LEU A 280 ? 1.7040 1.4765 1.1038 -0.0105 0.0275  0.3951  272 LEU A CD1 
1756 C  CD2 . LEU A 280 ? 1.6705 1.5130 1.1042 -0.0029 0.0066  0.3277  272 LEU A CD2 
1757 N  N   . ASP A 281 ? 1.7495 1.8041 1.0785 0.0146  0.0027  0.3051  273 ASP A N   
1758 C  CA  . ASP A 281 ? 1.7855 1.9078 1.0738 0.0294  -0.0019 0.3105  273 ASP A CA  
1759 C  C   . ASP A 281 ? 1.8499 1.9664 1.1088 0.0547  -0.0056 0.3622  273 ASP A C   
1760 O  O   . ASP A 281 ? 1.8560 1.9540 1.1228 0.0717  -0.0184 0.3740  273 ASP A O   
1761 C  CB  . ASP A 281 ? 1.7973 1.9799 1.0858 0.0288  -0.0200 0.2681  273 ASP A CB  
1762 C  CG  . ASP A 281 ? 1.8934 2.1510 1.1410 0.0381  -0.0234 0.2596  273 ASP A CG  
1763 O  OD1 . ASP A 281 ? 1.9170 2.1945 1.1315 0.0577  -0.0190 0.2990  273 ASP A OD1 
1764 O  OD2 . ASP A 281 ? 1.9499 2.2430 1.1944 0.0246  -0.0306 0.2131  273 ASP A OD2 
1765 N  N   . THR A 282 ? 1.8349 1.9659 1.0559 0.0592  0.0057  0.3936  274 THR A N   
1766 C  CA  . THR A 282 ? 1.8767 1.9862 1.0583 0.0819  0.0038  0.4483  274 THR A CA  
1767 C  C   . THR A 282 ? 1.9384 2.1215 1.0698 0.1009  0.0009  0.4626  274 THR A C   
1768 O  O   . THR A 282 ? 1.9802 2.1451 1.0680 0.1112  0.0075  0.5124  274 THR A O   
1769 C  CB  . THR A 282 ? 1.9613 1.9953 1.1369 0.0630  0.0229  0.4891  274 THR A CB  
1770 O  OG1 . THR A 282 ? 1.9719 2.0390 1.1473 0.0384  0.0424  0.4805  274 THR A OG1 
1771 C  CG2 . THR A 282 ? 1.9110 1.8695 1.1300 0.0498  0.0229  0.4804  274 THR A CG2 
1772 N  N   . SER A 283 ? 1.9218 2.1849 1.0556 0.1036  -0.0095 0.4192  275 SER A N   
1773 C  CA  . SER A 283 ? 1.9534 2.2979 1.0406 0.1215  -0.0137 0.4249  275 SER A CA  
1774 C  C   . SER A 283 ? 2.0174 2.3797 1.0695 0.1607  -0.0308 0.4611  275 SER A C   
1775 O  O   . SER A 283 ? 2.0669 2.4681 1.0681 0.1807  -0.0301 0.4924  275 SER A O   
1776 C  CB  . SER A 283 ? 1.9606 2.3798 1.0581 0.1120  -0.0233 0.3632  275 SER A CB  
1777 O  OG  . SER A 283 ? 2.0067 2.4389 1.1338 0.1129  -0.0433 0.3321  275 SER A OG  
1778 N  N   . ASN A 284 ? 1.9879 2.3257 1.0648 0.1750  -0.0461 0.4568  276 ASN A N   
1779 C  CA  . ASN A 284 ? 2.0178 2.3682 1.0621 0.2207  -0.0636 0.4901  276 ASN A CA  
1780 C  C   . ASN A 284 ? 2.0718 2.3120 1.0909 0.2346  -0.0558 0.5477  276 ASN A C   
1781 O  O   . ASN A 284 ? 2.0497 2.2136 1.1014 0.2249  -0.0535 0.5461  276 ASN A O   
1782 C  CB  . ASN A 284 ? 1.9842 2.3798 1.0649 0.2335  -0.0853 0.4539  276 ASN A CB  
1783 N  N   . LEU A 285 ? 2.1658 2.3948 1.1224 0.2558  -0.0520 0.5986  277 LEU A N   
1784 C  CA  . LEU A 285 ? 2.2142 2.3266 1.1328 0.2626  -0.0435 0.6574  277 LEU A CA  
1785 C  C   . LEU A 285 ? 2.2512 2.3050 1.1654 0.3047  -0.0621 0.6701  277 LEU A C   
1786 O  O   . LEU A 285 ? 2.2680 2.2096 1.1832 0.2971  -0.0564 0.6913  277 LEU A O   
1787 C  CB  . LEU A 285 ? 2.2852 2.3978 1.1401 0.2727  -0.0380 0.7016  277 LEU A CB  
1788 C  CG  . LEU A 285 ? 2.3663 2.3761 1.1983 0.2349  -0.0163 0.7431  277 LEU A CG  
1789 C  CD1 . LEU A 285 ? 2.3150 2.3624 1.1744 0.1860  0.0084  0.7275  277 LEU A CD1 
1790 C  CD2 . LEU A 285 ? 2.4608 2.4558 1.2347 0.2458  -0.0175 0.7801  277 LEU A CD2 
1791 N  N   . GLU A 286 ? 2.2121 2.3484 1.1206 0.3499  -0.0849 0.6549  278 GLU A N   
1792 C  CA  . GLU A 286 ? 2.2472 2.3465 1.1517 0.3984  -0.1044 0.6622  278 GLU A CA  
1793 C  C   . GLU A 286 ? 2.1742 2.2747 1.1418 0.3891  -0.1097 0.6215  278 GLU A C   
1794 O  O   . GLU A 286 ? 2.1901 2.2204 1.1549 0.4185  -0.1179 0.6333  278 GLU A O   
1795 C  CB  . GLU A 286 ? 2.3710 2.5709 1.2602 0.4456  -0.1261 0.6525  278 GLU A CB  
1796 C  CG  . GLU A 286 ? 2.2877 2.6430 1.2120 0.4416  -0.1380 0.6019  278 GLU A CG  
1797 C  CD  . GLU A 286 ? 2.2603 2.6853 1.1793 0.4026  -0.1263 0.5860  278 GLU A CD  
1798 O  OE1 . GLU A 286 ? 2.2708 2.6298 1.1752 0.3689  -0.1043 0.6077  278 GLU A OE1 
1799 O  OE2 . GLU A 286 ? 2.2317 2.7820 1.1623 0.4046  -0.1394 0.5485  278 GLU A OE2 
1800 N  N   . LEU A 287 ? 2.1240 2.2985 1.1496 0.3459  -0.1052 0.5693  279 LEU A N   
1801 C  CA  . LEU A 287 ? 2.0615 2.2451 1.1519 0.3287  -0.1096 0.5255  279 LEU A CA  
1802 C  C   . LEU A 287 ? 2.0811 2.1604 1.2030 0.2844  -0.0900 0.5239  279 LEU A C   
1803 O  O   . LEU A 287 ? 2.0844 2.1311 1.1987 0.2492  -0.0714 0.5342  279 LEU A O   
1804 C  CB  . LEU A 287 ? 2.0016 2.3080 1.1319 0.3024  -0.1162 0.4703  279 LEU A CB  
1805 C  CG  . LEU A 287 ? 2.0314 2.4630 1.1379 0.3390  -0.1371 0.4628  279 LEU A CG  
1806 C  CD1 . LEU A 287 ? 1.9800 2.5166 1.1201 0.2983  -0.1410 0.4066  279 LEU A CD1 
1807 C  CD2 . LEU A 287 ? 2.0410 2.5009 1.1496 0.3913  -0.1573 0.4681  279 LEU A CD2 
1808 N  N   . PRO A 288 ? 2.0269 2.0628 1.1843 0.2876  -0.0942 0.5103  280 PRO A N   
1809 C  CA  . PRO A 288 ? 2.0100 1.9556 1.2006 0.2475  -0.0779 0.5048  280 PRO A CA  
1810 C  C   . PRO A 288 ? 1.9943 1.9791 1.2287 0.1944  -0.0648 0.4651  280 PRO A C   
1811 O  O   . PRO A 288 ? 1.9686 2.0469 1.2155 0.1874  -0.0715 0.4326  280 PRO A O   
1812 C  CB  . PRO A 288 ? 2.0057 1.9326 1.2259 0.2696  -0.0898 0.4894  280 PRO A CB  
1813 C  CG  . PRO A 288 ? 2.0146 2.0568 1.2379 0.3046  -0.1100 0.4698  280 PRO A CG  
1814 C  CD  . PRO A 288 ? 2.0365 2.1165 1.2038 0.3319  -0.1151 0.4985  280 PRO A CD  
1815 N  N   . GLU A 289 ? 1.8688 1.7811 1.1224 0.1588  -0.0473 0.4668  281 GLU A N   
1816 C  CA  . GLU A 289 ? 1.8256 1.7627 1.1128 0.1154  -0.0341 0.4328  281 GLU A CA  
1817 C  C   . GLU A 289 ? 1.8032 1.7864 1.1367 0.1030  -0.0428 0.3837  281 GLU A C   
1818 O  O   . GLU A 289 ? 1.7915 1.7538 1.1499 0.1119  -0.0505 0.3768  281 GLU A O   
1819 C  CB  . GLU A 289 ? 1.7633 1.6186 1.0632 0.0853  -0.0153 0.4458  281 GLU A CB  
1820 N  N   . ALA A 290 ? 1.7032 1.7465 1.0436 0.0815  -0.0415 0.3499  282 ALA A N   
1821 C  CA  . ALA A 290 ? 1.6653 1.7453 1.0410 0.0612  -0.0490 0.3036  282 ALA A CA  
1822 C  C   . ALA A 290 ? 1.6727 1.7091 1.0724 0.0257  -0.0344 0.2788  282 ALA A C   
1823 O  O   . ALA A 290 ? 1.6794 1.7058 1.0636 0.0160  -0.0213 0.2816  282 ALA A O   
1824 C  CB  . ALA A 290 ? 1.6754 1.8503 1.0353 0.0620  -0.0620 0.2785  282 ALA A CB  
1825 N  N   . VAL A 291 ? 1.6036 1.6190 1.0387 0.0093  -0.0368 0.2552  283 VAL A N   
1826 C  CA  . VAL A 291 ? 1.5761 1.5445 1.0312 -0.0185 -0.0246 0.2328  283 VAL A CA  
1827 C  C   . VAL A 291 ? 1.6015 1.6022 1.0477 -0.0404 -0.0275 0.1914  283 VAL A C   
1828 O  O   . VAL A 291 ? 1.6034 1.6544 1.0488 -0.0482 -0.0414 0.1694  283 VAL A O   
1829 C  CB  . VAL A 291 ? 1.5743 1.5010 1.0657 -0.0265 -0.0256 0.2269  283 VAL A CB  
1830 C  CG1 . VAL A 291 ? 1.5467 1.4203 1.0538 -0.0487 -0.0126 0.2099  283 VAL A CG1 
1831 C  CG2 . VAL A 291 ? 1.5828 1.4745 1.0772 -0.0023 -0.0260 0.2630  283 VAL A CG2 
1832 N  N   . VAL A 292 ? 1.5254 1.4981 0.9623 -0.0502 -0.0147 0.1794  284 VAL A N   
1833 C  CA  . VAL A 292 ? 1.5277 1.5131 0.9465 -0.0670 -0.0172 0.1382  284 VAL A CA  
1834 C  C   . VAL A 292 ? 1.5258 1.4464 0.9586 -0.0845 -0.0104 0.1138  284 VAL A C   
1835 O  O   . VAL A 292 ? 1.5326 1.4416 0.9560 -0.1048 -0.0176 0.0781  284 VAL A O   
1836 C  CB  . VAL A 292 ? 1.5790 1.5942 0.9629 -0.0552 -0.0096 0.1387  284 VAL A CB  
1837 C  CG1 . VAL A 292 ? 1.6075 1.6400 0.9641 -0.0685 -0.0168 0.0922  284 VAL A CG1 
1838 C  CG2 . VAL A 292 ? 1.5944 1.6632 0.9605 -0.0340 -0.0135 0.1733  284 VAL A CG2 
1839 N  N   . PHE A 293 ? 1.4929 1.3693 0.9446 -0.0777 0.0027  0.1334  285 PHE A N   
1840 C  CA  . PHE A 293 ? 1.4843 1.3032 0.9455 -0.0867 0.0099  0.1135  285 PHE A CA  
1841 C  C   . PHE A 293 ? 1.4751 1.2569 0.9683 -0.0821 0.0194  0.1388  285 PHE A C   
1842 O  O   . PHE A 293 ? 1.4669 1.2594 0.9652 -0.0718 0.0267  0.1702  285 PHE A O   
1843 C  CB  . PHE A 293 ? 1.5159 1.3336 0.9476 -0.0783 0.0186  0.0928  285 PHE A CB  
1844 C  CG  . PHE A 293 ? 1.5159 1.2763 0.9513 -0.0769 0.0264  0.0750  285 PHE A CG  
1845 C  CD1 . PHE A 293 ? 1.5483 1.2590 0.9704 -0.0906 0.0187  0.0422  285 PHE A CD1 
1846 C  CD2 . PHE A 293 ? 1.5002 1.2580 0.9490 -0.0626 0.0412  0.0917  285 PHE A CD2 
1847 C  CE1 . PHE A 293 ? 1.5569 1.2095 0.9755 -0.0833 0.0249  0.0280  285 PHE A CE1 
1848 C  CE2 . PHE A 293 ? 1.5161 1.2306 0.9672 -0.0553 0.0472  0.0751  285 PHE A CE2 
1849 C  CZ  . PHE A 293 ? 1.5285 1.1869 0.9626 -0.0623 0.0389  0.0439  285 PHE A CZ  
1850 N  N   . GLN A 294 ? 1.4593 1.1952 0.9702 -0.0924 0.0188  0.1251  286 GLN A N   
1851 C  CA  . GLN A 294 ? 1.4183 1.1199 0.9587 -0.0892 0.0267  0.1429  286 GLN A CA  
1852 C  C   . GLN A 294 ? 1.4485 1.1047 0.9892 -0.0908 0.0325  0.1211  286 GLN A C   
1853 O  O   . GLN A 294 ? 1.4668 1.0974 0.9903 -0.1006 0.0265  0.0940  286 GLN A O   
1854 C  CB  . GLN A 294 ? 1.4077 1.1040 0.9734 -0.0939 0.0181  0.1558  286 GLN A CB  
1855 C  CG  . GLN A 294 ? 1.4682 1.1931 1.0349 -0.0811 0.0142  0.1857  286 GLN A CG  
1856 C  CD  . GLN A 294 ? 1.5667 1.2820 1.1568 -0.0773 0.0065  0.1965  286 GLN A CD  
1857 O  OE1 . GLN A 294 ? 1.4660 1.1888 1.0668 -0.0874 -0.0010 0.1790  286 GLN A OE1 
1858 N  NE2 . GLN A 294 ? 1.5960 1.2934 1.1907 -0.0636 0.0085  0.2249  286 GLN A NE2 
1859 N  N   . ASP A 295 ? 1.4929 1.1382 1.0497 -0.0819 0.0435  0.1334  287 ASP A N   
1860 C  CA  . ASP A 295 ? 1.4920 1.0994 1.0501 -0.0762 0.0485  0.1163  287 ASP A CA  
1861 C  C   . ASP A 295 ? 1.4641 1.0638 1.0560 -0.0747 0.0550  0.1357  287 ASP A C   
1862 O  O   . ASP A 295 ? 1.4336 1.0586 1.0393 -0.0763 0.0602  0.1603  287 ASP A O   
1863 C  CB  . ASP A 295 ? 1.5520 1.1717 1.0822 -0.0589 0.0562  0.0983  287 ASP A CB  
1864 C  CG  . ASP A 295 ? 1.7035 1.2759 1.2217 -0.0458 0.0577  0.0750  287 ASP A CG  
1865 O  OD1 . ASP A 295 ? 1.7073 1.2285 1.2234 -0.0568 0.0500  0.0656  287 ASP A OD1 
1866 O  OD2 . ASP A 295 ? 1.7894 1.3784 1.2975 -0.0230 0.0667  0.0669  287 ASP A OD2 
1867 N  N   . SER A 296 ? 1.4397 1.0009 1.0404 -0.0734 0.0542  0.1249  288 SER A N   
1868 C  CA  . SER A 296 ? 1.4030 0.9580 1.0358 -0.0739 0.0577  0.1399  288 SER A CA  
1869 C  C   . SER A 296 ? 1.4336 0.9718 1.0676 -0.0596 0.0631  0.1270  288 SER A C   
1870 O  O   . SER A 296 ? 1.4753 0.9871 1.0818 -0.0478 0.0621  0.1055  288 SER A O   
1871 C  CB  . SER A 296 ? 1.4111 0.9448 1.0608 -0.0859 0.0485  0.1462  288 SER A CB  
1872 O  OG  . SER A 296 ? 1.5030 1.0585 1.1505 -0.0922 0.0421  0.1577  288 SER A OG  
1873 N  N   . VAL A 297 ? 1.3712 0.9229 1.0336 -0.0597 0.0680  0.1398  289 VAL A N   
1874 C  CA  . VAL A 297 ? 1.3656 0.9104 1.0346 -0.0445 0.0714  0.1300  289 VAL A CA  
1875 C  C   . VAL A 297 ? 1.3502 0.8839 1.0500 -0.0546 0.0682  0.1410  289 VAL A C   
1876 O  O   . VAL A 297 ? 1.3351 0.8818 1.0546 -0.0701 0.0680  0.1584  289 VAL A O   
1877 C  CB  . VAL A 297 ? 1.4107 1.0095 1.0824 -0.0308 0.0824  0.1290  289 VAL A CB  
1878 C  CG1 . VAL A 297 ? 1.4616 1.0674 1.0970 -0.0104 0.0851  0.1105  289 VAL A CG1 
1879 C  CG2 . VAL A 297 ? 1.3888 1.0314 1.0818 -0.0522 0.0883  0.1527  289 VAL A CG2 
1880 N  N   . VAL A 298 ? 1.3220 0.8263 1.0206 -0.0444 0.0652  0.1309  290 VAL A N   
1881 C  CA  . VAL A 298 ? 1.2803 0.7753 1.0047 -0.0519 0.0614  0.1383  290 VAL A CA  
1882 C  C   . VAL A 298 ? 1.3082 0.8276 1.0483 -0.0388 0.0656  0.1351  290 VAL A C   
1883 O  O   . VAL A 298 ? 1.3422 0.8529 1.0655 -0.0159 0.0666  0.1227  290 VAL A O   
1884 C  CB  . VAL A 298 ? 1.3002 0.7500 1.0127 -0.0547 0.0541  0.1326  290 VAL A CB  
1885 C  CG1 . VAL A 298 ? 1.2675 0.7164 1.0060 -0.0601 0.0504  0.1397  290 VAL A CG1 
1886 C  CG2 . VAL A 298 ? 1.3108 0.7510 1.0094 -0.0700 0.0492  0.1333  290 VAL A CG2 
1887 N  N   . PHE A 299 ? 1.2402 0.7885 1.0090 -0.0529 0.0669  0.1457  291 PHE A N   
1888 C  CA  . PHE A 299 ? 1.2400 0.8239 1.0285 -0.0467 0.0696  0.1419  291 PHE A CA  
1889 C  C   . PHE A 299 ? 1.2493 0.8108 1.0521 -0.0483 0.0624  0.1407  291 PHE A C   
1890 O  O   . PHE A 299 ? 1.2372 0.7691 1.0448 -0.0619 0.0566  0.1473  291 PHE A O   
1891 C  CB  . PHE A 299 ? 1.2527 0.8851 1.0612 -0.0685 0.0758  0.1525  291 PHE A CB  
1892 C  CG  . PHE A 299 ? 1.2919 0.9687 1.0890 -0.0642 0.0853  0.1529  291 PHE A CG  
1893 C  CD1 . PHE A 299 ? 1.3116 0.9764 1.0919 -0.0737 0.0872  0.1626  291 PHE A CD1 
1894 C  CD2 . PHE A 299 ? 1.3359 1.0757 1.1382 -0.0478 0.0922  0.1429  291 PHE A CD2 
1895 C  CE1 . PHE A 299 ? 1.3464 1.0577 1.1142 -0.0686 0.0964  0.1625  291 PHE A CE1 
1896 C  CE2 . PHE A 299 ? 1.3854 1.1762 1.1765 -0.0408 0.1017  0.1419  291 PHE A CE2 
1897 C  CZ  . PHE A 299 ? 1.3695 1.1445 1.1429 -0.0523 0.1041  0.1518  291 PHE A CZ  
1898 N  N   . ARG A 300 ? 1.2436 0.8249 1.0512 -0.0305 0.0623  0.1316  292 ARG A N   
1899 C  CA  . ARG A 300 ? 1.2179 0.7911 1.0401 -0.0313 0.0559  0.1298  292 ARG A CA  
1900 C  C   . ARG A 300 ? 1.2590 0.8890 1.1086 -0.0392 0.0570  0.1266  292 ARG A C   
1901 O  O   . ARG A 300 ? 1.2884 0.9704 1.1406 -0.0254 0.0620  0.1203  292 ARG A O   
1902 C  CB  . ARG A 300 ? 1.2096 0.7537 1.0093 -0.0047 0.0530  0.1231  292 ARG A CB  
1903 C  CG  . ARG A 300 ? 1.2359 0.7857 1.0488 -0.0004 0.0474  0.1208  292 ARG A CG  
1904 C  CD  . ARG A 300 ? 1.3069 0.8043 1.0962 0.0063  0.0436  0.1235  292 ARG A CD  
1905 N  NE  . ARG A 300 ? 1.3124 0.8025 1.1182 -0.0123 0.0387  0.1274  292 ARG A NE  
1906 C  CZ  . ARG A 300 ? 1.4095 0.8662 1.2016 -0.0192 0.0366  0.1323  292 ARG A CZ  
1907 N  NH1 . ARG A 300 ? 1.3727 0.7913 1.1325 -0.0161 0.0386  0.1345  292 ARG A NH1 
1908 N  NH2 . ARG A 300 ? 1.2913 0.7539 1.0994 -0.0301 0.0322  0.1337  292 ARG A NH2 
1909 N  N   . VAL A 301 ? 1.2073 0.8741 1.1362 -0.1078 0.1014  0.0942  293 VAL A N   
1910 C  CA  . VAL A 301 ? 1.2164 0.9111 1.1657 -0.1222 0.1016  0.0894  293 VAL A CA  
1911 C  C   . VAL A 301 ? 1.3067 1.0268 1.2577 -0.1099 0.0957  0.0777  293 VAL A C   
1912 O  O   . VAL A 301 ? 1.3320 1.0290 1.2719 -0.1014 0.0902  0.0722  293 VAL A O   
1913 C  CB  . VAL A 301 ? 1.2795 0.9400 1.2311 -0.1407 0.0994  0.0891  293 VAL A CB  
1914 C  CG1 . VAL A 301 ? 1.2926 0.9713 1.2555 -0.1645 0.0966  0.0821  293 VAL A CG1 
1915 C  CG2 . VAL A 301 ? 1.2961 0.9279 1.2377 -0.1473 0.1043  0.1025  293 VAL A CG2 
1916 N  N   . ALA A 302 ? 1.2368 1.0120 1.1994 -0.1073 0.0971  0.0751  294 ALA A N   
1917 C  CA  . ALA A 302 ? 1.2326 1.0415 1.1951 -0.0906 0.0907  0.0649  294 ALA A CA  
1918 C  C   . ALA A 302 ? 1.2894 1.0946 1.2645 -0.1098 0.0836  0.0552  294 ALA A C   
1919 O  O   . ALA A 302 ? 1.3251 1.1298 1.3138 -0.1405 0.0841  0.0551  294 ALA A O   
1920 C  CB  . ALA A 302 ? 1.2465 1.1342 1.2223 -0.0821 0.0939  0.0648  294 ALA A CB  
2028 N  N   . VAL A 316 ? 1.3545 2.3935 1.5756 -0.0921 0.0983  -0.0009 308 VAL A N   
2029 C  CA  . VAL A 316 ? 1.3743 2.3889 1.5731 -0.1266 0.0786  -0.0137 308 VAL A CA  
2030 C  C   . VAL A 316 ? 1.4127 2.4273 1.6165 -0.1908 0.0702  -0.0231 308 VAL A C   
2031 O  O   . VAL A 316 ? 1.4085 2.5039 1.6529 -0.2133 0.0704  -0.0126 308 VAL A O   
2032 C  CB  . VAL A 316 ? 1.3847 2.4852 1.5937 -0.1117 0.0604  -0.0055 308 VAL A CB  
2033 C  CG1 . VAL A 316 ? 1.4163 2.4949 1.5961 -0.1466 0.0358  -0.0218 308 VAL A CG1 
2034 C  CG2 . VAL A 316 ? 1.3747 2.4637 1.5761 -0.0476 0.0720  0.0052  308 VAL A CG2 
2035 N  N   . TYR A 317 ? 1.4755 2.3982 1.6424 -0.2192 0.0650  -0.0411 309 TYR A N   
2036 C  CA  . TYR A 317 ? 1.5104 2.4160 1.6790 -0.2798 0.0589  -0.0518 309 TYR A CA  
2037 C  C   . TYR A 317 ? 1.6481 2.5669 1.8047 -0.3134 0.0292  -0.0663 309 TYR A C   
2038 O  O   . TYR A 317 ? 1.6514 2.5365 1.7709 -0.2896 0.0193  -0.0727 309 TYR A O   
2039 C  CB  . TYR A 317 ? 1.5234 2.3109 1.6569 -0.2885 0.0747  -0.0633 309 TYR A CB  
2040 C  CG  . TYR A 317 ? 1.5235 2.2937 1.6645 -0.2577 0.0988  -0.0545 309 TYR A CG  
2041 C  CD1 . TYR A 317 ? 1.5227 2.2898 1.6652 -0.1988 0.1072  -0.0485 309 TYR A CD1 
2042 C  CD2 . TYR A 317 ? 1.5431 2.2965 1.6875 -0.2841 0.1130  -0.0529 309 TYR A CD2 
2043 C  CE1 . TYR A 317 ? 1.5190 2.2673 1.6635 -0.1664 0.1242  -0.0452 309 TYR A CE1 
2044 C  CE2 . TYR A 317 ? 1.5457 2.2804 1.6865 -0.2488 0.1331  -0.0464 309 TYR A CE2 
2045 C  CZ  . TYR A 317 ? 1.6086 2.3406 1.7480 -0.1896 0.1362  -0.0447 309 TYR A CZ  
2046 O  OH  . TYR A 317 ? 1.5941 2.3046 1.7256 -0.1503 0.1513  -0.0428 309 TYR A OH  
2047 N  N   . ALA A 318 ? 1.6614 2.6282 1.8510 -0.3657 0.0153  -0.0712 310 ALA A N   
2048 C  CA  . ALA A 318 ? 1.7142 2.6992 1.8975 -0.3986 -0.0196 -0.0900 310 ALA A CA  
2049 C  C   . ALA A 318 ? 1.8223 2.8002 2.0325 -0.4652 -0.0275 -0.1021 310 ALA A C   
2050 O  O   . ALA A 318 ? 1.7988 2.8010 2.0534 -0.4858 -0.0066 -0.0884 310 ALA A O   
2051 C  CB  . ALA A 318 ? 1.7273 2.8300 1.9474 -0.3805 -0.0432 -0.0836 310 ALA A CB  
2052 N  N   . CYS A 319 ? 1.8911 2.8331 2.0730 -0.4955 -0.0563 -0.1269 311 CYS A N   
2053 C  CA  . CYS A 319 ? 1.9304 2.8599 2.1392 -0.5601 -0.0675 -0.1420 311 CYS A CA  
2054 C  C   . CYS A 319 ? 2.0199 2.9601 2.2154 -0.5836 -0.1144 -0.1713 311 CYS A C   
2055 O  O   . CYS A 319 ? 2.0331 2.9296 2.1612 -0.5521 -0.1295 -0.1835 311 CYS A O   
2056 C  CB  . CYS A 319 ? 1.9456 2.7559 2.1110 -0.5772 -0.0409 -0.1457 311 CYS A CB  
2057 S  SG  . CYS A 319 ? 2.0190 2.7034 2.0849 -0.5467 -0.0424 -0.1615 311 CYS A SG  
2058 N  N   . PHE A 322 ? 1.9819 3.2544 2.5204 -0.8155 -0.3485 -0.2990 314 PHE A N   
2059 C  CA  . PHE A 322 ? 2.0493 3.2480 2.5292 -0.8353 -0.3934 -0.3446 314 PHE A CA  
2060 C  C   . PHE A 322 ? 2.0944 3.3174 2.5064 -0.7852 -0.4451 -0.3710 314 PHE A C   
2061 O  O   . PHE A 322 ? 2.1537 3.4138 2.5922 -0.8033 -0.5070 -0.4108 314 PHE A O   
2062 C  CB  . PHE A 322 ? 2.0489 3.1048 2.4292 -0.8353 -0.3567 -0.3424 314 PHE A CB  
2063 N  N   . GLU A 323 ? 2.1861 3.3867 2.5118 -0.7195 -0.4201 -0.3493 315 GLU A N   
2064 C  CA  . GLU A 323 ? 2.2304 3.4495 2.4827 -0.6622 -0.4601 -0.3672 315 GLU A CA  
2065 C  C   . GLU A 323 ? 2.2007 3.4833 2.4478 -0.6010 -0.4334 -0.3308 315 GLU A C   
2066 O  O   . GLU A 323 ? 2.1447 3.4498 2.4388 -0.6021 -0.3847 -0.2938 315 GLU A O   
2067 C  CB  . GLU A 323 ? 2.3436 3.4331 2.4616 -0.6356 -0.4603 -0.3848 315 GLU A CB  
2068 N  N   . ASN A 324 ? 2.1770 3.4850 2.3624 -0.5446 -0.4659 -0.3421 316 ASN A N   
2069 C  CA  . ASN A 324 ? 2.1594 3.5225 2.3277 -0.4787 -0.4452 -0.3106 316 ASN A CA  
2070 C  C   . ASN A 324 ? 2.0871 3.5584 2.3679 -0.4910 -0.4219 -0.2790 316 ASN A C   
2071 O  O   . ASN A 324 ? 2.0399 3.5104 2.3126 -0.4557 -0.3733 -0.2418 316 ASN A O   
2072 C  CB  . ASN A 324 ? 2.1532 3.4085 2.2219 -0.4306 -0.3921 -0.2850 316 ASN A CB  
2073 C  CG  . ASN A 324 ? 2.0877 3.2840 2.1833 -0.4613 -0.3351 -0.2597 316 ASN A CG  
2074 O  OD1 . ASN A 324 ? 2.0931 3.1999 2.1662 -0.5003 -0.3265 -0.2726 316 ASN A OD1 
2075 N  ND2 . ASN A 324 ? 2.0354 3.2801 2.1752 -0.4401 -0.2970 -0.2243 316 ASN A ND2 
2076 N  N   . GLU A 325 ? 1.9620 3.5253 2.3514 -0.5399 -0.4570 -0.2941 317 GLU A N   
2077 C  CA  . GLU A 325 ? 1.8989 3.5723 2.4031 -0.5520 -0.4361 -0.2631 317 GLU A CA  
2078 C  C   . GLU A 325 ? 1.8905 3.6467 2.3844 -0.4859 -0.4378 -0.2429 317 GLU A C   
2079 O  O   . GLU A 325 ? 1.8340 3.6471 2.3778 -0.4703 -0.3991 -0.2055 317 GLU A O   
2080 C  CB  . GLU A 325 ? 1.9677 3.7279 2.6000 -0.6150 -0.4777 -0.2845 317 GLU A CB  
2081 C  CG  . GLU A 325 ? 1.9587 3.6634 2.6434 -0.6850 -0.4554 -0.2862 317 GLU A CG  
2082 C  CD  . GLU A 325 ? 2.0066 3.5835 2.5972 -0.7016 -0.4702 -0.3200 317 GLU A CD  
2083 O  OE1 . GLU A 325 ? 2.0720 3.6411 2.6156 -0.6903 -0.5283 -0.3606 317 GLU A OE1 
2084 O  OE2 . GLU A 325 ? 1.9829 3.4657 2.5416 -0.7217 -0.4241 -0.3059 317 GLU A OE2 
2085 N  N   . ASP A 326 ? 1.8250 3.5864 2.2503 -0.4438 -0.4827 -0.2676 318 ASP A N   
2086 C  CA  . ASP A 326 ? 1.8255 3.6572 2.2279 -0.3750 -0.4853 -0.2495 318 ASP A CA  
2087 C  C   . ASP A 326 ? 1.8049 3.5584 2.1199 -0.3192 -0.4255 -0.2148 318 ASP A C   
2088 O  O   . ASP A 326 ? 1.7740 3.5821 2.0937 -0.2696 -0.4034 -0.1851 318 ASP A O   
2089 C  CB  . ASP A 326 ? 1.9082 3.7640 2.2560 -0.3417 -0.5522 -0.2874 318 ASP A CB  
2090 C  CG  . ASP A 326 ? 1.9561 3.6878 2.1946 -0.3417 -0.5689 -0.3194 318 ASP A CG  
2091 O  OD1 . ASP A 326 ? 1.9166 3.5393 2.1090 -0.3553 -0.5220 -0.3063 318 ASP A OD1 
2092 O  OD2 . ASP A 326 ? 2.0396 3.7822 2.2362 -0.3249 -0.6300 -0.3583 318 ASP A OD2 
2093 N  N   . PHE A 327 ? 1.8546 3.4796 2.0960 -0.3281 -0.3998 -0.2192 319 PHE A N   
2094 C  CA  . PHE A 327 ? 1.8368 3.3777 2.0058 -0.2801 -0.3447 -0.1896 319 PHE A CA  
2095 C  C   . PHE A 327 ? 1.7563 3.3045 1.9862 -0.2949 -0.2920 -0.1561 319 PHE A C   
2096 O  O   . PHE A 327 ? 1.7241 3.2528 1.9293 -0.2471 -0.2517 -0.1273 319 PHE A O   
2097 C  CB  . PHE A 327 ? 1.8610 3.2631 1.9371 -0.2840 -0.3363 -0.2057 319 PHE A CB  
2098 N  N   . LEU A 328 ? 1.6524 3.2262 1.9619 -0.3584 -0.2921 -0.1602 320 LEU A N   
2099 C  CA  . LEU A 328 ? 1.5900 3.1846 1.9604 -0.3696 -0.2454 -0.1284 320 LEU A CA  
2100 C  C   . LEU A 328 ? 1.5621 3.2685 1.9797 -0.3272 -0.2386 -0.1016 320 LEU A C   
2101 O  O   . LEU A 328 ? 1.5166 3.2210 1.9410 -0.2996 -0.1948 -0.0715 320 LEU A O   
2102 C  CB  . LEU A 328 ? 1.5845 3.2019 2.0396 -0.4420 -0.2483 -0.1349 320 LEU A CB  
2103 C  CG  . LEU A 328 ? 1.5738 3.0783 2.0024 -0.4785 -0.2164 -0.1366 320 LEU A CG  
2104 C  CD1 . LEU A 328 ? 1.6254 3.0420 1.9918 -0.5042 -0.2470 -0.1731 320 LEU A CD1 
2105 C  CD2 . LEU A 328 ? 1.5515 3.1009 2.0778 -0.5301 -0.1971 -0.1223 320 LEU A CD2 
2106 N  N   . LYS A 329 ? 1.6083 3.4113 2.0573 -0.3202 -0.2847 -0.1146 321 LYS A N   
2107 C  CA  . LYS A 329 ? 1.5830 3.4969 2.0735 -0.2768 -0.2837 -0.0911 321 LYS A CA  
2108 C  C   . LYS A 329 ? 1.6124 3.4838 2.0180 -0.2021 -0.2588 -0.0733 321 LYS A C   
2109 O  O   . LYS A 329 ? 1.5614 3.4583 1.9833 -0.1672 -0.2212 -0.0418 321 LYS A O   
2110 C  CB  . LYS A 329 ? 1.6567 3.6786 2.1968 -0.2851 -0.3453 -0.1142 321 LYS A CB  
2111 N  N   . SER A 330 ? 1.6202 3.4237 1.9362 -0.1757 -0.2782 -0.0928 322 SER A N   
2112 C  CA  . SER A 330 ? 1.6131 3.3703 1.8511 -0.1033 -0.2529 -0.0746 322 SER A CA  
2113 C  C   . SER A 330 ? 1.5951 3.2566 1.8117 -0.0929 -0.1952 -0.0524 322 SER A C   
2114 O  O   . SER A 330 ? 1.5737 3.2158 1.7619 -0.0356 -0.1641 -0.0288 322 SER A O   
2115 C  CB  . SER A 330 ? 1.7212 3.4155 1.8656 -0.0785 -0.2817 -0.0986 322 SER A CB  
2116 O  OG  . SER A 330 ? 1.8375 3.4228 1.9435 -0.1196 -0.2789 -0.1187 322 SER A OG  
2117 N  N   . VAL A 331 ? 1.6278 3.2288 1.8611 -0.1473 -0.1826 -0.0611 323 VAL A N   
2118 C  CA  . VAL A 331 ? 1.5848 3.0993 1.8057 -0.1417 -0.1338 -0.0446 323 VAL A CA  
2119 C  C   . VAL A 331 ? 1.5348 3.1190 1.8229 -0.1337 -0.1066 -0.0182 323 VAL A C   
2120 O  O   . VAL A 331 ? 1.5061 3.0596 1.7812 -0.0900 -0.0720 0.0018  323 VAL A O   
2121 C  CB  . VAL A 331 ? 1.5875 3.0108 1.7969 -0.1994 -0.1302 -0.0635 323 VAL A CB  
2122 C  CG1 . VAL A 331 ? 1.5402 2.9047 1.7610 -0.2006 -0.0852 -0.0471 323 VAL A CG1 
2123 C  CG2 . VAL A 331 ? 1.6325 2.9561 1.7586 -0.1922 -0.1417 -0.0832 323 VAL A CG2 
2124 N  N   . THR A 332 ? 1.4282 3.1057 1.7912 -0.1737 -0.1224 -0.0181 324 THR A N   
2125 C  CA  . THR A 332 ? 1.3880 3.1363 1.8157 -0.1662 -0.0951 0.0093  324 THR A CA  
2126 C  C   . THR A 332 ? 1.3783 3.2022 1.8121 -0.1039 -0.0902 0.0310  324 THR A C   
2127 O  O   . THR A 332 ? 1.3457 3.1901 1.8012 -0.0749 -0.0574 0.0555  324 THR A O   
2128 C  CB  . THR A 332 ? 1.3890 3.2264 1.9063 -0.2223 -0.1108 0.0086  324 THR A CB  
2129 O  OG1 . THR A 332 ? 1.4267 3.3319 1.9656 -0.2392 -0.1618 -0.0125 324 THR A OG1 
2130 C  CG2 . THR A 332 ? 1.3882 3.1495 1.9098 -0.2786 -0.0981 -0.0019 324 THR A CG2 
2131 N  N   . THR A 333 ? 1.3436 3.2066 1.7542 -0.0799 -0.1229 0.0215  325 THR A N   
2132 C  CA  . THR A 333 ? 1.3404 3.2702 1.7492 -0.0166 -0.1183 0.0423  325 THR A CA  
2133 C  C   . THR A 333 ? 1.3243 3.1647 1.6758 0.0382  -0.0789 0.0574  325 THR A C   
2134 O  O   . THR A 333 ? 1.3005 3.1772 1.6686 0.0834  -0.0543 0.0818  325 THR A O   
2135 C  CB  . THR A 333 ? 1.3897 3.3740 1.7758 0.0024  -0.1640 0.0271  325 THR A CB  
2136 O  OG1 . THR A 333 ? 1.4291 3.3118 1.7355 0.0012  -0.1766 0.0043  325 THR A OG1 
2137 C  CG2 . THR A 333 ? 1.4047 3.4985 1.8680 -0.0448 -0.2075 0.0125  325 THR A CG2 
2138 N  N   . LEU A 334 ? 1.4302 3.1528 1.7198 0.0338  -0.0729 0.0428  326 LEU A N   
2139 C  CA  . LEU A 334 ? 1.4149 3.0449 1.6594 0.0830  -0.0375 0.0551  326 LEU A CA  
2140 C  C   . LEU A 334 ? 1.3988 2.9911 1.6715 0.0829  -0.0013 0.0664  326 LEU A C   
2141 O  O   . LEU A 334 ? 1.3684 2.9406 1.6394 0.1334  0.0261  0.0834  326 LEU A O   
2142 C  CB  . LEU A 334 ? 1.4482 2.9635 1.6267 0.0754  -0.0402 0.0374  326 LEU A CB  
2143 C  CG  . LEU A 334 ? 1.5155 2.9439 1.6501 0.1336  -0.0084 0.0517  326 LEU A CG  
2144 C  CD1 . LEU A 334 ? 1.5436 3.0343 1.6625 0.1953  -0.0115 0.0695  326 LEU A CD1 
2145 C  CD2 . LEU A 334 ? 1.5778 2.8909 1.6551 0.1191  -0.0076 0.0359  326 LEU A CD2 
2146 N  N   . ALA A 335 ? 1.3845 2.9653 1.6825 0.0288  -0.0020 0.0563  327 ALA A N   
2147 C  CA  . ALA A 335 ? 1.3510 2.8953 1.6680 0.0302  0.0291  0.0645  327 ALA A CA  
2148 C  C   . ALA A 335 ? 1.3306 2.9744 1.6958 0.0601  0.0418  0.0884  327 ALA A C   
2149 O  O   . ALA A 335 ? 1.3107 2.9265 1.6764 0.0976  0.0688  0.0994  327 ALA A O   
2150 C  CB  . ALA A 335 ? 1.3496 2.8602 1.6775 -0.0319 0.0268  0.0505  327 ALA A CB  
2151 N  N   . MET A 336 ? 1.2882 3.0476 1.6962 0.0447  0.0204  0.0949  328 MET A N   
2152 C  CA  . MET A 336 ? 1.2696 3.1340 1.7275 0.0730  0.0317  0.1201  328 MET A CA  
2153 C  C   . MET A 336 ? 1.3178 3.1989 1.7558 0.1409  0.0398  0.1344  328 MET A C   
2154 O  O   . MET A 336 ? 1.2968 3.2241 1.7585 0.1799  0.0607  0.1555  328 MET A O   
2155 C  CB  . MET A 336 ? 1.3088 3.2939 1.8289 0.0355  0.0042  0.1225  328 MET A CB  
2156 N  N   . LYS A 337 ? 1.3224 3.1637 1.7152 0.1577  0.0255  0.1244  329 LYS A N   
2157 C  CA  . LYS A 337 ? 1.3247 3.1729 1.6961 0.2240  0.0364  0.1400  329 LYS A CA  
2158 C  C   . LYS A 337 ? 1.3527 3.0975 1.7028 0.2611  0.0716  0.1446  329 LYS A C   
2159 O  O   . LYS A 337 ? 1.3341 3.0972 1.6945 0.3146  0.0919  0.1629  329 LYS A O   
2160 C  CB  . LYS A 337 ? 1.3959 3.2343 1.7223 0.2346  0.0120  0.1305  329 LYS A CB  
2161 N  N   . ALA A 338 ? 1.3947 3.0307 1.7195 0.2328  0.0772  0.1265  330 ALA A N   
2162 C  CA  . ALA A 338 ? 1.3804 2.9115 1.6931 0.2632  0.1052  0.1254  330 ALA A CA  
2163 C  C   . ALA A 338 ? 1.3891 2.9143 1.7279 0.2584  0.1202  0.1249  330 ALA A C   
2164 O  O   . ALA A 338 ? 1.3730 2.8100 1.7060 0.2787  0.1375  0.1177  330 ALA A O   
2165 C  CB  . ALA A 338 ? 1.3926 2.8081 1.6673 0.2397  0.1039  0.1067  330 ALA A CB  
2166 N  N   . LYS A 339 ? 1.4093 3.0288 1.7787 0.2345  0.1132  0.1327  331 LYS A N   
2167 C  CA  . LYS A 339 ? 1.3950 3.0194 1.7840 0.2328  0.1295  0.1363  331 LYS A CA  
2168 C  C   . LYS A 339 ? 1.4378 2.9522 1.8025 0.2031  0.1343  0.1151  331 LYS A C   
2169 O  O   . LYS A 339 ? 1.4233 2.8712 1.7786 0.2326  0.1501  0.1094  331 LYS A O   
2170 C  CB  . LYS A 339 ? 1.4209 3.0537 1.8188 0.2982  0.1505  0.1503  331 LYS A CB  
2171 N  N   . CYS A 340 ? 1.3913 2.8866 1.7462 0.1465  0.1184  0.1017  332 CYS A N   
2172 C  CA  . CYS A 340 ? 1.3943 2.7884 1.7250 0.1142  0.1219  0.0822  332 CYS A CA  
2173 C  C   . CYS A 340 ? 1.4311 2.8622 1.7788 0.0545  0.1152  0.0808  332 CYS A C   
2174 O  O   . CYS A 340 ? 1.4332 2.9369 1.8031 0.0216  0.0962  0.0834  332 CYS A O   
2175 C  CB  . CYS A 340 ? 1.4152 2.7148 1.7106 0.1068  0.1135  0.0649  332 CYS A CB  
2176 S  SG  . CYS A 340 ? 1.4742 2.6524 1.7405 0.0625  0.1150  0.0406  332 CYS A SG  
2177 N  N   . LYS A 341 ? 1.3663 2.7461 1.7059 0.0428  0.1301  0.0760  333 LYS A N   
2178 C  CA  . LYS A 341 ? 1.3694 2.7759 1.7287 -0.0106 0.1313  0.0785  333 LYS A CA  
2179 C  C   . LYS A 341 ? 1.4297 2.7865 1.7730 -0.0670 0.1113  0.0582  333 LYS A C   
2180 O  O   . LYS A 341 ? 1.4315 2.6889 1.7331 -0.0651 0.1075  0.0396  333 LYS A O   
2181 C  CB  . LYS A 341 ? 1.3989 2.7542 1.7431 0.0014  0.1556  0.0801  333 LYS A CB  
2182 C  CG  . LYS A 341 ? 1.4822 2.8526 1.8451 -0.0500 0.1643  0.0862  333 LYS A CG  
2183 C  CD  . LYS A 341 ? 1.5537 2.8773 1.8930 -0.0247 0.1914  0.0914  333 LYS A CD  
2184 C  CE  . LYS A 341 ? 1.6005 2.9179 1.9519 -0.0752 0.2042  0.0975  333 LYS A CE  
2185 N  NZ  . LYS A 341 ? 1.6274 2.8629 1.9550 -0.1249 0.1868  0.0721  333 LYS A NZ  
2186 N  N   . LEU A 342 ? 1.3677 2.7935 1.7488 -0.1162 0.0984  0.0616  334 LEU A N   
2187 C  CA  . LEU A 342 ? 1.3873 2.7726 1.7562 -0.1711 0.0765  0.0406  334 LEU A CA  
2188 C  C   . LEU A 342 ? 1.4721 2.8578 1.8695 -0.2234 0.0862  0.0428  334 LEU A C   
2189 O  O   . LEU A 342 ? 1.4771 2.9457 1.9288 -0.2294 0.0995  0.0643  334 LEU A O   
2190 C  CB  . LEU A 342 ? 1.4006 2.8630 1.7902 -0.1831 0.0435  0.0361  334 LEU A CB  
2191 C  CG  . LEU A 342 ? 1.4870 2.8950 1.8408 -0.2162 0.0143  0.0096  334 LEU A CG  
2192 C  CD1 . LEU A 342 ? 1.5057 2.9813 1.8597 -0.1960 -0.0155 0.0068  334 LEU A CD1 
2193 C  CD2 . LEU A 342 ? 1.5358 2.9426 1.9175 -0.2846 0.0027  -0.0026 334 LEU A CD2 
2194 N  N   . THR A 343 ? 1.4985 2.7906 1.8615 -0.2592 0.0827  0.0229  335 THR A N   
2195 C  CA  . THR A 343 ? 1.5173 2.7980 1.9042 -0.3101 0.0935  0.0245  335 THR A CA  
2196 C  C   . THR A 343 ? 1.6007 2.8241 1.9685 -0.3630 0.0691  -0.0016 335 THR A C   
2197 O  O   . THR A 343 ? 1.6030 2.7482 1.9146 -0.3522 0.0569  -0.0207 335 THR A O   
2198 C  CB  . THR A 343 ? 1.6483 2.8536 2.0027 -0.2892 0.1270  0.0308  335 THR A CB  
2199 O  OG1 . THR A 343 ? 1.6540 2.8951 2.0095 -0.2293 0.1454  0.0490  335 THR A OG1 
2200 C  CG2 . THR A 343 ? 1.6570 2.8723 2.0451 -0.3323 0.1468  0.0429  335 THR A CG2 
2201 N  N   . ILE A 344 ? 1.5332 2.7945 1.9515 -0.4185 0.0633  -0.0014 336 ILE A N   
2202 C  CA  . ILE A 344 ? 1.5574 2.7683 1.9623 -0.4709 0.0379  -0.0279 336 ILE A CA  
2203 C  C   . ILE A 344 ? 1.6178 2.7268 1.9915 -0.4974 0.0608  -0.0328 336 ILE A C   
2204 O  O   . ILE A 344 ? 1.6278 2.7525 2.0473 -0.5400 0.0729  -0.0250 336 ILE A O   
2205 C  CB  . ILE A 344 ? 1.6160 2.9219 2.1017 -0.5203 0.0123  -0.0305 336 ILE A CB  
2206 C  CG1 . ILE A 344 ? 1.6101 3.0340 2.1405 -0.4904 -0.0049 -0.0192 336 ILE A CG1 
2207 C  CG2 . ILE A 344 ? 1.6566 2.9124 2.1183 -0.5636 -0.0248 -0.0648 336 ILE A CG2 
2208 C  CD1 . ILE A 344 ? 1.6864 3.0960 2.1575 -0.4523 -0.0333 -0.0362 336 ILE A CD1 
2219 N  N   . GLU A 359 ? 1.7893 1.7728 2.0344 -0.3722 0.0929  -0.4550 351 GLU A N   
2220 C  CA  . GLU A 359 ? 1.8140 1.6606 2.0570 -0.3799 0.0942  -0.4023 351 GLU A CA  
2221 C  C   . GLU A 359 ? 1.7912 1.6219 2.0102 -0.3687 0.0833  -0.3479 351 GLU A C   
2222 O  O   . GLU A 359 ? 1.8347 1.5622 2.0463 -0.3670 0.0786  -0.3023 351 GLU A O   
2223 C  CB  . GLU A 359 ? 1.9253 1.6994 2.1737 -0.4484 0.1155  -0.4114 351 GLU A CB  
2224 C  CG  . GLU A 359 ? 2.1381 1.7594 2.3825 -0.4437 0.1146  -0.3692 351 GLU A CG  
2225 C  CD  . GLU A 359 ? 2.5150 2.0437 2.7396 -0.5114 0.1377  -0.3629 351 GLU A CD  
2226 O  OE1 . GLU A 359 ? 2.3399 1.8087 2.5277 -0.5278 0.1379  -0.3172 351 GLU A OE1 
2227 O  OE2 . GLU A 359 ? 2.5300 2.0397 2.7700 -0.5483 0.1579  -0.4041 351 GLU A OE2 
2228 N  N   . MET A 360 ? 1.7315 1.6667 1.9371 -0.3571 0.0774  -0.3553 352 MET A N   
2229 C  CA  . MET A 360 ? 1.6814 1.6120 1.8640 -0.3490 0.0682  -0.3085 352 MET A CA  
2230 C  C   . MET A 360 ? 1.5586 1.5776 1.7282 -0.2951 0.0558  -0.3121 352 MET A C   
2231 O  O   . MET A 360 ? 1.5130 1.6157 1.6822 -0.2723 0.0550  -0.3554 352 MET A O   
2232 C  CB  . MET A 360 ? 1.7653 1.7140 1.9330 -0.4141 0.0820  -0.3065 352 MET A CB  
2233 C  CG  . MET A 360 ? 1.7956 1.8875 1.9692 -0.4329 0.0885  -0.3570 352 MET A CG  
2234 S  SD  . MET A 360 ? 1.9214 2.0307 2.0780 -0.5153 0.1120  -0.3552 352 MET A SD  
2235 C  CE  . MET A 360 ? 1.8240 2.1293 2.0017 -0.5152 0.1117  -0.4246 352 MET A CE  
2236 N  N   . GLU A 361 ? 1.5079 1.5031 1.6614 -0.2725 0.0459  -0.2677 353 GLU A N   
2237 C  CA  . GLU A 361 ? 1.4115 1.4729 1.5453 -0.2238 0.0379  -0.2658 353 GLU A CA  
2238 C  C   . GLU A 361 ? 1.3886 1.4786 1.5039 -0.2411 0.0336  -0.2362 353 GLU A C   
2239 O  O   . GLU A 361 ? 1.3920 1.4105 1.5043 -0.2581 0.0298  -0.1952 353 GLU A O   
2240 C  CB  . GLU A 361 ? 1.4002 1.3998 1.5351 -0.1707 0.0344  -0.2466 353 GLU A CB  
2241 C  CG  . GLU A 361 ? 1.4476 1.4992 1.5523 -0.1178 0.0342  -0.2530 353 GLU A CG  
2242 C  CD  . GLU A 361 ? 1.6240 1.7176 1.7112 -0.0867 0.0394  -0.2975 353 GLU A CD  
2243 O  OE1 . GLU A 361 ? 1.5202 1.5839 1.6277 -0.0975 0.0440  -0.3195 353 GLU A OE1 
2244 O  OE2 . GLU A 361 ? 1.4849 1.6380 1.5329 -0.0483 0.0382  -0.3110 353 GLU A OE2 
2245 N  N   . ILE A 362 ? 1.3167 1.5114 1.4163 -0.2332 0.0326  -0.2589 354 ILE A N   
2246 C  CA  . ILE A 362 ? 1.2968 1.5293 1.3790 -0.2514 0.0305  -0.2365 354 ILE A CA  
2247 C  C   . ILE A 362 ? 1.2735 1.5017 1.3351 -0.1997 0.0212  -0.2076 354 ILE A C   
2248 O  O   . ILE A 362 ? 1.2394 1.5232 1.2829 -0.1538 0.0194  -0.2278 354 ILE A O   
2249 C  CB  . ILE A 362 ? 1.3312 1.6889 1.4123 -0.2736 0.0354  -0.2810 354 ILE A CB  
2250 C  CG1 . ILE A 362 ? 1.3868 1.7577 1.4934 -0.3311 0.0498  -0.3198 354 ILE A CG1 
2251 C  CG2 . ILE A 362 ? 1.3399 1.7327 1.4037 -0.2972 0.0363  -0.2582 354 ILE A CG2 
2252 C  CD1 . ILE A 362 ? 1.4989 2.0075 1.6166 -0.3566 0.0561  -0.3763 354 ILE A CD1 
2253 N  N   . GLY A 363 ? 1.3233 1.4816 1.3828 -0.2057 0.0158  -0.1624 355 GLY A N   
2254 C  CA  . GLY A 363 ? 1.2628 1.4171 1.3078 -0.1658 0.0094  -0.1375 355 GLY A CA  
2255 C  C   . GLY A 363 ? 1.2539 1.4393 1.2800 -0.1896 0.0051  -0.1133 355 GLY A C   
2256 O  O   . GLY A 363 ? 1.2644 1.5038 1.2832 -0.2297 0.0106  -0.1263 355 GLY A O   
2257 N  N   . TYR A 364 ? 1.2536 1.4085 1.2732 -0.1673 -0.0027 -0.0823 356 TYR A N   
2258 C  CA  . TYR A 364 ? 1.2346 1.4150 1.2325 -0.1862 -0.0079 -0.0579 356 TYR A CA  
2259 C  C   . TYR A 364 ? 1.2606 1.3863 1.2601 -0.1649 -0.0202 -0.0240 356 TYR A C   
2260 O  O   . TYR A 364 ? 1.2452 1.3329 1.2654 -0.1299 -0.0213 -0.0262 356 TYR A O   
2261 C  CB  . TYR A 364 ? 1.1966 1.4765 1.1746 -0.1704 -0.0024 -0.0794 356 TYR A CB  
2262 C  CG  . TYR A 364 ? 1.1568 1.4399 1.1251 -0.1139 -0.0006 -0.0825 356 TYR A CG  
2263 C  CD1 . TYR A 364 ? 1.1625 1.4407 1.1286 -0.0758 0.0074  -0.1088 356 TYR A CD1 
2264 C  CD2 . TYR A 364 ? 1.1466 1.4312 1.1015 -0.1001 -0.0037 -0.0605 356 TYR A CD2 
2265 C  CE1 . TYR A 364 ? 1.1370 1.4010 1.0813 -0.0274 0.0165  -0.1112 356 TYR A CE1 
2266 C  CE2 . TYR A 364 ? 1.1299 1.4075 1.0716 -0.0539 0.0047  -0.0660 356 TYR A CE2 
2267 C  CZ  . TYR A 364 ? 1.1933 1.4555 1.1266 -0.0186 0.0169  -0.0905 356 TYR A CZ  
2268 O  OH  . TYR A 364 ? 1.1645 1.4036 1.0722 0.0244  0.0324  -0.0956 356 TYR A OH  
2269 N  N   . ILE A 365 ? 1.1949 1.3208 1.1723 -0.1876 -0.0281 0.0032  357 ILE A N   
2270 C  CA  . ILE A 365 ? 1.1846 1.2826 1.1606 -0.1657 -0.0425 0.0295  357 ILE A CA  
2271 C  C   . ILE A 365 ? 1.1952 1.3618 1.1431 -0.1702 -0.0406 0.0348  357 ILE A C   
2272 O  O   . ILE A 365 ? 1.2032 1.4158 1.1284 -0.2042 -0.0326 0.0304  357 ILE A O   
2273 C  CB  . ILE A 365 ? 1.2887 1.3026 1.2568 -0.1813 -0.0602 0.0617  357 ILE A CB  
2274 C  CG1 . ILE A 365 ? 1.3554 1.3609 1.2794 -0.2328 -0.0549 0.0781  357 ILE A CG1 
2275 C  CG2 . ILE A 365 ? 1.3177 1.2622 1.3168 -0.1704 -0.0633 0.0544  357 ILE A CG2 
2276 C  CD1 . ILE A 365 ? 1.5479 1.4529 1.4414 -0.2441 -0.0707 0.1139  357 ILE A CD1 
2277 N  N   . GLN A 366 ? 1.1837 1.3611 1.1355 -0.1384 -0.0452 0.0394  358 GLN A N   
2278 C  CA  . GLN A 366 ? 1.1551 1.3970 1.0803 -0.1398 -0.0421 0.0418  358 GLN A CA  
2279 C  C   . GLN A 366 ? 1.2224 1.4505 1.1458 -0.1258 -0.0558 0.0619  358 GLN A C   
2280 O  O   . GLN A 366 ? 1.1963 1.3874 1.1486 -0.0990 -0.0619 0.0599  358 GLN A O   
2281 C  CB  . GLN A 366 ? 1.1142 1.4143 1.0350 -0.1102 -0.0248 0.0113  358 GLN A CB  
2282 C  CG  . GLN A 366 ? 1.1398 1.4075 1.0759 -0.0671 -0.0160 -0.0001 358 GLN A CG  
2283 C  CD  . GLN A 366 ? 1.2425 1.5541 1.1496 -0.0348 0.0018  -0.0213 358 GLN A CD  
2284 O  OE1 . GLN A 366 ? 1.1350 1.5115 1.0164 -0.0398 0.0031  -0.0299 358 GLN A OE1 
2285 N  NE2 . GLN A 366 ? 1.1698 1.4429 1.0775 -0.0008 0.0179  -0.0322 358 GLN A NE2 
2286 N  N   . ALA A 367 ? 1.2420 1.5068 1.1330 -0.1460 -0.0595 0.0766  359 ALA A N   
2287 C  CA  . ALA A 367 ? 1.2462 1.5129 1.1289 -0.1351 -0.0731 0.0925  359 ALA A CA  
2288 C  C   . ALA A 367 ? 1.2950 1.6382 1.1523 -0.1377 -0.0609 0.0840  359 ALA A C   
2289 O  O   . ALA A 367 ? 1.2788 1.6707 1.1229 -0.1522 -0.0464 0.0693  359 ALA A O   
2290 C  CB  . ALA A 367 ? 1.3234 1.5382 1.1791 -0.1574 -0.0948 0.1259  359 ALA A CB  
2291 N  N   . PRO A 368 ? 1.1852 1.5449 1.0387 -0.1223 -0.0669 0.0882  360 PRO A N   
2292 C  CA  . PRO A 368 ? 1.1693 1.5986 0.9972 -0.1231 -0.0549 0.0794  360 PRO A CA  
2293 C  C   . PRO A 368 ? 1.2729 1.7406 1.0642 -0.1638 -0.0535 0.0905  360 PRO A C   
2294 O  O   . PRO A 368 ? 1.2572 1.7937 1.0331 -0.1657 -0.0400 0.0743  360 PRO A O   
2295 C  CB  . PRO A 368 ? 1.1836 1.6109 1.0151 -0.1075 -0.0657 0.0853  360 PRO A CB  
2296 C  CG  . PRO A 368 ? 1.2290 1.6024 1.1029 -0.0842 -0.0726 0.0786  360 PRO A CG  
2297 C  CD  . PRO A 368 ? 1.2052 1.5294 1.0851 -0.0989 -0.0824 0.0915  360 PRO A CD  
2298 N  N   . HIS A 369 ? 1.1741 1.5940 0.9478 -0.1956 -0.0646 0.1154  361 HIS A N   
2299 C  CA  . HIS A 369 ? 1.2086 1.6519 0.9413 -0.2425 -0.0561 0.1253  361 HIS A CA  
2300 C  C   . HIS A 369 ? 1.2672 1.7151 1.0063 -0.2738 -0.0395 0.1097  361 HIS A C   
2301 O  O   . HIS A 369 ? 1.2704 1.7832 0.9968 -0.3051 -0.0216 0.0921  361 HIS A O   
2302 C  CB  . HIS A 369 ? 1.2967 1.6732 0.9855 -0.2617 -0.0733 0.1637  361 HIS A CB  
2303 C  CG  . HIS A 369 ? 1.3805 1.6629 1.0785 -0.2473 -0.0928 0.1819  361 HIS A CG  
2304 N  ND1 . HIS A 369 ? 1.3796 1.6374 1.1097 -0.2034 -0.1151 0.1823  361 HIS A ND1 
2305 C  CD2 . HIS A 369 ? 1.4695 1.6772 1.1498 -0.2707 -0.0919 0.1966  361 HIS A CD2 
2306 C  CE1 . HIS A 369 ? 1.4203 1.5978 1.1544 -0.1963 -0.1304 0.1960  361 HIS A CE1 
2307 N  NE2 . HIS A 369 ? 1.4814 1.6213 1.1820 -0.2357 -0.1168 0.2071  361 HIS A NE2 
2308 N  N   . LYS A 370 ? 1.2069 1.5923 0.9693 -0.2664 -0.0445 0.1109  362 LYS A N   
2309 C  CA  . LYS A 370 ? 1.2341 1.6191 1.0042 -0.2987 -0.0288 0.0937  362 LYS A CA  
2310 C  C   . LYS A 370 ? 1.2528 1.6259 1.0673 -0.2666 -0.0294 0.0712  362 LYS A C   
2311 O  O   . LYS A 370 ? 1.2266 1.5480 1.0615 -0.2308 -0.0430 0.0807  362 LYS A O   
2312 C  CB  . LYS A 370 ? 1.3628 1.6585 1.0950 -0.3419 -0.0286 0.1237  362 LYS A CB  
2313 C  CG  . LYS A 370 ? 1.6038 1.9055 1.3338 -0.3935 -0.0033 0.1030  362 LYS A CG  
2314 C  CD  . LYS A 370 ? 1.7461 2.1619 1.4760 -0.4236 0.0191  0.0696  362 LYS A CD  
2315 C  CE  . LYS A 370 ? 2.0091 2.4078 1.7032 -0.4977 0.0480  0.0670  362 LYS A CE  
2316 N  NZ  . LYS A 370 ? 2.1943 2.5341 1.9013 -0.5245 0.0600  0.0561  362 LYS A NZ  
2317 N  N   . THR A 371 ? 1.2968 1.7232 1.1266 -0.2801 -0.0139 0.0372  363 THR A N   
2318 C  CA  . THR A 371 ? 1.2639 1.6802 1.1271 -0.2537 -0.0128 0.0132  363 THR A CA  
2319 C  C   . THR A 371 ? 1.3563 1.7847 1.2276 -0.2970 0.0010  -0.0099 363 THR A C   
2320 O  O   . THR A 371 ? 1.3647 1.8752 1.2322 -0.3263 0.0147  -0.0371 363 THR A O   
2321 C  CB  . THR A 371 ? 1.2163 1.7017 1.0883 -0.2044 -0.0094 -0.0170 363 THR A CB  
2322 O  OG1 . THR A 371 ? 1.1798 1.6445 1.0449 -0.1684 -0.0162 0.0008  363 THR A OG1 
2323 C  CG2 . THR A 371 ? 1.1080 1.5768 1.0024 -0.1772 -0.0067 -0.0417 363 THR A CG2 
2324 N  N   . LEU A 372 ? 1.2940 1.6448 1.1799 -0.3024 -0.0011 -0.0040 364 LEU A N   
2325 C  CA  . LEU A 372 ? 1.3391 1.6881 1.2328 -0.3485 0.0146  -0.0266 364 LEU A CA  
2326 C  C   . LEU A 372 ? 1.3904 1.6975 1.3159 -0.3263 0.0115  -0.0422 364 LEU A C   
2327 O  O   . LEU A 372 ? 1.3781 1.6186 1.3134 -0.2886 -0.0022 -0.0219 364 LEU A O   
2328 C  CB  . LEU A 372 ? 1.4307 1.6994 1.2870 -0.4042 0.0229  0.0054  364 LEU A CB  
2329 C  CG  . LEU A 372 ? 1.5354 1.6855 1.3670 -0.3865 0.0035  0.0558  364 LEU A CG  
2330 C  CD1 . LEU A 372 ? 1.5674 1.6259 1.4165 -0.3798 -0.0010 0.0589  364 LEU A CD1 
2331 C  CD2 . LEU A 372 ? 1.6659 1.7656 1.4357 -0.4301 0.0106  0.0894  364 LEU A CD2 
2332 N  N   . PRO A 373 ? 1.3299 1.6824 1.2743 -0.3507 0.0254  -0.0835 365 PRO A N   
2333 C  CA  . PRO A 373 ? 1.3202 1.6377 1.2925 -0.3348 0.0245  -0.1031 365 PRO A CA  
2334 C  C   . PRO A 373 ? 1.4014 1.5975 1.3700 -0.3636 0.0262  -0.0759 365 PRO A C   
2335 O  O   . PRO A 373 ? 1.4410 1.5958 1.3827 -0.4163 0.0383  -0.0599 365 PRO A O   
2336 C  CB  . PRO A 373 ? 1.3429 1.7613 1.3336 -0.3590 0.0385  -0.1601 365 PRO A CB  
2337 C  CG  . PRO A 373 ? 1.4388 1.9040 1.4128 -0.4159 0.0542  -0.1633 365 PRO A CG  
2338 C  CD  . PRO A 373 ? 1.3620 1.8157 1.3070 -0.3936 0.0430  -0.1217 365 PRO A CD  
2339 N  N   . VAL A 374 ? 1.3555 1.4897 1.3453 -0.3280 0.0163  -0.0718 366 VAL A N   
2340 C  CA  . VAL A 374 ? 1.4227 1.4403 1.4116 -0.3439 0.0148  -0.0499 366 VAL A CA  
2341 C  C   . VAL A 374 ? 1.4745 1.4819 1.4977 -0.3336 0.0198  -0.0832 366 VAL A C   
2342 O  O   . VAL A 374 ? 1.4156 1.4576 1.4603 -0.2867 0.0139  -0.1012 366 VAL A O   
2343 C  CB  . VAL A 374 ? 1.4257 1.3651 1.4094 -0.3048 -0.0073 -0.0076 366 VAL A CB  
2344 C  CG1 . VAL A 374 ? 1.5002 1.3209 1.4829 -0.3110 -0.0125 0.0103  366 VAL A CG1 
2345 C  CG2 . VAL A 374 ? 1.4393 1.3860 1.3851 -0.3134 -0.0145 0.0250  366 VAL A CG2 
2346 N  N   . VAL A 375 ? 1.4684 1.4220 1.4907 -0.3781 0.0336  -0.0921 367 VAL A N   
2347 C  CA  . VAL A 375 ? 1.4694 1.4134 1.5240 -0.3723 0.0393  -0.1264 367 VAL A CA  
2348 C  C   . VAL A 375 ? 1.5780 1.4012 1.6412 -0.3511 0.0292  -0.1016 367 VAL A C   
2349 O  O   . VAL A 375 ? 1.6570 1.3819 1.6943 -0.3757 0.0296  -0.0713 367 VAL A O   
2350 C  CB  . VAL A 375 ? 1.5853 1.5570 1.6429 -0.4359 0.0644  -0.1657 367 VAL A CB  
2351 C  CG1 . VAL A 375 ? 1.6861 1.5751 1.7030 -0.4963 0.0811  -0.1373 367 VAL A CG1 
2352 C  CG2 . VAL A 375 ? 1.5987 1.5431 1.6874 -0.4320 0.0693  -0.1982 367 VAL A CG2 
2353 N  N   . PHE A 376 ? 1.5280 1.3563 1.6225 -0.3027 0.0210  -0.1160 368 PHE A N   
2354 C  CA  . PHE A 376 ? 1.5605 1.2913 1.6747 -0.2801 0.0130  -0.1048 368 PHE A CA  
2355 C  C   . PHE A 376 ? 1.7137 1.4204 1.8442 -0.3072 0.0284  -0.1386 368 PHE A C   
2356 O  O   . PHE A 376 ? 1.6627 1.4389 1.8112 -0.2998 0.0366  -0.1795 368 PHE A O   
2357 C  CB  . PHE A 376 ? 1.5019 1.2480 1.6424 -0.2203 0.0032  -0.1082 368 PHE A CB  
2358 C  CG  . PHE A 376 ? 1.5310 1.1865 1.6967 -0.1931 -0.0083 -0.0942 368 PHE A CG  
2359 C  CD1 . PHE A 376 ? 1.6396 1.2007 1.7949 -0.2125 -0.0157 -0.0724 368 PHE A CD1 
2360 C  CD2 . PHE A 376 ? 1.4934 1.1555 1.6896 -0.1470 -0.0097 -0.1059 368 PHE A CD2 
2361 C  CE1 . PHE A 376 ? 1.6690 1.1537 1.8495 -0.1802 -0.0301 -0.0641 368 PHE A CE1 
2362 C  CE2 . PHE A 376 ? 1.5430 1.1354 1.7713 -0.1219 -0.0199 -0.1012 368 PHE A CE2 
2363 C  CZ  . PHE A 376 ? 1.5922 1.1007 1.8154 -0.1355 -0.0330 -0.0811 368 PHE A CZ  
2364 N  N   . ASP A 377 ? 1.6686 1.2728 1.7864 -0.3364 0.0322  -0.1224 369 ASP A N   
2365 C  CA  . ASP A 377 ? 1.7429 1.3137 1.8739 -0.3682 0.0499  -0.1549 369 ASP A CA  
2366 C  C   . ASP A 377 ? 1.8301 1.3225 1.9902 -0.3306 0.0407  -0.1553 369 ASP A C   
2367 O  O   . ASP A 377 ? 1.8535 1.2610 2.0075 -0.3047 0.0240  -0.1206 369 ASP A O   
2368 C  CB  . ASP A 377 ? 1.8897 1.3878 1.9803 -0.4323 0.0690  -0.1429 369 ASP A CB  
2369 C  CG  . ASP A 377 ? 2.2025 1.6863 2.3073 -0.4775 0.0946  -0.1867 369 ASP A CG  
2370 O  OD1 . ASP A 377 ? 2.1974 1.7846 2.3163 -0.5121 0.1118  -0.2314 369 ASP A OD1 
2371 O  OD2 . ASP A 377 ? 2.3983 1.7714 2.5020 -0.4770 0.0970  -0.1803 369 ASP A OD2 
2372 N  N   . SER A 378 ? 1.8431 1.3695 2.0346 -0.3253 0.0504  -0.1984 370 SER A N   
2373 C  CA  . SER A 378 ? 1.8712 1.3326 2.0937 -0.2928 0.0460  -0.2069 370 SER A CA  
2374 C  C   . SER A 378 ? 2.0849 1.4225 2.2962 -0.3198 0.0507  -0.1946 370 SER A C   
2375 O  O   . SER A 378 ? 2.1510 1.4645 2.3349 -0.3755 0.0691  -0.1999 370 SER A O   
2376 C  CB  . SER A 378 ? 1.8743 1.4026 2.1225 -0.2838 0.0577  -0.2579 370 SER A CB  
2377 O  OG  . SER A 378 ? 2.0259 1.4864 2.3024 -0.2640 0.0590  -0.2712 370 SER A OG  
2378 N  N   . PRO A 379 ? 2.0790 1.3350 2.3097 -0.2803 0.0364  -0.1812 371 PRO A N   
2379 C  CA  . PRO A 379 ? 2.1985 1.3260 2.4153 -0.2943 0.0391  -0.1718 371 PRO A CA  
2380 C  C   . PRO A 379 ? 2.2886 1.4081 2.5192 -0.3324 0.0648  -0.2162 371 PRO A C   
2381 O  O   . PRO A 379 ? 2.3934 1.4111 2.5977 -0.3659 0.0780  -0.2128 371 PRO A O   
2382 C  CB  . PRO A 379 ? 2.2122 1.2921 2.4633 -0.2316 0.0153  -0.1619 371 PRO A CB  
2383 C  CG  . PRO A 379 ? 2.1479 1.3350 2.4410 -0.1975 0.0136  -0.1839 371 PRO A CG  
2384 C  CD  . PRO A 379 ? 2.0352 1.3144 2.3011 -0.2198 0.0187  -0.1772 371 PRO A CD  
2385 N  N   . ARG A 380 ? 2.1918 1.4129 2.4568 -0.3257 0.0726  -0.2584 372 ARG A N   
2386 C  CA  . ARG A 380 ? 2.2097 1.4435 2.4910 -0.3587 0.0946  -0.3078 372 ARG A CA  
2387 C  C   . ARG A 380 ? 2.2840 1.5657 2.5412 -0.4254 0.1163  -0.3282 372 ARG A C   
2388 O  O   . ARG A 380 ? 2.3737 1.5708 2.6045 -0.4754 0.1348  -0.3236 372 ARG A O   
2389 C  CB  . ARG A 380 ? 2.1149 1.4390 2.4306 -0.3218 0.0934  -0.3466 372 ARG A CB  
2390 N  N   . LYS A 390 ? 2.4739 1.4078 2.2929 -0.7920 0.2546  -0.1331 382 LYS A N   
2391 C  CA  . LYS A 390 ? 2.4049 1.4927 2.2470 -0.8397 0.2744  -0.1701 382 LYS A CA  
2392 C  C   . LYS A 390 ? 2.3088 1.5149 2.1754 -0.7790 0.2333  -0.1479 382 LYS A C   
2393 O  O   . LYS A 390 ? 2.1841 1.4878 2.1153 -0.7204 0.2014  -0.1648 382 LYS A O   
2394 C  CB  . LYS A 390 ? 2.3386 1.5549 2.2581 -0.8748 0.2941  -0.2513 382 LYS A CB  
2395 N  N   . ARG A 391 ? 2.3993 1.5884 2.2076 -0.7949 0.2377  -0.1105 383 ARG A N   
2396 C  CA  . ARG A 391 ? 2.2681 1.5593 2.0916 -0.7433 0.2028  -0.0883 383 ARG A CA  
2397 C  C   . ARG A 391 ? 2.2528 1.6664 2.0753 -0.7961 0.2276  -0.1155 383 ARG A C   
2398 O  O   . ARG A 391 ? 2.3673 1.7205 2.1294 -0.8645 0.2663  -0.1094 383 ARG A O   
2399 C  CB  . ARG A 391 ? 2.3327 1.5004 2.0903 -0.6973 0.1750  -0.0159 383 ARG A CB  
2400 N  N   . VAL A 392 ? 2.2333 1.8143 2.1181 -0.7633 0.2074  -0.1471 384 VAL A N   
2401 C  CA  . VAL A 392 ? 2.1929 1.9087 2.0865 -0.8032 0.2258  -0.1798 384 VAL A CA  
2402 C  C   . VAL A 392 ? 2.1768 1.8937 2.0276 -0.7767 0.2073  -0.1286 384 VAL A C   
2403 O  O   . VAL A 392 ? 2.0789 1.9123 1.9635 -0.7289 0.1808  -0.1343 384 VAL A O   
2404 C  CB  . VAL A 392 ? 2.1181 2.0154 2.0913 -0.7760 0.2124  -0.2435 384 VAL A CB  
2405 C  CG1 . VAL A 392 ? 2.0988 2.1348 2.0878 -0.8328 0.2402  -0.2966 384 VAL A CG1 
2406 C  CG2 . VAL A 392 ? 2.1243 2.0118 2.1409 -0.7749 0.2159  -0.2850 384 VAL A CG2 
2407 N  N   . MET A 393 ? 2.2377 1.8167 2.0070 -0.8057 0.2219  -0.0786 385 MET A N   
2408 C  CA  . MET A 393 ? 2.2222 1.7937 1.9412 -0.7867 0.2069  -0.0307 385 MET A CA  
2409 C  C   . MET A 393 ? 2.2427 1.9051 1.9470 -0.8546 0.2438  -0.0593 385 MET A C   
2410 O  O   . MET A 393 ? 2.3079 1.9606 2.0018 -0.9332 0.2913  -0.0960 385 MET A O   
2411 C  CB  . MET A 393 ? 2.3449 1.7237 1.9718 -0.7781 0.2017  0.0366  385 MET A CB  
2412 C  CG  . MET A 393 ? 2.3872 1.6615 2.0254 -0.7208 0.1717  0.0581  385 MET A CG  
2413 S  SD  . MET A 393 ? 2.5379 1.6003 2.0622 -0.6925 0.1549  0.1359  385 MET A SD  
2414 C  CE  . MET A 393 ? 2.5532 1.5028 2.1025 -0.6536 0.1393  0.1341  385 MET A CE  
2415 N  N   . GLY A 394 ? 2.1302 1.8828 1.8359 -0.8264 0.2246  -0.0466 386 GLY A N   
2416 C  CA  . GLY A 394 ? 2.1108 1.9599 1.8062 -0.8838 0.2564  -0.0743 386 GLY A CA  
2417 C  C   . GLY A 394 ? 2.0475 1.9711 1.7372 -0.8375 0.2273  -0.0483 386 GLY A C   
2418 O  O   . GLY A 394 ? 2.0112 1.9052 1.7032 -0.7642 0.1844  -0.0089 386 GLY A O   
2419 N  N   . PRO A 395 ? 2.0540 2.0775 1.7389 -0.8823 0.2527  -0.0747 387 PRO A N   
2420 C  CA  . PRO A 395 ? 1.9816 2.0843 1.6612 -0.8439 0.2294  -0.0561 387 PRO A CA  
2421 C  C   . PRO A 395 ? 1.8735 2.0922 1.6265 -0.7628 0.1870  -0.0754 387 PRO A C   
2422 O  O   . PRO A 395 ? 1.8108 2.1528 1.6274 -0.7617 0.1908  -0.1358 387 PRO A O   
2423 C  CB  . PRO A 395 ? 1.9884 2.1957 1.6672 -0.9169 0.2725  -0.1019 387 PRO A CB  
2424 C  CG  . PRO A 395 ? 2.0390 2.2839 1.7615 -0.9755 0.3082  -0.1659 387 PRO A CG  
2425 C  CD  . PRO A 395 ? 2.0954 2.1712 1.7859 -0.9744 0.3076  -0.1314 387 PRO A CD  
2426 N  N   . ASP A 396 ? 1.8687 2.0443 1.6076 -0.6958 0.1489  -0.0272 388 ASP A N   
2427 C  CA  . ASP A 396 ? 1.7679 2.0202 1.5620 -0.6185 0.1137  -0.0386 388 ASP A CA  
2428 C  C   . ASP A 396 ? 1.7787 2.0296 1.6233 -0.5983 0.1083  -0.0692 388 ASP A C   
2429 O  O   . ASP A 396 ? 1.7091 2.0692 1.6022 -0.5674 0.1008  -0.1131 388 ASP A O   
2430 C  CB  . ASP A 396 ? 1.6935 2.1048 1.5163 -0.6076 0.1145  -0.0780 388 ASP A CB  
2431 C  CG  . ASP A 396 ? 1.7411 2.1593 1.5231 -0.5994 0.1074  -0.0432 388 ASP A CG  
2432 O  OD1 . ASP A 396 ? 1.8074 2.1160 1.5303 -0.6219 0.1105  0.0050  388 ASP A OD1 
2433 O  OD2 . ASP A 396 ? 1.7134 2.2430 1.5170 -0.5673 0.0981  -0.0647 388 ASP A OD2 
2434 N  N   . PHE A 397 ? 1.7216 1.8441 1.5481 -0.6127 0.1119  -0.0463 389 PHE A N   
2435 C  CA  . PHE A 397 ? 1.7099 1.8156 1.5805 -0.5922 0.1061  -0.0708 389 PHE A CA  
2436 C  C   . PHE A 397 ? 1.7780 1.7282 1.6232 -0.5716 0.0916  -0.0238 389 PHE A C   
2437 O  O   . PHE A 397 ? 1.8547 1.6952 1.6570 -0.6169 0.1109  -0.0064 389 PHE A O   
2438 C  CB  . PHE A 397 ? 1.7512 1.9006 1.6434 -0.6562 0.1404  -0.1263 389 PHE A CB  
2439 C  CG  . PHE A 397 ? 1.7140 1.9481 1.6687 -0.6249 0.1313  -0.1788 389 PHE A CG  
2440 C  CD1 . PHE A 397 ? 1.6520 2.0323 1.6407 -0.5877 0.1188  -0.2181 389 PHE A CD1 
2441 C  CD2 . PHE A 397 ? 1.7759 1.9392 1.7481 -0.6291 0.1349  -0.1893 389 PHE A CD2 
2442 C  CE1 . PHE A 397 ? 1.6415 2.0922 1.6735 -0.5527 0.1088  -0.2653 389 PHE A CE1 
2443 C  CE2 . PHE A 397 ? 1.7436 1.9835 1.7662 -0.5988 0.1263  -0.2382 389 PHE A CE2 
2444 C  CZ  . PHE A 397 ? 1.6673 2.0495 1.7164 -0.5594 0.1127  -0.2755 389 PHE A CZ  
2445 N  N   . GLY A 398 ? 1.6723 1.6117 1.5418 -0.5024 0.0595  -0.0062 390 GLY A N   
2446 C  CA  . GLY A 398 ? 1.7139 1.5246 1.5684 -0.4718 0.0398  0.0334  390 GLY A CA  
2447 C  C   . GLY A 398 ? 1.7631 1.5180 1.6479 -0.4701 0.0439  0.0137  390 GLY A C   
2448 O  O   . GLY A 398 ? 1.7314 1.5577 1.6557 -0.4832 0.0580  -0.0329 390 GLY A O   
2449 N  N   . TYR A 399 ? 1.8420 1.4712 1.7074 -0.4499 0.0294  0.0469  391 TYR A N   
2450 C  CA  . TYR A 399 ? 1.8623 1.4244 1.7533 -0.4455 0.0322  0.0315  391 TYR A CA  
2451 C  C   . TYR A 399 ? 1.9138 1.3849 1.8092 -0.3873 0.0007  0.0624  391 TYR A C   
2452 O  O   . TYR A 399 ? 1.9613 1.3517 1.8067 -0.3756 -0.0151 0.1041  391 TYR A O   
2453 C  CB  . TYR A 399 ? 1.9591 1.4373 1.8070 -0.5133 0.0647  0.0280  391 TYR A CB  
2454 C  CG  . TYR A 399 ? 1.9858 1.3975 1.8597 -0.5152 0.0719  0.0067  391 TYR A CG  
2455 C  CD1 . TYR A 399 ? 1.9536 1.4506 1.8811 -0.5341 0.0889  -0.0486 391 TYR A CD1 
2456 C  CD2 . TYR A 399 ? 2.0579 1.3228 1.9006 -0.4944 0.0600  0.0394  391 TYR A CD2 
2457 C  CE1 . TYR A 399 ? 1.9801 1.4182 1.9312 -0.5370 0.0962  -0.0702 391 TYR A CE1 
2458 C  CE2 . TYR A 399 ? 2.0873 1.2900 1.9540 -0.4957 0.0675  0.0184  391 TYR A CE2 
2459 C  CZ  . TYR A 399 ? 2.0921 1.3818 2.0140 -0.5195 0.0869  -0.0362 391 TYR A CZ  
2460 O  OH  . TYR A 399 ? 2.1363 1.3662 2.0822 -0.5219 0.0951  -0.0593 391 TYR A OH  
2461 N  N   . VAL A 400 ? 1.8744 1.3614 1.8281 -0.3493 -0.0085 0.0383  392 VAL A N   
2462 C  CA  . VAL A 400 ? 1.8810 1.2987 1.8538 -0.2940 -0.0363 0.0556  392 VAL A CA  
2463 C  C   . VAL A 400 ? 1.9465 1.3208 1.9579 -0.2878 -0.0296 0.0284  392 VAL A C   
2464 O  O   . VAL A 400 ? 1.9073 1.3463 1.9514 -0.3038 -0.0108 -0.0102 392 VAL A O   
2465 C  CB  . VAL A 400 ? 1.8078 1.3058 1.8207 -0.2417 -0.0561 0.0527  392 VAL A CB  
2466 C  CG1 . VAL A 400 ? 1.7266 1.3279 1.7832 -0.2367 -0.0400 0.0117  392 VAL A CG1 
2467 C  CG2 . VAL A 400 ? 1.7935 1.2330 1.8357 -0.1878 -0.0830 0.0612  392 VAL A CG2 
2468 N  N   . THR A 401 ? 2.1239 1.3891 2.1283 -0.2618 -0.0463 0.0467  393 THR A N   
2469 C  CA  . THR A 401 ? 2.1402 1.3546 2.1799 -0.2539 -0.0408 0.0220  393 THR A CA  
2470 C  C   . THR A 401 ? 2.1778 1.3416 2.2501 -0.1910 -0.0709 0.0288  393 THR A C   
2471 O  O   . THR A 401 ? 2.2338 1.3235 2.2701 -0.1658 -0.0956 0.0620  393 THR A O   
2472 C  CB  . THR A 401 ? 2.3053 1.4128 2.2947 -0.3037 -0.0191 0.0275  393 THR A CB  
2473 O  OG1 . THR A 401 ? 2.3056 1.4792 2.2849 -0.3661 0.0138  0.0038  393 THR A OG1 
2474 C  CG2 . THR A 401 ? 2.3039 1.3461 2.3277 -0.2892 -0.0169 0.0046  393 THR A CG2 
2475 N  N   . ARG A 402 ? 2.4835 1.9109 2.5564 -0.2085 0.0346  0.0803  394 ARG A N   
2476 C  CA  . ARG A 402 ? 2.4699 1.8605 2.5318 -0.1757 0.0341  0.0613  394 ARG A CA  
2477 C  C   . ARG A 402 ? 2.5273 1.9166 2.5906 -0.1566 0.0295  0.0251  394 ARG A C   
2478 O  O   . ARG A 402 ? 2.5588 1.9341 2.6330 -0.1712 0.0130  0.0132  394 ARG A O   
2480 N  N   . ILE A 409 ? 2.4629 1.5228 2.5208 -0.0575 -0.1741 -0.2881 401 ILE A N   
2481 C  CA  . ILE A 409 ? 2.3988 1.5328 2.4617 -0.0845 -0.1485 -0.2682 401 ILE A CA  
2482 C  C   . ILE A 409 ? 2.4271 1.6134 2.4819 -0.0674 -0.1414 -0.3067 401 ILE A C   
2483 O  O   . ILE A 409 ? 2.4773 1.6275 2.5255 -0.0614 -0.1675 -0.3432 401 ILE A O   
2484 C  CB  . ILE A 409 ? 2.4597 1.5723 2.5331 -0.1379 -0.1611 -0.2319 401 ILE A CB  
2485 C  CG1 . ILE A 409 ? 2.4397 1.5492 2.5202 -0.1553 -0.1490 -0.1836 401 ILE A CG1 
2486 C  CG2 . ILE A 409 ? 2.4282 1.6105 2.5069 -0.1619 -0.1466 -0.2274 401 ILE A CG2 
2487 C  CD1 . ILE A 409 ? 2.5284 1.6045 2.6176 -0.2081 -0.1681 -0.1455 401 ILE A CD1 
2488 N  N   . SER A 410 ? 2.3004 1.5689 2.3530 -0.0600 -0.1080 -0.2977 402 SER A N   
2489 C  CA  . SER A 410 ? 2.2639 1.5939 2.3069 -0.0470 -0.0973 -0.3256 402 SER A CA  
2490 C  C   . SER A 410 ? 2.2576 1.6331 2.3063 -0.0798 -0.0883 -0.3053 402 SER A C   
2491 O  O   . SER A 410 ? 2.2307 1.6067 2.2911 -0.1075 -0.0826 -0.2676 402 SER A O   
2492 C  CB  . SER A 410 ? 2.2428 1.6300 2.2761 -0.0156 -0.0708 -0.3293 402 SER A CB  
2493 O  OG  . SER A 410 ? 2.2918 1.7335 2.3124 0.0000  -0.0650 -0.3602 402 SER A OG  
2494 N  N   . GLY A 411 ? 2.1906 1.6078 2.2309 -0.0753 -0.0881 -0.3313 403 GLY A N   
2495 C  CA  . GLY A 411 ? 2.1465 1.6131 2.1912 -0.1005 -0.0814 -0.3174 403 GLY A CA  
2496 C  C   . GLY A 411 ? 2.0907 1.6180 2.1341 -0.0978 -0.0515 -0.2867 403 GLY A C   
2497 O  O   . GLY A 411 ? 2.0551 1.6156 2.1072 -0.1190 -0.0449 -0.2630 403 GLY A O   
2498 N  N   . LEU A 412 ? 2.0030 1.5444 2.0350 -0.0710 -0.0351 -0.2872 404 LEU A N   
2499 C  CA  . LEU A 412 ? 1.9374 1.5238 1.9625 -0.0659 -0.0103 -0.2599 404 LEU A CA  
2500 C  C   . LEU A 412 ? 1.9810 1.5441 2.0166 -0.0767 -0.0020 -0.2231 404 LEU A C   
2501 O  O   . LEU A 412 ? 1.9519 1.5408 1.9798 -0.0704 0.0165  -0.2010 404 LEU A O   
2502 C  CB  . LEU A 412 ? 1.9187 1.5305 1.9255 -0.0374 0.0005  -0.2757 404 LEU A CB  
2503 C  CG  . LEU A 412 ? 1.9535 1.6249 1.9427 -0.0311 0.0066  -0.2898 404 LEU A CG  
2504 C  CD1 . LEU A 412 ? 1.9959 1.6685 1.9827 -0.0275 -0.0108 -0.3298 404 LEU A CD1 
2505 C  CD2 . LEU A 412 ? 1.9533 1.6579 1.9248 -0.0116 0.0208  -0.2900 404 LEU A CD2 
2506 N  N   . ASP A 413 ? 2.0114 1.2037 1.8004 -0.3023 -0.0253 -0.2099 405 ASP A N   
2507 C  CA  . ASP A 413 ? 2.0096 1.1636 1.7882 -0.3139 -0.0244 -0.1646 405 ASP A CA  
2508 C  C   . ASP A 413 ? 2.0306 1.2462 1.8102 -0.3652 -0.0163 -0.1459 405 ASP A C   
2509 O  O   . ASP A 413 ? 2.0224 1.2393 1.7957 -0.3761 -0.0124 -0.1081 405 ASP A O   
2510 C  CB  . ASP A 413 ? 2.1092 1.1252 1.8615 -0.3181 -0.0381 -0.1600 405 ASP A CB  
2511 C  CG  . ASP A 413 ? 2.1776 1.1426 1.9294 -0.2584 -0.0474 -0.1782 405 ASP A CG  
2512 O  OD1 . ASP A 413 ? 2.1256 1.1579 1.8966 -0.2170 -0.0411 -0.1731 405 ASP A OD1 
2513 O  OD2 . ASP A 413 ? 2.2773 1.1359 2.0082 -0.2529 -0.0617 -0.1986 405 ASP A OD2 
2514 N  N   . SER A 414 ? 1.9881 1.2654 1.7758 -0.3953 -0.0140 -0.1745 406 SER A N   
2515 C  CA  . SER A 414 ? 1.9809 1.3424 1.7738 -0.4412 -0.0064 -0.1630 406 SER A CA  
2516 C  C   . SER A 414 ? 1.9081 1.3778 1.7165 -0.4073 0.0033  -0.1434 406 SER A C   
2517 O  O   . SER A 414 ? 1.8551 1.3439 1.6709 -0.3586 0.0041  -0.1482 406 SER A O   
2518 C  CB  . SER A 414 ? 2.0487 1.4537 1.8465 -0.4809 -0.0087 -0.2034 406 SER A CB  
2519 O  OG  . SER A 414 ? 2.1314 1.6031 1.9315 -0.5376 -0.0034 -0.1930 406 SER A OG  
2520 N  N   . PHE A 415 ? 1.8542 1.3941 1.6650 -0.4334 0.0100  -0.1222 407 PHE A N   
2521 C  CA  . PHE A 415 ? 1.7869 1.4113 1.6058 -0.3965 0.0167  -0.1024 407 PHE A CA  
2522 C  C   . PHE A 415 ? 1.7776 1.5197 1.6092 -0.3870 0.0192  -0.1225 407 PHE A C   
2523 O  O   . PHE A 415 ? 1.7448 1.5643 1.5793 -0.3617 0.0229  -0.1086 407 PHE A O   
2524 C  CB  . PHE A 415 ? 1.8047 1.4487 1.6169 -0.4175 0.0220  -0.0691 407 PHE A CB  
2525 C  CG  . PHE A 415 ? 1.8161 1.3608 1.6132 -0.4060 0.0192  -0.0410 407 PHE A CG  
2526 C  CD1 . PHE A 415 ? 1.8275 1.2827 1.6210 -0.3730 0.0121  -0.0475 407 PHE A CD1 
2527 C  CD2 . PHE A 415 ? 1.8401 1.3926 1.6261 -0.4256 0.0235  -0.0089 407 PHE A CD2 
2528 C  CE1 . PHE A 415 ? 1.8372 1.2109 1.6169 -0.3580 0.0078  -0.0227 407 PHE A CE1 
2529 C  CE2 . PHE A 415 ? 1.8652 1.3320 1.6347 -0.4125 0.0197  0.0178  407 PHE A CE2 
2530 C  CZ  . PHE A 415 ? 1.8440 1.2207 1.6106 -0.3776 0.0111  0.0108  407 PHE A CZ  
2531 N  N   . GLY A 416 ? 1.7221 1.4763 1.5583 -0.4037 0.0154  -0.1566 408 GLY A N   
2532 C  CA  . GLY A 416 ? 1.6932 1.5514 1.5377 -0.3843 0.0155  -0.1763 408 GLY A CA  
2533 C  C   . GLY A 416 ? 1.6665 1.5007 1.5070 -0.3287 0.0146  -0.1744 408 GLY A C   
2534 O  O   . GLY A 416 ? 1.6393 1.5449 1.4788 -0.2964 0.0149  -0.1740 408 GLY A O   
2535 N  N   . ASN A 417 ? 1.6976 1.4309 1.5336 -0.3184 0.0126  -0.1717 409 ASN A N   
2536 C  CA  . ASN A 417 ? 1.6525 1.3617 1.4861 -0.2723 0.0128  -0.1677 409 ASN A CA  
2537 C  C   . ASN A 417 ? 1.6345 1.3325 1.4638 -0.2444 0.0156  -0.1314 409 ASN A C   
2538 O  O   . ASN A 417 ? 1.6058 1.2819 1.4322 -0.2121 0.0160  -0.1227 409 ASN A O   
2539 C  CB  . ASN A 417 ? 1.6554 1.2752 1.4878 -0.2705 0.0083  -0.1862 409 ASN A CB  
2540 C  CG  . ASN A 417 ? 1.6564 1.2798 1.4897 -0.2292 0.0095  -0.1919 409 ASN A CG  
2541 O  OD1 . ASN A 417 ? 1.5972 1.1864 1.4301 -0.2044 0.0105  -0.1709 409 ASN A OD1 
2542 N  ND2 . ASN A 417 ? 1.5615 1.2340 1.3954 -0.2248 0.0095  -0.2211 409 ASN A ND2 
2543 N  N   . LEU A 418 ? 1.6029 1.3225 1.4310 -0.2595 0.0176  -0.1122 410 LEU A N   
2544 C  CA  . LEU A 418 ? 1.5644 1.2735 1.3863 -0.2350 0.0191  -0.0821 410 LEU A CA  
2545 C  C   . LEU A 418 ? 1.5709 1.3668 1.3891 -0.2194 0.0205  -0.0736 410 LEU A C   
2546 O  O   . LEU A 418 ? 1.5867 1.4419 1.4090 -0.2438 0.0225  -0.0757 410 LEU A O   
2547 C  CB  . LEU A 418 ? 1.5815 1.2333 1.4004 -0.2588 0.0192  -0.0648 410 LEU A CB  
2548 C  CG  . LEU A 418 ? 1.5943 1.2409 1.4056 -0.2384 0.0204  -0.0363 410 LEU A CG  
2549 C  CD1 . LEU A 418 ? 1.5542 1.1659 1.3629 -0.1981 0.0177  -0.0307 410 LEU A CD1 
2550 C  CD2 . LEU A 418 ? 1.6385 1.2311 1.4430 -0.2658 0.0202  -0.0182 410 LEU A CD2 
2551 N  N   . GLU A 419 ? 1.4114 1.2147 1.2196 -0.1787 0.0186  -0.0645 411 GLU A N   
2552 C  CA  . GLU A 419 ? 1.4163 1.2874 1.2144 -0.1517 0.0166  -0.0573 411 GLU A CA  
2553 C  C   . GLU A 419 ? 1.4084 1.2371 1.1897 -0.1144 0.0134  -0.0371 411 GLU A C   
2554 O  O   . GLU A 419 ? 1.3954 1.1542 1.1759 -0.1126 0.0136  -0.0294 411 GLU A O   
2555 C  CB  . GLU A 419 ? 1.4372 1.3714 1.2311 -0.1389 0.0136  -0.0720 411 GLU A CB  
2556 C  CG  . GLU A 419 ? 1.5611 1.5669 1.3701 -0.1740 0.0149  -0.0953 411 GLU A CG  
2557 C  CD  . GLU A 419 ? 1.7946 1.8910 1.6070 -0.1759 0.0149  -0.0945 411 GLU A CD  
2558 O  OE1 . GLU A 419 ? 1.8477 1.9796 1.6751 -0.2215 0.0187  -0.1049 411 GLU A OE1 
2559 O  OE2 . GLU A 419 ? 1.7352 1.8683 1.5334 -0.1321 0.0105  -0.0842 411 GLU A OE2 
2560 N  N   . VAL A 420 ? 1.3428 1.2157 1.1096 -0.0837 0.0092  -0.0312 412 VAL A N   
2561 C  CA  . VAL A 420 ? 1.3203 1.1465 1.0660 -0.0489 0.0039  -0.0158 412 VAL A CA  
2562 C  C   . VAL A 420 ? 1.3681 1.2247 1.0882 -0.0061 -0.0048 -0.0140 412 VAL A C   
2563 O  O   . VAL A 420 ? 1.3972 1.3355 1.1181 0.0044  -0.0069 -0.0238 412 VAL A O   
2564 C  CB  . VAL A 420 ? 1.3354 1.1589 1.0821 -0.0499 0.0050  -0.0086 412 VAL A CB  
2565 C  CG1 . VAL A 420 ? 1.3580 1.2774 1.1074 -0.0452 0.0058  -0.0163 412 VAL A CG1 
2566 C  CG2 . VAL A 420 ? 1.3193 1.0832 1.0440 -0.0184 -0.0017 0.0025  412 VAL A CG2 
2567 N  N   . SER A 421 ? 1.3010 1.0906 0.9963 0.0176  -0.0109 -0.0009 413 SER A N   
2568 C  CA  . SER A 421 ? 1.3320 1.1211 0.9927 0.0601  -0.0218 0.0061  413 SER A CA  
2569 C  C   . SER A 421 ? 1.3955 1.1847 1.0357 0.0990  -0.0307 0.0063  413 SER A C   
2570 O  O   . SER A 421 ? 1.3885 1.1681 1.0397 0.0901  -0.0275 0.0038  413 SER A O   
2571 C  CB  . SER A 421 ? 1.3493 1.0578 0.9869 0.0603  -0.0245 0.0224  413 SER A CB  
2572 O  OG  . SER A 421 ? 1.3512 0.9858 0.9823 0.0572  -0.0261 0.0305  413 SER A OG  
2573 N  N   . PRO A 422 ? 1.4257 1.2278 1.0332 0.1461  -0.0432 0.0082  414 PRO A N   
2574 C  CA  . PRO A 422 ? 1.4459 1.2333 1.0255 0.1938  -0.0551 0.0051  414 PRO A CA  
2575 C  C   . PRO A 422 ? 1.4767 1.1446 1.0298 0.1966  -0.0613 0.0167  414 PRO A C   
2576 O  O   . PRO A 422 ? 1.4613 1.0672 1.0155 0.1643  -0.0568 0.0299  414 PRO A O   
2577 C  CB  . PRO A 422 ? 1.5117 1.3293 1.0580 0.2454  -0.0691 0.0062  414 PRO A CB  
2578 C  CG  . PRO A 422 ? 1.5322 1.4285 1.1032 0.2191  -0.0612 0.0028  414 PRO A CG  
2579 C  CD  . PRO A 422 ? 1.4653 1.3121 1.0604 0.1615  -0.0478 0.0095  414 PRO A CD  
2580 N  N   . PRO A 423 ? 1.4977 1.1407 1.0277 0.2336  -0.0717 0.0089  415 PRO A N   
2581 C  CA  . PRO A 423 ? 1.5209 1.0477 1.0208 0.2362  -0.0805 0.0161  415 PRO A CA  
2582 C  C   . PRO A 423 ? 1.6202 1.0555 1.0786 0.2419  -0.0906 0.0366  415 PRO A C   
2583 O  O   . PRO A 423 ? 1.6725 1.1067 1.0963 0.2846  -0.1029 0.0410  415 PRO A O   
2584 C  CB  . PRO A 423 ? 1.5604 1.0919 1.0350 0.2892  -0.0935 -0.0020 415 PRO A CB  
2585 C  CG  . PRO A 423 ? 1.5551 1.2192 1.0661 0.2908  -0.0832 -0.0179 415 PRO A CG  
2586 C  CD  . PRO A 423 ? 1.5079 1.2390 1.0424 0.2692  -0.0746 -0.0109 415 PRO A CD  
2587 N  N   . VAL A 424 ? 1.6410 1.0061 1.1014 0.1986  -0.0855 0.0502  416 VAL A N   
2588 C  CA  . VAL A 424 ? 1.6944 0.9758 1.1152 0.1912  -0.0925 0.0737  416 VAL A CA  
2589 C  C   . VAL A 424 ? 1.7501 0.9285 1.1516 0.1648  -0.0972 0.0803  416 VAL A C   
2590 O  O   . VAL A 424 ? 1.7073 0.8900 1.1346 0.1473  -0.0928 0.0664  416 VAL A O   
2591 C  CB  . VAL A 424 ? 1.6995 1.0264 1.1451 0.1531  -0.0782 0.0862  416 VAL A CB  
2592 C  CG1 . VAL A 424 ? 1.7005 1.1227 1.1567 0.1776  -0.0766 0.0797  416 VAL A CG1 
2593 C  CG2 . VAL A 424 ? 1.6297 0.9881 1.1275 0.1042  -0.0615 0.0778  416 VAL A CG2 
2594 N  N   . THR A 425 ? 1.8163 0.9047 1.1698 0.1594  -0.1069 0.1028  417 THR A N   
2595 C  CA  . THR A 425 ? 1.8400 0.8329 1.1732 0.1228  -0.1111 0.1113  417 THR A CA  
2596 C  C   . THR A 425 ? 1.8874 0.8645 1.2142 0.0754  -0.1024 0.1391  417 THR A C   
2597 O  O   . THR A 425 ? 1.9572 0.8994 1.2405 0.0872  -0.1092 0.1626  417 THR A O   
2598 C  CB  . THR A 425 ? 2.0054 0.8796 1.2726 0.1580  -0.1351 0.1112  417 THR A CB  
2599 O  OG1 . THR A 425 ? 2.0080 0.9123 1.2806 0.2082  -0.1429 0.0817  417 THR A OG1 
2600 C  CG2 . THR A 425 ? 2.0262 0.8064 1.2755 0.1108  -0.1394 0.1157  417 THR A CG2 
2601 N  N   . VAL A 426 ? 1.7936 0.8027 1.1619 0.0243  -0.0878 0.1365  418 VAL A N   
2602 C  CA  . VAL A 426 ? 1.7915 0.8184 1.1645 -0.0211 -0.0759 0.1575  418 VAL A CA  
2603 C  C   . VAL A 426 ? 1.8385 0.7950 1.1912 -0.0704 -0.0783 0.1702  418 VAL A C   
2604 O  O   . VAL A 426 ? 1.7834 0.7691 1.1750 -0.1013 -0.0708 0.1559  418 VAL A O   
2605 C  CB  . VAL A 426 ? 1.7416 0.8796 1.1808 -0.0404 -0.0562 0.1425  418 VAL A CB  
2606 C  CG1 . VAL A 426 ? 1.7503 0.9248 1.1912 -0.0738 -0.0444 0.1600  418 VAL A CG1 
2607 C  CG2 . VAL A 426 ? 1.7094 0.9161 1.1734 -0.0016 -0.0542 0.1250  418 VAL A CG2 
2608 N  N   . ARG A 427 ? 1.9529 0.8182 1.2424 -0.0786 -0.0895 0.1982  419 ARG A N   
2609 C  CA  . ARG A 427 ? 1.9926 0.7869 1.2545 -0.1354 -0.0920 0.2151  419 ARG A CA  
2610 C  C   . ARG A 427 ? 2.0052 0.7574 1.2772 -0.1474 -0.1003 0.1907  419 ARG A C   
2611 O  O   . ARG A 427 ? 1.9701 0.7542 1.2726 -0.1977 -0.0916 0.1852  419 ARG A O   
2612 C  CB  . ARG A 427 ? 1.9117 0.7934 1.2102 -0.1901 -0.0710 0.2257  419 ARG A CB  
2613 N  N   . GLY A 428 ? 2.0375 0.7283 1.2841 -0.0985 -0.1175 0.1737  420 GLY A N   
2614 C  CA  . GLY A 428 ? 2.0360 0.6876 1.2865 -0.1037 -0.1274 0.1473  420 GLY A CA  
2615 C  C   . GLY A 428 ? 1.9810 0.7207 1.2850 -0.0675 -0.1217 0.1151  420 GLY A C   
2616 O  O   . GLY A 428 ? 2.0092 0.7146 1.2952 -0.0245 -0.1353 0.0940  420 GLY A O   
2617 N  N   . LYS A 429 ? 1.8700 0.7216 1.2363 -0.0846 -0.1021 0.1114  421 LYS A N   
2618 C  CA  . LYS A 429 ? 1.7867 0.7190 1.2017 -0.0594 -0.0956 0.0868  421 LYS A CA  
2619 C  C   . LYS A 429 ? 1.8142 0.7690 1.2214 -0.0014 -0.0990 0.0802  421 LYS A C   
2620 O  O   . LYS A 429 ? 1.8204 0.7922 1.2180 0.0131  -0.0957 0.0948  421 LYS A O   
2621 C  CB  . LYS A 429 ? 1.7158 0.7476 1.1906 -0.0874 -0.0761 0.0871  421 LYS A CB  
2622 C  CG  . LYS A 429 ? 1.6873 0.7854 1.2077 -0.0741 -0.0708 0.0663  421 LYS A CG  
2623 C  CD  . LYS A 429 ? 1.7333 0.8114 1.2571 -0.0930 -0.0782 0.0526  421 LYS A CD  
2624 C  CE  . LYS A 429 ? 1.6929 0.8362 1.2560 -0.0782 -0.0738 0.0371  421 LYS A CE  
2625 N  NZ  . LYS A 429 ? 1.7310 0.8817 1.2834 -0.0343 -0.0775 0.0283  421 LYS A NZ  
2626 N  N   . GLU A 430 ? 1.7469 0.7118 1.1578 0.0311  -0.1057 0.0573  422 GLU A N   
2627 C  CA  . GLU A 430 ? 1.7513 0.7563 1.1581 0.0850  -0.1085 0.0475  422 GLU A CA  
2628 C  C   . GLU A 430 ? 1.6755 0.7922 1.1387 0.0834  -0.0922 0.0385  422 GLU A C   
2629 O  O   . GLU A 430 ? 1.6202 0.7646 1.1126 0.0644  -0.0870 0.0290  422 GLU A O   
2630 C  CB  . GLU A 430 ? 1.8213 0.7712 1.1887 0.1276  -0.1272 0.0263  422 GLU A CB  
2631 C  CG  . GLU A 430 ? 1.9497 0.9568 1.3128 0.1876  -0.1306 0.0129  422 GLU A CG  
2632 C  CD  . GLU A 430 ? 2.1964 1.1521 1.5165 0.2378  -0.1505 -0.0123 422 GLU A CD  
2633 O  OE1 . GLU A 430 ? 2.1275 1.1351 1.4402 0.2924  -0.1550 -0.0262 422 GLU A OE1 
2634 O  OE2 . GLU A 430 ? 2.2137 1.0827 1.5074 0.2233  -0.1622 -0.0213 422 GLU A OE2 
2635 N  N   . TYR A 431 ? 1.6219 0.8001 1.0970 0.1018  -0.0855 0.0424  423 TYR A N   
2636 C  CA  . TYR A 431 ? 1.5594 0.8353 1.0813 0.0975  -0.0716 0.0346  423 TYR A CA  
2637 C  C   . TYR A 431 ? 1.5997 0.9301 1.1136 0.1426  -0.0757 0.0222  423 TYR A C   
2638 O  O   . TYR A 431 ? 1.6009 0.9808 1.1188 0.1549  -0.0725 0.0254  423 TYR A O   
2639 C  CB  . TYR A 431 ? 1.5351 0.8529 1.0863 0.0681  -0.0579 0.0460  423 TYR A CB  
2640 C  CG  . TYR A 431 ? 1.5263 0.8146 1.0911 0.0263  -0.0521 0.0549  423 TYR A CG  
2641 C  CD1 . TYR A 431 ? 1.4759 0.7975 1.0805 0.0012  -0.0428 0.0494  423 TYR A CD1 
2642 C  CD2 . TYR A 431 ? 1.5852 0.8160 1.1207 0.0125  -0.0566 0.0698  423 TYR A CD2 
2643 C  CE1 . TYR A 431 ? 1.4504 0.7600 1.0694 -0.0311 -0.0384 0.0542  423 TYR A CE1 
2644 C  CE2 . TYR A 431 ? 1.5775 0.8002 1.1278 -0.0279 -0.0502 0.0764  423 TYR A CE2 
2645 C  CZ  . TYR A 431 ? 1.5504 0.8182 1.1446 -0.0469 -0.0412 0.0663  423 TYR A CZ  
2646 O  OH  . TYR A 431 ? 1.5507 0.8247 1.1616 -0.0813 -0.0357 0.0696  423 TYR A OH  
2647 N  N   . PRO A 432 ? 1.5668 0.8989 1.0697 0.1678  -0.0829 0.0055  424 PRO A N   
2648 C  CA  . PRO A 432 ? 1.5847 0.9778 1.0772 0.2159  -0.0880 -0.0105 424 PRO A CA  
2649 C  C   . PRO A 432 ? 1.5687 1.0790 1.1044 0.2012  -0.0721 -0.0130 424 PRO A C   
2650 O  O   . PRO A 432 ? 1.5850 1.1717 1.1190 0.2341  -0.0733 -0.0254 424 PRO A O   
2651 C  CB  . PRO A 432 ? 1.6244 0.9832 1.0942 0.2387  -0.0991 -0.0293 424 PRO A CB  
2652 C  CG  . PRO A 432 ? 1.6193 0.9508 1.1112 0.1905  -0.0922 -0.0231 424 PRO A CG  
2653 C  CD  . PRO A 432 ? 1.5714 0.8597 1.0724 0.1521  -0.0868 -0.0018 424 PRO A CD  
2654 N  N   . LEU A 433 ? 1.4871 1.0111 1.0590 0.1520  -0.0582 -0.0021 425 LEU A N   
2655 C  CA  . LEU A 433 ? 1.4539 1.0689 1.0621 0.1286  -0.0440 -0.0017 425 LEU A CA  
2656 C  C   . LEU A 433 ? 1.4676 1.0939 1.0961 0.1009  -0.0359 0.0075  425 LEU A C   
2657 O  O   . LEU A 433 ? 1.4475 1.1274 1.1057 0.0708  -0.0247 0.0083  425 LEU A O   
2658 C  CB  . LEU A 433 ? 1.4277 1.0469 1.0564 0.0981  -0.0365 0.0020  425 LEU A CB  
2659 C  CG  . LEU A 433 ? 1.4700 1.0880 1.0796 0.1220  -0.0437 -0.0089 425 LEU A CG  
2660 C  CD1 . LEU A 433 ? 1.4423 1.0668 1.0703 0.0903  -0.0366 -0.0006 425 LEU A CD1 
2661 C  CD2 . LEU A 433 ? 1.5079 1.2099 1.1077 0.1583  -0.0451 -0.0240 425 LEU A CD2 
2662 N  N   . GLY A 434 ? 1.4544 1.0272 1.0629 0.1096  -0.0424 0.0142  426 GLY A N   
2663 C  CA  . GLY A 434 ? 1.4428 1.0295 1.0652 0.0878  -0.0358 0.0207  426 GLY A CA  
2664 C  C   . GLY A 434 ? 1.4347 0.9915 1.0826 0.0455  -0.0266 0.0267  426 GLY A C   
2665 O  O   . GLY A 434 ? 1.4151 0.9382 1.0690 0.0337  -0.0264 0.0282  426 GLY A O   
2666 N  N   . ARG A 435 ? 1.3756 0.9506 1.0375 0.0264  -0.0202 0.0277  427 ARG A N   
2667 C  CA  . ARG A 435 ? 1.3337 0.8903 1.0204 -0.0069 -0.0123 0.0284  427 ARG A CA  
2668 C  C   . ARG A 435 ? 1.3480 0.9555 1.0625 -0.0285 -0.0038 0.0177  427 ARG A C   
2669 O  O   . ARG A 435 ? 1.3673 1.0217 1.0800 -0.0238 -0.0033 0.0116  427 ARG A O   
2670 C  CB  . ARG A 435 ? 1.3251 0.8432 0.9978 -0.0123 -0.0133 0.0372  427 ARG A CB  
2671 C  CG  . ARG A 435 ? 1.3510 0.8047 0.9938 -0.0025 -0.0223 0.0481  427 ARG A CG  
2672 C  CD  . ARG A 435 ? 1.3634 0.7857 0.9968 -0.0224 -0.0206 0.0591  427 ARG A CD  
2673 N  NE  . ARG A 435 ? 1.3293 0.7667 0.9967 -0.0494 -0.0119 0.0528  427 ARG A NE  
2674 C  CZ  . ARG A 435 ? 1.4240 0.8502 1.0919 -0.0707 -0.0088 0.0586  427 ARG A CZ  
2675 N  NH1 . ARG A 435 ? 1.3463 0.7970 1.0467 -0.0866 -0.0023 0.0488  427 ARG A NH1 
2676 N  NH2 . ARG A 435 ? 1.3945 0.7862 1.0281 -0.0759 -0.0129 0.0748  427 ARG A NH2 
2677 N  N   . ILE A 436 ? 1.2999 0.8948 1.0372 -0.0514 0.0012  0.0149  428 ILE A N   
2678 C  CA  . ILE A 436 ? 1.2967 0.9177 1.0559 -0.0758 0.0072  0.0036  428 ILE A CA  
2679 C  C   . ILE A 436 ? 1.3346 0.9573 1.0995 -0.0823 0.0098  -0.0061 428 ILE A C   
2680 O  O   . ILE A 436 ? 1.3223 0.9150 1.0849 -0.0792 0.0097  -0.0024 428 ILE A O   
2681 C  CB  . ILE A 436 ? 1.2986 0.8874 1.0723 -0.0941 0.0090  0.0064  428 ILE A CB  
2682 C  CG1 . ILE A 436 ? 1.3105 0.9206 1.0792 -0.0954 0.0089  0.0147  428 ILE A CG1 
2683 C  CG2 . ILE A 436 ? 1.2983 0.8834 1.0885 -0.1186 0.0125  -0.0067 428 ILE A CG2 
2684 C  CD1 . ILE A 436 ? 1.3234 0.9019 1.0992 -0.1147 0.0099  0.0231  428 ILE A CD1 
2685 N  N   . LEU A 437 ? 1.2869 0.9543 1.0588 -0.0930 0.0122  -0.0204 429 LEU A N   
2686 C  CA  . LEU A 437 ? 1.2934 0.9745 1.0691 -0.0983 0.0145  -0.0341 429 LEU A CA  
2687 C  C   . LEU A 437 ? 1.3263 1.0085 1.1220 -0.1239 0.0171  -0.0560 429 LEU A C   
2688 O  O   . LEU A 437 ? 1.3401 1.0513 1.1414 -0.1413 0.0172  -0.0640 429 LEU A O   
2689 C  CB  . LEU A 437 ? 1.3152 1.0507 1.0743 -0.0837 0.0123  -0.0345 429 LEU A CB  
2690 C  CG  . LEU A 437 ? 1.3564 1.0788 1.0862 -0.0546 0.0066  -0.0129 429 LEU A CG  
2691 C  CD1 . LEU A 437 ? 1.3858 1.1666 1.0976 -0.0348 0.0016  -0.0136 429 LEU A CD1 
2692 C  CD2 . LEU A 437 ? 1.3675 1.0472 1.0850 -0.0536 0.0076  -0.0009 429 LEU A CD2 
2693 N  N   . PHE A 438 ? 1.3531 1.0040 1.1578 -0.1266 0.0184  -0.0671 430 PHE A N   
2694 C  CA  . PHE A 438 ? 1.3658 1.0058 1.1833 -0.1454 0.0182  -0.0929 430 PHE A CA  
2695 C  C   . PHE A 438 ? 1.4134 1.0675 1.2339 -0.1370 0.0199  -0.1142 430 PHE A C   
2696 O  O   . PHE A 438 ? 1.4000 1.0646 1.2153 -0.1208 0.0224  -0.1043 430 PHE A O   
2697 C  CB  . PHE A 438 ? 1.3794 0.9528 1.2034 -0.1540 0.0153  -0.0887 430 PHE A CB  
2698 C  CG  . PHE A 438 ? 1.3767 0.9125 1.2042 -0.1336 0.0139  -0.0827 430 PHE A CG  
2699 C  CD1 . PHE A 438 ? 1.4182 0.9327 1.2539 -0.1258 0.0120  -0.1053 430 PHE A CD1 
2700 C  CD2 . PHE A 438 ? 1.3694 0.8968 1.1919 -0.1212 0.0135  -0.0581 430 PHE A CD2 
2701 C  CE1 . PHE A 438 ? 1.4175 0.9147 1.2591 -0.1051 0.0103  -0.1018 430 PHE A CE1 
2702 C  CE2 . PHE A 438 ? 1.3820 0.8873 1.2098 -0.1061 0.0117  -0.0546 430 PHE A CE2 
2703 C  CZ  . PHE A 438 ? 1.3877 0.8834 1.2265 -0.0977 0.0104  -0.0757 430 PHE A CZ  
2704 N  N   . GLY A 439 ? 1.4104 1.0668 1.2376 -0.1506 0.0184  -0.1448 431 GLY A N   
2705 C  CA  . GLY A 439 ? 1.4219 1.1076 1.2505 -0.1416 0.0200  -0.1715 431 GLY A CA  
2706 C  C   . GLY A 439 ? 1.4719 1.1120 1.3097 -0.1294 0.0177  -0.1907 431 GLY A C   
2707 O  O   . GLY A 439 ? 1.4793 1.0524 1.3209 -0.1323 0.0124  -0.1893 431 GLY A O   
2708 N  N   . ASP A 440 ? 1.4591 1.1407 1.2982 -0.1135 0.0213  -0.2084 432 ASP A N   
2709 C  CA  . ASP A 440 ? 1.4803 1.1391 1.3289 -0.0933 0.0190  -0.2314 432 ASP A CA  
2710 C  C   . ASP A 440 ? 1.5197 1.2504 1.3679 -0.0816 0.0240  -0.2605 432 ASP A C   
2711 O  O   . ASP A 440 ? 1.4999 1.2947 1.3379 -0.0895 0.0298  -0.2532 432 ASP A O   
2712 C  CB  . ASP A 440 ? 1.4825 1.1233 1.3371 -0.0785 0.0201  -0.2040 432 ASP A CB  
2713 C  CG  . ASP A 440 ? 1.6592 1.2485 1.5235 -0.0570 0.0124  -0.2219 432 ASP A CG  
2714 O  OD1 . ASP A 440 ? 1.7317 1.2464 1.5928 -0.0620 0.0043  -0.2155 432 ASP A OD1 
2715 O  OD2 . ASP A 440 ? 1.6831 1.3102 1.5561 -0.0338 0.0141  -0.2411 432 ASP A OD2 
2716 N  N   . SER A 441 ? 1.5022 1.2257 1.3588 -0.0596 0.0209  -0.2938 433 SER A N   
2717 C  CA  . SER A 441 ? 1.5099 1.3140 1.3667 -0.0448 0.0267  -0.3237 433 SER A CA  
2718 C  C   . SER A 441 ? 1.5333 1.4036 1.3912 -0.0405 0.0376  -0.2940 433 SER A C   
2719 O  O   . SER A 441 ? 1.5285 1.3697 1.3907 -0.0425 0.0379  -0.2605 433 SER A O   
2720 C  CB  . SER A 441 ? 1.5836 1.3622 1.4480 -0.0159 0.0187  -0.3724 433 SER A CB  
2721 O  OG  . SER A 441 ? 1.6906 1.4198 1.5654 0.0056  0.0136  -0.3614 433 SER A OG  
2722 N  N   . CYS A 442 ? 1.5080 1.4684 1.3594 -0.0384 0.0462  -0.3062 434 CYS A N   
2723 C  CA  . CYS A 442 ? 1.4866 1.5128 1.3348 -0.0427 0.0573  -0.2771 434 CYS A CA  
2724 C  C   . CYS A 442 ? 1.4733 1.5174 1.3422 -0.0209 0.0581  -0.2917 434 CYS A C   
2725 O  O   . CYS A 442 ? 1.4527 1.5207 1.3250 -0.0298 0.0639  -0.2617 434 CYS A O   
2726 C  CB  . CYS A 442 ? 1.4946 1.6176 1.3253 -0.0496 0.0669  -0.2828 434 CYS A CB  
2727 S  SG  . CYS A 442 ? 1.5332 1.6562 1.3330 -0.0738 0.0673  -0.2433 434 CYS A SG  
2728 N  N   . TYR A 443 ? 1.3906 1.4233 1.2719 0.0085  0.0507  -0.3398 435 TYR A N   
2729 C  CA  . TYR A 443 ? 1.3834 1.4298 1.2848 0.0401  0.0477  -0.3592 435 TYR A CA  
2730 C  C   . TYR A 443 ? 1.4584 1.4354 1.3637 0.0745  0.0325  -0.4069 435 TYR A C   
2731 O  O   . TYR A 443 ? 1.4848 1.4522 1.3798 0.0758  0.0288  -0.4413 435 TYR A O   
2732 C  CB  . TYR A 443 ? 1.3579 1.5362 1.2654 0.0472  0.0606  -0.3726 435 TYR A CB  
2733 C  CG  . TYR A 443 ? 1.3834 1.6280 1.2852 0.0651  0.0629  -0.4229 435 TYR A CG  
2734 C  CD1 . TYR A 443 ? 1.3785 1.6539 1.2591 0.0407  0.0690  -0.4185 435 TYR A CD1 
2735 C  CD2 . TYR A 443 ? 1.4222 1.7040 1.3380 0.1105  0.0578  -0.4772 435 TYR A CD2 
2736 C  CE1 . TYR A 443 ? 1.4087 1.7519 1.2826 0.0568  0.0706  -0.4673 435 TYR A CE1 
2737 C  CE2 . TYR A 443 ? 1.4559 1.8009 1.3646 0.1296  0.0592  -0.5287 435 TYR A CE2 
2738 C  CZ  . TYR A 443 ? 1.4481 1.8251 1.3361 0.1003  0.0659  -0.5236 435 TYR A CZ  
2739 O  OH  . TYR A 443 ? 1.4828 1.9291 1.3623 0.1189  0.0667  -0.5773 435 TYR A OH  
2740 N  N   . PRO A 444 ? 1.4695 1.3933 1.3865 0.1023  0.0221  -0.4090 436 PRO A N   
2741 C  CA  . PRO A 444 ? 1.5231 1.3528 1.4361 0.1364  0.0043  -0.4464 436 PRO A CA  
2742 C  C   . PRO A 444 ? 1.5813 1.4606 1.4955 0.1779  0.0005  -0.5099 436 PRO A C   
2743 O  O   . PRO A 444 ? 1.5686 1.5354 1.4983 0.2119  0.0037  -0.5283 436 PRO A O   
2744 C  CB  . PRO A 444 ? 1.5460 1.3339 1.4695 0.1604  -0.0046 -0.4259 436 PRO A CB  
2745 C  CG  . PRO A 444 ? 1.5228 1.3562 1.4537 0.1253  0.0078  -0.3733 436 PRO A CG  
2746 C  CD  . PRO A 444 ? 1.4546 1.3979 1.3852 0.1017  0.0248  -0.3734 436 PRO A CD  
2747 N  N   . SER A 445 ? 1.6176 1.4473 1.5155 0.1747  -0.0068 -0.5459 437 SER A N   
2748 C  CA  . SER A 445 ? 1.6840 1.5386 1.5780 0.2181  -0.0144 -0.6139 437 SER A CA  
2749 C  C   . SER A 445 ? 1.7834 1.4841 1.6578 0.2345  -0.0372 -0.6450 437 SER A C   
2750 O  O   . SER A 445 ? 1.8062 1.3948 1.6709 0.2062  -0.0444 -0.6096 437 SER A O   
2751 C  CB  . SER A 445 ? 1.6652 1.6211 1.5531 0.1980  -0.0021 -0.6379 437 SER A CB  
2752 O  OG  . SER A 445 ? 1.7069 1.6046 1.5794 0.1517  -0.0035 -0.6247 437 SER A OG  
2753 N  N   . ASN A 446 ? 1.8058 1.4999 1.6712 0.2792  -0.0489 -0.7114 438 ASN A N   
2754 C  CA  . ASN A 446 ? 1.9225 1.4570 1.7619 0.2947  -0.0730 -0.7457 438 ASN A CA  
2755 C  C   . ASN A 446 ? 1.9383 1.3982 1.7597 0.2317  -0.0745 -0.7387 438 ASN A C   
2756 O  O   . ASN A 446 ? 2.0157 1.3261 1.8156 0.2164  -0.0910 -0.7347 438 ASN A O   
2757 C  CB  . ASN A 446 ? 2.0130 1.5625 1.8431 0.3576  -0.0857 -0.8259 438 ASN A CB  
2758 C  CG  . ASN A 446 ? 2.0666 1.6589 1.9103 0.4306  -0.0917 -0.8398 438 ASN A CG  
2759 O  OD1 . ASN A 446 ? 1.9690 1.7241 1.8364 0.4523  -0.0762 -0.8494 438 ASN A OD1 
2760 N  ND2 . ASN A 446 ? 2.1182 1.5687 1.9449 0.4684  -0.1147 -0.8399 438 ASN A ND2 
2761 N  N   . ASP A 447 ? 1.9186 1.4876 1.7471 0.1940  -0.0578 -0.7358 439 ASP A N   
2762 C  CA  . ASP A 447 ? 1.9302 1.4593 1.7447 0.1370  -0.0590 -0.7361 439 ASP A CA  
2763 C  C   . ASP A 447 ? 1.8481 1.4081 1.6725 0.0838  -0.0443 -0.6664 439 ASP A C   
2764 O  O   . ASP A 447 ? 1.8378 1.4124 1.6563 0.0378  -0.0411 -0.6620 439 ASP A O   
2765 C  CB  . ASP A 447 ? 1.9398 1.5676 1.7496 0.1373  -0.0549 -0.7914 439 ASP A CB  
2766 C  CG  . ASP A 447 ? 2.0717 1.6935 1.8726 0.1983  -0.0680 -0.8660 439 ASP A CG  
2767 O  OD1 . ASP A 447 ? 2.1523 1.6497 1.9420 0.2334  -0.0866 -0.8825 439 ASP A OD1 
2768 O  OD2 . ASP A 447 ? 2.0983 1.8408 1.9004 0.2143  -0.0605 -0.9086 439 ASP A OD2 
2769 N  N   . SER A 448 ? 1.8108 1.3843 1.6493 0.0926  -0.0368 -0.6154 440 SER A N   
2770 C  CA  . SER A 448 ? 1.7499 1.3477 1.5952 0.0501  -0.0245 -0.5520 440 SER A CA  
2771 C  C   . SER A 448 ? 1.8009 1.2744 1.6392 0.0288  -0.0339 -0.5162 440 SER A C   
2772 O  O   . SER A 448 ? 1.8503 1.2299 1.6818 0.0561  -0.0475 -0.5236 440 SER A O   
2773 C  CB  . SER A 448 ? 1.7125 1.4092 1.5747 0.0650  -0.0097 -0.5173 440 SER A CB  
2774 O  OG  . SER A 448 ? 1.7990 1.4603 1.6700 0.1031  -0.0162 -0.5136 440 SER A OG  
2775 N  N   . ARG A 449 ? 1.7980 1.2761 1.6355 -0.0173 -0.0271 -0.4769 441 ARG A N   
2776 C  CA  . ARG A 449 ? 1.8193 1.1994 1.6494 -0.0438 -0.0333 -0.4399 441 ARG A CA  
2777 C  C   . ARG A 449 ? 1.8104 1.2240 1.6515 -0.0465 -0.0231 -0.3827 441 ARG A C   
2778 O  O   . ARG A 449 ? 1.7595 1.2682 1.6113 -0.0394 -0.0109 -0.3690 441 ARG A O   
2779 C  CB  . ARG A 449 ? 1.8225 1.1834 1.6425 -0.0965 -0.0349 -0.4435 441 ARG A CB  
2780 C  CG  . ARG A 449 ? 1.9029 1.2244 1.7092 -0.1030 -0.0465 -0.5031 441 ARG A CG  
2781 C  CD  . ARG A 449 ? 1.9067 1.2361 1.7070 -0.1617 -0.0467 -0.5068 441 ARG A CD  
2782 N  NE  . ARG A 449 ? 1.8532 1.3172 1.6658 -0.1727 -0.0331 -0.4966 441 ARG A NE  
2783 C  CZ  . ARG A 449 ? 1.9786 1.4889 1.7904 -0.2164 -0.0315 -0.4986 441 ARG A CZ  
2784 N  NH1 . ARG A 449 ? 1.9863 1.4239 1.7881 -0.2614 -0.0411 -0.5111 441 ARG A NH1 
2785 N  NH2 . ARG A 449 ? 1.8242 1.4550 1.6432 -0.2161 -0.0212 -0.4872 441 ARG A NH2 
2786 N  N   . GLN A 450 ? 1.8150 1.1469 1.6496 -0.0586 -0.0287 -0.3494 442 GLN A N   
2787 C  CA  . GLN A 450 ? 1.7640 1.1194 1.6060 -0.0628 -0.0211 -0.2986 442 GLN A CA  
2788 C  C   . GLN A 450 ? 1.8181 1.0936 1.6479 -0.0920 -0.0263 -0.2666 442 GLN A C   
2789 O  O   . GLN A 450 ? 1.8896 1.0724 1.7036 -0.1013 -0.0378 -0.2789 442 GLN A O   
2790 C  CB  . GLN A 450 ? 1.7614 1.1311 1.6139 -0.0203 -0.0220 -0.2923 442 GLN A CB  
2791 C  CG  . GLN A 450 ? 1.8959 1.1662 1.7388 0.0063  -0.0376 -0.2963 442 GLN A CG  
2792 C  CD  . GLN A 450 ? 1.9697 1.2590 1.8233 0.0376  -0.0384 -0.2723 442 GLN A CD  
2793 O  OE1 . GLN A 450 ? 1.8937 1.2679 1.7645 0.0609  -0.0320 -0.2825 442 GLN A OE1 
2794 N  NE2 . GLN A 450 ? 1.9259 1.1431 1.7683 0.0348  -0.0462 -0.2398 442 GLN A NE2 
2795 N  N   . MET A 451 ? 1.7718 1.0815 1.6055 -0.1072 -0.0182 -0.2259 443 MET A N   
2796 C  CA  . MET A 451 ? 1.7753 1.0261 1.5978 -0.1308 -0.0214 -0.1922 443 MET A CA  
2797 C  C   . MET A 451 ? 1.8278 1.0073 1.6438 -0.1011 -0.0313 -0.1792 443 MET A C   
2798 O  O   . MET A 451 ? 1.8007 1.0125 1.6284 -0.0644 -0.0310 -0.1808 443 MET A O   
2799 C  CB  . MET A 451 ? 1.7264 1.0406 1.5538 -0.1458 -0.0111 -0.1575 443 MET A CB  
2800 C  CG  . MET A 451 ? 1.7566 1.0287 1.5729 -0.1663 -0.0129 -0.1223 443 MET A CG  
2801 S  SD  . MET A 451 ? 1.7196 1.0707 1.5395 -0.1759 -0.0025 -0.0907 443 MET A SD  
2802 C  CE  . MET A 451 ? 1.7066 1.1185 1.5282 -0.2097 0.0026  -0.1096 443 MET A CE  
2803 N  N   . HIS A 452 ? 1.8005 0.8874 1.5961 -0.1184 -0.0407 -0.1656 444 HIS A N   
2804 C  CA  . HIS A 452 ? 1.8388 0.8487 1.6211 -0.0889 -0.0529 -0.1493 444 HIS A CA  
2805 C  C   . HIS A 452 ? 1.7776 0.8432 1.5727 -0.0669 -0.0478 -0.1193 444 HIS A C   
2806 O  O   . HIS A 452 ? 1.7176 0.8337 1.5173 -0.0904 -0.0378 -0.0937 444 HIS A O   
2807 C  CB  . HIS A 452 ? 1.9194 0.8279 1.6717 -0.1233 -0.0612 -0.1254 444 HIS A CB  
2808 C  CG  . HIS A 452 ? 2.0201 0.8250 1.7486 -0.0901 -0.0784 -0.1147 444 HIS A CG  
2809 N  ND1 . HIS A 452 ? 2.0156 0.8299 1.7536 -0.0294 -0.0862 -0.1288 444 HIS A ND1 
2810 C  CD2 . HIS A 452 ? 2.1348 0.8260 1.8275 -0.1078 -0.0903 -0.0897 444 HIS A CD2 
2811 C  CE1 . HIS A 452 ? 2.0945 0.8061 1.8040 -0.0049 -0.1035 -0.1144 444 HIS A CE1 
2812 N  NE2 . HIS A 452 ? 2.1743 0.8025 1.8533 -0.0525 -0.1066 -0.0885 444 HIS A NE2 
2813 N  N   . GLN A 453 ? 1.7571 0.8173 1.5573 -0.0203 -0.0559 -0.1262 445 GLN A N   
2814 C  CA  . GLN A 453 ? 1.6978 0.8155 1.5115 0.0003  -0.0529 -0.1044 445 GLN A CA  
2815 C  C   . GLN A 453 ? 1.7167 0.8040 1.5146 -0.0172 -0.0546 -0.0614 445 GLN A C   
2816 O  O   . GLN A 453 ? 1.6573 0.8017 1.4644 -0.0189 -0.0483 -0.0419 445 GLN A O   
2817 C  CB  . GLN A 453 ? 1.7354 0.8541 1.5564 0.0537  -0.0639 -0.1223 445 GLN A CB  
2818 C  CG  . GLN A 453 ? 1.7781 0.9787 1.6188 0.0706  -0.0598 -0.1092 445 GLN A CG  
2819 C  CD  . GLN A 453 ? 1.8480 1.1437 1.7092 0.0505  -0.0436 -0.1170 445 GLN A CD  
2820 O  OE1 . GLN A 453 ? 1.8007 1.1256 1.6689 0.0481  -0.0377 -0.1450 445 GLN A OE1 
2821 N  NE2 . GLN A 453 ? 1.7665 1.1066 1.6331 0.0360  -0.0374 -0.0920 445 GLN A NE2 
2822 N  N   . ALA A 454 ? 1.7790 0.7743 1.5498 -0.0318 -0.0635 -0.0474 446 ALA A N   
2823 C  CA  . ALA A 454 ? 1.7769 0.7455 1.5278 -0.0526 -0.0645 -0.0050 446 ALA A CA  
2824 C  C   . ALA A 454 ? 1.7349 0.7691 1.4928 -0.0948 -0.0489 0.0086  446 ALA A C   
2825 O  O   . ALA A 454 ? 1.6975 0.7635 1.4518 -0.1003 -0.0453 0.0364  446 ALA A O   
2826 C  CB  . ALA A 454 ? 1.8855 0.7369 1.6005 -0.0668 -0.0769 0.0089  446 ALA A CB  
2827 N  N   . LEU A 455 ? 1.7241 0.7831 1.4909 -0.1206 -0.0410 -0.0139 447 LEU A N   
2828 C  CA  . LEU A 455 ? 1.6730 0.8032 1.4470 -0.1530 -0.0279 -0.0062 447 LEU A CA  
2829 C  C   . LEU A 455 ? 1.6099 0.8221 1.4033 -0.1310 -0.0206 -0.0083 447 LEU A C   
2830 O  O   . LEU A 455 ? 1.5672 0.8231 1.3591 -0.1392 -0.0148 0.0107  447 LEU A O   
2831 C  CB  . LEU A 455 ? 1.7008 0.8400 1.4779 -0.1841 -0.0237 -0.0317 447 LEU A CB  
2832 C  CG  . LEU A 455 ? 1.8024 0.9015 1.5603 -0.2343 -0.0241 -0.0194 447 LEU A CG  
2833 C  CD1 . LEU A 455 ? 1.8335 0.9438 1.5965 -0.2635 -0.0223 -0.0525 447 LEU A CD1 
2834 C  CD2 . LEU A 455 ? 1.8005 0.9611 1.5562 -0.2575 -0.0147 0.0112  447 LEU A CD2 
2835 N  N   . GLN A 456 ? 1.5449 0.7767 1.3534 -0.1039 -0.0214 -0.0319 448 GLN A N   
2836 C  CA  . GLN A 456 ? 1.4776 0.7773 1.2999 -0.0892 -0.0152 -0.0324 448 GLN A CA  
2837 C  C   . GLN A 456 ? 1.4658 0.7685 1.2853 -0.0751 -0.0188 -0.0088 448 GLN A C   
2838 O  O   . GLN A 456 ? 1.4183 0.7630 1.2388 -0.0772 -0.0141 0.0008  448 GLN A O   
2839 C  CB  . GLN A 456 ? 1.4885 0.8130 1.3257 -0.0669 -0.0151 -0.0604 448 GLN A CB  
2840 C  CG  . GLN A 456 ? 1.5246 0.8545 1.3639 -0.0770 -0.0123 -0.0894 448 GLN A CG  
2841 C  CD  . GLN A 456 ? 1.6486 1.0245 1.5018 -0.0547 -0.0099 -0.1161 448 GLN A CD  
2842 O  OE1 . GLN A 456 ? 1.6114 1.0389 1.4729 -0.0460 -0.0051 -0.1086 448 GLN A OE1 
2843 N  NE2 . GLN A 456 ? 1.6298 0.9886 1.4834 -0.0477 -0.0135 -0.1487 448 GLN A NE2 
2844 N  N   . ASP A 457 ? 1.5121 0.7668 1.3247 -0.0589 -0.0289 -0.0006 449 ASP A N   
2845 C  CA  . ASP A 457 ? 1.4904 0.7519 1.2992 -0.0438 -0.0343 0.0199  449 ASP A CA  
2846 C  C   . ASP A 457 ? 1.4829 0.7507 1.2761 -0.0653 -0.0307 0.0457  449 ASP A C   
2847 O  O   . ASP A 457 ? 1.4392 0.7423 1.2324 -0.0597 -0.0302 0.0548  449 ASP A O   
2848 C  CB  . ASP A 457 ? 1.5582 0.7663 1.3586 -0.0170 -0.0480 0.0243  449 ASP A CB  
2849 C  CG  . ASP A 457 ? 1.6794 0.9061 1.4983 0.0165  -0.0531 -0.0032 449 ASP A CG  
2850 O  OD1 . ASP A 457 ? 1.6611 0.9523 1.4998 0.0152  -0.0448 -0.0198 449 ASP A OD1 
2851 O  OD2 . ASP A 457 ? 1.7676 0.9461 1.5787 0.0453  -0.0658 -0.0076 449 ASP A OD2 
2852 N  N   . PHE A 458 ? 1.4213 0.6589 1.2004 -0.0915 -0.0283 0.0551  450 PHE A N   
2853 C  CA  . PHE A 458 ? 1.4125 0.6700 1.1769 -0.1134 -0.0236 0.0783  450 PHE A CA  
2854 C  C   . PHE A 458 ? 1.3991 0.7247 1.1719 -0.1163 -0.0148 0.0707  450 PHE A C   
2855 O  O   . PHE A 458 ? 1.3673 0.7234 1.1322 -0.1119 -0.0141 0.0827  450 PHE A O   
2856 C  CB  . PHE A 458 ? 1.4773 0.7000 1.2268 -0.1492 -0.0213 0.0876  450 PHE A CB  
2857 C  CG  . PHE A 458 ? 1.4911 0.7540 1.2272 -0.1754 -0.0143 0.1097  450 PHE A CG  
2858 C  CD1 . PHE A 458 ? 1.5286 0.7793 1.2439 -0.1748 -0.0181 0.1391  450 PHE A CD1 
2859 C  CD2 . PHE A 458 ? 1.4939 0.8171 1.2373 -0.1981 -0.0042 0.1002  450 PHE A CD2 
2860 C  CE1 . PHE A 458 ? 1.5421 0.8434 1.2448 -0.1983 -0.0105 0.1576  450 PHE A CE1 
2861 C  CE2 . PHE A 458 ? 1.5211 0.8972 1.2539 -0.2186 0.0026  0.1171  450 PHE A CE2 
2862 C  CZ  . PHE A 458 ? 1.5249 0.8916 1.2375 -0.2197 0.0002  0.1453  450 PHE A CZ  
2863 N  N   . LEU A 459 ? 1.3714 0.7183 1.1567 -0.1205 -0.0095 0.0499  451 LEU A N   
2864 C  CA  . LEU A 459 ? 1.3363 0.7381 1.1241 -0.1187 -0.0035 0.0438  451 LEU A CA  
2865 C  C   . LEU A 459 ? 1.3410 0.7541 1.1300 -0.0959 -0.0067 0.0434  451 LEU A C   
2866 O  O   . LEU A 459 ? 1.3267 0.7661 1.1066 -0.0900 -0.0060 0.0469  451 LEU A O   
2867 C  CB  . LEU A 459 ? 1.3355 0.7566 1.1326 -0.1265 0.0012  0.0234  451 LEU A CB  
2868 C  CG  . LEU A 459 ? 1.3929 0.8129 1.1890 -0.1559 0.0041  0.0184  451 LEU A CG  
2869 C  CD1 . LEU A 459 ? 1.3887 0.8384 1.1939 -0.1602 0.0075  -0.0053 451 LEU A CD1 
2870 C  CD2 . LEU A 459 ? 1.4090 0.8683 1.1956 -0.1729 0.0082  0.0335  451 LEU A CD2 
2871 N  N   . SER A 460 ? 1.3096 0.7036 1.1086 -0.0832 -0.0112 0.0372  452 SER A N   
2872 C  CA  . SER A 460 ? 1.2901 0.6984 1.0917 -0.0699 -0.0145 0.0359  452 SER A CA  
2873 C  C   . SER A 460 ? 1.3045 0.7079 1.0963 -0.0625 -0.0212 0.0501  452 SER A C   
2874 O  O   . SER A 460 ? 1.2871 0.7042 1.0743 -0.0574 -0.0243 0.0494  452 SER A O   
2875 C  CB  . SER A 460 ? 1.3448 0.7550 1.1633 -0.0602 -0.0163 0.0220  452 SER A CB  
2876 O  OG  . SER A 460 ? 1.4657 0.8908 1.2911 -0.0661 -0.0097 0.0071  452 SER A OG  
2877 N  N   . ALA A 461 ? 1.3059 0.6871 1.0907 -0.0641 -0.0241 0.0632  453 ALA A N   
2878 C  CA  . ALA A 461 ? 1.2969 0.6786 1.0688 -0.0566 -0.0307 0.0790  453 ALA A CA  
2879 C  C   . ALA A 461 ? 1.2986 0.7083 1.0546 -0.0632 -0.0269 0.0855  453 ALA A C   
2880 O  O   . ALA A 461 ? 1.2841 0.7082 1.0286 -0.0546 -0.0321 0.0917  453 ALA A O   
2881 C  CB  . ALA A 461 ? 1.3438 0.6868 1.1066 -0.0564 -0.0358 0.0958  453 ALA A CB  
2882 N  N   . GLN A 462 ? 1.2681 0.6932 1.0232 -0.0756 -0.0188 0.0812  454 GLN A N   
2883 C  CA  . GLN A 462 ? 1.2690 0.7324 1.0100 -0.0753 -0.0156 0.0828  454 GLN A CA  
2884 C  C   . GLN A 462 ? 1.2881 0.7595 1.0239 -0.0574 -0.0197 0.0690  454 GLN A C   
2885 O  O   . GLN A 462 ? 1.2984 0.7935 1.0182 -0.0463 -0.0214 0.0663  454 GLN A O   
2886 C  CB  . GLN A 462 ? 1.2995 0.7886 1.0427 -0.0919 -0.0069 0.0804  454 GLN A CB  
2887 C  CG  . GLN A 462 ? 1.2893 0.7585 1.0342 -0.1185 -0.0036 0.0925  454 GLN A CG  
2888 C  CD  . GLN A 462 ? 1.3259 0.7798 1.0553 -0.1239 -0.0070 0.1158  454 GLN A CD  
2889 O  OE1 . GLN A 462 ? 1.3256 0.8219 1.0412 -0.1267 -0.0043 0.1261  454 GLN A OE1 
2890 N  NE2 . GLN A 462 ? 1.3525 0.7496 1.0818 -0.1219 -0.0137 0.1242  454 GLN A NE2 
2891 N  N   . GLN A 463 ? 1.2790 0.7294 1.0254 -0.0554 -0.0216 0.0596  455 GLN A N   
2892 C  CA  . GLN A 463 ? 1.2664 0.7077 1.0046 -0.0466 -0.0274 0.0502  455 GLN A CA  
2893 C  C   . GLN A 463 ? 1.3195 0.7641 1.0397 -0.0371 -0.0273 0.0433  455 GLN A C   
2894 O  O   . GLN A 463 ? 1.3430 0.7683 1.0582 -0.0376 -0.0286 0.0386  455 GLN A O   
2895 C  CB  . GLN A 463 ? 1.2721 0.7141 1.0012 -0.0392 -0.0360 0.0513  455 GLN A CB  
2896 C  CG  . GLN A 463 ? 1.3499 0.7787 1.0831 -0.0423 -0.0432 0.0428  455 GLN A CG  
2897 C  CD  . GLN A 463 ? 1.4449 0.8853 1.1743 -0.0369 -0.0524 0.0430  455 GLN A CD  
2898 O  OE1 . GLN A 463 ? 1.4278 0.8816 1.1579 -0.0313 -0.0527 0.0548  455 GLN A OE1 
2899 N  NE2 . GLN A 463 ? 1.3626 0.7968 1.0850 -0.0409 -0.0608 0.0308  455 GLN A NE2 
2900 N  N   . VAL A 464 ? 1.2792 0.7512 0.9871 -0.0269 -0.0262 0.0437  456 VAL A N   
2901 C  CA  . VAL A 464 ? 1.3000 0.7787 0.9865 -0.0065 -0.0294 0.0345  456 VAL A CA  
2902 C  C   . VAL A 464 ? 1.3535 0.8327 1.0412 -0.0059 -0.0259 0.0328  456 VAL A C   
2903 O  O   . VAL A 464 ? 1.3851 0.8463 1.0505 0.0132  -0.0321 0.0276  456 VAL A O   
2904 C  CB  . VAL A 464 ? 1.3411 0.8725 1.0188 0.0060  -0.0272 0.0329  456 VAL A CB  
2905 C  CG1 . VAL A 464 ? 1.3406 0.8737 1.0050 0.0155  -0.0337 0.0301  456 VAL A CG1 
2906 C  CG2 . VAL A 464 ? 1.3444 0.9150 1.0413 -0.0177 -0.0164 0.0441  456 VAL A CG2 
2907 N  N   . GLN A 465 ? 1.3143 0.8101 1.0237 -0.0251 -0.0175 0.0369  457 GLN A N   
2908 C  CA  . GLN A 465 ? 1.3276 0.8331 1.0387 -0.0259 -0.0142 0.0337  457 GLN A CA  
2909 C  C   . GLN A 465 ? 1.3392 0.8233 1.0672 -0.0442 -0.0107 0.0342  457 GLN A C   
2910 O  O   . GLN A 465 ? 1.3385 0.8337 1.0864 -0.0600 -0.0051 0.0323  457 GLN A O   
2911 C  CB  . GLN A 465 ? 1.3495 0.9111 1.0699 -0.0317 -0.0078 0.0309  457 GLN A CB  
2912 C  CG  . GLN A 465 ? 1.3879 0.9946 1.0934 -0.0104 -0.0102 0.0272  457 GLN A CG  
2913 C  CD  . GLN A 465 ? 1.4363 1.1119 1.1560 -0.0278 -0.0022 0.0256  457 GLN A CD  
2914 O  OE1 . GLN A 465 ? 1.4248 1.0986 1.1600 -0.0590 0.0040  0.0323  457 GLN A OE1 
2915 N  NE2 . GLN A 465 ? 1.2818 1.0178 0.9940 -0.0081 -0.0033 0.0168  457 GLN A NE2 
2916 N  N   . ALA A 466 ? 1.3313 0.7848 1.0489 -0.0427 -0.0144 0.0357  458 ALA A N   
2917 C  CA  . ALA A 466 ? 1.3242 0.7718 1.0572 -0.0587 -0.0105 0.0346  458 ALA A CA  
2918 C  C   . ALA A 466 ? 1.3655 0.8423 1.1099 -0.0649 -0.0034 0.0285  458 ALA A C   
2919 O  O   . ALA A 466 ? 1.3944 0.8842 1.1237 -0.0581 -0.0032 0.0296  458 ALA A O   
2920 C  CB  . ALA A 466 ? 1.3484 0.7670 1.0628 -0.0624 -0.0147 0.0399  458 ALA A CB  
2921 N  N   . PRO A 467 ? 1.2823 0.7673 1.0505 -0.0753 0.0008  0.0205  459 PRO A N   
2922 C  CA  . PRO A 467 ? 1.2914 0.8009 1.0707 -0.0826 0.0063  0.0085  459 PRO A CA  
2923 C  C   . PRO A 467 ? 1.3360 0.8605 1.1129 -0.0845 0.0096  0.0045  459 PRO A C   
2924 O  O   . PRO A 467 ? 1.3339 0.8504 1.1128 -0.0872 0.0094  0.0077  459 PRO A O   
2925 C  CB  . PRO A 467 ? 1.2999 0.7935 1.0988 -0.0893 0.0065  0.0006  459 PRO A CB  
2926 C  CG  . PRO A 467 ? 1.3179 0.7878 1.1133 -0.0851 0.0016  0.0135  459 PRO A CG  
2927 C  CD  . PRO A 467 ? 1.2756 0.7428 1.0576 -0.0772 -0.0016 0.0213  459 PRO A CD  
2928 N  N   . VAL A 468 ? 1.2811 0.8364 1.0531 -0.0853 0.0127  -0.0021 460 VAL A N   
2929 C  CA  . VAL A 468 ? 1.3042 0.8842 1.0713 -0.0884 0.0169  -0.0053 460 VAL A CA  
2930 C  C   . VAL A 468 ? 1.3242 0.9352 1.1092 -0.0939 0.0212  -0.0295 460 VAL A C   
2931 O  O   . VAL A 468 ? 1.3235 0.9498 1.1112 -0.0969 0.0206  -0.0399 460 VAL A O   
2932 C  CB  . VAL A 468 ? 1.3613 0.9518 1.0980 -0.0804 0.0147  0.0090  460 VAL A CB  
2933 C  CG1 . VAL A 468 ? 1.3949 1.0132 1.1218 -0.0873 0.0197  0.0108  460 VAL A CG1 
2934 C  CG2 . VAL A 468 ? 1.3646 0.9105 1.0779 -0.0718 0.0077  0.0288  460 VAL A CG2 
2935 N  N   . LYS A 469 ? 1.2880 0.9130 1.0849 -0.0958 0.0250  -0.0414 461 LYS A N   
2936 C  CA  . LYS A 469 ? 1.2863 0.9360 1.0978 -0.0965 0.0276  -0.0704 461 LYS A CA  
2937 C  C   . LYS A 469 ? 1.3310 1.0341 1.1292 -0.0985 0.0319  -0.0762 461 LYS A C   
2938 O  O   . LYS A 469 ? 1.3480 1.0782 1.1341 -0.0997 0.0363  -0.0650 461 LYS A O   
2939 C  CB  . LYS A 469 ? 1.3023 0.9532 1.1322 -0.0894 0.0286  -0.0855 461 LYS A CB  
2940 C  CG  . LYS A 469 ? 1.3243 0.9501 1.1695 -0.0827 0.0243  -0.1136 461 LYS A CG  
2941 C  CD  . LYS A 469 ? 1.3842 1.0129 1.2454 -0.0650 0.0227  -0.1292 461 LYS A CD  
2942 C  CE  . LYS A 469 ? 1.4692 1.0733 1.3344 -0.0605 0.0189  -0.1066 461 LYS A CE  
2943 N  NZ  . LYS A 469 ? 1.5565 1.1741 1.4390 -0.0386 0.0155  -0.1236 461 LYS A NZ  
2944 N  N   . LEU A 470 ? 1.2870 1.0085 1.0853 -0.1021 0.0304  -0.0924 462 LEU A N   
2945 C  CA  . LEU A 470 ? 1.2929 1.0731 1.0778 -0.1021 0.0330  -0.1004 462 LEU A CA  
2946 C  C   . LEU A 470 ? 1.3388 1.1483 1.1378 -0.1043 0.0349  -0.1397 462 LEU A C   
2947 O  O   . LEU A 470 ? 1.3482 1.1221 1.1654 -0.1036 0.0328  -0.1604 462 LEU A O   
2948 C  CB  . LEU A 470 ? 1.2920 1.0910 1.0651 -0.1025 0.0285  -0.0941 462 LEU A CB  
2949 C  CG  . LEU A 470 ? 1.3151 1.0913 1.0686 -0.0917 0.0245  -0.0605 462 LEU A CG  
2950 C  CD1 . LEU A 470 ? 1.3251 1.1431 1.0677 -0.0849 0.0196  -0.0606 462 LEU A CD1 
2951 C  CD2 . LEU A 470 ? 1.3459 1.1136 1.0745 -0.0847 0.0260  -0.0347 462 LEU A CD2 
2952 N  N   . TYR A 471 ? 1.3790 1.2513 1.1658 -0.1038 0.0375  -0.1505 463 TYR A N   
2953 C  CA  . TYR A 471 ? 1.3817 1.2902 1.1779 -0.1038 0.0386  -0.1930 463 TYR A CA  
2954 C  C   . TYR A 471 ? 1.4291 1.3573 1.2253 -0.1154 0.0330  -0.2168 463 TYR A C   
2955 O  O   . TYR A 471 ? 1.4262 1.4043 1.2063 -0.1161 0.0320  -0.2055 463 TYR A O   
2956 C  CB  . TYR A 471 ? 1.3880 1.3678 1.1700 -0.0975 0.0461  -0.1929 463 TYR A CB  
2957 C  CG  . TYR A 471 ? 1.3994 1.4281 1.1889 -0.0928 0.0473  -0.2413 463 TYR A CG  
2958 C  CD1 . TYR A 471 ? 1.4189 1.4089 1.2298 -0.0855 0.0435  -0.2788 463 TYR A CD1 
2959 C  CD2 . TYR A 471 ? 1.4065 1.5178 1.1777 -0.0922 0.0507  -0.2503 463 TYR A CD2 
2960 C  CE1 . TYR A 471 ? 1.4317 1.4602 1.2463 -0.0765 0.0426  -0.3284 463 TYR A CE1 
2961 C  CE2 . TYR A 471 ? 1.4187 1.5798 1.1952 -0.0860 0.0513  -0.2994 463 TYR A CE2 
2962 C  CZ  . TYR A 471 ? 1.4804 1.5979 1.2790 -0.0775 0.0470  -0.3405 463 TYR A CZ  
2963 O  OH  . TYR A 471 ? 1.5131 1.6738 1.3139 -0.0668 0.0456  -0.3947 463 TYR A OH  
2964 N  N   . SER A 472 ? 1.4408 1.3288 1.2529 -0.1250 0.0280  -0.2496 464 SER A N   
2965 C  CA  . SER A 472 ? 1.4635 1.3664 1.2770 -0.1459 0.0222  -0.2744 464 SER A CA  
2966 C  C   . SER A 472 ? 1.5367 1.4118 1.3585 -0.1534 0.0169  -0.3250 464 SER A C   
2967 O  O   . SER A 472 ? 1.5635 1.4342 1.3869 -0.1785 0.0107  -0.3504 464 SER A O   
2968 C  CB  . SER A 472 ? 1.4823 1.3442 1.3003 -0.1633 0.0188  -0.2514 464 SER A CB  
2969 O  OG  . SER A 472 ? 1.5547 1.3294 1.3827 -0.1685 0.0161  -0.2518 464 SER A OG  
2970 N  N   . ASP A 473 ? 1.5309 1.3891 1.3568 -0.1314 0.0185  -0.3416 465 ASP A N   
2971 C  CA  . ASP A 473 ? 1.5688 1.3902 1.3985 -0.1278 0.0113  -0.3931 465 ASP A CA  
2972 C  C   . ASP A 473 ? 1.6187 1.5163 1.4408 -0.1319 0.0103  -0.4359 465 ASP A C   
2973 O  O   . ASP A 473 ? 1.6671 1.5356 1.4884 -0.1344 0.0020  -0.4860 465 ASP A O   
2974 C  CB  . ASP A 473 ? 1.5824 1.3813 1.4190 -0.0941 0.0127  -0.4004 465 ASP A CB  
2975 C  CG  . ASP A 473 ? 1.7411 1.4784 1.5782 -0.0811 0.0017  -0.4526 465 ASP A CG  
2976 O  OD1 . ASP A 473 ? 1.7970 1.4355 1.6315 -0.0958 -0.0085 -0.4549 465 ASP A OD1 
2977 O  OD2 . ASP A 473 ? 1.7906 1.5764 1.6274 -0.0553 0.0026  -0.4913 465 ASP A OD2 
2978 N  N   . TRP A 474 ? 1.5791 1.5702 1.3918 -0.1314 0.0173  -0.4164 466 TRP A N   
2979 C  CA  . TRP A 474 ? 1.5875 1.6664 1.3899 -0.1338 0.0165  -0.4522 466 TRP A CA  
2980 C  C   . TRP A 474 ? 1.6545 1.7320 1.4578 -0.1667 0.0070  -0.4782 466 TRP A C   
2981 O  O   . TRP A 474 ? 1.6902 1.7972 1.4898 -0.1743 0.0010  -0.5300 466 TRP A O   
2982 C  CB  . TRP A 474 ? 1.5440 1.7175 1.3298 -0.1230 0.0252  -0.4160 466 TRP A CB  
2983 C  CG  . TRP A 474 ? 1.5319 1.6993 1.3118 -0.1308 0.0255  -0.3637 466 TRP A CG  
2984 C  CD1 . TRP A 474 ? 1.5373 1.6477 1.3197 -0.1256 0.0288  -0.3182 466 TRP A CD1 
2985 C  CD2 . TRP A 474 ? 1.5321 1.7589 1.3013 -0.1406 0.0209  -0.3552 466 TRP A CD2 
2986 N  NE1 . TRP A 474 ? 1.5291 1.6535 1.3016 -0.1293 0.0264  -0.2838 466 TRP A NE1 
2987 C  CE2 . TRP A 474 ? 1.5499 1.7483 1.3147 -0.1366 0.0215  -0.3048 466 TRP A CE2 
2988 C  CE3 . TRP A 474 ? 1.5533 1.8604 1.3159 -0.1501 0.0153  -0.3881 466 TRP A CE3 
2989 C  CZ2 . TRP A 474 ? 1.5482 1.7966 1.3023 -0.1366 0.0165  -0.2865 466 TRP A CZ2 
2990 C  CZ3 . TRP A 474 ? 1.5639 1.9264 1.3176 -0.1533 0.0105  -0.3680 466 TRP A CZ3 
2991 C  CH2 . TRP A 474 ? 1.5592 1.8926 1.3088 -0.1441 0.0110  -0.3177 466 TRP A CH2 
2992 N  N   . LEU A 475 ? 1.5992 1.6484 1.4071 -0.1877 0.0055  -0.4446 467 LEU A N   
2993 C  CA  . LEU A 475 ? 1.6254 1.6844 1.4366 -0.2257 -0.0023 -0.4647 467 LEU A CA  
2994 C  C   . LEU A 475 ? 1.7246 1.6910 1.5403 -0.2507 -0.0117 -0.5085 467 LEU A C   
2995 O  O   . LEU A 475 ? 1.7390 1.6155 1.5559 -0.2344 -0.0130 -0.5117 467 LEU A O   
2996 C  CB  . LEU A 475 ? 1.6051 1.6601 1.4211 -0.2394 -0.0005 -0.4176 467 LEU A CB  
2997 C  CG  . LEU A 475 ? 1.5995 1.7411 1.4049 -0.2164 0.0041  -0.3785 467 LEU A CG  
2998 C  CD1 . LEU A 475 ? 1.5807 1.6786 1.3881 -0.2083 0.0077  -0.3276 467 LEU A CD1 
2999 C  CD2 . LEU A 475 ? 1.6268 1.8700 1.4296 -0.2329 -0.0015 -0.3957 467 LEU A CD2 
3000 N  N   . SER A 476 ? 1.7247 1.7121 1.5403 -0.2905 -0.0197 -0.5424 468 SER A N   
3001 C  CA  . SER A 476 ? 1.7922 1.6794 1.6053 -0.3230 -0.0308 -0.5834 468 SER A CA  
3002 C  C   . SER A 476 ? 1.8351 1.6175 1.6513 -0.3458 -0.0314 -0.5461 468 SER A C   
3003 O  O   . SER A 476 ? 1.8712 1.5340 1.6807 -0.3401 -0.0373 -0.5530 468 SER A O   
3004 C  CB  . SER A 476 ? 1.8548 1.7993 1.6660 -0.3688 -0.0393 -0.6285 468 SER A CB  
3005 O  OG  . SER A 476 ? 1.9958 1.8304 1.7983 -0.4025 -0.0519 -0.6726 468 SER A OG  
3006 N  N   . VAL A 477 ? 1.7711 1.6034 1.5951 -0.3680 -0.0259 -0.5065 469 VAL A N   
3007 C  CA  . VAL A 477 ? 1.7856 1.5403 1.6116 -0.3893 -0.0245 -0.4665 469 VAL A CA  
3008 C  C   . VAL A 477 ? 1.7843 1.4936 1.6110 -0.3414 -0.0180 -0.4260 469 VAL A C   
3009 O  O   . VAL A 477 ? 1.8201 1.4198 1.6416 -0.3385 -0.0215 -0.4159 469 VAL A O   
3010 C  CB  . VAL A 477 ? 1.7919 1.6340 1.6269 -0.4212 -0.0198 -0.4395 469 VAL A CB  
3011 C  CG1 . VAL A 477 ? 1.8213 1.5851 1.6552 -0.4583 -0.0194 -0.4092 469 VAL A CG1 
3012 C  CG2 . VAL A 477 ? 1.8157 1.7478 1.6537 -0.4599 -0.0254 -0.4815 469 VAL A CG2 
3013 N  N   . GLY A 478 ? 1.7231 1.5156 1.5535 -0.3050 -0.0097 -0.4027 470 GLY A N   
3014 C  CA  . GLY A 478 ? 1.6849 1.4467 1.5157 -0.2636 -0.0038 -0.3686 470 GLY A CA  
3015 C  C   . GLY A 478 ? 1.6786 1.4472 1.5119 -0.2617 0.0018  -0.3169 470 GLY A C   
3016 O  O   . GLY A 478 ? 1.6446 1.3832 1.4778 -0.2334 0.0057  -0.2877 470 GLY A O   
3017 N  N   . HIS A 479 ? 1.6464 1.4619 1.4822 -0.2918 0.0017  -0.3088 471 HIS A N   
3018 C  CA  . HIS A 479 ? 1.6131 1.4456 1.4502 -0.2878 0.0061  -0.2657 471 HIS A CA  
3019 C  C   . HIS A 479 ? 1.5766 1.4864 1.4075 -0.2500 0.0098  -0.2448 471 HIS A C   
3020 O  O   . HIS A 479 ? 1.5675 1.5442 1.3934 -0.2394 0.0089  -0.2628 471 HIS A O   
3021 C  CB  . HIS A 479 ? 1.6497 1.5173 1.4920 -0.3334 0.0049  -0.2672 471 HIS A CB  
3022 C  CG  . HIS A 479 ? 1.7283 1.5033 1.5691 -0.3769 0.0011  -0.2759 471 HIS A CG  
3023 N  ND1 . HIS A 479 ? 1.7734 1.5617 1.6162 -0.4258 0.0017  -0.2675 471 HIS A ND1 
3024 C  CD2 . HIS A 479 ? 1.7761 1.4415 1.6096 -0.3778 -0.0044 -0.2910 471 HIS A CD2 
3025 C  CE1 . HIS A 479 ? 1.8241 1.5046 1.6575 -0.4597 -0.0033 -0.2733 471 HIS A CE1 
3026 N  NE2 . HIS A 479 ? 1.8319 1.4325 1.6588 -0.4275 -0.0082 -0.2884 471 HIS A NE2 
3027 N  N   . VAL A 480 ? 1.4767 1.3724 1.3038 -0.2294 0.0128  -0.2068 472 VAL A N   
3028 C  CA  . VAL A 480 ? 1.4545 1.3968 1.2683 -0.1924 0.0141  -0.1836 472 VAL A CA  
3029 C  C   . VAL A 480 ? 1.4905 1.5231 1.2997 -0.1889 0.0112  -0.1788 472 VAL A C   
3030 O  O   . VAL A 480 ? 1.4780 1.5595 1.2706 -0.1584 0.0090  -0.1678 472 VAL A O   
3031 C  CB  . VAL A 480 ? 1.4609 1.3433 1.2687 -0.1697 0.0163  -0.1487 472 VAL A CB  
3032 C  CG1 . VAL A 480 ? 1.4586 1.2709 1.2716 -0.1664 0.0183  -0.1535 472 VAL A CG1 
3033 C  CG2 . VAL A 480 ? 1.4511 1.3176 1.2642 -0.1825 0.0162  -0.1325 472 VAL A CG2 
3034 N  N   . ASP A 481 ? 1.4571 1.5146 1.2787 -0.2200 0.0106  -0.1863 473 ASP A N   
3035 C  CA  . ASP A 481 ? 1.4676 1.6250 1.2885 -0.2149 0.0078  -0.1835 473 ASP A CA  
3036 C  C   . ASP A 481 ? 1.4895 1.7408 1.3101 -0.2189 0.0031  -0.2118 473 ASP A C   
3037 O  O   . ASP A 481 ? 1.4976 1.8457 1.3141 -0.2016 -0.0013 -0.2103 473 ASP A O   
3038 C  CB  . ASP A 481 ? 1.5071 1.6779 1.3429 -0.2538 0.0103  -0.1833 473 ASP A CB  
3039 C  CG  . ASP A 481 ? 1.6741 1.8380 1.5232 -0.3119 0.0101  -0.2146 473 ASP A CG  
3040 O  OD1 . ASP A 481 ? 1.6863 1.7940 1.5337 -0.3182 0.0084  -0.2350 473 ASP A OD1 
3041 O  OD2 . ASP A 481 ? 1.7817 1.9970 1.6413 -0.3524 0.0112  -0.2201 473 ASP A OD2 
3042 N  N   . GLU A 482 ? 1.4451 1.6724 1.2687 -0.2378 0.0029  -0.2401 474 GLU A N   
3043 C  CA  . GLU A 482 ? 1.4431 1.7609 1.2661 -0.2459 -0.0021 -0.2726 474 GLU A CA  
3044 C  C   . GLU A 482 ? 1.4652 1.8143 1.2659 -0.2011 -0.0038 -0.2637 474 GLU A C   
3045 O  O   . GLU A 482 ? 1.4806 1.9003 1.2766 -0.2031 -0.0079 -0.2903 474 GLU A O   
3046 C  CB  . GLU A 482 ? 1.4681 1.7484 1.3026 -0.2914 -0.0031 -0.3146 474 GLU A CB  
3047 C  CG  . GLU A 482 ? 1.5262 1.7135 1.3547 -0.2775 -0.0006 -0.3210 474 GLU A CG  
3048 C  CD  . GLU A 482 ? 1.7171 1.8555 1.5524 -0.3157 -0.0045 -0.3663 474 GLU A CD  
3049 O  OE1 . GLU A 482 ? 1.6918 1.8981 1.5285 -0.3383 -0.0099 -0.4044 474 GLU A OE1 
3050 O  OE2 . GLU A 482 ? 1.7055 1.7352 1.5422 -0.3212 -0.0037 -0.3653 474 GLU A OE2 
3051 N  N   . PHE A 483 ? 1.4574 1.7551 1.2416 -0.1640 -0.0012 -0.2259 475 PHE A N   
3052 C  CA  . PHE A 483 ? 1.4583 1.7817 1.2144 -0.1257 -0.0030 -0.2086 475 PHE A CA  
3053 C  C   . PHE A 483 ? 1.4935 1.7833 1.2267 -0.0866 -0.0049 -0.1630 475 PHE A C   
3054 O  O   . PHE A 483 ? 1.5123 1.7964 1.2157 -0.0576 -0.0065 -0.1395 475 PHE A O   
3055 C  CB  . PHE A 483 ? 1.4631 1.7410 1.2164 -0.1298 0.0028  -0.2199 475 PHE A CB  
3056 C  CG  . PHE A 483 ? 1.4601 1.6400 1.2127 -0.1218 0.0091  -0.1937 475 PHE A CG  
3057 C  CD1 . PHE A 483 ? 1.4683 1.5746 1.2433 -0.1431 0.0120  -0.2004 475 PHE A CD1 
3058 C  CD2 . PHE A 483 ? 1.4842 1.6474 1.2113 -0.0957 0.0115  -0.1619 475 PHE A CD2 
3059 C  CE1 . PHE A 483 ? 1.4618 1.4898 1.2369 -0.1339 0.0164  -0.1783 475 PHE A CE1 
3060 C  CE2 . PHE A 483 ? 1.4934 1.5774 1.2216 -0.0932 0.0168  -0.1408 475 PHE A CE2 
3061 C  CZ  . PHE A 483 ? 1.4587 1.4802 1.2126 -0.1102 0.0190  -0.1506 475 PHE A CZ  
3062 N  N   . LEU A 484 ? 1.3866 1.6529 1.1301 -0.0873 -0.0053 -0.1510 476 LEU A N   
3063 C  CA  . LEU A 484 ? 1.3880 1.6251 1.1079 -0.0476 -0.0096 -0.1148 476 LEU A CA  
3064 C  C   . LEU A 484 ? 1.3788 1.6479 1.1113 -0.0455 -0.0122 -0.1146 476 LEU A C   
3065 O  O   . LEU A 484 ? 1.3687 1.6494 1.1300 -0.0844 -0.0073 -0.1336 476 LEU A O   
3066 C  CB  . LEU A 484 ? 1.3867 1.5149 1.0986 -0.0448 -0.0043 -0.0913 476 LEU A CB  
3067 C  CG  . LEU A 484 ? 1.3703 1.4319 1.1078 -0.0705 0.0020  -0.0941 476 LEU A CG  
3068 C  CD1 . LEU A 484 ? 1.3678 1.3993 1.0967 -0.0492 -0.0013 -0.0710 476 LEU A CD1 
3069 C  CD2 . LEU A 484 ? 1.3695 1.3597 1.1107 -0.0819 0.0084  -0.0924 476 LEU A CD2 
3070 N  N   . SER A 485 ? 1.3250 1.6065 1.0325 0.0005  -0.0206 -0.0926 477 SER A N   
3071 C  CA  . SER A 485 ? 1.3400 1.6629 1.0559 0.0125  -0.0234 -0.0929 477 SER A CA  
3072 C  C   . SER A 485 ? 1.3978 1.6922 1.0766 0.0732  -0.0342 -0.0667 477 SER A C   
3073 O  O   . SER A 485 ? 1.4187 1.6751 1.0620 0.1042  -0.0413 -0.0476 477 SER A O   
3074 C  CB  . SER A 485 ? 1.3836 1.8417 1.1189 0.0001  -0.0263 -0.1201 477 SER A CB  
3075 O  OG  . SER A 485 ? 1.4704 1.9851 1.2172 0.0074  -0.0271 -0.1223 477 SER A OG  
3076 N  N   . PHE A 486 ? 1.3578 1.6681 1.0414 0.0893  -0.0360 -0.0661 478 PHE A N   
3077 C  CA  . PHE A 486 ? 1.3856 1.6637 1.0324 0.1507  -0.0483 -0.0477 478 PHE A CA  
3078 C  C   . PHE A 486 ? 1.4561 1.8539 1.1044 0.1887  -0.0571 -0.0623 478 PHE A C   
3079 O  O   . PHE A 486 ? 1.4303 1.9195 1.1147 0.1570  -0.0493 -0.0829 478 PHE A O   
3080 C  CB  . PHE A 486 ? 1.3705 1.5455 1.0147 0.1464  -0.0443 -0.0349 478 PHE A CB  
3081 C  CG  . PHE A 486 ? 1.3684 1.4298 1.0054 0.1213  -0.0386 -0.0186 478 PHE A CG  
3082 C  CD1 . PHE A 486 ? 1.4187 1.3974 1.0129 0.1514  -0.0475 0.0051  478 PHE A CD1 
3083 C  CD2 . PHE A 486 ? 1.3328 1.3709 1.0033 0.0676  -0.0254 -0.0268 478 PHE A CD2 
3084 C  CE1 . PHE A 486 ? 1.4142 1.3056 1.0041 0.1238  -0.0413 0.0192  478 PHE A CE1 
3085 C  CE2 . PHE A 486 ? 1.3335 1.2841 0.9997 0.0491  -0.0206 -0.0150 478 PHE A CE2 
3086 C  CZ  . PHE A 486 ? 1.3702 1.2556 0.9986 0.0750  -0.0276 0.0075  478 PHE A CZ  
3087 N  N   . VAL A 487 ? 1.5023 1.8995 1.1089 0.2569  -0.0739 -0.0510 479 VAL A N   
3088 C  CA  . VAL A 487 ? 1.5089 2.0234 1.1120 0.3082  -0.0852 -0.0660 479 VAL A CA  
3089 C  C   . VAL A 487 ? 1.5899 2.0334 1.1475 0.3810  -0.1011 -0.0528 479 VAL A C   
3090 O  O   . VAL A 487 ? 1.6285 1.9410 1.1432 0.4023  -0.1092 -0.0276 479 VAL A O   
3091 C  CB  . VAL A 487 ? 1.5479 2.1715 1.1426 0.3326  -0.0958 -0.0740 479 VAL A CB  
3092 C  CG1 . VAL A 487 ? 1.5129 2.2406 1.1568 0.2633  -0.0823 -0.0993 479 VAL A CG1 
3093 C  CG2 . VAL A 487 ? 1.5834 2.1115 1.1289 0.3597  -0.1060 -0.0457 479 VAL A CG2 
3094 N  N   . PRO A 488 ? 1.5342 2.0653 1.0995 0.4177  -0.1058 -0.0715 480 PRO A N   
3095 C  CA  . PRO A 488 ? 1.5694 2.0431 1.0899 0.4956  -0.1235 -0.0674 480 PRO A CA  
3096 C  C   . PRO A 488 ? 1.6772 2.1342 1.1424 0.5727  -0.1477 -0.0550 480 PRO A C   
3097 O  O   . PRO A 488 ? 1.6768 2.2655 1.1486 0.5972  -0.1546 -0.0670 480 PRO A O   
3098 C  CB  . PRO A 488 ? 1.5439 2.1615 1.0948 0.5116  -0.1203 -0.0970 480 PRO A CB  
3099 C  CG  . PRO A 488 ? 1.5177 2.2146 1.1281 0.4213  -0.0967 -0.1076 480 PRO A CG  
3100 C  CD  . PRO A 488 ? 1.4932 2.1777 1.1103 0.3808  -0.0933 -0.0988 480 PRO A CD  
3101 N  N   . ALA A 489 ? 1.8124 2.1078 1.2208 0.6087  -0.1615 -0.0303 481 ALA A N   
3102 C  CA  . ALA A 489 ? 1.8960 2.1456 1.2395 0.6842  -0.1871 -0.0120 481 ALA A CA  
3103 C  C   . ALA A 489 ? 1.9852 2.1792 1.2817 0.7705  -0.2094 -0.0196 481 ALA A C   
3104 O  O   . ALA A 489 ? 1.9623 2.0992 1.2662 0.7615  -0.2043 -0.0304 481 ALA A O   
3105 C  CB  . ALA A 489 ? 1.9417 2.0405 1.2461 0.6547  -0.1877 0.0267  481 ALA A CB  
3106 N  N   . PRO A 490 ? 2.0166 2.2280 1.2619 0.8588  -0.2358 -0.0160 482 PRO A N   
3107 C  CA  . PRO A 490 ? 2.0827 2.2350 1.2769 0.9518  -0.2607 -0.0273 482 PRO A CA  
3108 C  C   . PRO A 490 ? 2.2029 2.1178 1.3261 0.9643  -0.2755 0.0027  482 PRO A C   
3109 O  O   . PRO A 490 ? 2.2299 2.0657 1.3292 1.0011  -0.2858 -0.0128 482 PRO A O   
3110 C  CB  . PRO A 490 ? 2.1435 2.4005 1.3067 1.0415  -0.2850 -0.0320 482 PRO A CB  
3111 C  CG  . PRO A 490 ? 2.1704 2.4438 1.3342 0.9982  -0.2794 -0.0033 482 PRO A CG  
3112 C  CD  . PRO A 490 ? 2.0455 2.3521 1.2805 0.8822  -0.2450 -0.0070 482 PRO A CD  
3113 N  N   . ASP A 491 ? 2.2825 2.0904 1.3717 0.9307  -0.2764 0.0437  483 ASP A N   
3114 C  CA  . ASP A 491 ? 2.3732 1.9579 1.3883 0.9374  -0.2918 0.0768  483 ASP A CA  
3115 C  C   . ASP A 491 ? 2.3405 1.8314 1.3782 0.8333  -0.2681 0.0992  483 ASP A C   
3116 O  O   . ASP A 491 ? 2.2359 1.8265 1.3459 0.7615  -0.2406 0.0873  483 ASP A O   
3117 C  CB  . ASP A 491 ? 2.4971 2.0145 1.4328 0.9966  -0.3182 0.1132  483 ASP A CB  
3118 C  CG  . ASP A 491 ? 2.5758 2.1882 1.5347 0.9504  -0.3044 0.1351  483 ASP A CG  
3119 O  OD1 . ASP A 491 ? 2.6246 2.4010 1.6040 0.9899  -0.3089 0.1191  483 ASP A OD1 
3120 O  OD2 . ASP A 491 ? 2.5704 2.1023 1.5279 0.8745  -0.2892 0.1656  483 ASP A OD2 
3121 N  N   . ARG A 492 ? 2.3814 1.6796 1.3536 0.8271  -0.2805 0.1312  484 ARG A N   
3122 C  CA  . ARG A 492 ? 2.3466 1.5478 1.3313 0.7342  -0.2614 0.1532  484 ARG A CA  
3123 C  C   . ARG A 492 ? 2.2622 1.5049 1.3164 0.6819  -0.2395 0.1212  484 ARG A C   
3124 O  O   . ARG A 492 ? 2.2630 1.4760 1.3118 0.7162  -0.2484 0.0949  484 ARG A O   
3125 C  CB  . ARG A 492 ? 2.3095 1.5712 1.3155 0.6759  -0.2438 0.1799  484 ARG A CB  
3126 C  CG  . ARG A 492 ? 2.4667 1.6688 1.3964 0.7127  -0.2635 0.2218  484 ARG A CG  
3127 C  CD  . ARG A 492 ? 2.4770 1.7371 1.4280 0.6468  -0.2437 0.2462  484 ARG A CD  
3128 N  NE  . ARG A 492 ? 2.6265 1.8873 1.5150 0.6902  -0.2612 0.2804  484 ARG A NE  
3129 C  CZ  . ARG A 492 ? 2.8410 1.9532 1.6455 0.6925  -0.2760 0.3301  484 ARG A CZ  
3130 N  NH1 . ARG A 492 ? 2.8433 1.9685 1.5904 0.7351  -0.2923 0.3625  484 ARG A NH1 
3131 N  NH2 . ARG A 492 ? 2.7535 1.7056 1.5289 0.6495  -0.2751 0.3486  484 ARG A NH2 
3132 N  N   . LYS A 493 ? 2.1750 1.4863 1.2910 0.6021  -0.2119 0.1230  485 LYS A N   
3133 C  CA  . LYS A 493 ? 2.0752 1.4234 1.2550 0.5484  -0.1909 0.0985  485 LYS A CA  
3134 C  C   . LYS A 493 ? 2.0495 1.5461 1.2778 0.5775  -0.1860 0.0599  485 LYS A C   
3135 O  O   . LYS A 493 ? 2.0037 1.5200 1.2681 0.5558  -0.1756 0.0382  485 LYS A O   
3136 C  CB  . LYS A 493 ? 2.0108 1.3936 1.2391 0.4639  -0.1654 0.1101  485 LYS A CB  
3137 C  CG  . LYS A 493 ? 2.0357 1.2863 1.2437 0.4097  -0.1610 0.1350  485 LYS A CG  
3138 C  CD  . LYS A 493 ? 2.2395 1.3648 1.3664 0.4327  -0.1806 0.1717  485 LYS A CD  
3139 C  CE  . LYS A 493 ? 2.3241 1.3560 1.4395 0.3621  -0.1708 0.1998  485 LYS A CE  
3140 N  NZ  . LYS A 493 ? 2.3099 1.4362 1.4694 0.3089  -0.1483 0.2075  485 LYS A NZ  
3141 N  N   . GLY A 494 ? 2.0349 1.6434 1.2626 0.6246  -0.1936 0.0526  486 GLY A N   
3142 C  CA  . GLY A 494 ? 1.9851 1.7556 1.2594 0.6471  -0.1882 0.0171  486 GLY A CA  
3143 C  C   . GLY A 494 ? 1.9383 1.8432 1.2795 0.5825  -0.1645 0.0099  486 GLY A C   
3144 O  O   . GLY A 494 ? 1.8934 1.9420 1.2796 0.5810  -0.1561 -0.0171 486 GLY A O   
3145 N  N   . PHE A 495 ? 1.8371 1.6954 1.1828 0.5271  -0.1540 0.0329  487 PHE A N   
3146 C  CA  . PHE A 495 ? 1.7734 1.7402 1.1758 0.4667  -0.1339 0.0241  487 PHE A CA  
3147 C  C   . PHE A 495 ? 1.8137 1.7544 1.1962 0.4469  -0.1336 0.0484  487 PHE A C   
3148 O  O   . PHE A 495 ? 1.8589 1.6847 1.1858 0.4663  -0.1455 0.0777  487 PHE A O   
3149 C  CB  . PHE A 495 ? 1.7227 1.6728 1.1749 0.3965  -0.1124 0.0155  487 PHE A CB  
3150 C  CG  . PHE A 495 ? 1.7348 1.5506 1.1732 0.3555  -0.1067 0.0389  487 PHE A CG  
3151 C  CD1 . PHE A 495 ? 1.7641 1.4589 1.1706 0.3687  -0.1147 0.0482  487 PHE A CD1 
3152 C  CD2 . PHE A 495 ? 1.7402 1.5593 1.1984 0.3028  -0.0935 0.0478  487 PHE A CD2 
3153 C  CE1 . PHE A 495 ? 1.7798 1.3664 1.1766 0.3260  -0.1092 0.0681  487 PHE A CE1 
3154 C  CE2 . PHE A 495 ? 1.7404 1.4555 1.1888 0.2658  -0.0876 0.0671  487 PHE A CE2 
3155 C  CZ  . PHE A 495 ? 1.7436 1.3458 1.1625 0.2752  -0.0951 0.0782  487 PHE A CZ  
3156 N  N   . ARG A 496 ? 1.7298 1.7784 1.1553 0.4058  -0.1203 0.0355  488 ARG A N   
3157 C  CA  . ARG A 496 ? 1.7374 1.7807 1.1520 0.3795  -0.1166 0.0523  488 ARG A CA  
3158 C  C   . ARG A 496 ? 1.7002 1.7794 1.1720 0.3034  -0.0940 0.0359  488 ARG A C   
3159 O  O   . ARG A 496 ? 1.6626 1.8066 1.1823 0.2762  -0.0838 0.0099  488 ARG A O   
3160 C  CB  . ARG A 496 ? 1.7549 1.9070 1.1517 0.4228  -0.1297 0.0492  488 ARG A CB  
3161 C  CG  . ARG A 496 ? 1.8846 2.0158 1.2245 0.5099  -0.1553 0.0611  488 ARG A CG  
3162 C  CD  . ARG A 496 ? 1.9893 1.9610 1.2569 0.5323  -0.1684 0.1035  488 ARG A CD  
3163 N  NE  . ARG A 496 ? 2.0626 1.9785 1.2720 0.6166  -0.1946 0.1122  488 ARG A NE  
3164 C  CZ  . ARG A 496 ? 2.1811 1.9541 1.3141 0.6506  -0.2128 0.1496  488 ARG A CZ  
3165 N  NH1 . ARG A 496 ? 2.0900 1.7751 1.1982 0.6022  -0.2054 0.1838  488 ARG A NH1 
3166 N  NH2 . ARG A 496 ? 2.1142 1.8323 1.1929 0.7328  -0.2390 0.1523  488 ARG A NH2 
3167 N  N   . LEU A 497 ? 1.6228 1.6586 1.0859 0.2701  -0.0869 0.0513  489 LEU A N   
3168 C  CA  . LEU A 497 ? 1.5604 1.6253 1.0717 0.2065  -0.0681 0.0332  489 LEU A CA  
3169 C  C   . LEU A 497 ? 1.5817 1.7538 1.1021 0.1978  -0.0673 0.0181  489 LEU A C   
3170 O  O   . LEU A 497 ? 1.6132 1.7824 1.0958 0.2143  -0.0734 0.0375  489 LEU A O   
3171 C  CB  . LEU A 497 ? 1.5466 1.5051 1.0484 0.1733  -0.0593 0.0532  489 LEU A CB  
3172 C  CG  . LEU A 497 ? 1.5086 1.4928 1.0501 0.1186  -0.0426 0.0354  489 LEU A CG  
3173 C  CD1 . LEU A 497 ? 1.4510 1.4674 1.0457 0.0874  -0.0332 0.0052  489 LEU A CD1 
3174 C  CD2 . LEU A 497 ? 1.5033 1.3977 1.0313 0.0944  -0.0356 0.0565  489 LEU A CD2 
3175 N  N   . LEU A 498 ? 1.4842 1.7513 1.0519 0.1692  -0.0602 -0.0160 490 LEU A N   
3176 C  CA  . LEU A 498 ? 1.4728 1.8488 1.0529 0.1558  -0.0602 -0.0379 490 LEU A CA  
3177 C  C   . LEU A 498 ? 1.4718 1.8276 1.0749 0.1020  -0.0462 -0.0520 490 LEU A C   
3178 O  O   . LEU A 498 ? 1.4391 1.7687 1.0799 0.0596  -0.0350 -0.0703 490 LEU A O   
3179 C  CB  . LEU A 498 ? 1.4535 1.9503 1.0700 0.1483  -0.0614 -0.0705 490 LEU A CB  
3180 C  CG  . LEU A 498 ? 1.5061 2.0584 1.1055 0.2067  -0.0757 -0.0655 490 LEU A CG  
3181 C  CD1 . LEU A 498 ? 1.4865 2.1961 1.1219 0.1936  -0.0767 -0.1004 490 LEU A CD1 
3182 C  CD2 . LEU A 498 ? 1.5572 2.0880 1.0973 0.2723  -0.0932 -0.0365 490 LEU A CD2 
3183 N  N   . LEU A 499 ? 1.4980 1.8667 1.0746 0.1072  -0.0477 -0.0433 491 LEU A N   
3184 C  CA  . LEU A 499 ? 1.4663 1.8320 1.0609 0.0646  -0.0357 -0.0612 491 LEU A CA  
3185 C  C   . LEU A 499 ? 1.4980 1.9794 1.0941 0.0602  -0.0393 -0.0880 491 LEU A C   
3186 O  O   . LEU A 499 ? 1.5252 2.0633 1.0859 0.0978  -0.0510 -0.0728 491 LEU A O   
3187 C  CB  . LEU A 499 ? 1.4807 1.7603 1.0430 0.0665  -0.0311 -0.0282 491 LEU A CB  
3188 C  CG  . LEU A 499 ? 1.4887 1.6566 1.0596 0.0521  -0.0237 -0.0124 491 LEU A CG  
3189 C  CD1 . LEU A 499 ? 1.5067 1.6099 1.0392 0.0536  -0.0211 0.0230  491 LEU A CD1 
3190 C  CD2 . LEU A 499 ? 1.4396 1.5998 1.0602 0.0095  -0.0116 -0.0459 491 LEU A CD2 
3191 N  N   . ALA A 500 ? 1.4673 1.9802 1.1009 0.0159  -0.0311 -0.1289 492 ALA A N   
3192 C  CA  . ALA A 500 ? 1.4656 2.0837 1.1015 0.0054  -0.0342 -0.1613 492 ALA A CA  
3193 C  C   . ALA A 500 ? 1.5155 2.1353 1.1119 0.0226  -0.0334 -0.1413 492 ALA A C   
3194 O  O   . ALA A 500 ? 1.5159 2.0520 1.1012 0.0180  -0.0248 -0.1190 492 ALA A O   
3195 C  CB  . ALA A 500 ? 1.4442 2.0677 1.1228 -0.0472 -0.0265 -0.2103 492 ALA A CB  
3196 N  N   . SER A 501 ? 1.6728 1.8680 1.4646 -0.0664 -0.0972 -0.1495 493 SER A N   
3197 C  CA  . SER A 501 ? 1.6938 1.9102 1.4441 -0.0767 -0.1070 -0.1437 493 SER A CA  
3198 C  C   . SER A 501 ? 1.7646 2.0342 1.5151 -0.0895 -0.1166 -0.1661 493 SER A C   
3199 O  O   . SER A 501 ? 1.7652 2.0593 1.5253 -0.0861 -0.1318 -0.1622 493 SER A O   
3200 C  CB  . SER A 501 ? 1.7462 1.9444 1.4642 -0.0674 -0.1244 -0.1079 493 SER A CB  
3201 O  OG  . SER A 501 ? 1.8366 2.0571 1.5120 -0.0822 -0.1366 -0.0967 493 SER A OG  
3202 N  N   . PRO A 502 ? 1.7441 2.0358 1.4828 -0.1025 -0.1091 -0.1909 494 PRO A N   
3203 C  CA  . PRO A 502 ? 1.7682 2.1107 1.5020 -0.1140 -0.1195 -0.2151 494 PRO A CA  
3204 C  C   . PRO A 502 ? 1.8545 2.2318 1.5511 -0.1199 -0.1385 -0.1927 494 PRO A C   
3205 O  O   . PRO A 502 ? 1.8527 2.2674 1.5519 -0.1248 -0.1532 -0.2009 494 PRO A O   
3206 C  CB  . PRO A 502 ? 1.7940 2.1469 1.5205 -0.1202 -0.1061 -0.2476 494 PRO A CB  
3207 C  CG  . PRO A 502 ? 1.8259 2.1302 1.5654 -0.1113 -0.0881 -0.2424 494 PRO A CG  
3208 C  CD  . PRO A 502 ? 1.7601 2.0366 1.4887 -0.1049 -0.0918 -0.2003 494 PRO A CD  
3209 N  N   . ARG A 503 ? 1.6660 2.4702 1.1923 -0.0606 -0.2332 -0.1867 495 ARG A N   
3210 C  CA  . ARG A 503 ? 1.7221 2.5362 1.1802 -0.0500 -0.2618 -0.1440 495 ARG A CA  
3211 C  C   . ARG A 503 ? 1.7904 2.6253 1.2556 -0.0087 -0.2926 -0.1197 495 ARG A C   
3212 O  O   . ARG A 503 ? 1.8289 2.7170 1.2603 -0.0031 -0.3216 -0.1025 495 ARG A O   
3213 C  CB  . ARG A 503 ? 1.7431 2.4666 1.1466 -0.0498 -0.2597 -0.1013 495 ARG A CB  
3214 C  CG  . ARG A 503 ? 1.8806 2.6030 1.2062 -0.0447 -0.2928 -0.0523 495 ARG A CG  
3215 C  CD  . ARG A 503 ? 2.0160 2.6593 1.2846 -0.0600 -0.2881 -0.0153 495 ARG A CD  
3216 N  NE  . ARG A 503 ? 2.0744 2.7436 1.3459 -0.1030 -0.2562 -0.0465 495 ARG A NE  
3217 C  CZ  . ARG A 503 ? 2.1703 2.9047 1.3995 -0.1366 -0.2570 -0.0519 495 ARG A CZ  
3218 N  NH1 . ARG A 503 ? 2.0265 2.7861 1.2651 -0.1703 -0.2254 -0.0852 495 ARG A NH1 
3219 N  NH2 . ARG A 503 ? 2.1073 2.8839 1.2848 -0.1360 -0.2900 -0.0247 495 ARG A NH2 
3220 N  N   . SER A 504 ? 1.7313 2.5276 1.2413 0.0203  -0.2865 -0.1190 496 SER A N   
3221 C  CA  . SER A 504 ? 1.7531 2.5758 1.2817 0.0643  -0.3116 -0.1026 496 SER A CA  
3222 C  C   . SER A 504 ? 1.7541 2.6934 1.3242 0.0557  -0.3208 -0.1347 496 SER A C   
3223 O  O   . SER A 504 ? 1.7835 2.7766 1.3458 0.0810  -0.3517 -0.1170 496 SER A O   
3224 C  CB  . SER A 504 ? 1.7619 2.5255 1.3321 0.0922  -0.2968 -0.1020 496 SER A CB  
3225 O  OG  . SER A 504 ? 1.8393 2.6430 1.4359 0.1363  -0.3175 -0.0934 496 SER A OG  
3226 N  N   . CYS A 505 ? 1.7116 2.6872 1.3250 0.0191  -0.2966 -0.1812 497 CYS A N   
3227 C  CA  . CYS A 505 ? 1.6864 2.7672 1.3393 0.0037  -0.3046 -0.2148 497 CYS A CA  
3228 C  C   . CYS A 505 ? 1.7226 2.8683 1.3295 -0.0173 -0.3243 -0.2156 497 CYS A C   
3229 O  O   . CYS A 505 ? 1.7281 2.9583 1.3446 -0.0115 -0.3486 -0.2170 497 CYS A O   
3230 C  CB  . CYS A 505 ? 1.6354 2.7221 1.3416 -0.0324 -0.2768 -0.2640 497 CYS A CB  
3231 S  SG  . CYS A 505 ? 1.6434 2.8508 1.3980 -0.0578 -0.2884 -0.3062 497 CYS A SG  
3232 N  N   . TYR A 506 ? 1.7169 2.8282 1.2737 -0.0432 -0.3137 -0.2143 498 TYR A N   
3233 C  CA  . TYR A 506 ? 1.7384 2.9112 1.2448 -0.0689 -0.3289 -0.2168 498 TYR A CA  
3234 C  C   . TYR A 506 ? 1.8194 3.0063 1.2759 -0.0419 -0.3678 -0.1657 498 TYR A C   
3235 O  O   . TYR A 506 ? 1.8426 3.1083 1.2780 -0.0534 -0.3915 -0.1667 498 TYR A O   
3236 C  CB  . TYR A 506 ? 1.7386 2.8748 1.2036 -0.1021 -0.3056 -0.2269 498 TYR A CB  
3237 C  CG  . TYR A 506 ? 1.7093 2.8832 1.2052 -0.1402 -0.2804 -0.2887 498 TYR A CG  
3238 C  CD1 . TYR A 506 ? 1.6683 2.7998 1.2225 -0.1446 -0.2541 -0.3211 498 TYR A CD1 
3239 C  CD2 . TYR A 506 ? 1.7386 2.9874 1.2029 -0.1718 -0.2853 -0.3154 498 TYR A CD2 
3240 C  CE1 . TYR A 506 ? 1.6454 2.8024 1.2272 -0.1770 -0.2358 -0.3783 498 TYR A CE1 
3241 C  CE2 . TYR A 506 ? 1.7183 2.9957 1.2088 -0.2033 -0.2644 -0.3759 498 TYR A CE2 
3242 C  CZ  . TYR A 506 ? 1.7093 2.9377 1.2594 -0.2045 -0.2409 -0.4071 498 TYR A CZ  
3243 O  OH  . TYR A 506 ? 1.6850 2.9328 1.2609 -0.2334 -0.2246 -0.4678 498 TYR A OH  
3244 N  N   . LYS A 507 ? 1.8033 2.9097 1.2392 -0.0065 -0.3771 -0.1209 499 LYS A N   
3245 C  CA  . LYS A 507 ? 1.8607 2.9617 1.2467 0.0230  -0.4184 -0.0692 499 LYS A CA  
3246 C  C   . LYS A 507 ? 1.9093 3.0903 1.3351 0.0531  -0.4470 -0.0698 499 LYS A C   
3247 O  O   . LYS A 507 ? 1.9513 3.1808 1.3418 0.0577  -0.4832 -0.0459 499 LYS A O   
3248 C  CB  . LYS A 507 ? 1.8971 2.8847 1.2577 0.0577  -0.4233 -0.0257 499 LYS A CB  
3249 C  CG  . LYS A 507 ? 2.0053 2.9689 1.3070 0.0882  -0.4705 0.0302  499 LYS A CG  
3250 C  CD  . LYS A 507 ? 2.1274 2.9667 1.3955 0.1176  -0.4764 0.0712  499 LYS A CD  
3251 C  CE  . LYS A 507 ? 2.3067 3.1120 1.5092 0.1447  -0.5288 0.1279  499 LYS A CE  
3252 N  NZ  . LYS A 507 ? 2.4142 3.0888 1.5755 0.1707  -0.5387 0.1686  499 LYS A NZ  
3253 N  N   . LEU A 508 ? 1.8574 3.0564 1.3567 0.0714  -0.4316 -0.0961 500 LEU A N   
3254 C  CA  . LEU A 508 ? 1.8566 3.1445 1.4039 0.0977  -0.4546 -0.1008 500 LEU A CA  
3255 C  C   . LEU A 508 ? 1.8553 3.2509 1.4042 0.0587  -0.4648 -0.1278 500 LEU A C   
3256 O  O   . LEU A 508 ? 1.8792 3.3435 1.4197 0.0729  -0.5008 -0.1098 500 LEU A O   
3257 C  CB  . LEU A 508 ? 1.8139 3.1070 1.4390 0.1142  -0.4309 -0.1272 500 LEU A CB  
3258 C  CG  . LEU A 508 ? 1.8477 3.2467 1.5316 0.1378  -0.4503 -0.1359 500 LEU A CG  
3259 C  CD1 . LEU A 508 ? 1.9109 3.3051 1.5837 0.2003  -0.4862 -0.0931 500 LEU A CD1 
3260 C  CD2 . LEU A 508 ? 1.8090 3.2271 1.5673 0.1328  -0.4210 -0.1698 500 LEU A CD2 
3261 N  N   . PHE A 509 ? 1.7582 3.1653 1.3171 0.0103  -0.4348 -0.1717 501 PHE A N   
3262 C  CA  . PHE A 509 ? 1.7655 3.2673 1.3254 -0.0306 -0.4411 -0.2054 501 PHE A CA  
3263 C  C   . PHE A 509 ? 1.8445 3.3735 1.3288 -0.0466 -0.4676 -0.1816 501 PHE A C   
3264 O  O   . PHE A 509 ? 1.8645 3.4828 1.3441 -0.0590 -0.4932 -0.1862 501 PHE A O   
3265 C  CB  . PHE A 509 ? 1.7218 3.2108 1.3025 -0.0755 -0.4039 -0.2588 501 PHE A CB  
3266 C  CG  . PHE A 509 ? 1.6705 3.1808 1.3292 -0.0782 -0.3891 -0.2923 501 PHE A CG  
3267 C  CD1 . PHE A 509 ? 1.6727 3.1463 1.3749 -0.0409 -0.3833 -0.2747 501 PHE A CD1 
3268 C  CD2 . PHE A 509 ? 1.6553 3.2206 1.3402 -0.1205 -0.3822 -0.3417 501 PHE A CD2 
3269 C  CE1 . PHE A 509 ? 1.6373 3.1360 1.4080 -0.0490 -0.3702 -0.3032 501 PHE A CE1 
3270 C  CE2 . PHE A 509 ? 1.6354 3.2179 1.3880 -0.1288 -0.3721 -0.3690 501 PHE A CE2 
3271 C  CZ  . PHE A 509 ? 1.6053 3.1577 1.4010 -0.0946 -0.3657 -0.3485 501 PHE A CZ  
3272 N  N   . GLN A 510 ? 1.9831 3.4375 1.4065 -0.0497 -0.4625 -0.1545 502 GLN A N   
3273 C  CA  . GLN A 510 ? 2.0350 3.5099 1.3795 -0.0684 -0.4883 -0.1259 502 GLN A CA  
3274 C  C   . GLN A 510 ? 2.1272 3.6113 1.4551 -0.0277 -0.5357 -0.0730 502 GLN A C   
3275 O  O   . GLN A 510 ? 2.1737 3.6869 1.4723 -0.0413 -0.5576 -0.0550 502 GLN A O   
3276 C  CB  . GLN A 510 ? 1.8837 3.2768 1.1690 -0.0856 -0.4697 -0.1082 502 GLN A CB  
3277 C  CG  . GLN A 510 ? 1.9650 3.3600 1.1768 -0.1132 -0.4849 -0.0788 502 GLN A CG  
3278 C  CD  . GLN A 510 ? 1.9766 3.4382 1.1923 -0.1581 -0.4669 -0.1220 502 GLN A CD  
3279 O  OE1 . GLN A 510 ? 2.0299 3.5370 1.2311 -0.1659 -0.4902 -0.1100 502 GLN A OE1 
3280 N  NE2 . GLN A 510 ? 1.9317 3.3955 1.1670 -0.1864 -0.4265 -0.1731 502 GLN A NE2 
3281 N  N   . GLU A 511 ? 1.9778 3.4092 1.3358 0.0239  -0.5434 -0.0482 503 GLU A N   
3282 C  CA  . GLU A 511 ? 2.0336 3.4682 1.3819 0.0726  -0.5906 -0.0009 503 GLU A CA  
3283 C  C   . GLU A 511 ? 2.0603 3.6060 1.4633 0.0837  -0.6116 -0.0163 503 GLU A C   
3284 O  O   . GLU A 511 ? 2.1094 3.6710 1.5009 0.1047  -0.6491 0.0174  503 GLU A O   
3285 C  CB  . GLU A 511 ? 2.0501 3.3915 1.4206 0.1274  -0.5879 0.0223  503 GLU A CB  
3286 N  N   . GLN A 512 ? 1.9282 3.5328 1.3963 0.0667  -0.5837 -0.0660 504 GLN A N   
3287 C  CA  . GLN A 512 ? 1.9191 3.6255 1.4455 0.0692  -0.5970 -0.0831 504 GLN A CA  
3288 C  C   . GLN A 512 ? 1.9820 3.7336 1.4834 0.0162  -0.5969 -0.0985 504 GLN A C   
3289 O  O   . GLN A 512 ? 2.0046 3.8270 1.5313 0.0169  -0.6181 -0.0958 504 GLN A O   
3290 C  CB  . GLN A 512 ? 1.8590 3.6033 1.4640 0.0681  -0.5685 -0.1268 504 GLN A CB  
3291 C  CG  . GLN A 512 ? 1.9679 3.6567 1.6158 0.1236  -0.5598 -0.1112 504 GLN A CG  
3292 C  CD  . GLN A 512 ? 2.1428 3.8778 1.8111 0.1827  -0.6010 -0.0768 504 GLN A CD  
3293 O  OE1 . GLN A 512 ? 2.1151 3.9484 1.8017 0.1795  -0.6279 -0.0762 504 GLN A OE1 
3294 N  NE2 . GLN A 512 ? 2.1194 3.7759 1.7859 0.2375  -0.6050 -0.0485 504 GLN A NE2 
3295 N  N   . GLN A 513 ? 1.9297 3.6417 1.3822 -0.0286 -0.5723 -0.1155 505 GLN A N   
3296 C  CA  . GLN A 513 ? 1.9568 3.7028 1.3761 -0.0768 -0.5702 -0.1299 505 GLN A CA  
3297 C  C   . GLN A 513 ? 2.0527 3.7881 1.4154 -0.0672 -0.6088 -0.0777 505 GLN A C   
3298 O  O   . GLN A 513 ? 2.0937 3.8831 1.4486 -0.0866 -0.6263 -0.0764 505 GLN A O   
3299 C  CB  . GLN A 513 ? 1.9432 3.6492 1.3284 -0.1211 -0.5314 -0.1631 505 GLN A CB  
3300 C  CG  . GLN A 513 ? 1.9826 3.7308 1.3449 -0.1704 -0.5214 -0.1920 505 GLN A CG  
3301 C  CD  . GLN A 513 ? 1.9921 3.7029 1.3261 -0.2069 -0.4819 -0.2266 505 GLN A CD  
3302 O  OE1 . GLN A 513 ? 1.9339 3.6586 1.3026 -0.2303 -0.4540 -0.2796 505 GLN A OE1 
3303 N  NE2 . GLN A 513 ? 2.0111 3.6725 1.2833 -0.2117 -0.4804 -0.1963 505 GLN A NE2 
3304 N  N   . ASN A 514 ? 2.0677 3.7270 1.3890 -0.0384 -0.6239 -0.0336 506 ASN A N   
3305 C  CA  . ASN A 514 ? 2.1498 3.7803 1.4166 -0.0254 -0.6660 0.0212  506 ASN A CA  
3306 C  C   . ASN A 514 ? 2.2152 3.8884 1.5259 0.0226  -0.7068 0.0448  506 ASN A C   
3307 O  O   . ASN A 514 ? 2.2808 3.9582 1.5614 0.0278  -0.7458 0.0804  506 ASN A O   
3308 C  CB  . ASN A 514 ? 2.1811 3.7054 1.3914 -0.0094 -0.6713 0.0616  506 ASN A CB  
3309 C  CG  . ASN A 514 ? 2.3262 3.8129 1.4930 -0.0572 -0.6315 0.0418  506 ASN A CG  
3310 O  OD1 . ASN A 514 ? 2.2486 3.7849 1.4338 -0.0964 -0.5975 -0.0075 506 ASN A OD1 
3311 N  ND2 . ASN A 514 ? 2.2963 3.6929 1.4068 -0.0536 -0.6361 0.0797  506 ASN A ND2 
3312 N  N   . GLU A 515 ? 2.1160 3.8235 1.5006 0.0571  -0.6972 0.0238  507 GLU A N   
3313 C  CA  . GLU A 515 ? 2.1303 3.8889 1.5700 0.1070  -0.7296 0.0402  507 GLU A CA  
3314 C  C   . GLU A 515 ? 2.1498 4.0138 1.6292 0.0800  -0.7337 0.0158  507 GLU A C   
3315 O  O   . GLU A 515 ? 2.1558 4.0781 1.6846 0.1146  -0.7597 0.0270  507 GLU A O   
3316 C  CB  . GLU A 515 ? 2.0899 3.8487 1.5946 0.1544  -0.7144 0.0261  507 GLU A CB  
3317 N  N   . GLY A 516 ? 2.1461 4.0332 1.6045 0.0193  -0.7077 -0.0182 508 GLY A N   
3318 C  CA  . GLY A 516 ? 2.1461 4.1218 1.6306 -0.0128 -0.7113 -0.0413 508 GLY A CA  
3319 C  C   . GLY A 516 ? 2.1098 4.1435 1.6658 -0.0277 -0.6804 -0.0913 508 GLY A C   
3320 O  O   . GLY A 516 ? 2.1001 4.1944 1.6712 -0.0661 -0.6753 -0.1186 508 GLY A O   
3321 N  N   . HIS A 517 ? 1.9593 3.9700 1.5567 0.0007  -0.6610 -0.1026 509 HIS A N   
3322 C  CA  . HIS A 517 ? 1.8867 3.9445 1.5528 -0.0141 -0.6332 -0.1469 509 HIS A CA  
3323 C  C   . HIS A 517 ? 1.8470 3.8595 1.4948 -0.0609 -0.5929 -0.1903 509 HIS A C   
3324 O  O   . HIS A 517 ? 1.7809 3.7843 1.4724 -0.0620 -0.5676 -0.2188 509 HIS A O   
3325 C  CB  . HIS A 517 ? 1.8363 3.9001 1.5622 0.0403  -0.6333 -0.1383 509 HIS A CB  
3326 N  N   . GLY A 518 ? 1.9297 3.9145 1.5145 -0.0992 -0.5873 -0.1958 510 GLY A N   
3327 C  CA  . GLY A 518 ? 1.9045 3.8468 1.4705 -0.1409 -0.5497 -0.2384 510 GLY A CA  
3328 C  C   . GLY A 518 ? 1.9274 3.9144 1.5287 -0.1833 -0.5333 -0.2873 510 GLY A C   
3329 O  O   . GLY A 518 ? 1.9118 3.8659 1.4991 -0.2188 -0.5046 -0.3271 510 GLY A O   
3330 N  N   . GLU A 519 ? 1.8556 3.9152 1.5029 -0.1787 -0.5524 -0.2839 511 GLU A N   
3331 C  CA  . GLU A 519 ? 1.8476 3.9473 1.5289 -0.2191 -0.5414 -0.3253 511 GLU A CA  
3332 C  C   . GLU A 519 ? 1.8425 3.9543 1.5965 -0.2108 -0.5286 -0.3429 511 GLU A C   
3333 O  O   . GLU A 519 ? 1.8283 3.9676 1.6162 -0.2432 -0.5212 -0.3732 511 GLU A O   
3334 C  CB  . GLU A 519 ? 1.9077 4.0831 1.5878 -0.2295 -0.5707 -0.3105 511 GLU A CB  
3335 C  CG  . GLU A 519 ? 2.0571 4.2253 1.6653 -0.2539 -0.5799 -0.3037 511 GLU A CG  
3336 C  CD  . GLU A 519 ? 2.1782 4.3203 1.7605 -0.3037 -0.5522 -0.3537 511 GLU A CD  
3337 O  OE1 . GLU A 519 ? 1.9524 4.0957 1.5762 -0.3244 -0.5355 -0.3921 511 GLU A OE1 
3338 O  OE2 . GLU A 519 ? 2.1785 4.2972 1.6987 -0.3217 -0.5477 -0.3544 511 GLU A OE2 
3339 N  N   . ALA A 520 ? 1.8459 3.9339 1.6206 -0.1686 -0.5269 -0.3223 512 ALA A N   
3340 C  CA  . ALA A 520 ? 1.8036 3.9046 1.6463 -0.1580 -0.5144 -0.3348 512 ALA A CA  
3341 C  C   . ALA A 520 ? 1.8155 3.8658 1.6699 -0.2004 -0.4831 -0.3819 512 ALA A C   
3342 O  O   . ALA A 520 ? 1.8095 3.7886 1.6248 -0.2122 -0.4648 -0.3978 512 ALA A O   
3343 C  CB  . ALA A 520 ? 1.7932 3.8677 1.6454 -0.1034 -0.5176 -0.3053 512 ALA A CB  
3344 N  N   . LEU A 521 ? 1.9243 4.0094 1.8325 -0.2232 -0.4778 -0.4024 513 LEU A N   
3345 C  CA  . LEU A 521 ? 1.9078 3.9390 1.8304 -0.2642 -0.4531 -0.4449 513 LEU A CA  
3346 C  C   . LEU A 521 ? 1.9031 3.9072 1.8739 -0.2510 -0.4372 -0.4473 513 LEU A C   
3347 O  O   . LEU A 521 ? 1.8872 3.9490 1.9080 -0.2343 -0.4439 -0.4309 513 LEU A O   
3348 C  CB  . LEU A 521 ? 1.9264 3.9978 1.8682 -0.3070 -0.4593 -0.4660 513 LEU A CB  
3349 N  N   . LEU A 522 ? 2.0298 3.9484 1.9860 -0.2589 -0.4155 -0.4679 514 LEU A N   
3350 C  CA  . LEU A 522 ? 1.9887 3.8711 1.9867 -0.2528 -0.3995 -0.4726 514 LEU A CA  
3351 C  C   . LEU A 522 ? 1.9956 3.8750 2.0376 -0.2954 -0.3917 -0.4982 514 LEU A C   
3352 O  O   . LEU A 522 ? 2.0333 3.9318 2.0688 -0.3280 -0.3991 -0.5137 514 LEU A O   
3353 C  CB  . LEU A 522 ? 1.5430 3.3313 1.5099 -0.2495 -0.3803 -0.4853 514 LEU A CB  
3354 N  N   . PHE A 523 ? 2.0122 3.8641 2.0952 -0.2962 -0.3785 -0.5001 515 PHE A N   
3355 C  CA  . PHE A 523 ? 2.0341 3.8649 2.1542 -0.3388 -0.3711 -0.5196 515 PHE A CA  
3356 C  C   . PHE A 523 ? 2.0889 4.0114 2.2374 -0.3528 -0.3871 -0.5082 515 PHE A C   
3357 O  O   . PHE A 523 ? 2.1166 4.0262 2.2760 -0.3956 -0.3892 -0.5249 515 PHE A O   
3358 C  CB  . PHE A 523 ? 2.0659 3.8099 2.1585 -0.3767 -0.3630 -0.5561 515 PHE A CB  
3359 C  CG  . PHE A 523 ? 2.0250 3.6716 2.1034 -0.3708 -0.3436 -0.5711 515 PHE A CG  
3360 C  CD1 . PHE A 523 ? 2.0035 3.5625 2.0958 -0.4016 -0.3321 -0.5966 515 PHE A CD1 
3361 C  CD2 . PHE A 523 ? 1.9963 3.6349 2.0458 -0.3341 -0.3390 -0.5572 515 PHE A CD2 
3362 C  CE1 . PHE A 523 ? 1.9904 3.4607 2.0733 -0.3951 -0.3145 -0.6096 515 PHE A CE1 
3363 C  CE2 . PHE A 523 ? 1.9708 3.5223 2.0071 -0.3307 -0.3211 -0.5702 515 PHE A CE2 
3364 C  CZ  . PHE A 523 ? 1.9620 3.4316 2.0178 -0.3608 -0.3077 -0.5974 515 PHE A CZ  
3365 N  N   . GLU A 524 ? 2.1480 4.1602 2.3073 -0.3149 -0.4002 -0.4786 516 GLU A N   
3366 C  CA  . GLU A 524 ? 2.2008 4.3098 2.3881 -0.3230 -0.4157 -0.4652 516 GLU A CA  
3367 C  C   . GLU A 524 ? 2.1904 4.3355 2.4348 -0.3297 -0.4068 -0.4570 516 GLU A C   
3368 O  O   . GLU A 524 ? 2.1504 4.2765 2.4153 -0.3059 -0.3929 -0.4499 516 GLU A O   
3369 C  CB  . GLU A 524 ? 1.6439 3.8323 1.8214 -0.2763 -0.4351 -0.4358 516 GLU A CB  
3370 N  N   . GLY A 525 ? 2.2732 4.4708 2.5401 -0.3643 -0.4150 -0.4574 517 GLY A N   
3371 C  CA  . GLY A 525 ? 2.2717 4.5123 2.5886 -0.3774 -0.4069 -0.4479 517 GLY A CA  
3372 C  C   . GLY A 525 ? 2.2686 4.4131 2.5914 -0.4134 -0.3897 -0.4644 517 GLY A C   
3373 O  O   . GLY A 525 ? 2.2445 4.4047 2.6030 -0.4151 -0.3773 -0.4545 517 GLY A O   
3374 N  N   . ILE A 526 ? 2.3181 4.3617 2.6049 -0.4413 -0.3893 -0.4895 518 ILE A N   
3375 C  CA  . ILE A 526 ? 2.3242 4.2617 2.6136 -0.4732 -0.3766 -0.5052 518 ILE A CA  
3376 C  C   . ILE A 526 ? 2.3890 4.2888 2.6719 -0.5282 -0.3894 -0.5205 518 ILE A C   
3377 O  O   . ILE A 526 ? 2.4345 4.3469 2.6912 -0.5407 -0.4048 -0.5323 518 ILE A O   
3378 C  CB  . ILE A 526 ? 2.3089 4.1466 2.5652 -0.4571 -0.3655 -0.5233 518 ILE A CB  
3379 C  CG1 . ILE A 526 ? 2.2733 4.1487 2.5278 -0.4015 -0.3590 -0.5062 518 ILE A CG1 
3380 C  CG2 . ILE A 526 ? 2.2968 4.0257 2.5620 -0.4829 -0.3524 -0.5349 518 ILE A CG2 
3381 C  CD1 . ILE A 526 ? 2.2391 4.1521 2.5358 -0.3815 -0.3478 -0.4855 518 ILE A CD1 
3382 N  N   . LYS A 527 ? 2.4906 4.3421 2.7949 -0.5610 -0.3852 -0.5188 519 LYS A N   
3383 C  CA  . LYS A 527 ? 2.5593 4.3693 2.8591 -0.6127 -0.4019 -0.5291 519 LYS A CA  
3384 C  C   . LYS A 527 ? 2.6021 4.3082 2.8620 -0.6257 -0.4101 -0.5611 519 LYS A C   
3385 O  O   . LYS A 527 ? 2.6595 4.3742 2.8991 -0.6476 -0.4289 -0.5744 519 LYS A O   
3386 C  CB  . LYS A 527 ? 1.8424 3.6065 2.1689 -0.6421 -0.3970 -0.5178 519 LYS A CB  
3387 N  N   . LYS A 528 ? 2.4845 4.0947 2.7336 -0.6111 -0.3958 -0.5743 520 LYS A N   
3388 C  CA  . LYS A 528 ? 2.5254 4.0333 2.7404 -0.6194 -0.4005 -0.6067 520 LYS A CA  
3389 C  C   . LYS A 528 ? 2.4896 3.9758 2.6812 -0.5796 -0.3823 -0.6185 520 LYS A C   
3390 O  O   . LYS A 528 ? 2.4598 3.8726 2.6562 -0.5670 -0.3667 -0.6211 520 LYS A O   
3391 C  CB  . LYS A 528 ? 1.9526 3.3429 2.1772 -0.6474 -0.4051 -0.6136 520 LYS A CB  
3392 N  N   . LYS A 529 ? 2.5073 4.0570 2.6720 -0.5613 -0.3856 -0.6235 521 LYS A N   
3393 C  CA  . LYS A 529 ? 2.4739 4.0134 2.6114 -0.5249 -0.3709 -0.6308 521 LYS A CA  
3394 C  C   . LYS A 529 ? 2.5091 4.0929 2.6058 -0.5204 -0.3804 -0.6436 521 LYS A C   
3395 O  O   . LYS A 529 ? 2.5481 4.1961 2.6436 -0.5379 -0.3983 -0.6388 521 LYS A O   
3396 C  CB  . LYS A 529 ? 1.7024 3.3019 1.8594 -0.4880 -0.3603 -0.6007 521 LYS A CB  
3397 N  N   . LYS A 530 ? 2.1646 3.7148 2.2267 -0.4989 -0.3683 -0.6588 522 LYS A N   
3398 C  CA  . LYS A 530 ? 2.1954 3.7834 2.2130 -0.4951 -0.3749 -0.6701 522 LYS A CA  
3399 C  C   . LYS A 530 ? 2.1433 3.8043 2.1451 -0.4578 -0.3741 -0.6410 522 LYS A C   
3400 O  O   . LYS A 530 ? 2.0952 3.7343 2.0978 -0.4296 -0.3606 -0.6291 522 LYS A O   
3401 C  CB  . LYS A 530 ? 2.0053 3.5092 1.9895 -0.4994 -0.3629 -0.7085 522 LYS A CB  
3402 N  N   . GLN A 531 ? 2.0689 3.8124 2.0544 -0.4578 -0.3915 -0.6278 523 GLN A N   
3403 C  CA  . GLN A 531 ? 2.0501 3.8618 2.0176 -0.4219 -0.3979 -0.5958 523 GLN A CA  
3404 C  C   . GLN A 531 ? 2.0642 3.8366 1.9793 -0.4059 -0.3864 -0.6043 523 GLN A C   
3405 O  O   . GLN A 531 ? 2.0938 3.8328 1.9754 -0.4263 -0.3813 -0.6346 523 GLN A O   
3406 C  CB  . GLN A 531 ? 2.0897 3.9934 2.0522 -0.4291 -0.4217 -0.5797 523 GLN A CB  
3407 N  N   . GLN A 532 ? 1.9266 3.7038 1.8336 -0.3691 -0.3826 -0.5768 524 GLN A N   
3408 C  CA  . GLN A 532 ? 1.9240 3.6673 1.7786 -0.3538 -0.3725 -0.5769 524 GLN A CA  
3409 C  C   . GLN A 532 ? 1.9407 3.7416 1.7678 -0.3200 -0.3903 -0.5327 524 GLN A C   
3410 O  O   . GLN A 532 ? 1.9169 3.7449 1.7703 -0.2892 -0.3994 -0.5015 524 GLN A O   
3411 C  CB  . GLN A 532 ? 1.8990 3.5610 1.7612 -0.3438 -0.3497 -0.5872 524 GLN A CB  
3412 C  CG  . GLN A 532 ? 1.9685 3.5604 1.8611 -0.3727 -0.3345 -0.6267 524 GLN A CG  
3413 C  CD  . GLN A 532 ? 2.1019 3.6511 1.9609 -0.3933 -0.3231 -0.6658 524 GLN A CD  
3414 O  OE1 . GLN A 532 ? 2.1212 3.7113 1.9408 -0.3988 -0.3302 -0.6685 524 GLN A OE1 
3415 N  NE2 . GLN A 532 ? 2.0014 3.4684 1.8771 -0.4032 -0.3060 -0.6962 524 GLN A NE2 
3416 N  N   . LYS A 533 ? 1.7191 3.5360 1.4926 -0.3248 -0.3962 -0.5293 525 LYS A N   
3417 C  CA  . LYS A 533 ? 1.7418 3.6032 1.4824 -0.2957 -0.4171 -0.4842 525 LYS A CA  
3418 C  C   . LYS A 533 ? 1.7284 3.5374 1.4300 -0.2700 -0.4078 -0.4635 525 LYS A C   
3419 O  O   . LYS A 533 ? 1.7218 3.4700 1.4036 -0.2832 -0.3834 -0.4890 525 LYS A O   
3420 C  CB  . LYS A 533 ? 1.8130 3.7172 1.5116 -0.3170 -0.4308 -0.4851 525 LYS A CB  
3421 C  CG  . LYS A 533 ? 1.8344 3.8101 1.5657 -0.3308 -0.4520 -0.4836 525 LYS A CG  
3422 C  CD  . LYS A 533 ? 1.8962 3.8833 1.5987 -0.3717 -0.4524 -0.5149 525 LYS A CD  
3423 C  CE  . LYS A 533 ? 1.9561 3.9600 1.5934 -0.3723 -0.4616 -0.4975 525 LYS A CE  
3424 N  NZ  . LYS A 533 ? 2.0209 4.0460 1.6317 -0.4114 -0.4644 -0.5273 525 LYS A NZ  
3425 N  N   . ILE A 534 ? 1.7094 3.5399 1.4002 -0.2320 -0.4287 -0.4162 526 ILE A N   
3426 C  CA  . ILE A 534 ? 1.7073 3.4847 1.3546 -0.2065 -0.4256 -0.3881 526 ILE A CA  
3427 C  C   . ILE A 534 ? 1.7622 3.5181 1.3415 -0.2289 -0.4180 -0.3902 526 ILE A C   
3428 O  O   . ILE A 534 ? 1.7559 3.4535 1.3030 -0.2303 -0.3988 -0.3920 526 ILE A O   
3429 C  CB  . ILE A 534 ? 1.7391 3.5408 1.3846 -0.1584 -0.4559 -0.3338 526 ILE A CB  
3430 C  CG1 . ILE A 534 ? 1.7000 3.5129 1.4109 -0.1300 -0.4559 -0.3329 526 ILE A CG1 
3431 C  CG2 . ILE A 534 ? 1.7630 3.5055 1.3454 -0.1378 -0.4596 -0.2975 526 ILE A CG2 
3432 C  CD1 . ILE A 534 ? 1.7591 3.5866 1.4725 -0.0735 -0.4830 -0.2837 526 ILE A CD1 
3433 N  N   . LYS A 535 ? 1.7466 3.5533 1.3056 -0.2486 -0.4322 -0.3905 527 LYS A N   
3434 C  CA  . LYS A 535 ? 1.8060 3.6057 1.3016 -0.2729 -0.4259 -0.3929 527 LYS A CA  
3435 C  C   . LYS A 535 ? 1.7950 3.5510 1.2848 -0.3010 -0.3889 -0.4428 527 LYS A C   
3436 O  O   . LYS A 535 ? 1.8077 3.5258 1.2551 -0.3037 -0.3729 -0.4375 527 LYS A O   
3437 C  CB  . LYS A 535 ? 1.8657 3.7316 1.3490 -0.2933 -0.4466 -0.3926 527 LYS A CB  
3438 N  N   . ASN A 536 ? 1.8493 3.6090 1.3827 -0.3214 -0.3765 -0.4899 528 ASN A N   
3439 C  CA  . ASN A 536 ? 1.8343 3.5520 1.3669 -0.3450 -0.3449 -0.5409 528 ASN A CA  
3440 C  C   . ASN A 536 ? 1.8035 3.4545 1.3673 -0.3323 -0.3230 -0.5541 528 ASN A C   
3441 O  O   . ASN A 536 ? 1.7868 3.3954 1.3525 -0.3454 -0.2967 -0.5928 528 ASN A O   
3442 C  CB  . ASN A 536 ? 1.8438 3.5825 1.4032 -0.3734 -0.3450 -0.5852 528 ASN A CB  
3443 C  CG  . ASN A 536 ? 1.8528 3.6090 1.4712 -0.3695 -0.3608 -0.5825 528 ASN A CG  
3444 O  OD1 . ASN A 536 ? 1.7329 3.4609 1.3889 -0.3509 -0.3572 -0.5729 528 ASN A OD1 
3445 N  ND2 . ASN A 536 ? 1.8470 3.6529 1.4733 -0.3891 -0.3783 -0.5904 528 ASN A ND2 
3446 N  N   . ILE A 537 ? 1.8130 3.4557 1.4022 -0.3050 -0.3345 -0.5223 529 ILE A N   
3447 C  CA  . ILE A 537 ? 1.7563 3.3352 1.3684 -0.2917 -0.3164 -0.5274 529 ILE A CA  
3448 C  C   . ILE A 537 ? 1.7670 3.3114 1.3249 -0.2796 -0.3072 -0.5005 529 ILE A C   
3449 O  O   . ILE A 537 ? 1.7443 3.2339 1.3022 -0.2829 -0.2824 -0.5191 529 ILE A O   
3450 C  CB  . ILE A 537 ? 1.7055 3.2912 1.3635 -0.2667 -0.3318 -0.5038 529 ILE A CB  
3451 N  N   . LEU A 538 ? 1.7903 3.3648 1.3020 -0.2668 -0.3290 -0.4542 530 LEU A N   
3452 C  CA  . LEU A 538 ? 1.8099 3.3526 1.2617 -0.2602 -0.3251 -0.4201 530 LEU A CA  
3453 C  C   . LEU A 538 ? 1.8705 3.4204 1.2846 -0.2911 -0.3037 -0.4455 530 LEU A C   
3454 O  O   . LEU A 538 ? 1.8780 3.3967 1.2530 -0.2946 -0.2886 -0.4324 530 LEU A O   
3455 C  CB  . LEU A 538 ? 1.8477 3.4123 1.2628 -0.2367 -0.3602 -0.3590 530 LEU A CB  
3456 C  CG  . LEU A 538 ? 1.8621 3.4195 1.3079 -0.1963 -0.3828 -0.3266 530 LEU A CG  
3457 C  CD1 . LEU A 538 ? 1.9138 3.5027 1.3318 -0.1730 -0.4215 -0.2740 530 LEU A CD1 
3458 C  CD2 . LEU A 538 ? 1.8490 3.3246 1.2881 -0.1765 -0.3673 -0.3081 530 LEU A CD2 
3459 N  N   . SER A 539 ? 1.7662 3.3600 1.1922 -0.3139 -0.3026 -0.4815 531 SER A N   
3460 C  CA  . SER A 539 ? 1.8157 3.4263 1.2083 -0.3415 -0.2831 -0.5098 531 SER A CA  
3461 C  C   . SER A 539 ? 1.7886 3.3641 1.2158 -0.3523 -0.2497 -0.5686 531 SER A C   
3462 O  O   . SER A 539 ? 1.8264 3.4161 1.2362 -0.3716 -0.2302 -0.6018 531 SER A O   
3463 C  CB  . SER A 539 ? 1.8708 3.5440 1.2521 -0.3605 -0.3002 -0.5190 531 SER A CB  
3464 O  OG  . SER A 539 ? 1.8559 3.5349 1.2862 -0.3717 -0.2958 -0.5675 531 SER A OG  
3465 N  N   . ASN A 540 ? 1.7904 3.3202 1.2680 -0.3388 -0.2442 -0.5813 532 ASN A N   
3466 C  CA  . ASN A 540 ? 1.7584 3.2433 1.2739 -0.3457 -0.2166 -0.6333 532 ASN A CA  
3467 C  C   . ASN A 540 ? 1.7655 3.2093 1.2630 -0.3387 -0.1927 -0.6264 532 ASN A C   
3468 O  O   . ASN A 540 ? 1.7332 3.1394 1.2331 -0.3213 -0.1956 -0.5948 532 ASN A O   
3469 C  CB  . ASN A 540 ? 1.7115 3.1621 1.2907 -0.3391 -0.2228 -0.6488 532 ASN A CB  
3470 C  CG  . ASN A 540 ? 1.7794 3.1819 1.4007 -0.3494 -0.2014 -0.7046 532 ASN A CG  
3471 O  OD1 . ASN A 540 ? 1.7267 3.1301 1.3328 -0.3592 -0.1829 -0.7373 532 ASN A OD1 
3472 N  ND2 . ASN A 540 ? 1.6807 3.0411 1.3561 -0.3467 -0.2054 -0.7147 532 ASN A ND2 
3473 N  N   . LYS A 541 ? 1.7947 3.2494 1.2741 -0.3524 -0.1694 -0.6561 533 LYS A N   
3474 C  CA  . LYS A 541 ? 1.7854 3.2143 1.2471 -0.3495 -0.1452 -0.6503 533 LYS A CA  
3475 C  C   . LYS A 541 ? 1.7315 3.0960 1.2479 -0.3395 -0.1271 -0.6820 533 LYS A C   
3476 O  O   . LYS A 541 ? 1.7078 3.0397 1.2177 -0.3329 -0.1116 -0.6684 533 LYS A O   
3477 C  CB  . LYS A 541 ? 1.8422 3.3167 1.2725 -0.3675 -0.1254 -0.6743 533 LYS A CB  
3478 N  N   . THR A 542 ? 1.7598 3.1032 1.3292 -0.3406 -0.1308 -0.7216 534 THR A N   
3479 C  CA  . THR A 542 ? 1.7233 2.9989 1.3488 -0.3332 -0.1178 -0.7513 534 THR A CA  
3480 C  C   . THR A 542 ? 1.7311 2.9632 1.3748 -0.3200 -0.1299 -0.7154 534 THR A C   
3481 O  O   . THR A 542 ? 1.7080 2.8885 1.3665 -0.3117 -0.1166 -0.7116 534 THR A O   
3482 C  CB  . THR A 542 ? 1.7851 3.0436 1.4580 -0.3414 -0.1216 -0.8012 534 THR A CB  
3483 O  OG1 . THR A 542 ? 1.8482 3.1606 1.4939 -0.3545 -0.1203 -0.8269 534 THR A OG1 
3484 C  CG2 . THR A 542 ? 1.7377 2.9285 1.4602 -0.3349 -0.1036 -0.8386 534 THR A CG2 
3485 N  N   . LEU A 543 ? 1.6896 2.9470 1.3331 -0.3179 -0.1556 -0.6896 535 LEU A N   
3486 C  CA  . LEU A 543 ? 1.6629 2.8912 1.3262 -0.3039 -0.1694 -0.6576 535 LEU A CA  
3487 C  C   . LEU A 543 ? 1.6898 2.9009 1.3102 -0.2860 -0.1675 -0.6030 535 LEU A C   
3488 O  O   . LEU A 543 ? 1.6652 2.8083 1.3127 -0.2670 -0.1616 -0.5704 535 LEU A O   
3489 C  CB  . LEU A 543 ? 1.6721 2.9463 1.3482 -0.3035 -0.1971 -0.6424 535 LEU A CB  
3490 C  CG  . LEU A 543 ? 1.6747 2.9229 1.3933 -0.2900 -0.2089 -0.6201 535 LEU A CG  
3491 C  CD1 . LEU A 543 ? 1.6463 2.8464 1.4263 -0.3051 -0.2013 -0.6609 535 LEU A CD1 
3492 C  CD2 . LEU A 543 ? 1.7077 3.0232 1.4254 -0.2830 -0.2371 -0.5929 535 LEU A CD2 
3493 N  N   . ARG A 544 ? 1.7149 2.9755 1.2707 -0.2917 -0.1711 -0.5853 536 ARG A N   
3494 C  CA  . ARG A 544 ? 1.7249 2.9600 1.2358 -0.2759 -0.1727 -0.5218 536 ARG A CA  
3495 C  C   . ARG A 544 ? 1.7279 2.9049 1.2388 -0.2760 -0.1441 -0.5204 536 ARG A C   
3496 O  O   . ARG A 544 ? 1.7317 2.8541 1.2264 -0.2605 -0.1432 -0.4682 536 ARG A O   
3497 C  CB  . ARG A 544 ? 1.7731 3.0791 1.2135 -0.2877 -0.1888 -0.5007 536 ARG A CB  
3498 C  CG  . ARG A 544 ? 1.8708 3.1573 1.2632 -0.2695 -0.2092 -0.4274 536 ARG A CG  
3499 C  CD  . ARG A 544 ? 1.9692 3.3211 1.3204 -0.2734 -0.2389 -0.4031 536 ARG A CD  
3500 N  NE  . ARG A 544 ? 2.0464 3.3773 1.3578 -0.2504 -0.2683 -0.3356 536 ARG A NE  
3501 C  CZ  . ARG A 544 ? 2.1851 3.5539 1.4731 -0.2422 -0.3007 -0.3028 536 ARG A CZ  
3502 N  NH1 . ARG A 544 ? 2.0850 3.5155 1.3858 -0.2578 -0.3055 -0.3293 536 ARG A NH1 
3503 N  NH2 . ARG A 544 ? 2.1326 3.4715 1.3860 -0.2168 -0.3296 -0.2422 536 ARG A NH2 
3504 N  N   . GLU A 545 ? 1.8126 3.0011 1.3424 -0.2929 -0.1225 -0.5789 537 GLU A N   
3505 C  CA  . GLU A 545 ? 1.7870 2.9317 1.3249 -0.2933 -0.0948 -0.5842 537 GLU A CA  
3506 C  C   . GLU A 545 ? 1.7652 2.8204 1.3681 -0.2775 -0.0874 -0.5806 537 GLU A C   
3507 O  O   . GLU A 545 ? 1.7451 2.7422 1.3497 -0.2692 -0.0743 -0.5494 537 GLU A O   
3508 C  CB  . GLU A 545 ? 1.7962 2.9851 1.3399 -0.3104 -0.0739 -0.6481 537 GLU A CB  
3509 C  CG  . GLU A 545 ? 1.8865 3.0951 1.3926 -0.3187 -0.0512 -0.6373 537 GLU A CG  
3510 C  CD  . GLU A 545 ? 2.0290 3.2868 1.5495 -0.3286 -0.0300 -0.6888 537 GLU A CD  
3511 O  OE1 . GLU A 545 ? 2.0264 3.2730 1.5996 -0.3249 -0.0276 -0.7409 537 GLU A OE1 
3512 O  OE2 . GLU A 545 ? 1.9142 3.2213 1.3927 -0.3408 -0.0172 -0.6756 537 GLU A OE2 
3513 N  N   . HIS A 546 ? 1.6727 2.7182 1.3261 -0.2771 -0.0975 -0.6108 538 HIS A N   
3514 C  CA  . HIS A 546 ? 1.6371 2.6029 1.3520 -0.2679 -0.0931 -0.6105 538 HIS A CA  
3515 C  C   . HIS A 546 ? 1.6644 2.5821 1.3756 -0.2468 -0.1021 -0.5452 538 HIS A C   
3516 O  O   . HIS A 546 ? 1.6428 2.4865 1.3770 -0.2377 -0.0911 -0.5241 538 HIS A O   
3517 C  CB  . HIS A 546 ? 1.6325 2.6073 1.3961 -0.2793 -0.1053 -0.6579 538 HIS A CB  
3518 C  CG  . HIS A 546 ? 1.6661 2.6721 1.4370 -0.2974 -0.0986 -0.7278 538 HIS A CG  
3519 N  ND1 . HIS A 546 ? 1.6872 2.6868 1.5011 -0.3068 -0.1082 -0.7627 538 HIS A ND1 
3520 C  CD2 . HIS A 546 ? 1.6891 2.7162 1.4402 -0.2999 -0.0787 -0.7523 538 HIS A CD2 
3521 C  CE1 . HIS A 546 ? 1.6985 2.7045 1.5186 -0.3103 -0.0951 -0.8033 538 HIS A CE1 
3522 N  NE2 . HIS A 546 ? 1.6997 2.7273 1.4853 -0.3054 -0.0760 -0.7997 538 HIS A NE2 
3523 N  N   . ASN A 547 ? 1.5947 2.5547 1.2767 -0.2379 -0.1234 -0.5145 539 ASN A N   
3524 C  CA  . ASN A 547 ? 1.6002 2.5196 1.2749 -0.2126 -0.1344 -0.4557 539 ASN A CA  
3525 C  C   . ASN A 547 ? 1.6634 2.5470 1.2839 -0.2037 -0.1293 -0.4073 539 ASN A C   
3526 O  O   . ASN A 547 ? 1.6757 2.5058 1.2855 -0.1817 -0.1364 -0.3587 539 ASN A O   
3527 C  CB  . ASN A 547 ? 1.6104 2.5911 1.2747 -0.2026 -0.1614 -0.4403 539 ASN A CB  
3528 C  CG  . ASN A 547 ? 1.7341 2.7393 1.4567 -0.2104 -0.1687 -0.4752 539 ASN A CG  
3529 O  OD1 . ASN A 547 ? 1.7241 2.6770 1.4960 -0.2124 -0.1584 -0.4874 539 ASN A OD1 
3530 N  ND2 . ASN A 547 ? 1.6534 2.7394 1.3686 -0.2185 -0.1884 -0.4896 539 ASN A ND2 
3531 N  N   . SER A 548 ? 1.6657 2.5806 1.2504 -0.2223 -0.1176 -0.4219 540 SER A N   
3532 C  CA  . SER A 548 ? 1.6784 2.5626 1.2126 -0.2228 -0.1108 -0.3794 540 SER A CA  
3533 C  C   . SER A 548 ? 1.6619 2.4756 1.2317 -0.2245 -0.0865 -0.3856 540 SER A C   
3534 O  O   . SER A 548 ? 1.6701 2.4257 1.2153 -0.2186 -0.0836 -0.3401 540 SER A O   
3535 C  CB  . SER A 548 ? 1.7232 2.6834 1.2025 -0.2461 -0.1079 -0.3914 540 SER A CB  
3536 O  OG  . SER A 548 ? 1.7856 2.7208 1.2137 -0.2522 -0.1029 -0.3468 540 SER A OG  
3537 N  N   . PHE A 549 ? 1.6106 2.4269 1.2373 -0.2334 -0.0721 -0.4419 541 PHE A N   
3538 C  CA  . PHE A 549 ? 1.5689 2.3199 1.2387 -0.2347 -0.0521 -0.4529 541 PHE A CA  
3539 C  C   . PHE A 549 ? 1.5828 2.2535 1.2892 -0.2188 -0.0581 -0.4257 541 PHE A C   
3540 O  O   . PHE A 549 ? 1.5682 2.1693 1.2795 -0.2146 -0.0487 -0.3972 541 PHE A O   
3541 C  CB  . PHE A 549 ? 1.5515 2.3292 1.2692 -0.2479 -0.0394 -0.5242 541 PHE A CB  
3542 C  CG  . PHE A 549 ? 1.5182 2.2222 1.2952 -0.2464 -0.0269 -0.5389 541 PHE A CG  
3543 C  CD1 . PHE A 549 ? 1.5192 2.1922 1.2950 -0.2478 -0.0087 -0.5257 541 PHE A CD1 
3544 C  CD2 . PHE A 549 ? 1.5080 2.1760 1.3414 -0.2463 -0.0354 -0.5634 541 PHE A CD2 
3545 C  CE1 . PHE A 549 ? 1.4904 2.0957 1.3217 -0.2466 0.0000  -0.5372 541 PHE A CE1 
3546 C  CE2 . PHE A 549 ? 1.4951 2.0923 1.3807 -0.2475 -0.0275 -0.5739 541 PHE A CE2 
3547 C  CZ  . PHE A 549 ? 1.4657 2.0305 1.3512 -0.2462 -0.0102 -0.5610 541 PHE A CZ  
3548 N  N   . VAL A 550 ? 1.4929 2.1784 1.2241 -0.2122 -0.0735 -0.4350 542 VAL A N   
3549 C  CA  . VAL A 550 ? 1.4798 2.1040 1.2442 -0.1984 -0.0789 -0.4116 542 VAL A CA  
3550 C  C   . VAL A 550 ? 1.5286 2.1081 1.2485 -0.1770 -0.0858 -0.3483 542 VAL A C   
3551 O  O   . VAL A 550 ? 1.5146 2.0182 1.2476 -0.1688 -0.0800 -0.3232 542 VAL A O   
3552 C  CB  . VAL A 550 ? 1.5065 2.1748 1.3011 -0.1973 -0.0954 -0.4315 542 VAL A CB  
3553 C  CG1 . VAL A 550 ? 1.5013 2.1245 1.3154 -0.1790 -0.1019 -0.3975 542 VAL A CG1 
3554 C  CG2 . VAL A 550 ? 1.4805 2.1633 1.3259 -0.2203 -0.0915 -0.4916 542 VAL A CG2 
3555 N  N   . GLU A 551 ? 1.5196 2.1429 1.1841 -0.1690 -0.1004 -0.3227 543 GLU A N   
3556 C  CA  . GLU A 551 ? 1.5511 2.1290 1.1655 -0.1480 -0.1128 -0.2626 543 GLU A CA  
3557 C  C   . GLU A 551 ? 1.5514 2.0594 1.1439 -0.1559 -0.0983 -0.2366 543 GLU A C   
3558 O  O   . GLU A 551 ? 1.5581 1.9922 1.1312 -0.1400 -0.1034 -0.1935 543 GLU A O   
3559 C  CB  . GLU A 551 ? 1.6057 2.2439 1.1608 -0.1440 -0.1341 -0.2414 543 GLU A CB  
3560 C  CG  . GLU A 551 ? 1.7546 2.3410 1.2555 -0.1197 -0.1545 -0.1790 543 GLU A CG  
3561 C  CD  . GLU A 551 ? 1.9694 2.5723 1.3964 -0.1342 -0.1643 -0.1484 543 GLU A CD  
3562 O  OE1 . GLU A 551 ? 1.9333 2.5994 1.3521 -0.1624 -0.1527 -0.1780 543 GLU A OE1 
3563 O  OE2 . GLU A 551 ? 1.9779 2.5301 1.3529 -0.1184 -0.1847 -0.0951 543 GLU A OE2 
3564 N  N   . ARG A 552 ? 1.5167 2.0505 1.1130 -0.1802 -0.0803 -0.2648 544 ARG A N   
3565 C  CA  . ARG A 552 ? 1.5130 1.9962 1.0935 -0.1917 -0.0653 -0.2437 544 ARG A CA  
3566 C  C   . ARG A 552 ? 1.5131 1.9144 1.1441 -0.1877 -0.0539 -0.2443 544 ARG A C   
3567 O  O   . ARG A 552 ? 1.5211 1.8547 1.1329 -0.1885 -0.0499 -0.2070 544 ARG A O   
3568 C  CB  . ARG A 552 ? 1.5007 2.0482 1.0813 -0.2163 -0.0474 -0.2814 544 ARG A CB  
3569 C  CG  . ARG A 552 ? 1.5902 2.1119 1.1421 -0.2313 -0.0342 -0.2539 544 ARG A CG  
3570 C  CD  . ARG A 552 ? 1.6608 2.2734 1.1874 -0.2536 -0.0221 -0.2803 544 ARG A CD  
3571 N  NE  . ARG A 552 ? 1.7252 2.3278 1.2250 -0.2713 -0.0088 -0.2535 544 ARG A NE  
3572 C  CZ  . ARG A 552 ? 1.8751 2.5558 1.3391 -0.2938 0.0018  -0.2614 544 ARG A CZ  
3573 N  NH1 . ARG A 552 ? 1.8309 2.6009 1.2785 -0.3005 0.0004  -0.2966 544 ARG A NH1 
3574 N  NH2 . ARG A 552 ? 1.7903 2.4642 1.2332 -0.3118 0.0137  -0.2338 544 ARG A NH2 
3575 N  N   . CYS A 553 ? 1.4543 1.8612 1.1470 -0.1869 -0.0508 -0.2849 545 CYS A N   
3576 C  CA  . CYS A 553 ? 1.4141 1.7469 1.1556 -0.1866 -0.0430 -0.2862 545 CYS A CA  
3577 C  C   . CYS A 553 ? 1.4350 1.7070 1.1587 -0.1654 -0.0544 -0.2409 545 CYS A C   
3578 O  O   . CYS A 553 ? 1.4381 1.6321 1.1571 -0.1643 -0.0493 -0.2114 545 CYS A O   
3579 C  CB  . CYS A 553 ? 1.3836 1.7401 1.1907 -0.1957 -0.0413 -0.3397 545 CYS A CB  
3580 S  SG  . CYS A 553 ? 1.3920 1.8038 1.2286 -0.2164 -0.0285 -0.4027 545 CYS A SG  
3581 N  N   . ILE A 554 ? 1.3326 1.6435 1.0474 -0.1479 -0.0703 -0.2374 546 ILE A N   
3582 C  CA  . ILE A 554 ? 1.3388 1.6046 1.0383 -0.1216 -0.0820 -0.2004 546 ILE A CA  
3583 C  C   . ILE A 554 ? 1.3804 1.5891 1.0128 -0.1100 -0.0896 -0.1475 546 ILE A C   
3584 O  O   . ILE A 554 ? 1.3846 1.5177 1.0041 -0.0946 -0.0924 -0.1161 546 ILE A O   
3585 C  CB  . ILE A 554 ? 1.3487 1.6838 1.0523 -0.1028 -0.0993 -0.2085 546 ILE A CB  
3586 C  CG1 . ILE A 554 ? 1.3125 1.7010 1.0798 -0.1200 -0.0944 -0.2590 546 ILE A CG1 
3587 C  CG2 . ILE A 554 ? 1.3593 1.6539 1.0499 -0.0699 -0.1108 -0.1741 546 ILE A CG2 
3588 C  CD1 . ILE A 554 ? 1.3189 1.7829 1.0970 -0.1060 -0.1110 -0.2681 546 ILE A CD1 
3589 N  N   . ASP A 555 ? 1.4459 1.6896 1.0327 -0.1203 -0.0938 -0.1379 547 ASP A N   
3590 C  CA  . ASP A 555 ? 1.4821 1.6727 1.0002 -0.1178 -0.1036 -0.0859 547 ASP A CA  
3591 C  C   . ASP A 555 ? 1.4854 1.5968 1.0072 -0.1335 -0.0880 -0.0700 547 ASP A C   
3592 O  O   . ASP A 555 ? 1.5266 1.5612 1.0024 -0.1261 -0.0977 -0.0238 547 ASP A O   
3593 C  CB  . ASP A 555 ? 1.5183 1.7741 0.9885 -0.1346 -0.1099 -0.0814 547 ASP A CB  
3594 C  CG  . ASP A 555 ? 1.6949 2.0020 1.1327 -0.1154 -0.1360 -0.0708 547 ASP A CG  
3595 O  OD1 . ASP A 555 ? 1.7290 2.0038 1.1658 -0.0838 -0.1528 -0.0521 547 ASP A OD1 
3596 O  OD2 . ASP A 555 ? 1.7696 2.1520 1.1827 -0.1316 -0.1400 -0.0815 547 ASP A OD2 
3597 N  N   . TRP A 556 ? 1.4349 1.5626 1.0108 -0.1549 -0.0663 -0.1082 548 TRP A N   
3598 C  CA  . TRP A 556 ? 1.4158 1.4751 1.0057 -0.1705 -0.0520 -0.0966 548 TRP A CA  
3599 C  C   . TRP A 556 ? 1.4109 1.3860 1.0176 -0.1559 -0.0545 -0.0797 548 TRP A C   
3600 O  O   . TRP A 556 ? 1.4245 1.3192 0.9991 -0.1565 -0.0569 -0.0400 548 TRP A O   
3601 C  CB  . TRP A 556 ? 1.3770 1.4769 1.0276 -0.1921 -0.0317 -0.1462 548 TRP A CB  
3602 C  CG  . TRP A 556 ? 1.3509 1.3826 1.0314 -0.2056 -0.0190 -0.1394 548 TRP A CG  
3603 C  CD1 . TRP A 556 ? 1.3121 1.2954 1.0471 -0.2063 -0.0145 -0.1547 548 TRP A CD1 
3604 C  CD2 . TRP A 556 ? 1.3646 1.3726 1.0217 -0.2231 -0.0110 -0.1133 548 TRP A CD2 
3605 N  NE1 . TRP A 556 ? 1.3009 1.2288 1.0484 -0.2216 -0.0053 -0.1398 548 TRP A NE1 
3606 C  CE2 . TRP A 556 ? 1.3313 1.2752 1.0332 -0.2315 -0.0024 -0.1147 548 TRP A CE2 
3607 C  CE3 . TRP A 556 ? 1.4045 1.4427 1.0061 -0.2357 -0.0115 -0.0871 548 TRP A CE3 
3608 C  CZ2 . TRP A 556 ? 1.3342 1.2457 1.0307 -0.2497 0.0057  -0.0916 548 TRP A CZ2 
3609 C  CZ3 . TRP A 556 ? 1.4076 1.4166 1.0027 -0.2558 -0.0023 -0.0641 548 TRP A CZ3 
3610 C  CH2 . TRP A 556 ? 1.3715 1.3185 1.0154 -0.2614 0.0063  -0.0668 548 TRP A CH2 
3611 N  N   . ASN A 557 ? 1.3762 1.3727 1.0309 -0.1456 -0.0543 -0.1101 549 ASN A N   
3612 C  CA  . ASN A 557 ? 1.3753 1.3083 1.0465 -0.1323 -0.0558 -0.0984 549 ASN A CA  
3613 C  C   . ASN A 557 ? 1.4724 1.3660 1.0853 -0.1018 -0.0734 -0.0564 549 ASN A C   
3614 O  O   . ASN A 557 ? 1.4803 1.2974 1.0820 -0.0912 -0.0746 -0.0330 549 ASN A O   
3615 C  CB  . ASN A 557 ? 1.3127 1.2945 1.0455 -0.1320 -0.0534 -0.1401 549 ASN A CB  
3616 C  CG  . ASN A 557 ? 1.3814 1.3729 1.1742 -0.1609 -0.0401 -0.1795 549 ASN A CG  
3617 O  OD1 . ASN A 557 ? 1.3598 1.3033 1.1899 -0.1719 -0.0346 -0.1842 549 ASN A OD1 
3618 N  ND2 . ASN A 557 ? 1.2725 1.3246 1.0732 -0.1733 -0.0363 -0.2085 549 ASN A ND2 
3619 N  N   . ARG A 558 ? 1.4496 1.3944 1.0244 -0.0875 -0.0889 -0.0481 550 ARG A N   
3620 C  CA  . ARG A 558 ? 1.4987 1.4080 1.0156 -0.0553 -0.1113 -0.0089 550 ARG A CA  
3621 C  C   . ARG A 558 ? 1.5439 1.3524 1.0040 -0.0597 -0.1165 0.0376  550 ARG A C   
3622 O  O   . ARG A 558 ? 1.5668 1.3015 0.9992 -0.0355 -0.1273 0.0637  550 ARG A O   
3623 C  CB  . ARG A 558 ? 1.5267 1.5087 1.0100 -0.0469 -0.1296 -0.0057 550 ARG A CB  
3624 C  CG  . ARG A 558 ? 1.6145 1.5677 1.0445 -0.0089 -0.1585 0.0308  550 ARG A CG  
3625 C  CD  . ARG A 558 ? 1.6388 1.6631 1.0334 -0.0075 -0.1787 0.0370  550 ARG A CD  
3626 N  NE  . ARG A 558 ? 1.7489 1.7587 1.1063 0.0340  -0.2100 0.0646  550 ARG A NE  
3627 C  CZ  . ARG A 558 ? 1.8631 1.9358 1.2544 0.0631  -0.2191 0.0445  550 ARG A CZ  
3628 N  NH1 . ARG A 558 ? 1.7671 1.9186 1.2260 0.0506  -0.2000 -0.0016 550 ARG A NH1 
3629 N  NH2 . ARG A 558 ? 1.7891 1.8459 1.1471 0.1046  -0.2496 0.0707  550 ARG A NH2 
3630 N  N   . GLU A 559 ? 1.5797 1.3881 1.0225 -0.0914 -0.1090 0.0462  551 GLU A N   
3631 C  CA  . GLU A 559 ? 1.6066 1.3271 0.9947 -0.1038 -0.1146 0.0920  551 GLU A CA  
3632 C  C   . GLU A 559 ? 1.6131 1.2619 1.0338 -0.1156 -0.0982 0.0909  551 GLU A C   
3633 O  O   . GLU A 559 ? 1.6324 1.1897 1.0095 -0.1184 -0.1056 0.1297  551 GLU A O   
3634 C  CB  . GLU A 559 ? 1.6178 1.3791 0.9780 -0.1365 -0.1115 0.1018  551 GLU A CB  
3635 C  CG  . GLU A 559 ? 1.7701 1.6031 1.0913 -0.1313 -0.1289 0.1060  551 GLU A CG  
3636 C  CD  . GLU A 559 ? 2.0714 1.8463 1.3236 -0.1030 -0.1624 0.1510  551 GLU A CD  
3637 O  OE1 . GLU A 559 ? 2.1403 1.8199 1.3412 -0.1058 -0.1748 0.1948  551 GLU A OE1 
3638 O  OE2 . GLU A 559 ? 2.0307 1.8532 1.2802 -0.0775 -0.1785 0.1423  551 GLU A OE2 
3639 N  N   . LEU A 560 ? 1.5740 1.2614 1.0687 -0.1249 -0.0786 0.0476  552 LEU A N   
3640 C  CA  . LEU A 560 ? 1.5363 1.1607 1.0671 -0.1380 -0.0652 0.0446  552 LEU A CA  
3641 C  C   . LEU A 560 ? 1.5709 1.1312 1.0878 -0.1112 -0.0731 0.0589  552 LEU A C   
3642 O  O   . LEU A 560 ? 1.5664 1.0373 1.0609 -0.1159 -0.0734 0.0854  552 LEU A O   
3643 C  CB  . LEU A 560 ? 1.4856 1.1667 1.0975 -0.1553 -0.0475 -0.0054 552 LEU A CB  
3644 C  CG  . LEU A 560 ? 1.4891 1.1411 1.1358 -0.1863 -0.0331 -0.0105 552 LEU A CG  
3645 C  CD1 . LEU A 560 ? 1.5012 1.1800 1.1199 -0.2035 -0.0305 0.0023  552 LEU A CD1 
3646 C  CD2 . LEU A 560 ? 1.4695 1.1652 1.1954 -0.1982 -0.0222 -0.0606 552 LEU A CD2 
3647 N  N   . LEU A 561 ? 1.4882 1.0990 1.0178 -0.0831 -0.0797 0.0402  553 LEU A N   
3648 C  CA  . LEU A 561 ? 1.5095 1.0789 1.0295 -0.0522 -0.0861 0.0478  553 LEU A CA  
3649 C  C   . LEU A 561 ? 1.6151 1.1075 1.0552 -0.0267 -0.1076 0.0923  553 LEU A C   
3650 O  O   . LEU A 561 ? 1.6402 1.0569 1.0581 -0.0096 -0.1109 0.1076  553 LEU A O   
3651 C  CB  . LEU A 561 ? 1.4998 1.1589 1.0580 -0.0288 -0.0884 0.0156  553 LEU A CB  
3652 C  CG  . LEU A 561 ? 1.4626 1.1868 1.0983 -0.0528 -0.0714 -0.0285 553 LEU A CG  
3653 C  CD1 . LEU A 561 ? 1.4579 1.2763 1.1234 -0.0323 -0.0773 -0.0552 553 LEU A CD1 
3654 C  CD2 . LEU A 561 ? 1.4521 1.1172 1.1157 -0.0677 -0.0585 -0.0305 553 LEU A CD2 
3655 N  N   . LYS A 562 ? 1.6644 1.1739 1.0582 -0.0255 -0.1238 0.1128  554 LYS A N   
3656 C  CA  . LYS A 562 ? 1.7164 1.1473 1.0283 -0.0053 -0.1502 0.1584  554 LYS A CA  
3657 C  C   . LYS A 562 ? 1.7580 1.0805 1.0314 -0.0284 -0.1492 0.1920  554 LYS A C   
3658 O  O   . LYS A 562 ? 1.8130 1.0428 1.0239 -0.0096 -0.1694 0.2259  554 LYS A O   
3659 C  CB  . LYS A 562 ? 1.7531 1.2297 1.0230 -0.0097 -0.1690 0.1757  554 LYS A CB  
3660 C  CG  . LYS A 562 ? 1.8135 1.3677 1.0922 0.0245  -0.1840 0.1592  554 LYS A CG  
3661 C  CD  . LYS A 562 ? 1.8675 1.4780 1.1095 0.0104  -0.1999 0.1731  554 LYS A CD  
3662 C  CE  . LYS A 562 ? 1.9751 1.4989 1.1266 0.0080  -0.2291 0.2288  554 LYS A CE  
3663 N  NZ  . LYS A 562 ? 2.0325 1.6157 1.1439 -0.0093 -0.2466 0.2449  554 LYS A NZ  
3664 N  N   . ARG A 563 ? 1.7803 1.1133 1.0915 -0.0687 -0.1274 0.1818  555 ARG A N   
3665 C  CA  . ARG A 563 ? 1.7771 1.0200 1.0570 -0.0969 -0.1262 0.2144  555 ARG A CA  
3666 C  C   . ARG A 563 ? 1.7781 0.9618 1.0891 -0.0988 -0.1123 0.2047  555 ARG A C   
3667 O  O   . ARG A 563 ? 1.7743 0.8809 1.0583 -0.1021 -0.1171 0.2290  555 ARG A O   
3668 C  CB  . ARG A 563 ? 1.7495 1.0412 1.0515 -0.1394 -0.1124 0.2119  555 ARG A CB  
3669 C  CG  . ARG A 563 ? 1.8366 1.0489 1.0993 -0.1716 -0.1152 0.2523  555 ARG A CG  
3670 C  CD  . ARG A 563 ? 1.8751 1.1522 1.1806 -0.2100 -0.0961 0.2392  555 ARG A CD  
3671 N  NE  . ARG A 563 ? 1.9312 1.2445 1.3234 -0.2156 -0.0730 0.1947  555 ARG A NE  
3672 C  CZ  . ARG A 563 ? 2.0786 1.4603 1.5274 -0.2387 -0.0553 0.1669  555 ARG A CZ  
3673 N  NH1 . ARG A 563 ? 2.0583 1.4904 1.4876 -0.2585 -0.0540 0.1770  555 ARG A NH1 
3674 N  NH2 . ARG A 563 ? 1.9512 1.3518 1.4752 -0.2422 -0.0402 0.1284  555 ARG A NH2 
3675 N  N   . GLU A 564 ? 1.6280 0.8729 1.0122 -0.0974 -0.0939 0.1622  556 GLU A N   
3676 C  CA  . GLU A 564 ? 1.5884 0.7879 1.0063 -0.1066 -0.0803 0.1518  556 GLU A CA  
3677 C  C   . GLU A 564 ? 1.6182 0.7986 1.0274 -0.0690 -0.0843 0.1438  556 GLU A C   
3678 O  O   . GLU A 564 ? 1.5868 0.7240 1.0111 -0.0750 -0.0747 0.1389  556 GLU A O   
3679 C  CB  . GLU A 564 ? 1.5477 0.8169 1.0499 -0.1332 -0.0603 0.1124  556 GLU A CB  
3680 C  CG  . GLU A 564 ? 1.6063 0.8825 1.1267 -0.1703 -0.0529 0.1167  556 GLU A CG  
3681 C  CD  . GLU A 564 ? 1.7634 0.9631 1.2716 -0.1896 -0.0519 0.1460  556 GLU A CD  
3682 O  OE1 . GLU A 564 ? 1.6456 0.8690 1.2107 -0.1780 -0.0432 0.1316  556 GLU A OE1 
3683 O  OE2 . GLU A 564 ? 1.7407 0.9556 1.2351 -0.1966 -0.0553 0.1662  556 GLU A OE2 
3684 N  N   . LEU A 565 ? 1.5978 0.8146 0.9832 -0.0305 -0.0989 0.1419  557 LEU A N   
3685 C  CA  . LEU A 565 ? 1.6214 0.8272 0.9973 0.0120  -0.1041 0.1337  557 LEU A CA  
3686 C  C   . LEU A 565 ? 1.7458 0.8832 1.0410 0.0491  -0.1319 0.1667  557 LEU A C   
3687 O  O   . LEU A 565 ? 1.7813 0.8995 1.0593 0.0919  -0.1402 0.1620  557 LEU A O   
3688 C  CB  . LEU A 565 ? 1.6066 0.9299 1.0415 0.0304  -0.0978 0.0946  557 LEU A CB  
3689 C  CG  . LEU A 565 ? 1.5739 0.9583 1.0875 -0.0021 -0.0746 0.0592  557 LEU A CG  
3690 C  CD1 . LEU A 565 ? 1.5638 1.0653 1.1275 0.0134  -0.0731 0.0246  557 LEU A CD1 
3691 C  CD2 . LEU A 565 ? 1.5704 0.8968 1.0918 -0.0099 -0.0625 0.0582  557 LEU A CD2 
3692 N  N   . GLY A 566 ? 1.8021 0.9037 1.0477 0.0320  -0.1474 0.1997  558 GLY A N   
3693 C  CA  . GLY A 566 ? 1.8826 0.9095 1.0451 0.0598  -0.1795 0.2365  558 GLY A CA  
3694 C  C   . GLY A 566 ? 1.9754 1.0607 1.1362 0.1090  -0.1976 0.2246  558 GLY A C   
3695 O  O   . GLY A 566 ? 2.0237 1.0589 1.1512 0.1550  -0.2148 0.2291  558 GLY A O   
3696 N  N   . LEU A 567 ? 1.8367 1.0293 1.0340 0.1007  -0.1946 0.2079  559 LEU A N   
3697 C  CA  . LEU A 567 ? 1.8699 1.1331 1.0744 0.1434  -0.2115 0.1950  559 LEU A CA  
3698 C  C   . LEU A 567 ? 1.9482 1.2161 1.0976 0.1418  -0.2411 0.2260  559 LEU A C   
3699 O  O   . LEU A 567 ? 1.9278 1.2197 1.0712 0.0983  -0.2356 0.2363  559 LEU A O   
3700 C  CB  . LEU A 567 ? 1.8219 1.2137 1.1127 0.1368  -0.1876 0.1484  559 LEU A CB  
3701 C  CG  . LEU A 567 ? 1.8112 1.2152 1.1626 0.1290  -0.1586 0.1168  559 LEU A CG  
3702 C  CD1 . LEU A 567 ? 1.7683 1.2947 1.1981 0.1105  -0.1398 0.0758  559 LEU A CD1 
3703 C  CD2 . LEU A 567 ? 1.8582 1.2293 1.1995 0.1779  -0.1646 0.1123  559 LEU A CD2 
3704 N  N   . ALA A 568 ? 2.0555 1.3023 1.1645 0.1894  -0.2736 0.2407  560 ALA A N   
3705 C  CA  . ALA A 568 ? 2.0930 1.3552 1.1525 0.1909  -0.3063 0.2691  560 ALA A CA  
3706 C  C   . ALA A 568 ? 2.0883 1.4871 1.2028 0.2028  -0.3031 0.2374  560 ALA A C   
3707 O  O   . ALA A 568 ? 2.0507 1.5186 1.2341 0.2194  -0.2816 0.1973  560 ALA A O   
3708 C  CB  . ALA A 568 ? 2.1808 1.3401 1.1647 0.2359  -0.3495 0.3042  560 ALA A CB  
3709 N  N   . GLU A 569 ? 1.9895 1.4286 1.0710 0.1909  -0.3255 0.2568  561 GLU A N   
3710 C  CA  . GLU A 569 ? 1.9686 1.5356 1.0941 0.1986  -0.3262 0.2300  561 GLU A CA  
3711 C  C   . GLU A 569 ? 2.0350 1.6253 1.1788 0.2619  -0.3466 0.2185  561 GLU A C   
3712 O  O   . GLU A 569 ? 2.0129 1.7146 1.2099 0.2733  -0.3422 0.1887  561 GLU A O   
3713 C  CB  . GLU A 569 ? 2.0025 1.5996 1.0770 0.1710  -0.3496 0.2581  561 GLU A CB  
3714 C  CG  . GLU A 569 ? 1.9783 1.6187 1.0633 0.1088  -0.3212 0.2500  561 GLU A CG  
3715 C  CD  . GLU A 569 ? 1.9647 1.7287 1.1311 0.0943  -0.2899 0.1967  561 GLU A CD  
3716 O  OE1 . GLU A 569 ? 1.8677 1.6996 1.0717 0.1261  -0.2965 0.1732  561 GLU A OE1 
3717 O  OE2 . GLU A 569 ? 1.8289 1.6217 1.0219 0.0513  -0.2604 0.1780  561 GLU A OE2 
3718 N  N   . SER A 570 ? 2.1136 1.5997 1.2138 0.3035  -0.3694 0.2409  562 SER A N   
3719 C  CA  . SER A 570 ? 2.1507 1.6511 1.2655 0.3708  -0.3906 0.2301  562 SER A CA  
3720 C  C   . SER A 570 ? 2.1469 1.6929 1.3367 0.3903  -0.3556 0.1853  562 SER A C   
3721 O  O   . SER A 570 ? 2.1766 1.7403 1.3865 0.4471  -0.3662 0.1708  562 SER A O   
3722 C  CB  . SER A 570 ? 2.2471 1.6115 1.2818 0.4106  -0.4316 0.2693  562 SER A CB  
3723 O  OG  . SER A 570 ? 2.2868 1.5406 1.2948 0.3969  -0.4160 0.2773  562 SER A OG  
3724 N  N   . ASP A 571 ? 2.0410 1.6079 1.2717 0.3424  -0.3153 0.1639  563 ASP A N   
3725 C  CA  . ASP A 571 ? 1.9940 1.6069 1.2943 0.3483  -0.2817 0.1239  563 ASP A CA  
3726 C  C   . ASP A 571 ? 1.9636 1.7054 1.3376 0.3120  -0.2560 0.0885  563 ASP A C   
3727 O  O   . ASP A 571 ? 1.9243 1.7218 1.3607 0.3091  -0.2301 0.0549  563 ASP A O   
3728 C  CB  . ASP A 571 ? 1.9863 1.4994 1.2719 0.3237  -0.2592 0.1289  563 ASP A CB  
3729 C  CG  . ASP A 571 ? 2.1409 1.5210 1.3538 0.3601  -0.2839 0.1593  563 ASP A CG  
3730 O  OD1 . ASP A 571 ? 2.1702 1.5400 1.3919 0.4104  -0.2865 0.1440  563 ASP A OD1 
3731 O  OD2 . ASP A 571 ? 2.2191 1.5060 1.3650 0.3375  -0.3012 0.1974  563 ASP A OD2 
3732 N  N   . ILE A 572 ? 1.8764 1.6642 1.2396 0.2822  -0.2645 0.0961  564 ILE A N   
3733 C  CA  . ILE A 572 ? 1.8181 1.7181 1.2428 0.2451  -0.2431 0.0619  564 ILE A CA  
3734 C  C   . ILE A 572 ? 1.8453 1.8539 1.2901 0.2683  -0.2634 0.0511  564 ILE A C   
3735 O  O   . ILE A 572 ? 1.8860 1.8827 1.2814 0.2908  -0.2965 0.0792  564 ILE A O   
3736 C  CB  . ILE A 572 ? 1.8165 1.7038 1.2215 0.1892  -0.2325 0.0694  564 ILE A CB  
3737 C  CG1 . ILE A 572 ? 1.8141 1.5859 1.1870 0.1685  -0.2204 0.0906  564 ILE A CG1 
3738 C  CG2 . ILE A 572 ? 1.7649 1.7512 1.2373 0.1517  -0.2071 0.0272  564 ILE A CG2 
3739 C  CD1 . ILE A 572 ? 1.8037 1.5664 1.1583 0.1168  -0.2102 0.0995  564 ILE A CD1 
3740 N  N   . ILE A 573 ? 1.7230 1.8358 1.2389 0.2603  -0.2459 0.0124  565 ILE A N   
3741 C  CA  . ILE A 573 ? 1.7329 1.9599 1.2749 0.2751  -0.2633 -0.0007 565 ILE A CA  
3742 C  C   . ILE A 573 ? 1.7251 2.0379 1.3069 0.2234  -0.2460 -0.0313 565 ILE A C   
3743 O  O   . ILE A 573 ? 1.6742 2.0073 1.3066 0.1942  -0.2183 -0.0610 565 ILE A O   
3744 C  CB  . ILE A 573 ? 1.7536 2.0444 1.3463 0.3196  -0.2645 -0.0201 565 ILE A CB  
3745 C  CG1 . ILE A 573 ? 1.8033 2.0075 1.3580 0.3765  -0.2811 0.0038  565 ILE A CG1 
3746 C  CG2 . ILE A 573 ? 1.7672 2.1792 1.3864 0.3338  -0.2856 -0.0303 565 ILE A CG2 
3747 C  CD1 . ILE A 573 ? 1.8498 2.1222 1.4542 0.4258  -0.2811 -0.0172 565 ILE A CD1 
3748 N  N   . ASP A 574 ? 1.7550 2.1151 1.3109 0.2117  -0.2647 -0.0241 566 ASP A N   
3749 C  CA  . ASP A 574 ? 1.7152 2.1554 1.3007 0.1652  -0.2514 -0.0551 566 ASP A CA  
3750 C  C   . ASP A 574 ? 1.7225 2.2821 1.3654 0.1732  -0.2565 -0.0847 566 ASP A C   
3751 O  O   . ASP A 574 ? 1.7549 2.3627 1.3907 0.2089  -0.2838 -0.0719 566 ASP A O   
3752 C  CB  . ASP A 574 ? 1.7564 2.1978 1.2837 0.1439  -0.2672 -0.0358 566 ASP A CB  
3753 C  CG  . ASP A 574 ? 1.8704 2.2042 1.3415 0.1288  -0.2621 -0.0053 566 ASP A CG  
3754 O  OD1 . ASP A 574 ? 1.8472 2.1583 1.3345 0.0915  -0.2342 -0.0226 566 ASP A OD1 
3755 O  OD2 . ASP A 574 ? 1.9580 2.2296 1.3687 0.1534  -0.2882 0.0366  566 ASP A OD2 
3756 N  N   . ILE A 575 ? 1.5999 2.2054 1.2994 0.1385  -0.2327 -0.1230 567 ILE A N   
3757 C  CA  . ILE A 575 ? 1.5707 2.2901 1.3267 0.1364  -0.2364 -0.1522 567 ILE A CA  
3758 C  C   . ILE A 575 ? 1.5676 2.3533 1.3308 0.0916  -0.2358 -0.1797 567 ILE A C   
3759 O  O   . ILE A 575 ? 1.5287 2.2797 1.2927 0.0524  -0.2164 -0.1976 567 ILE A O   
3760 C  CB  . ILE A 575 ? 1.5553 2.2826 1.3719 0.1294  -0.2139 -0.1753 567 ILE A CB  
3761 C  CG1 . ILE A 575 ? 1.5827 2.3078 1.4072 0.1830  -0.2211 -0.1586 567 ILE A CG1 
3762 C  CG2 . ILE A 575 ? 1.5251 2.3585 1.3985 0.0967  -0.2112 -0.2124 567 ILE A CG2 
3763 C  CD1 . ILE A 575 ? 1.6547 2.2604 1.4266 0.2138  -0.2224 -0.1257 567 ILE A CD1 
3764 N  N   . PRO A 576 ? 1.5869 2.4689 1.3552 0.0988  -0.2584 -0.1841 568 PRO A N   
3765 C  CA  . PRO A 576 ? 1.5689 2.5209 1.3381 0.0590  -0.2620 -0.2109 568 PRO A CA  
3766 C  C   . PRO A 576 ? 1.5472 2.5232 1.3701 0.0155  -0.2403 -0.2553 568 PRO A C   
3767 O  O   . PRO A 576 ? 1.5317 2.5477 1.4073 0.0170  -0.2367 -0.2692 568 PRO A O   
3768 C  CB  . PRO A 576 ? 1.5997 2.6521 1.3763 0.0827  -0.2921 -0.2043 568 PRO A CB  
3769 C  CG  . PRO A 576 ? 1.6389 2.6930 1.4463 0.1293  -0.2964 -0.1891 568 PRO A CG  
3770 C  CD  . PRO A 576 ? 1.6264 2.5591 1.4023 0.1479  -0.2832 -0.1651 568 PRO A CD  
3771 N  N   . GLN A 577 ? 1.5411 2.4939 1.3496 -0.0229 -0.2276 -0.2773 569 GLN A N   
3772 C  CA  . GLN A 577 ? 1.4904 2.4474 1.3441 -0.0642 -0.2102 -0.3200 569 GLN A CA  
3773 C  C   . GLN A 577 ? 1.5092 2.4530 1.3368 -0.0972 -0.2018 -0.3444 569 GLN A C   
3774 O  O   . GLN A 577 ? 1.5181 2.4088 1.3005 -0.0919 -0.1957 -0.3247 569 GLN A O   
3775 C  CB  . GLN A 577 ? 1.4729 2.3515 1.3565 -0.0640 -0.1896 -0.3168 569 GLN A CB  
3776 C  CG  . GLN A 577 ? 1.5122 2.3806 1.4409 -0.1071 -0.1756 -0.3568 569 GLN A CG  
3777 C  CD  . GLN A 577 ? 1.6249 2.5810 1.6004 -0.1260 -0.1869 -0.3827 569 GLN A CD  
3778 O  OE1 . GLN A 577 ? 1.6215 2.6240 1.6192 -0.1057 -0.1943 -0.3682 569 GLN A OE1 
3779 N  NE2 . GLN A 577 ? 1.5161 2.4971 1.5063 -0.1652 -0.1892 -0.4222 569 GLN A NE2 
3780 N  N   . LEU A 578 ? 1.5229 2.5163 1.3779 -0.1318 -0.2021 -0.3881 570 LEU A N   
3781 C  CA  . LEU A 578 ? 1.5177 2.5001 1.3535 -0.1611 -0.1920 -0.4199 570 LEU A CA  
3782 C  C   . LEU A 578 ? 1.5156 2.4850 1.4008 -0.1955 -0.1825 -0.4674 570 LEU A C   
3783 O  O   . LEU A 578 ? 1.5027 2.4969 1.4324 -0.2052 -0.1896 -0.4784 570 LEU A O   
3784 C  CB  . LEU A 578 ? 1.5507 2.6126 1.3467 -0.1682 -0.2089 -0.4279 570 LEU A CB  
3785 C  CG  . LEU A 578 ? 1.6014 2.7547 1.4065 -0.1606 -0.2350 -0.4224 570 LEU A CG  
3786 C  CD1 . LEU A 578 ? 1.5712 2.7677 1.4303 -0.1894 -0.2387 -0.4632 570 LEU A CD1 
3787 C  CD2 . LEU A 578 ? 1.6605 2.8750 1.4112 -0.1646 -0.2519 -0.4183 570 LEU A CD2 
3788 N  N   . PHE A 579 ? 1.5824 2.5140 1.4592 -0.2141 -0.1680 -0.4951 571 PHE A N   
3789 C  CA  . PHE A 579 ? 1.5510 2.4477 1.4729 -0.2425 -0.1603 -0.5382 571 PHE A CA  
3790 C  C   . PHE A 579 ? 1.5890 2.5207 1.5016 -0.2676 -0.1622 -0.5904 571 PHE A C   
3791 O  O   . PHE A 579 ? 1.6104 2.5779 1.4768 -0.2638 -0.1606 -0.5919 571 PHE A O   
3792 C  CB  . PHE A 579 ? 1.5394 2.3404 1.4723 -0.2377 -0.1400 -0.5266 571 PHE A CB  
3793 C  CG  . PHE A 579 ? 1.5418 2.2987 1.4800 -0.2144 -0.1367 -0.4789 571 PHE A CG  
3794 C  CD1 . PHE A 579 ? 1.5874 2.3353 1.4802 -0.1843 -0.1364 -0.4337 571 PHE A CD1 
3795 C  CD2 . PHE A 579 ? 1.5282 2.2497 1.5133 -0.2240 -0.1355 -0.4799 571 PHE A CD2 
3796 C  CE1 . PHE A 579 ? 1.5962 2.2986 1.4907 -0.1604 -0.1344 -0.3939 571 PHE A CE1 
3797 C  CE2 . PHE A 579 ? 1.5451 2.2288 1.5321 -0.2023 -0.1309 -0.4396 571 PHE A CE2 
3798 C  CZ  . PHE A 579 ? 1.5593 2.2321 1.5011 -0.1685 -0.1300 -0.3984 571 PHE A CZ  
3799 N  N   . LYS A 580 ? 1.6569 2.5761 1.6111 -0.2945 -0.1670 -0.6335 572 LYS A N   
3800 C  CA  . LYS A 580 ? 1.6663 2.6036 1.6152 -0.3169 -0.1690 -0.6903 572 LYS A CA  
3801 C  C   . LYS A 580 ? 1.6733 2.5281 1.6524 -0.3239 -0.1546 -0.7185 572 LYS A C   
3802 O  O   . LYS A 580 ? 1.6486 2.4428 1.6703 -0.3301 -0.1554 -0.7110 572 LYS A O   
3803 C  CB  . LYS A 580 ? 1.7039 2.6807 1.6741 -0.3376 -0.1878 -0.7097 572 LYS A CB  
3804 N  N   . LEU A 581 ? 1.7357 2.5852 1.6949 -0.3194 -0.1395 -0.7427 573 LEU A N   
3805 C  CA  . LEU A 581 ? 1.7214 2.4946 1.7130 -0.3180 -0.1245 -0.7644 573 LEU A CA  
3806 C  C   . LEU A 581 ? 1.7633 2.4921 1.7978 -0.3301 -0.1346 -0.7886 573 LEU A C   
3807 O  O   . LEU A 581 ? 1.7854 2.5524 1.8108 -0.3394 -0.1457 -0.8071 573 LEU A O   
3808 C  CB  . LEU A 581 ? 1.7381 2.5341 1.6984 -0.3087 -0.1054 -0.7862 573 LEU A CB  
3809 C  CG  . LEU A 581 ? 1.7658 2.5679 1.6889 -0.2971 -0.0907 -0.7573 573 LEU A CG  
3810 C  CD1 . LEU A 581 ? 1.8386 2.6683 1.7376 -0.2935 -0.0708 -0.7852 573 LEU A CD1 
3811 C  CD2 . LEU A 581 ? 1.7093 2.4238 1.6693 -0.2891 -0.0838 -0.7245 573 LEU A CD2 
3812 N  N   . LYS A 582 ? 1.7953 2.4394 1.8720 -0.3309 -0.1331 -0.7845 574 LYS A N   
3813 C  CA  . LYS A 582 ? 1.8109 2.3974 1.9218 -0.3416 -0.1464 -0.8004 574 LYS A CA  
3814 C  C   . LYS A 582 ? 1.8556 2.3896 1.9833 -0.3289 -0.1356 -0.8291 574 LYS A C   
3815 O  O   . LYS A 582 ? 1.8649 2.4225 1.9776 -0.3139 -0.1160 -0.8403 574 LYS A O   
3816 C  CB  . LYS A 582 ? 1.6363 2.1658 1.7799 -0.3541 -0.1585 -0.7666 574 LYS A CB  
3817 N  N   . GLU A 583 ? 1.8679 2.3339 2.0242 -0.3349 -0.1501 -0.8396 575 GLU A N   
3818 C  CA  . GLU A 583 ? 1.8794 2.2944 2.0564 -0.3197 -0.1438 -0.8667 575 GLU A CA  
3819 C  C   . GLU A 583 ? 1.8614 2.2362 2.0582 -0.3063 -0.1277 -0.8438 575 GLU A C   
3820 O  O   . GLU A 583 ? 1.8340 2.1857 2.0362 -0.3132 -0.1290 -0.8032 575 GLU A O   
3821 C  CB  . GLU A 583 ? 1.9412 2.2807 2.1394 -0.3300 -0.1687 -0.8739 575 GLU A CB  
3822 C  CG  . GLU A 583 ? 1.9808 2.2460 2.2000 -0.3440 -0.1840 -0.8283 575 GLU A CG  
3823 C  CD  . GLU A 583 ? 2.1239 2.4239 2.3315 -0.3667 -0.1958 -0.7992 575 GLU A CD  
3824 O  OE1 . GLU A 583 ? 2.1719 2.4724 2.3719 -0.3866 -0.2181 -0.8060 575 GLU A OE1 
3825 O  OE2 . GLU A 583 ? 2.0019 2.3308 2.2081 -0.3649 -0.1835 -0.7706 575 GLU A OE2 
3826 N  N   . PHE A 584 ? 1.9554 2.3263 2.1632 -0.2874 -0.1126 -0.8711 576 PHE A N   
3827 C  CA  . PHE A 584 ? 1.9158 2.2609 2.1399 -0.2748 -0.0954 -0.8538 576 PHE A CA  
3828 C  C   . PHE A 584 ? 1.8962 2.2961 2.0858 -0.2776 -0.0800 -0.8304 576 PHE A C   
3829 O  O   . PHE A 584 ? 1.8526 2.2192 2.0492 -0.2761 -0.0722 -0.7997 576 PHE A O   
3830 C  CB  . PHE A 584 ? 1.9180 2.1666 2.1760 -0.2789 -0.1088 -0.8166 576 PHE A CB  
3831 C  CG  . PHE A 584 ? 1.9555 2.1422 2.2446 -0.2706 -0.1217 -0.8361 576 PHE A CG  
3832 C  CD1 . PHE A 584 ? 1.9834 2.1851 2.2905 -0.2489 -0.1087 -0.8752 576 PHE A CD1 
3833 C  CD2 . PHE A 584 ? 1.9978 2.1147 2.2949 -0.2853 -0.1481 -0.8154 576 PHE A CD2 
3834 C  CE1 . PHE A 584 ? 2.0135 2.1598 2.3506 -0.2384 -0.1227 -0.8953 576 PHE A CE1 
3835 C  CE2 . PHE A 584 ? 2.0464 2.1026 2.3644 -0.2786 -0.1633 -0.8316 576 PHE A CE2 
3836 C  CZ  . PHE A 584 ? 2.0346 2.1046 2.3749 -0.2533 -0.1510 -0.8727 576 PHE A CZ  
3837 N  N   . SER A 585 ? 1.7455 2.2266 1.8936 -0.2826 -0.0783 -0.8427 577 SER A N   
3838 C  CA  . SER A 585 ? 1.7295 2.2709 1.8314 -0.2843 -0.0677 -0.8215 577 SER A CA  
3839 C  C   . SER A 585 ? 1.7314 2.2410 1.8340 -0.2923 -0.0755 -0.7758 577 SER A C   
3840 O  O   . SER A 585 ? 1.7210 2.2493 1.7916 -0.2904 -0.0669 -0.7528 577 SER A O   
3841 C  CB  . SER A 585 ? 1.7396 2.3026 1.8265 -0.2731 -0.0442 -0.8308 577 SER A CB  
3842 O  OG  . SER A 585 ? 1.8189 2.4265 1.9035 -0.2649 -0.0345 -0.8752 577 SER A OG  
3843 N  N   . LYS A 586 ? 1.7015 2.1640 1.8359 -0.3022 -0.0926 -0.7618 578 LYS A N   
3844 C  CA  . LYS A 586 ? 1.6780 2.1153 1.8176 -0.3104 -0.0994 -0.7211 578 LYS A CA  
3845 C  C   . LYS A 586 ? 1.7252 2.2407 1.8318 -0.3166 -0.1096 -0.7122 578 LYS A C   
3846 O  O   . LYS A 586 ? 1.7503 2.3270 1.8369 -0.3184 -0.1154 -0.7341 578 LYS A O   
3847 C  CB  . LYS A 586 ? 1.6859 2.0457 1.8686 -0.3202 -0.1131 -0.7051 578 LYS A CB  
3848 C  CG  . LYS A 586 ? 1.7030 1.9803 1.9165 -0.3118 -0.1076 -0.7013 578 LYS A CG  
3849 C  CD  . LYS A 586 ? 1.6913 1.9393 1.9024 -0.3057 -0.0926 -0.6724 578 LYS A CD  
3850 C  CE  . LYS A 586 ? 1.7146 1.9632 1.9269 -0.2908 -0.0754 -0.6939 578 LYS A CE  
3851 N  NZ  . LYS A 586 ? 1.7406 1.9507 1.9512 -0.2888 -0.0628 -0.6630 578 LYS A NZ  
3852 N  N   . ALA A 587 ? 1.5208 2.0298 1.6217 -0.3136 -0.1102 -0.6695 579 ALA A N   
3853 C  CA  . ALA A 587 ? 1.5355 2.1125 1.6037 -0.3039 -0.1160 -0.6403 579 ALA A CA  
3854 C  C   . ALA A 587 ? 1.5624 2.1476 1.6578 -0.3166 -0.1315 -0.6254 579 ALA A C   
3855 O  O   . ALA A 587 ? 1.5278 2.0581 1.6466 -0.3187 -0.1286 -0.5996 579 ALA A O   
3856 C  CB  . ALA A 587 ? 1.5440 2.1141 1.5713 -0.2763 -0.1011 -0.5887 579 ALA A CB  
3857 N  N   . GLU A 588 ? 1.5789 2.2386 1.6697 -0.3270 -0.1478 -0.6418 580 GLU A N   
3858 C  CA  . GLU A 588 ? 1.5811 2.2757 1.6928 -0.3371 -0.1618 -0.6241 580 GLU A CA  
3859 C  C   . GLU A 588 ? 1.6312 2.4068 1.7092 -0.3131 -0.1652 -0.5952 580 GLU A C   
3860 O  O   . GLU A 588 ? 1.6481 2.4634 1.6876 -0.3012 -0.1642 -0.6014 580 GLU A O   
3861 C  CB  . GLU A 588 ? 1.6038 2.3066 1.7438 -0.3679 -0.1792 -0.6541 580 GLU A CB  
3862 C  CG  . GLU A 588 ? 1.7110 2.3115 1.8856 -0.3813 -0.1778 -0.6515 580 GLU A CG  
3863 C  CD  . GLU A 588 ? 1.9354 2.5280 2.1260 -0.4041 -0.1961 -0.6595 580 GLU A CD  
3864 O  OE1 . GLU A 588 ? 1.8996 2.5645 2.0760 -0.4100 -0.2066 -0.6725 580 GLU A OE1 
3865 O  OE2 . GLU A 588 ? 1.9325 2.4445 2.1456 -0.4171 -0.2026 -0.6496 580 GLU A OE2 
3866 N  N   . ALA A 589 ? 1.5360 2.3388 1.6286 -0.3058 -0.1701 -0.5641 581 ALA A N   
3867 C  CA  . ALA A 589 ? 1.5546 2.4356 1.6225 -0.2796 -0.1774 -0.5369 581 ALA A CA  
3868 C  C   . ALA A 589 ? 1.5994 2.5696 1.6646 -0.2984 -0.1974 -0.5659 581 ALA A C   
3869 O  O   . ALA A 589 ? 1.5884 2.5769 1.6861 -0.3332 -0.2103 -0.5946 581 ALA A O   
3870 C  CB  . ALA A 589 ? 1.5527 2.4463 1.6439 -0.2659 -0.1773 -0.5031 581 ALA A CB  
3871 N  N   . PHE A 590 ? 1.5430 2.5663 1.5664 -0.2786 -0.2024 -0.5568 582 PHE A N   
3872 C  CA  . PHE A 590 ? 1.5649 2.6749 1.5791 -0.2964 -0.2224 -0.5821 582 PHE A CA  
3873 C  C   . PHE A 590 ? 1.5952 2.7838 1.6386 -0.2976 -0.2400 -0.5666 582 PHE A C   
3874 O  O   . PHE A 590 ? 1.5957 2.8399 1.6576 -0.3295 -0.2575 -0.5939 582 PHE A O   
3875 C  CB  . PHE A 590 ? 1.6057 2.7509 1.5633 -0.2769 -0.2240 -0.5724 582 PHE A CB  
3876 C  CG  . PHE A 590 ? 1.6381 2.8572 1.5783 -0.3016 -0.2415 -0.6076 582 PHE A CG  
3877 C  CD1 . PHE A 590 ? 1.6583 2.8667 1.6263 -0.3362 -0.2452 -0.6491 582 PHE A CD1 
3878 C  CD2 . PHE A 590 ? 1.6796 2.9632 1.5737 -0.2881 -0.2528 -0.5916 582 PHE A CD2 
3879 C  CE1 . PHE A 590 ? 1.6979 2.9441 1.6494 -0.3510 -0.2529 -0.6674 582 PHE A CE1 
3880 C  CE2 . PHE A 590 ? 1.7247 3.0674 1.6013 -0.3105 -0.2659 -0.6188 582 PHE A CE2 
3881 C  CZ  . PHE A 590 ? 1.7166 3.0324 1.6235 -0.3392 -0.2621 -0.6535 582 PHE A CZ  
3882 N  N   . PHE A 591 ? 1.4617 2.6571 1.5087 -0.2623 -0.2360 -0.5237 583 PHE A N   
3883 C  CA  . PHE A 591 ? 1.4536 2.7213 1.5380 -0.2594 -0.2477 -0.5086 583 PHE A CA  
3884 C  C   . PHE A 591 ? 1.4569 2.6664 1.5672 -0.2450 -0.2305 -0.4851 583 PHE A C   
3885 O  O   . PHE A 591 ? 1.4493 2.5721 1.5382 -0.2264 -0.2132 -0.4709 583 PHE A O   
3886 C  CB  . PHE A 591 ? 1.4906 2.8449 1.5544 -0.2249 -0.2640 -0.4819 583 PHE A CB  
3887 C  CG  . PHE A 591 ? 1.5157 2.8275 1.5437 -0.1743 -0.2563 -0.4418 583 PHE A CG  
3888 C  CD1 . PHE A 591 ? 1.5368 2.8278 1.5829 -0.1407 -0.2480 -0.4117 583 PHE A CD1 
3889 C  CD2 . PHE A 591 ? 1.5537 2.8491 1.5266 -0.1619 -0.2595 -0.4340 583 PHE A CD2 
3890 C  CE1 . PHE A 591 ? 1.5647 2.8081 1.5737 -0.0946 -0.2449 -0.3755 583 PHE A CE1 
3891 C  CE2 . PHE A 591 ? 1.5939 2.8454 1.5296 -0.1198 -0.2571 -0.3944 583 PHE A CE2 
3892 C  CZ  . PHE A 591 ? 1.5812 2.8023 1.5345 -0.0853 -0.2510 -0.3654 583 PHE A CZ  
3893 N  N   . PRO A 592 ? 1.3939 2.6540 1.5488 -0.2566 -0.2350 -0.4812 584 PRO A N   
3894 C  CA  . PRO A 592 ? 1.3798 2.5928 1.5601 -0.2498 -0.2186 -0.4627 584 PRO A CA  
3895 C  C   . PRO A 592 ? 1.4258 2.5744 1.5753 -0.1993 -0.2027 -0.4289 584 PRO A C   
3896 O  O   . PRO A 592 ? 1.4417 2.6303 1.5698 -0.1563 -0.2094 -0.4057 584 PRO A O   
3897 C  CB  . PRO A 592 ? 1.3838 2.7052 1.6049 -0.2526 -0.2289 -0.4554 584 PRO A CB  
3898 C  CG  . PRO A 592 ? 1.4187 2.8410 1.6334 -0.2541 -0.2520 -0.4649 584 PRO A CG  
3899 C  CD  . PRO A 592 ? 1.4032 2.7762 1.5861 -0.2790 -0.2563 -0.4928 584 PRO A CD  
3900 N  N   . ASN A 593 ? 1.3877 2.4335 1.5341 -0.2062 -0.1848 -0.4257 585 ASN A N   
3901 C  CA  . ASN A 593 ? 1.3994 2.3677 1.5119 -0.1660 -0.1705 -0.3952 585 ASN A CA  
3902 C  C   . ASN A 593 ? 1.4397 2.4384 1.5578 -0.1242 -0.1684 -0.3658 585 ASN A C   
3903 O  O   . ASN A 593 ? 1.4242 2.4381 1.5777 -0.1348 -0.1614 -0.3656 585 ASN A O   
3904 C  CB  . ASN A 593 ? 1.3733 2.2328 1.4897 -0.1886 -0.1535 -0.3992 585 ASN A CB  
3905 C  CG  . ASN A 593 ? 1.5089 2.2816 1.5807 -0.1581 -0.1415 -0.3738 585 ASN A CG  
3906 O  OD1 . ASN A 593 ? 1.4729 2.2549 1.5046 -0.1348 -0.1473 -0.3637 585 ASN A OD1 
3907 N  ND2 . ASN A 593 ? 1.4426 2.1307 1.5186 -0.1616 -0.1265 -0.3612 585 ASN A ND2 
3908 N  N   . MET A 594 ? 1.3452 2.3523 1.4266 -0.0769 -0.1758 -0.3415 586 MET A N   
3909 C  CA  . MET A 594 ? 1.3639 2.4032 1.4486 -0.0286 -0.1781 -0.3169 586 MET A CA  
3910 C  C   . MET A 594 ? 1.4023 2.3377 1.4619 -0.0010 -0.1622 -0.2925 586 MET A C   
3911 O  O   . MET A 594 ? 1.4054 2.3541 1.4785 0.0286  -0.1573 -0.2810 586 MET A O   
3912 C  CB  . MET A 594 ? 1.4117 2.5099 1.4695 0.0114  -0.2004 -0.3016 586 MET A CB  
3913 C  CG  . MET A 594 ? 1.4217 2.6449 1.5101 -0.0055 -0.2190 -0.3203 586 MET A CG  
3914 S  SD  . MET A 594 ? 1.4862 2.7812 1.5487 0.0494  -0.2482 -0.2955 586 MET A SD  
3915 C  CE  . MET A 594 ? 1.4843 2.6905 1.4733 0.0468  -0.2530 -0.2828 586 MET A CE  
3916 N  N   . VAL A 595 ? 1.4127 2.2484 1.4349 -0.0106 -0.1544 -0.2856 587 VAL A N   
3917 C  CA  . VAL A 595 ? 1.4277 2.1585 1.4199 0.0119  -0.1417 -0.2603 587 VAL A CA  
3918 C  C   . VAL A 595 ? 1.4346 2.1377 1.4631 -0.0112 -0.1234 -0.2682 587 VAL A C   
3919 O  O   . VAL A 595 ? 1.4564 2.1117 1.4736 0.0147  -0.1144 -0.2500 587 VAL A O   
3920 C  CB  . VAL A 595 ? 1.4516 2.0910 1.3987 0.0001  -0.1376 -0.2509 587 VAL A CB  
3921 C  CG1 . VAL A 595 ? 1.4070 2.0309 1.3803 -0.0531 -0.1275 -0.2806 587 VAL A CG1 
3922 C  CG2 . VAL A 595 ? 1.4717 2.0039 1.3826 0.0236  -0.1283 -0.2206 587 VAL A CG2 
3923 N  N   . ASN A 596 ? 1.4376 2.1698 1.5069 -0.0614 -0.1202 -0.2955 588 ASN A N   
3924 C  CA  . ASN A 596 ? 1.4133 2.1381 1.5206 -0.0908 -0.1079 -0.3031 588 ASN A CA  
3925 C  C   . ASN A 596 ? 1.4498 2.2879 1.5935 -0.0806 -0.1123 -0.3081 588 ASN A C   
3926 O  O   . ASN A 596 ? 1.4382 2.3721 1.6018 -0.0871 -0.1269 -0.3224 588 ASN A O   
3927 C  CB  . ASN A 596 ? 1.3700 2.0728 1.5043 -0.1503 -0.1078 -0.3288 588 ASN A CB  
3928 C  CG  . ASN A 596 ? 1.4969 2.1677 1.6620 -0.1858 -0.0975 -0.3307 588 ASN A CG  
3929 O  OD1 . ASN A 596 ? 1.4741 2.1638 1.6460 -0.1705 -0.0890 -0.3174 588 ASN A OD1 
3930 N  ND2 . ASN A 596 ? 1.4036 2.0263 1.5865 -0.2336 -0.0995 -0.3483 588 ASN A ND2 
3931 N  N   . MET A 597 ? 1.3289 2.1609 1.4810 -0.0656 -0.0995 -0.2972 589 MET A N   
3932 C  CA  . MET A 597 ? 1.3216 2.2693 1.5084 -0.0497 -0.1010 -0.3015 589 MET A CA  
3933 C  C   . MET A 597 ? 1.3566 2.2944 1.5597 -0.0571 -0.0822 -0.2976 589 MET A C   
3934 O  O   . MET A 597 ? 1.3605 2.2038 1.5533 -0.0866 -0.0703 -0.2932 589 MET A O   
3935 C  CB  . MET A 597 ? 1.3671 2.3569 1.5325 0.0184  -0.1120 -0.2877 589 MET A CB  
3936 C  CG  . MET A 597 ? 1.4278 2.3184 1.5467 0.0679  -0.1045 -0.2640 589 MET A CG  
3937 S  SD  . MET A 597 ? 1.4946 2.4186 1.5840 0.1485  -0.1252 -0.2464 589 MET A SD  
3938 C  CE  . MET A 597 ? 1.4784 2.3587 1.5265 0.1358  -0.1439 -0.2385 589 MET A CE  
3939 N  N   . LEU A 598 ? 1.3274 2.3688 1.5565 -0.0301 -0.0800 -0.2997 590 LEU A N   
3940 C  CA  . LEU A 598 ? 1.3099 2.3621 1.5527 -0.0314 -0.0608 -0.2980 590 LEU A CA  
3941 C  C   . LEU A 598 ? 1.3431 2.3968 1.5628 0.0453  -0.0558 -0.2871 590 LEU A C   
3942 O  O   . LEU A 598 ? 1.3357 2.4966 1.5763 0.0867  -0.0641 -0.2919 590 LEU A O   
3943 C  CB  . LEU A 598 ? 1.2731 2.4596 1.5720 -0.0727 -0.0605 -0.3140 590 LEU A CB  
3944 C  CG  . LEU A 598 ? 1.2912 2.5005 1.6067 -0.0906 -0.0396 -0.3141 590 LEU A CG  
3945 C  CD1 . LEU A 598 ? 1.2802 2.3825 1.5858 -0.1543 -0.0329 -0.3103 590 LEU A CD1 
3946 C  CD2 . LEU A 598 ? 1.2858 2.6606 1.6554 -0.1127 -0.0408 -0.3271 590 LEU A CD2 
3947 N  N   . VAL A 599 ? 1.3352 2.2679 1.5115 0.0650  -0.0444 -0.2726 591 VAL A N   
3948 C  CA  . VAL A 599 ? 1.3602 2.2702 1.5056 0.1390  -0.0429 -0.2627 591 VAL A CA  
3949 C  C   . VAL A 599 ? 1.3695 2.3078 1.5273 0.1473  -0.0209 -0.2700 591 VAL A C   
3950 O  O   . VAL A 599 ? 1.3650 2.2202 1.5052 0.1151  -0.0049 -0.2650 591 VAL A O   
3951 C  CB  . VAL A 599 ? 1.4232 2.1783 1.5040 0.1609  -0.0474 -0.2406 591 VAL A CB  
3952 C  CG1 . VAL A 599 ? 1.4548 2.1769 1.4996 0.2370  -0.0504 -0.2307 591 VAL A CG1 
3953 C  CG2 . VAL A 599 ? 1.4385 2.1735 1.5036 0.1530  -0.0674 -0.2338 591 VAL A CG2 
3954 N  N   . LEU A 600 ? 1.2881 2.3486 1.4766 0.1907  -0.0206 -0.2822 592 LEU A N   
3955 C  CA  . LEU A 600 ? 1.2691 2.3764 1.4705 0.2062  0.0015  -0.2933 592 LEU A CA  
3956 C  C   . LEU A 600 ? 1.3344 2.4276 1.5087 0.2980  -0.0020 -0.2932 592 LEU A C   
3957 O  O   . LEU A 600 ? 1.3301 2.5481 1.5399 0.3424  -0.0015 -0.3088 592 LEU A O   
3958 C  CB  . LEU A 600 ? 1.2229 2.5043 1.4913 0.1742  0.0082  -0.3123 592 LEU A CB  
3959 C  CG  . LEU A 600 ? 1.2147 2.5196 1.5126 0.0831  0.0054  -0.3138 592 LEU A CG  
3960 C  CD1 . LEU A 600 ? 1.1704 2.6510 1.5303 0.0523  0.0100  -0.3298 592 LEU A CD1 
3961 C  CD2 . LEU A 600 ? 1.2252 2.4060 1.4957 0.0273  0.0190  -0.3048 592 LEU A CD2 
3962 N  N   . GLY A 601 ? 1.4301 2.3708 1.5414 0.3263  -0.0077 -0.2756 593 GLY A N   
3963 C  CA  . GLY A 601 ? 1.4726 2.3727 1.5482 0.4124  -0.0168 -0.2734 593 GLY A CA  
3964 C  C   . GLY A 601 ? 1.5233 2.4474 1.5956 0.4623  -0.0488 -0.2645 593 GLY A C   
3965 O  O   . GLY A 601 ? 1.5276 2.3932 1.5780 0.4377  -0.0658 -0.2467 593 GLY A O   
3966 N  N   . LYS A 602 ? 1.5278 2.5423 1.6224 0.5329  -0.0577 -0.2774 594 LYS A N   
3967 C  CA  . LYS A 602 ? 1.5554 2.6004 1.6491 0.5850  -0.0919 -0.2680 594 LYS A CA  
3968 C  C   . LYS A 602 ? 1.5390 2.7183 1.6888 0.5442  -0.1006 -0.2732 594 LYS A C   
3969 O  O   . LYS A 602 ? 1.5561 2.7633 1.7052 0.5710  -0.1300 -0.2629 594 LYS A O   
3970 C  CB  . LYS A 602 ? 1.6013 2.7000 1.7048 0.6782  -0.1012 -0.2818 594 LYS A CB  
3971 C  CG  . LYS A 602 ? 1.7757 2.7283 1.8085 0.7454  -0.1274 -0.2629 594 LYS A CG  
3972 C  CD  . LYS A 602 ? 1.8542 2.6505 1.8261 0.7314  -0.1095 -0.2561 594 LYS A CD  
3973 C  CE  . LYS A 602 ? 1.9861 2.6242 1.8802 0.7866  -0.1403 -0.2321 594 LYS A CE  
3974 N  NZ  . LYS A 602 ? 2.0207 2.5943 1.8817 0.7582  -0.1680 -0.1995 594 LYS A NZ  
3975 N  N   . HIS A 603 ? 1.4205 2.6795 1.6155 0.4767  -0.0775 -0.2879 595 HIS A N   
3976 C  CA  . HIS A 603 ? 1.3852 2.7760 1.6344 0.4333  -0.0857 -0.2954 595 HIS A CA  
3977 C  C   . HIS A 603 ? 1.4014 2.7275 1.6374 0.3525  -0.0859 -0.2871 595 HIS A C   
3978 O  O   . HIS A 603 ? 1.3786 2.6448 1.6081 0.2978  -0.0651 -0.2888 595 HIS A O   
3979 C  CB  . HIS A 603 ? 1.3416 2.8897 1.6565 0.4144  -0.0649 -0.3189 595 HIS A CB  
3980 C  CG  . HIS A 603 ? 1.3774 3.0249 1.7192 0.4961  -0.0661 -0.3326 595 HIS A CG  
3981 N  ND1 . HIS A 603 ? 1.3538 3.1419 1.7493 0.4938  -0.0437 -0.3550 595 HIS A ND1 
3982 C  CD2 . HIS A 603 ? 1.4372 3.0652 1.7603 0.5835  -0.0887 -0.3277 595 HIS A CD2 
3983 C  CE1 . HIS A 603 ? 1.3714 3.2269 1.7833 0.5802  -0.0503 -0.3664 595 HIS A CE1 
3984 N  NE2 . HIS A 603 ? 1.4254 3.1811 1.7940 0.6370  -0.0792 -0.3500 595 HIS A NE2 
3985 N  N   . LEU A 604 ? 1.3649 2.7049 1.5970 0.3466  -0.1106 -0.2792 596 LEU A N   
3986 C  CA  . LEU A 604 ? 1.3320 2.6182 1.5521 0.2773  -0.1132 -0.2758 596 LEU A CA  
3987 C  C   . LEU A 604 ? 1.2942 2.7119 1.5718 0.2208  -0.1152 -0.2933 596 LEU A C   
3988 O  O   . LEU A 604 ? 1.2923 2.8501 1.6163 0.2402  -0.1203 -0.3034 596 LEU A O   
3989 C  CB  . LEU A 604 ? 1.3614 2.5748 1.5336 0.2993  -0.1383 -0.2573 596 LEU A CB  
3990 C  CG  . LEU A 604 ? 1.4178 2.4959 1.5259 0.3520  -0.1435 -0.2352 596 LEU A CG  
3991 C  CD1 . LEU A 604 ? 1.4525 2.4898 1.5184 0.3710  -0.1728 -0.2155 596 LEU A CD1 
3992 C  CD2 . LEU A 604 ? 1.4340 2.3807 1.5096 0.3156  -0.1213 -0.2295 596 LEU A CD2 
3993 N  N   . GLY A 605 ? 1.3091 2.6807 1.5837 0.1512  -0.1128 -0.2973 597 GLY A N   
3994 C  CA  . GLY A 605 ? 1.2721 2.7469 1.5932 0.0906  -0.1184 -0.3138 597 GLY A CA  
3995 C  C   . GLY A 605 ? 1.3172 2.7378 1.6174 0.0492  -0.1329 -0.3160 597 GLY A C   
3996 O  O   . GLY A 605 ? 1.2980 2.7053 1.6129 -0.0170 -0.1299 -0.3283 597 GLY A O   
3997 N  N   . ILE A 606 ? 1.2969 2.6856 1.5608 0.0889  -0.1501 -0.3047 598 ILE A N   
3998 C  CA  . ILE A 606 ? 1.3015 2.6406 1.5382 0.0576  -0.1628 -0.3074 598 ILE A CA  
3999 C  C   . ILE A 606 ? 1.2997 2.7366 1.5748 0.0026  -0.1748 -0.3290 598 ILE A C   
4000 O  O   . ILE A 606 ? 1.2789 2.8441 1.5934 0.0088  -0.1845 -0.3343 598 ILE A O   
4001 C  CB  . ILE A 606 ? 1.3630 2.6829 1.5567 0.1107  -0.1830 -0.2894 598 ILE A CB  
4002 C  CG1 . ILE A 606 ? 1.4038 2.6532 1.5652 0.1750  -0.1785 -0.2672 598 ILE A CG1 
4003 C  CG2 . ILE A 606 ? 1.3742 2.6153 1.5267 0.0807  -0.1890 -0.2898 598 ILE A CG2 
4004 C  CD1 . ILE A 606 ? 1.4684 2.8146 1.6519 0.2374  -0.1919 -0.2620 598 ILE A CD1 
4005 N  N   . PRO A 607 ? 1.3560 2.7326 1.6205 -0.0517 -0.1750 -0.3427 599 PRO A N   
4006 C  CA  . PRO A 607 ? 1.3354 2.7893 1.6253 -0.1022 -0.1912 -0.3648 599 PRO A CA  
4007 C  C   . PRO A 607 ? 1.3828 2.9115 1.6604 -0.0748 -0.2147 -0.3622 599 PRO A C   
4008 O  O   . PRO A 607 ? 1.4102 2.8824 1.6428 -0.0384 -0.2196 -0.3483 599 PRO A O   
4009 C  CB  . PRO A 607 ? 1.3420 2.6884 1.6109 -0.1492 -0.1869 -0.3795 599 PRO A CB  
4010 C  CG  . PRO A 607 ? 1.3787 2.6151 1.6332 -0.1402 -0.1647 -0.3663 599 PRO A CG  
4011 C  CD  . PRO A 607 ? 1.3733 2.6105 1.6076 -0.0719 -0.1598 -0.3409 599 PRO A CD  
4012 N  N   . LYS A 608 ? 1.3263 2.9815 1.6415 -0.0953 -0.2308 -0.3734 600 LYS A N   
4013 C  CA  . LYS A 608 ? 1.3379 3.0727 1.6440 -0.0741 -0.2559 -0.3706 600 LYS A CA  
4014 C  C   . LYS A 608 ? 1.3734 3.0532 1.6407 -0.1073 -0.2659 -0.3854 600 LYS A C   
4015 O  O   . LYS A 608 ? 1.3442 3.0170 1.6231 -0.1662 -0.2672 -0.4104 600 LYS A O   
4016 C  CB  . LYS A 608 ? 1.3325 3.2216 1.6918 -0.0930 -0.2709 -0.3787 600 LYS A CB  
4017 C  CG  . LYS A 608 ? 1.4084 3.3966 1.7679 -0.0502 -0.2961 -0.3666 600 LYS A CG  
4018 C  CD  . LYS A 608 ? 1.3882 3.5375 1.8077 -0.0642 -0.3083 -0.3717 600 LYS A CD  
4019 C  CE  . LYS A 608 ? 1.3919 3.6415 1.8171 -0.0122 -0.3342 -0.3562 600 LYS A CE  
4020 N  NZ  . LYS A 608 ? 1.4338 3.6527 1.8487 0.0693  -0.3289 -0.3336 600 LYS A NZ  
4021 N  N   . PRO A 609 ? 1.4237 3.0639 1.6429 -0.0699 -0.2741 -0.3705 601 PRO A N   
4022 C  CA  . PRO A 609 ? 1.4390 3.0224 1.6141 -0.0956 -0.2792 -0.3837 601 PRO A CA  
4023 C  C   . PRO A 609 ? 1.4893 3.1626 1.6712 -0.1336 -0.3019 -0.4060 601 PRO A C   
4024 O  O   . PRO A 609 ? 1.4880 3.1194 1.6450 -0.1706 -0.3025 -0.4297 601 PRO A O   
4025 C  CB  . PRO A 609 ? 1.4875 3.0267 1.6112 -0.0417 -0.2852 -0.3542 601 PRO A CB  
4026 C  CG  . PRO A 609 ? 1.5302 3.1493 1.6772 0.0092  -0.2980 -0.3316 601 PRO A CG  
4027 C  CD  . PRO A 609 ? 1.4654 3.1155 1.6679 -0.0003 -0.2813 -0.3400 601 PRO A CD  
4028 N  N   . PHE A 610 ? 1.5099 3.3058 1.7247 -0.1236 -0.3204 -0.3998 602 PHE A N   
4029 C  CA  . PHE A 610 ? 1.5161 3.4069 1.7356 -0.1571 -0.3458 -0.4167 602 PHE A CA  
4030 C  C   . PHE A 610 ? 1.5942 3.4609 1.7548 -0.1489 -0.3594 -0.4148 602 PHE A C   
4031 O  O   . PHE A 610 ? 1.6003 3.4912 1.7455 -0.1910 -0.3721 -0.4399 602 PHE A O   
4032 C  CB  . PHE A 610 ? 1.5028 3.3904 1.7449 -0.2275 -0.3440 -0.4516 602 PHE A CB  
4033 C  CG  . PHE A 610 ? 1.4916 3.4112 1.7879 -0.2451 -0.3324 -0.4485 602 PHE A CG  
4034 C  CD1 . PHE A 610 ? 1.5090 3.5324 1.8427 -0.2121 -0.3367 -0.4272 602 PHE A CD1 
4035 C  CD2 . PHE A 610 ? 1.4946 3.3379 1.8023 -0.2937 -0.3171 -0.4655 602 PHE A CD2 
4036 C  CE1 . PHE A 610 ? 1.4973 3.5556 1.8768 -0.2307 -0.3233 -0.4243 602 PHE A CE1 
4037 C  CE2 . PHE A 610 ? 1.5002 3.3700 1.8505 -0.3139 -0.3069 -0.4587 602 PHE A CE2 
4038 C  CZ  . PHE A 610 ? 1.4800 3.4613 1.8651 -0.2842 -0.3086 -0.4388 602 PHE A CZ  
4039 N  N   . GLY A 611 ? 1.5384 3.3563 1.6628 -0.0965 -0.3579 -0.3851 603 GLY A N   
4040 C  CA  . GLY A 611 ? 1.5787 3.3744 1.6425 -0.0884 -0.3713 -0.3769 603 GLY A CA  
4041 C  C   . GLY A 611 ? 1.6378 3.5501 1.7013 -0.0842 -0.4048 -0.3696 603 GLY A C   
4042 O  O   . GLY A 611 ? 1.6226 3.6330 1.7358 -0.0757 -0.4174 -0.3653 603 GLY A O   
4043 N  N   . PRO A 612 ? 1.6481 3.5557 1.6554 -0.0920 -0.4198 -0.3677 604 PRO A N   
4044 C  CA  . PRO A 612 ? 1.6747 3.6735 1.6715 -0.0923 -0.4500 -0.3573 604 PRO A CA  
4045 C  C   . PRO A 612 ? 1.7158 3.7851 1.7405 -0.0359 -0.4725 -0.3208 604 PRO A C   
4046 O  O   . PRO A 612 ? 1.7269 3.7495 1.7378 0.0152  -0.4736 -0.2926 604 PRO A O   
4047 C  CB  . PRO A 612 ? 1.7229 3.6703 1.6438 -0.0971 -0.4556 -0.3505 604 PRO A CB  
4048 C  CG  . PRO A 612 ? 1.7345 3.5906 1.6368 -0.1256 -0.4268 -0.3794 604 PRO A CG  
4049 C  CD  . PRO A 612 ? 1.6740 3.4782 1.6230 -0.1040 -0.4036 -0.3736 604 PRO A CD  
4050 N  N   . VAL A 613 ? 1.5807 3.7372 1.6434 -0.0437 -0.4838 -0.3189 605 VAL A N   
4051 C  CA  . VAL A 613 ? 1.5847 3.8168 1.6835 0.0097  -0.5036 -0.2886 605 VAL A CA  
4052 C  C   . VAL A 613 ? 1.6576 3.8949 1.7103 0.0412  -0.5348 -0.2556 605 VAL A C   
4053 O  O   . VAL A 613 ? 1.6826 3.9295 1.7015 0.0068  -0.5454 -0.2585 605 VAL A O   
4054 C  CB  . VAL A 613 ? 1.5985 3.9269 1.7581 -0.0133 -0.5027 -0.2984 605 VAL A CB  
4055 C  CG1 . VAL A 613 ? 1.6105 4.0216 1.8085 0.0450  -0.5227 -0.2688 605 VAL A CG1 
4056 C  CG2 . VAL A 613 ? 1.5511 3.8711 1.7552 -0.0458 -0.4739 -0.3253 605 VAL A CG2 
4057 N  N   . ILE A 614 ? 1.6505 3.8752 1.6998 0.1065  -0.5507 -0.2237 606 ILE A N   
4058 C  CA  . ILE A 614 ? 1.7060 3.9243 1.7119 0.1405  -0.5846 -0.1866 606 ILE A CA  
4059 C  C   . ILE A 614 ? 1.7456 4.0156 1.7965 0.2097  -0.6054 -0.1598 606 ILE A C   
4060 O  O   . ILE A 614 ? 1.7366 3.9752 1.8036 0.2600  -0.6001 -0.1519 606 ILE A O   
4061 C  CB  . ILE A 614 ? 1.7546 3.8644 1.6836 0.1513  -0.5882 -0.1686 606 ILE A CB  
4062 C  CG1 . ILE A 614 ? 1.7430 3.8083 1.6261 0.0841  -0.5674 -0.1968 606 ILE A CG1 
4063 C  CG2 . ILE A 614 ? 1.8258 3.9205 1.7106 0.1885  -0.6267 -0.1243 606 ILE A CG2 
4064 C  CD1 . ILE A 614 ? 1.7893 3.7508 1.6046 0.0866  -0.5604 -0.1861 606 ILE A CD1 
4065 N  N   . ASN A 615 ? 1.6300 3.9782 1.7013 0.2125  -0.6288 -0.1477 607 ASN A N   
4066 C  CA  . ASN A 615 ? 1.6580 4.0655 1.7766 0.2768  -0.6502 -0.1249 607 ASN A CA  
4067 C  C   . ASN A 615 ? 1.6015 4.0590 1.7944 0.3013  -0.6242 -0.1438 607 ASN A C   
4068 O  O   . ASN A 615 ? 1.6056 4.0461 1.8171 0.3675  -0.6277 -0.1307 607 ASN A O   
4069 C  CB  . ASN A 615 ? 1.7138 4.0426 1.7861 0.3390  -0.6797 -0.0862 607 ASN A CB  
4070 C  CG  . ASN A 615 ? 1.9253 4.3094 2.0326 0.3982  -0.7132 -0.0597 607 ASN A CG  
4071 O  OD1 . ASN A 615 ? 1.8976 4.3769 2.0422 0.3815  -0.7236 -0.0626 607 ASN A OD1 
4072 N  ND2 . ASN A 615 ? 1.8773 4.1969 1.9716 0.4680  -0.7315 -0.0340 607 ASN A ND2 
4073 N  N   . GLY A 616 ? 1.5614 4.0747 1.7930 0.2459  -0.5981 -0.1749 608 GLY A N   
4074 C  CA  . GLY A 616 ? 1.5137 4.0854 1.8150 0.2567  -0.5726 -0.1922 608 GLY A CA  
4075 C  C   . GLY A 616 ? 1.4491 3.9586 1.7499 0.2357  -0.5394 -0.2153 608 GLY A C   
4076 O  O   . GLY A 616 ? 1.4095 3.9450 1.7386 0.1805  -0.5150 -0.2414 608 GLY A O   
4077 N  N   . ARG A 617 ? 1.5245 3.9460 1.7909 0.2781  -0.5405 -0.2039 609 ARG A N   
4078 C  CA  . ARG A 617 ? 1.4815 3.8435 1.7501 0.2670  -0.5115 -0.2226 609 ARG A CA  
4079 C  C   . ARG A 617 ? 1.5069 3.7512 1.7071 0.2231  -0.5018 -0.2288 609 ARG A C   
4080 O  O   . ARG A 617 ? 1.5383 3.7463 1.6809 0.2216  -0.5242 -0.2126 609 ARG A O   
4081 C  CB  . ARG A 617 ? 1.4976 3.8168 1.7746 0.3443  -0.5082 -0.2068 609 ARG A CB  
4082 N  N   . CYS A 618 ? 1.5463 3.7231 1.7517 0.1856  -0.4649 -0.2511 610 CYS A N   
4083 C  CA  . CYS A 618 ? 1.5517 3.6067 1.6996 0.1443  -0.4472 -0.2601 610 CYS A CA  
4084 C  C   . CYS A 618 ? 1.6360 3.5694 1.7226 0.1888  -0.4491 -0.2306 610 CYS A C   
4085 O  O   . CYS A 618 ? 1.6447 3.5339 1.7393 0.2402  -0.4420 -0.2149 610 CYS A O   
4086 C  CB  . CYS A 618 ? 1.5067 3.5169 1.6813 0.1011  -0.4104 -0.2879 610 CYS A CB  
4087 S  SG  . CYS A 618 ? 1.5361 3.3886 1.6495 0.0633  -0.3851 -0.2987 610 CYS A SG  
4088 N  N   . CYS A 619 ? 1.6881 3.5686 1.7111 0.1665  -0.4593 -0.2237 611 CYS A N   
4089 C  CA  . CYS A 619 ? 1.7372 3.5085 1.6948 0.2002  -0.4665 -0.1916 611 CYS A CA  
4090 C  C   . CYS A 619 ? 1.7383 3.3828 1.6794 0.1966  -0.4313 -0.1948 611 CYS A C   
4091 O  O   . CYS A 619 ? 1.7698 3.3252 1.6750 0.2378  -0.4343 -0.1664 611 CYS A O   
4092 C  CB  . CYS A 619 ? 1.7743 3.5376 1.6676 0.1687  -0.4856 -0.1844 611 CYS A CB  
4093 S  SG  . CYS A 619 ? 1.7675 3.5173 1.6475 0.0865  -0.4579 -0.2286 611 CYS A SG  
4094 N  N   . LEU A 620 ? 1.6167 3.2501 1.5828 0.1463  -0.4009 -0.2283 612 LEU A N   
4095 C  CA  . LEU A 620 ? 1.5943 3.1148 1.5524 0.1390  -0.3680 -0.2328 612 LEU A CA  
4096 C  C   . LEU A 620 ? 1.6135 3.1193 1.6061 0.1865  -0.3585 -0.2216 612 LEU A C   
4097 O  O   . LEU A 620 ? 1.6266 3.0284 1.5887 0.2137  -0.3484 -0.2028 612 LEU A O   
4098 C  CB  . LEU A 620 ? 1.5457 3.0644 1.5296 0.0759  -0.3428 -0.2720 612 LEU A CB  
4099 C  CG  . LEU A 620 ? 1.5788 3.0782 1.5217 0.0288  -0.3427 -0.2900 612 LEU A CG  
4100 C  CD1 . LEU A 620 ? 1.5339 3.0232 1.5084 -0.0264 -0.3205 -0.3311 612 LEU A CD1 
4101 C  CD2 . LEU A 620 ? 1.6287 3.0227 1.5061 0.0414  -0.3378 -0.2667 612 LEU A CD2 
4102 N  N   . GLU A 621 ? 1.5125 3.1267 1.5673 0.1950  -0.3620 -0.2338 613 GLU A N   
4103 C  CA  . GLU A 621 ? 1.5042 3.1277 1.5965 0.2415  -0.3525 -0.2278 613 GLU A CA  
4104 C  C   . GLU A 621 ? 1.5805 3.1750 1.6424 0.3146  -0.3773 -0.1946 613 GLU A C   
4105 O  O   . GLU A 621 ? 1.5980 3.1283 1.6557 0.3575  -0.3674 -0.1841 613 GLU A O   
4106 C  CB  . GLU A 621 ? 1.4731 3.2402 1.6394 0.2320  -0.3534 -0.2478 613 GLU A CB  
4107 C  CG  . GLU A 621 ? 1.4925 3.2944 1.6868 0.1561  -0.3381 -0.2791 613 GLU A CG  
4108 C  CD  . GLU A 621 ? 1.5257 3.4665 1.7913 0.1424  -0.3389 -0.2950 613 GLU A CD  
4109 O  OE1 . GLU A 621 ? 1.3883 3.3837 1.6885 0.1914  -0.3378 -0.2864 613 GLU A OE1 
4110 O  OE2 . GLU A 621 ? 1.4436 3.4407 1.7300 0.0822  -0.3413 -0.3168 613 GLU A OE2 
4111 N  N   . GLU A 622 ? 1.6816 3.3200 1.7194 0.3272  -0.4120 -0.1784 614 GLU A N   
4112 C  CA  . GLU A 622 ? 1.7344 3.3474 1.7410 0.3945  -0.4446 -0.1445 614 GLU A CA  
4113 C  C   . GLU A 622 ? 1.7984 3.2532 1.7344 0.4087  -0.4406 -0.1201 614 GLU A C   
4114 O  O   . GLU A 622 ? 1.8341 3.2308 1.7538 0.4685  -0.4527 -0.0988 614 GLU A O   
4115 C  CB  . GLU A 622 ? 1.4983 3.1855 1.4872 0.3918  -0.4844 -0.1305 614 GLU A CB  
4116 C  CG  . GLU A 622 ? 1.5664 3.2666 1.5453 0.4655  -0.5260 -0.0983 614 GLU A CG  
4117 C  CD  . GLU A 622 ? 1.5547 3.3492 1.6082 0.5189  -0.5268 -0.1092 614 GLU A CD  
4118 O  OE1 . GLU A 622 ? 1.5446 3.4796 1.6504 0.5162  -0.5421 -0.1192 614 GLU A OE1 
4119 O  OE2 . GLU A 622 ? 1.5579 3.2899 1.6175 0.5630  -0.5118 -0.1085 614 GLU A OE2 
4120 N  N   . LYS A 623 ? 1.6767 3.0631 1.5712 0.3537  -0.4244 -0.1242 615 LYS A N   
4121 C  CA  . LYS A 623 ? 1.7075 2.9505 1.5353 0.3573  -0.4190 -0.1007 615 LYS A CA  
4122 C  C   . LYS A 623 ? 1.7183 2.8844 1.5631 0.3618  -0.3841 -0.1110 615 LYS A C   
4123 O  O   . LYS A 623 ? 1.7538 2.8155 1.5599 0.3967  -0.3868 -0.0876 615 LYS A O   
4124 C  CB  . LYS A 623 ? 1.7152 2.9254 1.4962 0.2973  -0.4128 -0.1033 615 LYS A CB  
4125 C  CG  . LYS A 623 ? 1.8112 2.8860 1.5204 0.2972  -0.4107 -0.0748 615 LYS A CG  
4126 C  CD  . LYS A 623 ? 1.8668 2.9298 1.5319 0.2402  -0.4053 -0.0788 615 LYS A CD  
4127 C  CE  . LYS A 623 ? 1.9498 2.8892 1.5430 0.2379  -0.4052 -0.0467 615 LYS A CE  
4128 N  NZ  . LYS A 623 ? 1.9850 2.9248 1.5359 0.1834  -0.3982 -0.0519 615 LYS A NZ  
4129 N  N   . VAL A 624 ? 1.6552 2.8702 1.5547 0.3235  -0.3541 -0.1450 616 VAL A N   
4130 C  CA  . VAL A 624 ? 1.6272 2.7830 1.5481 0.3217  -0.3214 -0.1562 616 VAL A CA  
4131 C  C   . VAL A 624 ? 1.6647 2.8271 1.6045 0.3891  -0.3277 -0.1468 616 VAL A C   
4132 O  O   . VAL A 624 ? 1.6745 2.7369 1.5901 0.4124  -0.3157 -0.1364 616 VAL A O   
4133 C  CB  . VAL A 624 ? 1.5964 2.8191 1.5765 0.2670  -0.2950 -0.1929 616 VAL A CB  
4134 C  CG1 . VAL A 624 ? 1.5764 2.7724 1.5897 0.2742  -0.2675 -0.2027 616 VAL A CG1 
4135 C  CG2 . VAL A 624 ? 1.5729 2.7488 1.5295 0.2048  -0.2824 -0.2058 616 VAL A CG2 
4136 N  N   . CYS A 625 ? 1.5836 2.8657 1.5660 0.4214  -0.3474 -0.1516 617 CYS A N   
4137 C  CA  . CYS A 625 ? 1.6025 2.9062 1.6068 0.4928  -0.3563 -0.1462 617 CYS A CA  
4138 C  C   . CYS A 625 ? 1.6784 2.8785 1.6178 0.5496  -0.3867 -0.1114 617 CYS A C   
4139 O  O   . CYS A 625 ? 1.6987 2.8346 1.6277 0.6001  -0.3846 -0.1054 617 CYS A O   
4140 C  CB  . CYS A 625 ? 1.5910 3.0591 1.6599 0.5135  -0.3729 -0.1591 617 CYS A CB  
4141 S  SG  . CYS A 625 ? 1.5404 3.1367 1.6920 0.4574  -0.3395 -0.1981 617 CYS A SG  
4142 N  N   . SER A 626 ? 1.5634 2.7443 1.4554 0.5385  -0.4161 -0.0885 618 SER A N   
4143 C  CA  . SER A 626 ? 1.6478 2.7303 1.4723 0.5848  -0.4518 -0.0506 618 SER A CA  
4144 C  C   . SER A 626 ? 1.6641 2.5877 1.4314 0.5813  -0.4358 -0.0357 618 SER A C   
4145 O  O   . SER A 626 ? 1.7372 2.5648 1.4537 0.6285  -0.4617 -0.0073 618 SER A O   
4146 C  CB  . SER A 626 ? 1.6822 2.7784 1.4626 0.5579  -0.4834 -0.0284 618 SER A CB  
4147 O  OG  . SER A 626 ? 1.6534 2.6903 1.3950 0.4908  -0.4616 -0.0295 618 SER A OG  
4148 N  N   . LEU A 627 ? 1.7062 2.6003 1.4813 0.5242  -0.3961 -0.0541 619 LEU A N   
4149 C  CA  . LEU A 627 ? 1.7136 2.4649 1.4392 0.5119  -0.3785 -0.0410 619 LEU A CA  
4150 C  C   . LEU A 627 ? 1.6895 2.4160 1.4477 0.5348  -0.3503 -0.0594 619 LEU A C   
4151 O  O   . LEU A 627 ? 1.7213 2.3265 1.4357 0.5517  -0.3464 -0.0441 619 LEU A O   
4152 C  CB  . LEU A 627 ? 1.6647 2.3911 1.3760 0.4363  -0.3541 -0.0483 619 LEU A CB  
4153 C  CG  . LEU A 627 ? 1.6912 2.4283 1.3585 0.4054  -0.3762 -0.0313 619 LEU A CG  
4154 C  CD1 . LEU A 627 ? 1.6322 2.3777 1.3074 0.3342  -0.3464 -0.0533 619 LEU A CD1 
4155 C  CD2 . LEU A 627 ? 1.7711 2.3920 1.3554 0.4268  -0.4044 0.0128  619 LEU A CD2 
4156 N  N   . LEU A 628 ? 1.6878 2.5315 1.5200 0.5325  -0.3317 -0.0914 620 LEU A N   
4157 C  CA  . LEU A 628 ? 1.6609 2.4980 1.5273 0.5419  -0.3005 -0.1121 620 LEU A CA  
4158 C  C   . LEU A 628 ? 1.7108 2.5997 1.6051 0.6182  -0.3126 -0.1185 620 LEU A C   
4159 O  O   . LEU A 628 ? 1.7155 2.5512 1.6065 0.6464  -0.2963 -0.1251 620 LEU A O   
4160 C  CB  . LEU A 628 ? 1.5980 2.5253 1.5262 0.4804  -0.2686 -0.1437 620 LEU A CB  
4161 C  CG  . LEU A 628 ? 1.6108 2.4734 1.5171 0.4084  -0.2507 -0.1445 620 LEU A CG  
4162 C  CD1 . LEU A 628 ? 1.5552 2.5125 1.5227 0.3503  -0.2292 -0.1757 620 LEU A CD1 
4163 C  CD2 . LEU A 628 ? 1.6471 2.3691 1.5121 0.4030  -0.2319 -0.1329 620 LEU A CD2 
4164 N  N   . GLU A 629 ? 1.7215 2.7164 1.6440 0.6523  -0.3413 -0.1180 621 GLU A N   
4165 C  CA  . GLU A 629 ? 1.7358 2.7880 1.6886 0.7321  -0.3569 -0.1249 621 GLU A CA  
4166 C  C   . GLU A 629 ? 1.8278 2.7415 1.7178 0.7978  -0.3791 -0.1030 621 GLU A C   
4167 O  O   . GLU A 629 ? 1.8320 2.7459 1.7395 0.8519  -0.3712 -0.1185 621 GLU A O   
4168 C  CB  . GLU A 629 ? 1.5920 2.7766 1.5821 0.7560  -0.3901 -0.1232 621 GLU A CB  
4169 C  CG  . GLU A 629 ? 1.5166 2.8637 1.5830 0.7096  -0.3707 -0.1508 621 GLU A CG  
4170 C  CD  . GLU A 629 ? 1.5344 3.0036 1.6298 0.7256  -0.4065 -0.1450 621 GLU A CD  
4171 O  OE1 . GLU A 629 ? 1.5914 3.0062 1.6362 0.7434  -0.4440 -0.1162 621 GLU A OE1 
4172 O  OE2 . GLU A 629 ? 1.4945 3.1161 1.6620 0.7177  -0.3988 -0.1674 621 GLU A OE2 
4173 N  N   . PRO A 630 ? 1.7767 2.5726 1.5912 0.7924  -0.4079 -0.0675 622 PRO A N   
4174 C  CA  . PRO A 630 ? 1.8548 2.5080 1.6048 0.8495  -0.4315 -0.0453 622 PRO A CA  
4175 C  C   . PRO A 630 ? 1.8691 2.4193 1.5981 0.8424  -0.3972 -0.0556 622 PRO A C   
4176 O  O   . PRO A 630 ? 1.9204 2.3654 1.6058 0.8969  -0.4131 -0.0462 622 PRO A O   
4177 C  CB  . PRO A 630 ? 1.9004 2.4562 1.5735 0.8212  -0.4635 -0.0039 622 PRO A CB  
4178 C  CG  . PRO A 630 ? 1.9024 2.5834 1.6095 0.7852  -0.4724 -0.0058 622 PRO A CG  
4179 C  CD  . PRO A 630 ? 1.7937 2.5921 1.5778 0.7439  -0.4273 -0.0455 622 PRO A CD  
4180 N  N   . LEU A 631 ? 1.8429 2.4183 1.6000 0.7758  -0.3536 -0.0741 623 LEU A N   
4181 C  CA  . LEU A 631 ? 1.8275 2.3206 1.5718 0.7639  -0.3197 -0.0853 623 LEU A CA  
4182 C  C   . LEU A 631 ? 1.8221 2.4073 1.6266 0.8061  -0.2986 -0.1207 623 LEU A C   
4183 O  O   . LEU A 631 ? 1.8287 2.3474 1.6180 0.8198  -0.2778 -0.1311 623 LEU A O   
4184 C  CB  . LEU A 631 ? 1.7565 2.2381 1.5080 0.6757  -0.2848 -0.0898 623 LEU A CB  
4185 C  CG  . LEU A 631 ? 1.8110 2.1907 1.5003 0.6291  -0.2963 -0.0585 623 LEU A CG  
4186 C  CD1 . LEU A 631 ? 1.7579 2.1494 1.4706 0.5485  -0.2611 -0.0712 623 LEU A CD1 
4187 C  CD2 . LEU A 631 ? 1.8907 2.1046 1.5001 0.6549  -0.3115 -0.0298 623 LEU A CD2 
4188 N  N   . GLY A 632 ? 1.7652 2.5086 1.6369 0.8248  -0.3042 -0.1390 624 GLY A N   
4189 C  CA  . GLY A 632 ? 1.7341 2.5951 1.6718 0.8593  -0.2828 -0.1739 624 GLY A CA  
4190 C  C   . GLY A 632 ? 1.6811 2.6470 1.6783 0.7860  -0.2426 -0.1973 624 GLY A C   
4191 O  O   . GLY A 632 ? 1.6439 2.6685 1.6794 0.7885  -0.2125 -0.2236 624 GLY A O   
4192 N  N   . LEU A 633 ? 1.6239 2.6124 1.6262 0.7193  -0.2438 -0.1881 625 LEU A N   
4193 C  CA  . LEU A 633 ? 1.5578 2.6260 1.6090 0.6432  -0.2116 -0.2076 625 LEU A CA  
4194 C  C   . LEU A 633 ? 1.5461 2.7887 1.6648 0.6315  -0.2205 -0.2217 625 LEU A C   
4195 O  O   . LEU A 633 ? 1.5482 2.8133 1.6589 0.6243  -0.2474 -0.2083 625 LEU A O   
4196 C  CB  . LEU A 633 ? 1.5522 2.5164 1.5627 0.5714  -0.2040 -0.1925 625 LEU A CB  
4197 C  CG  . LEU A 633 ? 1.6132 2.4018 1.5530 0.5746  -0.1988 -0.1732 625 LEU A CG  
4198 C  CD1 . LEU A 633 ? 1.5993 2.3092 1.5088 0.5045  -0.1924 -0.1598 625 LEU A CD1 
4199 C  CD2 . LEU A 633 ? 1.6144 2.3804 1.5639 0.5809  -0.1683 -0.1898 625 LEU A CD2 
4200 N  N   . GLN A 634 ? 1.4681 2.8366 1.6510 0.6263  -0.1982 -0.2480 626 GLN A N   
4201 C  CA  . GLN A 634 ? 1.4275 2.9708 1.6784 0.6093  -0.2048 -0.2619 626 GLN A CA  
4202 C  C   . GLN A 634 ? 1.4077 2.9689 1.6709 0.5159  -0.1949 -0.2651 626 GLN A C   
4203 O  O   . GLN A 634 ? 1.3566 2.9073 1.6330 0.4602  -0.1660 -0.2770 626 GLN A O   
4204 C  CB  . GLN A 634 ? 1.4009 3.0794 1.7156 0.6335  -0.1841 -0.2880 626 GLN A CB  
4205 N  N   . CYS A 635 ? 1.4130 2.9986 1.6697 0.4993  -0.2211 -0.2550 627 CYS A N   
4206 C  CA  . CYS A 635 ? 1.3828 2.9774 1.6453 0.4162  -0.2164 -0.2606 627 CYS A CA  
4207 C  C   . CYS A 635 ? 1.3491 3.1102 1.6832 0.3776  -0.2122 -0.2815 627 CYS A C   
4208 O  O   . CYS A 635 ? 1.3451 3.2339 1.7195 0.4154  -0.2289 -0.2845 627 CYS A O   
4209 C  CB  . CYS A 635 ? 1.4193 2.9694 1.6387 0.4123  -0.2455 -0.2429 627 CYS A CB  
4210 S  SG  . CYS A 635 ? 1.5104 2.8715 1.6410 0.4496  -0.2555 -0.2130 627 CYS A SG  
4211 N  N   . THR A 636 ? 1.3343 3.0924 1.6838 0.3012  -0.1925 -0.2946 628 THR A N   
4212 C  CA  . THR A 636 ? 1.2791 3.1828 1.6904 0.2515  -0.1904 -0.3123 628 THR A CA  
4213 C  C   . THR A 636 ? 1.2785 3.1440 1.6814 0.1675  -0.1911 -0.3199 628 THR A C   
4214 O  O   . THR A 636 ? 1.2607 3.0551 1.6578 0.1183  -0.1708 -0.3260 628 THR A O   
4215 C  CB  . THR A 636 ? 1.3084 3.2746 1.7609 0.2452  -0.1627 -0.3250 628 THR A CB  
4216 O  OG1 . THR A 636 ? 1.3311 3.3155 1.7855 0.3290  -0.1599 -0.3222 628 THR A OG1 
4217 C  CG2 . THR A 636 ? 1.2528 3.3883 1.7705 0.1978  -0.1650 -0.3395 628 THR A CG2 
4218 N  N   . PHE A 637 ? 1.2672 3.1782 1.6684 0.1525  -0.2163 -0.3204 629 PHE A N   
4219 C  CA  . PHE A 637 ? 1.2497 3.1190 1.6370 0.0807  -0.2207 -0.3311 629 PHE A CA  
4220 C  C   . PHE A 637 ? 1.2409 3.2029 1.6788 0.0113  -0.2165 -0.3499 629 PHE A C   
4221 O  O   . PHE A 637 ? 1.2197 3.3262 1.7055 0.0138  -0.2246 -0.3538 629 PHE A O   
4222 C  CB  . PHE A 637 ? 1.2833 3.1702 1.6454 0.0888  -0.2495 -0.3265 629 PHE A CB  
4223 C  CG  . PHE A 637 ? 1.3407 3.1330 1.6470 0.1478  -0.2581 -0.3045 629 PHE A CG  
4224 C  CD1 . PHE A 637 ? 1.3803 3.2192 1.6893 0.2206  -0.2736 -0.2879 629 PHE A CD1 
4225 C  CD2 . PHE A 637 ? 1.3820 3.0394 1.6333 0.1301  -0.2527 -0.3000 629 PHE A CD2 
4226 C  CE1 . PHE A 637 ? 1.4485 3.1929 1.7018 0.2712  -0.2863 -0.2649 629 PHE A CE1 
4227 C  CE2 . PHE A 637 ? 1.4321 3.0045 1.6289 0.1782  -0.2625 -0.2765 629 PHE A CE2 
4228 C  CZ  . PHE A 637 ? 1.4539 3.0655 1.6493 0.2472  -0.2807 -0.2578 629 PHE A CZ  
4229 N  N   . ILE A 638 ? 1.2680 3.1458 1.6949 -0.0514 -0.2061 -0.3605 630 ILE A N   
4230 C  CA  . ILE A 638 ? 1.2363 3.1760 1.7039 -0.1237 -0.2041 -0.3757 630 ILE A CA  
4231 C  C   . ILE A 638 ? 1.2840 3.2365 1.7489 -0.1816 -0.2266 -0.3919 630 ILE A C   
4232 O  O   . ILE A 638 ? 1.2994 3.1495 1.7238 -0.1903 -0.2311 -0.3973 630 ILE A O   
4233 C  CB  . ILE A 638 ? 1.2449 3.0815 1.7057 -0.1589 -0.1807 -0.3768 630 ILE A CB  
4234 C  CG1 . ILE A 638 ? 1.2477 3.0796 1.7106 -0.1062 -0.1578 -0.3639 630 ILE A CG1 
4235 C  CG2 . ILE A 638 ? 1.2170 3.1068 1.7143 -0.2402 -0.1843 -0.3898 630 ILE A CG2 
4236 C  CD1 . ILE A 638 ? 1.2971 3.0413 1.7544 -0.1426 -0.1354 -0.3630 630 ILE A CD1 
4237 N  N   . ASN A 639 ? 1.7296 2.6773 2.1059 -0.2904 -0.1375 -0.1191 631 ASN A N   
4238 C  CA  . ASN A 639 ? 1.7789 2.6956 2.1498 -0.3362 -0.1594 -0.1342 631 ASN A CA  
4239 C  C   . ASN A 639 ? 1.8758 2.6790 2.2259 -0.3656 -0.1595 -0.1436 631 ASN A C   
4240 O  O   . ASN A 639 ? 1.8936 2.6161 2.2089 -0.3516 -0.1623 -0.1644 631 ASN A O   
4241 C  CB  . ASN A 639 ? 1.8176 2.8375 2.2287 -0.3802 -0.1754 -0.1238 631 ASN A CB  
4242 C  CG  . ASN A 639 ? 2.1167 3.1328 2.5212 -0.4123 -0.2024 -0.1420 631 ASN A CG  
4243 O  OD1 . ASN A 639 ? 2.0804 3.0137 2.4666 -0.4470 -0.2150 -0.1570 631 ASN A OD1 
4244 N  ND2 . ASN A 639 ? 1.9960 3.1044 2.4156 -0.4011 -0.2138 -0.1419 631 ASN A ND2 
4245 N  N   . ASP A 640 ? 1.8412 2.6410 2.2114 -0.4048 -0.1574 -0.1278 632 ASP A N   
4246 C  CA  . ASP A 640 ? 1.8678 2.5593 2.2200 -0.4321 -0.1611 -0.1349 632 ASP A CA  
4247 C  C   . ASP A 640 ? 1.9024 2.5477 2.2454 -0.4057 -0.1363 -0.1227 632 ASP A C   
4248 O  O   . ASP A 640 ? 1.8921 2.5561 2.2549 -0.4291 -0.1293 -0.1002 632 ASP A O   
4249 C  CB  . ASP A 640 ? 1.9325 2.6329 2.3064 -0.4997 -0.1827 -0.1255 632 ASP A CB  
4250 C  CG  . ASP A 640 ? 2.0526 2.7192 2.4143 -0.5317 -0.2130 -0.1501 632 ASP A CG  
4251 O  OD1 . ASP A 640 ? 2.0356 2.7260 2.3856 -0.5069 -0.2181 -0.1689 632 ASP A OD1 
4252 O  OD2 . ASP A 640 ? 2.1672 2.7835 2.5296 -0.5824 -0.2338 -0.1501 632 ASP A OD2 
4253 N  N   . PHE A 641 ? 1.8595 2.4498 2.1716 -0.3585 -0.1238 -0.1359 633 PHE A N   
4254 C  CA  . PHE A 641 ? 1.8466 2.3892 2.1459 -0.3308 -0.1014 -0.1264 633 PHE A CA  
4255 C  C   . PHE A 641 ? 1.9389 2.3777 2.2223 -0.3532 -0.1046 -0.1334 633 PHE A C   
4256 O  O   . PHE A 641 ? 1.9207 2.3407 2.2115 -0.3628 -0.0940 -0.1155 633 PHE A O   
4257 C  CB  . PHE A 641 ? 1.8435 2.3722 2.1157 -0.2746 -0.0892 -0.1342 633 PHE A CB  
4258 C  CG  . PHE A 641 ? 1.8389 2.3550 2.1055 -0.2426 -0.0666 -0.1189 633 PHE A CG  
4259 C  CD1 . PHE A 641 ? 1.8826 2.3116 2.1288 -0.2398 -0.0565 -0.1205 633 PHE A CD1 
4260 C  CD2 . PHE A 641 ? 1.8439 2.4364 2.1248 -0.2135 -0.0568 -0.1048 633 PHE A CD2 
4261 C  CE1 . PHE A 641 ? 1.8717 2.2895 2.1114 -0.2125 -0.0370 -0.1065 633 PHE A CE1 
4262 C  CE2 . PHE A 641 ? 1.8607 2.4392 2.1336 -0.1836 -0.0377 -0.0934 633 PHE A CE2 
4263 C  CZ  . PHE A 641 ? 1.8373 2.3277 2.0890 -0.1849 -0.0279 -0.0938 633 PHE A CZ  
4264 N  N   . PHE A 642 ? 1.8363 2.9685 1.9238 -0.5381 0.2250  -0.5077 634 PHE A N   
4265 C  CA  . PHE A 642 ? 1.8593 2.9527 1.9728 -0.5415 0.1584  -0.4720 634 PHE A CA  
4266 C  C   . PHE A 642 ? 1.8619 2.9654 2.0618 -0.5490 0.1678  -0.4511 634 PHE A C   
4267 O  O   . PHE A 642 ? 1.7638 2.9256 2.0568 -0.5376 0.2096  -0.4760 634 PHE A O   
4268 C  CB  . PHE A 642 ? 1.5440 2.6644 1.7359 -0.5107 0.1018  -0.4933 634 PHE A CB  
4269 C  CG  . PHE A 642 ? 1.5618 2.6722 1.6774 -0.5021 0.0873  -0.5136 634 PHE A CG  
4270 C  CD1 . PHE A 642 ? 1.6802 2.7198 1.6759 -0.5199 0.0490  -0.4847 634 PHE A CD1 
4271 C  CD2 . PHE A 642 ? 1.4614 2.6321 1.6250 -0.4757 0.1112  -0.5619 634 PHE A CD2 
4272 C  CE1 . PHE A 642 ? 1.6979 2.7275 1.6247 -0.5120 0.0343  -0.5036 634 PHE A CE1 
4273 C  CE2 . PHE A 642 ? 1.4777 2.6393 1.5730 -0.4680 0.0980  -0.5806 634 PHE A CE2 
4274 C  CZ  . PHE A 642 ? 1.5959 2.6871 1.5735 -0.4863 0.0591  -0.5515 634 PHE A CZ  
4275 N  N   . THR A 643 ? 1.8818 2.9271 2.0498 -0.5680 0.1276  -0.4054 635 THR A N   
4276 C  CA  . THR A 643 ? 1.8515 2.8989 2.0951 -0.5771 0.1310  -0.3809 635 THR A CA  
4277 C  C   . THR A 643 ? 1.8552 2.8869 2.1656 -0.5679 0.0576  -0.3594 635 THR A C   
4278 O  O   . THR A 643 ? 1.8939 2.8883 2.1552 -0.5653 0.0026  -0.3485 635 THR A O   
4279 C  CB  . THR A 643 ? 2.0350 3.0241 2.1777 -0.6132 0.1624  -0.3406 635 THR A CB  
4280 O  OG1 . THR A 643 ? 2.1568 3.0686 2.1852 -0.6299 0.1150  -0.3043 635 THR A OG1 
4281 C  CG2 . THR A 643 ? 2.0598 3.0623 2.1351 -0.6231 0.2369  -0.3604 635 THR A CG2 
4282 N  N   . TYR A 644 ? 1.9694 3.0293 2.3933 -0.5627 0.0568  -0.3536 636 TYR A N   
4283 C  CA  . TYR A 644 ? 1.9359 2.9870 2.4371 -0.5525 -0.0090 -0.3348 636 TYR A CA  
4284 C  C   . TYR A 644 ? 2.0351 3.0275 2.5008 -0.5811 -0.0254 -0.2828 636 TYR A C   
4285 O  O   . TYR A 644 ? 2.0795 3.0650 2.5259 -0.6014 0.0230  -0.2688 636 TYR A O   
4286 C  CB  . TYR A 644 ? 1.6629 2.7866 2.3226 -0.5230 -0.0050 -0.3659 636 TYR A CB  
4287 C  CG  . TYR A 644 ? 1.6006 2.7139 2.3252 -0.4864 -0.0693 -0.3653 636 TYR A CG  
4288 C  CD1 . TYR A 644 ? 1.6514 2.7322 2.3588 -0.5054 -0.1357 -0.3364 636 TYR A CD1 
4289 C  CD2 . TYR A 644 ? 1.5244 2.6049 2.2854 -0.4149 -0.0603 -0.3739 636 TYR A CD2 
4290 C  CE1 . TYR A 644 ? 1.6103 2.6517 2.3626 -0.4602 -0.1889 -0.3247 636 TYR A CE1 
4291 C  CE2 . TYR A 644 ? 1.4930 2.5230 2.2807 -0.3726 -0.1093 -0.3546 636 TYR A CE2 
4292 C  CZ  . TYR A 644 ? 1.5336 2.5457 2.3229 -0.3942 -0.1718 -0.3299 636 TYR A CZ  
4293 O  OH  . TYR A 644 ? 1.5057 2.4643 2.3172 -0.3547 -0.2155 -0.3054 636 TYR A OH  
4294 N  N   . HIS A 645 ? 1.9814 2.9311 2.4395 -0.5823 -0.0936 -0.2544 637 HIS A N   
4295 C  CA  . HIS A 645 ? 2.0477 2.9375 2.4695 -0.6080 -0.1170 -0.2037 637 HIS A CA  
4296 C  C   . HIS A 645 ? 1.9995 2.9028 2.5415 -0.5948 -0.1679 -0.1916 637 HIS A C   
4297 O  O   . HIS A 645 ? 1.8866 2.8174 2.4985 -0.5687 -0.2102 -0.2117 637 HIS A O   
4298 C  CB  . HIS A 645 ? 2.1725 2.9836 2.4511 -0.6266 -0.1538 -0.1734 637 HIS A CB  
4299 C  CG  . HIS A 645 ? 2.3123 3.0924 2.4569 -0.6475 -0.1020 -0.1713 637 HIS A CG  
4300 N  ND1 . HIS A 645 ? 2.4266 3.1535 2.4866 -0.6781 -0.0743 -0.1339 637 HIS A ND1 
4301 C  CD2 . HIS A 645 ? 2.3514 3.1455 2.4321 -0.6417 -0.0721 -0.2019 637 HIS A CD2 
4302 C  CE1 . HIS A 645 ? 2.5106 3.2191 2.4590 -0.6901 -0.0291 -0.1413 637 HIS A CE1 
4303 N  NE2 . HIS A 645 ? 2.4691 3.2181 2.4277 -0.6687 -0.0274 -0.1824 637 HIS A NE2 
4304 N  N   . ILE A 646 ? 2.0726 2.9557 2.6379 -0.6129 -0.1623 -0.1587 638 ILE A N   
4305 C  CA  . ILE A 646 ? 2.0188 2.9099 2.6935 -0.6039 -0.2078 -0.1426 638 ILE A CA  
4306 C  C   . ILE A 646 ? 1.8626 2.8328 2.6845 -0.5697 -0.2046 -0.1843 638 ILE A C   
4307 O  O   . ILE A 646 ? 1.7950 2.7849 2.6621 -0.5447 -0.2458 -0.2040 638 ILE A O   
4308 C  CB  . ILE A 646 ? 1.9434 2.7811 2.5816 -0.6046 -0.2863 -0.1146 638 ILE A CB  
4309 C  CG1 . ILE A 646 ? 2.1017 2.8582 2.5820 -0.6354 -0.2918 -0.0773 638 ILE A CG1 
4310 C  CG2 . ILE A 646 ? 1.9053 2.7432 2.6455 -0.6004 -0.3297 -0.0915 638 ILE A CG2 
4311 C  CD1 . ILE A 646 ? 2.1614 2.8612 2.5974 -0.6374 -0.3688 -0.0495 638 ILE A CD1 
4312 N  N   . GLY A 649 ? 1.8193 2.7009 2.4636 -0.5490 -0.3537 -0.1859 641 GLY A N   
4313 C  CA  . GLY A 649 ? 1.7093 2.6489 2.4145 -0.5175 -0.3488 -0.2334 641 GLY A CA  
4314 C  C   . GLY A 649 ? 1.7601 2.6779 2.3578 -0.5182 -0.3515 -0.2474 641 GLY A C   
4315 O  O   . GLY A 649 ? 1.7146 2.6422 2.3362 -0.4972 -0.3910 -0.2655 641 GLY A O   
4316 N  N   . GLU A 650 ? 1.7783 2.6661 2.2583 -0.5421 -0.3086 -0.2393 642 GLU A N   
4317 C  CA  . GLU A 650 ? 1.8620 2.7238 2.2279 -0.5454 -0.3083 -0.2505 642 GLU A CA  
4318 C  C   . GLU A 650 ? 1.9018 2.7994 2.2307 -0.5463 -0.2334 -0.2823 642 GLU A C   
4319 O  O   . GLU A 650 ? 1.9350 2.8310 2.2392 -0.5648 -0.1813 -0.2722 642 GLU A O   
4320 C  CB  . GLU A 650 ? 1.8012 2.5755 2.0318 -0.5748 -0.3379 -0.2057 642 GLU A CB  
4321 N  N   . VAL A 651 ? 1.6772 2.6069 2.0044 -0.5261 -0.2283 -0.3207 643 VAL A N   
4322 C  CA  . VAL A 651 ? 1.6755 2.6396 1.9650 -0.5249 -0.1608 -0.3537 643 VAL A CA  
4323 C  C   . VAL A 651 ? 1.8413 2.7505 1.9737 -0.5439 -0.1561 -0.3444 643 VAL A C   
4324 O  O   . VAL A 651 ? 1.8589 2.7464 1.9499 -0.5358 -0.1998 -0.3493 643 VAL A O   
4325 C  CB  . VAL A 651 ? 1.5716 2.6078 1.9553 -0.4898 -0.1518 -0.4045 643 VAL A CB  
4326 C  CG1 . VAL A 651 ? 1.5453 2.6143 1.8835 -0.4893 -0.0832 -0.4382 643 VAL A CG1 
4327 C  CG2 . VAL A 651 ? 1.4824 2.5508 2.0084 -0.4598 -0.1508 -0.4074 643 VAL A CG2 
4328 N  N   . HIS A 652 ? 1.7651 2.6514 1.8114 -0.5686 -0.1028 -0.3313 644 HIS A N   
4329 C  CA  . HIS A 652 ? 1.8962 2.7227 1.7845 -0.5889 -0.0961 -0.3176 644 HIS A CA  
4330 C  C   . HIS A 652 ? 1.9476 2.8000 1.7816 -0.5935 -0.0209 -0.3446 644 HIS A C   
4331 O  O   . HIS A 652 ? 1.8557 2.7688 1.7708 -0.5847 0.0302  -0.3698 644 HIS A O   
4332 C  CB  . HIS A 652 ? 2.0286 2.7780 1.8305 -0.6197 -0.1113 -0.2645 644 HIS A CB  
4333 C  CG  . HIS A 652 ? 2.0480 2.7594 1.8770 -0.6184 -0.1890 -0.2346 644 HIS A CG  
4334 N  ND1 . HIS A 652 ? 1.9906 2.7175 1.8759 -0.5949 -0.2470 -0.2509 644 HIS A ND1 
4335 C  CD2 . HIS A 652 ? 2.1265 2.7843 1.9347 -0.6376 -0.2177 -0.1891 644 HIS A CD2 
4336 C  CE1 . HIS A 652 ? 2.0192 2.7043 1.9181 -0.5998 -0.3087 -0.2171 644 HIS A CE1 
4337 N  NE2 . HIS A 652 ? 2.1064 2.7492 1.9583 -0.6255 -0.2927 -0.1793 644 HIS A NE2 
4338 N  N   . ALA A 653 ? 1.8226 2.6270 1.5178 -0.6069 -0.0158 -0.3392 645 ALA A N   
4339 C  CA  . ALA A 653 ? 1.8516 2.6670 1.4722 -0.6157 0.0543  -0.3583 645 ALA A CA  
4340 C  C   . ALA A 653 ? 2.0162 2.7497 1.4819 -0.6474 0.0656  -0.3192 645 ALA A C   
4341 O  O   . ALA A 653 ? 2.1083 2.7762 1.4943 -0.6561 0.0114  -0.2910 645 ALA A O   
4342 C  CB  . ALA A 653 ? 1.7999 2.6472 1.4059 -0.5952 0.0556  -0.4005 645 ALA A CB  
4343 N  N   . GLY A 654 ? 1.8377 2.1635 2.1331 -0.3847 -0.0579 -0.0577 646 GLY A N   
4344 C  CA  . GLY A 654 ? 1.8389 2.2160 2.1572 -0.4141 -0.0513 -0.0261 646 GLY A CA  
4345 C  C   . GLY A 654 ? 1.8467 2.2906 2.1701 -0.3786 -0.0246 -0.0110 646 GLY A C   
4346 O  O   . GLY A 654 ? 1.8392 2.3654 2.1865 -0.3997 -0.0184 0.0129  646 GLY A O   
4347 N  N   . THR A 655 ? 1.7744 2.1847 2.0737 -0.3259 -0.0100 -0.0248 647 THR A N   
4348 C  CA  . THR A 655 ? 1.7369 2.1964 2.0345 -0.2865 0.0124  -0.0150 647 THR A CA  
4349 C  C   . THR A 655 ? 1.7637 2.1449 2.0349 -0.2633 0.0264  -0.0133 647 THR A C   
4350 O  O   . THR A 655 ? 1.7719 2.0611 2.0212 -0.2605 0.0209  -0.0263 647 THR A O   
4351 C  CB  . THR A 655 ? 1.8302 2.3472 2.1260 -0.2428 0.0146  -0.0284 647 THR A CB  
4352 O  OG1 . THR A 655 ? 1.8360 2.2850 2.1067 -0.2250 0.0053  -0.0506 647 THR A OG1 
4353 C  CG2 . THR A 655 ? 1.8286 2.4561 2.1575 -0.2610 0.0062  -0.0230 647 THR A CG2 
4354 N  N   . ASN A 656 ? 1.6819 2.1072 1.9556 -0.2463 0.0443  0.0021  648 ASN A N   
4355 C  CA  . ASN A 656 ? 1.6543 2.0253 1.9048 -0.2227 0.0592  0.0068  648 ASN A CA  
4356 C  C   . ASN A 656 ? 1.6402 2.0926 1.8945 -0.1899 0.0759  0.0140  648 ASN A C   
4357 O  O   . ASN A 656 ? 1.6418 2.1887 1.9229 -0.2079 0.0789  0.0276  648 ASN A O   
4358 C  CB  . ASN A 656 ? 1.6967 2.0198 1.9497 -0.2636 0.0573  0.0248  648 ASN A CB  
4359 C  CG  . ASN A 656 ? 2.1001 2.3258 2.3246 -0.2459 0.0629  0.0207  648 ASN A CG  
4360 O  OD1 . ASN A 656 ? 1.9937 2.1974 2.1954 -0.2029 0.0732  0.0101  648 ASN A OD1 
4361 N  ND2 . ASN A 656 ? 2.0553 2.2192 2.2798 -0.2798 0.0536  0.0300  648 ASN A ND2 
4362 N  N   . VAL A 657 ? 1.5473 1.9686 1.7744 -0.1415 0.0846  0.0036  649 VAL A N   
4363 C  CA  . VAL A 657 ? 1.5188 2.0107 1.7453 -0.1033 0.0971  0.0049  649 VAL A CA  
4364 C  C   . VAL A 657 ? 1.5331 1.9860 1.7364 -0.0859 0.1116  0.0117  649 VAL A C   
4365 O  O   . VAL A 657 ? 1.5298 1.8891 1.7055 -0.0770 0.1109  0.0067  649 VAL A O   
4366 C  CB  . VAL A 657 ? 1.5595 2.0675 1.7740 -0.0549 0.0903  -0.0140 649 VAL A CB  
4367 C  CG1 . VAL A 657 ? 1.5546 2.1587 1.7780 -0.0178 0.0982  -0.0151 649 VAL A CG1 
4368 C  CG2 . VAL A 657 ? 1.5590 2.0814 1.7884 -0.0721 0.0738  -0.0226 649 VAL A CG2 
4369 N  N   . ARG A 658 ? 1.4592 1.9916 1.6734 -0.0797 0.1245  0.0221  650 ARG A N   
4370 C  CA  . ARG A 658 ? 1.4422 1.9566 1.6338 -0.0573 0.1386  0.0263  650 ARG A CA  
4371 C  C   . ARG A 658 ? 1.4677 2.0017 1.6397 0.0049  0.1390  0.0067  650 ARG A C   
4372 O  O   . ARG A 658 ? 1.4680 2.0886 1.6583 0.0239  0.1364  -0.0009 650 ARG A O   
4373 C  CB  . ARG A 658 ? 1.4254 2.0244 1.6380 -0.0852 0.1514  0.0477  650 ARG A CB  
4374 C  CG  . ARG A 658 ? 1.4738 2.0631 1.6621 -0.0628 0.1663  0.0516  650 ARG A CG  
4375 C  CD  . ARG A 658 ? 1.5581 2.2181 1.7642 -0.1021 0.1776  0.0775  650 ARG A CD  
4376 N  NE  . ARG A 658 ? 1.6560 2.4573 1.8925 -0.1037 0.1833  0.0810  650 ARG A NE  
4377 C  CZ  . ARG A 658 ? 1.8268 2.7151 2.0597 -0.0596 0.1955  0.0697  650 ARG A CZ  
4378 N  NH1 . ARG A 658 ? 1.6037 2.4438 1.8014 -0.0117 0.2017  0.0542  650 ARG A NH1 
4379 N  NH2 . ARG A 658 ? 1.7019 2.7282 1.9660 -0.0626 0.2003  0.0727  650 ARG A NH2 
4380 N  N   . ARG A 659 ? 1.4094 1.8600 1.5436 0.0360  0.1391  -0.0018 651 ARG A N   
4381 C  CA  . ARG A 659 ? 1.4116 1.8595 1.5200 0.0943  0.1340  -0.0201 651 ARG A CA  
4382 C  C   . ARG A 659 ? 1.4587 1.8881 1.5389 0.1217  0.1441  -0.0214 651 ARG A C   
4383 O  O   . ARG A 659 ? 1.4577 1.8351 1.5268 0.0980  0.1519  -0.0094 651 ARG A O   
4384 C  CB  . ARG A 659 ? 1.4219 1.7803 1.5042 0.1086  0.1176  -0.0309 651 ARG A CB  
4385 C  CG  . ARG A 659 ? 1.4607 1.8416 1.5646 0.0930  0.1052  -0.0347 651 ARG A CG  
4386 C  CD  . ARG A 659 ? 1.5120 1.8052 1.5850 0.1052  0.0904  -0.0430 651 ARG A CD  
4387 N  NE  . ARG A 659 ? 1.6498 1.9341 1.7391 0.0712  0.0823  -0.0433 651 ARG A NE  
4388 C  CZ  . ARG A 659 ? 1.7820 2.1141 1.8873 0.0744  0.0706  -0.0501 651 ARG A CZ  
4389 N  NH1 . ARG A 659 ? 1.5129 1.9068 1.6221 0.1117  0.0654  -0.0564 651 ARG A NH1 
4390 N  NH2 . ARG A 659 ? 1.6228 1.9422 1.7394 0.0424  0.0629  -0.0520 651 ARG A NH2 
4391 N  N   . LYS A 660 ? 1.4133 1.8820 1.4797 0.1744  0.1415  -0.0377 652 LYS A N   
4392 C  CA  . LYS A 660 ? 1.4198 1.8782 1.4558 0.2102  0.1478  -0.0454 652 LYS A CA  
4393 C  C   . LYS A 660 ? 1.4528 1.7850 1.4462 0.2118  0.1421  -0.0444 652 LYS A C   
4394 O  O   . LYS A 660 ? 1.4492 1.7069 1.4197 0.2256  0.1253  -0.0515 652 LYS A O   
4395 C  CB  . LYS A 660 ? 1.4739 1.9869 1.5006 0.2728  0.1394  -0.0686 652 LYS A CB  
4396 C  CG  . LYS A 660 ? 1.6736 2.1987 1.6726 0.3124  0.1465  -0.0805 652 LYS A CG  
4397 C  CD  . LYS A 660 ? 1.8693 2.3751 1.8368 0.3820  0.1269  -0.1081 652 LYS A CD  
4398 C  CE  . LYS A 660 ? 2.0325 2.3978 1.9464 0.3992  0.1093  -0.1133 652 LYS A CE  
4399 N  NZ  . LYS A 660 ? 2.0964 2.3816 2.0052 0.3779  0.0926  -0.1049 652 LYS A NZ  
4400 N  N   . PRO A 661 ? 1.3916 1.7042 1.3742 0.1950  0.1554  -0.0336 653 PRO A N   
4401 C  CA  . PRO A 661 ? 1.3941 1.5951 1.3383 0.1940  0.1503  -0.0312 653 PRO A CA  
4402 C  C   . PRO A 661 ? 1.4877 1.6336 1.3874 0.2452  0.1344  -0.0500 653 PRO A C   
4403 O  O   . PRO A 661 ? 1.4994 1.6967 1.3940 0.2886  0.1304  -0.0670 653 PRO A O   
4404 C  CB  . PRO A 661 ? 1.4076 1.6245 1.3516 0.1733  0.1676  -0.0176 653 PRO A CB  
4405 C  CG  . PRO A 661 ? 1.4473 1.7639 1.4355 0.1417  0.1801  -0.0046 653 PRO A CG  
4406 C  CD  . PRO A 661 ? 1.3981 1.7922 1.4029 0.1726  0.1746  -0.0205 653 PRO A CD  
4407 N  N   . PHE A 662 ? 1.4716 1.5135 1.3385 0.2398  0.1232  -0.0470 654 PHE A N   
4408 C  CA  . PHE A 662 ? 1.5198 1.4890 1.3384 0.2790  0.1031  -0.0601 654 PHE A CA  
4409 C  C   . PHE A 662 ? 1.6140 1.5937 1.4055 0.3154  0.1055  -0.0727 654 PHE A C   
4410 O  O   . PHE A 662 ? 1.6004 1.6041 1.3973 0.2984  0.1234  -0.0647 654 PHE A O   
4411 C  CB  . PHE A 662 ? 1.5437 1.4117 1.3350 0.2547  0.0945  -0.0489 654 PHE A CB  
4412 C  CG  . PHE A 662 ? 1.5507 1.3940 1.3535 0.2308  0.0856  -0.0424 654 PHE A CG  
4413 C  CD1 . PHE A 662 ? 1.6133 1.4108 1.3888 0.2509  0.0621  -0.0483 654 PHE A CD1 
4414 C  CD2 . PHE A 662 ? 1.5464 1.4053 1.3827 0.1875  0.0986  -0.0303 654 PHE A CD2 
4415 C  CE1 . PHE A 662 ? 1.6044 1.3836 1.3875 0.2273  0.0545  -0.0420 654 PHE A CE1 
4416 C  CE2 . PHE A 662 ? 1.5626 1.3998 1.4061 0.1679  0.0902  -0.0278 654 PHE A CE2 
4417 C  CZ  . PHE A 662 ? 1.5553 1.3568 1.3723 0.1872  0.0695  -0.0334 654 PHE A CZ  
4418 N  N   . SER A 663 ? 1.6132 1.5737 1.3737 0.3666  0.0855  -0.0931 655 SER A N   
4419 C  CA  . SER A 663 ? 1.6462 1.6079 1.3742 0.4088  0.0831  -0.1110 655 SER A CA  
4420 C  C   . SER A 663 ? 1.6925 1.5500 1.3757 0.3966  0.0757  -0.1042 655 SER A C   
4421 O  O   . SER A 663 ? 1.7040 1.5689 1.3700 0.4059  0.0846  -0.1094 655 SER A O   
4422 C  CB  . SER A 663 ? 1.7522 1.7150 1.4585 0.4700  0.0591  -0.1368 655 SER A CB  
4423 O  OG  . SER A 663 ? 1.8621 1.9322 1.6130 0.4810  0.0666  -0.1426 655 SER A OG  
4424 N  N   . PHE A 664 ? 1.6320 1.4015 1.2986 0.3716  0.0607  -0.0909 656 PHE A N   
4425 C  CA  . PHE A 664 ? 1.6379 1.3137 1.2662 0.3517  0.0530  -0.0803 656 PHE A CA  
4426 C  C   . PHE A 664 ? 1.6625 1.3672 1.3163 0.3099  0.0802  -0.0629 656 PHE A C   
4427 O  O   . PHE A 664 ? 1.6303 1.3688 1.3247 0.2731  0.0947  -0.0480 656 PHE A O   
4428 C  CB  . PHE A 664 ? 1.6549 1.2530 1.2669 0.3298  0.0333  -0.0676 656 PHE A CB  
4429 C  CG  . PHE A 664 ? 1.6879 1.1926 1.2570 0.3107  0.0209  -0.0564 656 PHE A CG  
4430 C  CD1 . PHE A 664 ? 1.6928 1.1949 1.2747 0.2709  0.0394  -0.0397 656 PHE A CD1 
4431 C  CD2 . PHE A 664 ? 1.7681 1.1870 1.2843 0.3303  -0.0118 -0.0607 656 PHE A CD2 
4432 C  CE1 . PHE A 664 ? 1.7232 1.1482 1.2675 0.2527  0.0278  -0.0289 656 PHE A CE1 
4433 C  CE2 . PHE A 664 ? 1.8251 1.1624 1.3019 0.3071  -0.0247 -0.0477 656 PHE A CE2 
4434 C  CZ  . PHE A 664 ? 1.7590 1.1046 1.2514 0.2689  -0.0037 -0.0323 656 PHE A CZ  
4435 N  N   . LYS A 665 ? 1.6186 1.3054 1.2456 0.3166  0.0843  -0.0655 657 LYS A N   
4436 C  CA  . LYS A 665 ? 1.5655 1.2726 1.2087 0.2813  0.1064  -0.0486 657 LYS A CA  
4437 C  C   . LYS A 665 ? 1.5616 1.1936 1.1961 0.2431  0.1012  -0.0295 657 LYS A C   
4438 O  O   . LYS A 665 ? 1.5683 1.1217 1.1596 0.2493  0.0820  -0.0309 657 LYS A O   
4439 C  CB  . LYS A 665 ? 1.6226 1.3401 1.2364 0.3054  0.1104  -0.0599 657 LYS A CB  
4440 C  CG  . LYS A 665 ? 1.8121 1.5994 1.4242 0.3547  0.1107  -0.0855 657 LYS A CG  
4441 C  CD  . LYS A 665 ? 1.8829 1.7924 1.5462 0.3423  0.1372  -0.0795 657 LYS A CD  
4442 C  CE  . LYS A 665 ? 1.9607 1.9538 1.6225 0.3926  0.1392  -0.1057 657 LYS A CE  
4443 N  NZ  . LYS A 665 ? 2.0145 2.0203 1.6861 0.4241  0.1236  -0.1213 657 LYS A NZ  
4444 N  N   . TRP A 666 ? 1.4679 1.1265 1.1432 0.2038  0.1166  -0.0121 658 TRP A N   
4445 C  CA  . TRP A 666 ? 1.4454 1.0525 1.1227 0.1686  0.1146  0.0043  658 TRP A CA  
4446 C  C   . TRP A 666 ? 1.5120 1.0558 1.1515 0.1619  0.1079  0.0111  658 TRP A C   
4447 O  O   . TRP A 666 ? 1.4980 0.9899 1.1244 0.1444  0.0975  0.0195  658 TRP A O   
4448 C  CB  . TRP A 666 ? 1.3855 1.0361 1.1108 0.1334  0.1328  0.0186  658 TRP A CB  
4449 C  CG  . TRP A 666 ? 1.3902 1.0740 1.1257 0.1209  0.1491  0.0290  658 TRP A CG  
4450 C  CD1 . TRP A 666 ? 1.4215 1.1802 1.1806 0.1223  0.1629  0.0295  658 TRP A CD1 
4451 C  CD2 . TRP A 666 ? 1.3840 1.0324 1.1070 0.1020  0.1524  0.0427  658 TRP A CD2 
4452 N  NE1 . TRP A 666 ? 1.4122 1.1817 1.1714 0.1048  0.1741  0.0438  658 TRP A NE1 
4453 C  CE2 . TRP A 666 ? 1.4266 1.1269 1.1635 0.0940  0.1675  0.0514  658 TRP A CE2 
4454 C  CE3 . TRP A 666 ? 1.3979 0.9811 1.0990 0.0904  0.1435  0.0497  658 TRP A CE3 
4455 C  CZ2 . TRP A 666 ? 1.4105 1.0937 1.1385 0.0766  0.1728  0.0664  658 TRP A CZ2 
4456 C  CZ3 . TRP A 666 ? 1.4118 0.9811 1.1053 0.0754  0.1490  0.0629  658 TRP A CZ3 
4457 C  CH2 . TRP A 666 ? 1.4163 1.0326 1.1232 0.0689  0.1631  0.0712  658 TRP A CH2 
4458 N  N   . TRP A 667 ? 1.4997 1.0548 1.1225 0.1734  0.1143  0.0083  659 TRP A N   
4459 C  CA  . TRP A 667 ? 1.5287 1.0305 1.1166 0.1654  0.1086  0.0150  659 TRP A CA  
4460 C  C   . TRP A 667 ? 1.6644 1.0910 1.1999 0.1837  0.0823  0.0059  659 TRP A C   
4461 O  O   . TRP A 667 ? 1.6881 1.0624 1.1953 0.1685  0.0737  0.0150  659 TRP A O   
4462 C  CB  . TRP A 667 ? 1.5152 1.0567 1.1015 0.1688  0.1238  0.0160  659 TRP A CB  
4463 C  CG  . TRP A 667 ? 1.5518 1.1383 1.1263 0.2077  0.1253  -0.0051 659 TRP A CG  
4464 C  CD1 . TRP A 667 ? 1.6435 1.1953 1.1701 0.2442  0.1091  -0.0255 659 TRP A CD1 
4465 C  CD2 . TRP A 667 ? 1.5266 1.2050 1.1374 0.2153  0.1425  -0.0091 659 TRP A CD2 
4466 N  NE1 . TRP A 667 ? 1.6515 1.2719 1.1832 0.2788  0.1162  -0.0447 659 TRP A NE1 
4467 C  CE2 . TRP A 667 ? 1.6182 1.3224 1.2024 0.2601  0.1377  -0.0338 659 TRP A CE2 
4468 C  CE3 . TRP A 667 ? 1.4959 1.2383 1.1581 0.1875  0.1596  0.0056  659 TRP A CE3 
4469 C  CZ2 . TRP A 667 ? 1.6003 1.4039 1.2106 0.2781  0.1523  -0.0434 659 TRP A CZ2 
4470 C  CZ3 . TRP A 667 ? 1.5087 1.3433 1.1953 0.2001  0.1724  -0.0010 659 TRP A CZ3 
4471 C  CH2 . TRP A 667 ? 1.5522 1.4225 1.2145 0.2452  0.1700  -0.0250 659 TRP A CH2 
4472 N  N   . ASN A 668 ? 1.6637 1.0830 1.1856 0.2143  0.0671  -0.0105 660 ASN A N   
4473 C  CA  . ASN A 668 ? 1.7287 1.0688 1.1974 0.2331  0.0363  -0.0188 660 ASN A CA  
4474 C  C   . ASN A 668 ? 1.8049 1.0918 1.2646 0.2053  0.0201  -0.0031 660 ASN A C   
4475 O  O   . ASN A 668 ? 1.8566 1.0692 1.2681 0.2062  -0.0063 -0.0015 660 ASN A O   
4476 C  CB  . ASN A 668 ? 1.7541 1.1044 1.2094 0.2803  0.0230  -0.0427 660 ASN A CB  
4477 C  CG  . ASN A 668 ? 1.8796 1.2670 1.3236 0.3146  0.0308  -0.0624 660 ASN A CG  
4478 O  OD1 . ASN A 668 ? 1.7382 1.0998 1.1538 0.3125  0.0306  -0.0630 660 ASN A OD1 
4479 N  ND2 . ASN A 668 ? 1.7748 1.2288 1.2401 0.3479  0.0371  -0.0799 660 ASN A ND2 
4480 N  N   . MET A 669 ? 1.7309 1.0548 1.2331 0.1802  0.0335  0.0081  661 MET A N   
4481 C  CA  . MET A 669 ? 1.7474 1.0305 1.2389 0.1545  0.0189  0.0219  661 MET A CA  
4482 C  C   . MET A 669 ? 1.8385 1.0975 1.3222 0.1210  0.0221  0.0392  661 MET A C   
4483 O  O   . MET A 669 ? 1.8205 1.1075 1.3233 0.1135  0.0411  0.0422  661 MET A O   
4484 C  CB  . MET A 669 ? 1.7354 1.0624 1.2674 0.1446  0.0271  0.0235  661 MET A CB  
4485 C  CG  . MET A 669 ? 1.7227 1.1076 1.3065 0.1221  0.0543  0.0293  661 MET A CG  
4486 S  SD  . MET A 669 ? 1.7549 1.1788 1.3754 0.1130  0.0568  0.0273  661 MET A SD  
4487 C  CE  . MET A 669 ? 1.6987 1.0951 1.3122 0.0776  0.0519  0.0425  661 MET A CE  
4488 N  N   . VAL A 670 ? 1.8437 1.0532 1.2972 0.1006  0.0020  0.0517  662 VAL A N   
4489 C  CA  . VAL A 670 ? 1.8340 1.0302 1.2821 0.0674  0.0040  0.0690  662 VAL A CA  
4490 C  C   . VAL A 670 ? 1.8868 1.1160 1.3659 0.0408  0.0115  0.0795  662 VAL A C   
4491 O  O   . VAL A 670 ? 1.9190 1.1232 1.3750 0.0282  -0.0075 0.0876  662 VAL A O   
4492 C  CB  . VAL A 670 ? 1.9275 1.0503 1.3160 0.0600  -0.0246 0.0768  662 VAL A CB  
4493 C  CG1 . VAL A 670 ? 1.9073 1.0301 1.2953 0.0245  -0.0207 0.0954  662 VAL A CG1 
4494 C  CG2 . VAL A 670 ? 1.9670 1.0571 1.3231 0.0923  -0.0335 0.0606  662 VAL A CG2 
4495 N  N   . PRO A 671 ? 1.7867 1.0719 1.3163 0.0334  0.0370  0.0782  663 PRO A N   
4496 C  CA  . PRO A 671 ? 1.7661 1.0845 1.3247 0.0141  0.0434  0.0823  663 PRO A CA  
4497 C  C   . PRO A 671 ? 2.1249 1.4331 1.6673 -0.0145 0.0351  0.0978  663 PRO A C   
4498 O  O   . PRO A 671 ? 2.0886 1.4183 1.6390 -0.0282 0.0326  0.1005  663 PRO A O   
4499 C  CB  . PRO A 671 ? 1.7321 1.0990 1.3416 0.0152  0.0680  0.0763  663 PRO A CB  
4500 C  CG  . PRO A 671 ? 1.7831 1.1520 1.3922 0.0362  0.0744  0.0693  663 PRO A CG  
4501 C  CD  . PRO A 671 ? 1.7718 1.0909 1.3319 0.0419  0.0586  0.0732  663 PRO A CD  
4502 O  OXT . PRO A 671 ? 2.5270 1.8103 2.0470 -0.0238 0.0302  0.1074  663 PRO A OXT 
4503 CA CA  . CA  B .   ? 1.8092 1.7303 1.8935 -0.1099 0.0592  -0.0689 701 CA  A CA  
4504 CA CA  . CA  C .   ? 1.6609 2.1424 1.7474 -0.5991 0.1502  0.1774  702 CA  A CA  
4505 CA CA  . CA  D .   ? 1.4689 2.3954 1.6678 -0.4770 0.1584  0.1507  703 CA  A CA  
4506 CA CA  . CA  E .   ? 1.8877 1.6429 1.6733 -0.7228 0.1595  0.2799  704 CA  A CA  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -7  ?   ?   ?   A . n 
A 1 2   PRO 2   -6  ?   ?   ?   A . n 
A 1 3   LEU 3   -5  ?   ?   ?   A . n 
A 1 4   GLY 4   -4  ?   ?   ?   A . n 
A 1 5   SER 5   -3  ?   ?   ?   A . n 
A 1 6   PRO 6   -2  ?   ?   ?   A . n 
A 1 7   GLU 7   -1  ?   ?   ?   A . n 
A 1 8   PHE 8   0   ?   ?   ?   A . n 
A 1 9   MET 9   1   ?   ?   ?   A . n 
A 1 10  ALA 10  2   ?   ?   ?   A . n 
A 1 11  GLN 11  3   3   GLN GLN A . n 
A 1 12  GLY 12  4   4   GLY GLY A . n 
A 1 13  THR 13  5   5   THR THR A . n 
A 1 14  LEU 14  6   6   LEU LEU A . n 
A 1 15  ILE 15  7   7   ILE ILE A . n 
A 1 16  ARG 16  8   8   ARG ARG A . n 
A 1 17  VAL 17  9   9   VAL VAL A . n 
A 1 18  THR 18  10  10  THR THR A . n 
A 1 19  PRO 19  11  11  PRO PRO A . n 
A 1 20  GLU 20  12  12  GLU GLU A . n 
A 1 21  GLN 21  13  13  GLN GLN A . n 
A 1 22  PRO 22  14  14  PRO PRO A . n 
A 1 23  THR 23  15  15  THR THR A . n 
A 1 24  HIS 24  16  16  HIS HIS A . n 
A 1 25  ALA 25  17  17  ALA ALA A . n 
A 1 26  VAL 26  18  18  VAL VAL A . n 
A 1 27  CYS 27  19  19  CYS CYS A . n 
A 1 28  VAL 28  20  20  VAL VAL A . n 
A 1 29  LEU 29  21  21  LEU LEU A . n 
A 1 30  GLY 30  22  22  GLY GLY A . n 
A 1 31  THR 31  23  23  THR THR A . n 
A 1 32  LEU 32  24  24  LEU LEU A . n 
A 1 33  THR 33  25  25  THR THR A . n 
A 1 34  GLN 34  26  26  GLN GLN A . n 
A 1 35  LEU 35  27  27  LEU LEU A . n 
A 1 36  ASP 36  28  28  ASP ASP A . n 
A 1 37  ILE 37  29  29  ILE ILE A . n 
A 1 38  CYS 38  30  30  CYS CYS A . n 
A 1 39  SER 39  31  31  SER SER A . n 
A 1 40  SER 40  32  32  SER SER A . n 
A 1 41  ALA 41  33  33  ALA ALA A . n 
A 1 42  PRO 42  34  34  PRO PRO A . n 
A 1 43  GLU 43  35  35  GLU GLU A . n 
A 1 44  ASP 44  36  36  ASP ASP A . n 
A 1 45  CYS 45  37  37  CYS CYS A . n 
A 1 46  THR 46  38  38  THR THR A . n 
A 1 47  SER 47  39  39  SER SER A . n 
A 1 48  PHE 48  40  40  PHE PHE A . n 
A 1 49  SER 49  41  41  SER SER A . n 
A 1 50  ILE 50  42  42  ILE ILE A . n 
A 1 51  ASN 51  43  43  ASN ASN A . n 
A 1 52  ALA 52  44  44  ALA ALA A . n 
A 1 53  SER 53  45  45  SER SER A . n 
A 1 54  PRO 54  46  46  PRO PRO A . n 
A 1 55  GLY 55  47  47  GLY GLY A . n 
A 1 56  VAL 56  48  48  VAL VAL A . n 
A 1 57  VAL 57  49  49  VAL VAL A . n 
A 1 58  VAL 58  50  50  VAL VAL A . n 
A 1 59  ASP 59  51  51  ASP ASP A . n 
A 1 60  ILE 60  52  52  ILE ILE A . n 
A 1 61  ALA 61  53  53  ALA ALA A . n 
A 1 62  HIS 62  54  ?   ?   ?   A . n 
A 1 63  GLY 63  55  ?   ?   ?   A . n 
A 1 64  PRO 64  56  ?   ?   ?   A . n 
A 1 65  PRO 65  57  ?   ?   ?   A . n 
A 1 66  ALA 66  58  ?   ?   ?   A . n 
A 1 67  LYS 67  59  ?   ?   ?   A . n 
A 1 68  LYS 68  60  ?   ?   ?   A . n 
A 1 69  LYS 69  61  ?   ?   ?   A . n 
A 1 70  SER 70  62  ?   ?   ?   A . n 
A 1 71  THR 71  63  ?   ?   ?   A . n 
A 1 72  GLY 72  64  ?   ?   ?   A . n 
A 1 73  SER 73  65  ?   ?   ?   A . n 
A 1 74  SER 74  66  66  SER SER A . n 
A 1 75  THR 75  67  67  THR THR A . n 
A 1 76  TRP 76  68  68  TRP TRP A . n 
A 1 77  PRO 77  69  69  PRO PRO A . n 
A 1 78  LEU 78  70  70  LEU LEU A . n 
A 1 79  ASP 79  71  71  ASP ASP A . n 
A 1 80  PRO 80  72  72  PRO PRO A . n 
A 1 81  GLY 81  73  73  GLY GLY A . n 
A 1 82  VAL 82  74  74  VAL VAL A . n 
A 1 83  GLU 83  75  75  GLU GLU A . n 
A 1 84  VAL 84  76  76  VAL VAL A . n 
A 1 85  THR 85  77  77  THR THR A . n 
A 1 86  LEU 86  78  78  LEU LEU A . n 
A 1 87  THR 87  79  79  THR THR A . n 
A 1 88  MET 88  80  80  MET MET A . n 
A 1 89  LYS 89  81  81  LYS LYS A . n 
A 1 90  VAL 90  82  82  VAL VAL A . n 
A 1 91  ALA 91  83  83  ALA ALA A . n 
A 1 92  SER 92  84  84  SER SER A . n 
A 1 93  GLY 93  85  85  GLY GLY A . n 
A 1 94  SER 94  86  86  SER SER A . n 
A 1 95  THR 95  87  87  THR THR A . n 
A 1 96  GLY 96  88  88  GLY GLY A . n 
A 1 97  ASP 97  89  89  ASP ASP A . n 
A 1 98  GLN 98  90  90  GLN GLN A . n 
A 1 99  LYS 99  91  91  LYS LYS A . n 
A 1 100 VAL 100 92  92  VAL VAL A . n 
A 1 101 GLN 101 93  93  GLN GLN A . n 
A 1 102 ILE 102 94  94  ILE ILE A . n 
A 1 103 SER 103 95  95  SER SER A . n 
A 1 104 TYR 104 96  96  TYR TYR A . n 
A 1 105 TYR 105 97  97  TYR TYR A . n 
A 1 106 GLY 106 98  ?   ?   ?   A . n 
A 1 107 PRO 107 99  ?   ?   ?   A . n 
A 1 108 LYS 108 100 ?   ?   ?   A . n 
A 1 109 THR 109 101 ?   ?   ?   A . n 
A 1 110 PRO 110 102 ?   ?   ?   A . n 
A 1 111 PRO 111 103 103 PRO PRO A . n 
A 1 112 VAL 112 104 104 VAL VAL A . n 
A 1 113 LYS 113 105 105 LYS LYS A . n 
A 1 114 ALA 114 106 106 ALA ALA A . n 
A 1 115 LEU 115 107 107 LEU LEU A . n 
A 1 116 LEU 116 108 108 LEU LEU A . n 
A 1 117 TYR 117 109 109 TYR TYR A . n 
A 1 118 LEU 118 110 110 LEU LEU A . n 
A 1 119 THR 119 111 111 THR THR A . n 
A 1 120 GLY 120 112 112 GLY GLY A . n 
A 1 121 VAL 121 113 113 VAL VAL A . n 
A 1 122 GLU 122 114 114 GLU GLU A . n 
A 1 123 ILE 123 115 115 ILE ILE A . n 
A 1 124 SER 124 116 116 SER SER A . n 
A 1 125 LEU 125 117 117 LEU LEU A . n 
A 1 126 CYS 126 118 118 CYS CYS A . n 
A 1 127 ALA 127 119 119 ALA ALA A . n 
A 1 128 ASP 128 120 120 ASP ASP A . n 
A 1 129 ILE 129 121 121 ILE ILE A . n 
A 1 130 THR 130 122 122 THR THR A . n 
A 1 131 ARG 131 123 123 ARG ARG A . n 
A 1 132 THR 132 124 124 THR THR A . n 
A 1 133 GLY 133 125 125 GLY GLY A . n 
A 1 134 LYS 134 126 126 LYS LYS A . n 
A 1 135 VAL 135 127 127 VAL VAL A . n 
A 1 136 LYS 136 128 128 LYS LYS A . n 
A 1 137 PRO 137 129 129 PRO PRO A . n 
A 1 138 THR 138 130 130 THR THR A . n 
A 1 139 ARG 139 131 ?   ?   ?   A . n 
A 1 140 ALA 140 132 132 ALA ALA A . n 
A 1 141 VAL 141 133 133 VAL VAL A . n 
A 1 142 LYS 142 134 134 LYS LYS A . n 
A 1 143 ASP 143 135 135 ASP ASP A . n 
A 1 144 GLN 144 136 136 GLN GLN A . n 
A 1 145 ARG 145 137 137 ARG ARG A . n 
A 1 146 THR 146 138 138 THR THR A . n 
A 1 147 TRP 147 139 139 TRP TRP A . n 
A 1 148 THR 148 140 140 THR THR A . n 
A 1 149 TRP 149 141 141 TRP TRP A . n 
A 1 150 GLY 150 142 142 GLY GLY A . n 
A 1 151 PRO 151 143 143 PRO PRO A . n 
A 1 152 CYS 152 144 144 CYS CYS A . n 
A 1 153 GLY 153 145 145 GLY GLY A . n 
A 1 154 GLN 154 146 146 GLN GLN A . n 
A 1 155 GLY 155 147 147 GLY GLY A . n 
A 1 156 ALA 156 148 148 ALA ALA A . n 
A 1 157 ILE 157 149 149 ILE ILE A . n 
A 1 158 LEU 158 150 150 LEU LEU A . n 
A 1 159 LEU 159 151 151 LEU LEU A . n 
A 1 160 VAL 160 152 152 VAL VAL A . n 
A 1 161 ASN 161 153 153 ASN ASN A . n 
A 1 162 CYS 162 154 154 CYS CYS A . n 
A 1 163 ASP 163 155 155 ASP ASP A . n 
A 1 164 ARG 164 156 156 ARG ARG A . n 
A 1 165 ASP 165 157 157 ASP ASP A . n 
A 1 166 ASN 166 158 158 ASN ASN A . n 
A 1 167 LEU 167 159 159 LEU LEU A . n 
A 1 168 GLU 168 160 160 GLU GLU A . n 
A 1 169 SER 169 161 161 SER SER A . n 
A 1 170 SER 170 162 162 SER SER A . n 
A 1 171 ALA 171 163 163 ALA ALA A . n 
A 1 172 MET 172 164 164 MET MET A . n 
A 1 173 ASP 173 165 165 ASP ASP A . n 
A 1 174 CYS 174 166 166 CYS CYS A . n 
A 1 175 GLU 175 167 167 GLU GLU A . n 
A 1 176 ASP 176 168 168 ASP ASP A . n 
A 1 177 ASP 177 169 169 ASP ASP A . n 
A 1 178 GLU 178 170 170 GLU GLU A . n 
A 1 179 VAL 179 171 171 VAL VAL A . n 
A 1 180 LEU 180 172 172 LEU LEU A . n 
A 1 181 ASP 181 173 173 ASP ASP A . n 
A 1 182 SER 182 174 174 SER SER A . n 
A 1 183 GLU 183 175 175 GLU GLU A . n 
A 1 184 ASP 184 176 176 ASP ASP A . n 
A 1 185 LEU 185 177 177 LEU LEU A . n 
A 1 186 GLN 186 178 178 GLN GLN A . n 
A 1 187 ASP 187 179 179 ASP ASP A . n 
A 1 188 MET 188 180 180 MET MET A . n 
A 1 189 SER 189 181 181 SER SER A . n 
A 1 190 LEU 190 182 182 LEU LEU A . n 
A 1 191 MET 191 183 183 MET MET A . n 
A 1 192 THR 192 184 184 THR THR A . n 
A 1 193 LEU 193 185 185 LEU LEU A . n 
A 1 194 SER 194 186 186 SER SER A . n 
A 1 195 THR 195 187 187 THR THR A . n 
A 1 196 LYS 196 188 188 LYS LYS A . n 
A 1 197 THR 197 189 189 THR THR A . n 
A 1 198 PRO 198 190 190 PRO PRO A . n 
A 1 199 LYS 199 191 191 LYS LYS A . n 
A 1 200 ASP 200 192 192 ASP ASP A . n 
A 1 201 PHE 201 193 193 PHE PHE A . n 
A 1 202 PHE 202 194 194 PHE PHE A . n 
A 1 203 THR 203 195 195 THR THR A . n 
A 1 204 ASN 204 196 196 ASN ASN A . n 
A 1 205 HIS 205 197 197 HIS HIS A . n 
A 1 206 THR 206 198 198 THR THR A . n 
A 1 207 LEU 207 199 199 LEU LEU A . n 
A 1 208 VAL 208 200 200 VAL VAL A . n 
A 1 209 LEU 209 201 201 LEU LEU A . n 
A 1 210 HIS 210 202 202 HIS HIS A . n 
A 1 211 VAL 211 203 203 VAL VAL A . n 
A 1 212 ALA 212 204 204 ALA ALA A . n 
A 1 213 ARG 213 205 205 ARG ARG A . n 
A 1 214 SER 214 206 206 SER SER A . n 
A 1 215 GLU 215 207 207 GLU GLU A . n 
A 1 216 MET 216 208 208 MET MET A . n 
A 1 217 ASP 217 209 209 ASP ASP A . n 
A 1 218 LYS 218 210 210 LYS LYS A . n 
A 1 219 VAL 219 211 211 VAL VAL A . n 
A 1 220 ARG 220 212 212 ARG ARG A . n 
A 1 221 VAL 221 213 213 VAL VAL A . n 
A 1 222 PHE 222 214 214 PHE PHE A . n 
A 1 223 GLN 223 215 215 GLN GLN A . n 
A 1 224 ALA 224 216 216 ALA ALA A . n 
A 1 225 THR 225 217 217 THR THR A . n 
A 1 226 ARG 226 218 ?   ?   ?   A . n 
A 1 227 GLY 227 219 ?   ?   ?   A . n 
A 1 228 LYS 228 220 ?   ?   ?   A . n 
A 1 229 LEU 229 221 ?   ?   ?   A . n 
A 1 230 SER 230 222 ?   ?   ?   A . n 
A 1 231 SER 231 223 ?   ?   ?   A . n 
A 1 232 LYS 232 224 224 LYS LYS A . n 
A 1 233 CYS 233 225 225 CYS CYS A . n 
A 1 234 SER 234 226 226 SER SER A . n 
A 1 235 VAL 235 227 227 VAL VAL A . n 
A 1 236 VAL 236 228 228 VAL VAL A . n 
A 1 237 LEU 237 229 229 LEU LEU A . n 
A 1 238 GLY 238 230 230 GLY GLY A . n 
A 1 239 PRO 239 231 231 PRO PRO A . n 
A 1 240 LYS 240 232 232 LYS LYS A . n 
A 1 241 TRP 241 233 233 TRP TRP A . n 
A 1 242 PRO 242 234 234 PRO PRO A . n 
A 1 243 SER 243 235 235 SER SER A . n 
A 1 244 HIS 244 236 236 HIS HIS A . n 
A 1 245 TYR 245 237 237 TYR TYR A . n 
A 1 246 LEU 246 238 238 LEU LEU A . n 
A 1 247 MET 247 239 239 MET MET A . n 
A 1 248 VAL 248 240 240 VAL VAL A . n 
A 1 249 PRO 249 241 241 PRO PRO A . n 
A 1 250 GLY 250 242 242 GLY GLY A . n 
A 1 251 GLY 251 243 243 GLY GLY A . n 
A 1 252 LYS 252 244 244 LYS LYS A . n 
A 1 253 HIS 253 245 245 HIS HIS A . n 
A 1 254 ASN 254 246 246 ASN ASN A . n 
A 1 255 MET 255 247 247 MET MET A . n 
A 1 256 ASP 256 248 248 ASP ASP A . n 
A 1 257 PHE 257 249 249 PHE PHE A . n 
A 1 258 TYR 258 250 250 TYR TYR A . n 
A 1 259 VAL 259 251 251 VAL VAL A . n 
A 1 260 GLU 260 252 252 GLU GLU A . n 
A 1 261 ALA 261 253 253 ALA ALA A . n 
A 1 262 LEU 262 254 254 LEU LEU A . n 
A 1 263 ALA 263 255 255 ALA ALA A . n 
A 1 264 PHE 264 256 256 PHE PHE A . n 
A 1 265 PRO 265 257 257 PRO PRO A . n 
A 1 266 ASP 266 258 258 ASP ASP A . n 
A 1 267 THR 267 259 259 THR THR A . n 
A 1 268 ASP 268 260 260 ASP ASP A . n 
A 1 269 PHE 269 261 261 PHE PHE A . n 
A 1 270 PRO 270 262 262 PRO PRO A . n 
A 1 271 GLY 271 263 263 GLY GLY A . n 
A 1 272 LEU 272 264 264 LEU LEU A . n 
A 1 273 ILE 273 265 265 ILE ILE A . n 
A 1 274 THR 274 266 266 THR THR A . n 
A 1 275 LEU 275 267 267 LEU LEU A . n 
A 1 276 THR 276 268 268 THR THR A . n 
A 1 277 ILE 277 269 269 ILE ILE A . n 
A 1 278 SER 278 270 270 SER SER A . n 
A 1 279 LEU 279 271 271 LEU LEU A . n 
A 1 280 LEU 280 272 272 LEU LEU A . n 
A 1 281 ASP 281 273 273 ASP ASP A . n 
A 1 282 THR 282 274 274 THR THR A . n 
A 1 283 SER 283 275 275 SER SER A . n 
A 1 284 ASN 284 276 276 ASN ASN A . n 
A 1 285 LEU 285 277 277 LEU LEU A . n 
A 1 286 GLU 286 278 278 GLU GLU A . n 
A 1 287 LEU 287 279 279 LEU LEU A . n 
A 1 288 PRO 288 280 280 PRO PRO A . n 
A 1 289 GLU 289 281 281 GLU GLU A . n 
A 1 290 ALA 290 282 282 ALA ALA A . n 
A 1 291 VAL 291 283 283 VAL VAL A . n 
A 1 292 VAL 292 284 284 VAL VAL A . n 
A 1 293 PHE 293 285 285 PHE PHE A . n 
A 1 294 GLN 294 286 286 GLN GLN A . n 
A 1 295 ASP 295 287 287 ASP ASP A . n 
A 1 296 SER 296 288 288 SER SER A . n 
A 1 297 VAL 297 289 289 VAL VAL A . n 
A 1 298 VAL 298 290 290 VAL VAL A . n 
A 1 299 PHE 299 291 291 PHE PHE A . n 
A 1 300 ARG 300 292 292 ARG ARG A . n 
A 1 301 VAL 301 293 293 VAL VAL A . n 
A 1 302 ALA 302 294 294 ALA ALA A . n 
A 1 303 PRO 303 295 295 PRO PRO A . n 
A 1 304 TRP 304 296 296 TRP TRP A . n 
A 1 305 ILE 305 297 297 ILE ILE A . n 
A 1 306 MET 306 298 298 MET MET A . n 
A 1 307 THR 307 299 299 THR THR A . n 
A 1 308 PRO 308 300 300 PRO PRO A . n 
A 1 309 ASN 309 301 301 ASN ASN A . n 
A 1 310 THR 310 302 302 THR THR A . n 
A 1 311 GLN 311 303 303 GLN GLN A . n 
A 1 312 PRO 312 304 304 PRO PRO A . n 
A 1 313 PRO 313 305 305 PRO PRO A . n 
A 1 314 GLN 314 306 306 GLN GLN A . n 
A 1 315 GLU 315 307 307 GLU GLU A . n 
A 1 316 VAL 316 308 308 VAL VAL A . n 
A 1 317 TYR 317 309 309 TYR TYR A . n 
A 1 318 ALA 318 310 310 ALA ALA A . n 
A 1 319 CYS 319 311 311 CYS CYS A . n 
A 1 320 SER 320 312 ?   ?   ?   A . n 
A 1 321 ILE 321 313 ?   ?   ?   A . n 
A 1 322 PHE 322 314 314 PHE PHE A . n 
A 1 323 GLU 323 315 315 GLU GLU A . n 
A 1 324 ASN 324 316 316 ASN ASN A . n 
A 1 325 GLU 325 317 317 GLU GLU A . n 
A 1 326 ASP 326 318 318 ASP ASP A . n 
A 1 327 PHE 327 319 319 PHE PHE A . n 
A 1 328 LEU 328 320 320 LEU LEU A . n 
A 1 329 LYS 329 321 321 LYS LYS A . n 
A 1 330 SER 330 322 322 SER SER A . n 
A 1 331 VAL 331 323 323 VAL VAL A . n 
A 1 332 THR 332 324 324 THR THR A . n 
A 1 333 THR 333 325 325 THR THR A . n 
A 1 334 LEU 334 326 326 LEU LEU A . n 
A 1 335 ALA 335 327 327 ALA ALA A . n 
A 1 336 MET 336 328 328 MET MET A . n 
A 1 337 LYS 337 329 329 LYS LYS A . n 
A 1 338 ALA 338 330 330 ALA ALA A . n 
A 1 339 LYS 339 331 331 LYS LYS A . n 
A 1 340 CYS 340 332 332 CYS CYS A . n 
A 1 341 LYS 341 333 333 LYS LYS A . n 
A 1 342 LEU 342 334 334 LEU LEU A . n 
A 1 343 THR 343 335 335 THR THR A . n 
A 1 344 ILE 344 336 336 ILE ILE A . n 
A 1 345 CYS 345 337 ?   ?   ?   A . n 
A 1 346 PRO 346 338 ?   ?   ?   A . n 
A 1 347 GLU 347 339 ?   ?   ?   A . n 
A 1 348 GLU 348 340 ?   ?   ?   A . n 
A 1 349 GLU 349 341 ?   ?   ?   A . n 
A 1 350 ASN 350 342 ?   ?   ?   A . n 
A 1 351 MET 351 343 ?   ?   ?   A . n 
A 1 352 ASP 352 344 ?   ?   ?   A . n 
A 1 353 ASP 353 345 ?   ?   ?   A . n 
A 1 354 GLN 354 346 ?   ?   ?   A . n 
A 1 355 TRP 355 347 ?   ?   ?   A . n 
A 1 356 MET 356 348 ?   ?   ?   A . n 
A 1 357 GLN 357 349 349 GLN GLN A . n 
A 1 358 ASP 358 350 350 ASP ASP A . n 
A 1 359 GLU 359 351 351 GLU GLU A . n 
A 1 360 MET 360 352 352 MET MET A . n 
A 1 361 GLU 361 353 353 GLU GLU A . n 
A 1 362 ILE 362 354 354 ILE ILE A . n 
A 1 363 GLY 363 355 355 GLY GLY A . n 
A 1 364 TYR 364 356 356 TYR TYR A . n 
A 1 365 ILE 365 357 357 ILE ILE A . n 
A 1 366 GLN 366 358 358 GLN GLN A . n 
A 1 367 ALA 367 359 359 ALA ALA A . n 
A 1 368 PRO 368 360 360 PRO PRO A . n 
A 1 369 HIS 369 361 361 HIS HIS A . n 
A 1 370 LYS 370 362 362 LYS LYS A . n 
A 1 371 THR 371 363 363 THR THR A . n 
A 1 372 LEU 372 364 364 LEU LEU A . n 
A 1 373 PRO 373 365 365 PRO PRO A . n 
A 1 374 VAL 374 366 366 VAL VAL A . n 
A 1 375 VAL 375 367 367 VAL VAL A . n 
A 1 376 PHE 376 368 368 PHE PHE A . n 
A 1 377 ASP 377 369 369 ASP ASP A . n 
A 1 378 SER 378 370 370 SER SER A . n 
A 1 379 PRO 379 371 371 PRO PRO A . n 
A 1 380 ARG 380 372 372 ARG ARG A . n 
A 1 381 ASN 381 373 ?   ?   ?   A . n 
A 1 382 ARG 382 374 ?   ?   ?   A . n 
A 1 383 GLY 383 375 ?   ?   ?   A . n 
A 1 384 LEU 384 376 ?   ?   ?   A . n 
A 1 385 LYS 385 377 ?   ?   ?   A . n 
A 1 386 GLU 386 378 ?   ?   ?   A . n 
A 1 387 PHE 387 379 ?   ?   ?   A . n 
A 1 388 PRO 388 380 ?   ?   ?   A . n 
A 1 389 ILE 389 381 ?   ?   ?   A . n 
A 1 390 LYS 390 382 382 LYS LYS A . n 
A 1 391 ARG 391 383 383 ARG ARG A . n 
A 1 392 VAL 392 384 384 VAL VAL A . n 
A 1 393 MET 393 385 385 MET MET A . n 
A 1 394 GLY 394 386 386 GLY GLY A . n 
A 1 395 PRO 395 387 387 PRO PRO A . n 
A 1 396 ASP 396 388 388 ASP ASP A . n 
A 1 397 PHE 397 389 389 PHE PHE A . n 
A 1 398 GLY 398 390 390 GLY GLY A . n 
A 1 399 TYR 399 391 391 TYR TYR A . n 
A 1 400 VAL 400 392 392 VAL VAL A . n 
A 1 401 THR 401 393 393 THR THR A . n 
A 1 402 ARG 402 394 394 ARG ARG A . n 
A 1 403 GLY 403 395 ?   ?   ?   A . n 
A 1 404 PRO 404 396 ?   ?   ?   A . n 
A 1 405 GLN 405 397 ?   ?   ?   A . n 
A 1 406 THR 406 398 ?   ?   ?   A . n 
A 1 407 GLY 407 399 ?   ?   ?   A . n 
A 1 408 GLY 408 400 ?   ?   ?   A . n 
A 1 409 ILE 409 401 401 ILE ILE A . n 
A 1 410 SER 410 402 402 SER SER A . n 
A 1 411 GLY 411 403 403 GLY GLY A . n 
A 1 412 LEU 412 404 404 LEU LEU A . n 
A 1 413 ASP 413 405 405 ASP ASP A . n 
A 1 414 SER 414 406 406 SER SER A . n 
A 1 415 PHE 415 407 407 PHE PHE A . n 
A 1 416 GLY 416 408 408 GLY GLY A . n 
A 1 417 ASN 417 409 409 ASN ASN A . n 
A 1 418 LEU 418 410 410 LEU LEU A . n 
A 1 419 GLU 419 411 411 GLU GLU A . n 
A 1 420 VAL 420 412 412 VAL VAL A . n 
A 1 421 SER 421 413 413 SER SER A . n 
A 1 422 PRO 422 414 414 PRO PRO A . n 
A 1 423 PRO 423 415 415 PRO PRO A . n 
A 1 424 VAL 424 416 416 VAL VAL A . n 
A 1 425 THR 425 417 417 THR THR A . n 
A 1 426 VAL 426 418 418 VAL VAL A . n 
A 1 427 ARG 427 419 419 ARG ARG A . n 
A 1 428 GLY 428 420 420 GLY GLY A . n 
A 1 429 LYS 429 421 421 LYS LYS A . n 
A 1 430 GLU 430 422 422 GLU GLU A . n 
A 1 431 TYR 431 423 423 TYR TYR A . n 
A 1 432 PRO 432 424 424 PRO PRO A . n 
A 1 433 LEU 433 425 425 LEU LEU A . n 
A 1 434 GLY 434 426 426 GLY GLY A . n 
A 1 435 ARG 435 427 427 ARG ARG A . n 
A 1 436 ILE 436 428 428 ILE ILE A . n 
A 1 437 LEU 437 429 429 LEU LEU A . n 
A 1 438 PHE 438 430 430 PHE PHE A . n 
A 1 439 GLY 439 431 431 GLY GLY A . n 
A 1 440 ASP 440 432 432 ASP ASP A . n 
A 1 441 SER 441 433 433 SER SER A . n 
A 1 442 CYS 442 434 434 CYS CYS A . n 
A 1 443 TYR 443 435 435 TYR TYR A . n 
A 1 444 PRO 444 436 436 PRO PRO A . n 
A 1 445 SER 445 437 437 SER SER A . n 
A 1 446 ASN 446 438 438 ASN ASN A . n 
A 1 447 ASP 447 439 439 ASP ASP A . n 
A 1 448 SER 448 440 440 SER SER A . n 
A 1 449 ARG 449 441 441 ARG ARG A . n 
A 1 450 GLN 450 442 442 GLN GLN A . n 
A 1 451 MET 451 443 443 MET MET A . n 
A 1 452 HIS 452 444 444 HIS HIS A . n 
A 1 453 GLN 453 445 445 GLN GLN A . n 
A 1 454 ALA 454 446 446 ALA ALA A . n 
A 1 455 LEU 455 447 447 LEU LEU A . n 
A 1 456 GLN 456 448 448 GLN GLN A . n 
A 1 457 ASP 457 449 449 ASP ASP A . n 
A 1 458 PHE 458 450 450 PHE PHE A . n 
A 1 459 LEU 459 451 451 LEU LEU A . n 
A 1 460 SER 460 452 452 SER SER A . n 
A 1 461 ALA 461 453 453 ALA ALA A . n 
A 1 462 GLN 462 454 454 GLN GLN A . n 
A 1 463 GLN 463 455 455 GLN GLN A . n 
A 1 464 VAL 464 456 456 VAL VAL A . n 
A 1 465 GLN 465 457 457 GLN GLN A . n 
A 1 466 ALA 466 458 458 ALA ALA A . n 
A 1 467 PRO 467 459 459 PRO PRO A . n 
A 1 468 VAL 468 460 460 VAL VAL A . n 
A 1 469 LYS 469 461 461 LYS LYS A . n 
A 1 470 LEU 470 462 462 LEU LEU A . n 
A 1 471 TYR 471 463 463 TYR TYR A . n 
A 1 472 SER 472 464 464 SER SER A . n 
A 1 473 ASP 473 465 465 ASP ASP A . n 
A 1 474 TRP 474 466 466 TRP TRP A . n 
A 1 475 LEU 475 467 467 LEU LEU A . n 
A 1 476 SER 476 468 468 SER SER A . n 
A 1 477 VAL 477 469 469 VAL VAL A . n 
A 1 478 GLY 478 470 470 GLY GLY A . n 
A 1 479 HIS 479 471 471 HIS HIS A . n 
A 1 480 VAL 480 472 472 VAL VAL A . n 
A 1 481 ASP 481 473 473 ASP ASP A . n 
A 1 482 GLU 482 474 474 GLU GLU A . n 
A 1 483 PHE 483 475 475 PHE PHE A . n 
A 1 484 LEU 484 476 476 LEU LEU A . n 
A 1 485 SER 485 477 477 SER SER A . n 
A 1 486 PHE 486 478 478 PHE PHE A . n 
A 1 487 VAL 487 479 479 VAL VAL A . n 
A 1 488 PRO 488 480 480 PRO PRO A . n 
A 1 489 ALA 489 481 481 ALA ALA A . n 
A 1 490 PRO 490 482 482 PRO PRO A . n 
A 1 491 ASP 491 483 483 ASP ASP A . n 
A 1 492 ARG 492 484 484 ARG ARG A . n 
A 1 493 LYS 493 485 485 LYS LYS A . n 
A 1 494 GLY 494 486 486 GLY GLY A . n 
A 1 495 PHE 495 487 487 PHE PHE A . n 
A 1 496 ARG 496 488 488 ARG ARG A . n 
A 1 497 LEU 497 489 489 LEU LEU A . n 
A 1 498 LEU 498 490 490 LEU LEU A . n 
A 1 499 LEU 499 491 491 LEU LEU A . n 
A 1 500 ALA 500 492 492 ALA ALA A . n 
A 1 501 SER 501 493 493 SER SER A . n 
A 1 502 PRO 502 494 494 PRO PRO A . n 
A 1 503 ARG 503 495 495 ARG ARG A . n 
A 1 504 SER 504 496 496 SER SER A . n 
A 1 505 CYS 505 497 497 CYS CYS A . n 
A 1 506 TYR 506 498 498 TYR TYR A . n 
A 1 507 LYS 507 499 499 LYS LYS A . n 
A 1 508 LEU 508 500 500 LEU LEU A . n 
A 1 509 PHE 509 501 501 PHE PHE A . n 
A 1 510 GLN 510 502 502 GLN GLN A . n 
A 1 511 GLU 511 503 503 GLU GLU A . n 
A 1 512 GLN 512 504 504 GLN GLN A . n 
A 1 513 GLN 513 505 505 GLN GLN A . n 
A 1 514 ASN 514 506 506 ASN ASN A . n 
A 1 515 GLU 515 507 507 GLU GLU A . n 
A 1 516 GLY 516 508 508 GLY GLY A . n 
A 1 517 HIS 517 509 509 HIS HIS A . n 
A 1 518 GLY 518 510 510 GLY GLY A . n 
A 1 519 GLU 519 511 511 GLU GLU A . n 
A 1 520 ALA 520 512 512 ALA ALA A . n 
A 1 521 LEU 521 513 513 LEU LEU A . n 
A 1 522 LEU 522 514 514 LEU LEU A . n 
A 1 523 PHE 523 515 515 PHE PHE A . n 
A 1 524 GLU 524 516 516 GLU GLU A . n 
A 1 525 GLY 525 517 517 GLY GLY A . n 
A 1 526 ILE 526 518 518 ILE ILE A . n 
A 1 527 LYS 527 519 519 LYS LYS A . n 
A 1 528 LYS 528 520 520 LYS LYS A . n 
A 1 529 LYS 529 521 521 LYS LYS A . n 
A 1 530 LYS 530 522 522 LYS LYS A . n 
A 1 531 GLN 531 523 523 GLN GLN A . n 
A 1 532 GLN 532 524 524 GLN GLN A . n 
A 1 533 LYS 533 525 525 LYS LYS A . n 
A 1 534 ILE 534 526 526 ILE ILE A . n 
A 1 535 LYS 535 527 527 LYS LYS A . n 
A 1 536 ASN 536 528 528 ASN ASN A . n 
A 1 537 ILE 537 529 529 ILE ILE A . n 
A 1 538 LEU 538 530 530 LEU LEU A . n 
A 1 539 SER 539 531 531 SER SER A . n 
A 1 540 ASN 540 532 532 ASN ASN A . n 
A 1 541 LYS 541 533 533 LYS LYS A . n 
A 1 542 THR 542 534 534 THR THR A . n 
A 1 543 LEU 543 535 535 LEU LEU A . n 
A 1 544 ARG 544 536 536 ARG ARG A . n 
A 1 545 GLU 545 537 537 GLU GLU A . n 
A 1 546 HIS 546 538 538 HIS HIS A . n 
A 1 547 ASN 547 539 539 ASN ASN A . n 
A 1 548 SER 548 540 540 SER SER A . n 
A 1 549 PHE 549 541 541 PHE PHE A . n 
A 1 550 VAL 550 542 542 VAL VAL A . n 
A 1 551 GLU 551 543 543 GLU GLU A . n 
A 1 552 ARG 552 544 544 ARG ARG A . n 
A 1 553 CYS 553 545 545 CYS CYS A . n 
A 1 554 ILE 554 546 546 ILE ILE A . n 
A 1 555 ASP 555 547 547 ASP ASP A . n 
A 1 556 TRP 556 548 548 TRP TRP A . n 
A 1 557 ASN 557 549 549 ASN ASN A . n 
A 1 558 ARG 558 550 550 ARG ARG A . n 
A 1 559 GLU 559 551 551 GLU GLU A . n 
A 1 560 LEU 560 552 552 LEU LEU A . n 
A 1 561 LEU 561 553 553 LEU LEU A . n 
A 1 562 LYS 562 554 554 LYS LYS A . n 
A 1 563 ARG 563 555 555 ARG ARG A . n 
A 1 564 GLU 564 556 556 GLU GLU A . n 
A 1 565 LEU 565 557 557 LEU LEU A . n 
A 1 566 GLY 566 558 558 GLY GLY A . n 
A 1 567 LEU 567 559 559 LEU LEU A . n 
A 1 568 ALA 568 560 560 ALA ALA A . n 
A 1 569 GLU 569 561 561 GLU GLU A . n 
A 1 570 SER 570 562 562 SER SER A . n 
A 1 571 ASP 571 563 563 ASP ASP A . n 
A 1 572 ILE 572 564 564 ILE ILE A . n 
A 1 573 ILE 573 565 565 ILE ILE A . n 
A 1 574 ASP 574 566 566 ASP ASP A . n 
A 1 575 ILE 575 567 567 ILE ILE A . n 
A 1 576 PRO 576 568 568 PRO PRO A . n 
A 1 577 GLN 577 569 569 GLN GLN A . n 
A 1 578 LEU 578 570 570 LEU LEU A . n 
A 1 579 PHE 579 571 571 PHE PHE A . n 
A 1 580 LYS 580 572 572 LYS LYS A . n 
A 1 581 LEU 581 573 573 LEU LEU A . n 
A 1 582 LYS 582 574 574 LYS LYS A . n 
A 1 583 GLU 583 575 575 GLU GLU A . n 
A 1 584 PHE 584 576 576 PHE PHE A . n 
A 1 585 SER 585 577 577 SER SER A . n 
A 1 586 LYS 586 578 578 LYS LYS A . n 
A 1 587 ALA 587 579 579 ALA ALA A . n 
A 1 588 GLU 588 580 580 GLU GLU A . n 
A 1 589 ALA 589 581 581 ALA ALA A . n 
A 1 590 PHE 590 582 582 PHE PHE A . n 
A 1 591 PHE 591 583 583 PHE PHE A . n 
A 1 592 PRO 592 584 584 PRO PRO A . n 
A 1 593 ASN 593 585 585 ASN ASN A . n 
A 1 594 MET 594 586 586 MET MET A . n 
A 1 595 VAL 595 587 587 VAL VAL A . n 
A 1 596 ASN 596 588 588 ASN ASN A . n 
A 1 597 MET 597 589 589 MET MET A . n 
A 1 598 LEU 598 590 590 LEU LEU A . n 
A 1 599 VAL 599 591 591 VAL VAL A . n 
A 1 600 LEU 600 592 592 LEU LEU A . n 
A 1 601 GLY 601 593 593 GLY GLY A . n 
A 1 602 LYS 602 594 594 LYS LYS A . n 
A 1 603 HIS 603 595 595 HIS HIS A . n 
A 1 604 LEU 604 596 596 LEU LEU A . n 
A 1 605 GLY 605 597 597 GLY GLY A . n 
A 1 606 ILE 606 598 598 ILE ILE A . n 
A 1 607 PRO 607 599 599 PRO PRO A . n 
A 1 608 LYS 608 600 600 LYS LYS A . n 
A 1 609 PRO 609 601 601 PRO PRO A . n 
A 1 610 PHE 610 602 602 PHE PHE A . n 
A 1 611 GLY 611 603 603 GLY GLY A . n 
A 1 612 PRO 612 604 604 PRO PRO A . n 
A 1 613 VAL 613 605 605 VAL VAL A . n 
A 1 614 ILE 614 606 606 ILE ILE A . n 
A 1 615 ASN 615 607 607 ASN ASN A . n 
A 1 616 GLY 616 608 608 GLY GLY A . n 
A 1 617 ARG 617 609 609 ARG ARG A . n 
A 1 618 CYS 618 610 610 CYS CYS A . n 
A 1 619 CYS 619 611 611 CYS CYS A . n 
A 1 620 LEU 620 612 612 LEU LEU A . n 
A 1 621 GLU 621 613 613 GLU GLU A . n 
A 1 622 GLU 622 614 614 GLU GLU A . n 
A 1 623 LYS 623 615 615 LYS LYS A . n 
A 1 624 VAL 624 616 616 VAL VAL A . n 
A 1 625 CYS 625 617 617 CYS CYS A . n 
A 1 626 SER 626 618 618 SER SER A . n 
A 1 627 LEU 627 619 619 LEU LEU A . n 
A 1 628 LEU 628 620 620 LEU LEU A . n 
A 1 629 GLU 629 621 621 GLU GLU A . n 
A 1 630 PRO 630 622 622 PRO PRO A . n 
A 1 631 LEU 631 623 623 LEU LEU A . n 
A 1 632 GLY 632 624 624 GLY GLY A . n 
A 1 633 LEU 633 625 625 LEU LEU A . n 
A 1 634 GLN 634 626 626 GLN GLN A . n 
A 1 635 CYS 635 627 627 CYS CYS A . n 
A 1 636 THR 636 628 628 THR THR A . n 
A 1 637 PHE 637 629 629 PHE PHE A . n 
A 1 638 ILE 638 630 630 ILE ILE A . n 
A 1 639 ASN 639 631 631 ASN ASN A . n 
A 1 640 ASP 640 632 632 ASP ASP A . n 
A 1 641 PHE 641 633 633 PHE PHE A . n 
A 1 642 PHE 642 634 634 PHE PHE A . n 
A 1 643 THR 643 635 635 THR THR A . n 
A 1 644 TYR 644 636 636 TYR TYR A . n 
A 1 645 HIS 645 637 637 HIS HIS A . n 
A 1 646 ILE 646 638 638 ILE ILE A . n 
A 1 647 ARG 647 639 ?   ?   ?   A . n 
A 1 648 HIS 648 640 ?   ?   ?   A . n 
A 1 649 GLY 649 641 641 GLY GLY A . n 
A 1 650 GLU 650 642 642 GLU GLU A . n 
A 1 651 VAL 651 643 643 VAL VAL A . n 
A 1 652 HIS 652 644 644 HIS HIS A . n 
A 1 653 ALA 653 645 645 ALA ALA A . n 
A 1 654 GLY 654 646 646 GLY GLY A . n 
A 1 655 THR 655 647 647 THR THR A . n 
A 1 656 ASN 656 648 648 ASN ASN A . n 
A 1 657 VAL 657 649 649 VAL VAL A . n 
A 1 658 ARG 658 650 650 ARG ARG A . n 
A 1 659 ARG 659 651 651 ARG ARG A . n 
A 1 660 LYS 660 652 652 LYS LYS A . n 
A 1 661 PRO 661 653 653 PRO PRO A . n 
A 1 662 PHE 662 654 654 PHE PHE A . n 
A 1 663 SER 663 655 655 SER SER A . n 
A 1 664 PHE 664 656 656 PHE PHE A . n 
A 1 665 LYS 665 657 657 LYS LYS A . n 
A 1 666 TRP 666 658 658 TRP TRP A . n 
A 1 667 TRP 667 659 659 TRP TRP A . n 
A 1 668 ASN 668 660 660 ASN ASN A . n 
A 1 669 MET 669 661 661 MET MET A . n 
A 1 670 VAL 670 662 662 VAL VAL A . n 
A 1 671 PRO 671 663 663 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1  701 900 CA  CA  A . 
C 2 CA  1  702 901 CA  CA  A . 
D 2 CA  1  703 902 CA  CA  A . 
E 2 CA  1  704 904 CA  CA  A . 
F 3 3Z0 1  705 667 3Z0 UNL A . 
G 4 HOH 1  801 19  HOH HOH A . 
G 4 HOH 2  802 4   HOH HOH A . 
G 4 HOH 3  803 2   HOH HOH A . 
G 4 HOH 4  804 3   HOH HOH A . 
G 4 HOH 5  805 5   HOH HOH A . 
G 4 HOH 6  806 7   HOH HOH A . 
G 4 HOH 7  807 8   HOH HOH A . 
G 4 HOH 8  808 9   HOH HOH A . 
G 4 HOH 9  809 10  HOH HOH A . 
G 4 HOH 10 810 11  HOH HOH A . 
G 4 HOH 11 811 13  HOH HOH A . 
G 4 HOH 12 812 15  HOH HOH A . 
G 4 HOH 13 813 17  HOH HOH A . 
G 4 HOH 14 814 18  HOH HOH A . 
G 4 HOH 15 815 20  HOH HOH A . 
G 4 HOH 16 816 22  HOH HOH A . 
G 4 HOH 17 817 23  HOH HOH A . 
G 4 HOH 18 818 24  HOH HOH A . 
G 4 HOH 19 819 25  HOH HOH A . 
G 4 HOH 20 820 26  HOH HOH A . 
G 4 HOH 21 821 27  HOH HOH A . 
G 4 HOH 22 822 28  HOH HOH A . 
G 4 HOH 23 823 29  HOH HOH A . 
G 4 HOH 24 824 30  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5000  ? 
1 MORE         -84   ? 
1 'SSA (A^2)'  50210 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 161 ? A ASN 153 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD1 ? A ASP 163 ? A ASP 155 ? 1_555 81.4  ? 
2  OD1 ? A ASN 161 ? A ASN 153 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 165 ? A ASP 157 ? 1_555 174.0 ? 
3  OD1 ? A ASP 163 ? A ASP 155 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 165 ? A ASP 157 ? 1_555 92.6  ? 
4  OD1 ? A ASN 161 ? A ASN 153 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 173 ? A ASP 165 ? 1_555 98.4  ? 
5  OD1 ? A ASP 163 ? A ASP 155 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 173 ? A ASP 165 ? 1_555 78.0  ? 
6  OD2 ? A ASP 165 ? A ASP 157 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 173 ? A ASP 165 ? 1_555 79.7  ? 
7  OD1 ? A ASN 161 ? A ASN 153 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD1 ? A ASP 184 ? A ASP 176 ? 1_555 90.9  ? 
8  OD1 ? A ASP 163 ? A ASP 155 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD1 ? A ASP 184 ? A ASP 176 ? 1_555 166.9 ? 
9  OD2 ? A ASP 165 ? A ASP 157 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD1 ? A ASP 184 ? A ASP 176 ? 1_555 94.8  ? 
10 OD2 ? A ASP 173 ? A ASP 165 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD1 ? A ASP 184 ? A ASP 176 ? 1_555 92.8  ? 
11 OD1 ? A ASN 161 ? A ASN 153 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 107.8 ? 
12 OD1 ? A ASP 163 ? A ASP 155 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 98.5  ? 
13 OD2 ? A ASP 165 ? A ASP 157 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 73.4  ? 
14 OD2 ? A ASP 173 ? A ASP 165 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 152.7 ? 
15 OD1 ? A ASP 184 ? A ASP 176 ? 1_555 CA ? C CA . ? A CA 702 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 93.9  ? 
16 OD1 ? A ASP 165 ? A ASP 157 ? 1_555 CA ? D CA . ? A CA 703 ? 1_555 OD1 ? A ASP 187 ? A ASP 179 ? 1_555 146.8 ? 
17 OD1 ? A ASP 165 ? A ASP 157 ? 1_555 CA ? D CA . ? A CA 703 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 96.6  ? 
18 OD1 ? A ASP 187 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 703 ? 1_555 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 50.2  ? 
19 OD1 ? A ASP 165 ? A ASP 157 ? 1_555 CA ? D CA . ? A CA 703 ? 1_555 OD1 ? A ASP 396 ? A ASP 388 ? 1_555 94.3  ? 
20 OD1 ? A ASP 187 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 703 ? 1_555 OD1 ? A ASP 396 ? A ASP 388 ? 1_555 115.9 ? 
21 OD2 ? A ASP 187 ? A ASP 179 ? 1_555 CA ? D CA . ? A CA 703 ? 1_555 OD1 ? A ASP 396 ? A ASP 388 ? 1_555 155.4 ? 
22 O   ? A ASP 173 ? A ASP 165 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 OD1 ? A ASP 176 ? A ASP 168 ? 1_555 63.8  ? 
23 O   ? A ASP 173 ? A ASP 165 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 OD2 ? A ASP 176 ? A ASP 168 ? 1_555 101.4 ? 
24 OD1 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 OD2 ? A ASP 176 ? A ASP 168 ? 1_555 42.6  ? 
25 O   ? A ASP 173 ? A ASP 165 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? A GLU 178 ? A GLU 170 ? 1_555 170.4 ? 
26 OD1 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? A GLU 178 ? A GLU 170 ? 1_555 106.9 ? 
27 OD2 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? A GLU 178 ? A GLU 170 ? 1_555 69.1  ? 
28 O   ? A ASP 173 ? A ASP 165 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 821 ? 1_555 72.1  ? 
29 OD1 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 821 ? 1_555 134.4 ? 
30 OD2 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 821 ? 1_555 169.4 ? 
31 O   ? A GLU 178 ? A GLU 170 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 821 ? 1_555 117.4 ? 
32 O   ? A ASP 173 ? A ASP 165 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 822 ? 1_555 67.0  ? 
33 OD1 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 822 ? 1_555 102.4 ? 
34 OD2 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 822 ? 1_555 101.0 ? 
35 O   ? A GLU 178 ? A GLU 170 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 822 ? 1_555 114.9 ? 
36 O   ? G HOH .   ? A HOH 821 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 822 ? 1_555 68.8  ? 
37 O   ? A ASP 173 ? A ASP 165 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 813 ? 1_555 113.6 ? 
38 OD1 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 813 ? 1_555 88.1  ? 
39 OD2 ? A ASP 176 ? A ASP 168 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 813 ? 1_555 90.8  ? 
40 O   ? A GLU 178 ? A GLU 170 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 813 ? 1_555 66.8  ? 
41 O   ? G HOH .   ? A HOH 821 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 813 ? 1_555 99.4  ? 
42 O   ? G HOH .   ? A HOH 822 ? 1_555 CA ? E CA . ? A CA 704 ? 1_555 O   ? G HOH .   ? A HOH 813 ? 1_555 167.8 ? 
43 OE1 ? A GLU 361 ? A GLU 353 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? A PHE 415 ? A PHE 407 ? 1_555 75.8  ? 
44 OE1 ? A GLU 361 ? A GLU 353 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? A LEU 418 ? A LEU 410 ? 1_555 79.6  ? 
45 O   ? A PHE 415 ? A PHE 407 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? A LEU 418 ? A LEU 410 ? 1_555 78.1  ? 
46 OE1 ? A GLU 361 ? A GLU 353 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 OE1 ? A GLU 419 ? A GLU 411 ? 1_555 122.4 ? 
47 O   ? A PHE 415 ? A PHE 407 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 OE1 ? A GLU 419 ? A GLU 411 ? 1_555 157.8 ? 
48 O   ? A LEU 418 ? A LEU 410 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 OE1 ? A GLU 419 ? A GLU 411 ? 1_555 92.0  ? 
49 OE1 ? A GLU 361 ? A GLU 353 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 818 ? 1_555 61.1  ? 
50 O   ? A PHE 415 ? A PHE 407 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 818 ? 1_555 65.3  ? 
51 O   ? A LEU 418 ? A LEU 410 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 818 ? 1_555 131.0 ? 
52 OE1 ? A GLU 419 ? A GLU 411 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 818 ? 1_555 132.8 ? 
53 OE1 ? A GLU 361 ? A GLU 353 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 819 ? 1_555 119.1 ? 
54 O   ? A PHE 415 ? A PHE 407 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 819 ? 1_555 103.0 ? 
55 O   ? A LEU 418 ? A LEU 410 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 819 ? 1_555 161.2 ? 
56 OE1 ? A GLU 419 ? A GLU 411 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 819 ? 1_555 80.0  ? 
57 O   ? G HOH .   ? A HOH 818 ? 1_555 CA ? B CA . ? A CA 701 ? 1_555 O   ? G HOH .   ? A HOH 819 ? 1_555 63.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-01-28 
2 'Structure model' 1 1 2015-02-11 
3 'Structure model' 1 2 2015-02-25 
4 'Structure model' 1 3 2017-11-22 
5 'Structure model' 1 4 2018-04-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Data collection'        
4 4 'Structure model' 'Derived calculations'   
5 4 'Structure model' 'Refinement description' 
6 4 'Structure model' 'Source and taxonomy'    
7 5 'Structure model' 'Data collection'        
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source         
2 4 'Structure model' entity_src_gen        
3 4 'Structure model' pdbx_struct_oper_list 
4 4 'Structure model' software              
5 5 'Structure model' diffrn_detector       
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
2 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 4 'Structure model' '_software.classification'                  
5 5 'Structure model' '_diffrn_detector.detector'                 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -9.7100 17.3624 -41.7024 1.7343 2.0214 0.8633 -0.0267 0.0316  -0.3578 3.4733 1.0469 3.6120 1.6582  
2.9450  0.8175  -0.4030 -0.1084 0.1748  1.4954  -0.2705 -0.0183 -0.5740 0.0959  -0.6898 
'X-RAY DIFFRACTION' 2 ? refined 11.2948 36.1562 -21.4602 1.1522 0.9076 0.8844 -0.1570 0.1160  0.2482  3.9161 1.2311 9.0332 -0.6774 
0.5557  0.5800  -0.0065 0.0360  -0.0230 1.1086  0.4808  -0.3001 -0.4860 -0.4427 1.3601  
'X-RAY DIFFRACTION' 3 ? refined 41.0162 39.9851 12.7575  1.2638 2.7192 1.5863 -0.2526 -0.0755 -0.0346 3.7262 5.2056 1.3807 -4.0184 
-0.5318 -0.4891 -0.3637 0.0195  0.9758  -0.8090 0.7219  -1.4082 0.7524  -0.4092 2.5963  
'X-RAY DIFFRACTION' 4 ? refined 23.5588 40.5382 -0.3030  1.3164 1.2528 1.3026 -0.3720 0.0215  -0.0456 2.6225 4.5688 7.2074 -1.0769 
-2.0463 4.7097  -0.1198 0.6997  -0.5622 0.2170  1.5522  0.1186  -0.8384 -1.7962 1.7137  
'X-RAY DIFFRACTION' 5 ? refined 14.7246 33.8048 16.2826  1.0844 0.7926 0.8621 -0.1024 0.0166  -0.0489 5.6411 1.4271 9.3159 -0.2845 
1.3237  1.1713  0.0218  0.0595  -0.0563 -0.8469 0.5118  0.0604  0.0779  -0.0696 0.9182  
'X-RAY DIFFRACTION' 6 ? refined 27.2836 33.2964 32.9717  1.1980 2.1964 1.0395 -0.0105 -0.2345 -0.2792 3.5042 2.1279 5.1902 1.6440  
2.4763  -0.1349 0.3070  -0.1237 -0.0638 -1.7489 0.1523  -0.6716 0.6978  0.6897  1.7922  
'X-RAY DIFFRACTION' 7 ? refined 29.4346 50.4133 22.9636  1.1628 2.1024 1.4340 -0.5661 -0.0927 -0.3086 0.2749 1.9862 0.0088 -0.7428 
-0.0512 0.1416  -0.6760 0.5081  -0.2509 1.4761  1.3517  0.0726  -2.9550 -0.4572 0.5027  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 3   A 112 '( CHAIN A AND RESID 3:112 )'   ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 113 A 292 '( CHAIN A AND RESID 113:292 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 308 A 336 '( CHAIN A AND RESID 308:336 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 351 A 393 '( CHAIN A AND RESID 351:393 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 A 405 A 492 '( CHAIN A AND RESID 405:492 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 A 495 A 630 '( CHAIN A AND RESID 495:630 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 7 7 A 634 A 645 '( CHAIN A AND RESID 634:645 )' ? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 
? refinement     ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? .                           2 
? refinement     ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? .                           3 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .                           4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 155 ? ? -112.69 -161.00 
2 1 ARG A 156 ? ? -153.43 77.49   
3 1 GLN A 455 ? ? 69.00   -49.92  
4 1 ARG A 484 ? ? 54.55   -123.59 
5 1 HIS A 509 ? ? -91.68  37.23   
6 1 GLN A 569 ? ? -171.33 138.29  
7 1 LEU A 592 ? ? -116.41 65.74   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 3   ? CG  ? A GLN 11  CG  
2   1 Y 1 A GLN 3   ? CD  ? A GLN 11  CD  
3   1 Y 1 A GLN 3   ? OE1 ? A GLN 11  OE1 
4   1 Y 1 A GLN 3   ? NE2 ? A GLN 11  NE2 
5   1 Y 1 A GLU 12  ? CD  ? A GLU 20  CD  
6   1 Y 1 A GLU 12  ? OE1 ? A GLU 20  OE1 
7   1 Y 1 A GLU 12  ? OE2 ? A GLU 20  OE2 
8   1 Y 1 A GLN 13  ? CG  ? A GLN 21  CG  
9   1 Y 1 A GLN 13  ? CD  ? A GLN 21  CD  
10  1 Y 1 A GLN 13  ? OE1 ? A GLN 21  OE1 
11  1 Y 1 A GLN 13  ? NE2 ? A GLN 21  NE2 
12  1 Y 1 A THR 15  ? OG1 ? A THR 23  OG1 
13  1 Y 1 A THR 15  ? CG2 ? A THR 23  CG2 
14  1 Y 1 A LEU 24  ? CG  ? A LEU 32  CG  
15  1 Y 1 A LEU 24  ? CD1 ? A LEU 32  CD1 
16  1 Y 1 A LEU 24  ? CD2 ? A LEU 32  CD2 
17  1 Y 1 A GLN 26  ? CG  ? A GLN 34  CG  
18  1 Y 1 A GLN 26  ? CD  ? A GLN 34  CD  
19  1 Y 1 A GLN 26  ? OE1 ? A GLN 34  OE1 
20  1 Y 1 A GLN 26  ? NE2 ? A GLN 34  NE2 
21  1 Y 1 A ILE 29  ? CG1 ? A ILE 37  CG1 
22  1 Y 1 A ILE 29  ? CG2 ? A ILE 37  CG2 
23  1 Y 1 A ILE 29  ? CD1 ? A ILE 37  CD1 
24  1 Y 1 A GLU 35  ? CG  ? A GLU 43  CG  
25  1 Y 1 A GLU 35  ? CD  ? A GLU 43  CD  
26  1 Y 1 A GLU 35  ? OE1 ? A GLU 43  OE1 
27  1 Y 1 A GLU 35  ? OE2 ? A GLU 43  OE2 
28  1 Y 1 A ASP 36  ? CG  ? A ASP 44  CG  
29  1 Y 1 A ASP 36  ? OD1 ? A ASP 44  OD1 
30  1 Y 1 A ASP 36  ? OD2 ? A ASP 44  OD2 
31  1 Y 1 A CYS 37  ? SG  ? A CYS 45  SG  
32  1 Y 1 A LEU 70  ? CG  ? A LEU 78  CG  
33  1 Y 1 A LEU 70  ? CD1 ? A LEU 78  CD1 
34  1 Y 1 A LEU 70  ? CD2 ? A LEU 78  CD2 
35  1 Y 1 A LYS 81  ? CG  ? A LYS 89  CG  
36  1 Y 1 A LYS 81  ? CD  ? A LYS 89  CD  
37  1 Y 1 A LYS 81  ? CE  ? A LYS 89  CE  
38  1 Y 1 A LYS 81  ? NZ  ? A LYS 89  NZ  
39  1 Y 1 A VAL 82  ? CG1 ? A VAL 90  CG1 
40  1 Y 1 A VAL 82  ? CG2 ? A VAL 90  CG2 
41  1 Y 1 A LYS 91  ? CE  ? A LYS 99  CE  
42  1 Y 1 A LYS 91  ? NZ  ? A LYS 99  NZ  
43  1 Y 1 A VAL 104 ? CG1 ? A VAL 112 CG1 
44  1 Y 1 A VAL 104 ? CG2 ? A VAL 112 CG2 
45  1 Y 1 A LYS 105 ? CG  ? A LYS 113 CG  
46  1 Y 1 A LYS 105 ? CD  ? A LYS 113 CD  
47  1 Y 1 A LYS 105 ? CE  ? A LYS 113 CE  
48  1 Y 1 A LYS 105 ? NZ  ? A LYS 113 NZ  
49  1 Y 1 A LYS 126 ? CG  ? A LYS 134 CG  
50  1 Y 1 A LYS 126 ? CD  ? A LYS 134 CD  
51  1 Y 1 A LYS 126 ? CE  ? A LYS 134 CE  
52  1 Y 1 A LYS 126 ? NZ  ? A LYS 134 NZ  
53  1 Y 1 A LYS 128 ? CG  ? A LYS 136 CG  
54  1 Y 1 A LYS 128 ? CD  ? A LYS 136 CD  
55  1 Y 1 A LYS 128 ? CE  ? A LYS 136 CE  
56  1 Y 1 A LYS 128 ? NZ  ? A LYS 136 NZ  
57  1 Y 1 A VAL 133 ? CG1 ? A VAL 141 CG1 
58  1 Y 1 A VAL 133 ? CG2 ? A VAL 141 CG2 
59  1 Y 1 A LYS 134 ? CG  ? A LYS 142 CG  
60  1 Y 1 A LYS 134 ? CD  ? A LYS 142 CD  
61  1 Y 1 A LYS 134 ? CE  ? A LYS 142 CE  
62  1 Y 1 A LYS 134 ? NZ  ? A LYS 142 NZ  
63  1 Y 1 A ASP 135 ? CG  ? A ASP 143 CG  
64  1 Y 1 A ASP 135 ? OD1 ? A ASP 143 OD1 
65  1 Y 1 A ASP 135 ? OD2 ? A ASP 143 OD2 
66  1 Y 1 A ARG 137 ? CG  ? A ARG 145 CG  
67  1 Y 1 A ARG 137 ? CD  ? A ARG 145 CD  
68  1 Y 1 A ARG 137 ? NE  ? A ARG 145 NE  
69  1 Y 1 A ARG 137 ? CZ  ? A ARG 145 CZ  
70  1 Y 1 A ARG 137 ? NH1 ? A ARG 145 NH1 
71  1 Y 1 A ARG 137 ? NH2 ? A ARG 145 NH2 
72  1 Y 1 A GLN 146 ? CG  ? A GLN 154 CG  
73  1 Y 1 A GLN 146 ? CD  ? A GLN 154 CD  
74  1 Y 1 A GLN 146 ? OE1 ? A GLN 154 OE1 
75  1 Y 1 A GLN 146 ? NE2 ? A GLN 154 NE2 
76  1 Y 1 A ASN 158 ? CG  ? A ASN 166 CG  
77  1 Y 1 A ASN 158 ? OD1 ? A ASN 166 OD1 
78  1 Y 1 A ASN 158 ? ND2 ? A ASN 166 ND2 
79  1 Y 1 A LEU 159 ? CG  ? A LEU 167 CG  
80  1 Y 1 A LEU 159 ? CD1 ? A LEU 167 CD1 
81  1 Y 1 A LEU 159 ? CD2 ? A LEU 167 CD2 
82  1 Y 1 A SER 161 ? OG  ? A SER 169 OG  
83  1 Y 1 A GLU 167 ? CG  ? A GLU 175 CG  
84  1 Y 1 A GLU 167 ? CD  ? A GLU 175 CD  
85  1 Y 1 A GLU 167 ? OE1 ? A GLU 175 OE1 
86  1 Y 1 A GLU 167 ? OE2 ? A GLU 175 OE2 
87  1 Y 1 A GLU 170 ? CG  ? A GLU 178 CG  
88  1 Y 1 A GLU 170 ? CD  ? A GLU 178 CD  
89  1 Y 1 A GLU 170 ? OE1 ? A GLU 178 OE1 
90  1 Y 1 A GLU 170 ? OE2 ? A GLU 178 OE2 
91  1 Y 1 A GLU 175 ? CG  ? A GLU 183 CG  
92  1 Y 1 A GLU 175 ? CD  ? A GLU 183 CD  
93  1 Y 1 A GLU 175 ? OE1 ? A GLU 183 OE1 
94  1 Y 1 A GLU 175 ? OE2 ? A GLU 183 OE2 
95  1 Y 1 A SER 181 ? OG  ? A SER 189 OG  
96  1 Y 1 A SER 186 ? OG  ? A SER 194 OG  
97  1 Y 1 A LYS 188 ? CG  ? A LYS 196 CG  
98  1 Y 1 A LYS 188 ? CD  ? A LYS 196 CD  
99  1 Y 1 A LYS 188 ? CE  ? A LYS 196 CE  
100 1 Y 1 A LYS 188 ? NZ  ? A LYS 196 NZ  
101 1 Y 1 A LYS 191 ? CG  ? A LYS 199 CG  
102 1 Y 1 A LYS 191 ? CD  ? A LYS 199 CD  
103 1 Y 1 A LYS 191 ? CE  ? A LYS 199 CE  
104 1 Y 1 A LYS 191 ? NZ  ? A LYS 199 NZ  
105 1 Y 1 A LYS 224 ? CG  ? A LYS 232 CG  
106 1 Y 1 A LYS 224 ? CD  ? A LYS 232 CD  
107 1 Y 1 A LYS 224 ? CE  ? A LYS 232 CE  
108 1 Y 1 A LYS 224 ? NZ  ? A LYS 232 NZ  
109 1 Y 1 A LYS 232 ? CG  ? A LYS 240 CG  
110 1 Y 1 A LYS 232 ? CD  ? A LYS 240 CD  
111 1 Y 1 A LYS 232 ? CE  ? A LYS 240 CE  
112 1 Y 1 A LYS 232 ? NZ  ? A LYS 240 NZ  
113 1 Y 1 A LYS 244 ? CG  ? A LYS 252 CG  
114 1 Y 1 A LYS 244 ? CD  ? A LYS 252 CD  
115 1 Y 1 A LYS 244 ? CE  ? A LYS 252 CE  
116 1 Y 1 A LYS 244 ? NZ  ? A LYS 252 NZ  
117 1 Y 1 A ASN 276 ? CG  ? A ASN 284 CG  
118 1 Y 1 A ASN 276 ? OD1 ? A ASN 284 OD1 
119 1 Y 1 A ASN 276 ? ND2 ? A ASN 284 ND2 
120 1 Y 1 A GLU 281 ? CG  ? A GLU 289 CG  
121 1 Y 1 A GLU 281 ? CD  ? A GLU 289 CD  
122 1 Y 1 A GLU 281 ? OE1 ? A GLU 289 OE1 
123 1 Y 1 A GLU 281 ? OE2 ? A GLU 289 OE2 
124 1 Y 1 A PHE 314 ? CG  ? A PHE 322 CG  
125 1 Y 1 A PHE 314 ? CD1 ? A PHE 322 CD1 
126 1 Y 1 A PHE 314 ? CD2 ? A PHE 322 CD2 
127 1 Y 1 A PHE 314 ? CE1 ? A PHE 322 CE1 
128 1 Y 1 A PHE 314 ? CE2 ? A PHE 322 CE2 
129 1 Y 1 A PHE 314 ? CZ  ? A PHE 322 CZ  
130 1 Y 1 A GLU 315 ? CG  ? A GLU 323 CG  
131 1 Y 1 A GLU 315 ? CD  ? A GLU 323 CD  
132 1 Y 1 A GLU 315 ? OE1 ? A GLU 323 OE1 
133 1 Y 1 A GLU 315 ? OE2 ? A GLU 323 OE2 
134 1 Y 1 A PHE 319 ? CG  ? A PHE 327 CG  
135 1 Y 1 A PHE 319 ? CD1 ? A PHE 327 CD1 
136 1 Y 1 A PHE 319 ? CD2 ? A PHE 327 CD2 
137 1 Y 1 A PHE 319 ? CE1 ? A PHE 327 CE1 
138 1 Y 1 A PHE 319 ? CE2 ? A PHE 327 CE2 
139 1 Y 1 A PHE 319 ? CZ  ? A PHE 327 CZ  
140 1 Y 1 A LYS 321 ? CG  ? A LYS 329 CG  
141 1 Y 1 A LYS 321 ? CD  ? A LYS 329 CD  
142 1 Y 1 A LYS 321 ? CE  ? A LYS 329 CE  
143 1 Y 1 A LYS 321 ? NZ  ? A LYS 329 NZ  
144 1 Y 1 A MET 328 ? CG  ? A MET 336 CG  
145 1 Y 1 A MET 328 ? SD  ? A MET 336 SD  
146 1 Y 1 A MET 328 ? CE  ? A MET 336 CE  
147 1 Y 1 A LYS 329 ? CG  ? A LYS 337 CG  
148 1 Y 1 A LYS 329 ? CD  ? A LYS 337 CD  
149 1 Y 1 A LYS 329 ? CE  ? A LYS 337 CE  
150 1 Y 1 A LYS 329 ? NZ  ? A LYS 337 NZ  
151 1 Y 1 A LYS 331 ? CG  ? A LYS 339 CG  
152 1 Y 1 A LYS 331 ? CD  ? A LYS 339 CD  
153 1 Y 1 A LYS 331 ? CE  ? A LYS 339 CE  
154 1 Y 1 A LYS 331 ? NZ  ? A LYS 339 NZ  
155 1 Y 1 A GLN 349 ? CG  ? A GLN 357 CG  
156 1 Y 1 A GLN 349 ? CD  ? A GLN 357 CD  
157 1 Y 1 A GLN 349 ? OE1 ? A GLN 357 OE1 
158 1 Y 1 A GLN 349 ? NE2 ? A GLN 357 NE2 
159 1 Y 1 A ASP 350 ? CG  ? A ASP 358 CG  
160 1 Y 1 A ASP 350 ? OD1 ? A ASP 358 OD1 
161 1 Y 1 A ASP 350 ? OD2 ? A ASP 358 OD2 
162 1 Y 1 A ARG 372 ? CG  ? A ARG 380 CG  
163 1 Y 1 A ARG 372 ? CD  ? A ARG 380 CD  
164 1 Y 1 A ARG 372 ? NE  ? A ARG 380 NE  
165 1 Y 1 A ARG 372 ? CZ  ? A ARG 380 CZ  
166 1 Y 1 A ARG 372 ? NH1 ? A ARG 380 NH1 
167 1 Y 1 A ARG 372 ? NH2 ? A ARG 380 NH2 
168 1 Y 1 A LYS 382 ? CG  ? A LYS 390 CG  
169 1 Y 1 A LYS 382 ? CD  ? A LYS 390 CD  
170 1 Y 1 A LYS 382 ? CE  ? A LYS 390 CE  
171 1 Y 1 A LYS 382 ? NZ  ? A LYS 390 NZ  
172 1 Y 1 A ARG 383 ? CG  ? A ARG 391 CG  
173 1 Y 1 A ARG 383 ? CD  ? A ARG 391 CD  
174 1 Y 1 A ARG 383 ? NE  ? A ARG 391 NE  
175 1 Y 1 A ARG 383 ? CZ  ? A ARG 391 CZ  
176 1 Y 1 A ARG 383 ? NH1 ? A ARG 391 NH1 
177 1 Y 1 A ARG 383 ? NH2 ? A ARG 391 NH2 
178 1 Y 1 A ARG 394 ? CG  ? A ARG 402 CG  
179 1 Y 1 A ARG 394 ? CD  ? A ARG 402 CD  
180 1 Y 1 A ARG 394 ? NE  ? A ARG 402 NE  
181 1 Y 1 A ARG 394 ? CZ  ? A ARG 402 CZ  
182 1 Y 1 A ARG 394 ? NH1 ? A ARG 402 NH1 
183 1 Y 1 A ARG 394 ? NH2 ? A ARG 402 NH2 
184 1 Y 1 A ARG 419 ? CG  ? A ARG 427 CG  
185 1 Y 1 A ARG 419 ? CD  ? A ARG 427 CD  
186 1 Y 1 A ARG 419 ? NE  ? A ARG 427 NE  
187 1 Y 1 A ARG 419 ? CZ  ? A ARG 427 CZ  
188 1 Y 1 A ARG 419 ? NH1 ? A ARG 427 NH1 
189 1 Y 1 A ARG 419 ? NH2 ? A ARG 427 NH2 
190 1 Y 1 A GLU 503 ? CG  ? A GLU 511 CG  
191 1 Y 1 A GLU 503 ? CD  ? A GLU 511 CD  
192 1 Y 1 A GLU 503 ? OE1 ? A GLU 511 OE1 
193 1 Y 1 A GLU 503 ? OE2 ? A GLU 511 OE2 
194 1 Y 1 A GLU 507 ? CG  ? A GLU 515 CG  
195 1 Y 1 A GLU 507 ? CD  ? A GLU 515 CD  
196 1 Y 1 A GLU 507 ? OE1 ? A GLU 515 OE1 
197 1 Y 1 A GLU 507 ? OE2 ? A GLU 515 OE2 
198 1 Y 1 A HIS 509 ? CG  ? A HIS 517 CG  
199 1 Y 1 A HIS 509 ? ND1 ? A HIS 517 ND1 
200 1 Y 1 A HIS 509 ? CD2 ? A HIS 517 CD2 
201 1 Y 1 A HIS 509 ? CE1 ? A HIS 517 CE1 
202 1 Y 1 A HIS 509 ? NE2 ? A HIS 517 NE2 
203 1 Y 1 A LEU 513 ? CG  ? A LEU 521 CG  
204 1 Y 1 A LEU 513 ? CD1 ? A LEU 521 CD1 
205 1 Y 1 A LEU 513 ? CD2 ? A LEU 521 CD2 
206 1 Y 1 A LEU 514 ? CG  ? A LEU 522 CG  
207 1 Y 1 A LEU 514 ? CD1 ? A LEU 522 CD1 
208 1 Y 1 A LEU 514 ? CD2 ? A LEU 522 CD2 
209 1 Y 1 A GLU 516 ? CG  ? A GLU 524 CG  
210 1 Y 1 A GLU 516 ? CD  ? A GLU 524 CD  
211 1 Y 1 A GLU 516 ? OE1 ? A GLU 524 OE1 
212 1 Y 1 A GLU 516 ? OE2 ? A GLU 524 OE2 
213 1 Y 1 A LYS 519 ? CG  ? A LYS 527 CG  
214 1 Y 1 A LYS 519 ? CD  ? A LYS 527 CD  
215 1 Y 1 A LYS 519 ? CE  ? A LYS 527 CE  
216 1 Y 1 A LYS 519 ? NZ  ? A LYS 527 NZ  
217 1 Y 1 A LYS 520 ? CG  ? A LYS 528 CG  
218 1 Y 1 A LYS 520 ? CD  ? A LYS 528 CD  
219 1 Y 1 A LYS 520 ? CE  ? A LYS 528 CE  
220 1 Y 1 A LYS 520 ? NZ  ? A LYS 528 NZ  
221 1 Y 1 A LYS 521 ? CG  ? A LYS 529 CG  
222 1 Y 1 A LYS 521 ? CD  ? A LYS 529 CD  
223 1 Y 1 A LYS 521 ? CE  ? A LYS 529 CE  
224 1 Y 1 A LYS 521 ? NZ  ? A LYS 529 NZ  
225 1 Y 1 A LYS 522 ? CG  ? A LYS 530 CG  
226 1 Y 1 A LYS 522 ? CD  ? A LYS 530 CD  
227 1 Y 1 A LYS 522 ? CE  ? A LYS 530 CE  
228 1 Y 1 A LYS 522 ? NZ  ? A LYS 530 NZ  
229 1 Y 1 A GLN 523 ? CG  ? A GLN 531 CG  
230 1 Y 1 A GLN 523 ? CD  ? A GLN 531 CD  
231 1 Y 1 A GLN 523 ? OE1 ? A GLN 531 OE1 
232 1 Y 1 A GLN 523 ? NE2 ? A GLN 531 NE2 
233 1 Y 1 A LYS 527 ? CG  ? A LYS 535 CG  
234 1 Y 1 A LYS 527 ? CD  ? A LYS 535 CD  
235 1 Y 1 A LYS 527 ? CE  ? A LYS 535 CE  
236 1 Y 1 A LYS 527 ? NZ  ? A LYS 535 NZ  
237 1 Y 1 A ILE 529 ? CG1 ? A ILE 537 CG1 
238 1 Y 1 A ILE 529 ? CG2 ? A ILE 537 CG2 
239 1 Y 1 A ILE 529 ? CD1 ? A ILE 537 CD1 
240 1 Y 1 A LYS 533 ? CG  ? A LYS 541 CG  
241 1 Y 1 A LYS 533 ? CD  ? A LYS 541 CD  
242 1 Y 1 A LYS 533 ? CE  ? A LYS 541 CE  
243 1 Y 1 A LYS 533 ? NZ  ? A LYS 541 NZ  
244 1 Y 1 A LYS 572 ? CG  ? A LYS 580 CG  
245 1 Y 1 A LYS 572 ? CD  ? A LYS 580 CD  
246 1 Y 1 A LYS 572 ? CE  ? A LYS 580 CE  
247 1 Y 1 A LYS 572 ? NZ  ? A LYS 580 NZ  
248 1 Y 1 A LYS 574 ? CG  ? A LYS 582 CG  
249 1 Y 1 A LYS 574 ? CD  ? A LYS 582 CD  
250 1 Y 1 A LYS 574 ? CE  ? A LYS 582 CE  
251 1 Y 1 A LYS 574 ? NZ  ? A LYS 582 NZ  
252 1 Y 1 A ARG 609 ? CG  ? A ARG 617 CG  
253 1 Y 1 A ARG 609 ? CD  ? A ARG 617 CD  
254 1 Y 1 A ARG 609 ? NE  ? A ARG 617 NE  
255 1 Y 1 A ARG 609 ? CZ  ? A ARG 617 CZ  
256 1 Y 1 A ARG 609 ? NH1 ? A ARG 617 NH1 
257 1 Y 1 A ARG 609 ? NH2 ? A ARG 617 NH2 
258 1 Y 1 A GLN 626 ? CG  ? A GLN 634 CG  
259 1 Y 1 A GLN 626 ? CD  ? A GLN 634 CD  
260 1 Y 1 A GLN 626 ? OE1 ? A GLN 634 OE1 
261 1 Y 1 A GLN 626 ? NE2 ? A GLN 634 NE2 
262 1 Y 1 A GLU 642 ? CG  ? A GLU 650 CG  
263 1 Y 1 A GLU 642 ? CD  ? A GLU 650 CD  
264 1 Y 1 A GLU 642 ? OE1 ? A GLU 650 OE1 
265 1 Y 1 A GLU 642 ? OE2 ? A GLU 650 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -7  ? A GLY 1   
2  1 Y 1 A PRO -6  ? A PRO 2   
3  1 Y 1 A LEU -5  ? A LEU 3   
4  1 Y 1 A GLY -4  ? A GLY 4   
5  1 Y 1 A SER -3  ? A SER 5   
6  1 Y 1 A PRO -2  ? A PRO 6   
7  1 Y 1 A GLU -1  ? A GLU 7   
8  1 Y 1 A PHE 0   ? A PHE 8   
9  1 Y 1 A MET 1   ? A MET 9   
10 1 Y 1 A ALA 2   ? A ALA 10  
11 1 Y 1 A HIS 54  ? A HIS 62  
12 1 Y 1 A GLY 55  ? A GLY 63  
13 1 Y 1 A PRO 56  ? A PRO 64  
14 1 Y 1 A PRO 57  ? A PRO 65  
15 1 Y 1 A ALA 58  ? A ALA 66  
16 1 Y 1 A LYS 59  ? A LYS 67  
17 1 Y 1 A LYS 60  ? A LYS 68  
18 1 Y 1 A LYS 61  ? A LYS 69  
19 1 Y 1 A SER 62  ? A SER 70  
20 1 Y 1 A THR 63  ? A THR 71  
21 1 Y 1 A GLY 64  ? A GLY 72  
22 1 Y 1 A SER 65  ? A SER 73  
23 1 Y 1 A GLY 98  ? A GLY 106 
24 1 Y 1 A PRO 99  ? A PRO 107 
25 1 Y 1 A LYS 100 ? A LYS 108 
26 1 Y 1 A THR 101 ? A THR 109 
27 1 Y 1 A PRO 102 ? A PRO 110 
28 1 Y 1 A ARG 131 ? A ARG 139 
29 1 Y 1 A ARG 218 ? A ARG 226 
30 1 Y 1 A GLY 219 ? A GLY 227 
31 1 Y 1 A LYS 220 ? A LYS 228 
32 1 Y 1 A LEU 221 ? A LEU 229 
33 1 Y 1 A SER 222 ? A SER 230 
34 1 Y 1 A SER 223 ? A SER 231 
35 1 Y 1 A SER 312 ? A SER 320 
36 1 Y 1 A ILE 313 ? A ILE 321 
37 1 Y 1 A CYS 337 ? A CYS 345 
38 1 Y 1 A PRO 338 ? A PRO 346 
39 1 Y 1 A GLU 339 ? A GLU 347 
40 1 Y 1 A GLU 340 ? A GLU 348 
41 1 Y 1 A GLU 341 ? A GLU 349 
42 1 Y 1 A ASN 342 ? A ASN 350 
43 1 Y 1 A MET 343 ? A MET 351 
44 1 Y 1 A ASP 344 ? A ASP 352 
45 1 Y 1 A ASP 345 ? A ASP 353 
46 1 Y 1 A GLN 346 ? A GLN 354 
47 1 Y 1 A TRP 347 ? A TRP 355 
48 1 Y 1 A MET 348 ? A MET 356 
49 1 Y 1 A ASN 373 ? A ASN 381 
50 1 Y 1 A ARG 374 ? A ARG 382 
51 1 Y 1 A GLY 375 ? A GLY 383 
52 1 Y 1 A LEU 376 ? A LEU 384 
53 1 Y 1 A LYS 377 ? A LYS 385 
54 1 Y 1 A GLU 378 ? A GLU 386 
55 1 Y 1 A PHE 379 ? A PHE 387 
56 1 Y 1 A PRO 380 ? A PRO 388 
57 1 Y 1 A ILE 381 ? A ILE 389 
58 1 Y 1 A GLY 395 ? A GLY 403 
59 1 Y 1 A PRO 396 ? A PRO 404 
60 1 Y 1 A GLN 397 ? A GLN 405 
61 1 Y 1 A THR 398 ? A THR 406 
62 1 Y 1 A GLY 399 ? A GLY 407 
63 1 Y 1 A GLY 400 ? A GLY 408 
64 1 Y 1 A ARG 639 ? A ARG 647 
65 1 Y 1 A HIS 640 ? A HIS 648 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'                                                                                                              CA  
3 '[(3R)-3-aminopiperidin-1-yl][2-(1-ethyl-1H-pyrrolo[2,3-b]pyridin-2-yl)-7-methoxy-1-methyl-1H-benzimidazol-5-yl]methanone' 3Z0 
4 water                                                                                                                      HOH 
#