data_4XIH
# 
_entry.id   4XIH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4XIH         
WWPDB D_1000205681 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin'              1XXU unspecified 
PDB 'Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin - re-refined' 4X0X unspecified 
PDB 'Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys peroxiredoxin'               1XVW unspecified 
PDB 'Crystal Structure of AhpE from Mycrobacterium tuberculosis, a 1-Cys peroxiredoxin - re-refined' 4X1U unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4XIH 
_pdbx_database_status.recvd_initial_deposition_date   2015-01-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tamu Dufe, V.' 1 
'van Molle, I.' 2 
'Pallo, A.'     3 
'Messens, J.'   4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Chem.Commun.(Camb.)' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1364-548X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            52 
_citation.language                  ? 
_citation.page_first                10293 
_citation.page_last                 10296 
_citation.title                     
'The active site architecture in peroxiredoxins: a case study on Mycobacterium tuberculosis AhpE.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1039/c6cc02645a 
_citation.pdbx_database_id_PubMed   27471753 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pedre, B.'        1  ? 
primary 'van Bergen, L.A.' 2  ? 
primary 'Pallo, A.'        3  ? 
primary 'Rosado, L.A.'     4  ? 
primary 'Dufe, V.T.'       5  ? 
primary 'Molle, I.V.'      6  ? 
primary 'Wahni, K.'        7  ? 
primary 'Erdogan, H.'      8  ? 
primary 'Alonso, M.'       9  ? 
primary 'Proft, F.D.'      10 ? 
primary 'Messens, J.'      11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4XIH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     147.260 
_cell.length_a_esd                 ? 
_cell.length_b                     147.260 
_cell.length_b_esd                 ? 
_cell.length_c                     33.303 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4XIH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                79 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'AhpC/TSA family protein' 16814.902 2  ? R116A ? ? 
2 water   nat water                     18.015    60 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Peroxiredoxin AhpE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKI
WATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANAGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKI
WATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANAGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   MET n 
1 3   LEU n 
1 4   ASN n 
1 5   VAL n 
1 6   GLY n 
1 7   ALA n 
1 8   THR n 
1 9   ALA n 
1 10  PRO n 
1 11  ASP n 
1 12  PHE n 
1 13  THR n 
1 14  LEU n 
1 15  ARG n 
1 16  ASP n 
1 17  GLN n 
1 18  ASN n 
1 19  GLN n 
1 20  GLN n 
1 21  LEU n 
1 22  VAL n 
1 23  THR n 
1 24  LEU n 
1 25  ARG n 
1 26  GLY n 
1 27  TYR n 
1 28  ARG n 
1 29  GLY n 
1 30  ALA n 
1 31  LYS n 
1 32  ASN n 
1 33  VAL n 
1 34  LEU n 
1 35  LEU n 
1 36  VAL n 
1 37  PHE n 
1 38  PHE n 
1 39  PRO n 
1 40  LEU n 
1 41  ALA n 
1 42  PHE n 
1 43  THR n 
1 44  GLY n 
1 45  ILE n 
1 46  CYS n 
1 47  GLN n 
1 48  GLY n 
1 49  GLU n 
1 50  LEU n 
1 51  ASP n 
1 52  GLN n 
1 53  LEU n 
1 54  ARG n 
1 55  ASP n 
1 56  HIS n 
1 57  LEU n 
1 58  PRO n 
1 59  GLU n 
1 60  PHE n 
1 61  GLU n 
1 62  ASN n 
1 63  ASP n 
1 64  ASP n 
1 65  SER n 
1 66  ALA n 
1 67  ALA n 
1 68  LEU n 
1 69  ALA n 
1 70  ILE n 
1 71  SER n 
1 72  VAL n 
1 73  GLY n 
1 74  PRO n 
1 75  PRO n 
1 76  PRO n 
1 77  THR n 
1 78  HIS n 
1 79  LYS n 
1 80  ILE n 
1 81  TRP n 
1 82  ALA n 
1 83  THR n 
1 84  GLN n 
1 85  SER n 
1 86  GLY n 
1 87  PHE n 
1 88  THR n 
1 89  PHE n 
1 90  PRO n 
1 91  LEU n 
1 92  LEU n 
1 93  SER n 
1 94  ASP n 
1 95  PHE n 
1 96  TRP n 
1 97  PRO n 
1 98  HIS n 
1 99  GLY n 
1 100 ALA n 
1 101 VAL n 
1 102 SER n 
1 103 GLN n 
1 104 ALA n 
1 105 TYR n 
1 106 GLY n 
1 107 VAL n 
1 108 PHE n 
1 109 ASN n 
1 110 GLU n 
1 111 GLN n 
1 112 ALA n 
1 113 GLY n 
1 114 ILE n 
1 115 ALA n 
1 116 ASN n 
1 117 ALA n 
1 118 GLY n 
1 119 THR n 
1 120 PHE n 
1 121 VAL n 
1 122 VAL n 
1 123 ASP n 
1 124 ARG n 
1 125 SER n 
1 126 GLY n 
1 127 ILE n 
1 128 ILE n 
1 129 ARG n 
1 130 PHE n 
1 131 ALA n 
1 132 GLU n 
1 133 MET n 
1 134 LYS n 
1 135 GLN n 
1 136 PRO n 
1 137 GLY n 
1 138 GLU n 
1 139 VAL n 
1 140 ARG n 
1 141 ASP n 
1 142 GLN n 
1 143 ARG n 
1 144 LEU n 
1 145 TRP n 
1 146 THR n 
1 147 ASP n 
1 148 ALA n 
1 149 LEU n 
1 150 ALA n 
1 151 ALA n 
1 152 LEU n 
1 153 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   153 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ahpE, CCDC5079_2075, CFBS_2371' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycobacterium tuberculosis (strain CCDC5079)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     443149 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    F7WEJ6_MYCTC 
_struct_ref.pdbx_db_accession          F7WEJ6 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIW
ATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4XIH A 2 ? 153 ? F7WEJ6 1 ? 152 ? 1 152 
2 1 4XIH B 2 ? 153 ? F7WEJ6 1 ? 152 ? 1 152 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4XIH HIS A 1   ? UNP F7WEJ6 ?   ?   'expression tag'      0   1 
1 4XIH ALA A 117 ? UNP F7WEJ6 ARG 116 'engineered mutation' 116 2 
2 4XIH HIS B 1   ? UNP F7WEJ6 ?   ?   'expression tag'      0   3 
2 4XIH ALA B 117 ? UNP F7WEJ6 ARG 116 'engineered mutation' 116 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4XIH 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.68 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.18 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.5 M Na-malonate, 0.1 M Na-acetate, pH 4.5' 
_exptl_crystal_grow.pdbx_pH_range   4.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-02-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            45.050 
_reflns.entry_id                         4XIH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.250 
_reflns.d_resolution_low                 104 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17069 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             97.500 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     0.996 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.73 
_reflns.pdbx_Rmerge_I_obs                0.098 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.930 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.009 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.111 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         74903 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.250  2.310  ? 1.830  ? 4291 1270 ? 1105 87.000 ? ? 0.700 ? 0.816 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.932 ? 0 1  1 ? ? 
2.310  2.370  ? 2.390  ? 5328 1259 ? 1219 96.800 ? ? 0.719 ? 0.707 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.802 ? 0 2  1 ? ? 
2.370  2.440  ? 2.780  ? 5141 1193 ? 1176 98.600 ? ? 0.801 ? 0.602 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.684 ? 0 3  1 ? ? 
2.440  2.510  ? 3.040  ? 5439 1195 ? 1182 98.900 ? ? 0.824 ? 0.574 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.648 ? 0 4  1 ? ? 
2.510  2.590  ? 3.840  ? 4932 1112 ? 1103 99.200 ? ? 0.871 ? 0.461 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.522 ? 0 5  1 ? ? 
2.590  2.690  ? 4.770  ? 4923 1122 ? 1112 99.100 ? ? 0.915 ? 0.356 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.404 ? 0 6  1 ? ? 
2.690  2.790  ? 5.910  ? 4888 1082 ? 1065 98.400 ? ? 0.939 ? 0.285 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.321 ? 0 7  1 ? ? 
2.790  2.900  ? 7.640  ? 4420 1015 ? 1000 98.500 ? ? 0.964 ? 0.206 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.234 ? 0 8  1 ? ? 
2.900  3.030  ? 8.810  ? 4366 1016 ? 996  98.000 ? ? 0.969 ? 0.175 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.200 ? 0 9  1 ? ? 
3.030  3.180  ? 11.910 ? 4218 923  ? 916  99.200 ? ? 0.974 ? 0.138 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.158 ? 0 10 1 ? ? 
3.180  3.350  ? 14.450 ? 4168 909  ? 908  99.900 ? ? 0.985 ? 0.106 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.120 ? 0 11 1 ? ? 
3.350  3.550  ? 17.460 ? 3654 840  ? 834  99.300 ? ? 0.990 ? 0.081 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.092 ? 0 12 1 ? ? 
3.550  3.800  ? 20.230 ? 3636 815  ? 801  98.300 ? ? 0.994 ? 0.066 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.076 ? 0 13 1 ? ? 
3.800  4.100  ? 21.780 ? 3230 755  ? 743  98.400 ? ? 0.995 ? 0.058 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.066 ? 0 14 1 ? ? 
4.100  4.490  ? 24.280 ? 2827 699  ? 683  97.700 ? ? 0.996 ? 0.048 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.055 ? 0 15 1 ? ? 
4.490  5.030  ? 24.810 ? 2693 638  ? 633  99.200 ? ? 0.996 ? 0.049 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.056 ? 0 16 1 ? ? 
5.030  5.800  ? 22.480 ? 2356 569  ? 560  98.400 ? ? 0.997 ? 0.050 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.057 ? 0 17 1 ? ? 
5.800  7.110  ? 23.480 ? 2024 476  ? 468  98.300 ? ? 0.996 ? 0.051 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.057 ? 0 18 1 ? ? 
7.110  10.050 ? 27.470 ? 1529 381  ? 364  95.500 ? ? 0.998 ? 0.039 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.044 ? 0 19 1 ? ? 
10.050 ?      ? 28.240 ? 840  233  ? 201  86.300 ? ? 0.998 ? 0.035 ? ? ? ? ? ? ? ? ? ? ? ? ? 0.039 ? 0 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            -0.4300 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -0.4300 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.8500 
_refine.B_iso_max                                91.870 
_refine.B_iso_mean                               40.7990 
_refine.B_iso_min                                17.820 
_refine.correlation_coeff_Fo_to_Fc               0.9450 
_refine.correlation_coeff_Fo_to_Fc_free          0.9360 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4XIH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.25 
_refine.ls_d_res_low                             104 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     16096 
_refine.ls_number_reflns_R_free                  962 
_refine.ls_number_reflns_R_work                  16096 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.8400 
_refine.ls_percent_reflns_R_free                 5.6000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2104 
_refine.ls_R_factor_R_free                       0.2242 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2095 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      0.2122 
_refine.ls_wR_factor_R_work                      0.1927 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4X0X 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.3030 
_refine.pdbx_overall_ESU_R_Free                  0.2020 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             14.9340 
_refine.overall_SU_ML                            0.1750 
_refine.overall_SU_R_Cruickshank_DPI             0.3025 
_refine.overall_SU_R_free                        0.2022 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8058 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.25 
_refine_hist.d_res_low                        104 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             60 
_refine_hist.number_atoms_total               2436 
_refine_hist.pdbx_number_residues_total       306 
_refine_hist.pdbx_B_iso_mean_solvent          38.13 
_refine_hist.pdbx_number_atoms_protein        2376 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  0.019  2458 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  2297 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.229  1.933  3351 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.720  3.000  5257 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 2.674  5.000  310  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 29.296 23.884 121  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 10.058 15.000 367  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 9.550  15.000 17   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.074  0.200  367  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  2865 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  616  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 0.927  3.245  1231 ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 0.927  3.244  1230 ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 1.704  4.865  1538 ? r_mcangle_it           ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.2500 
_refine_ls_shell.d_res_low                        2.3090 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             54 
_refine_ls_shell.number_reflns_R_work             1100 
_refine_ls_shell.percent_reflns_obs               91.0800 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3030 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2560 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4XIH 
_struct.title                        'Crystal structure of the R116A mutant AhpE from Mycobacterium tuberculosis' 
_struct.pdbx_descriptor              'Alkyl hydroperoxid reductase E' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4XIH 
_struct_keywords.text            'Peroxiredoxins, oxidoreductase' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 25  ? ARG A 28  ? ARG A 24  ARG A 27  5 ? 4  
HELX_P HELX_P2  AA2 THR A 43  ? HIS A 56  ? THR A 42  HIS A 55  1 ? 14 
HELX_P HELX_P3  AA3 HIS A 56  ? GLU A 61  ? HIS A 55  GLU A 60  1 ? 6  
HELX_P HELX_P4  AA4 PRO A 74  ? GLY A 86  ? PRO A 73  GLY A 85  1 ? 13 
HELX_P HELX_P5  AA5 GLY A 99  ? TYR A 105 ? GLY A 98  TYR A 104 1 ? 7  
HELX_P HELX_P6  AA6 GLN A 142 ? ALA A 151 ? GLN A 141 ALA A 150 1 ? 10 
HELX_P HELX_P7  AA7 ARG B 25  ? ARG B 28  ? ARG B 24  ARG B 27  5 ? 4  
HELX_P HELX_P8  AA8 THR B 43  ? HIS B 56  ? THR B 42  HIS B 55  1 ? 14 
HELX_P HELX_P9  AA9 LEU B 57  ? PHE B 60  ? LEU B 56  PHE B 59  5 ? 4  
HELX_P HELX_P10 AB1 PRO B 74  ? GLY B 86  ? PRO B 73  GLY B 85  1 ? 13 
HELX_P HELX_P11 AB2 GLY B 99  ? TYR B 105 ? GLY B 98  TYR B 104 1 ? 7  
HELX_P HELX_P12 AB3 GLN B 142 ? LEU B 152 ? GLN B 141 LEU B 151 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 96 A . ? TRP 95 A PRO 97 A ? PRO 96 A 1 0.34 
2 TRP 96 B . ? TRP 95 B PRO 97 B ? PRO 96 B 1 0.91 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 5 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 13  ? ARG A 15  ? THR A 12  ARG A 14  
AA1 2 LEU A 21  ? THR A 23  ? LEU A 20  THR A 22  
AA2 1 LEU A 91  ? SER A 93  ? LEU A 90  SER A 92  
AA2 2 SER A 65  ? SER A 71  ? SER A 64  SER A 70  
AA2 3 ASN A 32  ? PHE A 37  ? ASN A 31  PHE A 36  
AA2 4 GLY A 118 ? VAL A 122 ? GLY A 117 VAL A 121 
AA2 5 ILE A 128 ? MET A 133 ? ILE A 127 MET A 132 
AA3 1 PHE A 108 ? ASN A 109 ? PHE A 107 ASN A 108 
AA3 2 ILE A 114 ? ALA A 115 ? ILE A 113 ALA A 114 
AA4 1 THR B 13  ? ARG B 15  ? THR B 12  ARG B 14  
AA4 2 LEU B 21  ? THR B 23  ? LEU B 20  THR B 22  
AA5 1 LEU B 91  ? SER B 93  ? LEU B 90  SER B 92  
AA5 2 SER B 65  ? SER B 71  ? SER B 64  SER B 70  
AA5 3 ASN B 32  ? PHE B 37  ? ASN B 31  PHE B 36  
AA5 4 GLY B 118 ? VAL B 122 ? GLY B 117 VAL B 121 
AA5 5 ILE B 128 ? MET B 133 ? ILE B 127 MET B 132 
AA6 1 PHE B 108 ? ASN B 109 ? PHE B 107 ASN B 108 
AA6 2 ILE B 114 ? ALA B 115 ? ILE B 113 ALA B 114 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 14  ? N LEU A 13  O VAL A 22  ? O VAL A 21  
AA2 1 2 O LEU A 92  ? O LEU A 91  N ALA A 69  ? N ALA A 68  
AA2 2 3 O LEU A 68  ? O LEU A 67  N LEU A 34  ? N LEU A 33  
AA2 3 4 N VAL A 33  ? N VAL A 32  O VAL A 122 ? O VAL A 121 
AA2 4 5 N VAL A 121 ? N VAL A 120 O ARG A 129 ? O ARG A 128 
AA3 1 2 N ASN A 109 ? N ASN A 108 O ILE A 114 ? O ILE A 113 
AA4 1 2 N LEU B 14  ? N LEU B 13  O VAL B 22  ? O VAL B 21  
AA5 1 2 O LEU B 92  ? O LEU B 91  N ALA B 69  ? N ALA B 68  
AA5 2 3 O LEU B 68  ? O LEU B 67  N LEU B 34  ? N LEU B 33  
AA5 3 4 N VAL B 33  ? N VAL B 32  O VAL B 122 ? O VAL B 121 
AA5 4 5 N VAL B 121 ? N VAL B 120 O ARG B 129 ? O ARG B 128 
AA6 1 2 N ASN B 109 ? N ASN B 108 O ILE B 114 ? O ILE B 113 
# 
_atom_sites.entry_id                    4XIH 
_atom_sites.fract_transf_matrix[1][1]   0.006791 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006791 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.030027 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . HIS A 1 1   ? 41.184 138.919 -27.253 1.00 52.37 ? 0   HIS A N   1 
ATOM   2    C CA  . HIS A 1 1   ? 39.701 138.757 -27.153 1.00 52.03 ? 0   HIS A CA  1 
ATOM   3    C C   . HIS A 1 1   ? 39.063 138.942 -28.527 1.00 46.91 ? 0   HIS A C   1 
ATOM   4    O O   . HIS A 1 1   ? 39.629 139.590 -29.407 1.00 45.58 ? 0   HIS A O   1 
ATOM   5    C CB  . HIS A 1 1   ? 39.114 139.767 -26.148 1.00 55.78 ? 0   HIS A CB  1 
ATOM   6    C CG  . HIS A 1 1   ? 37.665 139.541 -25.820 1.00 60.33 ? 0   HIS A CG  1 
ATOM   7    N ND1 . HIS A 1 1   ? 36.636 140.092 -26.556 1.00 62.14 ? 0   HIS A ND1 1 
ATOM   8    C CD2 . HIS A 1 1   ? 37.076 138.834 -24.825 1.00 62.75 ? 0   HIS A CD2 1 
ATOM   9    C CE1 . HIS A 1 1   ? 35.477 139.726 -26.036 1.00 62.50 ? 0   HIS A CE1 1 
ATOM   10   N NE2 . HIS A 1 1   ? 35.716 138.964 -24.983 1.00 63.79 ? 0   HIS A NE2 1 
ATOM   11   N N   . MET A 1 2   ? 37.887 138.353 -28.699 1.00 51.52 ? 1   MET A N   1 
ATOM   12   C CA  . MET A 1 2   ? 37.119 138.457 -29.930 1.00 48.31 ? 1   MET A CA  1 
ATOM   13   C C   . MET A 1 2   ? 36.693 139.900 -30.179 1.00 46.31 ? 1   MET A C   1 
ATOM   14   O O   . MET A 1 2   ? 36.335 140.609 -29.239 1.00 45.81 ? 1   MET A O   1 
ATOM   15   C CB  . MET A 1 2   ? 35.857 137.613 -29.783 1.00 48.38 ? 1   MET A CB  1 
ATOM   16   C CG  . MET A 1 2   ? 35.019 137.469 -31.038 1.00 48.55 ? 1   MET A CG  1 
ATOM   17   S SD  . MET A 1 2   ? 33.372 136.853 -30.651 1.00 49.44 ? 1   MET A SD  1 
ATOM   18   C CE  . MET A 1 2   ? 32.757 136.572 -32.305 1.00 49.38 ? 1   MET A CE  1 
ATOM   19   N N   . LEU A 1 3   ? 36.732 140.338 -31.435 1.00 44.17 ? 2   LEU A N   1 
ATOM   20   C CA  . LEU A 1 3   ? 36.247 141.675 -31.770 1.00 42.80 ? 2   LEU A CA  1 
ATOM   21   C C   . LEU A 1 3   ? 34.747 141.658 -31.527 1.00 41.17 ? 2   LEU A C   1 
ATOM   22   O O   . LEU A 1 3   ? 34.065 140.710 -31.905 1.00 40.22 ? 2   LEU A O   1 
ATOM   23   C CB  . LEU A 1 3   ? 36.528 142.041 -33.226 1.00 42.95 ? 2   LEU A CB  1 
ATOM   24   C CG  . LEU A 1 3   ? 37.983 142.180 -33.673 1.00 42.80 ? 2   LEU A CG  1 
ATOM   25   C CD1 . LEU A 1 3   ? 38.011 142.606 -35.129 1.00 42.68 ? 2   LEU A CD1 1 
ATOM   26   C CD2 . LEU A 1 3   ? 38.740 143.180 -32.815 1.00 43.32 ? 2   LEU A CD2 1 
ATOM   27   N N   . ASN A 1 4   ? 34.232 142.698 -30.888 1.00 40.61 ? 3   ASN A N   1 
ATOM   28   C CA  . ASN A 1 4   ? 32.818 142.744 -30.566 1.00 39.52 ? 3   ASN A CA  1 
ATOM   29   C C   . ASN A 1 4   ? 32.122 143.823 -31.388 1.00 38.61 ? 3   ASN A C   1 
ATOM   30   O O   . ASN A 1 4   ? 32.761 144.525 -32.173 1.00 38.09 ? 3   ASN A O   1 
ATOM   31   C CB  . ASN A 1 4   ? 32.651 142.977 -29.061 1.00 40.35 ? 3   ASN A CB  1 
ATOM   32   C CG  . ASN A 1 4   ? 31.395 142.327 -28.497 1.00 40.99 ? 3   ASN A CG  1 
ATOM   33   O OD1 . ASN A 1 4   ? 30.476 141.952 -29.233 1.00 40.76 ? 3   ASN A OD1 1 
ATOM   34   N ND2 . ASN A 1 4   ? 31.354 142.187 -27.177 1.00 41.52 ? 3   ASN A ND2 1 
ATOM   35   N N   . VAL A 1 5   ? 30.808 143.929 -31.213 1.00 37.89 ? 4   VAL A N   1 
ATOM   36   C CA  . VAL A 1 5   ? 29.975 144.900 -31.925 1.00 37.83 ? 4   VAL A CA  1 
ATOM   37   C C   . VAL A 1 5   ? 30.518 146.325 -31.768 1.00 37.78 ? 4   VAL A C   1 
ATOM   38   O O   . VAL A 1 5   ? 30.945 146.717 -30.681 1.00 37.75 ? 4   VAL A O   1 
ATOM   39   C CB  . VAL A 1 5   ? 28.506 144.815 -31.430 1.00 38.39 ? 4   VAL A CB  1 
ATOM   40   C CG1 . VAL A 1 5   ? 27.654 145.943 -31.999 1.00 39.32 ? 4   VAL A CG1 1 
ATOM   41   C CG2 . VAL A 1 5   ? 27.907 143.455 -31.780 1.00 37.95 ? 4   VAL A CG2 1 
ATOM   42   N N   . GLY A 1 6   ? 30.518 147.080 -32.867 1.00 37.34 ? 5   GLY A N   1 
ATOM   43   C CA  . GLY A 1 6   ? 30.999 148.464 -32.874 1.00 37.55 ? 5   GLY A CA  1 
ATOM   44   C C   . GLY A 1 6   ? 32.376 148.635 -33.493 1.00 37.07 ? 5   GLY A C   1 
ATOM   45   O O   . GLY A 1 6   ? 32.753 149.739 -33.892 1.00 36.82 ? 5   GLY A O   1 
ATOM   46   N N   . ALA A 1 7   ? 33.131 147.544 -33.573 1.00 36.05 ? 6   ALA A N   1 
ATOM   47   C CA  . ALA A 1 7   ? 34.475 147.580 -34.134 1.00 35.81 ? 6   ALA A CA  1 
ATOM   48   C C   . ALA A 1 7   ? 34.464 147.494 -35.648 1.00 35.80 ? 6   ALA A C   1 
ATOM   49   O O   . ALA A 1 7   ? 33.532 146.961 -36.253 1.00 35.08 ? 6   ALA A O   1 
ATOM   50   C CB  . ALA A 1 7   ? 35.308 146.445 -33.568 1.00 35.11 ? 6   ALA A CB  1 
ATOM   51   N N   . THR A 1 8   ? 35.521 148.031 -36.247 1.00 36.28 ? 7   THR A N   1 
ATOM   52   C CA  . THR A 1 8   ? 35.709 147.964 -37.680 1.00 36.56 ? 7   THR A CA  1 
ATOM   53   C C   . THR A 1 8   ? 36.141 146.537 -37.982 1.00 35.84 ? 7   THR A C   1 
ATOM   54   O O   . THR A 1 8   ? 37.037 146.008 -37.323 1.00 35.49 ? 7   THR A O   1 
ATOM   55   C CB  . THR A 1 8   ? 36.812 148.934 -38.144 1.00 37.34 ? 7   THR A CB  1 
ATOM   56   O OG1 . THR A 1 8   ? 36.495 150.261 -37.711 1.00 37.95 ? 7   THR A OG1 1 
ATOM   57   C CG2 . THR A 1 8   ? 36.959 148.914 -39.665 1.00 37.70 ? 7   THR A CG2 1 
ATOM   58   N N   . ALA A 1 9   ? 35.484 145.903 -38.947 1.00 35.64 ? 8   ALA A N   1 
ATOM   59   C CA  . ALA A 1 9   ? 35.842 144.548 -39.341 1.00 34.86 ? 8   ALA A CA  1 
ATOM   60   C C   . ALA A 1 9   ? 37.161 144.613 -40.109 1.00 35.23 ? 8   ALA A C   1 
ATOM   61   O O   . ALA A 1 9   ? 37.232 145.283 -41.142 1.00 34.90 ? 8   ALA A O   1 
ATOM   62   C CB  . ALA A 1 9   ? 34.751 143.943 -40.206 1.00 34.72 ? 8   ALA A CB  1 
ATOM   63   N N   . PRO A 1 10  ? 38.218 143.952 -39.593 1.00 35.63 ? 9   PRO A N   1 
ATOM   64   C CA  . PRO A 1 10  ? 39.493 143.969 -40.301 1.00 36.30 ? 9   PRO A CA  1 
ATOM   65   C C   . PRO A 1 10  ? 39.346 143.504 -41.740 1.00 37.04 ? 9   PRO A C   1 
ATOM   66   O O   . PRO A 1 10  ? 38.708 142.482 -42.007 1.00 36.11 ? 9   PRO A O   1 
ATOM   67   C CB  . PRO A 1 10  ? 40.352 142.983 -39.508 1.00 35.50 ? 9   PRO A CB  1 
ATOM   68   C CG  . PRO A 1 10  ? 39.814 143.064 -38.131 1.00 35.61 ? 9   PRO A CG  1 
ATOM   69   C CD  . PRO A 1 10  ? 38.336 143.281 -38.287 1.00 35.50 ? 9   PRO A CD  1 
ATOM   70   N N   . ASP A 1 11  ? 39.919 144.275 -42.654 1.00 38.47 ? 10  ASP A N   1 
ATOM   71   C CA  . ASP A 1 11  ? 39.861 143.958 -44.062 1.00 39.61 ? 10  ASP A CA  1 
ATOM   72   C C   . ASP A 1 11  ? 40.766 142.764 -44.352 1.00 39.14 ? 10  ASP A C   1 
ATOM   73   O O   . ASP A 1 11  ? 41.776 142.559 -43.677 1.00 39.35 ? 10  ASP A O   1 
ATOM   74   C CB  . ASP A 1 11  ? 40.298 145.171 -44.881 1.00 41.18 ? 10  ASP A CB  1 
ATOM   75   C CG  . ASP A 1 11  ? 40.211 144.933 -46.369 1.00 42.64 ? 10  ASP A CG  1 
ATOM   76   O OD1 . ASP A 1 11  ? 39.358 144.127 -46.816 1.00 42.32 ? 10  ASP A OD1 1 
ATOM   77   O OD2 . ASP A 1 11  ? 41.004 145.566 -47.100 1.00 44.90 ? 10  ASP A OD2 1 
ATOM   78   N N   . PHE A 1 12  ? 40.382 141.966 -45.341 1.00 38.41 ? 11  PHE A N   1 
ATOM   79   C CA  . PHE A 1 12  ? 41.171 140.810 -45.740 1.00 37.70 ? 11  PHE A CA  1 
ATOM   80   C C   . PHE A 1 12  ? 41.002 140.538 -47.222 1.00 37.87 ? 11  PHE A C   1 
ATOM   81   O O   . PHE A 1 12  ? 40.053 141.009 -47.846 1.00 37.94 ? 11  PHE A O   1 
ATOM   82   C CB  . PHE A 1 12  ? 40.789 139.561 -44.928 1.00 36.66 ? 11  PHE A CB  1 
ATOM   83   C CG  . PHE A 1 12  ? 39.344 139.159 -45.058 1.00 36.02 ? 11  PHE A CG  1 
ATOM   84   C CD1 . PHE A 1 12  ? 38.899 138.450 -46.167 1.00 35.78 ? 11  PHE A CD1 1 
ATOM   85   C CD2 . PHE A 1 12  ? 38.433 139.468 -44.059 1.00 35.65 ? 11  PHE A CD2 1 
ATOM   86   C CE1 . PHE A 1 12  ? 37.573 138.076 -46.284 1.00 35.55 ? 11  PHE A CE1 1 
ATOM   87   C CE2 . PHE A 1 12  ? 37.106 139.095 -44.171 1.00 35.41 ? 11  PHE A CE2 1 
ATOM   88   C CZ  . PHE A 1 12  ? 36.674 138.398 -45.284 1.00 35.41 ? 11  PHE A CZ  1 
ATOM   89   N N   . THR A 1 13  ? 41.948 139.779 -47.762 1.00 38.00 ? 12  THR A N   1 
ATOM   90   C CA  . THR A 1 13  ? 41.949 139.361 -49.154 1.00 38.24 ? 12  THR A CA  1 
ATOM   91   C C   . THR A 1 13  ? 42.386 137.904 -49.130 1.00 37.35 ? 12  THR A C   1 
ATOM   92   O O   . THR A 1 13  ? 43.544 137.609 -48.836 1.00 37.20 ? 12  THR A O   1 
ATOM   93   C CB  . THR A 1 13  ? 42.933 140.194 -49.995 1.00 39.28 ? 12  THR A CB  1 
ATOM   94   O OG1 . THR A 1 13  ? 42.606 141.584 -49.879 1.00 40.16 ? 12  THR A OG1 1 
ATOM   95   C CG2 . THR A 1 13  ? 42.885 139.779 -51.464 1.00 39.76 ? 12  THR A CG2 1 
ATOM   96   N N   . LEU A 1 14  ? 41.453 137.000 -49.412 1.00 36.83 ? 13  LEU A N   1 
ATOM   97   C CA  . LEU A 1 14  ? 41.727 135.569 -49.357 1.00 36.41 ? 13  LEU A CA  1 
ATOM   98   C C   . LEU A 1 14  ? 41.208 134.826 -50.582 1.00 36.79 ? 13  LEU A C   1 
ATOM   99   O O   . LEU A 1 14  ? 40.291 135.288 -51.264 1.00 36.60 ? 13  LEU A O   1 
ATOM   100  C CB  . LEU A 1 14  ? 41.078 134.976 -48.104 1.00 35.64 ? 13  LEU A CB  1 
ATOM   101  C CG  . LEU A 1 14  ? 41.427 135.597 -46.745 1.00 35.45 ? 13  LEU A CG  1 
ATOM   102  C CD1 . LEU A 1 14  ? 40.525 135.013 -45.667 1.00 35.07 ? 13  LEU A CD1 1 
ATOM   103  C CD2 . LEU A 1 14  ? 42.892 135.410 -46.371 1.00 35.30 ? 13  LEU A CD2 1 
ATOM   104  N N   . ARG A 1 15  ? 41.807 133.666 -50.840 1.00 37.16 ? 14  ARG A N   1 
ATOM   105  C CA  . ARG A 1 15  ? 41.422 132.801 -51.950 1.00 38.10 ? 14  ARG A CA  1 
ATOM   106  C C   . ARG A 1 15  ? 40.237 131.940 -51.546 1.00 37.45 ? 14  ARG A C   1 
ATOM   107  O O   . ARG A 1 15  ? 40.234 131.378 -50.452 1.00 36.48 ? 14  ARG A O   1 
ATOM   108  C CB  . ARG A 1 15  ? 42.570 131.850 -52.302 1.00 39.08 ? 14  ARG A CB  1 
ATOM   109  C CG  . ARG A 1 15  ? 43.845 132.515 -52.786 1.00 40.65 ? 14  ARG A CG  1 
ATOM   110  C CD  . ARG A 1 15  ? 43.720 132.974 -54.225 1.00 42.25 ? 14  ARG A CD  1 
ATOM   111  N NE  . ARG A 1 15  ? 44.878 133.762 -54.641 1.00 44.04 ? 14  ARG A NE  1 
ATOM   112  C CZ  . ARG A 1 15  ? 45.045 134.281 -55.855 1.00 45.29 ? 14  ARG A CZ  1 
ATOM   113  N NH1 . ARG A 1 15  ? 44.133 134.094 -56.807 1.00 45.32 ? 14  ARG A NH1 1 
ATOM   114  N NH2 . ARG A 1 15  ? 46.135 134.993 -56.120 1.00 46.35 ? 14  ARG A NH2 1 
ATOM   115  N N   . ASP A 1 16  ? 39.238 131.829 -52.417 1.00 38.08 ? 15  ASP A N   1 
ATOM   116  C CA  . ASP A 1 16  ? 38.105 130.945 -52.144 1.00 38.75 ? 15  ASP A CA  1 
ATOM   117  C C   . ASP A 1 16  ? 38.461 129.546 -52.675 1.00 38.65 ? 15  ASP A C   1 
ATOM   118  O O   . ASP A 1 16  ? 39.558 129.347 -53.204 1.00 38.22 ? 15  ASP A O   1 
ATOM   119  C CB  . ASP A 1 16  ? 36.786 131.492 -52.720 1.00 39.93 ? 15  ASP A CB  1 
ATOM   120  C CG  . ASP A 1 16  ? 36.751 131.526 -54.244 1.00 41.44 ? 15  ASP A CG  1 
ATOM   121  O OD1 . ASP A 1 16  ? 37.504 130.781 -54.908 1.00 41.62 ? 15  ASP A OD1 1 
ATOM   122  O OD2 . ASP A 1 16  ? 35.930 132.302 -54.780 1.00 43.60 ? 15  ASP A OD2 1 
ATOM   123  N N   . GLN A 1 17  ? 37.550 128.584 -52.547 1.00 38.50 ? 16  GLN A N   1 
ATOM   124  C CA  . GLN A 1 17  ? 37.836 127.214 -52.993 1.00 39.09 ? 16  GLN A CA  1 
ATOM   125  C C   . GLN A 1 17  ? 38.202 127.083 -54.478 1.00 40.41 ? 16  GLN A C   1 
ATOM   126  O O   . GLN A 1 17  ? 38.826 126.098 -54.870 1.00 40.24 ? 16  GLN A O   1 
ATOM   127  C CB  . GLN A 1 17  ? 36.706 126.233 -52.644 1.00 38.54 ? 16  GLN A CB  1 
ATOM   128  C CG  . GLN A 1 17  ? 35.354 126.459 -53.316 1.00 38.78 ? 16  GLN A CG  1 
ATOM   129  C CD  . GLN A 1 17  ? 34.450 127.411 -52.553 1.00 38.64 ? 16  GLN A CD  1 
ATOM   130  O OE1 . GLN A 1 17  ? 34.917 128.337 -51.890 1.00 38.36 ? 16  GLN A OE1 1 
ATOM   131  N NE2 . GLN A 1 17  ? 33.142 127.183 -52.644 1.00 38.35 ? 16  GLN A NE2 1 
ATOM   132  N N   . ASN A 1 18  ? 37.815 128.064 -55.292 1.00 41.80 ? 17  ASN A N   1 
ATOM   133  C CA  . ASN A 1 18  ? 38.128 128.069 -56.720 1.00 43.47 ? 17  ASN A CA  1 
ATOM   134  C C   . ASN A 1 18  ? 39.278 129.021 -57.066 1.00 44.39 ? 17  ASN A C   1 
ATOM   135  O O   . ASN A 1 18  ? 39.393 129.466 -58.207 1.00 44.92 ? 17  ASN A O   1 
ATOM   136  C CB  . ASN A 1 18  ? 36.876 128.448 -57.511 1.00 44.18 ? 17  ASN A CB  1 
ATOM   137  C CG  . ASN A 1 18  ? 35.726 127.487 -57.274 1.00 44.07 ? 17  ASN A CG  1 
ATOM   138  O OD1 . ASN A 1 18  ? 35.890 126.269 -57.370 1.00 43.84 ? 17  ASN A OD1 1 
ATOM   139  N ND2 . ASN A 1 18  ? 34.550 128.031 -56.976 1.00 44.26 ? 17  ASN A ND2 1 
ATOM   140  N N   . GLN A 1 19  ? 40.117 129.331 -56.073 1.00 44.98 ? 18  GLN A N   1 
ATOM   141  C CA  . GLN A 1 19  ? 41.281 130.218 -56.232 1.00 46.32 ? 18  GLN A CA  1 
ATOM   142  C C   . GLN A 1 19  ? 40.954 131.676 -56.613 1.00 46.44 ? 18  GLN A C   1 
ATOM   143  O O   . GLN A 1 19  ? 41.846 132.425 -57.015 1.00 45.93 ? 18  GLN A O   1 
ATOM   144  C CB  . GLN A 1 19  ? 42.290 129.619 -57.230 1.00 47.67 ? 18  GLN A CB  1 
ATOM   145  C CG  . GLN A 1 19  ? 42.856 128.257 -56.836 1.00 48.38 ? 18  GLN A CG  1 
ATOM   146  C CD  . GLN A 1 19  ? 43.836 128.312 -55.673 1.00 49.15 ? 18  GLN A CD  1 
ATOM   147  O OE1 . GLN A 1 19  ? 44.095 129.374 -55.102 1.00 50.49 ? 18  GLN A OE1 1 
ATOM   148  N NE2 . GLN A 1 19  ? 44.398 127.160 -55.323 1.00 49.35 ? 18  GLN A NE2 1 
ATOM   149  N N   . GLN A 1 20  ? 39.693 132.081 -56.471 1.00 46.55 ? 19  GLN A N   1 
ATOM   150  C CA  . GLN A 1 20  ? 39.285 133.453 -56.769 1.00 47.48 ? 19  GLN A CA  1 
ATOM   151  C C   . GLN A 1 20  ? 39.451 134.304 -55.515 1.00 46.50 ? 19  GLN A C   1 
ATOM   152  O O   . GLN A 1 20  ? 39.070 133.881 -54.422 1.00 45.32 ? 19  GLN A O   1 
ATOM   153  C CB  . GLN A 1 20  ? 37.831 133.502 -57.255 1.00 48.87 ? 19  GLN A CB  1 
ATOM   154  C CG  . GLN A 1 20  ? 37.625 133.029 -58.686 1.00 50.41 ? 19  GLN A CG  1 
ATOM   155  C CD  . GLN A 1 20  ? 38.134 134.023 -59.724 1.00 52.89 ? 19  GLN A CD  1 
ATOM   156  O OE1 . GLN A 1 20  ? 38.055 135.243 -59.537 1.00 54.94 ? 19  GLN A OE1 1 
ATOM   157  N NE2 . GLN A 1 20  ? 38.639 133.504 -60.839 1.00 53.90 ? 19  GLN A NE2 1 
ATOM   158  N N   . LEU A 1 21  ? 40.030 135.492 -55.672 1.00 46.53 ? 20  LEU A N   1 
ATOM   159  C CA  . LEU A 1 21  ? 40.238 136.400 -54.546 1.00 46.25 ? 20  LEU A CA  1 
ATOM   160  C C   . LEU A 1 21  ? 38.926 136.995 -54.060 1.00 45.77 ? 20  LEU A C   1 
ATOM   161  O O   . LEU A 1 21  ? 38.082 137.401 -54.858 1.00 46.57 ? 20  LEU A O   1 
ATOM   162  C CB  . LEU A 1 21  ? 41.203 137.536 -54.909 1.00 47.23 ? 20  LEU A CB  1 
ATOM   163  C CG  . LEU A 1 21  ? 42.686 137.177 -55.019 1.00 47.82 ? 20  LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 21  ? 43.487 138.386 -55.478 1.00 48.41 ? 20  LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 21  ? 43.218 136.659 -53.689 1.00 47.64 ? 20  LEU A CD2 1 
ATOM   166  N N   . VAL A 1 22  ? 38.769 137.032 -52.741 1.00 44.66 ? 21  VAL A N   1 
ATOM   167  C CA  . VAL A 1 22  ? 37.588 137.598 -52.109 1.00 43.76 ? 21  VAL A CA  1 
ATOM   168  C C   . VAL A 1 22  ? 38.054 138.591 -51.055 1.00 43.28 ? 21  VAL A C   1 
ATOM   169  O O   . VAL A 1 22  ? 38.782 138.222 -50.133 1.00 42.76 ? 21  VAL A O   1 
ATOM   170  C CB  . VAL A 1 22  ? 36.725 136.510 -51.443 1.00 43.24 ? 21  VAL A CB  1 
ATOM   171  C CG1 . VAL A 1 22  ? 35.522 137.131 -50.741 1.00 43.53 ? 21  VAL A CG1 1 
ATOM   172  C CG2 . VAL A 1 22  ? 36.282 135.480 -52.474 1.00 43.11 ? 21  VAL A CG2 1 
ATOM   173  N N   . THR A 1 23  ? 37.656 139.852 -51.214 1.00 43.44 ? 22  THR A N   1 
ATOM   174  C CA  . THR A 1 23  ? 37.989 140.900 -50.257 1.00 43.85 ? 22  THR A CA  1 
ATOM   175  C C   . THR A 1 23  ? 36.722 141.337 -49.533 1.00 43.77 ? 22  THR A C   1 
ATOM   176  O O   . THR A 1 23  ? 35.641 141.367 -50.122 1.00 43.94 ? 22  THR A O   1 
ATOM   177  C CB  . THR A 1 23  ? 38.632 142.126 -50.938 1.00 45.10 ? 22  THR A CB  1 
ATOM   178  O OG1 . THR A 1 23  ? 37.698 142.729 -51.842 1.00 46.32 ? 22  THR A OG1 1 
ATOM   179  C CG2 . THR A 1 23  ? 39.890 141.723 -51.696 1.00 45.05 ? 22  THR A CG2 1 
ATOM   180  N N   . LEU A 1 24  ? 36.858 141.670 -48.254 1.00 43.59 ? 23  LEU A N   1 
ATOM   181  C CA  . LEU A 1 24  ? 35.722 142.114 -47.451 1.00 44.17 ? 23  LEU A CA  1 
ATOM   182  C C   . LEU A 1 24  ? 35.241 143.502 -47.884 1.00 45.27 ? 23  LEU A C   1 
ATOM   183  O O   . LEU A 1 24  ? 34.040 143.729 -48.025 1.00 45.33 ? 23  LEU A O   1 
ATOM   184  C CB  . LEU A 1 24  ? 36.101 142.135 -45.971 1.00 43.88 ? 23  LEU A CB  1 
ATOM   185  C CG  . LEU A 1 24  ? 34.996 142.482 -44.971 1.00 43.78 ? 23  LEU A CG  1 
ATOM   186  C CD1 . LEU A 1 24  ? 33.846 141.490 -45.052 1.00 43.23 ? 23  LEU A CD1 1 
ATOM   187  C CD2 . LEU A 1 24  ? 35.583 142.513 -43.572 1.00 43.75 ? 23  LEU A CD2 1 
ATOM   188  N N   . ARG A 1 25  ? 36.182 144.418 -48.106 1.00 46.56 ? 24  ARG A N   1 
ATOM   189  C CA  . ARG A 1 25  ? 35.853 145.793 -48.514 1.00 48.35 ? 24  ARG A CA  1 
ATOM   190  C C   . ARG A 1 25  ? 35.083 145.884 -49.839 1.00 47.85 ? 24  ARG A C   1 
ATOM   191  O O   . ARG A 1 25  ? 34.463 146.907 -50.127 1.00 48.68 ? 24  ARG A O   1 
ATOM   192  C CB  . ARG A 1 25  ? 37.118 146.665 -48.564 1.00 50.31 ? 24  ARG A CB  1 
ATOM   193  C CG  . ARG A 1 25  ? 38.128 146.281 -49.637 1.00 52.07 ? 24  ARG A CG  1 
ATOM   194  C CD  . ARG A 1 25  ? 39.455 146.984 -49.404 1.00 53.72 ? 24  ARG A CD  1 
ATOM   195  N NE  . ARG A 1 25  ? 40.476 146.624 -50.390 1.00 55.63 ? 24  ARG A NE  1 
ATOM   196  C CZ  . ARG A 1 25  ? 41.145 145.468 -50.425 1.00 56.27 ? 24  ARG A CZ  1 
ATOM   197  N NH1 . ARG A 1 25  ? 40.899 144.497 -49.548 1.00 56.37 ? 24  ARG A NH1 1 
ATOM   198  N NH2 . ARG A 1 25  ? 42.054 145.269 -51.372 1.00 56.82 ? 24  ARG A NH2 1 
ATOM   199  N N   . GLY A 1 26  ? 35.120 144.820 -50.640 1.00 46.95 ? 25  GLY A N   1 
ATOM   200  C CA  . GLY A 1 26  ? 34.369 144.770 -51.890 1.00 46.63 ? 25  GLY A CA  1 
ATOM   201  C C   . GLY A 1 26  ? 32.862 144.783 -51.683 1.00 46.35 ? 25  GLY A C   1 
ATOM   202  O O   . GLY A 1 26  ? 32.113 145.085 -52.611 1.00 46.85 ? 25  GLY A O   1 
ATOM   203  N N   . TYR A 1 27  ? 32.415 144.449 -50.471 1.00 45.41 ? 26  TYR A N   1 
ATOM   204  C CA  . TYR A 1 27  ? 30.989 144.438 -50.134 1.00 45.00 ? 26  TYR A CA  1 
ATOM   205  C C   . TYR A 1 27  ? 30.479 145.732 -49.494 1.00 45.22 ? 26  TYR A C   1 
ATOM   206  O O   . TYR A 1 27  ? 29.266 145.922 -49.395 1.00 45.23 ? 26  TYR A O   1 
ATOM   207  C CB  . TYR A 1 27  ? 30.674 143.264 -49.206 1.00 44.22 ? 26  TYR A CB  1 
ATOM   208  C CG  . TYR A 1 27  ? 30.877 141.917 -49.852 1.00 43.98 ? 26  TYR A CG  1 
ATOM   209  C CD1 . TYR A 1 27  ? 29.899 141.369 -50.674 1.00 44.15 ? 26  TYR A CD1 1 
ATOM   210  C CD2 . TYR A 1 27  ? 32.042 141.186 -49.638 1.00 43.57 ? 26  TYR A CD2 1 
ATOM   211  C CE1 . TYR A 1 27  ? 30.075 140.133 -51.272 1.00 44.04 ? 26  TYR A CE1 1 
ATOM   212  C CE2 . TYR A 1 27  ? 32.228 139.948 -50.231 1.00 43.43 ? 26  TYR A CE2 1 
ATOM   213  C CZ  . TYR A 1 27  ? 31.242 139.427 -51.047 1.00 43.49 ? 26  TYR A CZ  1 
ATOM   214  O OH  . TYR A 1 27  ? 31.420 138.199 -51.639 1.00 43.70 ? 26  TYR A OH  1 
ATOM   215  N N   . ARG A 1 28  ? 31.381 146.610 -49.053 1.00 45.24 ? 27  ARG A N   1 
ATOM   216  C CA  . ARG A 1 28  ? 30.968 147.876 -48.428 1.00 46.35 ? 27  ARG A CA  1 
ATOM   217  C C   . ARG A 1 28  ? 30.120 148.729 -49.374 1.00 46.11 ? 27  ARG A C   1 
ATOM   218  O O   . ARG A 1 28  ? 30.376 148.786 -50.569 1.00 46.71 ? 27  ARG A O   1 
ATOM   219  C CB  . ARG A 1 28  ? 32.174 148.634 -47.835 1.00 47.39 ? 27  ARG A CB  1 
ATOM   220  C CG  . ARG A 1 28  ? 32.510 148.087 -46.451 1.00 48.33 ? 27  ARG A CG  1 
ATOM   221  C CD  . ARG A 1 28  ? 33.914 148.340 -45.920 1.00 49.22 ? 27  ARG A CD  1 
ATOM   222  N NE  . ARG A 1 28  ? 34.170 149.715 -45.490 1.00 51.05 ? 27  ARG A NE  1 
ATOM   223  C CZ  . ARG A 1 28  ? 35.148 150.074 -44.654 1.00 51.66 ? 27  ARG A CZ  1 
ATOM   224  N NH1 . ARG A 1 28  ? 35.955 149.162 -44.109 1.00 50.90 ? 27  ARG A NH1 1 
ATOM   225  N NH2 . ARG A 1 28  ? 35.305 151.355 -44.328 1.00 52.18 ? 27  ARG A NH2 1 
ATOM   226  N N   . GLY A 1 29  ? 29.072 149.337 -48.826 1.00 45.57 ? 28  GLY A N   1 
ATOM   227  C CA  . GLY A 1 29  ? 28.134 150.146 -49.605 1.00 46.01 ? 28  GLY A CA  1 
ATOM   228  C C   . GLY A 1 29  ? 27.226 149.331 -50.518 1.00 45.27 ? 28  GLY A C   1 
ATOM   229  O O   . GLY A 1 29  ? 26.570 149.891 -51.397 1.00 46.17 ? 28  GLY A O   1 
ATOM   230  N N   . ALA A 1 30  ? 27.167 148.016 -50.301 1.00 43.45 ? 29  ALA A N   1 
ATOM   231  C CA  . ALA A 1 30  ? 26.364 147.122 -51.139 1.00 42.61 ? 29  ALA A CA  1 
ATOM   232  C C   . ALA A 1 30  ? 25.637 146.042 -50.336 1.00 41.45 ? 29  ALA A C   1 
ATOM   233  O O   . ALA A 1 30  ? 24.410 145.924 -50.412 1.00 41.64 ? 29  ALA A O   1 
ATOM   234  C CB  . ALA A 1 30  ? 27.245 146.477 -52.200 1.00 42.07 ? 29  ALA A CB  1 
ATOM   235  N N   . LYS A 1 31  ? 26.389 145.253 -49.572 1.00 39.84 ? 30  LYS A N   1 
ATOM   236  C CA  . LYS A 1 31  ? 25.799 144.160 -48.808 1.00 38.92 ? 30  LYS A CA  1 
ATOM   237  C C   . LYS A 1 31  ? 26.358 143.994 -47.403 1.00 37.65 ? 30  LYS A C   1 
ATOM   238  O O   . LYS A 1 31  ? 27.498 144.367 -47.112 1.00 36.97 ? 30  LYS A O   1 
ATOM   239  C CB  . LYS A 1 31  ? 26.013 142.840 -49.556 1.00 38.81 ? 30  LYS A CB  1 
ATOM   240  C CG  . LYS A 1 31  ? 25.408 142.799 -50.949 1.00 40.02 ? 30  LYS A CG  1 
ATOM   241  C CD  . LYS A 1 31  ? 25.624 141.445 -51.606 1.00 40.18 ? 30  LYS A CD  1 
ATOM   242  C CE  . LYS A 1 31  ? 25.005 141.399 -52.994 1.00 41.25 ? 30  LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 31  ? 25.193 140.071 -53.643 1.00 41.25 ? 30  LYS A NZ  1 
ATOM   244  N N   . ASN A 1 32  ? 25.523 143.424 -46.540 1.00 36.61 ? 31  ASN A N   1 
ATOM   245  C CA  . ASN A 1 32  ? 25.919 143.066 -45.192 1.00 35.79 ? 31  ASN A CA  1 
ATOM   246  C C   . ASN A 1 32  ? 26.636 141.736 -45.354 1.00 34.70 ? 31  ASN A C   1 
ATOM   247  O O   . ASN A 1 32  ? 26.246 140.927 -46.189 1.00 34.67 ? 31  ASN A O   1 
ATOM   248  C CB  . ASN A 1 32  ? 24.692 142.923 -44.298 1.00 35.99 ? 31  ASN A CB  1 
ATOM   249  C CG  . ASN A 1 32  ? 23.888 144.206 -44.218 1.00 36.99 ? 31  ASN A CG  1 
ATOM   250  O OD1 . ASN A 1 32  ? 24.453 145.288 -44.108 1.00 37.80 ? 31  ASN A OD1 1 
ATOM   251  N ND2 . ASN A 1 32  ? 22.567 144.091 -44.270 1.00 37.60 ? 31  ASN A ND2 1 
ATOM   252  N N   . VAL A 1 33  ? 27.693 141.502 -44.591 1.00 33.75 ? 32  VAL A N   1 
ATOM   253  C CA  . VAL A 1 33  ? 28.449 140.269 -44.759 1.00 32.93 ? 32  VAL A CA  1 
ATOM   254  C C   . VAL A 1 33  ? 28.470 139.410 -43.505 1.00 32.17 ? 32  VAL A C   1 
ATOM   255  O O   . VAL A 1 33  ? 28.810 139.882 -42.422 1.00 31.78 ? 32  VAL A O   1 
ATOM   256  C CB  . VAL A 1 33  ? 29.905 140.564 -45.179 1.00 32.87 ? 32  VAL A CB  1 
ATOM   257  C CG1 . VAL A 1 33  ? 30.637 139.266 -45.499 1.00 32.27 ? 32  VAL A CG1 1 
ATOM   258  C CG2 . VAL A 1 33  ? 29.931 141.500 -46.378 1.00 33.21 ? 32  VAL A CG2 1 
ATOM   259  N N   . LEU A 1 34  ? 28.106 138.143 -43.674 1.00 31.95 ? 33  LEU A N   1 
ATOM   260  C CA  . LEU A 1 34  ? 28.160 137.169 -42.600 1.00 31.55 ? 33  LEU A CA  1 
ATOM   261  C C   . LEU A 1 34  ? 29.515 136.479 -42.684 1.00 30.89 ? 33  LEU A C   1 
ATOM   262  O O   . LEU A 1 34  ? 29.820 135.843 -43.690 1.00 30.68 ? 33  LEU A O   1 
ATOM   263  C CB  . LEU A 1 34  ? 27.054 136.126 -42.756 1.00 31.56 ? 33  LEU A CB  1 
ATOM   264  C CG  . LEU A 1 34  ? 27.021 135.022 -41.697 1.00 31.40 ? 33  LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 34  ? 26.529 135.553 -40.361 1.00 31.56 ? 33  LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 34  ? 26.136 133.880 -42.159 1.00 31.70 ? 33  LEU A CD2 1 
ATOM   267  N N   . LEU A 1 35  ? 30.335 136.626 -41.649 1.00 30.89 ? 34  LEU A N   1 
ATOM   268  C CA  . LEU A 1 35  ? 31.628 135.951 -41.601 1.00 30.87 ? 34  LEU A CA  1 
ATOM   269  C C   . LEU A 1 35  ? 31.503 134.777 -40.653 1.00 30.45 ? 34  LEU A C   1 
ATOM   270  O O   . LEU A 1 35  ? 31.219 134.965 -39.476 1.00 30.64 ? 34  LEU A O   1 
ATOM   271  C CB  . LEU A 1 35  ? 32.732 136.879 -41.105 1.00 31.08 ? 34  LEU A CB  1 
ATOM   272  C CG  . LEU A 1 35  ? 32.991 138.156 -41.895 1.00 31.60 ? 34  LEU A CG  1 
ATOM   273  C CD1 . LEU A 1 35  ? 34.151 138.901 -41.256 1.00 31.92 ? 34  LEU A CD1 1 
ATOM   274  C CD2 . LEU A 1 35  ? 33.292 137.847 -43.350 1.00 31.77 ? 34  LEU A CD2 1 
ATOM   275  N N   . VAL A 1 36  ? 31.705 133.571 -41.166 1.00 30.42 ? 35  VAL A N   1 
ATOM   276  C CA  . VAL A 1 36  ? 31.616 132.372 -40.350 1.00 30.54 ? 35  VAL A CA  1 
ATOM   277  C C   . VAL A 1 36  ? 32.980 131.701 -40.268 1.00 30.38 ? 35  VAL A C   1 
ATOM   278  O O   . VAL A 1 36  ? 33.414 131.046 -41.213 1.00 30.45 ? 35  VAL A O   1 
ATOM   279  C CB  . VAL A 1 36  ? 30.596 131.364 -40.924 1.00 30.74 ? 35  VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 36  ? 30.534 130.116 -40.048 1.00 30.60 ? 35  VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 36  ? 29.218 132.003 -41.049 1.00 31.23 ? 35  VAL A CG2 1 
ATOM   282  N N   . PHE A 1 37  ? 33.659 131.878 -39.140 1.00 30.23 ? 36  PHE A N   1 
ATOM   283  C CA  . PHE A 1 37  ? 34.943 131.231 -38.921 1.00 30.27 ? 36  PHE A CA  1 
ATOM   284  C C   . PHE A 1 37  ? 34.679 129.821 -38.407 1.00 30.21 ? 36  PHE A C   1 
ATOM   285  O O   . PHE A 1 37  ? 33.840 129.635 -37.528 1.00 30.61 ? 36  PHE A O   1 
ATOM   286  C CB  . PHE A 1 37  ? 35.796 132.022 -37.926 1.00 30.33 ? 36  PHE A CB  1 
ATOM   287  C CG  . PHE A 1 37  ? 36.297 133.333 -38.467 1.00 30.62 ? 36  PHE A CG  1 
ATOM   288  C CD1 . PHE A 1 37  ? 35.488 134.459 -38.463 1.00 30.84 ? 36  PHE A CD1 1 
ATOM   289  C CD2 . PHE A 1 37  ? 37.582 133.440 -38.978 1.00 30.57 ? 36  PHE A CD2 1 
ATOM   290  C CE1 . PHE A 1 37  ? 35.947 135.664 -38.964 1.00 31.07 ? 36  PHE A CE1 1 
ATOM   291  C CE2 . PHE A 1 37  ? 38.048 134.641 -39.479 1.00 30.84 ? 36  PHE A CE2 1 
ATOM   292  C CZ  . PHE A 1 37  ? 37.229 135.755 -39.471 1.00 31.19 ? 36  PHE A CZ  1 
ATOM   293  N N   . PHE A 1 38  ? 35.362 128.829 -38.974 1.00 30.30 ? 37  PHE A N   1 
ATOM   294  C CA  . PHE A 1 38  ? 35.206 127.442 -38.527 1.00 30.48 ? 37  PHE A CA  1 
ATOM   295  C C   . PHE A 1 38  ? 36.579 126.793 -38.399 1.00 30.79 ? 37  PHE A C   1 
ATOM   296  O O   . PHE A 1 38  ? 37.498 127.156 -39.126 1.00 31.54 ? 37  PHE A O   1 
ATOM   297  C CB  . PHE A 1 38  ? 34.285 126.648 -39.458 1.00 30.22 ? 37  PHE A CB  1 
ATOM   298  C CG  . PHE A 1 38  ? 34.827 126.453 -40.841 1.00 30.29 ? 37  PHE A CG  1 
ATOM   299  C CD1 . PHE A 1 38  ? 34.695 127.447 -41.800 1.00 30.37 ? 37  PHE A CD1 1 
ATOM   300  C CD2 . PHE A 1 38  ? 35.438 125.253 -41.200 1.00 30.25 ? 37  PHE A CD2 1 
ATOM   301  C CE1 . PHE A 1 38  ? 35.184 127.263 -43.084 1.00 30.23 ? 37  PHE A CE1 1 
ATOM   302  C CE2 . PHE A 1 38  ? 35.927 125.064 -42.480 1.00 30.13 ? 37  PHE A CE2 1 
ATOM   303  C CZ  . PHE A 1 38  ? 35.797 126.070 -43.424 1.00 30.40 ? 37  PHE A CZ  1 
ATOM   304  N N   . PRO A 1 39  ? 36.728 125.846 -37.456 1.00 31.22 ? 38  PRO A N   1 
ATOM   305  C CA  . PRO A 1 39  ? 38.041 125.233 -37.204 1.00 31.54 ? 38  PRO A CA  1 
ATOM   306  C C   . PRO A 1 39  ? 38.678 124.422 -38.337 1.00 32.03 ? 38  PRO A C   1 
ATOM   307  O O   . PRO A 1 39  ? 39.758 124.783 -38.805 1.00 32.39 ? 38  PRO A O   1 
ATOM   308  C CB  . PRO A 1 39  ? 37.812 124.341 -35.970 1.00 31.46 ? 38  PRO A CB  1 
ATOM   309  C CG  . PRO A 1 39  ? 36.400 124.519 -35.550 1.00 31.35 ? 38  PRO A CG  1 
ATOM   310  C CD  . PRO A 1 39  ? 35.759 125.586 -36.376 1.00 31.28 ? 38  PRO A CD  1 
ATOM   311  N N   . LEU A 1 40  ? 38.037 123.340 -38.765 1.00 32.53 ? 39  LEU A N   1 
ATOM   312  C CA  . LEU A 1 40  ? 38.634 122.463 -39.768 1.00 33.23 ? 39  LEU A CA  1 
ATOM   313  C C   . LEU A 1 40  ? 37.626 121.802 -40.684 1.00 33.34 ? 39  LEU A C   1 
ATOM   314  O O   . LEU A 1 40  ? 36.562 121.365 -40.245 1.00 32.98 ? 39  LEU A O   1 
ATOM   315  C CB  . LEU A 1 40  ? 39.419 121.349 -39.065 1.00 33.59 ? 39  LEU A CB  1 
ATOM   316  C CG  . LEU A 1 40  ? 40.714 121.720 -38.341 1.00 34.04 ? 39  LEU A CG  1 
ATOM   317  C CD1 . LEU A 1 40  ? 41.198 120.565 -37.478 1.00 34.39 ? 39  LEU A CD1 1 
ATOM   318  C CD2 . LEU A 1 40  ? 41.777 122.135 -39.346 1.00 34.29 ? 39  LEU A CD2 1 
ATOM   319  N N   . ALA A 1 41  ? 37.982 121.712 -41.961 1.00 33.56 ? 40  ALA A N   1 
ATOM   320  C CA  . ALA A 1 41  ? 37.153 121.016 -42.928 1.00 33.80 ? 40  ALA A CA  1 
ATOM   321  C C   . ALA A 1 41  ? 37.184 119.530 -42.581 1.00 34.15 ? 40  ALA A C   1 
ATOM   322  O O   . ALA A 1 41  ? 38.141 119.044 -41.971 1.00 33.99 ? 40  ALA A O   1 
ATOM   323  C CB  . ALA A 1 41  ? 37.673 121.243 -44.339 1.00 33.62 ? 40  ALA A CB  1 
ATOM   324  N N   . PHE A 1 42  ? 36.116 118.827 -42.940 1.00 34.60 ? 41  PHE A N   1 
ATOM   325  C CA  . PHE A 1 42  ? 35.994 117.377 -42.733 1.00 35.58 ? 41  PHE A CA  1 
ATOM   326  C C   . PHE A 1 42  ? 35.780 116.930 -41.285 1.00 36.20 ? 41  PHE A C   1 
ATOM   327  O O   . PHE A 1 42  ? 35.892 115.740 -40.987 1.00 36.71 ? 41  PHE A O   1 
ATOM   328  C CB  . PHE A 1 42  ? 37.201 116.628 -43.308 1.00 35.72 ? 41  PHE A CB  1 
ATOM   329  C CG  . PHE A 1 42  ? 37.500 116.962 -44.738 1.00 35.91 ? 41  PHE A CG  1 
ATOM   330  C CD1 . PHE A 1 42  ? 36.589 116.653 -45.739 1.00 35.88 ? 41  PHE A CD1 1 
ATOM   331  C CD2 . PHE A 1 42  ? 38.709 117.542 -45.091 1.00 35.95 ? 41  PHE A CD2 1 
ATOM   332  C CE1 . PHE A 1 42  ? 36.868 116.942 -47.064 1.00 36.04 ? 41  PHE A CE1 1 
ATOM   333  C CE2 . PHE A 1 42  ? 38.995 117.831 -46.414 1.00 36.24 ? 41  PHE A CE2 1 
ATOM   334  C CZ  . PHE A 1 42  ? 38.074 117.531 -47.402 1.00 36.29 ? 41  PHE A CZ  1 
ATOM   335  N N   . THR A 1 43  ? 35.487 117.868 -40.388 1.00 36.70 ? 42  THR A N   1 
ATOM   336  C CA  . THR A 1 43  ? 35.194 117.527 -39.000 1.00 36.93 ? 42  THR A CA  1 
ATOM   337  C C   . THR A 1 43  ? 33.685 117.621 -38.830 1.00 36.88 ? 42  THR A C   1 
ATOM   338  O O   . THR A 1 43  ? 33.036 118.463 -39.456 1.00 36.48 ? 42  THR A O   1 
ATOM   339  C CB  . THR A 1 43  ? 35.912 118.461 -38.012 1.00 37.34 ? 42  THR A CB  1 
ATOM   340  O OG1 . THR A 1 43  ? 35.575 119.822 -38.301 1.00 38.01 ? 42  THR A OG1 1 
ATOM   341  C CG2 . THR A 1 43  ? 37.415 118.283 -38.121 1.00 37.74 ? 42  THR A CG2 1 
ATOM   342  N N   . GLY A 1 44  ? 33.126 116.744 -38.002 1.00 37.08 ? 43  GLY A N   1 
ATOM   343  C CA  . GLY A 1 44  ? 31.685 116.710 -37.776 1.00 37.37 ? 43  GLY A CA  1 
ATOM   344  C C   . GLY A 1 44  ? 31.099 118.017 -37.271 1.00 37.39 ? 43  GLY A C   1 
ATOM   345  O O   . GLY A 1 44  ? 30.048 118.455 -37.739 1.00 36.75 ? 43  GLY A O   1 
ATOM   346  N N   . ILE A 1 45  ? 31.793 118.645 -36.326 1.00 38.45 ? 44  ILE A N   1 
ATOM   347  C CA  . ILE A 1 45  ? 31.337 119.899 -35.717 1.00 39.77 ? 44  ILE A CA  1 
ATOM   348  C C   . ILE A 1 45  ? 31.220 121.050 -36.734 1.00 39.73 ? 44  ILE A C   1 
ATOM   349  O O   . ILE A 1 45  ? 30.255 121.820 -36.694 1.00 39.78 ? 44  ILE A O   1 
ATOM   350  C CB  . ILE A 1 45  ? 32.243 120.294 -34.517 1.00 41.34 ? 44  ILE A CB  1 
ATOM   351  C CG1 . ILE A 1 45  ? 31.549 121.312 -33.608 1.00 42.46 ? 44  ILE A CG1 1 
ATOM   352  C CG2 . ILE A 1 45  ? 33.619 120.772 -34.975 1.00 42.19 ? 44  ILE A CG2 1 
ATOM   353  C CD1 . ILE A 1 45  ? 30.374 120.739 -32.839 1.00 43.26 ? 44  ILE A CD1 1 
ATOM   354  N N   . CYS A 1 46  ? 32.187 121.155 -37.645 1.00 39.36 ? 45  CYS A N   1 
ATOM   355  C CA  . CYS A 1 46  ? 32.170 122.192 -38.683 1.00 39.11 ? 45  CYS A CA  1 
ATOM   356  C C   . CYS A 1 46  ? 31.186 121.833 -39.785 1.00 38.17 ? 45  CYS A C   1 
ATOM   357  O O   . CYS A 1 46  ? 30.617 122.713 -40.433 1.00 37.27 ? 45  CYS A O   1 
ATOM   358  C CB  . CYS A 1 46  ? 33.558 122.374 -39.289 1.00 39.22 ? 45  CYS A CB  1 
ATOM   359  S SG  . CYS A 1 46  ? 34.803 122.848 -38.076 1.00 41.02 ? 45  CYS A SG  1 
ATOM   360  N N   . GLN A 1 47  ? 31.009 120.534 -40.006 1.00 37.75 ? 46  GLN A N   1 
ATOM   361  C CA  . GLN A 1 47  ? 30.069 120.041 -40.999 1.00 38.29 ? 46  GLN A CA  1 
ATOM   362  C C   . GLN A 1 47  ? 28.665 120.462 -40.588 1.00 38.29 ? 46  GLN A C   1 
ATOM   363  O O   . GLN A 1 47  ? 27.918 121.009 -41.393 1.00 38.36 ? 46  GLN A O   1 
ATOM   364  C CB  . GLN A 1 47  ? 30.141 118.513 -41.102 1.00 38.04 ? 46  GLN A CB  1 
ATOM   365  C CG  . GLN A 1 47  ? 29.339 117.922 -42.252 1.00 38.17 ? 46  GLN A CG  1 
ATOM   366  C CD  . GLN A 1 47  ? 29.998 118.146 -43.599 1.00 38.74 ? 46  GLN A CD  1 
ATOM   367  O OE1 . GLN A 1 47  ? 31.153 117.777 -43.801 1.00 39.42 ? 46  GLN A OE1 1 
ATOM   368  N NE2 . GLN A 1 47  ? 29.260 118.728 -44.535 1.00 38.89 ? 46  GLN A NE2 1 
ATOM   369  N N   . GLY A 1 48  ? 28.321 120.210 -39.328 1.00 38.63 ? 47  GLY A N   1 
ATOM   370  C CA  . GLY A 1 48  ? 27.007 120.556 -38.801 1.00 39.55 ? 47  GLY A CA  1 
ATOM   371  C C   . GLY A 1 48  ? 26.696 122.027 -38.969 1.00 40.68 ? 47  GLY A C   1 
ATOM   372  O O   . GLY A 1 48  ? 25.596 122.405 -39.378 1.00 41.08 ? 47  GLY A O   1 
ATOM   373  N N   . GLU A 1 49  ? 27.688 122.855 -38.669 1.00 41.59 ? 48  GLU A N   1 
ATOM   374  C CA  . GLU A 1 49  ? 27.549 124.296 -38.767 1.00 42.43 ? 48  GLU A CA  1 
ATOM   375  C C   . GLU A 1 49  ? 27.344 124.787 -40.198 1.00 40.71 ? 48  GLU A C   1 
ATOM   376  O O   . GLU A 1 49  ? 26.409 125.543 -40.467 1.00 40.11 ? 48  GLU A O   1 
ATOM   377  C CB  . GLU A 1 49  ? 28.782 124.971 -38.183 1.00 44.98 ? 48  GLU A CB  1 
ATOM   378  C CG  . GLU A 1 49  ? 28.756 126.473 -38.346 1.00 48.13 ? 48  GLU A CG  1 
ATOM   379  C CD  . GLU A 1 49  ? 29.896 127.155 -37.640 1.00 50.68 ? 48  GLU A CD  1 
ATOM   380  O OE1 . GLU A 1 49  ? 29.638 128.242 -37.094 1.00 52.39 ? 48  GLU A OE1 1 
ATOM   381  O OE2 . GLU A 1 49  ? 31.027 126.613 -37.608 1.00 52.04 ? 48  GLU A OE2 1 
ATOM   382  N N   . LEU A 1 50  ? 28.226 124.376 -41.107 1.00 38.39 ? 49  LEU A N   1 
ATOM   383  C CA  . LEU A 1 50  ? 28.126 124.811 -42.496 1.00 37.71 ? 49  LEU A CA  1 
ATOM   384  C C   . LEU A 1 50  ? 26.938 124.186 -43.216 1.00 37.43 ? 49  LEU A C   1 
ATOM   385  O O   . LEU A 1 50  ? 26.420 124.775 -44.163 1.00 37.32 ? 49  LEU A O   1 
ATOM   386  C CB  . LEU A 1 50  ? 29.426 124.562 -43.265 1.00 37.52 ? 49  LEU A CB  1 
ATOM   387  C CG  . LEU A 1 50  ? 30.671 125.298 -42.755 1.00 37.56 ? 49  LEU A CG  1 
ATOM   388  C CD1 . LEU A 1 50  ? 31.770 125.232 -43.805 1.00 37.35 ? 49  LEU A CD1 1 
ATOM   389  C CD2 . LEU A 1 50  ? 30.382 126.751 -42.414 1.00 38.02 ? 49  LEU A CD2 1 
ATOM   390  N N   . ASP A 1 51  ? 26.521 122.995 -42.787 1.00 37.45 ? 50  ASP A N   1 
ATOM   391  C CA  . ASP A 1 51  ? 25.326 122.362 -43.348 1.00 38.22 ? 50  ASP A CA  1 
ATOM   392  C C   . ASP A 1 51  ? 24.110 123.220 -43.014 1.00 38.77 ? 50  ASP A C   1 
ATOM   393  O O   . ASP A 1 51  ? 23.241 123.429 -43.856 1.00 38.68 ? 50  ASP A O   1 
ATOM   394  C CB  . ASP A 1 51  ? 25.119 120.944 -42.805 1.00 37.90 ? 50  ASP A CB  1 
ATOM   395  C CG  . ASP A 1 51  ? 26.087 119.929 -43.401 1.00 38.41 ? 50  ASP A CG  1 
ATOM   396  O OD1 . ASP A 1 51  ? 26.995 120.316 -44.170 1.00 38.17 ? 50  ASP A OD1 1 
ATOM   397  O OD2 . ASP A 1 51  ? 25.931 118.726 -43.094 1.00 38.59 ? 50  ASP A OD2 1 
ATOM   398  N N   . GLN A 1 52  ? 24.065 123.720 -41.781 1.00 39.76 ? 51  GLN A N   1 
ATOM   399  C CA  . GLN A 1 52  ? 22.974 124.584 -41.335 1.00 41.21 ? 51  GLN A CA  1 
ATOM   400  C C   . GLN A 1 52  ? 22.984 125.863 -42.182 1.00 41.72 ? 51  GLN A C   1 
ATOM   401  O O   . GLN A 1 52  ? 21.932 126.348 -42.596 1.00 42.56 ? 51  GLN A O   1 
ATOM   402  C CB  . GLN A 1 52  ? 23.102 124.869 -39.833 1.00 41.88 ? 51  GLN A CB  1 
ATOM   403  C CG  . GLN A 1 52  ? 21.886 125.536 -39.205 1.00 43.41 ? 51  GLN A CG  1 
ATOM   404  C CD  . GLN A 1 52  ? 21.931 125.581 -37.681 1.00 44.05 ? 51  GLN A CD  1 
ATOM   405  O OE1 . GLN A 1 52  ? 21.238 126.386 -37.058 1.00 44.73 ? 51  GLN A OE1 1 
ATOM   406  N NE2 . GLN A 1 52  ? 22.740 124.711 -37.073 1.00 44.01 ? 51  GLN A NE2 1 
ATOM   407  N N   . LEU A 1 53  ? 24.178 126.385 -42.459 1.00 41.61 ? 52  LEU A N   1 
ATOM   408  C CA  . LEU A 1 53  ? 24.336 127.545 -43.336 1.00 41.59 ? 52  LEU A CA  1 
ATOM   409  C C   . LEU A 1 53  ? 23.852 127.213 -44.749 1.00 41.26 ? 52  LEU A C   1 
ATOM   410  O O   . LEU A 1 53  ? 23.107 127.980 -45.347 1.00 41.83 ? 52  LEU A O   1 
ATOM   411  C CB  . LEU A 1 53  ? 25.802 127.988 -43.382 1.00 41.99 ? 52  LEU A CB  1 
ATOM   412  C CG  . LEU A 1 53  ? 26.168 129.121 -44.346 1.00 42.95 ? 52  LEU A CG  1 
ATOM   413  C CD1 . LEU A 1 53  ? 25.369 130.377 -44.046 1.00 43.76 ? 52  LEU A CD1 1 
ATOM   414  C CD2 . LEU A 1 53  ? 27.660 129.405 -44.276 1.00 43.13 ? 52  LEU A CD2 1 
ATOM   415  N N   . ARG A 1 54  ? 24.290 126.070 -45.271 1.00 40.91 ? 53  ARG A N   1 
ATOM   416  C CA  . ARG A 1 54  ? 23.904 125.609 -46.606 1.00 41.27 ? 53  ARG A CA  1 
ATOM   417  C C   . ARG A 1 54  ? 22.395 125.443 -46.735 1.00 42.42 ? 53  ARG A C   1 
ATOM   418  O O   . ARG A 1 54  ? 21.799 125.867 -47.728 1.00 43.03 ? 53  ARG A O   1 
ATOM   419  C CB  . ARG A 1 54  ? 24.573 124.261 -46.905 1.00 40.53 ? 53  ARG A CB  1 
ATOM   420  C CG  . ARG A 1 54  ? 24.139 123.581 -48.207 1.00 40.18 ? 53  ARG A CG  1 
ATOM   421  C CD  . ARG A 1 54  ? 24.528 122.109 -48.204 1.00 39.74 ? 53  ARG A CD  1 
ATOM   422  N NE  . ARG A 1 54  ? 23.850 121.400 -47.121 1.00 39.36 ? 53  ARG A NE  1 
ATOM   423  C CZ  . ARG A 1 54  ? 24.108 120.154 -46.731 1.00 39.49 ? 53  ARG A CZ  1 
ATOM   424  N NH1 . ARG A 1 54  ? 25.052 119.426 -47.323 1.00 39.65 ? 53  ARG A NH1 1 
ATOM   425  N NH2 . ARG A 1 54  ? 23.416 119.632 -45.724 1.00 39.10 ? 53  ARG A NH2 1 
ATOM   426  N N   . ASP A 1 55  ? 21.789 124.818 -45.730 1.00 43.17 ? 54  ASP A N   1 
ATOM   427  C CA  . ASP A 1 55  ? 20.350 124.548 -45.730 1.00 44.38 ? 54  ASP A CA  1 
ATOM   428  C C   . ASP A 1 55  ? 19.476 125.807 -45.700 1.00 45.84 ? 54  ASP A C   1 
ATOM   429  O O   . ASP A 1 55  ? 18.315 125.752 -46.103 1.00 46.82 ? 54  ASP A O   1 
ATOM   430  C CB  . ASP A 1 55  ? 19.984 123.614 -44.568 1.00 44.41 ? 54  ASP A CB  1 
ATOM   431  C CG  . ASP A 1 55  ? 20.593 122.220 -44.716 1.00 44.29 ? 54  ASP A CG  1 
ATOM   432  O OD1 . ASP A 1 55  ? 20.885 121.805 -45.859 1.00 45.02 ? 54  ASP A OD1 1 
ATOM   433  O OD2 . ASP A 1 55  ? 20.773 121.533 -43.688 1.00 43.44 ? 54  ASP A OD2 1 
ATOM   434  N N   . HIS A 1 56  ? 20.025 126.926 -45.225 1.00 46.47 ? 55  HIS A N   1 
ATOM   435  C CA  . HIS A 1 56  ? 19.298 128.199 -45.185 1.00 48.02 ? 55  HIS A CA  1 
ATOM   436  C C   . HIS A 1 56  ? 20.072 129.285 -45.937 1.00 48.43 ? 55  HIS A C   1 
ATOM   437  O O   . HIS A 1 56  ? 20.001 130.464 -45.579 1.00 47.99 ? 55  HIS A O   1 
ATOM   438  C CB  . HIS A 1 56  ? 19.089 128.646 -43.735 1.00 48.69 ? 55  HIS A CB  1 
ATOM   439  C CG  . HIS A 1 56  ? 18.366 127.648 -42.887 1.00 49.75 ? 55  HIS A CG  1 
ATOM   440  N ND1 . HIS A 1 56  ? 16.994 127.519 -42.898 1.00 51.22 ? 55  HIS A ND1 1 
ATOM   441  C CD2 . HIS A 1 56  ? 18.821 126.747 -41.985 1.00 49.91 ? 55  HIS A CD2 1 
ATOM   442  C CE1 . HIS A 1 56  ? 16.636 126.572 -42.049 1.00 51.31 ? 55  HIS A CE1 1 
ATOM   443  N NE2 . HIS A 1 56  ? 17.726 126.088 -41.482 1.00 50.56 ? 55  HIS A NE2 1 
ATOM   444  N N   . LEU A 1 57  ? 20.784 128.895 -46.994 1.00 48.00 ? 56  LEU A N   1 
ATOM   445  C CA  . LEU A 1 57  ? 21.637 129.828 -47.735 1.00 48.34 ? 56  LEU A CA  1 
ATOM   446  C C   . LEU A 1 57  ? 20.922 131.049 -48.333 1.00 49.09 ? 56  LEU A C   1 
ATOM   447  O O   . LEU A 1 57  ? 21.454 132.155 -48.253 1.00 49.08 ? 56  LEU A O   1 
ATOM   448  C CB  . LEU A 1 57  ? 22.425 129.098 -48.832 1.00 48.56 ? 56  LEU A CB  1 
ATOM   449  C CG  . LEU A 1 57  ? 23.498 129.928 -49.548 1.00 49.19 ? 56  LEU A CG  1 
ATOM   450  C CD1 . LEU A 1 57  ? 24.561 130.404 -48.565 1.00 48.73 ? 56  LEU A CD1 1 
ATOM   451  C CD2 . LEU A 1 57  ? 24.132 129.126 -50.674 1.00 49.17 ? 56  LEU A CD2 1 
ATOM   452  N N   . PRO A 1 58  ? 19.729 130.860 -48.934 1.00 49.74 ? 57  PRO A N   1 
ATOM   453  C CA  . PRO A 1 58  ? 19.013 132.002 -49.523 1.00 51.00 ? 57  PRO A CA  1 
ATOM   454  C C   . PRO A 1 58  ? 18.749 133.170 -48.565 1.00 52.20 ? 57  PRO A C   1 
ATOM   455  O O   . PRO A 1 58  ? 18.631 134.310 -49.014 1.00 52.71 ? 57  PRO A O   1 
ATOM   456  C CB  . PRO A 1 58  ? 17.692 131.384 -49.989 1.00 51.09 ? 57  PRO A CB  1 
ATOM   457  C CG  . PRO A 1 58  ? 18.025 129.956 -50.252 1.00 50.34 ? 57  PRO A CG  1 
ATOM   458  C CD  . PRO A 1 58  ? 19.029 129.589 -49.198 1.00 49.47 ? 57  PRO A CD  1 
ATOM   459  N N   . GLU A 1 59  ? 18.660 132.890 -47.266 1.00 53.20 ? 58  GLU A N   1 
ATOM   460  C CA  . GLU A 1 59  ? 18.427 133.932 -46.266 1.00 54.94 ? 58  GLU A CA  1 
ATOM   461  C C   . GLU A 1 59  ? 19.700 134.739 -45.968 1.00 54.94 ? 58  GLU A C   1 
ATOM   462  O O   . GLU A 1 59  ? 19.619 135.857 -45.461 1.00 55.32 ? 58  GLU A O   1 
ATOM   463  C CB  . GLU A 1 59  ? 17.870 133.324 -44.969 1.00 55.55 ? 58  GLU A CB  1 
ATOM   464  C CG  . GLU A 1 59  ? 16.595 132.507 -45.159 1.00 56.80 ? 58  GLU A CG  1 
ATOM   465  C CD  . GLU A 1 59  ? 15.984 132.031 -43.849 1.00 58.06 ? 58  GLU A CD  1 
ATOM   466  O OE1 . GLU A 1 59  ? 15.802 132.857 -42.927 1.00 59.03 ? 58  GLU A OE1 1 
ATOM   467  O OE2 . GLU A 1 59  ? 15.653 130.829 -43.751 1.00 57.84 ? 58  GLU A OE2 1 
ATOM   468  N N   . PHE A 1 60  ? 20.865 134.168 -46.277 1.00 55.19 ? 59  PHE A N   1 
ATOM   469  C CA  . PHE A 1 60  ? 22.156 134.829 -46.050 1.00 55.53 ? 59  PHE A CA  1 
ATOM   470  C C   . PHE A 1 60  ? 22.805 135.385 -47.314 1.00 56.09 ? 59  PHE A C   1 
ATOM   471  O O   . PHE A 1 60  ? 23.542 136.366 -47.238 1.00 56.34 ? 59  PHE A O   1 
ATOM   472  C CB  . PHE A 1 60  ? 23.144 133.864 -45.394 1.00 54.45 ? 59  PHE A CB  1 
ATOM   473  C CG  . PHE A 1 60  ? 22.678 133.325 -44.078 1.00 54.82 ? 59  PHE A CG  1 
ATOM   474  C CD1 . PHE A 1 60  ? 22.688 134.126 -42.947 1.00 54.78 ? 59  PHE A CD1 1 
ATOM   475  C CD2 . PHE A 1 60  ? 22.244 132.012 -43.963 1.00 54.57 ? 59  PHE A CD2 1 
ATOM   476  C CE1 . PHE A 1 60  ? 22.265 133.633 -41.726 1.00 54.84 ? 59  PHE A CE1 1 
ATOM   477  C CE2 . PHE A 1 60  ? 21.820 131.511 -42.744 1.00 54.64 ? 59  PHE A CE2 1 
ATOM   478  C CZ  . PHE A 1 60  ? 21.831 132.323 -41.623 1.00 54.48 ? 59  PHE A CZ  1 
ATOM   479  N N   . GLU A 1 61  ? 22.563 134.752 -48.462 1.00 56.56 ? 60  GLU A N   1 
ATOM   480  C CA  . GLU A 1 61  ? 23.155 135.203 -49.720 1.00 58.46 ? 60  GLU A CA  1 
ATOM   481  C C   . GLU A 1 61  ? 22.055 135.676 -50.670 1.00 58.11 ? 60  GLU A C   1 
ATOM   482  O O   . GLU A 1 61  ? 21.393 134.873 -51.328 1.00 59.06 ? 60  GLU A O   1 
ATOM   483  C CB  . GLU A 1 61  ? 24.008 134.095 -50.345 1.00 59.79 ? 60  GLU A CB  1 
ATOM   484  C CG  . GLU A 1 61  ? 24.946 134.587 -51.440 1.00 62.76 ? 60  GLU A CG  1 
ATOM   485  C CD  . GLU A 1 61  ? 25.938 133.527 -51.894 1.00 64.44 ? 60  GLU A CD  1 
ATOM   486  O OE1 . GLU A 1 61  ? 25.626 132.320 -51.781 1.00 64.40 ? 60  GLU A OE1 1 
ATOM   487  O OE2 . GLU A 1 61  ? 27.032 133.902 -52.374 1.00 66.99 ? 60  GLU A OE2 1 
ATOM   488  N N   . ASN A 1 62  ? 21.867 136.993 -50.711 1.00 57.20 ? 61  ASN A N   1 
ATOM   489  C CA  . ASN A 1 62  ? 20.847 137.629 -51.541 1.00 56.77 ? 61  ASN A CA  1 
ATOM   490  C C   . ASN A 1 62  ? 21.297 139.044 -51.933 1.00 56.79 ? 61  ASN A C   1 
ATOM   491  O O   . ASN A 1 62  ? 22.476 139.369 -51.797 1.00 56.74 ? 61  ASN A O   1 
ATOM   492  C CB  . ASN A 1 62  ? 19.507 137.625 -50.790 1.00 56.81 ? 61  ASN A CB  1 
ATOM   493  C CG  . ASN A 1 62  ? 19.605 138.248 -49.405 1.00 56.58 ? 61  ASN A CG  1 
ATOM   494  O OD1 . ASN A 1 62  ? 20.122 139.352 -49.238 1.00 55.42 ? 61  ASN A OD1 1 
ATOM   495  N ND2 . ASN A 1 62  ? 19.087 137.543 -48.404 1.00 56.89 ? 61  ASN A ND2 1 
ATOM   496  N N   . ASP A 1 63  ? 20.378 139.875 -52.425 1.00 56.48 ? 62  ASP A N   1 
ATOM   497  C CA  . ASP A 1 63  ? 20.713 141.245 -52.836 1.00 56.82 ? 62  ASP A CA  1 
ATOM   498  C C   . ASP A 1 63  ? 21.239 142.118 -51.690 1.00 54.90 ? 62  ASP A C   1 
ATOM   499  O O   . ASP A 1 63  ? 22.034 143.030 -51.920 1.00 54.79 ? 62  ASP A O   1 
ATOM   500  C CB  . ASP A 1 63  ? 19.492 141.939 -53.465 1.00 58.85 ? 62  ASP A CB  1 
ATOM   501  C CG  . ASP A 1 63  ? 19.025 141.276 -54.760 1.00 60.15 ? 62  ASP A CG  1 
ATOM   502  O OD1 . ASP A 1 63  ? 19.639 140.276 -55.196 1.00 60.30 ? 62  ASP A OD1 1 
ATOM   503  O OD2 . ASP A 1 63  ? 18.033 141.763 -55.346 1.00 61.44 ? 62  ASP A OD2 1 
ATOM   504  N N   . ASP A 1 64  ? 20.796 141.833 -50.467 1.00 52.29 ? 63  ASP A N   1 
ATOM   505  C CA  . ASP A 1 64  ? 21.169 142.622 -49.294 1.00 50.98 ? 63  ASP A CA  1 
ATOM   506  C C   . ASP A 1 64  ? 22.243 142.009 -48.397 1.00 47.84 ? 63  ASP A C   1 
ATOM   507  O O   . ASP A 1 64  ? 22.686 142.666 -47.453 1.00 47.45 ? 63  ASP A O   1 
ATOM   508  C CB  . ASP A 1 64  ? 19.921 142.872 -48.440 1.00 51.96 ? 63  ASP A CB  1 
ATOM   509  C CG  . ASP A 1 64  ? 18.835 143.618 -49.192 1.00 53.97 ? 63  ASP A CG  1 
ATOM   510  O OD1 . ASP A 1 64  ? 19.159 144.386 -50.125 1.00 55.14 ? 63  ASP A OD1 1 
ATOM   511  O OD2 . ASP A 1 64  ? 17.651 143.446 -48.832 1.00 54.72 ? 63  ASP A OD2 1 
ATOM   512  N N   . SER A 1 65  ? 22.659 140.770 -48.664 1.00 45.57 ? 64  SER A N   1 
ATOM   513  C CA  A SER A 1 65  ? 23.651 140.102 -47.822 0.50 43.97 ? 64  SER A CA  1 
ATOM   514  C CA  B SER A 1 65  ? 23.675 140.128 -47.835 0.50 43.97 ? 64  SER A CA  1 
ATOM   515  C C   . SER A 1 65  ? 24.460 139.036 -48.556 1.00 42.84 ? 64  SER A C   1 
ATOM   516  O O   . SER A 1 65  ? 23.998 138.463 -49.539 1.00 42.63 ? 64  SER A O   1 
ATOM   517  C CB  A SER A 1 65  ? 22.956 139.444 -46.627 0.50 43.63 ? 64  SER A CB  1 
ATOM   518  C CB  B SER A 1 65  ? 23.035 139.554 -46.571 0.50 43.64 ? 64  SER A CB  1 
ATOM   519  O OG  A SER A 1 65  ? 22.217 140.382 -45.865 0.50 44.44 ? 64  SER A OG  1 
ATOM   520  O OG  B SER A 1 65  ? 22.006 138.637 -46.892 0.50 43.93 ? 64  SER A OG  1 
ATOM   521  N N   . ALA A 1 66  ? 25.660 138.772 -48.045 1.00 41.08 ? 65  ALA A N   1 
ATOM   522  C CA  . ALA A 1 66  ? 26.560 137.750 -48.567 1.00 39.80 ? 65  ALA A CA  1 
ATOM   523  C C   . ALA A 1 66  ? 27.076 136.959 -47.369 1.00 38.49 ? 65  ALA A C   1 
ATOM   524  O O   . ALA A 1 66  ? 27.046 137.453 -46.243 1.00 38.39 ? 65  ALA A O   1 
ATOM   525  C CB  . ALA A 1 66  ? 27.713 138.380 -49.328 1.00 40.06 ? 65  ALA A CB  1 
ATOM   526  N N   . ALA A 1 67  ? 27.541 135.738 -47.607 1.00 37.22 ? 66  ALA A N   1 
ATOM   527  C CA  . ALA A 1 67  ? 28.042 134.884 -46.532 1.00 36.12 ? 66  ALA A CA  1 
ATOM   528  C C   . ALA A 1 67  ? 29.402 134.312 -46.890 1.00 35.39 ? 66  ALA A C   1 
ATOM   529  O O   . ALA A 1 67  ? 29.562 133.712 -47.949 1.00 35.56 ? 66  ALA A O   1 
ATOM   530  C CB  . ALA A 1 67  ? 27.060 133.760 -46.255 1.00 35.84 ? 66  ALA A CB  1 
ATOM   531  N N   . LEU A 1 68  ? 30.371 134.493 -45.996 1.00 34.57 ? 67  LEU A N   1 
ATOM   532  C CA  . LEU A 1 68  ? 31.726 134.001 -46.206 1.00 33.95 ? 67  LEU A CA  1 
ATOM   533  C C   . LEU A 1 68  ? 32.139 133.091 -45.063 1.00 32.56 ? 67  LEU A C   1 
ATOM   534  O O   . LEU A 1 68  ? 32.071 133.482 -43.905 1.00 32.32 ? 67  LEU A O   1 
ATOM   535  C CB  . LEU A 1 68  ? 32.703 135.175 -46.287 1.00 34.53 ? 67  LEU A CB  1 
ATOM   536  C CG  . LEU A 1 68  ? 32.402 136.223 -47.358 1.00 35.23 ? 67  LEU A CG  1 
ATOM   537  C CD1 . LEU A 1 68  ? 33.359 137.397 -47.236 1.00 35.59 ? 67  LEU A CD1 1 
ATOM   538  C CD2 . LEU A 1 68  ? 32.474 135.603 -48.743 1.00 35.66 ? 67  LEU A CD2 1 
ATOM   539  N N   . ALA A 1 69  ? 32.544 131.870 -45.396 1.00 31.56 ? 68  ALA A N   1 
ATOM   540  C CA  . ALA A 1 69  ? 33.041 130.925 -44.409 1.00 30.83 ? 68  ALA A CA  1 
ATOM   541  C C   . ALA A 1 69  ? 34.556 131.033 -44.470 1.00 30.57 ? 68  ALA A C   1 
ATOM   542  O O   . ALA A 1 69  ? 35.114 131.193 -45.553 1.00 30.87 ? 68  ALA A O   1 
ATOM   543  C CB  . ALA A 1 69  ? 32.583 129.513 -44.731 1.00 30.79 ? 68  ALA A CB  1 
ATOM   544  N N   . ILE A 1 70  ? 35.221 130.960 -43.320 1.00 29.98 ? 69  ILE A N   1 
ATOM   545  C CA  . ILE A 1 70  ? 36.674 131.112 -43.269 1.00 29.62 ? 69  ILE A CA  1 
ATOM   546  C C   . ILE A 1 70  ? 37.327 130.109 -42.318 1.00 29.22 ? 69  ILE A C   1 
ATOM   547  O O   . ILE A 1 70  ? 36.824 129.867 -41.221 1.00 28.94 ? 69  ILE A O   1 
ATOM   548  C CB  . ILE A 1 70  ? 37.059 132.541 -42.813 1.00 29.81 ? 69  ILE A CB  1 
ATOM   549  C CG1 . ILE A 1 70  ? 36.344 133.595 -43.673 1.00 30.25 ? 69  ILE A CG1 1 
ATOM   550  C CG2 . ILE A 1 70  ? 38.571 132.733 -42.860 1.00 29.85 ? 69  ILE A CG2 1 
ATOM   551  C CD1 . ILE A 1 70  ? 36.610 135.025 -43.260 1.00 30.57 ? 69  ILE A CD1 1 
ATOM   552  N N   . SER A 1 71  ? 38.439 129.522 -42.756 1.00 29.26 ? 70  SER A N   1 
ATOM   553  C CA  . SER A 1 71  ? 39.230 128.611 -41.924 1.00 29.41 ? 70  SER A CA  1 
ATOM   554  C C   . SER A 1 71  ? 40.670 128.609 -42.418 1.00 29.59 ? 70  SER A C   1 
ATOM   555  O O   . SER A 1 71  ? 40.975 129.185 -43.463 1.00 30.07 ? 70  SER A O   1 
ATOM   556  C CB  . SER A 1 71  ? 38.677 127.186 -41.937 1.00 29.57 ? 70  SER A CB  1 
ATOM   557  O OG  . SER A 1 71  ? 38.953 126.533 -43.162 1.00 30.65 ? 70  SER A OG  1 
ATOM   558  N N   . VAL A 1 72  ? 41.546 127.941 -41.675 1.00 29.69 ? 71  VAL A N   1 
ATOM   559  C CA  . VAL A 1 72  ? 42.972 127.896 -42.019 1.00 30.21 ? 71  VAL A CA  1 
ATOM   560  C C   . VAL A 1 72  ? 43.353 126.921 -43.144 1.00 30.28 ? 71  VAL A C   1 
ATOM   561  O O   . VAL A 1 72  ? 44.503 126.913 -43.580 1.00 30.88 ? 71  VAL A O   1 
ATOM   562  C CB  . VAL A 1 72  ? 43.852 127.624 -40.776 1.00 30.48 ? 71  VAL A CB  1 
ATOM   563  C CG1 . VAL A 1 72  ? 43.631 128.703 -39.728 1.00 30.40 ? 71  VAL A CG1 1 
ATOM   564  C CG2 . VAL A 1 72  ? 43.587 126.242 -40.190 1.00 30.65 ? 71  VAL A CG2 1 
ATOM   565  N N   . GLY A 1 73  ? 42.408 126.113 -43.621 1.00 29.75 ? 72  GLY A N   1 
ATOM   566  C CA  . GLY A 1 73  ? 42.687 125.166 -44.701 1.00 29.60 ? 72  GLY A CA  1 
ATOM   567  C C   . GLY A 1 73  ? 42.912 125.837 -46.052 1.00 30.04 ? 72  GLY A C   1 
ATOM   568  O O   . GLY A 1 73  ? 42.394 126.928 -46.297 1.00 30.03 ? 72  GLY A O   1 
ATOM   569  N N   . PRO A 1 74  ? 43.697 125.194 -46.939 1.00 29.68 ? 73  PRO A N   1 
ATOM   570  C CA  . PRO A 1 74  ? 43.947 125.746 -48.267 1.00 30.09 ? 73  PRO A CA  1 
ATOM   571  C C   . PRO A 1 74  ? 42.789 125.455 -49.236 1.00 30.03 ? 73  PRO A C   1 
ATOM   572  O O   . PRO A 1 74  ? 41.952 124.605 -48.947 1.00 29.46 ? 73  PRO A O   1 
ATOM   573  C CB  . PRO A 1 74  ? 45.225 125.029 -48.700 1.00 30.40 ? 73  PRO A CB  1 
ATOM   574  C CG  . PRO A 1 74  ? 45.129 123.700 -48.041 1.00 30.16 ? 73  PRO A CG  1 
ATOM   575  C CD  . PRO A 1 74  ? 44.432 123.936 -46.728 1.00 29.72 ? 73  PRO A CD  1 
ATOM   576  N N   . PRO A 1 75  ? 42.749 126.151 -50.387 1.00 30.91 ? 74  PRO A N   1 
ATOM   577  C CA  . PRO A 1 75  ? 41.664 125.996 -51.375 1.00 31.26 ? 74  PRO A CA  1 
ATOM   578  C C   . PRO A 1 75  ? 41.347 124.569 -51.861 1.00 31.64 ? 74  PRO A C   1 
ATOM   579  O O   . PRO A 1 75  ? 40.168 124.229 -51.981 1.00 31.80 ? 74  PRO A O   1 
ATOM   580  C CB  . PRO A 1 75  ? 42.117 126.880 -52.541 1.00 31.65 ? 74  PRO A CB  1 
ATOM   581  C CG  . PRO A 1 75  ? 43.021 127.890 -51.923 1.00 31.61 ? 74  PRO A CG  1 
ATOM   582  C CD  . PRO A 1 75  ? 43.719 127.184 -50.799 1.00 31.25 ? 74  PRO A CD  1 
ATOM   583  N N   . PRO A 1 76  ? 42.374 123.743 -52.148 1.00 32.30 ? 75  PRO A N   1 
ATOM   584  C CA  . PRO A 1 76  ? 42.074 122.376 -52.607 1.00 32.56 ? 75  PRO A CA  1 
ATOM   585  C C   . PRO A 1 76  ? 41.264 121.580 -51.582 1.00 32.61 ? 75  PRO A C   1 
ATOM   586  O O   . PRO A 1 76  ? 40.401 120.782 -51.953 1.00 32.23 ? 75  PRO A O   1 
ATOM   587  C CB  . PRO A 1 76  ? 43.461 121.756 -52.803 1.00 32.81 ? 75  PRO A CB  1 
ATOM   588  C CG  . PRO A 1 76  ? 44.376 122.917 -53.001 1.00 33.04 ? 75  PRO A CG  1 
ATOM   589  C CD  . PRO A 1 76  ? 43.826 123.995 -52.114 1.00 32.68 ? 75  PRO A CD  1 
ATOM   590  N N   . THR A 1 77  ? 41.560 121.806 -50.306 1.00 32.90 ? 76  THR A N   1 
ATOM   591  C CA  . THR A 1 77  ? 40.845 121.179 -49.207 1.00 33.15 ? 76  THR A CA  1 
ATOM   592  C C   . THR A 1 77  ? 39.391 121.624 -49.208 1.00 33.00 ? 76  THR A C   1 
ATOM   593  O O   . THR A 1 77  ? 38.484 120.794 -49.160 1.00 32.32 ? 76  THR A O   1 
ATOM   594  C CB  . THR A 1 77  ? 41.477 121.566 -47.859 1.00 33.53 ? 76  THR A CB  1 
ATOM   595  O OG1 . THR A 1 77  ? 42.795 121.012 -47.779 1.00 34.83 ? 76  THR A OG1 1 
ATOM   596  C CG2 . THR A 1 77  ? 40.637 121.072 -46.687 1.00 33.25 ? 76  THR A CG2 1 
ATOM   597  N N   . HIS A 1 78  ? 39.180 122.937 -49.262 1.00 33.54 ? 77  HIS A N   1 
ATOM   598  C CA  . HIS A 1 78  ? 37.827 123.485 -49.270 1.00 34.08 ? 77  HIS A CA  1 
ATOM   599  C C   . HIS A 1 78  ? 37.069 123.106 -50.526 1.00 34.49 ? 77  HIS A C   1 
ATOM   600  O O   . HIS A 1 78  ? 35.857 122.924 -50.482 1.00 34.35 ? 77  HIS A O   1 
ATOM   601  C CB  . HIS A 1 78  ? 37.823 125.006 -49.146 1.00 34.01 ? 77  HIS A CB  1 
ATOM   602  C CG  . HIS A 1 78  ? 38.315 125.507 -47.830 1.00 33.93 ? 77  HIS A CG  1 
ATOM   603  N ND1 . HIS A 1 78  ? 39.079 126.646 -47.707 1.00 34.25 ? 77  HIS A ND1 1 
ATOM   604  C CD2 . HIS A 1 78  ? 38.173 125.011 -46.579 1.00 33.95 ? 77  HIS A CD2 1 
ATOM   605  C CE1 . HIS A 1 78  ? 39.363 126.846 -46.433 1.00 34.31 ? 77  HIS A CE1 1 
ATOM   606  N NE2 . HIS A 1 78  ? 38.831 125.864 -45.728 1.00 34.03 ? 77  HIS A NE2 1 
ATOM   607  N N   . LYS A 1 79  ? 37.782 123.009 -51.643 1.00 35.53 ? 78  LYS A N   1 
ATOM   608  C CA  . LYS A 1 79  ? 37.165 122.644 -52.905 1.00 36.69 ? 78  LYS A CA  1 
ATOM   609  C C   . LYS A 1 79  ? 36.526 121.269 -52.800 1.00 36.10 ? 78  LYS A C   1 
ATOM   610  O O   . LYS A 1 79  ? 35.331 121.111 -53.051 1.00 35.36 ? 78  LYS A O   1 
ATOM   611  C CB  . LYS A 1 79  ? 38.198 122.674 -54.033 1.00 38.23 ? 78  LYS A CB  1 
ATOM   612  C CG  . LYS A 1 79  ? 37.652 122.301 -55.405 1.00 40.08 ? 78  LYS A CG  1 
ATOM   613  C CD  . LYS A 1 79  ? 36.398 123.097 -55.731 1.00 41.25 ? 78  LYS A CD  1 
ATOM   614  C CE  . LYS A 1 79  ? 35.952 122.904 -57.170 1.00 42.65 ? 78  LYS A CE  1 
ATOM   615  N NZ  . LYS A 1 79  ? 34.696 123.661 -57.438 1.00 43.10 ? 78  LYS A NZ  1 
ATOM   616  N N   . ILE A 1 80  ? 37.330 120.289 -52.402 1.00 35.84 ? 79  ILE A N   1 
ATOM   617  C CA  . ILE A 1 80  ? 36.865 118.912 -52.255 1.00 35.81 ? 79  ILE A CA  1 
ATOM   618  C C   . ILE A 1 80  ? 35.722 118.814 -51.245 1.00 35.00 ? 79  ILE A C   1 
ATOM   619  O O   . ILE A 1 80  ? 34.716 118.150 -51.500 1.00 34.62 ? 79  ILE A O   1 
ATOM   620  C CB  . ILE A 1 80  ? 38.026 117.978 -51.833 1.00 36.13 ? 79  ILE A CB  1 
ATOM   621  C CG1 . ILE A 1 80  ? 39.043 117.830 -52.976 1.00 37.09 ? 79  ILE A CG1 1 
ATOM   622  C CG2 . ILE A 1 80  ? 37.514 116.599 -51.428 1.00 36.07 ? 79  ILE A CG2 1 
ATOM   623  C CD1 . ILE A 1 80  ? 38.549 117.033 -54.172 1.00 37.75 ? 79  ILE A CD1 1 
ATOM   624  N N   . TRP A 1 81  ? 35.878 119.487 -50.110 1.00 34.32 ? 80  TRP A N   1 
ATOM   625  C CA  . TRP A 1 81  ? 34.871 119.448 -49.054 1.00 34.48 ? 80  TRP A CA  1 
ATOM   626  C C   . TRP A 1 81  ? 33.563 120.104 -49.493 1.00 34.53 ? 80  TRP A C   1 
ATOM   627  O O   . TRP A 1 81  ? 32.483 119.613 -49.166 1.00 34.17 ? 80  TRP A O   1 
ATOM   628  C CB  . TRP A 1 81  ? 35.414 120.096 -47.778 1.00 34.10 ? 80  TRP A CB  1 
ATOM   629  C CG  . TRP A 1 81  ? 34.549 119.886 -46.576 1.00 33.86 ? 80  TRP A CG  1 
ATOM   630  C CD1 . TRP A 1 81  ? 33.985 118.712 -46.167 1.00 33.53 ? 80  TRP A CD1 1 
ATOM   631  C CD2 . TRP A 1 81  ? 34.221 120.856 -45.575 1.00 33.55 ? 80  TRP A CD2 1 
ATOM   632  N NE1 . TRP A 1 81  ? 33.290 118.900 -44.999 1.00 33.21 ? 80  TRP A NE1 1 
ATOM   633  C CE2 . TRP A 1 81  ? 33.417 120.208 -44.613 1.00 33.27 ? 80  TRP A CE2 1 
ATOM   634  C CE3 . TRP A 1 81  ? 34.510 122.215 -45.408 1.00 33.67 ? 80  TRP A CE3 1 
ATOM   635  C CZ2 . TRP A 1 81  ? 32.907 120.871 -43.495 1.00 33.19 ? 80  TRP A CZ2 1 
ATOM   636  C CZ3 . TRP A 1 81  ? 34.001 122.872 -44.301 1.00 33.15 ? 80  TRP A CZ3 1 
ATOM   637  C CH2 . TRP A 1 81  ? 33.207 122.200 -43.359 1.00 32.97 ? 80  TRP A CH2 1 
ATOM   638  N N   . ALA A 1 82  ? 33.671 121.201 -50.240 1.00 35.36 ? 81  ALA A N   1 
ATOM   639  C CA  . ALA A 1 82  ? 32.499 121.911 -50.751 1.00 36.56 ? 81  ALA A CA  1 
ATOM   640  C C   . ALA A 1 82  ? 31.738 121.045 -51.749 1.00 37.48 ? 81  ALA A C   1 
ATOM   641  O O   . ALA A 1 82  ? 30.508 121.034 -51.759 1.00 38.05 ? 81  ALA A O   1 
ATOM   642  C CB  . ALA A 1 82  ? 32.911 123.224 -51.397 1.00 36.48 ? 81  ALA A CB  1 
ATOM   643  N N   . THR A 1 83  ? 32.483 120.328 -52.586 1.00 39.02 ? 82  THR A N   1 
ATOM   644  C CA  . THR A 1 83  ? 31.914 119.425 -53.582 1.00 39.74 ? 82  THR A CA  1 
ATOM   645  C C   . THR A 1 83  ? 31.181 118.260 -52.908 1.00 40.33 ? 82  THR A C   1 
ATOM   646  O O   . THR A 1 83  ? 30.097 117.874 -53.343 1.00 40.55 ? 82  THR A O   1 
ATOM   647  C CB  . THR A 1 83  ? 33.017 118.882 -54.515 1.00 40.13 ? 82  THR A CB  1 
ATOM   648  O OG1 . THR A 1 83  ? 33.656 119.976 -55.186 1.00 40.65 ? 82  THR A OG1 1 
ATOM   649  C CG2 . THR A 1 83  ? 32.446 117.917 -55.552 1.00 40.35 ? 82  THR A CG2 1 
ATOM   650  N N   . GLN A 1 84  ? 31.781 117.707 -51.854 1.00 41.23 ? 83  GLN A N   1 
ATOM   651  C CA  . GLN A 1 84  ? 31.178 116.603 -51.099 1.00 42.16 ? 83  GLN A CA  1 
ATOM   652  C C   . GLN A 1 84  ? 29.983 117.026 -50.255 1.00 41.53 ? 83  GLN A C   1 
ATOM   653  O O   . GLN A 1 84  ? 29.067 116.236 -50.048 1.00 42.29 ? 83  GLN A O   1 
ATOM   654  C CB  . GLN A 1 84  ? 32.195 115.951 -50.161 1.00 43.32 ? 83  GLN A CB  1 
ATOM   655  C CG  . GLN A 1 84  ? 33.248 115.104 -50.851 1.00 45.40 ? 83  GLN A CG  1 
ATOM   656  C CD  . GLN A 1 84  ? 34.226 114.485 -49.866 1.00 46.56 ? 83  GLN A CD  1 
ATOM   657  O OE1 . GLN A 1 84  ? 34.241 114.825 -48.678 1.00 48.08 ? 83  GLN A OE1 1 
ATOM   658  N NE2 . GLN A 1 84  ? 35.056 113.576 -50.358 1.00 47.03 ? 83  GLN A NE2 1 
ATOM   659  N N   . SER A 1 85  ? 30.009 118.255 -49.750 1.00 40.59 ? 84  SER A N   1 
ATOM   660  C CA  . SER A 1 85  ? 28.939 118.757 -48.895 1.00 40.04 ? 84  SER A CA  1 
ATOM   661  C C   . SER A 1 85  ? 27.901 119.597 -49.636 1.00 39.64 ? 84  SER A C   1 
ATOM   662  O O   . SER A 1 85  ? 26.862 119.934 -49.071 1.00 39.42 ? 84  SER A O   1 
ATOM   663  C CB  . SER A 1 85  ? 29.539 119.585 -47.765 1.00 39.60 ? 84  SER A CB  1 
ATOM   664  O OG  . SER A 1 85  ? 30.442 118.811 -46.995 1.00 39.58 ? 84  SER A OG  1 
ATOM   665  N N   . GLY A 1 86  ? 28.177 119.936 -50.890 1.00 39.35 ? 85  GLY A N   1 
ATOM   666  C CA  . GLY A 1 86  ? 27.264 120.760 -51.672 1.00 38.96 ? 85  GLY A CA  1 
ATOM   667  C C   . GLY A 1 86  ? 27.259 122.218 -51.239 1.00 38.55 ? 85  GLY A C   1 
ATOM   668  O O   . GLY A 1 86  ? 26.208 122.861 -51.252 1.00 38.93 ? 85  GLY A O   1 
ATOM   669  N N   . PHE A 1 87  ? 28.423 122.739 -50.845 1.00 37.14 ? 86  PHE A N   1 
ATOM   670  C CA  . PHE A 1 87  ? 28.541 124.146 -50.459 1.00 36.81 ? 86  PHE A CA  1 
ATOM   671  C C   . PHE A 1 87  ? 28.795 124.990 -51.705 1.00 36.94 ? 86  PHE A C   1 
ATOM   672  O O   . PHE A 1 87  ? 29.773 124.762 -52.419 1.00 37.60 ? 86  PHE A O   1 
ATOM   673  C CB  . PHE A 1 87  ? 29.688 124.392 -49.466 1.00 36.21 ? 86  PHE A CB  1 
ATOM   674  C CG  . PHE A 1 87  ? 29.613 123.579 -48.198 1.00 35.38 ? 86  PHE A CG  1 
ATOM   675  C CD1 . PHE A 1 87  ? 28.406 123.365 -47.543 1.00 35.18 ? 86  PHE A CD1 1 
ATOM   676  C CD2 . PHE A 1 87  ? 30.778 123.110 -47.606 1.00 35.24 ? 86  PHE A CD2 1 
ATOM   677  C CE1 . PHE A 1 87  ? 28.358 122.642 -46.362 1.00 34.75 ? 86  PHE A CE1 1 
ATOM   678  C CE2 . PHE A 1 87  ? 30.738 122.398 -46.419 1.00 35.05 ? 86  PHE A CE2 1 
ATOM   679  C CZ  . PHE A 1 87  ? 29.526 122.165 -45.796 1.00 34.73 ? 86  PHE A CZ  1 
ATOM   680  N N   . THR A 1 88  ? 27.917 125.958 -51.956 1.00 36.80 ? 87  THR A N   1 
ATOM   681  C CA  . THR A 1 88  ? 28.028 126.858 -53.109 1.00 37.38 ? 87  THR A CA  1 
ATOM   682  C C   . THR A 1 88  ? 28.462 128.277 -52.720 1.00 37.72 ? 87  THR A C   1 
ATOM   683  O O   . THR A 1 88  ? 28.638 129.132 -53.586 1.00 38.20 ? 87  THR A O   1 
ATOM   684  C CB  . THR A 1 88  ? 26.689 126.944 -53.864 1.00 37.95 ? 87  THR A CB  1 
ATOM   685  O OG1 . THR A 1 88  ? 25.651 127.344 -52.959 1.00 37.71 ? 87  THR A OG1 1 
ATOM   686  C CG2 . THR A 1 88  ? 26.337 125.593 -54.470 1.00 37.90 ? 87  THR A CG2 1 
ATOM   687  N N   . PHE A 1 89  ? 28.627 128.516 -51.420 1.00 37.16 ? 88  PHE A N   1 
ATOM   688  C CA  . PHE A 1 89  ? 29.075 129.812 -50.898 1.00 37.05 ? 88  PHE A CA  1 
ATOM   689  C C   . PHE A 1 89  ? 30.603 129.794 -50.810 1.00 36.32 ? 88  PHE A C   1 
ATOM   690  O O   . PHE A 1 89  ? 31.207 128.720 -50.837 1.00 35.57 ? 88  PHE A O   1 
ATOM   691  C CB  . PHE A 1 89  ? 28.454 130.099 -49.525 1.00 36.95 ? 88  PHE A CB  1 
ATOM   692  C CG  . PHE A 1 89  ? 28.526 128.938 -48.574 1.00 36.85 ? 88  PHE A CG  1 
ATOM   693  C CD1 . PHE A 1 89  ? 27.468 128.040 -48.477 1.00 36.76 ? 88  PHE A CD1 1 
ATOM   694  C CD2 . PHE A 1 89  ? 29.652 128.726 -47.795 1.00 36.76 ? 88  PHE A CD2 1 
ATOM   695  C CE1 . PHE A 1 89  ? 27.532 126.957 -47.619 1.00 36.31 ? 88  PHE A CE1 1 
ATOM   696  C CE2 . PHE A 1 89  ? 29.719 127.645 -46.931 1.00 36.25 ? 88  PHE A CE2 1 
ATOM   697  C CZ  . PHE A 1 89  ? 28.658 126.759 -46.845 1.00 36.10 ? 88  PHE A CZ  1 
ATOM   698  N N   . PRO A 1 90  ? 31.238 130.975 -50.706 1.00 35.80 ? 89  PRO A N   1 
ATOM   699  C CA  . PRO A 1 90  ? 32.701 130.973 -50.655 1.00 35.42 ? 89  PRO A CA  1 
ATOM   700  C C   . PRO A 1 90  ? 33.305 130.517 -49.323 1.00 34.68 ? 89  PRO A C   1 
ATOM   701  O O   . PRO A 1 90  ? 32.911 131.009 -48.265 1.00 34.66 ? 89  PRO A O   1 
ATOM   702  C CB  . PRO A 1 90  ? 33.070 132.444 -50.924 1.00 36.07 ? 89  PRO A CB  1 
ATOM   703  C CG  . PRO A 1 90  ? 31.831 133.087 -51.456 1.00 36.44 ? 89  PRO A CG  1 
ATOM   704  C CD  . PRO A 1 90  ? 30.702 132.342 -50.815 1.00 36.12 ? 89  PRO A CD  1 
ATOM   705  N N   . LEU A 1 91  ? 34.226 129.556 -49.395 1.00 33.93 ? 90  LEU A N   1 
ATOM   706  C CA  . LEU A 1 91  ? 35.000 129.105 -48.241 1.00 33.09 ? 90  LEU A CA  1 
ATOM   707  C C   . LEU A 1 91  ? 36.385 129.690 -48.472 1.00 32.59 ? 90  LEU A C   1 
ATOM   708  O O   . LEU A 1 91  ? 37.076 129.284 -49.404 1.00 32.66 ? 90  LEU A O   1 
ATOM   709  C CB  . LEU A 1 91  ? 35.078 127.580 -48.138 1.00 33.19 ? 90  LEU A CB  1 
ATOM   710  C CG  . LEU A 1 91  ? 33.842 126.821 -47.653 1.00 33.72 ? 90  LEU A CG  1 
ATOM   711  C CD1 . LEU A 1 91  ? 32.688 126.943 -48.635 1.00 34.46 ? 90  LEU A CD1 1 
ATOM   712  C CD2 . LEU A 1 91  ? 34.189 125.356 -47.436 1.00 33.99 ? 90  LEU A CD2 1 
ATOM   713  N N   . LEU A 1 92  ? 36.783 130.642 -47.632 1.00 31.77 ? 91  LEU A N   1 
ATOM   714  C CA  . LEU A 1 92  ? 38.055 131.342 -47.797 1.00 31.27 ? 91  LEU A CA  1 
ATOM   715  C C   . LEU A 1 92  ? 39.188 130.709 -46.998 1.00 30.75 ? 91  LEU A C   1 
ATOM   716  O O   . LEU A 1 92  ? 38.974 130.175 -45.910 1.00 30.53 ? 91  LEU A O   1 
ATOM   717  C CB  . LEU A 1 92  ? 37.892 132.813 -47.406 1.00 31.17 ? 91  LEU A CB  1 
ATOM   718  C CG  . LEU A 1 92  ? 36.703 133.523 -48.060 1.00 31.27 ? 91  LEU A CG  1 
ATOM   719  C CD1 . LEU A 1 92  ? 36.667 134.989 -47.664 1.00 31.45 ? 91  LEU A CD1 1 
ATOM   720  C CD2 . LEU A 1 92  ? 36.743 133.376 -49.574 1.00 31.61 ? 91  LEU A CD2 1 
ATOM   721  N N   . SER A 1 93  ? 40.396 130.798 -47.544 1.00 30.82 ? 92  SER A N   1 
ATOM   722  C CA  . SER A 1 93  ? 41.578 130.213 -46.925 1.00 30.99 ? 92  SER A CA  1 
ATOM   723  C C   . SER A 1 93  ? 42.416 131.227 -46.158 1.00 31.05 ? 92  SER A C   1 
ATOM   724  O O   . SER A 1 93  ? 43.011 132.123 -46.743 1.00 31.37 ? 92  SER A O   1 
ATOM   725  C CB  . SER A 1 93  ? 42.447 129.539 -47.990 1.00 31.12 ? 92  SER A CB  1 
ATOM   726  O OG  . SER A 1 93  ? 41.754 128.455 -48.581 1.00 30.87 ? 92  SER A OG  1 
ATOM   727  N N   . ASP A 1 94  ? 42.460 131.057 -44.842 1.00 31.35 ? 93  ASP A N   1 
ATOM   728  C CA  . ASP A 1 94  ? 43.265 131.879 -43.943 1.00 31.83 ? 93  ASP A CA  1 
ATOM   729  C C   . ASP A 1 94  ? 44.499 131.011 -43.673 1.00 31.54 ? 93  ASP A C   1 
ATOM   730  O O   . ASP A 1 94  ? 44.894 130.792 -42.526 1.00 31.95 ? 93  ASP A O   1 
ATOM   731  C CB  . ASP A 1 94  ? 42.446 132.130 -42.671 1.00 32.17 ? 93  ASP A CB  1 
ATOM   732  C CG  . ASP A 1 94  ? 43.094 133.116 -41.718 1.00 32.83 ? 93  ASP A CG  1 
ATOM   733  O OD1 . ASP A 1 94  ? 44.067 133.798 -42.100 1.00 33.75 ? 93  ASP A OD1 1 
ATOM   734  O OD2 . ASP A 1 94  ? 42.599 133.221 -40.573 1.00 32.80 ? 93  ASP A OD2 1 
ATOM   735  N N   . PHE A 1 95  ? 45.116 130.554 -44.764 1.00 31.40 ? 94  PHE A N   1 
ATOM   736  C CA  . PHE A 1 95  ? 46.183 129.548 -44.741 1.00 30.82 ? 94  PHE A CA  1 
ATOM   737  C C   . PHE A 1 95  ? 47.611 130.046 -44.541 1.00 31.52 ? 94  PHE A C   1 
ATOM   738  O O   . PHE A 1 95  ? 48.365 129.455 -43.765 1.00 31.24 ? 94  PHE A O   1 
ATOM   739  C CB  . PHE A 1 95  ? 46.096 128.734 -46.042 1.00 30.65 ? 94  PHE A CB  1 
ATOM   740  C CG  . PHE A 1 95  ? 47.173 127.696 -46.197 1.00 30.49 ? 94  PHE A CG  1 
ATOM   741  C CD1 . PHE A 1 95  ? 47.101 126.491 -45.513 1.00 29.93 ? 94  PHE A CD1 1 
ATOM   742  C CD2 . PHE A 1 95  ? 48.244 127.911 -47.056 1.00 30.73 ? 94  PHE A CD2 1 
ATOM   743  C CE1 . PHE A 1 95  ? 48.084 125.527 -45.666 1.00 30.01 ? 94  PHE A CE1 1 
ATOM   744  C CE2 . PHE A 1 95  ? 49.230 126.951 -47.211 1.00 30.84 ? 94  PHE A CE2 1 
ATOM   745  C CZ  . PHE A 1 95  ? 49.150 125.758 -46.515 1.00 30.49 ? 94  PHE A CZ  1 
ATOM   746  N N   . TRP A 1 96  ? 47.989 131.106 -45.246 1.00 31.99 ? 95  TRP A N   1 
ATOM   747  C CA  . TRP A 1 96  ? 49.348 131.619 -45.160 1.00 32.68 ? 95  TRP A CA  1 
ATOM   748  C C   . TRP A 1 96  ? 49.361 133.126 -45.422 1.00 33.61 ? 95  TRP A C   1 
ATOM   749  O O   . TRP A 1 96  ? 49.057 133.544 -46.537 1.00 34.17 ? 95  TRP A O   1 
ATOM   750  C CB  . TRP A 1 96  ? 50.221 130.877 -46.172 1.00 32.79 ? 95  TRP A CB  1 
ATOM   751  C CG  . TRP A 1 96  ? 51.677 131.081 -45.977 1.00 33.00 ? 95  TRP A CG  1 
ATOM   752  C CD1 . TRP A 1 96  ? 52.543 131.677 -46.842 1.00 33.39 ? 95  TRP A CD1 1 
ATOM   753  C CD2 . TRP A 1 96  ? 52.446 130.705 -44.830 1.00 32.78 ? 95  TRP A CD2 1 
ATOM   754  N NE1 . TRP A 1 96  ? 53.809 131.683 -46.313 1.00 33.64 ? 95  TRP A NE1 1 
ATOM   755  C CE2 . TRP A 1 96  ? 53.779 131.094 -45.077 1.00 33.29 ? 95  TRP A CE2 1 
ATOM   756  C CE3 . TRP A 1 96  ? 52.138 130.071 -43.620 1.00 32.36 ? 95  TRP A CE3 1 
ATOM   757  C CZ2 . TRP A 1 96  ? 54.806 130.871 -44.158 1.00 33.45 ? 95  TRP A CZ2 1 
ATOM   758  C CZ3 . TRP A 1 96  ? 53.160 129.851 -42.704 1.00 32.67 ? 95  TRP A CZ3 1 
ATOM   759  C CH2 . TRP A 1 96  ? 54.477 130.251 -42.979 1.00 33.21 ? 95  TRP A CH2 1 
ATOM   760  N N   . PRO A 1 97  ? 49.686 133.948 -44.417 1.00 34.48 ? 96  PRO A N   1 
ATOM   761  C CA  . PRO A 1 97  ? 50.045 133.507 -43.057 1.00 34.64 ? 96  PRO A CA  1 
ATOM   762  C C   . PRO A 1 97  ? 48.950 132.708 -42.345 1.00 34.47 ? 96  PRO A C   1 
ATOM   763  O O   . PRO A 1 97  ? 47.762 132.918 -42.584 1.00 34.84 ? 96  PRO A O   1 
ATOM   764  C CB  . PRO A 1 97  ? 50.338 134.820 -42.313 1.00 34.96 ? 96  PRO A CB  1 
ATOM   765  C CG  . PRO A 1 97  ? 49.984 135.928 -43.252 1.00 35.10 ? 96  PRO A CG  1 
ATOM   766  C CD  . PRO A 1 97  ? 50.009 135.365 -44.635 1.00 34.85 ? 96  PRO A CD  1 
ATOM   767  N N   . HIS A 1 98  ? 49.374 131.796 -41.476 1.00 34.54 ? 97  HIS A N   1 
ATOM   768  C CA  . HIS A 1 98  ? 48.472 130.886 -40.782 1.00 34.18 ? 97  HIS A CA  1 
ATOM   769  C C   . HIS A 1 98  ? 47.592 131.563 -39.736 1.00 33.92 ? 97  HIS A C   1 
ATOM   770  O O   . HIS A 1 98  ? 48.075 131.976 -38.681 1.00 33.73 ? 97  HIS A O   1 
ATOM   771  C CB  . HIS A 1 98  ? 49.284 129.777 -40.116 1.00 34.63 ? 97  HIS A CB  1 
ATOM   772  C CG  . HIS A 1 98  ? 48.452 128.680 -39.533 1.00 34.67 ? 97  HIS A CG  1 
ATOM   773  N ND1 . HIS A 1 98  ? 48.353 127.437 -40.116 1.00 35.02 ? 97  HIS A ND1 1 
ATOM   774  C CD2 . HIS A 1 98  ? 47.675 128.638 -38.426 1.00 34.72 ? 97  HIS A CD2 1 
ATOM   775  C CE1 . HIS A 1 98  ? 47.562 126.670 -39.388 1.00 34.65 ? 97  HIS A CE1 1 
ATOM   776  N NE2 . HIS A 1 98  ? 47.133 127.377 -38.359 1.00 34.68 ? 97  HIS A NE2 1 
ATOM   777  N N   . GLY A 1 99  ? 46.299 131.653 -40.037 1.00 33.49 ? 98  GLY A N   1 
ATOM   778  C CA  . GLY A 1 99  ? 45.322 132.223 -39.121 1.00 33.65 ? 98  GLY A CA  1 
ATOM   779  C C   . GLY A 1 99  ? 45.387 133.726 -38.910 1.00 33.82 ? 98  GLY A C   1 
ATOM   780  O O   . GLY A 1 99  ? 44.822 134.226 -37.943 1.00 34.63 ? 98  GLY A O   1 
ATOM   781  N N   . ALA A 1 100 ? 46.045 134.452 -39.811 1.00 33.91 ? 99  ALA A N   1 
ATOM   782  C CA  . ALA A 1 100 ? 46.191 135.909 -39.679 1.00 33.84 ? 99  ALA A CA  1 
ATOM   783  C C   . ALA A 1 100 ? 44.852 136.623 -39.547 1.00 33.74 ? 99  ALA A C   1 
ATOM   784  O O   . ALA A 1 100 ? 44.644 137.403 -38.618 1.00 33.68 ? 99  ALA A O   1 
ATOM   785  C CB  . ALA A 1 100 ? 46.960 136.473 -40.861 1.00 34.22 ? 99  ALA A CB  1 
ATOM   786  N N   . VAL A 1 101 ? 43.950 136.355 -40.484 1.00 33.60 ? 100 VAL A N   1 
ATOM   787  C CA  . VAL A 1 101 ? 42.625 136.972 -40.468 1.00 33.45 ? 100 VAL A CA  1 
ATOM   788  C C   . VAL A 1 101 ? 41.880 136.577 -39.192 1.00 32.99 ? 100 VAL A C   1 
ATOM   789  O O   . VAL A 1 101 ? 41.256 137.419 -38.548 1.00 32.83 ? 100 VAL A O   1 
ATOM   790  C CB  . VAL A 1 101 ? 41.812 136.605 -41.726 1.00 33.30 ? 100 VAL A CB  1 
ATOM   791  C CG1 . VAL A 1 101 ? 40.383 137.123 -41.624 1.00 33.29 ? 100 VAL A CG1 1 
ATOM   792  C CG2 . VAL A 1 101 ? 42.496 137.166 -42.966 1.00 33.82 ? 100 VAL A CG2 1 
ATOM   793  N N   . SER A 1 102 ? 41.970 135.304 -38.821 1.00 32.45 ? 101 SER A N   1 
ATOM   794  C CA  . SER A 1 102 ? 41.341 134.810 -37.601 1.00 32.25 ? 101 SER A CA  1 
ATOM   795  C C   . SER A 1 102 ? 41.892 135.503 -36.353 1.00 32.63 ? 101 SER A C   1 
ATOM   796  O O   . SER A 1 102 ? 41.135 135.807 -35.431 1.00 32.62 ? 101 SER A O   1 
ATOM   797  C CB  . SER A 1 102 ? 41.524 133.297 -37.485 1.00 32.12 ? 101 SER A CB  1 
ATOM   798  O OG  . SER A 1 102 ? 40.910 132.635 -38.576 1.00 31.99 ? 101 SER A OG  1 
ATOM   799  N N   . GLN A 1 103 ? 43.202 135.750 -36.326 1.00 33.23 ? 102 GLN A N   1 
ATOM   800  C CA  . GLN A 1 103 ? 43.840 136.429 -35.195 1.00 34.01 ? 102 GLN A CA  1 
ATOM   801  C C   . GLN A 1 103 ? 43.397 137.891 -35.128 1.00 33.85 ? 102 GLN A C   1 
ATOM   802  O O   . GLN A 1 103 ? 43.231 138.440 -34.039 1.00 34.24 ? 102 GLN A O   1 
ATOM   803  C CB  . GLN A 1 103 ? 45.367 136.348 -35.288 1.00 35.53 ? 102 GLN A CB  1 
ATOM   804  C CG  . GLN A 1 103 ? 45.939 134.943 -35.163 1.00 36.24 ? 102 GLN A CG  1 
ATOM   805  C CD  . GLN A 1 103 ? 47.423 134.884 -35.502 1.00 37.87 ? 102 GLN A CD  1 
ATOM   806  O OE1 . GLN A 1 103 ? 48.237 135.588 -34.905 1.00 39.47 ? 102 GLN A OE1 1 
ATOM   807  N NE2 . GLN A 1 103 ? 47.782 134.027 -36.453 1.00 38.12 ? 102 GLN A NE2 1 
ATOM   808  N N   . ALA A 1 104 ? 43.198 138.509 -36.291 1.00 33.39 ? 103 ALA A N   1 
ATOM   809  C CA  . ALA A 1 104 ? 42.738 139.900 -36.372 1.00 33.32 ? 103 ALA A CA  1 
ATOM   810  C C   . ALA A 1 104 ? 41.314 140.058 -35.831 1.00 33.12 ? 103 ALA A C   1 
ATOM   811  O O   . ALA A 1 104 ? 40.979 141.100 -35.277 1.00 33.41 ? 103 ALA A O   1 
ATOM   812  C CB  . ALA A 1 104 ? 42.821 140.410 -37.803 1.00 33.26 ? 103 ALA A CB  1 
ATOM   813  N N   . TYR A 1 105 ? 40.481 139.032 -36.003 1.00 32.51 ? 104 TYR A N   1 
ATOM   814  C CA  . TYR A 1 105 ? 39.114 139.044 -35.471 1.00 32.43 ? 104 TYR A CA  1 
ATOM   815  C C   . TYR A 1 105 ? 39.048 138.516 -34.033 1.00 32.85 ? 104 TYR A C   1 
ATOM   816  O O   . TYR A 1 105 ? 37.984 138.520 -33.415 1.00 32.80 ? 104 TYR A O   1 
ATOM   817  C CB  . TYR A 1 105 ? 38.166 138.261 -36.386 1.00 31.72 ? 104 TYR A CB  1 
ATOM   818  C CG  . TYR A 1 105 ? 37.744 139.031 -37.618 1.00 31.63 ? 104 TYR A CG  1 
ATOM   819  C CD1 . TYR A 1 105 ? 38.612 139.206 -38.693 1.00 31.70 ? 104 TYR A CD1 1 
ATOM   820  C CD2 . TYR A 1 105 ? 36.469 139.587 -37.708 1.00 31.66 ? 104 TYR A CD2 1 
ATOM   821  C CE1 . TYR A 1 105 ? 38.225 139.916 -39.818 1.00 31.68 ? 104 TYR A CE1 1 
ATOM   822  C CE2 . TYR A 1 105 ? 36.072 140.295 -38.828 1.00 31.63 ? 104 TYR A CE2 1 
ATOM   823  C CZ  . TYR A 1 105 ? 36.950 140.457 -39.878 1.00 31.68 ? 104 TYR A CZ  1 
ATOM   824  O OH  . TYR A 1 105 ? 36.551 141.163 -40.984 1.00 31.76 ? 104 TYR A OH  1 
ATOM   825  N N   . GLY A 1 106 ? 40.185 138.067 -33.506 1.00 33.55 ? 105 GLY A N   1 
ATOM   826  C CA  . GLY A 1 106 ? 40.269 137.562 -32.142 1.00 33.95 ? 105 GLY A CA  1 
ATOM   827  C C   . GLY A 1 106 ? 39.577 136.230 -31.946 1.00 34.32 ? 105 GLY A C   1 
ATOM   828  O O   . GLY A 1 106 ? 39.089 135.937 -30.852 1.00 34.80 ? 105 GLY A O   1 
ATOM   829  N N   . VAL A 1 107 ? 39.546 135.418 -33.001 1.00 34.55 ? 106 VAL A N   1 
ATOM   830  C CA  . VAL A 1 107 ? 38.886 134.113 -32.954 1.00 34.84 ? 106 VAL A CA  1 
ATOM   831  C C   . VAL A 1 107 ? 39.854 132.966 -33.255 1.00 35.44 ? 106 VAL A C   1 
ATOM   832  O O   . VAL A 1 107 ? 39.426 131.873 -33.610 1.00 35.79 ? 106 VAL A O   1 
ATOM   833  C CB  . VAL A 1 107 ? 37.683 134.047 -33.931 1.00 34.81 ? 106 VAL A CB  1 
ATOM   834  C CG1 . VAL A 1 107 ? 36.635 135.080 -33.555 1.00 35.25 ? 106 VAL A CG1 1 
ATOM   835  C CG2 . VAL A 1 107 ? 38.120 134.244 -35.377 1.00 34.94 ? 106 VAL A CG2 1 
ATOM   836  N N   . PHE A 1 108 ? 41.150 133.205 -33.095 1.00 36.49 ? 107 PHE A N   1 
ATOM   837  C CA  . PHE A 1 108 ? 42.145 132.183 -33.379 1.00 37.51 ? 107 PHE A CA  1 
ATOM   838  C C   . PHE A 1 108 ? 42.545 131.433 -32.114 1.00 38.72 ? 107 PHE A C   1 
ATOM   839  O O   . PHE A 1 108 ? 42.807 132.040 -31.081 1.00 39.21 ? 107 PHE A O   1 
ATOM   840  C CB  . PHE A 1 108 ? 43.371 132.811 -34.033 1.00 37.56 ? 107 PHE A CB  1 
ATOM   841  C CG  . PHE A 1 108 ? 44.406 131.812 -34.459 1.00 37.72 ? 107 PHE A CG  1 
ATOM   842  C CD1 . PHE A 1 108 ? 44.195 131.019 -35.576 1.00 37.34 ? 107 PHE A CD1 1 
ATOM   843  C CD2 . PHE A 1 108 ? 45.597 131.677 -33.757 1.00 38.21 ? 107 PHE A CD2 1 
ATOM   844  C CE1 . PHE A 1 108 ? 45.145 130.100 -35.980 1.00 37.51 ? 107 PHE A CE1 1 
ATOM   845  C CE2 . PHE A 1 108 ? 46.554 130.760 -34.158 1.00 38.19 ? 107 PHE A CE2 1 
ATOM   846  C CZ  . PHE A 1 108 ? 46.328 129.972 -35.273 1.00 38.04 ? 107 PHE A CZ  1 
ATOM   847  N N   . ASN A 1 109 ? 42.574 130.107 -32.209 1.00 39.96 ? 108 ASN A N   1 
ATOM   848  C CA  . ASN A 1 109 ? 42.973 129.244 -31.102 1.00 41.00 ? 108 ASN A CA  1 
ATOM   849  C C   . ASN A 1 109 ? 44.471 128.974 -31.210 1.00 42.11 ? 108 ASN A C   1 
ATOM   850  O O   . ASN A 1 109 ? 44.906 128.197 -32.060 1.00 41.56 ? 108 ASN A O   1 
ATOM   851  C CB  . ASN A 1 109 ? 42.170 127.941 -31.142 1.00 40.85 ? 108 ASN A CB  1 
ATOM   852  C CG  . ASN A 1 109 ? 42.529 126.988 -30.020 1.00 41.58 ? 108 ASN A CG  1 
ATOM   853  O OD1 . ASN A 1 109 ? 43.614 127.061 -29.441 1.00 43.53 ? 108 ASN A OD1 1 
ATOM   854  N ND2 . ASN A 1 109 ? 41.623 126.066 -29.723 1.00 41.42 ? 108 ASN A ND2 1 
ATOM   855  N N   . GLU A 1 110 ? 45.249 129.623 -30.348 1.00 44.08 ? 109 GLU A N   1 
ATOM   856  C CA  . GLU A 1 110 ? 46.712 129.496 -30.349 1.00 46.03 ? 109 GLU A CA  1 
ATOM   857  C C   . GLU A 1 110 ? 47.263 128.119 -29.966 1.00 45.88 ? 109 GLU A C   1 
ATOM   858  O O   . GLU A 1 110 ? 48.385 127.790 -30.342 1.00 46.40 ? 109 GLU A O   1 
ATOM   859  C CB  . GLU A 1 110 ? 47.341 130.566 -29.441 1.00 48.11 ? 109 GLU A CB  1 
ATOM   860  C CG  . GLU A 1 110 ? 47.369 131.961 -30.049 1.00 49.74 ? 109 GLU A CG  1 
ATOM   861  C CD  . GLU A 1 110 ? 48.308 132.074 -31.243 1.00 51.60 ? 109 GLU A CD  1 
ATOM   862  O OE1 . GLU A 1 110 ? 49.214 131.225 -31.385 1.00 53.33 ? 109 GLU A OE1 1 
ATOM   863  O OE2 . GLU A 1 110 ? 48.149 133.024 -32.040 1.00 53.59 ? 109 GLU A OE2 1 
ATOM   864  N N   . GLN A 1 111 ? 46.498 127.326 -29.217 1.00 45.88 ? 110 GLN A N   1 
ATOM   865  C CA  . GLN A 1 111 ? 46.954 125.990 -28.819 1.00 46.49 ? 110 GLN A CA  1 
ATOM   866  C C   . GLN A 1 111 ? 46.895 124.996 -29.977 1.00 44.60 ? 110 GLN A C   1 
ATOM   867  O O   . GLN A 1 111 ? 47.871 124.298 -30.247 1.00 45.04 ? 110 GLN A O   1 
ATOM   868  C CB  . GLN A 1 111 ? 46.139 125.429 -27.641 1.00 48.00 ? 110 GLN A CB  1 
ATOM   869  C CG  . GLN A 1 111 ? 46.460 126.035 -26.281 1.00 49.90 ? 110 GLN A CG  1 
ATOM   870  C CD  . GLN A 1 111 ? 45.951 127.455 -26.110 1.00 51.30 ? 110 GLN A CD  1 
ATOM   871  O OE1 . GLN A 1 111 ? 44.902 127.823 -26.647 1.00 52.76 ? 110 GLN A OE1 1 
ATOM   872  N NE2 . GLN A 1 111 ? 46.679 128.256 -25.337 1.00 52.32 ? 110 GLN A NE2 1 
ATOM   873  N N   . ALA A 1 112 ? 45.746 124.941 -30.647 1.00 42.22 ? 111 ALA A N   1 
ATOM   874  C CA  . ALA A 1 112 ? 45.517 124.000 -31.745 1.00 40.97 ? 111 ALA A CA  1 
ATOM   875  C C   . ALA A 1 112 ? 45.819 124.556 -33.143 1.00 40.04 ? 111 ALA A C   1 
ATOM   876  O O   . ALA A 1 112 ? 45.851 123.797 -34.108 1.00 40.39 ? 111 ALA A O   1 
ATOM   877  C CB  . ALA A 1 112 ? 44.086 123.487 -31.687 1.00 40.39 ? 111 ALA A CB  1 
ATOM   878  N N   . GLY A 1 113 ? 46.028 125.865 -33.255 1.00 38.96 ? 112 GLY A N   1 
ATOM   879  C CA  . GLY A 1 113 ? 46.336 126.492 -34.541 1.00 37.83 ? 112 GLY A CA  1 
ATOM   880  C C   . GLY A 1 113 ? 45.177 126.531 -35.520 1.00 36.88 ? 112 GLY A C   1 
ATOM   881  O O   . GLY A 1 113 ? 45.374 126.435 -36.732 1.00 36.17 ? 112 GLY A O   1 
ATOM   882  N N   . ILE A 1 114 ? 43.968 126.679 -34.994 1.00 36.06 ? 113 ILE A N   1 
ATOM   883  C CA  . ILE A 1 114 ? 42.761 126.725 -35.809 1.00 35.85 ? 113 ILE A CA  1 
ATOM   884  C C   . ILE A 1 114 ? 41.902 127.891 -35.352 1.00 35.46 ? 113 ILE A C   1 
ATOM   885  O O   . ILE A 1 114 ? 42.112 128.438 -34.272 1.00 35.76 ? 113 ILE A O   1 
ATOM   886  C CB  . ILE A 1 114 ? 41.948 125.413 -35.699 1.00 36.06 ? 113 ILE A CB  1 
ATOM   887  C CG1 . ILE A 1 114 ? 41.542 125.141 -34.242 1.00 36.48 ? 113 ILE A CG1 1 
ATOM   888  C CG2 . ILE A 1 114 ? 42.751 124.248 -36.259 1.00 36.60 ? 113 ILE A CG2 1 
ATOM   889  C CD1 . ILE A 1 114 ? 40.869 123.805 -34.018 1.00 36.89 ? 113 ILE A CD1 1 
ATOM   890  N N   . ALA A 1 115 ? 40.942 128.274 -36.181 1.00 34.59 ? 114 ALA A N   1 
ATOM   891  C CA  . ALA A 1 115 ? 40.033 129.347 -35.829 1.00 34.49 ? 114 ALA A CA  1 
ATOM   892  C C   . ALA A 1 115 ? 38.914 128.786 -34.962 1.00 34.53 ? 114 ALA A C   1 
ATOM   893  O O   . ALA A 1 115 ? 38.423 127.682 -35.210 1.00 34.62 ? 114 ALA A O   1 
ATOM   894  C CB  . ALA A 1 115 ? 39.457 129.983 -37.082 1.00 34.09 ? 114 ALA A CB  1 
ATOM   895  N N   . ASN A 1 116 ? 38.537 129.527 -33.924 1.00 34.73 ? 115 ASN A N   1 
ATOM   896  C CA  . ASN A 1 116 ? 37.403 129.144 -33.094 1.00 35.21 ? 115 ASN A CA  1 
ATOM   897  C C   . ASN A 1 116 ? 36.129 129.390 -33.889 1.00 35.48 ? 115 ASN A C   1 
ATOM   898  O O   . ASN A 1 116 ? 36.124 130.160 -34.854 1.00 35.67 ? 115 ASN A O   1 
ATOM   899  C CB  . ASN A 1 116 ? 37.357 129.947 -31.787 1.00 35.76 ? 115 ASN A CB  1 
ATOM   900  C CG  . ASN A 1 116 ? 38.414 129.514 -30.781 1.00 36.10 ? 115 ASN A CG  1 
ATOM   901  O OD1 . ASN A 1 116 ? 39.124 130.347 -30.224 1.00 36.53 ? 115 ASN A OD1 1 
ATOM   902  N ND2 . ASN A 1 116 ? 38.512 128.212 -30.535 1.00 35.94 ? 115 ASN A ND2 1 
ATOM   903  N N   . ALA A 1 117 ? 35.049 128.734 -33.488 1.00 35.65 ? 116 ALA A N   1 
ATOM   904  C CA  . ALA A 1 117 ? 33.773 128.899 -34.172 1.00 35.77 ? 116 ALA A CA  1 
ATOM   905  C C   . ALA A 1 117 ? 33.175 130.278 -33.844 1.00 35.79 ? 116 ALA A C   1 
ATOM   906  O O   . ALA A 1 117 ? 32.337 130.411 -32.952 1.00 36.22 ? 116 ALA A O   1 
ATOM   907  C CB  . ALA A 1 117 ? 32.822 127.767 -33.802 1.00 35.89 ? 116 ALA A CB  1 
ATOM   908  N N   . GLY A 1 118 ? 33.627 131.297 -34.576 1.00 34.72 ? 117 GLY A N   1 
ATOM   909  C CA  . GLY A 1 118 ? 33.163 132.675 -34.397 1.00 34.27 ? 117 GLY A CA  1 
ATOM   910  C C   . GLY A 1 118 ? 32.371 133.183 -35.589 1.00 33.24 ? 117 GLY A C   1 
ATOM   911  O O   . GLY A 1 118 ? 32.749 132.944 -36.734 1.00 32.81 ? 117 GLY A O   1 
ATOM   912  N N   . THR A 1 119 ? 31.253 133.859 -35.323 1.00 32.44 ? 118 THR A N   1 
ATOM   913  C CA  . THR A 1 119 ? 30.413 134.409 -36.387 1.00 31.95 ? 118 THR A CA  1 
ATOM   914  C C   . THR A 1 119 ? 30.276 135.901 -36.212 1.00 31.40 ? 118 THR A C   1 
ATOM   915  O O   . THR A 1 119 ? 30.075 136.385 -35.105 1.00 31.28 ? 118 THR A O   1 
ATOM   916  C CB  . THR A 1 119 ? 28.998 133.802 -36.409 1.00 31.99 ? 118 THR A CB  1 
ATOM   917  O OG1 . THR A 1 119 ? 29.091 132.393 -36.587 1.00 31.40 ? 118 THR A OG1 1 
ATOM   918  C CG2 . THR A 1 119 ? 28.169 134.381 -37.556 1.00 32.23 ? 118 THR A CG2 1 
ATOM   919  N N   . PHE A 1 120 ? 30.375 136.619 -37.324 1.00 31.19 ? 119 PHE A N   1 
ATOM   920  C CA  . PHE A 1 120 ? 30.259 138.064 -37.325 1.00 31.59 ? 119 PHE A CA  1 
ATOM   921  C C   . PHE A 1 120 ? 29.307 138.512 -38.411 1.00 32.00 ? 119 PHE A C   1 
ATOM   922  O O   . PHE A 1 120 ? 29.121 137.819 -39.406 1.00 32.37 ? 119 PHE A O   1 
ATOM   923  C CB  . PHE A 1 120 ? 31.613 138.712 -37.618 1.00 31.21 ? 119 PHE A CB  1 
ATOM   924  C CG  . PHE A 1 120 ? 32.681 138.380 -36.625 1.00 30.96 ? 119 PHE A CG  1 
ATOM   925  C CD1 . PHE A 1 120 ? 32.896 139.195 -35.523 1.00 31.19 ? 119 PHE A CD1 1 
ATOM   926  C CD2 . PHE A 1 120 ? 33.488 137.264 -36.800 1.00 30.48 ? 119 PHE A CD2 1 
ATOM   927  C CE1 . PHE A 1 120 ? 33.889 138.898 -34.608 1.00 31.02 ? 119 PHE A CE1 1 
ATOM   928  C CE2 . PHE A 1 120 ? 34.483 136.961 -35.885 1.00 30.33 ? 119 PHE A CE2 1 
ATOM   929  C CZ  . PHE A 1 120 ? 34.683 137.779 -34.787 1.00 30.66 ? 119 PHE A CZ  1 
ATOM   930  N N   . VAL A 1 121 ? 28.695 139.668 -38.202 1.00 32.66 ? 120 VAL A N   1 
ATOM   931  C CA  . VAL A 1 121 ? 27.890 140.302 -39.230 1.00 33.42 ? 120 VAL A CA  1 
ATOM   932  C C   . VAL A 1 121 ? 28.480 141.693 -39.390 1.00 34.05 ? 120 VAL A C   1 
ATOM   933  O O   . VAL A 1 121 ? 28.555 142.459 -38.427 1.00 34.13 ? 120 VAL A O   1 
ATOM   934  C CB  . VAL A 1 121 ? 26.397 140.402 -38.884 1.00 33.88 ? 120 VAL A CB  1 
ATOM   935  C CG1 . VAL A 1 121 ? 25.659 141.197 -39.957 1.00 34.79 ? 120 VAL A CG1 1 
ATOM   936  C CG2 . VAL A 1 121 ? 25.791 139.015 -38.739 1.00 33.37 ? 120 VAL A CG2 1 
ATOM   937  N N   . VAL A 1 122 ? 28.930 141.990 -40.603 1.00 34.46 ? 121 VAL A N   1 
ATOM   938  C CA  . VAL A 1 122 ? 29.506 143.282 -40.928 1.00 35.21 ? 121 VAL A CA  1 
ATOM   939  C C   . VAL A 1 122 ? 28.482 144.013 -41.780 1.00 35.96 ? 121 VAL A C   1 
ATOM   940  O O   . VAL A 1 122 ? 27.983 143.456 -42.757 1.00 35.92 ? 121 VAL A O   1 
ATOM   941  C CB  . VAL A 1 122 ? 30.815 143.119 -41.723 1.00 35.11 ? 121 VAL A CB  1 
ATOM   942  C CG1 . VAL A 1 122 ? 31.451 144.479 -41.994 1.00 35.89 ? 121 VAL A CG1 1 
ATOM   943  C CG2 . VAL A 1 122 ? 31.782 142.211 -40.976 1.00 34.32 ? 121 VAL A CG2 1 
ATOM   944  N N   . ASP A 1 123 ? 28.155 145.249 -41.414 1.00 36.85 ? 122 ASP A N   1 
ATOM   945  C CA  . ASP A 1 123 ? 27.183 146.021 -42.184 1.00 37.88 ? 122 ASP A CA  1 
ATOM   946  C C   . ASP A 1 123 ? 27.865 146.704 -43.369 1.00 38.61 ? 122 ASP A C   1 
ATOM   947  O O   . ASP A 1 123 ? 29.064 146.533 -43.582 1.00 37.83 ? 122 ASP A O   1 
ATOM   948  C CB  . ASP A 1 123 ? 26.434 147.021 -41.297 1.00 38.69 ? 122 ASP A CB  1 
ATOM   949  C CG  . ASP A 1 123 ? 27.315 148.134 -40.767 1.00 39.41 ? 122 ASP A CG  1 
ATOM   950  O OD1 . ASP A 1 123 ? 28.523 148.179 -41.082 1.00 40.02 ? 122 ASP A OD1 1 
ATOM   951  O OD2 . ASP A 1 123 ? 26.777 148.982 -40.030 1.00 40.27 ? 122 ASP A OD2 1 
ATOM   952  N N   . ARG A 1 124 ? 27.103 147.491 -44.123 1.00 39.95 ? 123 ARG A N   1 
ATOM   953  C CA  . ARG A 1 124 ? 27.621 148.154 -45.321 1.00 41.11 ? 123 ARG A CA  1 
ATOM   954  C C   . ARG A 1 124 ? 28.731 149.177 -45.059 1.00 40.70 ? 123 ARG A C   1 
ATOM   955  O O   . ARG A 1 124 ? 29.508 149.481 -45.963 1.00 40.75 ? 123 ARG A O   1 
ATOM   956  C CB  . ARG A 1 124 ? 26.471 148.786 -46.113 1.00 43.33 ? 123 ARG A CB  1 
ATOM   957  C CG  . ARG A 1 124 ? 25.449 147.765 -46.592 1.00 44.59 ? 123 ARG A CG  1 
ATOM   958  C CD  . ARG A 1 124 ? 24.399 148.377 -47.502 1.00 47.06 ? 123 ARG A CD  1 
ATOM   959  N NE  . ARG A 1 124 ? 23.299 147.440 -47.724 1.00 48.50 ? 123 ARG A NE  1 
ATOM   960  C CZ  . ARG A 1 124 ? 22.235 147.310 -46.929 1.00 49.93 ? 123 ARG A CZ  1 
ATOM   961  N NH1 . ARG A 1 124 ? 22.098 148.062 -45.837 1.00 50.64 ? 123 ARG A NH1 1 
ATOM   962  N NH2 . ARG A 1 124 ? 21.295 146.417 -47.225 1.00 50.71 ? 123 ARG A NH2 1 
ATOM   963  N N   . SER A 1 125 ? 28.805 149.701 -43.837 1.00 40.21 ? 124 SER A N   1 
ATOM   964  C CA  . SER A 1 125 ? 29.840 150.671 -43.464 1.00 40.05 ? 124 SER A CA  1 
ATOM   965  C C   . SER A 1 125 ? 31.147 150.010 -43.018 1.00 38.81 ? 124 SER A C   1 
ATOM   966  O O   . SER A 1 125 ? 32.159 150.693 -42.858 1.00 39.30 ? 124 SER A O   1 
ATOM   967  C CB  . SER A 1 125 ? 29.335 151.580 -42.342 1.00 40.62 ? 124 SER A CB  1 
ATOM   968  O OG  . SER A 1 125 ? 28.189 152.307 -42.746 1.00 41.57 ? 124 SER A OG  1 
ATOM   969  N N   . GLY A 1 126 ? 31.123 148.694 -42.807 1.00 37.34 ? 125 GLY A N   1 
ATOM   970  C CA  . GLY A 1 126 ? 32.306 147.943 -42.374 1.00 36.15 ? 125 GLY A CA  1 
ATOM   971  C C   . GLY A 1 126 ? 32.414 147.772 -40.867 1.00 35.42 ? 125 GLY A C   1 
ATOM   972  O O   . GLY A 1 126 ? 33.479 147.419 -40.354 1.00 34.94 ? 125 GLY A O   1 
ATOM   973  N N   . ILE A 1 127 ? 31.309 148.014 -40.163 1.00 35.12 ? 126 ILE A N   1 
ATOM   974  C CA  . ILE A 1 127 ? 31.251 147.897 -38.708 1.00 34.65 ? 126 ILE A CA  1 
ATOM   975  C C   . ILE A 1 127 ? 30.620 146.567 -38.306 1.00 33.63 ? 126 ILE A C   1 
ATOM   976  O O   . ILE A 1 127 ? 29.647 146.124 -38.914 1.00 33.12 ? 126 ILE A O   1 
ATOM   977  C CB  . ILE A 1 127 ? 30.406 149.039 -38.090 1.00 35.33 ? 126 ILE A CB  1 
ATOM   978  C CG1 . ILE A 1 127 ? 31.045 150.406 -38.369 1.00 36.30 ? 126 ILE A CG1 1 
ATOM   979  C CG2 . ILE A 1 127 ? 30.217 148.843 -36.588 1.00 35.07 ? 126 ILE A CG2 1 
ATOM   980  C CD1 . ILE A 1 127 ? 32.420 150.601 -37.755 1.00 36.19 ? 126 ILE A CD1 1 
ATOM   981  N N   . ILE A 1 128 ? 31.168 145.951 -37.264 1.00 33.33 ? 127 ILE A N   1 
ATOM   982  C CA  . ILE A 1 128 ? 30.632 144.701 -36.743 1.00 33.21 ? 127 ILE A CA  1 
ATOM   983  C C   . ILE A 1 128 ? 29.330 145.016 -36.009 1.00 34.08 ? 127 ILE A C   1 
ATOM   984  O O   . ILE A 1 128 ? 29.307 145.863 -35.118 1.00 34.44 ? 127 ILE A O   1 
ATOM   985  C CB  . ILE A 1 128 ? 31.634 144.000 -35.806 1.00 32.52 ? 127 ILE A CB  1 
ATOM   986  C CG1 . ILE A 1 128 ? 32.880 143.599 -36.605 1.00 32.28 ? 127 ILE A CG1 1 
ATOM   987  C CG2 . ILE A 1 128 ? 30.999 142.772 -35.162 1.00 31.99 ? 127 ILE A CG2 1 
ATOM   988  C CD1 . ILE A 1 128 ? 33.976 142.952 -35.785 1.00 32.04 ? 127 ILE A CD1 1 
ATOM   989  N N   . ARG A 1 129 ? 28.252 144.354 -36.420 1.00 34.81 ? 128 ARG A N   1 
ATOM   990  C CA  . ARG A 1 129 ? 26.926 144.540 -35.824 1.00 36.35 ? 128 ARG A CA  1 
ATOM   991  C C   . ARG A 1 129 ? 26.495 143.336 -34.998 1.00 36.22 ? 128 ARG A C   1 
ATOM   992  O O   . ARG A 1 129 ? 25.565 143.424 -34.202 1.00 36.38 ? 128 ARG A O   1 
ATOM   993  C CB  . ARG A 1 129 ? 25.895 144.754 -36.924 1.00 37.35 ? 128 ARG A CB  1 
ATOM   994  C CG  . ARG A 1 129 ? 26.218 145.895 -37.866 1.00 38.66 ? 128 ARG A CG  1 
ATOM   995  C CD  . ARG A 1 129 ? 26.130 147.264 -37.215 1.00 40.18 ? 128 ARG A CD  1 
ATOM   996  N NE  . ARG A 1 129 ? 24.755 147.603 -36.861 1.00 41.77 ? 128 ARG A NE  1 
ATOM   997  C CZ  . ARG A 1 129 ? 24.317 148.828 -36.587 1.00 43.36 ? 128 ARG A CZ  1 
ATOM   998  N NH1 . ARG A 1 129 ? 25.134 149.879 -36.640 1.00 44.74 ? 128 ARG A NH1 1 
ATOM   999  N NH2 . ARG A 1 129 ? 23.040 149.006 -36.277 1.00 44.13 ? 128 ARG A NH2 1 
ATOM   1000 N N   . PHE A 1 130 ? 27.155 142.207 -35.220 1.00 36.47 ? 129 PHE A N   1 
ATOM   1001 C CA  . PHE A 1 130 ? 26.868 140.985 -34.498 1.00 36.33 ? 129 PHE A CA  1 
ATOM   1002 C C   . PHE A 1 130 ? 28.179 140.246 -34.339 1.00 36.24 ? 129 PHE A C   1 
ATOM   1003 O O   . PHE A 1 130 ? 28.965 140.169 -35.276 1.00 36.02 ? 129 PHE A O   1 
ATOM   1004 C CB  . PHE A 1 130 ? 25.854 140.145 -35.270 1.00 35.89 ? 129 PHE A CB  1 
ATOM   1005 C CG  . PHE A 1 130 ? 25.589 138.801 -34.666 1.00 35.43 ? 129 PHE A CG  1 
ATOM   1006 C CD1 . PHE A 1 130 ? 24.642 138.648 -33.663 1.00 35.48 ? 129 PHE A CD1 1 
ATOM   1007 C CD2 . PHE A 1 130 ? 26.274 137.678 -35.117 1.00 34.85 ? 129 PHE A CD2 1 
ATOM   1008 C CE1 . PHE A 1 130 ? 24.393 137.403 -33.112 1.00 35.12 ? 129 PHE A CE1 1 
ATOM   1009 C CE2 . PHE A 1 130 ? 26.031 136.432 -34.567 1.00 34.51 ? 129 PHE A CE2 1 
ATOM   1010 C CZ  . PHE A 1 130 ? 25.088 136.295 -33.564 1.00 34.45 ? 129 PHE A CZ  1 
ATOM   1011 N N   . ALA A 1 131 ? 28.419 139.743 -33.136 1.00 37.58 ? 130 ALA A N   1 
ATOM   1012 C CA  . ALA A 1 131 ? 29.625 138.990 -32.831 1.00 38.79 ? 130 ALA A CA  1 
ATOM   1013 C C   . ALA A 1 131 ? 29.273 137.952 -31.777 1.00 40.35 ? 130 ALA A C   1 
ATOM   1014 O O   . ALA A 1 131 ? 28.851 138.291 -30.673 1.00 40.56 ? 130 ALA A O   1 
ATOM   1015 C CB  . ALA A 1 131 ? 30.728 139.911 -32.340 1.00 38.89 ? 130 ALA A CB  1 
ATOM   1016 N N   . GLU A 1 132 ? 29.433 136.688 -32.142 1.00 42.88 ? 131 GLU A N   1 
ATOM   1017 C CA  . GLU A 1 132 ? 29.103 135.570 -31.275 1.00 46.25 ? 131 GLU A CA  1 
ATOM   1018 C C   . GLU A 1 132 ? 30.108 134.451 -31.498 1.00 48.41 ? 131 GLU A C   1 
ATOM   1019 O O   . GLU A 1 132 ? 30.379 134.089 -32.642 1.00 48.42 ? 131 GLU A O   1 
ATOM   1020 C CB  . GLU A 1 132 ? 27.692 135.080 -31.624 1.00 47.34 ? 131 GLU A CB  1 
ATOM   1021 C CG  . GLU A 1 132 ? 27.254 133.778 -30.970 1.00 48.00 ? 131 GLU A CG  1 
ATOM   1022 C CD  . GLU A 1 132 ? 25.983 133.216 -31.594 1.00 48.39 ? 131 GLU A CD  1 
ATOM   1023 O OE1 . GLU A 1 132 ? 26.083 132.239 -32.364 1.00 47.70 ? 131 GLU A OE1 1 
ATOM   1024 O OE2 . GLU A 1 132 ? 24.889 133.771 -31.352 1.00 49.42 ? 131 GLU A OE2 1 
ATOM   1025 N N   . MET A 1 133 ? 30.677 133.918 -30.419 1.00 52.13 ? 132 MET A N   1 
ATOM   1026 C CA  . MET A 1 133 ? 31.601 132.800 -30.542 1.00 55.97 ? 132 MET A CA  1 
ATOM   1027 C C   . MET A 1 133 ? 30.936 131.575 -29.940 1.00 59.03 ? 132 MET A C   1 
ATOM   1028 O O   . MET A 1 133 ? 30.454 131.611 -28.808 1.00 59.72 ? 132 MET A O   1 
ATOM   1029 C CB  . MET A 1 133 ? 32.942 133.073 -29.863 1.00 57.61 ? 132 MET A CB  1 
ATOM   1030 C CG  . MET A 1 133 ? 34.043 132.142 -30.365 1.00 58.31 ? 132 MET A CG  1 
ATOM   1031 S SD  . MET A 1 133 ? 35.685 132.440 -29.681 1.00 60.51 ? 132 MET A SD  1 
ATOM   1032 C CE  . MET A 1 133 ? 35.880 134.184 -30.010 1.00 60.55 ? 132 MET A CE  1 
ATOM   1033 N N   . LYS A 1 134 ? 30.915 130.499 -30.721 1.00 63.15 ? 133 LYS A N   1 
ATOM   1034 C CA  . LYS A 1 134 ? 30.301 129.236 -30.331 1.00 67.21 ? 133 LYS A CA  1 
ATOM   1035 C C   . LYS A 1 134 ? 30.792 128.815 -28.963 1.00 71.27 ? 133 LYS A C   1 
ATOM   1036 O O   . LYS A 1 134 ? 31.997 128.813 -28.716 1.00 71.22 ? 133 LYS A O   1 
ATOM   1037 C CB  . LYS A 1 134 ? 30.685 128.156 -31.341 1.00 67.48 ? 133 LYS A CB  1 
ATOM   1038 C CG  . LYS A 1 134 ? 29.983 126.819 -31.191 1.00 68.95 ? 133 LYS A CG  1 
ATOM   1039 C CD  . LYS A 1 134 ? 30.426 125.877 -32.304 1.00 69.72 ? 133 LYS A CD  1 
ATOM   1040 C CE  . LYS A 1 134 ? 29.602 124.601 -32.357 1.00 70.64 ? 133 LYS A CE  1 
ATOM   1041 N NZ  . LYS A 1 134 ? 29.745 123.750 -31.142 1.00 71.40 ? 133 LYS A NZ  1 
ATOM   1042 N N   . GLN A 1 135 ? 29.860 128.466 -28.079 1.00 76.33 ? 134 GLN A N   1 
ATOM   1043 C CA  . GLN A 1 135 ? 30.216 127.991 -26.749 1.00 80.54 ? 134 GLN A CA  1 
ATOM   1044 C C   . GLN A 1 135 ? 30.671 126.551 -27.027 1.00 83.00 ? 134 GLN A C   1 
ATOM   1045 O O   . GLN A 1 135 ? 29.826 125.673 -27.208 1.00 82.40 ? 134 GLN A O   1 
ATOM   1046 C CB  . GLN A 1 135 ? 29.012 128.018 -25.790 1.00 81.81 ? 134 GLN A CB  1 
ATOM   1047 C CG  . GLN A 1 135 ? 28.118 129.258 -25.855 1.00 82.95 ? 134 GLN A CG  1 
ATOM   1048 C CD  . GLN A 1 135 ? 28.843 130.564 -25.578 1.00 84.12 ? 134 GLN A CD  1 
ATOM   1049 O OE1 . GLN A 1 135 ? 29.949 130.578 -25.037 1.00 85.15 ? 134 GLN A OE1 1 
ATOM   1050 N NE2 . GLN A 1 135 ? 28.209 131.677 -25.937 1.00 84.18 ? 134 GLN A NE2 1 
ATOM   1051 N N   . PRO A 1 136 ? 31.999 126.302 -27.086 1.00 85.76 ? 135 PRO A N   1 
ATOM   1052 C CA  . PRO A 1 136 ? 32.438 124.956 -27.479 1.00 85.83 ? 135 PRO A CA  1 
ATOM   1053 C C   . PRO A 1 136 ? 31.784 123.876 -26.621 1.00 85.76 ? 135 PRO A C   1 
ATOM   1054 O O   . PRO A 1 136 ? 32.011 123.813 -25.412 1.00 86.36 ? 135 PRO A O   1 
ATOM   1055 C CB  . PRO A 1 136 ? 33.966 125.004 -27.309 1.00 86.25 ? 135 PRO A CB  1 
ATOM   1056 C CG  . PRO A 1 136 ? 34.311 126.453 -27.176 1.00 86.35 ? 135 PRO A CG  1 
ATOM   1057 C CD  . PRO A 1 136 ? 33.117 127.079 -26.523 1.00 86.46 ? 135 PRO A CD  1 
ATOM   1058 N N   . GLY A 1 137 ? 30.966 123.050 -27.270 1.00 85.08 ? 136 GLY A N   1 
ATOM   1059 C CA  . GLY A 1 137 ? 30.166 122.028 -26.601 1.00 84.23 ? 136 GLY A CA  1 
ATOM   1060 C C   . GLY A 1 137 ? 28.695 122.289 -26.894 1.00 83.83 ? 136 GLY A C   1 
ATOM   1061 O O   . GLY A 1 137 ? 27.865 121.388 -26.793 1.00 82.53 ? 136 GLY A O   1 
ATOM   1062 N N   . GLU A 1 138 ? 28.383 123.538 -27.246 1.00 84.32 ? 137 GLU A N   1 
ATOM   1063 C CA  . GLU A 1 138 ? 27.035 123.968 -27.608 1.00 85.14 ? 137 GLU A CA  1 
ATOM   1064 C C   . GLU A 1 138 ? 27.030 124.367 -29.083 1.00 83.33 ? 137 GLU A C   1 
ATOM   1065 O O   . GLU A 1 138 ? 28.028 124.875 -29.597 1.00 83.74 ? 137 GLU A O   1 
ATOM   1066 C CB  . GLU A 1 138 ? 26.604 125.151 -26.735 1.00 87.67 ? 137 GLU A CB  1 
ATOM   1067 C CG  . GLU A 1 138 ? 25.233 125.734 -27.062 1.00 89.79 ? 137 GLU A CG  1 
ATOM   1068 C CD  . GLU A 1 138 ? 24.110 124.716 -26.972 1.00 90.78 ? 137 GLU A CD  1 
ATOM   1069 O OE1 . GLU A 1 138 ? 24.201 123.787 -26.141 1.00 91.87 ? 137 GLU A OE1 1 
ATOM   1070 O OE2 . GLU A 1 138 ? 23.127 124.851 -27.731 1.00 91.11 ? 137 GLU A OE2 1 
ATOM   1071 N N   . VAL A 1 139 ? 25.898 124.151 -29.751 1.00 80.42 ? 138 VAL A N   1 
ATOM   1072 C CA  . VAL A 1 139 ? 25.762 124.423 -31.187 1.00 77.37 ? 138 VAL A CA  1 
ATOM   1073 C C   . VAL A 1 139 ? 25.155 125.792 -31.525 1.00 74.41 ? 138 VAL A C   1 
ATOM   1074 O O   . VAL A 1 139 ? 24.266 126.288 -30.824 1.00 74.07 ? 138 VAL A O   1 
ATOM   1075 C CB  . VAL A 1 139 ? 24.939 123.292 -31.867 1.00 76.84 ? 138 VAL A CB  1 
ATOM   1076 C CG1 . VAL A 1 139 ? 24.467 123.665 -33.271 1.00 76.62 ? 138 VAL A CG1 1 
ATOM   1077 C CG2 . VAL A 1 139 ? 25.757 122.010 -31.911 1.00 76.03 ? 138 VAL A CG2 1 
ATOM   1078 N N   A ARG A 1 140 ? 25.676 126.427 -32.573 0.50 71.98 ? 139 ARG A N   1 
ATOM   1079 N N   B ARG A 1 140 ? 25.640 126.343 -32.638 0.50 72.34 ? 139 ARG A N   1 
ATOM   1080 C CA  A ARG A 1 140 ? 25.205 127.753 -32.968 0.50 70.18 ? 139 ARG A CA  1 
ATOM   1081 C CA  B ARG A 1 140 ? 25.150 127.572 -33.248 0.50 70.64 ? 139 ARG A CA  1 
ATOM   1082 C C   A ARG A 1 140 ? 23.801 127.730 -33.596 0.50 70.34 ? 139 ARG A C   1 
ATOM   1083 C C   B ARG A 1 140 ? 23.662 127.579 -33.544 0.50 70.51 ? 139 ARG A C   1 
ATOM   1084 O O   A ARG A 1 140 ? 23.530 126.987 -34.540 0.50 70.12 ? 139 ARG A O   1 
ATOM   1085 O O   B ARG A 1 140 ? 23.176 126.682 -34.236 0.50 69.93 ? 139 ARG A O   1 
ATOM   1086 C CB  A ARG A 1 140 ? 26.241 128.459 -33.859 0.50 68.46 ? 139 ARG A CB  1 
ATOM   1087 C CB  B ARG A 1 140 ? 25.800 127.715 -34.623 0.50 69.22 ? 139 ARG A CB  1 
ATOM   1088 C CG  A ARG A 1 140 ? 27.451 128.934 -33.058 0.50 67.12 ? 139 ARG A CG  1 
ATOM   1089 C CG  B ARG A 1 140 ? 26.982 128.645 -34.733 0.50 68.17 ? 139 ARG A CG  1 
ATOM   1090 C CD  A ARG A 1 140 ? 28.389 129.860 -33.822 0.50 65.83 ? 139 ARG A CD  1 
ATOM   1091 C CD  B ARG A 1 140 ? 28.201 128.282 -33.923 0.50 67.30 ? 139 ARG A CD  1 
ATOM   1092 N NE  A ARG A 1 140 ? 29.436 129.181 -34.586 0.50 64.03 ? 139 ARG A NE  1 
ATOM   1093 N NE  B ARG A 1 140 ? 29.164 129.357 -34.108 0.50 66.09 ? 139 ARG A NE  1 
ATOM   1094 C CZ  A ARG A 1 140 ? 30.284 129.823 -35.384 0.50 62.73 ? 139 ARG A CZ  1 
ATOM   1095 C CZ  B ARG A 1 140 ? 29.100 130.505 -33.447 0.50 65.35 ? 139 ARG A CZ  1 
ATOM   1096 N NH1 A ARG A 1 140 ? 30.166 131.121 -35.532 0.50 62.72 ? 139 ARG A NH1 1 
ATOM   1097 N NH1 B ARG A 1 140 ? 28.137 130.686 -32.559 0.50 65.36 ? 139 ARG A NH1 1 
ATOM   1098 N NH2 A ARG A 1 140 ? 31.233 129.187 -36.056 0.50 61.85 ? 139 ARG A NH2 1 
ATOM   1099 N NH2 B ARG A 1 140 ? 29.991 131.460 -33.662 0.50 64.62 ? 139 ARG A NH2 1 
ATOM   1100 N N   . ASP A 1 141 ? 22.929 128.567 -33.035 1.00 70.63 ? 140 ASP A N   1 
ATOM   1101 C CA  . ASP A 1 141 ? 21.531 128.717 -33.438 1.00 69.80 ? 140 ASP A CA  1 
ATOM   1102 C C   . ASP A 1 141 ? 21.581 129.825 -34.491 1.00 68.05 ? 140 ASP A C   1 
ATOM   1103 O O   . ASP A 1 141 ? 21.678 131.010 -34.158 1.00 68.32 ? 140 ASP A O   1 
ATOM   1104 C CB  . ASP A 1 141 ? 20.648 129.103 -32.248 1.00 71.64 ? 140 ASP A CB  1 
ATOM   1105 C CG  . ASP A 1 141 ? 19.169 129.202 -32.612 1.00 72.89 ? 140 ASP A CG  1 
ATOM   1106 O OD1 . ASP A 1 141 ? 18.787 128.840 -33.749 1.00 72.60 ? 140 ASP A OD1 1 
ATOM   1107 O OD2 . ASP A 1 141 ? 18.383 129.644 -31.746 1.00 74.33 ? 140 ASP A OD2 1 
ATOM   1108 N N   . GLN A 1 142 ? 21.516 129.432 -35.761 1.00 65.01 ? 141 GLN A N   1 
ATOM   1109 C CA  . GLN A 1 142 ? 21.683 130.368 -36.879 1.00 63.28 ? 141 GLN A CA  1 
ATOM   1110 C C   . GLN A 1 142 ? 20.502 131.287 -37.202 1.00 62.69 ? 141 GLN A C   1 
ATOM   1111 O O   . GLN A 1 142 ? 20.598 132.118 -38.104 1.00 61.26 ? 141 GLN A O   1 
ATOM   1112 C CB  . GLN A 1 142 ? 22.130 129.609 -38.127 1.00 62.25 ? 141 GLN A CB  1 
ATOM   1113 C CG  . GLN A 1 142 ? 23.437 128.870 -37.899 1.00 61.68 ? 141 GLN A CG  1 
ATOM   1114 C CD  . GLN A 1 142 ? 24.010 128.255 -39.156 1.00 61.31 ? 141 GLN A CD  1 
ATOM   1115 O OE1 . GLN A 1 142 ? 23.462 128.407 -40.249 1.00 61.73 ? 141 GLN A OE1 1 
ATOM   1116 N NE2 . GLN A 1 142 ? 25.131 127.559 -39.007 1.00 60.98 ? 141 GLN A NE2 1 
ATOM   1117 N N   . ARG A 1 143 ? 19.400 131.144 -36.472 1.00 63.23 ? 142 ARG A N   1 
ATOM   1118 C CA  . ARG A 1 143 ? 18.255 132.033 -36.639 1.00 64.18 ? 142 ARG A CA  1 
ATOM   1119 C C   . ARG A 1 143 ? 18.579 133.367 -35.960 1.00 62.48 ? 142 ARG A C   1 
ATOM   1120 O O   . ARG A 1 143 ? 17.975 134.392 -36.269 1.00 63.00 ? 142 ARG A O   1 
ATOM   1121 C CB  . ARG A 1 143 ? 16.985 131.391 -36.081 1.00 66.29 ? 142 ARG A CB  1 
ATOM   1122 C CG  . ARG A 1 143 ? 16.619 130.108 -36.821 1.00 68.04 ? 142 ARG A CG  1 
ATOM   1123 C CD  . ARG A 1 143 ? 15.488 129.325 -36.172 1.00 69.86 ? 142 ARG A CD  1 
ATOM   1124 N NE  . ARG A 1 143 ? 15.806 128.909 -34.804 1.00 70.51 ? 142 ARG A NE  1 
ATOM   1125 C CZ  . ARG A 1 143 ? 15.074 128.063 -34.080 1.00 71.85 ? 142 ARG A CZ  1 
ATOM   1126 N NH1 . ARG A 1 143 ? 15.454 127.761 -32.842 1.00 72.05 ? 142 ARG A NH1 1 
ATOM   1127 N NH2 . ARG A 1 143 ? 13.975 127.504 -34.584 1.00 71.92 ? 142 ARG A NH2 1 
ATOM   1128 N N   . LEU A 1 144 ? 19.540 133.337 -35.034 1.00 60.64 ? 143 LEU A N   1 
ATOM   1129 C CA  . LEU A 1 144 ? 20.033 134.546 -34.375 1.00 60.35 ? 143 LEU A CA  1 
ATOM   1130 C C   . LEU A 1 144 ? 20.824 135.395 -35.374 1.00 58.74 ? 143 LEU A C   1 
ATOM   1131 O O   . LEU A 1 144 ? 20.848 136.623 -35.267 1.00 58.73 ? 143 LEU A O   1 
ATOM   1132 C CB  . LEU A 1 144 ? 20.915 134.203 -33.164 1.00 61.06 ? 143 LEU A CB  1 
ATOM   1133 C CG  . LEU A 1 144 ? 20.247 133.793 -31.841 1.00 62.45 ? 143 LEU A CG  1 
ATOM   1134 C CD1 . LEU A 1 144 ? 19.130 132.770 -32.008 1.00 62.49 ? 143 LEU A CD1 1 
ATOM   1135 C CD2 . LEU A 1 144 ? 21.304 133.282 -30.870 1.00 62.42 ? 143 LEU A CD2 1 
ATOM   1136 N N   . TRP A 1 145 ? 21.471 134.738 -36.340 1.00 56.45 ? 144 TRP A N   1 
ATOM   1137 C CA  . TRP A 1 145 ? 22.230 135.445 -37.371 1.00 55.35 ? 144 TRP A CA  1 
ATOM   1138 C C   . TRP A 1 145 ? 21.292 136.118 -38.367 1.00 55.93 ? 144 TRP A C   1 
ATOM   1139 O O   . TRP A 1 145 ? 21.517 137.262 -38.764 1.00 55.47 ? 144 TRP A O   1 
ATOM   1140 C CB  . TRP A 1 145 ? 23.154 134.516 -38.163 1.00 53.88 ? 144 TRP A CB  1 
ATOM   1141 C CG  . TRP A 1 145 ? 24.065 133.631 -37.380 1.00 52.42 ? 144 TRP A CG  1 
ATOM   1142 C CD1 . TRP A 1 145 ? 24.412 133.739 -36.064 1.00 52.37 ? 144 TRP A CD1 1 
ATOM   1143 C CD2 . TRP A 1 145 ? 24.850 132.563 -37.913 1.00 51.33 ? 144 TRP A CD2 1 
ATOM   1144 N NE1 . TRP A 1 145 ? 25.313 132.755 -35.730 1.00 51.17 ? 144 TRP A NE1 1 
ATOM   1145 C CE2 . TRP A 1 145 ? 25.606 132.027 -36.853 1.00 51.03 ? 144 TRP A CE2 1 
ATOM   1146 C CE3 . TRP A 1 145 ? 24.969 131.989 -39.186 1.00 51.31 ? 144 TRP A CE3 1 
ATOM   1147 C CZ2 . TRP A 1 145 ? 26.469 130.949 -37.027 1.00 50.72 ? 144 TRP A CZ2 1 
ATOM   1148 C CZ3 . TRP A 1 145 ? 25.830 130.917 -39.355 1.00 50.88 ? 144 TRP A CZ3 1 
ATOM   1149 C CH2 . TRP A 1 145 ? 26.567 130.406 -38.280 1.00 50.46 ? 144 TRP A CH2 1 
ATOM   1150 N N   . THR A 1 146 ? 20.253 135.393 -38.781 1.00 56.68 ? 145 THR A N   1 
ATOM   1151 C CA  . THR A 1 146 ? 19.269 135.918 -39.733 1.00 57.75 ? 145 THR A CA  1 
ATOM   1152 C C   . THR A 1 146 ? 18.579 137.162 -39.180 1.00 58.31 ? 145 THR A C   1 
ATOM   1153 O O   . THR A 1 146 ? 18.321 138.111 -39.919 1.00 57.91 ? 145 THR A O   1 
ATOM   1154 C CB  . THR A 1 146 ? 18.194 134.873 -40.096 1.00 58.28 ? 145 THR A CB  1 
ATOM   1155 O OG1 . THR A 1 146 ? 17.558 134.400 -38.904 1.00 59.71 ? 145 THR A OG1 1 
ATOM   1156 C CG2 . THR A 1 146 ? 18.810 133.695 -40.841 1.00 57.88 ? 145 THR A CG2 1 
ATOM   1157 N N   . ASP A 1 147 ? 18.284 137.146 -37.880 1.00 59.02 ? 146 ASP A N   1 
ATOM   1158 C CA  . ASP A 1 147 ? 17.657 138.287 -37.212 1.00 60.75 ? 146 ASP A CA  1 
ATOM   1159 C C   . ASP A 1 147 ? 18.609 139.482 -37.151 1.00 60.56 ? 146 ASP A C   1 
ATOM   1160 O O   . ASP A 1 147 ? 18.174 140.631 -37.248 1.00 60.89 ? 146 ASP A O   1 
ATOM   1161 C CB  . ASP A 1 147 ? 17.194 137.904 -35.802 1.00 61.82 ? 146 ASP A CB  1 
ATOM   1162 C CG  . ASP A 1 147 ? 16.064 136.882 -35.810 1.00 63.17 ? 146 ASP A CG  1 
ATOM   1163 O OD1 . ASP A 1 147 ? 15.379 136.743 -36.848 1.00 64.22 ? 146 ASP A OD1 1 
ATOM   1164 O OD2 . ASP A 1 147 ? 15.851 136.222 -34.770 1.00 63.79 ? 146 ASP A OD2 1 
ATOM   1165 N N   . ALA A 1 148 ? 19.903 139.206 -36.988 1.00 59.65 ? 147 ALA A N   1 
ATOM   1166 C CA  . ALA A 1 148 ? 20.921 140.256 -36.963 1.00 59.32 ? 147 ALA A CA  1 
ATOM   1167 C C   . ALA A 1 148 ? 21.002 140.953 -38.323 1.00 58.80 ? 147 ALA A C   1 
ATOM   1168 O O   . ALA A 1 148 ? 21.104 142.176 -38.389 1.00 58.62 ? 147 ALA A O   1 
ATOM   1169 C CB  . ALA A 1 148 ? 22.275 139.683 -36.571 1.00 58.79 ? 147 ALA A CB  1 
ATOM   1170 N N   . LEU A 1 149 ? 20.959 140.168 -39.399 1.00 58.21 ? 148 LEU A N   1 
ATOM   1171 C CA  . LEU A 1 149 ? 20.975 140.712 -40.761 1.00 58.88 ? 148 LEU A CA  1 
ATOM   1172 C C   . LEU A 1 149 ? 19.654 141.406 -41.098 1.00 60.12 ? 148 LEU A C   1 
ATOM   1173 O O   . LEU A 1 149 ? 19.638 142.381 -41.851 1.00 60.02 ? 148 LEU A O   1 
ATOM   1174 C CB  . LEU A 1 149 ? 21.256 139.610 -41.788 1.00 58.14 ? 148 LEU A CB  1 
ATOM   1175 C CG  . LEU A 1 149 ? 22.673 139.031 -41.818 1.00 57.77 ? 148 LEU A CG  1 
ATOM   1176 C CD1 . LEU A 1 149 ? 22.703 137.728 -42.599 1.00 57.73 ? 148 LEU A CD1 1 
ATOM   1177 C CD2 . LEU A 1 149 ? 23.667 140.025 -42.403 1.00 57.60 ? 148 LEU A CD2 1 
ATOM   1178 N N   . ALA A 1 150 ? 18.555 140.897 -40.540 1.00 60.89 ? 149 ALA A N   1 
ATOM   1179 C CA  . ALA A 1 150 ? 17.224 141.473 -40.754 1.00 62.45 ? 149 ALA A CA  1 
ATOM   1180 C C   . ALA A 1 150 ? 17.133 142.913 -40.246 1.00 63.95 ? 149 ALA A C   1 
ATOM   1181 O O   . ALA A 1 150 ? 16.454 143.746 -40.848 1.00 65.06 ? 149 ALA A O   1 
ATOM   1182 C CB  . ALA A 1 150 ? 16.161 140.613 -40.083 1.00 61.98 ? 149 ALA A CB  1 
ATOM   1183 N N   . ALA A 1 151 ? 17.825 143.199 -39.144 1.00 64.40 ? 150 ALA A N   1 
ATOM   1184 C CA  . ALA A 1 151 ? 17.834 144.538 -38.554 1.00 65.80 ? 150 ALA A CA  1 
ATOM   1185 C C   . ALA A 1 151 ? 18.683 145.554 -39.335 1.00 66.53 ? 150 ALA A C   1 
ATOM   1186 O O   . ALA A 1 151 ? 18.603 146.753 -39.064 1.00 67.09 ? 150 ALA A O   1 
ATOM   1187 C CB  . ALA A 1 151 ? 18.310 144.466 -37.109 1.00 65.16 ? 150 ALA A CB  1 
ATOM   1188 N N   . LEU A 1 152 ? 19.481 145.086 -40.297 1.00 66.72 ? 151 LEU A N   1 
ATOM   1189 C CA  . LEU A 1 152 ? 20.353 145.962 -41.091 1.00 68.29 ? 151 LEU A CA  1 
ATOM   1190 C C   . LEU A 1 152 ? 19.776 146.352 -42.463 1.00 70.96 ? 151 LEU A C   1 
ATOM   1191 O O   . LEU A 1 152 ? 20.518 146.472 -43.443 1.00 71.41 ? 151 LEU A O   1 
ATOM   1192 C CB  . LEU A 1 152 ? 21.718 145.290 -41.284 1.00 67.14 ? 151 LEU A CB  1 
ATOM   1193 C CG  . LEU A 1 152 ? 22.481 144.885 -40.022 1.00 65.75 ? 151 LEU A CG  1 
ATOM   1194 C CD1 . LEU A 1 152 ? 23.796 144.222 -40.406 1.00 64.60 ? 151 LEU A CD1 1 
ATOM   1195 C CD2 . LEU A 1 152 ? 22.727 146.077 -39.111 1.00 66.08 ? 151 LEU A CD2 1 
ATOM   1196 N N   . THR A 1 153 ? 18.461 146.558 -42.529 1.00 73.81 ? 152 THR A N   1 
ATOM   1197 C CA  . THR A 1 153 ? 17.788 146.954 -43.772 1.00 75.56 ? 152 THR A CA  1 
ATOM   1198 C C   . THR A 1 153 ? 16.680 147.962 -43.483 1.00 77.52 ? 152 THR A C   1 
ATOM   1199 O O   . THR A 1 153 ? 15.928 147.812 -42.519 1.00 78.83 ? 152 THR A O   1 
ATOM   1200 C CB  . THR A 1 153 ? 17.178 145.743 -44.511 1.00 75.44 ? 152 THR A CB  1 
ATOM   1201 O OG1 . THR A 1 153 ? 16.378 144.976 -43.601 1.00 74.97 ? 152 THR A OG1 1 
ATOM   1202 C CG2 . THR A 1 153 ? 18.268 144.851 -45.099 1.00 74.56 ? 152 THR A CG2 1 
ATOM   1203 N N   . HIS B 1 1   ? 6.227  95.497  -31.287 1.00 53.97 ? 0   HIS B N   1 
ATOM   1204 C CA  . HIS B 1 1   ? 5.457  96.641  -31.865 1.00 53.19 ? 0   HIS B CA  1 
ATOM   1205 C C   . HIS B 1 1   ? 5.535  97.893  -30.986 1.00 49.29 ? 0   HIS B C   1 
ATOM   1206 O O   . HIS B 1 1   ? 5.397  97.819  -29.763 1.00 46.53 ? 0   HIS B O   1 
ATOM   1207 C CB  . HIS B 1 1   ? 3.990  96.251  -32.090 1.00 55.96 ? 0   HIS B CB  1 
ATOM   1208 C CG  . HIS B 1 1   ? 3.116  97.398  -32.498 1.00 59.18 ? 0   HIS B CG  1 
ATOM   1209 N ND1 . HIS B 1 1   ? 2.347  98.103  -31.596 1.00 60.61 ? 0   HIS B ND1 1 
ATOM   1210 C CD2 . HIS B 1 1   ? 2.902  97.974  -33.705 1.00 61.25 ? 0   HIS B CD2 1 
ATOM   1211 C CE1 . HIS B 1 1   ? 1.690  99.057  -32.231 1.00 61.83 ? 0   HIS B CE1 1 
ATOM   1212 N NE2 . HIS B 1 1   ? 2.010  99.002  -33.511 1.00 62.56 ? 0   HIS B NE2 1 
ATOM   1213 N N   . MET B 1 2   ? 5.751  99.035  -31.637 1.00 52.67 ? 1   MET B N   1 
ATOM   1214 C CA  . MET B 1 2   ? 5.842  100.335 -30.974 1.00 50.75 ? 1   MET B CA  1 
ATOM   1215 C C   . MET B 1 2   ? 4.695  100.676 -30.041 1.00 48.73 ? 1   MET B C   1 
ATOM   1216 O O   . MET B 1 2   ? 3.557  100.256 -30.258 1.00 48.79 ? 1   MET B O   1 
ATOM   1217 C CB  . MET B 1 2   ? 5.858  101.453 -32.016 1.00 51.51 ? 1   MET B CB  1 
ATOM   1218 C CG  . MET B 1 2   ? 7.208  101.796 -32.591 1.00 51.62 ? 1   MET B CG  1 
ATOM   1219 S SD  . MET B 1 2   ? 7.018  103.225 -33.671 1.00 52.69 ? 1   MET B SD  1 
ATOM   1220 C CE  . MET B 1 2   ? 8.668  103.901 -33.586 1.00 51.32 ? 1   MET B CE  1 
ATOM   1221 N N   . LEU B 1 3   ? 5.001  101.464 -29.013 1.00 45.71 ? 2   LEU B N   1 
ATOM   1222 C CA  . LEU B 1 3   ? 3.966  101.984 -28.144 1.00 44.52 ? 2   LEU B CA  1 
ATOM   1223 C C   . LEU B 1 3   ? 3.241  103.005 -29.004 1.00 43.24 ? 2   LEU B C   1 
ATOM   1224 O O   . LEU B 1 3   ? 3.872  103.748 -29.759 1.00 42.17 ? 2   LEU B O   1 
ATOM   1225 C CB  . LEU B 1 3   ? 4.537  102.650 -26.896 1.00 44.41 ? 2   LEU B CB  1 
ATOM   1226 C CG  . LEU B 1 3   ? 5.236  101.752 -25.877 1.00 44.64 ? 2   LEU B CG  1 
ATOM   1227 C CD1 . LEU B 1 3   ? 5.696  102.604 -24.705 1.00 44.70 ? 2   LEU B CD1 1 
ATOM   1228 C CD2 . LEU B 1 3   ? 4.323  100.632 -25.400 1.00 45.08 ? 2   LEU B CD2 1 
ATOM   1229 N N   . ASN B 1 4   ? 1.920  103.028 -28.902 1.00 42.26 ? 3   ASN B N   1 
ATOM   1230 C CA  . ASN B 1 4   ? 1.111  103.927 -29.712 1.00 42.10 ? 3   ASN B CA  1 
ATOM   1231 C C   . ASN B 1 4   ? 0.966  105.317 -29.120 1.00 41.10 ? 3   ASN B C   1 
ATOM   1232 O O   . ASN B 1 4   ? 1.272  105.547 -27.948 1.00 40.87 ? 3   ASN B O   1 
ATOM   1233 C CB  . ASN B 1 4   ? -0.270 103.310 -29.933 1.00 42.91 ? 3   ASN B CB  1 
ATOM   1234 C CG  . ASN B 1 4   ? -0.207 102.034 -30.747 1.00 43.63 ? 3   ASN B CG  1 
ATOM   1235 O OD1 . ASN B 1 4   ? 0.340  102.017 -31.852 1.00 43.49 ? 3   ASN B OD1 1 
ATOM   1236 N ND2 . ASN B 1 4   ? -0.781 100.961 -30.214 1.00 44.16 ? 3   ASN B ND2 1 
ATOM   1237 N N   . VAL B 1 5   ? 0.500  106.237 -29.960 1.00 40.29 ? 4   VAL B N   1 
ATOM   1238 C CA  . VAL B 1 5   ? 0.226  107.610 -29.557 1.00 40.15 ? 4   VAL B CA  1 
ATOM   1239 C C   . VAL B 1 5   ? -0.829 107.551 -28.450 1.00 40.07 ? 4   VAL B C   1 
ATOM   1240 O O   . VAL B 1 5   ? -1.762 106.757 -28.526 1.00 39.43 ? 4   VAL B O   1 
ATOM   1241 C CB  . VAL B 1 5   ? -0.297 108.448 -30.746 1.00 40.55 ? 4   VAL B CB  1 
ATOM   1242 C CG1 . VAL B 1 5   ? -0.797 109.811 -30.280 1.00 41.42 ? 4   VAL B CG1 1 
ATOM   1243 C CG2 . VAL B 1 5   ? 0.781  108.602 -31.813 1.00 39.99 ? 4   VAL B CG2 1 
ATOM   1244 N N   . GLY B 1 6   ? -0.664 108.368 -27.414 1.00 39.89 ? 5   GLY B N   1 
ATOM   1245 C CA  . GLY B 1 6   ? -1.599 108.381 -26.285 1.00 40.16 ? 5   GLY B CA  1 
ATOM   1246 C C   . GLY B 1 6   ? -1.145 107.536 -25.104 1.00 39.69 ? 5   GLY B C   1 
ATOM   1247 O O   . GLY B 1 6   ? -1.643 107.705 -23.993 1.00 39.92 ? 5   GLY B O   1 
ATOM   1248 N N   . ALA B 1 7   ? -0.211 106.619 -25.336 1.00 39.34 ? 6   ALA B N   1 
ATOM   1249 C CA  . ALA B 1 7   ? 0.323  105.789 -24.264 1.00 39.42 ? 6   ALA B CA  1 
ATOM   1250 C C   . ALA B 1 7   ? 1.275  106.617 -23.412 1.00 39.48 ? 6   ALA B C   1 
ATOM   1251 O O   . ALA B 1 7   ? 1.898  107.565 -23.899 1.00 38.91 ? 6   ALA B O   1 
ATOM   1252 C CB  . ALA B 1 7   ? 1.047  104.581 -24.835 1.00 38.94 ? 6   ALA B CB  1 
ATOM   1253 N N   . THR B 1 8   ? 1.374  106.256 -22.138 1.00 40.07 ? 7   THR B N   1 
ATOM   1254 C CA  . THR B 1 8   ? 2.273  106.929 -21.216 1.00 40.54 ? 7   THR B CA  1 
ATOM   1255 C C   . THR B 1 8   ? 3.689  106.480 -21.548 1.00 39.93 ? 7   THR B C   1 
ATOM   1256 O O   . THR B 1 8   ? 3.950  105.285 -21.666 1.00 40.32 ? 7   THR B O   1 
ATOM   1257 C CB  . THR B 1 8   ? 1.952  106.568 -19.754 1.00 41.53 ? 7   THR B CB  1 
ATOM   1258 O OG1 . THR B 1 8   ? 0.565  106.812 -19.497 1.00 42.87 ? 7   THR B OG1 1 
ATOM   1259 C CG2 . THR B 1 8   ? 2.803  107.389 -18.782 1.00 41.87 ? 7   THR B CG2 1 
ATOM   1260 N N   . ALA B 1 9   ? 4.593  107.439 -21.714 1.00 39.33 ? 8   ALA B N   1 
ATOM   1261 C CA  . ALA B 1 9   ? 5.975  107.133 -22.046 1.00 38.59 ? 8   ALA B CA  1 
ATOM   1262 C C   . ALA B 1 9   ? 6.646  106.466 -20.854 1.00 38.84 ? 8   ALA B C   1 
ATOM   1263 O O   . ALA B 1 9   ? 6.671  107.045 -19.766 1.00 39.52 ? 8   ALA B O   1 
ATOM   1264 C CB  . ALA B 1 9   ? 6.718  108.404 -22.426 1.00 38.18 ? 8   ALA B CB  1 
ATOM   1265 N N   . PRO B 1 10  ? 7.164  105.235 -21.038 1.00 38.69 ? 9   PRO B N   1 
ATOM   1266 C CA  . PRO B 1 10  ? 7.852  104.600 -19.922 1.00 39.14 ? 9   PRO B CA  1 
ATOM   1267 C C   . PRO B 1 10  ? 9.032  105.433 -19.451 1.00 39.53 ? 9   PRO B C   1 
ATOM   1268 O O   . PRO B 1 10  ? 9.802  105.952 -20.265 1.00 39.06 ? 9   PRO B O   1 
ATOM   1269 C CB  . PRO B 1 10  ? 8.333  103.275 -20.514 1.00 38.88 ? 9   PRO B CB  1 
ATOM   1270 C CG  . PRO B 1 10  ? 7.335  102.968 -21.572 1.00 38.71 ? 9   PRO B CG  1 
ATOM   1271 C CD  . PRO B 1 10  ? 6.987  104.301 -22.165 1.00 38.54 ? 9   PRO B CD  1 
ATOM   1272 N N   . ASP B 1 11  ? 9.149  105.567 -18.140 1.00 40.57 ? 10  ASP B N   1 
ATOM   1273 C CA  . ASP B 1 11  ? 10.220 106.334 -17.538 1.00 41.08 ? 10  ASP B CA  1 
ATOM   1274 C C   . ASP B 1 11  ? 11.530 105.583 -17.659 1.00 39.56 ? 10  ASP B C   1 
ATOM   1275 O O   . ASP B 1 11  ? 11.548 104.357 -17.752 1.00 39.27 ? 10  ASP B O   1 
ATOM   1276 C CB  . ASP B 1 11  ? 9.917  106.578 -16.064 1.00 43.58 ? 10  ASP B CB  1 
ATOM   1277 C CG  . ASP B 1 11  ? 8.667  107.405 -15.853 1.00 45.96 ? 10  ASP B CG  1 
ATOM   1278 O OD1 . ASP B 1 11  ? 8.416  108.329 -16.660 1.00 47.12 ? 10  ASP B OD1 1 
ATOM   1279 O OD2 . ASP B 1 11  ? 7.955  107.153 -14.856 1.00 48.49 ? 10  ASP B OD2 1 
ATOM   1280 N N   . PHE B 1 12  ? 12.626 106.329 -17.667 1.00 37.96 ? 11  PHE B N   1 
ATOM   1281 C CA  . PHE B 1 12  ? 13.945 105.730 -17.733 1.00 36.92 ? 11  PHE B CA  1 
ATOM   1282 C C   . PHE B 1 12  ? 14.997 106.710 -17.253 1.00 36.24 ? 11  PHE B C   1 
ATOM   1283 O O   . PHE B 1 12  ? 14.800 107.921 -17.299 1.00 35.77 ? 11  PHE B O   1 
ATOM   1284 C CB  . PHE B 1 12  ? 14.281 105.279 -19.165 1.00 36.38 ? 11  PHE B CB  1 
ATOM   1285 C CG  . PHE B 1 12  ? 14.352 106.407 -20.166 1.00 35.41 ? 11  PHE B CG  1 
ATOM   1286 C CD1 . PHE B 1 12  ? 15.481 107.213 -20.249 1.00 34.85 ? 11  PHE B CD1 1 
ATOM   1287 C CD2 . PHE B 1 12  ? 13.301 106.648 -21.038 1.00 35.14 ? 11  PHE B CD2 1 
ATOM   1288 C CE1 . PHE B 1 12  ? 15.549 108.248 -21.164 1.00 34.73 ? 11  PHE B CE1 1 
ATOM   1289 C CE2 . PHE B 1 12  ? 13.366 107.677 -21.963 1.00 34.84 ? 11  PHE B CE2 1 
ATOM   1290 C CZ  . PHE B 1 12  ? 14.493 108.479 -22.024 1.00 34.55 ? 11  PHE B CZ  1 
ATOM   1291 N N   . THR B 1 13  ? 16.103 106.161 -16.773 1.00 36.46 ? 12  THR B N   1 
ATOM   1292 C CA  . THR B 1 13  ? 17.261 106.943 -16.385 1.00 36.70 ? 12  THR B CA  1 
ATOM   1293 C C   . THR B 1 13  ? 18.438 106.249 -17.045 1.00 36.05 ? 12  THR B C   1 
ATOM   1294 O O   . THR B 1 13  ? 18.706 105.081 -16.768 1.00 36.05 ? 12  THR B O   1 
ATOM   1295 C CB  . THR B 1 13  ? 17.453 107.011 -14.863 1.00 38.05 ? 12  THR B CB  1 
ATOM   1296 O OG1 . THR B 1 13  ? 16.357 107.727 -14.279 1.00 38.95 ? 12  THR B OG1 1 
ATOM   1297 C CG2 . THR B 1 13  ? 18.750 107.733 -14.521 1.00 38.17 ? 12  THR B CG2 1 
ATOM   1298 N N   . LEU B 1 14  ? 19.113 106.962 -17.941 1.00 35.08 ? 13  LEU B N   1 
ATOM   1299 C CA  . LEU B 1 14  ? 20.242 106.405 -18.667 1.00 34.74 ? 13  LEU B CA  1 
ATOM   1300 C C   . LEU B 1 14  ? 21.416 107.372 -18.667 1.00 34.86 ? 13  LEU B C   1 
ATOM   1301 O O   . LEU B 1 14  ? 21.239 108.582 -18.529 1.00 35.00 ? 13  LEU B O   1 
ATOM   1302 C CB  . LEU B 1 14  ? 19.837 106.097 -20.110 1.00 34.04 ? 13  LEU B CB  1 
ATOM   1303 C CG  . LEU B 1 14  ? 18.689 105.112 -20.343 1.00 33.81 ? 13  LEU B CG  1 
ATOM   1304 C CD1 . LEU B 1 14  ? 18.318 105.088 -21.817 1.00 33.38 ? 13  LEU B CD1 1 
ATOM   1305 C CD2 . LEU B 1 14  ? 19.031 103.713 -19.850 1.00 34.09 ? 13  LEU B CD2 1 
ATOM   1306 N N   . ARG B 1 15  ? 22.611 106.815 -18.827 1.00 35.12 ? 14  ARG B N   1 
ATOM   1307 C CA  . ARG B 1 15  ? 23.848 107.587 -18.878 1.00 36.05 ? 14  ARG B CA  1 
ATOM   1308 C C   . ARG B 1 15  ? 24.046 108.200 -20.257 1.00 35.04 ? 14  ARG B C   1 
ATOM   1309 O O   . ARG B 1 15  ? 23.880 107.514 -21.266 1.00 34.15 ? 14  ARG B O   1 
ATOM   1310 C CB  . ARG B 1 15  ? 25.044 106.672 -18.599 1.00 37.09 ? 14  ARG B CB  1 
ATOM   1311 C CG  . ARG B 1 15  ? 25.091 106.084 -17.201 1.00 38.66 ? 14  ARG B CG  1 
ATOM   1312 C CD  . ARG B 1 15  ? 25.609 107.092 -16.194 1.00 40.01 ? 14  ARG B CD  1 
ATOM   1313 N NE  . ARG B 1 15  ? 25.557 106.565 -14.833 1.00 41.86 ? 14  ARG B NE  1 
ATOM   1314 C CZ  . ARG B 1 15  ? 26.015 107.196 -13.754 1.00 42.67 ? 14  ARG B CZ  1 
ATOM   1315 N NH1 . ARG B 1 15  ? 26.587 108.391 -13.857 1.00 43.00 ? 14  ARG B NH1 1 
ATOM   1316 N NH2 . ARG B 1 15  ? 25.907 106.619 -12.562 1.00 43.54 ? 14  ARG B NH2 1 
ATOM   1317 N N   . ASP B 1 16  ? 24.408 109.481 -20.304 1.00 35.22 ? 15  ASP B N   1 
ATOM   1318 C CA  . ASP B 1 16  ? 24.701 110.133 -21.582 1.00 35.50 ? 15  ASP B CA  1 
ATOM   1319 C C   . ASP B 1 16  ? 26.177 109.869 -21.911 1.00 34.82 ? 15  ASP B C   1 
ATOM   1320 O O   . ASP B 1 16  ? 26.849 109.140 -21.180 1.00 34.72 ? 15  ASP B O   1 
ATOM   1321 C CB  . ASP B 1 16  ? 24.358 111.634 -21.561 1.00 36.57 ? 15  ASP B CB  1 
ATOM   1322 C CG  . ASP B 1 16  ? 25.324 112.472 -20.724 1.00 38.55 ? 15  ASP B CG  1 
ATOM   1323 O OD1 . ASP B 1 16  ? 26.257 111.917 -20.099 1.00 39.72 ? 15  ASP B OD1 1 
ATOM   1324 O OD2 . ASP B 1 16  ? 25.149 113.712 -20.705 1.00 40.09 ? 15  ASP B OD2 1 
ATOM   1325 N N   . GLN B 1 17  ? 26.681 110.451 -22.995 1.00 34.31 ? 16  GLN B N   1 
ATOM   1326 C CA  . GLN B 1 17  ? 28.078 110.229 -23.396 1.00 34.46 ? 16  GLN B CA  1 
ATOM   1327 C C   . GLN B 1 17  ? 29.126 110.734 -22.391 1.00 35.81 ? 16  GLN B C   1 
ATOM   1328 O O   . GLN B 1 17  ? 30.264 110.265 -22.406 1.00 35.62 ? 16  GLN B O   1 
ATOM   1329 C CB  . GLN B 1 17  ? 28.380 110.788 -24.795 1.00 33.27 ? 16  GLN B CB  1 
ATOM   1330 C CG  . GLN B 1 17  ? 28.204 112.290 -25.003 1.00 32.69 ? 16  GLN B CG  1 
ATOM   1331 C CD  . GLN B 1 17  ? 26.788 112.681 -25.391 1.00 32.02 ? 16  GLN B CD  1 
ATOM   1332 O OE1 . GLN B 1 17  ? 25.817 112.199 -24.810 1.00 31.36 ? 16  GLN B OE1 1 
ATOM   1333 N NE2 . GLN B 1 17  ? 26.666 113.563 -26.377 1.00 31.35 ? 16  GLN B NE2 1 
ATOM   1334 N N   . ASN B 1 18  ? 28.746 111.688 -21.540 1.00 37.66 ? 17  ASN B N   1 
ATOM   1335 C CA  . ASN B 1 18  ? 29.634 112.229 -20.504 1.00 39.14 ? 17  ASN B CA  1 
ATOM   1336 C C   . ASN B 1 18  ? 29.356 111.631 -19.121 1.00 40.72 ? 17  ASN B C   1 
ATOM   1337 O O   . ASN B 1 18  ? 29.758 112.197 -18.107 1.00 41.54 ? 17  ASN B O   1 
ATOM   1338 C CB  . ASN B 1 18  ? 29.495 113.753 -20.447 1.00 39.56 ? 17  ASN B CB  1 
ATOM   1339 C CG  . ASN B 1 18  ? 29.923 114.430 -21.737 1.00 39.59 ? 17  ASN B CG  1 
ATOM   1340 O OD1 . ASN B 1 18  ? 30.911 114.040 -22.360 1.00 40.87 ? 17  ASN B OD1 1 
ATOM   1341 N ND2 . ASN B 1 18  ? 29.191 115.465 -22.134 1.00 39.69 ? 17  ASN B ND2 1 
ATOM   1342 N N   . GLN B 1 19  ? 28.656 110.496 -19.090 1.00 42.91 ? 18  GLN B N   1 
ATOM   1343 C CA  . GLN B 1 19  ? 28.303 109.780 -17.854 1.00 44.05 ? 18  GLN B CA  1 
ATOM   1344 C C   . GLN B 1 19  ? 27.244 110.451 -16.967 1.00 44.16 ? 18  GLN B C   1 
ATOM   1345 O O   . GLN B 1 19  ? 26.954 109.947 -15.883 1.00 44.06 ? 18  GLN B O   1 
ATOM   1346 C CB  . GLN B 1 19  ? 29.556 109.454 -17.020 1.00 45.83 ? 18  GLN B CB  1 
ATOM   1347 C CG  . GLN B 1 19  ? 30.595 108.594 -17.729 1.00 47.02 ? 18  GLN B CG  1 
ATOM   1348 C CD  . GLN B 1 19  ? 30.156 107.154 -17.939 1.00 48.60 ? 18  GLN B CD  1 
ATOM   1349 O OE1 . GLN B 1 19  ? 29.066 106.747 -17.526 1.00 50.48 ? 18  GLN B OE1 1 
ATOM   1350 N NE2 . GLN B 1 19  ? 31.015 106.368 -18.579 1.00 49.37 ? 18  GLN B NE2 1 
ATOM   1351 N N   . GLN B 1 20  ? 26.660 111.566 -17.407 1.00 44.59 ? 19  GLN B N   1 
ATOM   1352 C CA  . GLN B 1 20  ? 25.608 112.219 -16.624 1.00 45.34 ? 19  GLN B CA  1 
ATOM   1353 C C   . GLN B 1 20  ? 24.326 111.407 -16.752 1.00 44.67 ? 19  GLN B C   1 
ATOM   1354 O O   . GLN B 1 20  ? 24.075 110.803 -17.791 1.00 44.97 ? 19  GLN B O   1 
ATOM   1355 C CB  . GLN B 1 20  ? 25.318 113.646 -17.103 1.00 46.57 ? 19  GLN B CB  1 
ATOM   1356 C CG  . GLN B 1 20  ? 26.495 114.607 -17.107 1.00 47.99 ? 19  GLN B CG  1 
ATOM   1357 C CD  . GLN B 1 20  ? 26.051 116.066 -17.154 1.00 49.51 ? 19  GLN B CD  1 
ATOM   1358 O OE1 . GLN B 1 20  ? 26.361 116.799 -18.098 1.00 49.28 ? 19  GLN B OE1 1 
ATOM   1359 N NE2 . GLN B 1 20  ? 25.303 116.488 -16.136 1.00 50.32 ? 19  GLN B NE2 1 
ATOM   1360 N N   . LEU B 1 21  ? 23.518 111.403 -15.698 1.00 44.65 ? 20  LEU B N   1 
ATOM   1361 C CA  . LEU B 1 21  ? 22.240 110.703 -15.709 1.00 44.27 ? 20  LEU B CA  1 
ATOM   1362 C C   . LEU B 1 21  ? 21.181 111.609 -16.309 1.00 43.09 ? 20  LEU B C   1 
ATOM   1363 O O   . LEU B 1 21  ? 21.072 112.777 -15.940 1.00 42.93 ? 20  LEU B O   1 
ATOM   1364 C CB  . LEU B 1 21  ? 21.826 110.293 -14.293 1.00 45.46 ? 20  LEU B CB  1 
ATOM   1365 C CG  . LEU B 1 21  ? 22.655 109.195 -13.621 1.00 46.26 ? 20  LEU B CG  1 
ATOM   1366 C CD1 . LEU B 1 21  ? 22.369 109.149 -12.129 1.00 47.25 ? 20  LEU B CD1 1 
ATOM   1367 C CD2 . LEU B 1 21  ? 22.395 107.837 -14.259 1.00 46.30 ? 20  LEU B CD2 1 
ATOM   1368 N N   . VAL B 1 22  ? 20.415 111.067 -17.249 1.00 42.31 ? 21  VAL B N   1 
ATOM   1369 C CA  . VAL B 1 22  ? 19.335 111.801 -17.895 1.00 41.59 ? 21  VAL B CA  1 
ATOM   1370 C C   . VAL B 1 22  ? 18.048 111.030 -17.662 1.00 40.74 ? 21  VAL B C   1 
ATOM   1371 O O   . VAL B 1 22  ? 17.953 109.850 -17.994 1.00 39.13 ? 21  VAL B O   1 
ATOM   1372 C CB  . VAL B 1 22  ? 19.585 111.983 -19.405 1.00 41.48 ? 21  VAL B CB  1 
ATOM   1373 C CG1 . VAL B 1 22  ? 18.373 112.614 -20.085 1.00 41.42 ? 21  VAL B CG1 1 
ATOM   1374 C CG2 . VAL B 1 22  ? 20.834 112.827 -19.631 1.00 41.15 ? 21  VAL B CG2 1 
ATOM   1375 N N   . THR B 1 23  ? 17.069 111.706 -17.070 1.00 41.06 ? 22  THR B N   1 
ATOM   1376 C CA  . THR B 1 23  ? 15.780 111.108 -16.769 1.00 41.45 ? 22  THR B CA  1 
ATOM   1377 C C   . THR B 1 23  ? 14.710 111.783 -17.610 1.00 41.34 ? 22  THR B C   1 
ATOM   1378 O O   . THR B 1 23  ? 14.658 113.012 -17.682 1.00 41.06 ? 22  THR B O   1 
ATOM   1379 C CB  . THR B 1 23  ? 15.436 111.271 -15.277 1.00 42.09 ? 22  THR B CB  1 
ATOM   1380 O OG1 . THR B 1 23  ? 16.486 110.707 -14.483 1.00 42.91 ? 22  THR B OG1 1 
ATOM   1381 C CG2 . THR B 1 23  ? 14.127 110.576 -14.936 1.00 42.52 ? 22  THR B CG2 1 
ATOM   1382 N N   . LEU B 1 24  ? 13.863 110.979 -18.246 1.00 41.64 ? 23  LEU B N   1 
ATOM   1383 C CA  . LEU B 1 24  ? 12.780 111.506 -19.074 1.00 42.26 ? 23  LEU B CA  1 
ATOM   1384 C C   . LEU B 1 24  ? 11.837 112.405 -18.271 1.00 43.63 ? 23  LEU B C   1 
ATOM   1385 O O   . LEU B 1 24  ? 11.455 113.477 -18.741 1.00 42.50 ? 23  LEU B O   1 
ATOM   1386 C CB  . LEU B 1 24  ? 11.982 110.366 -19.719 1.00 41.98 ? 23  LEU B CB  1 
ATOM   1387 C CG  . LEU B 1 24  ? 10.769 110.772 -20.568 1.00 41.76 ? 23  LEU B CG  1 
ATOM   1388 C CD1 . LEU B 1 24  ? 11.166 111.733 -21.679 1.00 41.43 ? 23  LEU B CD1 1 
ATOM   1389 C CD2 . LEU B 1 24  ? 10.087 109.543 -21.146 1.00 41.74 ? 23  LEU B CD2 1 
ATOM   1390 N N   . ARG B 1 25  ? 11.475 111.972 -17.062 1.00 46.00 ? 24  ARG B N   1 
ATOM   1391 C CA  . ARG B 1 25  ? 10.559 112.742 -16.208 1.00 48.92 ? 24  ARG B CA  1 
ATOM   1392 C C   . ARG B 1 25  ? 11.109 114.108 -15.790 1.00 47.51 ? 24  ARG B C   1 
ATOM   1393 O O   . ARG B 1 25  ? 10.339 114.988 -15.415 1.00 48.72 ? 24  ARG B O   1 
ATOM   1394 C CB  . ARG B 1 25  ? 10.113 111.927 -14.986 1.00 52.86 ? 24  ARG B CB  1 
ATOM   1395 C CG  . ARG B 1 25  ? 9.035  112.617 -14.156 1.00 57.05 ? 24  ARG B CG  1 
ATOM   1396 C CD  . ARG B 1 25  ? 8.248  111.672 -13.255 1.00 60.67 ? 24  ARG B CD  1 
ATOM   1397 N NE  . ARG B 1 25  ? 9.068  111.019 -12.237 1.00 64.19 ? 24  ARG B NE  1 
ATOM   1398 C CZ  . ARG B 1 25  ? 9.678  109.844 -12.390 1.00 66.41 ? 24  ARG B CZ  1 
ATOM   1399 N NH1 . ARG B 1 25  ? 9.551  109.150 -13.514 1.00 67.22 ? 24  ARG B NH1 1 
ATOM   1400 N NH2 . ARG B 1 25  ? 10.411 109.344 -11.399 1.00 67.79 ? 24  ARG B NH2 1 
ATOM   1401 N N   . GLY B 1 26  ? 12.425 114.296 -15.869 1.00 45.61 ? 25  GLY B N   1 
ATOM   1402 C CA  . GLY B 1 26  ? 13.032 115.591 -15.578 1.00 44.59 ? 25  GLY B CA  1 
ATOM   1403 C C   . GLY B 1 26  ? 12.552 116.684 -16.525 1.00 43.63 ? 25  GLY B C   1 
ATOM   1404 O O   . GLY B 1 26  ? 12.691 117.870 -16.225 1.00 43.16 ? 25  GLY B O   1 
ATOM   1405 N N   . TYR B 1 27  ? 11.997 116.287 -17.673 1.00 42.40 ? 26  TYR B N   1 
ATOM   1406 C CA  . TYR B 1 27  ? 11.467 117.230 -18.660 1.00 41.91 ? 26  TYR B CA  1 
ATOM   1407 C C   . TYR B 1 27  ? 9.968  117.508 -18.505 1.00 41.48 ? 26  TYR B C   1 
ATOM   1408 O O   . TYR B 1 27  ? 9.455  118.438 -19.127 1.00 40.42 ? 26  TYR B O   1 
ATOM   1409 C CB  . TYR B 1 27  ? 11.762 116.739 -20.082 1.00 41.91 ? 26  TYR B CB  1 
ATOM   1410 C CG  . TYR B 1 27  ? 13.240 116.669 -20.403 1.00 41.93 ? 26  TYR B CG  1 
ATOM   1411 C CD1 . TYR B 1 27  ? 13.943 117.807 -20.786 1.00 42.10 ? 26  TYR B CD1 1 
ATOM   1412 C CD2 . TYR B 1 27  ? 13.934 115.465 -20.329 1.00 42.19 ? 26  TYR B CD2 1 
ATOM   1413 C CE1 . TYR B 1 27  ? 15.295 117.747 -21.080 1.00 42.47 ? 26  TYR B CE1 1 
ATOM   1414 C CE2 . TYR B 1 27  ? 15.285 115.395 -20.622 1.00 42.10 ? 26  TYR B CE2 1 
ATOM   1415 C CZ  . TYR B 1 27  ? 15.961 116.537 -20.996 1.00 42.21 ? 26  TYR B CZ  1 
ATOM   1416 O OH  . TYR B 1 27  ? 17.304 116.468 -21.286 1.00 43.32 ? 26  TYR B OH  1 
ATOM   1417 N N   . ARG B 1 28  ? 9.267  116.709 -17.699 1.00 42.35 ? 27  ARG B N   1 
ATOM   1418 C CA  . ARG B 1 28  ? 7.830  116.929 -17.459 1.00 43.69 ? 27  ARG B CA  1 
ATOM   1419 C C   . ARG B 1 28  ? 7.514  118.324 -16.929 1.00 43.22 ? 27  ARG B C   1 
ATOM   1420 O O   . ARG B 1 28  ? 8.138  118.798 -15.983 1.00 43.58 ? 27  ARG B O   1 
ATOM   1421 C CB  . ARG B 1 28  ? 7.216  115.859 -16.539 1.00 45.86 ? 27  ARG B CB  1 
ATOM   1422 C CG  . ARG B 1 28  ? 6.284  114.902 -17.265 1.00 47.48 ? 27  ARG B CG  1 
ATOM   1423 C CD  . ARG B 1 28  ? 5.721  113.811 -16.366 1.00 49.99 ? 27  ARG B CD  1 
ATOM   1424 N NE  . ARG B 1 28  ? 6.421  112.534 -16.500 1.00 51.43 ? 27  ARG B NE  1 
ATOM   1425 C CZ  . ARG B 1 28  ? 6.116  111.430 -15.817 1.00 53.73 ? 27  ARG B CZ  1 
ATOM   1426 N NH1 . ARG B 1 28  ? 5.141  111.438 -14.908 1.00 55.03 ? 27  ARG B NH1 1 
ATOM   1427 N NH2 . ARG B 1 28  ? 6.806  110.313 -16.026 1.00 53.74 ? 27  ARG B NH2 1 
ATOM   1428 N N   . GLY B 1 29  ? 6.546  118.971 -17.572 1.00 42.56 ? 28  GLY B N   1 
ATOM   1429 C CA  . GLY B 1 29  ? 6.127  120.319 -17.217 1.00 43.15 ? 28  GLY B CA  1 
ATOM   1430 C C   . GLY B 1 29  ? 6.987  121.416 -17.822 1.00 43.09 ? 28  GLY B C   1 
ATOM   1431 O O   . GLY B 1 29  ? 6.660  122.597 -17.688 1.00 43.98 ? 28  GLY B O   1 
ATOM   1432 N N   . ALA B 1 30  ? 8.067  121.036 -18.508 1.00 41.85 ? 29  ALA B N   1 
ATOM   1433 C CA  . ALA B 1 30  ? 9.004  122.000 -19.081 1.00 40.86 ? 29  ALA B CA  1 
ATOM   1434 C C   . ALA B 1 30  ? 9.150  121.880 -20.596 1.00 39.73 ? 29  ALA B C   1 
ATOM   1435 O O   . ALA B 1 30  ? 8.908  122.843 -21.326 1.00 40.10 ? 29  ALA B O   1 
ATOM   1436 C CB  . ALA B 1 30  ? 10.366 121.842 -18.419 1.00 40.52 ? 29  ALA B CB  1 
ATOM   1437 N N   . LYS B 1 31  ? 9.547  120.701 -21.067 1.00 38.14 ? 30  LYS B N   1 
ATOM   1438 C CA  . LYS B 1 31  ? 9.798  120.505 -22.489 1.00 36.99 ? 30  LYS B CA  1 
ATOM   1439 C C   . LYS B 1 31  ? 9.190  119.250 -23.076 1.00 35.14 ? 30  LYS B C   1 
ATOM   1440 O O   . LYS B 1 31  ? 9.027  118.243 -22.392 1.00 34.13 ? 30  LYS B O   1 
ATOM   1441 C CB  . LYS B 1 31  ? 11.308 120.419 -22.733 1.00 37.25 ? 30  LYS B CB  1 
ATOM   1442 C CG  . LYS B 1 31  ? 12.097 121.626 -22.275 1.00 38.12 ? 30  LYS B CG  1 
ATOM   1443 C CD  . LYS B 1 31  ? 13.571 121.448 -22.590 1.00 38.49 ? 30  LYS B CD  1 
ATOM   1444 C CE  . LYS B 1 31  ? 14.387 122.638 -22.112 1.00 39.25 ? 30  LYS B CE  1 
ATOM   1445 N NZ  . LYS B 1 31  ? 13.948 123.900 -22.765 1.00 40.12 ? 30  LYS B NZ  1 
ATOM   1446 N N   . ASN B 1 32  ? 8.866  119.338 -24.363 1.00 33.95 ? 31  ASN B N   1 
ATOM   1447 C CA  . ASN B 1 32  ? 8.428  118.193 -25.137 1.00 33.37 ? 31  ASN B CA  1 
ATOM   1448 C C   . ASN B 1 32  ? 9.725  117.493 -25.476 1.00 32.37 ? 31  ASN B C   1 
ATOM   1449 O O   . ASN B 1 32  ? 10.734 118.153 -25.725 1.00 32.61 ? 31  ASN B O   1 
ATOM   1450 C CB  . ASN B 1 32  ? 7.722  118.631 -26.417 1.00 33.59 ? 31  ASN B CB  1 
ATOM   1451 C CG  . ASN B 1 32  ? 6.447  119.396 -26.143 1.00 34.07 ? 31  ASN B CG  1 
ATOM   1452 O OD1 . ASN B 1 32  ? 5.567  118.909 -25.440 1.00 34.40 ? 31  ASN B OD1 1 
ATOM   1453 N ND2 . ASN B 1 32  ? 6.332  120.591 -26.712 1.00 34.29 ? 31  ASN B ND2 1 
ATOM   1454 N N   . VAL B 1 33  ? 9.719  116.169 -25.492 1.00 31.33 ? 32  VAL B N   1 
ATOM   1455 C CA  . VAL B 1 33  ? 10.949 115.433 -25.731 1.00 30.40 ? 32  VAL B CA  1 
ATOM   1456 C C   . VAL B 1 33  ? 10.886 114.559 -26.972 1.00 29.65 ? 32  VAL B C   1 
ATOM   1457 O O   . VAL B 1 33  ? 9.935  113.806 -27.162 1.00 29.52 ? 32  VAL B O   1 
ATOM   1458 C CB  . VAL B 1 33  ? 11.292 114.546 -24.520 1.00 30.33 ? 32  VAL B CB  1 
ATOM   1459 C CG1 . VAL B 1 33  ? 12.664 113.912 -24.700 1.00 29.90 ? 32  VAL B CG1 1 
ATOM   1460 C CG2 . VAL B 1 33  ? 11.255 115.374 -23.247 1.00 30.71 ? 32  VAL B CG2 1 
ATOM   1461 N N   . LEU B 1 34  ? 11.919 114.670 -27.802 1.00 28.81 ? 33  LEU B N   1 
ATOM   1462 C CA  . LEU B 1 34  ? 12.062 113.855 -28.995 1.00 28.46 ? 33  LEU B CA  1 
ATOM   1463 C C   . LEU B 1 34  ? 13.002 112.710 -28.647 1.00 27.71 ? 33  LEU B C   1 
ATOM   1464 O O   . LEU B 1 34  ? 14.144 112.945 -28.250 1.00 28.07 ? 33  LEU B O   1 
ATOM   1465 C CB  . LEU B 1 34  ? 12.659 114.676 -30.141 1.00 28.54 ? 33  LEU B CB  1 
ATOM   1466 C CG  . LEU B 1 34  ? 12.930 113.945 -31.456 1.00 28.43 ? 33  LEU B CG  1 
ATOM   1467 C CD1 . LEU B 1 34  ? 11.626 113.535 -32.116 1.00 29.08 ? 33  LEU B CD1 1 
ATOM   1468 C CD2 . LEU B 1 34  ? 13.737 114.822 -32.399 1.00 28.65 ? 33  LEU B CD2 1 
ATOM   1469 N N   . LEU B 1 35  ? 12.516 111.479 -28.773 1.00 27.14 ? 34  LEU B N   1 
ATOM   1470 C CA  . LEU B 1 35  ? 13.325 110.295 -28.509 1.00 26.48 ? 34  LEU B CA  1 
ATOM   1471 C C   . LEU B 1 35  ? 13.661 109.644 -29.840 1.00 25.76 ? 34  LEU B C   1 
ATOM   1472 O O   . LEU B 1 35  ? 12.771 109.180 -30.551 1.00 25.71 ? 34  LEU B O   1 
ATOM   1473 C CB  . LEU B 1 35  ? 12.573 109.299 -27.629 1.00 26.76 ? 34  LEU B CB  1 
ATOM   1474 C CG  . LEU B 1 35  ? 12.011 109.823 -26.311 1.00 27.31 ? 34  LEU B CG  1 
ATOM   1475 C CD1 . LEU B 1 35  ? 11.297 108.698 -25.581 1.00 27.65 ? 34  LEU B CD1 1 
ATOM   1476 C CD2 . LEU B 1 35  ? 13.100 110.420 -25.434 1.00 27.67 ? 34  LEU B CD2 1 
ATOM   1477 N N   . VAL B 1 36  ? 14.944 109.617 -30.177 1.00 24.95 ? 35  VAL B N   1 
ATOM   1478 C CA  . VAL B 1 36  ? 15.394 109.021 -31.419 1.00 24.52 ? 35  VAL B CA  1 
ATOM   1479 C C   . VAL B 1 36  ? 16.173 107.752 -31.113 1.00 24.66 ? 35  VAL B C   1 
ATOM   1480 O O   . VAL B 1 36  ? 17.345 107.809 -30.741 1.00 24.42 ? 35  VAL B O   1 
ATOM   1481 C CB  . VAL B 1 36  ? 16.295 109.986 -32.217 1.00 24.06 ? 35  VAL B CB  1 
ATOM   1482 C CG1 . VAL B 1 36  ? 16.746 109.338 -33.524 1.00 23.82 ? 35  VAL B CG1 1 
ATOM   1483 C CG2 . VAL B 1 36  ? 15.566 111.295 -32.482 1.00 24.19 ? 35  VAL B CG2 1 
ATOM   1484 N N   . PHE B 1 37  ? 15.520 106.603 -31.246 1.00 24.89 ? 36  PHE B N   1 
ATOM   1485 C CA  . PHE B 1 37  ? 16.213 105.337 -31.053 1.00 25.23 ? 36  PHE B CA  1 
ATOM   1486 C C   . PHE B 1 37  ? 16.969 105.030 -32.332 1.00 25.07 ? 36  PHE B C   1 
ATOM   1487 O O   . PHE B 1 37  ? 16.482 105.312 -33.421 1.00 25.08 ? 36  PHE B O   1 
ATOM   1488 C CB  . PHE B 1 37  ? 15.249 104.197 -30.735 1.00 25.32 ? 36  PHE B CB  1 
ATOM   1489 C CG  . PHE B 1 37  ? 14.646 104.275 -29.370 1.00 25.65 ? 36  PHE B CG  1 
ATOM   1490 C CD1 . PHE B 1 37  ? 13.512 105.036 -29.139 1.00 26.09 ? 36  PHE B CD1 1 
ATOM   1491 C CD2 . PHE B 1 37  ? 15.201 103.569 -28.313 1.00 26.01 ? 36  PHE B CD2 1 
ATOM   1492 C CE1 . PHE B 1 37  ? 12.946 105.100 -27.879 1.00 26.05 ? 36  PHE B CE1 1 
ATOM   1493 C CE2 . PHE B 1 37  ? 14.640 103.631 -27.051 1.00 26.25 ? 36  PHE B CE2 1 
ATOM   1494 C CZ  . PHE B 1 37  ? 13.511 104.395 -26.835 1.00 26.29 ? 36  PHE B CZ  1 
ATOM   1495 N N   . PHE B 1 38  ? 18.167 104.479 -32.205 1.00 25.55 ? 37  PHE B N   1 
ATOM   1496 C CA  . PHE B 1 38  ? 18.939 104.095 -33.382 1.00 26.11 ? 37  PHE B CA  1 
ATOM   1497 C C   . PHE B 1 38  ? 19.694 102.806 -33.086 1.00 27.10 ? 37  PHE B C   1 
ATOM   1498 O O   . PHE B 1 38  ? 20.021 102.539 -31.928 1.00 27.94 ? 37  PHE B O   1 
ATOM   1499 C CB  . PHE B 1 38  ? 19.870 105.218 -33.839 1.00 25.63 ? 37  PHE B CB  1 
ATOM   1500 C CG  . PHE B 1 38  ? 20.958 105.551 -32.865 1.00 25.40 ? 37  PHE B CG  1 
ATOM   1501 C CD1 . PHE B 1 38  ? 20.720 106.411 -31.806 1.00 25.39 ? 37  PHE B CD1 1 
ATOM   1502 C CD2 . PHE B 1 38  ? 22.233 105.031 -33.030 1.00 25.50 ? 37  PHE B CD2 1 
ATOM   1503 C CE1 . PHE B 1 38  ? 21.728 106.728 -30.914 1.00 25.35 ? 37  PHE B CE1 1 
ATOM   1504 C CE2 . PHE B 1 38  ? 23.246 105.342 -32.143 1.00 25.33 ? 37  PHE B CE2 1 
ATOM   1505 C CZ  . PHE B 1 38  ? 22.994 106.197 -31.085 1.00 25.46 ? 37  PHE B CZ  1 
ATOM   1506 N N   . PRO B 1 39  ? 19.947 101.991 -34.127 1.00 28.03 ? 38  PRO B N   1 
ATOM   1507 C CA  . PRO B 1 39  ? 20.604 100.692 -33.934 1.00 28.75 ? 38  PRO B CA  1 
ATOM   1508 C C   . PRO B 1 39  ? 22.043 100.729 -33.406 1.00 29.66 ? 38  PRO B C   1 
ATOM   1509 O O   . PRO B 1 39  ? 22.278 100.301 -32.278 1.00 29.82 ? 38  PRO B O   1 
ATOM   1510 C CB  . PRO B 1 39  ? 20.542 100.024 -35.320 1.00 28.77 ? 38  PRO B CB  1 
ATOM   1511 C CG  . PRO B 1 39  ? 19.827 100.949 -36.230 1.00 28.33 ? 38  PRO B CG  1 
ATOM   1512 C CD  . PRO B 1 39  ? 19.366 102.150 -35.473 1.00 28.33 ? 38  PRO B CD  1 
ATOM   1513 N N   . LEU B 1 40  ? 22.991 101.225 -34.199 1.00 30.67 ? 39  LEU B N   1 
ATOM   1514 C CA  . LEU B 1 40  ? 24.398 101.215 -33.792 1.00 31.60 ? 39  LEU B CA  1 
ATOM   1515 C C   . LEU B 1 40  ? 25.180 102.440 -34.208 1.00 31.97 ? 39  LEU B C   1 
ATOM   1516 O O   . LEU B 1 40  ? 24.951 103.009 -35.273 1.00 32.56 ? 39  LEU B O   1 
ATOM   1517 C CB  . LEU B 1 40  ? 25.113 100.007 -34.403 1.00 31.99 ? 39  LEU B CB  1 
ATOM   1518 C CG  . LEU B 1 40  ? 24.709 98.603  -33.962 1.00 32.64 ? 39  LEU B CG  1 
ATOM   1519 C CD1 . LEU B 1 40  ? 25.410 97.570  -34.831 1.00 33.33 ? 39  LEU B CD1 1 
ATOM   1520 C CD2 . LEU B 1 40  ? 25.037 98.385  -32.494 1.00 32.97 ? 39  LEU B CD2 1 
ATOM   1521 N N   . ALA B 1 41  ? 26.127 102.818 -33.357 1.00 32.60 ? 40  ALA B N   1 
ATOM   1522 C CA  . ALA B 1 41  ? 27.046 103.896 -33.651 1.00 33.08 ? 40  ALA B CA  1 
ATOM   1523 C C   . ALA B 1 41  ? 28.028 103.367 -34.687 1.00 33.82 ? 40  ALA B C   1 
ATOM   1524 O O   . ALA B 1 41  ? 28.264 102.160 -34.767 1.00 33.27 ? 40  ALA B O   1 
ATOM   1525 C CB  . ALA B 1 41  ? 27.787 104.321 -32.393 1.00 33.67 ? 40  ALA B CB  1 
ATOM   1526 N N   . PHE B 1 42  ? 28.574 104.278 -35.485 1.00 34.78 ? 41  PHE B N   1 
ATOM   1527 C CA  . PHE B 1 42  ? 29.551 103.963 -36.535 1.00 35.99 ? 41  PHE B CA  1 
ATOM   1528 C C   . PHE B 1 42  ? 28.980 103.181 -37.719 1.00 37.31 ? 41  PHE B C   1 
ATOM   1529 O O   . PHE B 1 42  ? 29.714 102.465 -38.401 1.00 38.64 ? 41  PHE B O   1 
ATOM   1530 C CB  . PHE B 1 42  ? 30.771 103.236 -35.958 1.00 36.42 ? 41  PHE B CB  1 
ATOM   1531 C CG  . PHE B 1 42  ? 31.368 103.915 -34.759 1.00 36.32 ? 41  PHE B CG  1 
ATOM   1532 C CD1 . PHE B 1 42  ? 31.943 105.174 -34.876 1.00 36.05 ? 41  PHE B CD1 1 
ATOM   1533 C CD2 . PHE B 1 42  ? 31.384 103.286 -33.522 1.00 36.32 ? 41  PHE B CD2 1 
ATOM   1534 C CE1 . PHE B 1 42  ? 32.506 105.800 -33.777 1.00 36.16 ? 41  PHE B CE1 1 
ATOM   1535 C CE2 . PHE B 1 42  ? 31.948 103.908 -32.420 1.00 36.21 ? 41  PHE B CE2 1 
ATOM   1536 C CZ  . PHE B 1 42  ? 32.507 105.166 -32.547 1.00 36.09 ? 41  PHE B CZ  1 
ATOM   1537 N N   . THR B 1 43  ? 27.675 103.301 -37.953 1.00 38.12 ? 42  THR B N   1 
ATOM   1538 C CA  . THR B 1 43  ? 27.037 102.666 -39.108 1.00 38.74 ? 42  THR B CA  1 
ATOM   1539 C C   . THR B 1 43  ? 26.471 103.787 -39.973 1.00 39.76 ? 42  THR B C   1 
ATOM   1540 O O   . THR B 1 43  ? 25.912 104.761 -39.455 1.00 39.18 ? 42  THR B O   1 
ATOM   1541 C CB  . THR B 1 43  ? 25.927 101.673 -38.716 1.00 38.48 ? 42  THR B CB  1 
ATOM   1542 O OG1 . THR B 1 43  ? 24.903 102.350 -37.977 1.00 37.86 ? 42  THR B OG1 1 
ATOM   1543 C CG2 . THR B 1 43  ? 26.498 100.529 -37.885 1.00 38.76 ? 42  THR B CG2 1 
ATOM   1544 N N   . GLY B 1 44  ? 26.628 103.637 -41.286 1.00 40.66 ? 43  GLY B N   1 
ATOM   1545 C CA  . GLY B 1 44  ? 26.217 104.641 -42.264 1.00 41.53 ? 43  GLY B CA  1 
ATOM   1546 C C   . GLY B 1 44  ? 24.831 105.238 -42.117 1.00 41.95 ? 43  GLY B C   1 
ATOM   1547 O O   . GLY B 1 44  ? 24.665 106.455 -42.223 1.00 41.97 ? 43  GLY B O   1 
ATOM   1548 N N   . ILE B 1 45  ? 23.836 104.393 -41.871 1.00 42.67 ? 44  ILE B N   1 
ATOM   1549 C CA  . ILE B 1 45  ? 22.454 104.865 -41.767 1.00 43.60 ? 44  ILE B CA  1 
ATOM   1550 C C   . ILE B 1 45  ? 22.206 105.723 -40.522 1.00 42.46 ? 44  ILE B C   1 
ATOM   1551 O O   . ILE B 1 45  ? 21.559 106.769 -40.610 1.00 42.36 ? 44  ILE B O   1 
ATOM   1552 C CB  . ILE B 1 45  ? 21.437 103.698 -41.851 1.00 46.00 ? 44  ILE B CB  1 
ATOM   1553 C CG1 . ILE B 1 45  ? 20.024 104.231 -42.112 1.00 47.08 ? 44  ILE B CG1 1 
ATOM   1554 C CG2 . ILE B 1 45  ? 21.470 102.816 -40.603 1.00 46.65 ? 44  ILE B CG2 1 
ATOM   1555 C CD1 . ILE B 1 45  ? 19.879 104.992 -43.415 1.00 47.93 ? 44  ILE B CD1 1 
ATOM   1556 N N   . CYS B 1 46  ? 22.730 105.291 -39.377 1.00 41.37 ? 45  CYS B N   1 
ATOM   1557 C CA  . CYS B 1 46  ? 22.571 106.029 -38.126 1.00 40.45 ? 45  CYS B CA  1 
ATOM   1558 C C   . CYS B 1 46  ? 23.311 107.351 -38.210 1.00 38.68 ? 45  CYS B C   1 
ATOM   1559 O O   . CYS B 1 46  ? 22.836 108.368 -37.711 1.00 38.31 ? 45  CYS B O   1 
ATOM   1560 C CB  . CYS B 1 46  ? 23.098 105.213 -36.949 1.00 41.21 ? 45  CYS B CB  1 
ATOM   1561 S SG  . CYS B 1 46  ? 22.236 103.643 -36.735 1.00 44.44 ? 45  CYS B SG  1 
ATOM   1562 N N   . GLN B 1 47  ? 24.478 107.316 -38.848 1.00 37.36 ? 46  GLN B N   1 
ATOM   1563 C CA  . GLN B 1 47  ? 25.291 108.503 -39.054 1.00 37.03 ? 46  GLN B CA  1 
ATOM   1564 C C   . GLN B 1 47  ? 24.465 109.559 -39.783 1.00 36.10 ? 46  GLN B C   1 
ATOM   1565 O O   . GLN B 1 47  ? 24.346 110.693 -39.324 1.00 34.66 ? 46  GLN B O   1 
ATOM   1566 C CB  . GLN B 1 47  ? 26.536 108.156 -39.878 1.00 37.65 ? 46  GLN B CB  1 
ATOM   1567 C CG  . GLN B 1 47  ? 27.556 109.275 -39.963 1.00 38.19 ? 46  GLN B CG  1 
ATOM   1568 C CD  . GLN B 1 47  ? 28.273 109.489 -38.649 1.00 38.99 ? 46  GLN B CD  1 
ATOM   1569 O OE1 . GLN B 1 47  ? 28.955 108.593 -38.154 1.00 39.91 ? 46  GLN B OE1 1 
ATOM   1570 N NE2 . GLN B 1 47  ? 28.141 110.684 -38.086 1.00 39.36 ? 46  GLN B NE2 1 
ATOM   1571 N N   . GLY B 1 48  ? 23.882 109.164 -40.911 1.00 36.12 ? 47  GLY B N   1 
ATOM   1572 C CA  . GLY B 1 48  ? 23.062 110.060 -41.722 1.00 36.41 ? 47  GLY B CA  1 
ATOM   1573 C C   . GLY B 1 48  ? 21.890 110.663 -40.969 1.00 36.65 ? 47  GLY B C   1 
ATOM   1574 O O   . GLY B 1 48  ? 21.622 111.858 -41.087 1.00 36.67 ? 47  GLY B O   1 
ATOM   1575 N N   . GLU B 1 49  ? 21.191 109.838 -40.194 1.00 37.57 ? 48  GLU B N   1 
ATOM   1576 C CA  . GLU B 1 49  ? 20.045 110.310 -39.416 1.00 38.04 ? 48  GLU B CA  1 
ATOM   1577 C C   . GLU B 1 49  ? 20.453 111.280 -38.309 1.00 37.44 ? 48  GLU B C   1 
ATOM   1578 O O   . GLU B 1 49  ? 19.816 112.320 -38.135 1.00 36.84 ? 48  GLU B O   1 
ATOM   1579 C CB  . GLU B 1 49  ? 19.245 109.136 -38.847 1.00 39.32 ? 48  GLU B CB  1 
ATOM   1580 C CG  . GLU B 1 49  ? 18.433 108.410 -39.908 1.00 40.91 ? 48  GLU B CG  1 
ATOM   1581 C CD  . GLU B 1 49  ? 17.570 107.296 -39.351 1.00 41.99 ? 48  GLU B CD  1 
ATOM   1582 O OE1 . GLU B 1 49  ? 18.013 106.601 -38.411 1.00 43.75 ? 48  GLU B OE1 1 
ATOM   1583 O OE2 . GLU B 1 49  ? 16.444 107.103 -39.859 1.00 41.96 ? 48  GLU B OE2 1 
ATOM   1584 N N   . LEU B 1 50  ? 21.509 110.954 -37.569 1.00 36.75 ? 49  LEU B N   1 
ATOM   1585 C CA  . LEU B 1 50  ? 21.978 111.842 -36.507 1.00 37.37 ? 49  LEU B CA  1 
ATOM   1586 C C   . LEU B 1 50  ? 22.698 113.079 -37.062 1.00 37.65 ? 49  LEU B C   1 
ATOM   1587 O O   . LEU B 1 50  ? 22.670 114.135 -36.429 1.00 37.30 ? 49  LEU B O   1 
ATOM   1588 C CB  . LEU B 1 50  ? 22.846 111.096 -35.490 1.00 37.58 ? 49  LEU B CB  1 
ATOM   1589 C CG  . LEU B 1 50  ? 22.163 109.971 -34.700 1.00 37.96 ? 49  LEU B CG  1 
ATOM   1590 C CD1 . LEU B 1 50  ? 23.055 109.547 -33.543 1.00 38.10 ? 49  LEU B CD1 1 
ATOM   1591 C CD2 . LEU B 1 50  ? 20.798 110.385 -34.167 1.00 38.28 ? 49  LEU B CD2 1 
ATOM   1592 N N   . ASP B 1 51  ? 23.337 112.954 -38.229 1.00 38.39 ? 50  ASP B N   1 
ATOM   1593 C CA  . ASP B 1 51  ? 23.964 114.111 -38.888 1.00 38.99 ? 50  ASP B CA  1 
ATOM   1594 C C   . ASP B 1 51  ? 22.891 115.129 -39.254 1.00 38.97 ? 50  ASP B C   1 
ATOM   1595 O O   . ASP B 1 51  ? 23.091 116.329 -39.091 1.00 38.29 ? 50  ASP B O   1 
ATOM   1596 C CB  . ASP B 1 51  ? 24.728 113.715 -40.162 1.00 39.15 ? 50  ASP B CB  1 
ATOM   1597 C CG  . ASP B 1 51  ? 26.081 113.084 -39.878 1.00 40.19 ? 50  ASP B CG  1 
ATOM   1598 O OD1 . ASP B 1 51  ? 26.481 113.001 -38.695 1.00 40.73 ? 50  ASP B OD1 1 
ATOM   1599 O OD2 . ASP B 1 51  ? 26.754 112.677 -40.854 1.00 40.40 ? 50  ASP B OD2 1 
ATOM   1600 N N   . GLN B 1 52  ? 21.760 114.638 -39.754 1.00 39.33 ? 51  GLN B N   1 
ATOM   1601 C CA  . GLN B 1 52  ? 20.633 115.493 -40.124 1.00 40.86 ? 51  GLN B CA  1 
ATOM   1602 C C   . GLN B 1 52  ? 20.031 116.160 -38.878 1.00 40.12 ? 51  GLN B C   1 
ATOM   1603 O O   . GLN B 1 52  ? 19.590 117.305 -38.931 1.00 40.44 ? 51  GLN B O   1 
ATOM   1604 C CB  . GLN B 1 52  ? 19.577 114.672 -40.869 1.00 43.12 ? 51  GLN B CB  1 
ATOM   1605 C CG  . GLN B 1 52  ? 18.483 115.495 -41.535 1.00 45.71 ? 51  GLN B CG  1 
ATOM   1606 C CD  . GLN B 1 52  ? 17.444 114.634 -42.239 1.00 47.43 ? 51  GLN B CD  1 
ATOM   1607 O OE1 . GLN B 1 52  ? 17.564 113.409 -42.293 1.00 49.08 ? 51  GLN B OE1 1 
ATOM   1608 N NE2 . GLN B 1 52  ? 16.415 115.275 -42.781 1.00 48.88 ? 51  GLN B NE2 1 
ATOM   1609 N N   . LEU B 1 53  ? 20.012 115.431 -37.766 1.00 39.17 ? 52  LEU B N   1 
ATOM   1610 C CA  . LEU B 1 53  ? 19.538 115.954 -36.481 1.00 38.63 ? 52  LEU B CA  1 
ATOM   1611 C C   . LEU B 1 53  ? 20.505 117.031 -35.962 1.00 37.45 ? 52  LEU B C   1 
ATOM   1612 O O   . LEU B 1 53  ? 20.088 118.055 -35.419 1.00 36.91 ? 52  LEU B O   1 
ATOM   1613 C CB  . LEU B 1 53  ? 19.386 114.796 -35.484 1.00 39.13 ? 52  LEU B CB  1 
ATOM   1614 C CG  . LEU B 1 53  ? 19.025 115.066 -34.023 1.00 39.93 ? 52  LEU B CG  1 
ATOM   1615 C CD1 . LEU B 1 53  ? 17.889 116.059 -33.890 1.00 40.66 ? 52  LEU B CD1 1 
ATOM   1616 C CD2 . LEU B 1 53  ? 18.674 113.755 -33.332 1.00 40.31 ? 52  LEU B CD2 1 
ATOM   1617 N N   . ARG B 1 54  ? 21.799 116.784 -36.138 1.00 36.20 ? 53  ARG B N   1 
ATOM   1618 C CA  . ARG B 1 54  ? 22.845 117.745 -35.780 1.00 35.66 ? 53  ARG B CA  1 
ATOM   1619 C C   . ARG B 1 54  ? 22.694 119.041 -36.588 1.00 35.74 ? 53  ARG B C   1 
ATOM   1620 O O   . ARG B 1 54  ? 22.798 120.141 -36.041 1.00 35.76 ? 53  ARG B O   1 
ATOM   1621 C CB  . ARG B 1 54  ? 24.215 117.125 -36.064 1.00 34.74 ? 53  ARG B CB  1 
ATOM   1622 C CG  . ARG B 1 54  ? 25.416 118.055 -35.943 1.00 34.53 ? 53  ARG B CG  1 
ATOM   1623 C CD  . ARG B 1 54  ? 26.610 117.432 -36.651 1.00 33.99 ? 53  ARG B CD  1 
ATOM   1624 N NE  . ARG B 1 54  ? 26.363 117.323 -38.090 1.00 33.39 ? 53  ARG B NE  1 
ATOM   1625 C CZ  . ARG B 1 54  ? 27.074 116.583 -38.938 1.00 33.04 ? 53  ARG B CZ  1 
ATOM   1626 N NH1 . ARG B 1 54  ? 28.093 115.843 -38.513 1.00 33.39 ? 53  ARG B NH1 1 
ATOM   1627 N NH2 . ARG B 1 54  ? 26.749 116.566 -40.223 1.00 33.14 ? 53  ARG B NH2 1 
ATOM   1628 N N   . ASP B 1 55  ? 22.447 118.896 -37.888 1.00 35.49 ? 54  ASP B N   1 
ATOM   1629 C CA  . ASP B 1 55  ? 22.313 120.043 -38.788 1.00 36.28 ? 54  ASP B CA  1 
ATOM   1630 C C   . ASP B 1 55  ? 21.096 120.918 -38.485 1.00 37.06 ? 54  ASP B C   1 
ATOM   1631 O O   . ASP B 1 55  ? 21.139 122.124 -38.707 1.00 37.82 ? 54  ASP B O   1 
ATOM   1632 C CB  . ASP B 1 55  ? 22.248 119.580 -40.248 1.00 36.06 ? 54  ASP B CB  1 
ATOM   1633 C CG  . ASP B 1 55  ? 23.517 118.879 -40.705 1.00 36.11 ? 54  ASP B CG  1 
ATOM   1634 O OD1 . ASP B 1 55  ? 24.505 118.849 -39.943 1.00 36.98 ? 54  ASP B OD1 1 
ATOM   1635 O OD2 . ASP B 1 55  ? 23.526 118.349 -41.835 1.00 35.77 ? 54  ASP B OD2 1 
ATOM   1636 N N   . HIS B 1 56  ? 20.021 120.309 -37.985 1.00 37.53 ? 55  HIS B N   1 
ATOM   1637 C CA  . HIS B 1 56  ? 18.787 121.026 -37.670 1.00 38.03 ? 55  HIS B CA  1 
ATOM   1638 C C   . HIS B 1 56  ? 18.524 121.058 -36.161 1.00 37.93 ? 55  HIS B C   1 
ATOM   1639 O O   . HIS B 1 56  ? 17.380 121.223 -35.734 1.00 37.04 ? 55  HIS B O   1 
ATOM   1640 C CB  . HIS B 1 56  ? 17.606 120.334 -38.360 1.00 38.81 ? 55  HIS B CB  1 
ATOM   1641 C CG  . HIS B 1 56  ? 17.773 120.163 -39.838 1.00 39.32 ? 55  HIS B CG  1 
ATOM   1642 N ND1 . HIS B 1 56  ? 18.250 119.000 -40.403 1.00 40.04 ? 55  HIS B ND1 1 
ATOM   1643 C CD2 . HIS B 1 56  ? 17.506 120.999 -40.869 1.00 40.36 ? 55  HIS B CD2 1 
ATOM   1644 C CE1 . HIS B 1 56  ? 18.279 119.129 -41.717 1.00 40.22 ? 55  HIS B CE1 1 
ATOM   1645 N NE2 . HIS B 1 56  ? 17.835 120.334 -42.026 1.00 40.49 ? 55  HIS B NE2 1 
ATOM   1646 N N   . LEU B 1 57  ? 19.586 120.938 -35.365 1.00 38.01 ? 56  LEU B N   1 
ATOM   1647 C CA  . LEU B 1 57  ? 19.478 120.835 -33.902 1.00 38.41 ? 56  LEU B CA  1 
ATOM   1648 C C   . LEU B 1 57  ? 18.633 121.899 -33.194 1.00 39.69 ? 56  LEU B C   1 
ATOM   1649 O O   . LEU B 1 57  ? 17.882 121.561 -32.279 1.00 39.82 ? 56  LEU B O   1 
ATOM   1650 C CB  . LEU B 1 57  ? 20.873 120.764 -33.260 1.00 38.32 ? 56  LEU B CB  1 
ATOM   1651 C CG  . LEU B 1 57  ? 20.913 120.455 -31.760 1.00 38.43 ? 56  LEU B CG  1 
ATOM   1652 C CD1 . LEU B 1 57  ? 20.217 119.135 -31.462 1.00 38.29 ? 56  LEU B CD1 1 
ATOM   1653 C CD2 . LEU B 1 57  ? 22.344 120.428 -31.251 1.00 38.50 ? 56  LEU B CD2 1 
ATOM   1654 N N   . PRO B 1 58  ? 18.747 123.180 -33.600 1.00 40.83 ? 57  PRO B N   1 
ATOM   1655 C CA  . PRO B 1 58  ? 17.938 124.215 -32.940 1.00 41.87 ? 57  PRO B CA  1 
ATOM   1656 C C   . PRO B 1 58  ? 16.426 124.002 -33.040 1.00 42.61 ? 57  PRO B C   1 
ATOM   1657 O O   . PRO B 1 58  ? 15.681 124.533 -32.222 1.00 43.40 ? 57  PRO B O   1 
ATOM   1658 C CB  . PRO B 1 58  ? 18.345 125.499 -33.670 1.00 42.27 ? 57  PRO B CB  1 
ATOM   1659 C CG  . PRO B 1 58  ? 19.718 125.222 -34.171 1.00 41.97 ? 57  PRO B CG  1 
ATOM   1660 C CD  . PRO B 1 58  ? 19.704 123.770 -34.554 1.00 41.26 ? 57  PRO B CD  1 
ATOM   1661 N N   . GLU B 1 59  ? 15.982 123.240 -34.035 1.00 43.58 ? 58  GLU B N   1 
ATOM   1662 C CA  . GLU B 1 59  ? 14.566 122.940 -34.201 1.00 45.19 ? 58  GLU B CA  1 
ATOM   1663 C C   . GLU B 1 59  ? 14.114 121.825 -33.248 1.00 44.56 ? 58  GLU B C   1 
ATOM   1664 O O   . GLU B 1 59  ? 12.914 121.610 -33.068 1.00 44.20 ? 58  GLU B O   1 
ATOM   1665 C CB  . GLU B 1 59  ? 14.274 122.562 -35.658 1.00 47.37 ? 58  GLU B CB  1 
ATOM   1666 C CG  . GLU B 1 59  ? 14.613 123.676 -36.644 1.00 50.07 ? 58  GLU B CG  1 
ATOM   1667 C CD  . GLU B 1 59  ? 14.428 123.285 -38.101 1.00 52.63 ? 58  GLU B CD  1 
ATOM   1668 O OE1 . GLU B 1 59  ? 15.078 123.915 -38.968 1.00 55.39 ? 58  GLU B OE1 1 
ATOM   1669 O OE2 . GLU B 1 59  ? 13.648 122.353 -38.390 1.00 53.47 ? 58  GLU B OE2 1 
ATOM   1670 N N   . PHE B 1 60  ? 15.075 121.125 -32.643 1.00 43.51 ? 59  PHE B N   1 
ATOM   1671 C CA  . PHE B 1 60  ? 14.786 120.033 -31.709 1.00 43.65 ? 59  PHE B CA  1 
ATOM   1672 C C   . PHE B 1 60  ? 15.211 120.308 -30.269 1.00 43.55 ? 59  PHE B C   1 
ATOM   1673 O O   . PHE B 1 60  ? 14.549 119.857 -29.337 1.00 44.15 ? 59  PHE B O   1 
ATOM   1674 C CB  . PHE B 1 60  ? 15.461 118.754 -32.187 1.00 43.13 ? 59  PHE B CB  1 
ATOM   1675 C CG  . PHE B 1 60  ? 15.104 118.381 -33.588 1.00 43.29 ? 59  PHE B CG  1 
ATOM   1676 C CD1 . PHE B 1 60  ? 13.830 117.936 -33.884 1.00 43.69 ? 59  PHE B CD1 1 
ATOM   1677 C CD2 . PHE B 1 60  ? 16.036 118.472 -34.609 1.00 43.24 ? 59  PHE B CD2 1 
ATOM   1678 C CE1 . PHE B 1 60  ? 13.487 117.585 -35.173 1.00 44.10 ? 59  PHE B CE1 1 
ATOM   1679 C CE2 . PHE B 1 60  ? 15.701 118.118 -35.903 1.00 43.67 ? 59  PHE B CE2 1 
ATOM   1680 C CZ  . PHE B 1 60  ? 14.425 117.673 -36.187 1.00 43.69 ? 59  PHE B CZ  1 
ATOM   1681 N N   . GLU B 1 61  ? 16.324 121.014 -30.091 1.00 43.49 ? 60  GLU B N   1 
ATOM   1682 C CA  . GLU B 1 61  ? 16.827 121.357 -28.766 1.00 44.37 ? 60  GLU B CA  1 
ATOM   1683 C C   . GLU B 1 61  ? 16.684 122.870 -28.581 1.00 43.88 ? 60  GLU B C   1 
ATOM   1684 O O   . GLU B 1 61  ? 17.518 123.642 -29.052 1.00 43.46 ? 60  GLU B O   1 
ATOM   1685 C CB  . GLU B 1 61  ? 18.277 120.887 -28.619 1.00 45.69 ? 60  GLU B CB  1 
ATOM   1686 C CG  . GLU B 1 61  ? 18.902 121.149 -27.253 1.00 47.96 ? 60  GLU B CG  1 
ATOM   1687 C CD  . GLU B 1 61  ? 20.232 120.428 -27.053 1.00 49.79 ? 60  GLU B CD  1 
ATOM   1688 O OE1 . GLU B 1 61  ? 21.171 121.047 -26.507 1.00 51.15 ? 60  GLU B OE1 1 
ATOM   1689 O OE2 . GLU B 1 61  ? 20.351 119.246 -27.445 1.00 50.46 ? 60  GLU B OE2 1 
ATOM   1690 N N   . ASN B 1 62  ? 15.610 123.277 -27.903 1.00 43.31 ? 61  ASN B N   1 
ATOM   1691 C CA  . ASN B 1 62  ? 15.299 124.691 -27.682 1.00 43.71 ? 61  ASN B CA  1 
ATOM   1692 C C   . ASN B 1 62  ? 14.528 124.923 -26.367 1.00 44.33 ? 61  ASN B C   1 
ATOM   1693 O O   . ASN B 1 62  ? 14.485 124.041 -25.510 1.00 44.39 ? 61  ASN B O   1 
ATOM   1694 C CB  . ASN B 1 62  ? 14.538 125.231 -28.905 1.00 43.62 ? 61  ASN B CB  1 
ATOM   1695 C CG  . ASN B 1 62  ? 13.248 124.471 -29.184 1.00 43.79 ? 61  ASN B CG  1 
ATOM   1696 O OD1 . ASN B 1 62  ? 12.419 124.275 -28.293 1.00 43.20 ? 61  ASN B OD1 1 
ATOM   1697 N ND2 . ASN B 1 62  ? 13.061 124.060 -30.437 1.00 43.73 ? 61  ASN B ND2 1 
ATOM   1698 N N   . ASP B 1 63  ? 13.939 126.106 -26.201 1.00 45.30 ? 62  ASP B N   1 
ATOM   1699 C CA  . ASP B 1 63  ? 13.186 126.437 -24.983 1.00 46.64 ? 62  ASP B CA  1 
ATOM   1700 C C   . ASP B 1 63  ? 11.949 125.557 -24.759 1.00 45.75 ? 62  ASP B C   1 
ATOM   1701 O O   . ASP B 1 63  ? 11.516 125.377 -23.622 1.00 45.38 ? 62  ASP B O   1 
ATOM   1702 C CB  . ASP B 1 63  ? 12.766 127.915 -25.003 1.00 48.36 ? 62  ASP B CB  1 
ATOM   1703 C CG  . ASP B 1 63  ? 13.952 128.865 -24.892 1.00 50.42 ? 62  ASP B CG  1 
ATOM   1704 O OD1 . ASP B 1 63  ? 14.812 128.655 -24.006 1.00 51.42 ? 62  ASP B OD1 1 
ATOM   1705 O OD2 . ASP B 1 63  ? 14.010 129.841 -25.673 1.00 51.25 ? 62  ASP B OD2 1 
ATOM   1706 N N   . ASP B 1 64  ? 11.394 125.012 -25.840 1.00 44.83 ? 63  ASP B N   1 
ATOM   1707 C CA  . ASP B 1 64  ? 10.200 124.173 -25.771 1.00 44.41 ? 63  ASP B CA  1 
ATOM   1708 C C   . ASP B 1 64  ? 10.464 122.682 -25.982 1.00 41.64 ? 63  ASP B C   1 
ATOM   1709 O O   . ASP B 1 64  ? 9.622  121.855 -25.629 1.00 40.75 ? 63  ASP B O   1 
ATOM   1710 C CB  . ASP B 1 64  ? 9.211  124.622 -26.847 1.00 46.27 ? 63  ASP B CB  1 
ATOM   1711 C CG  . ASP B 1 64  ? 8.856  126.098 -26.748 1.00 49.02 ? 63  ASP B CG  1 
ATOM   1712 O OD1 . ASP B 1 64  ? 8.923  126.668 -25.634 1.00 51.35 ? 63  ASP B OD1 1 
ATOM   1713 O OD2 . ASP B 1 64  ? 8.499  126.686 -27.793 1.00 50.36 ? 63  ASP B OD2 1 
ATOM   1714 N N   . SER B 1 65  ? 11.615 122.336 -26.554 1.00 38.93 ? 64  SER B N   1 
ATOM   1715 C CA  . SER B 1 65  ? 11.899 120.948 -26.891 1.00 37.47 ? 64  SER B CA  1 
ATOM   1716 C C   . SER B 1 65  ? 13.293 120.475 -26.508 1.00 35.78 ? 64  SER B C   1 
ATOM   1717 O O   . SER B 1 65  ? 14.231 121.263 -26.431 1.00 36.11 ? 64  SER B O   1 
ATOM   1718 C CB  . SER B 1 65  ? 11.731 120.760 -28.402 1.00 37.58 ? 64  SER B CB  1 
ATOM   1719 O OG  . SER B 1 65  ? 10.461 121.205 -28.843 1.00 38.16 ? 64  SER B OG  1 
ATOM   1720 N N   . ALA B 1 66  ? 13.405 119.169 -26.283 1.00 33.93 ? 65  ALA B N   1 
ATOM   1721 C CA  . ALA B 1 66  ? 14.670 118.507 -25.989 1.00 32.68 ? 65  ALA B CA  1 
ATOM   1722 C C   . ALA B 1 66  ? 14.753 117.282 -26.896 1.00 31.29 ? 65  ALA B C   1 
ATOM   1723 O O   . ALA B 1 66  ? 13.731 116.697 -27.236 1.00 31.24 ? 65  ALA B O   1 
ATOM   1724 C CB  . ALA B 1 66  ? 14.741 118.099 -24.528 1.00 32.70 ? 65  ALA B CB  1 
ATOM   1725 N N   . ALA B 1 67  ? 15.962 116.908 -27.297 1.00 30.34 ? 66  ALA B N   1 
ATOM   1726 C CA  . ALA B 1 67  ? 16.169 115.759 -28.174 1.00 29.54 ? 66  ALA B CA  1 
ATOM   1727 C C   . ALA B 1 67  ? 17.140 114.783 -27.531 1.00 28.79 ? 66  ALA B C   1 
ATOM   1728 O O   . ALA B 1 67  ? 18.216 115.178 -27.102 1.00 29.33 ? 66  ALA B O   1 
ATOM   1729 C CB  . ALA B 1 67  ? 16.703 116.218 -29.518 1.00 29.50 ? 66  ALA B CB  1 
ATOM   1730 N N   . LEU B 1 68  ? 16.756 113.513 -27.473 1.00 28.09 ? 67  LEU B N   1 
ATOM   1731 C CA  . LEU B 1 68  ? 17.582 112.478 -26.871 1.00 27.41 ? 67  LEU B CA  1 
ATOM   1732 C C   . LEU B 1 68  ? 17.713 111.309 -27.829 1.00 26.50 ? 67  LEU B C   1 
ATOM   1733 O O   . LEU B 1 68  ? 16.706 110.740 -28.248 1.00 26.34 ? 67  LEU B O   1 
ATOM   1734 C CB  . LEU B 1 68  ? 16.935 111.978 -25.580 1.00 28.15 ? 67  LEU B CB  1 
ATOM   1735 C CG  . LEU B 1 68  ? 16.614 113.018 -24.508 1.00 28.85 ? 67  LEU B CG  1 
ATOM   1736 C CD1 . LEU B 1 68  ? 15.822 112.371 -23.381 1.00 29.20 ? 67  LEU B CD1 1 
ATOM   1737 C CD2 . LEU B 1 68  ? 17.888 113.663 -23.982 1.00 28.87 ? 67  LEU B CD2 1 
ATOM   1738 N N   . ALA B 1 69  ? 18.948 110.969 -28.189 1.00 25.56 ? 68  ALA B N   1 
ATOM   1739 C CA  . ALA B 1 69  ? 19.215 109.821 -29.053 1.00 24.98 ? 68  ALA B CA  1 
ATOM   1740 C C   . ALA B 1 69  ? 19.479 108.637 -28.134 1.00 24.70 ? 68  ALA B C   1 
ATOM   1741 O O   . ALA B 1 69  ? 20.130 108.794 -27.103 1.00 24.92 ? 68  ALA B O   1 
ATOM   1742 C CB  . ALA B 1 69  ? 20.413 110.083 -29.949 1.00 24.80 ? 68  ALA B CB  1 
ATOM   1743 N N   . ILE B 1 70  ? 18.976 107.460 -28.491 1.00 24.31 ? 69  ILE B N   1 
ATOM   1744 C CA  . ILE B 1 70  ? 19.130 106.284 -27.636 1.00 24.55 ? 69  ILE B CA  1 
ATOM   1745 C C   . ILE B 1 70  ? 19.530 105.036 -28.417 1.00 24.57 ? 69  ILE B C   1 
ATOM   1746 O O   . ILE B 1 70  ? 18.970 104.737 -29.471 1.00 24.38 ? 69  ILE B O   1 
ATOM   1747 C CB  . ILE B 1 70  ? 17.823 105.977 -26.864 1.00 24.70 ? 69  ILE B CB  1 
ATOM   1748 C CG1 . ILE B 1 70  ? 17.301 107.237 -26.158 1.00 24.79 ? 69  ILE B CG1 1 
ATOM   1749 C CG2 . ILE B 1 70  ? 18.050 104.851 -25.863 1.00 25.01 ? 69  ILE B CG2 1 
ATOM   1750 C CD1 . ILE B 1 70  ? 16.003 107.047 -25.405 1.00 25.17 ? 69  ILE B CD1 1 
ATOM   1751 N N   . SER B 1 71  ? 20.503 104.311 -27.875 1.00 24.75 ? 70  SER B N   1 
ATOM   1752 C CA  A SER B 1 71  ? 20.993 103.081 -28.479 0.50 24.86 ? 70  SER B CA  1 
ATOM   1753 C CA  B SER B 1 71  ? 20.961 103.063 -28.475 0.50 24.76 ? 70  SER B CA  1 
ATOM   1754 C C   . SER B 1 71  ? 21.552 102.172 -27.398 1.00 25.10 ? 70  SER B C   1 
ATOM   1755 O O   . SER B 1 71  ? 21.771 102.606 -26.268 1.00 25.26 ? 70  SER B O   1 
ATOM   1756 C CB  A SER B 1 71  ? 22.075 103.398 -29.512 0.50 24.77 ? 70  SER B CB  1 
ATOM   1757 C CB  B SER B 1 71  ? 21.997 103.315 -29.567 0.50 24.57 ? 70  SER B CB  1 
ATOM   1758 O OG  A SER B 1 71  ? 22.676 102.219 -30.019 0.50 25.23 ? 70  SER B OG  1 
ATOM   1759 O OG  B SER B 1 71  ? 23.212 103.788 -29.020 0.50 24.63 ? 70  SER B OG  1 
ATOM   1760 N N   . VAL B 1 72  ? 21.808 100.921 -27.758 1.00 25.44 ? 71  VAL B N   1 
ATOM   1761 C CA  . VAL B 1 72  ? 22.347 99.954  -26.805 1.00 26.20 ? 71  VAL B CA  1 
ATOM   1762 C C   . VAL B 1 72  ? 23.836 100.134 -26.501 1.00 26.66 ? 71  VAL B C   1 
ATOM   1763 O O   . VAL B 1 72  ? 24.373 99.441  -25.637 1.00 27.33 ? 71  VAL B O   1 
ATOM   1764 C CB  . VAL B 1 72  ? 22.081 98.499  -27.246 1.00 26.49 ? 71  VAL B CB  1 
ATOM   1765 C CG1 . VAL B 1 72  ? 20.586 98.276  -27.438 1.00 26.37 ? 71  VAL B CG1 1 
ATOM   1766 C CG2 . VAL B 1 72  ? 22.860 98.145  -28.509 1.00 26.51 ? 71  VAL B CG2 1 
ATOM   1767 N N   . GLY B 1 73  ? 24.497 101.059 -27.194 1.00 26.40 ? 72  GLY B N   1 
ATOM   1768 C CA  . GLY B 1 73  ? 25.910 101.315 -26.969 1.00 26.98 ? 72  GLY B CA  1 
ATOM   1769 C C   . GLY B 1 73  ? 26.199 101.989 -25.637 1.00 27.53 ? 72  GLY B C   1 
ATOM   1770 O O   . GLY B 1 73  ? 25.371 102.743 -25.130 1.00 27.48 ? 72  GLY B O   1 
ATOM   1771 N N   . PRO B 1 74  ? 27.377 101.714 -25.053 1.00 28.25 ? 73  PRO B N   1 
ATOM   1772 C CA  . PRO B 1 74  ? 27.758 102.333 -23.785 1.00 28.62 ? 73  PRO B CA  1 
ATOM   1773 C C   . PRO B 1 74  ? 28.327 103.737 -24.000 1.00 28.47 ? 73  PRO B C   1 
ATOM   1774 O O   . PRO B 1 74  ? 28.658 104.088 -25.130 1.00 28.46 ? 73  PRO B O   1 
ATOM   1775 C CB  . PRO B 1 74  ? 28.818 101.378 -23.242 1.00 29.12 ? 73  PRO B CB  1 
ATOM   1776 C CG  . PRO B 1 74  ? 29.451 100.806 -24.460 1.00 28.95 ? 73  PRO B CG  1 
ATOM   1777 C CD  . PRO B 1 74  ? 28.364 100.710 -25.491 1.00 28.56 ? 73  PRO B CD  1 
ATOM   1778 N N   . PRO B 1 75  ? 28.451 104.536 -22.923 1.00 28.75 ? 74  PRO B N   1 
ATOM   1779 C CA  . PRO B 1 75  ? 28.915 105.926 -23.034 1.00 28.81 ? 74  PRO B CA  1 
ATOM   1780 C C   . PRO B 1 75  ? 30.252 106.163 -23.750 1.00 28.94 ? 74  PRO B C   1 
ATOM   1781 O O   . PRO B 1 75  ? 30.346 107.110 -24.537 1.00 28.58 ? 74  PRO B O   1 
ATOM   1782 C CB  . PRO B 1 75  ? 28.991 106.393 -21.574 1.00 29.09 ? 74  PRO B CB  1 
ATOM   1783 C CG  . PRO B 1 75  ? 28.018 105.531 -20.856 1.00 29.27 ? 74  PRO B CG  1 
ATOM   1784 C CD  . PRO B 1 75  ? 28.096 104.193 -21.533 1.00 29.31 ? 74  PRO B CD  1 
ATOM   1785 N N   . PRO B 1 76  ? 31.280 105.335 -23.483 1.00 29.73 ? 75  PRO B N   1 
ATOM   1786 C CA  . PRO B 1 76  ? 32.548 105.574 -24.176 1.00 30.08 ? 75  PRO B CA  1 
ATOM   1787 C C   . PRO B 1 76  ? 32.389 105.499 -25.693 1.00 30.08 ? 75  PRO B C   1 
ATOM   1788 O O   . PRO B 1 76  ? 33.024 106.258 -26.422 1.00 29.87 ? 75  PRO B O   1 
ATOM   1789 C CB  . PRO B 1 76  ? 33.455 104.452 -23.656 1.00 30.68 ? 75  PRO B CB  1 
ATOM   1790 C CG  . PRO B 1 76  ? 32.856 104.053 -22.352 1.00 30.90 ? 75  PRO B CG  1 
ATOM   1791 C CD  . PRO B 1 76  ? 31.380 104.195 -22.555 1.00 30.48 ? 75  PRO B CD  1 
ATOM   1792 N N   . THR B 1 77  ? 31.538 104.591 -26.156 1.00 30.63 ? 76  THR B N   1 
ATOM   1793 C CA  . THR B 1 77  ? 31.248 104.468 -27.575 1.00 30.87 ? 76  THR B CA  1 
ATOM   1794 C C   . THR B 1 77  ? 30.566 105.739 -28.073 1.00 30.22 ? 76  THR B C   1 
ATOM   1795 O O   . THR B 1 77  ? 30.990 106.318 -29.074 1.00 30.03 ? 76  THR B O   1 
ATOM   1796 C CB  . THR B 1 77  ? 30.356 103.246 -27.860 1.00 31.49 ? 76  THR B CB  1 
ATOM   1797 O OG1 . THR B 1 77  ? 31.102 102.050 -27.605 1.00 32.27 ? 76  THR B OG1 1 
ATOM   1798 C CG2 . THR B 1 77  ? 29.866 103.239 -29.310 1.00 31.39 ? 76  THR B CG2 1 
ATOM   1799 N N   . HIS B 1 78  ? 29.524 106.176 -27.369 1.00 29.86 ? 77  HIS B N   1 
ATOM   1800 C CA  . HIS B 1 78  ? 28.805 107.387 -27.768 1.00 29.47 ? 77  HIS B CA  1 
ATOM   1801 C C   . HIS B 1 78  ? 29.651 108.647 -27.651 1.00 30.00 ? 77  HIS B C   1 
ATOM   1802 O O   . HIS B 1 78  ? 29.486 109.569 -28.446 1.00 29.64 ? 77  HIS B O   1 
ATOM   1803 C CB  . HIS B 1 78  ? 27.504 107.570 -26.987 1.00 29.02 ? 77  HIS B CB  1 
ATOM   1804 C CG  . HIS B 1 78  ? 26.500 106.488 -27.223 1.00 28.73 ? 77  HIS B CG  1 
ATOM   1805 N ND1 . HIS B 1 78  ? 25.567 106.119 -26.279 1.00 28.94 ? 77  HIS B ND1 1 
ATOM   1806 C CD2 . HIS B 1 78  ? 26.315 105.661 -28.278 1.00 28.70 ? 77  HIS B CD2 1 
ATOM   1807 C CE1 . HIS B 1 78  ? 24.821 105.141 -26.760 1.00 28.89 ? 77  HIS B CE1 1 
ATOM   1808 N NE2 . HIS B 1 78  ? 25.262 104.837 -27.967 1.00 28.76 ? 77  HIS B NE2 1 
ATOM   1809 N N   . LYS B 1 79  ? 30.545 108.689 -26.666 1.00 31.26 ? 78  LYS B N   1 
ATOM   1810 C CA  . LYS B 1 79  ? 31.429 109.840 -26.475 1.00 32.49 ? 78  LYS B CA  1 
ATOM   1811 C C   . LYS B 1 79  ? 32.331 110.046 -27.686 1.00 32.28 ? 78  LYS B C   1 
ATOM   1812 O O   . LYS B 1 79  ? 32.400 111.148 -28.235 1.00 31.60 ? 78  LYS B O   1 
ATOM   1813 C CB  . LYS B 1 79  ? 32.278 109.654 -25.213 1.00 33.83 ? 78  LYS B CB  1 
ATOM   1814 C CG  . LYS B 1 79  ? 33.277 110.766 -24.924 1.00 34.77 ? 78  LYS B CG  1 
ATOM   1815 C CD  . LYS B 1 79  ? 32.606 112.123 -24.795 1.00 35.68 ? 78  LYS B CD  1 
ATOM   1816 C CE  . LYS B 1 79  ? 33.588 113.190 -24.335 1.00 36.67 ? 78  LYS B CE  1 
ATOM   1817 N NZ  . LYS B 1 79  ? 32.925 114.520 -24.199 1.00 37.06 ? 78  LYS B NZ  1 
ATOM   1818 N N   . ILE B 1 80  ? 33.008 108.980 -28.103 1.00 32.78 ? 79  ILE B N   1 
ATOM   1819 C CA  . ILE B 1 80  ? 33.915 109.048 -29.248 1.00 33.06 ? 79  ILE B CA  1 
ATOM   1820 C C   . ILE B 1 80  ? 33.152 109.382 -30.523 1.00 32.32 ? 79  ILE B C   1 
ATOM   1821 O O   . ILE B 1 80  ? 33.587 110.228 -31.303 1.00 31.84 ? 79  ILE B O   1 
ATOM   1822 C CB  . ILE B 1 80  ? 34.691 107.726 -29.448 1.00 34.08 ? 79  ILE B CB  1 
ATOM   1823 C CG1 . ILE B 1 80  ? 35.586 107.435 -28.233 1.00 35.33 ? 79  ILE B CG1 1 
ATOM   1824 C CG2 . ILE B 1 80  ? 35.536 107.775 -30.719 1.00 34.36 ? 79  ILE B CG2 1 
ATOM   1825 C CD1 . ILE B 1 80  ? 36.614 108.508 -27.919 1.00 35.85 ? 79  ILE B CD1 1 
ATOM   1826 N N   . TRP B 1 81  ? 32.011 108.728 -30.722 1.00 31.83 ? 80  TRP B N   1 
ATOM   1827 C CA  . TRP B 1 81  ? 31.216 108.945 -31.922 1.00 31.79 ? 80  TRP B CA  1 
ATOM   1828 C C   . TRP B 1 81  ? 30.670 110.368 -31.968 1.00 31.50 ? 80  TRP B C   1 
ATOM   1829 O O   . TRP B 1 81  ? 30.727 111.017 -33.010 1.00 31.73 ? 80  TRP B O   1 
ATOM   1830 C CB  . TRP B 1 81  ? 30.088 107.917 -32.017 1.00 31.76 ? 80  TRP B CB  1 
ATOM   1831 C CG  . TRP B 1 81  ? 29.405 107.888 -33.349 1.00 31.97 ? 80  TRP B CG  1 
ATOM   1832 C CD1 . TRP B 1 81  ? 30.005 107.915 -34.578 1.00 32.39 ? 80  TRP B CD1 1 
ATOM   1833 C CD2 . TRP B 1 81  ? 28.003 107.729 -33.595 1.00 31.96 ? 80  TRP B CD2 1 
ATOM   1834 N NE1 . TRP B 1 81  ? 29.061 107.831 -35.570 1.00 32.18 ? 80  TRP B NE1 1 
ATOM   1835 C CE2 . TRP B 1 81  ? 27.824 107.712 -34.996 1.00 31.99 ? 80  TRP B CE2 1 
ATOM   1836 C CE3 . TRP B 1 81  ? 26.878 107.624 -32.771 1.00 32.13 ? 80  TRP B CE3 1 
ATOM   1837 C CZ2 . TRP B 1 81  ? 26.566 107.589 -35.590 1.00 31.86 ? 80  TRP B CZ2 1 
ATOM   1838 C CZ3 . TRP B 1 81  ? 25.626 107.502 -33.364 1.00 32.22 ? 80  TRP B CZ3 1 
ATOM   1839 C CH2 . TRP B 1 81  ? 25.482 107.486 -34.761 1.00 31.79 ? 80  TRP B CH2 1 
ATOM   1840 N N   . ALA B 1 82  ? 30.161 110.850 -30.835 1.00 31.56 ? 81  ALA B N   1 
ATOM   1841 C CA  . ALA B 1 82  ? 29.628 112.208 -30.736 1.00 31.66 ? 81  ALA B CA  1 
ATOM   1842 C C   . ALA B 1 82  ? 30.699 113.256 -31.032 1.00 32.16 ? 81  ALA B C   1 
ATOM   1843 O O   . ALA B 1 82  ? 30.444 114.219 -31.751 1.00 31.43 ? 81  ALA B O   1 
ATOM   1844 C CB  . ALA B 1 82  ? 29.026 112.445 -29.359 1.00 31.67 ? 81  ALA B CB  1 
ATOM   1845 N N   . THR B 1 83  ? 31.893 113.057 -30.479 1.00 33.66 ? 82  THR B N   1 
ATOM   1846 C CA  . THR B 1 83  ? 33.017 113.971 -30.690 1.00 34.76 ? 82  THR B CA  1 
ATOM   1847 C C   . THR B 1 83  ? 33.396 114.071 -32.172 1.00 35.10 ? 82  THR B C   1 
ATOM   1848 O O   . THR B 1 83  ? 33.499 115.169 -32.711 1.00 36.16 ? 82  THR B O   1 
ATOM   1849 C CB  . THR B 1 83  ? 34.242 113.537 -29.858 1.00 35.52 ? 82  THR B CB  1 
ATOM   1850 O OG1 . THR B 1 83  ? 33.912 113.606 -28.468 1.00 35.89 ? 82  THR B OG1 1 
ATOM   1851 C CG2 . THR B 1 83  ? 35.447 114.434 -30.125 1.00 35.73 ? 82  THR B CG2 1 
ATOM   1852 N N   . GLN B 1 84  ? 33.588 112.928 -32.822 1.00 35.57 ? 83  GLN B N   1 
ATOM   1853 C CA  . GLN B 1 84  ? 33.942 112.893 -34.246 1.00 36.12 ? 83  GLN B CA  1 
ATOM   1854 C C   . GLN B 1 84  ? 32.827 113.432 -35.143 1.00 35.08 ? 83  GLN B C   1 
ATOM   1855 O O   . GLN B 1 84  ? 33.089 114.125 -36.128 1.00 34.96 ? 83  GLN B O   1 
ATOM   1856 C CB  . GLN B 1 84  ? 34.258 111.460 -34.686 1.00 37.78 ? 83  GLN B CB  1 
ATOM   1857 C CG  . GLN B 1 84  ? 35.501 110.849 -34.056 1.00 39.32 ? 83  GLN B CG  1 
ATOM   1858 C CD  . GLN B 1 84  ? 35.751 109.419 -34.515 1.00 41.21 ? 83  GLN B CD  1 
ATOM   1859 O OE1 . GLN B 1 84  ? 36.844 108.886 -34.337 1.00 42.34 ? 83  GLN B OE1 1 
ATOM   1860 N NE2 . GLN B 1 84  ? 34.738 108.792 -35.113 1.00 41.69 ? 83  GLN B NE2 1 
ATOM   1861 N N   . SER B 1 85  ? 31.587 113.100 -34.801 1.00 33.70 ? 84  SER B N   1 
ATOM   1862 C CA  . SER B 1 85  ? 30.430 113.508 -35.588 1.00 32.88 ? 84  SER B CA  1 
ATOM   1863 C C   . SER B 1 85  ? 29.947 114.919 -35.274 1.00 32.25 ? 84  SER B C   1 
ATOM   1864 O O   . SER B 1 85  ? 29.175 115.490 -36.039 1.00 31.65 ? 84  SER B O   1 
ATOM   1865 C CB  . SER B 1 85  ? 29.277 112.540 -35.345 1.00 32.62 ? 84  SER B CB  1 
ATOM   1866 O OG  . SER B 1 85  ? 29.658 111.208 -35.613 1.00 32.86 ? 84  SER B OG  1 
ATOM   1867 N N   . GLY B 1 86  ? 30.394 115.474 -34.152 1.00 32.47 ? 85  GLY B N   1 
ATOM   1868 C CA  . GLY B 1 86  ? 29.965 116.797 -33.726 1.00 32.47 ? 85  GLY B CA  1 
ATOM   1869 C C   . GLY B 1 86  ? 28.570 116.797 -33.120 1.00 32.67 ? 85  GLY B C   1 
ATOM   1870 O O   . GLY B 1 86  ? 27.827 117.768 -33.280 1.00 33.38 ? 85  GLY B O   1 
ATOM   1871 N N   . PHE B 1 87  ? 28.195 115.711 -32.440 1.00 31.89 ? 86  PHE B N   1 
ATOM   1872 C CA  . PHE B 1 87  ? 26.885 115.647 -31.787 1.00 31.28 ? 86  PHE B CA  1 
ATOM   1873 C C   . PHE B 1 87  ? 27.008 116.254 -30.396 1.00 31.72 ? 86  PHE B C   1 
ATOM   1874 O O   . PHE B 1 87  ? 27.828 115.807 -29.597 1.00 32.44 ? 86  PHE B O   1 
ATOM   1875 C CB  . PHE B 1 87  ? 26.358 114.213 -31.649 1.00 30.44 ? 86  PHE B CB  1 
ATOM   1876 C CG  . PHE B 1 87  ? 26.291 113.437 -32.937 1.00 29.60 ? 86  PHE B CG  1 
ATOM   1877 C CD1 . PHE B 1 87  ? 25.863 114.030 -34.117 1.00 29.36 ? 86  PHE B CD1 1 
ATOM   1878 C CD2 . PHE B 1 87  ? 26.572 112.077 -32.944 1.00 29.32 ? 86  PHE B CD2 1 
ATOM   1879 C CE1 . PHE B 1 87  ? 25.780 113.298 -35.289 1.00 29.28 ? 86  PHE B CE1 1 
ATOM   1880 C CE2 . PHE B 1 87  ? 26.480 111.337 -34.111 1.00 29.38 ? 86  PHE B CE2 1 
ATOM   1881 C CZ  . PHE B 1 87  ? 26.081 111.948 -35.286 1.00 29.29 ? 86  PHE B CZ  1 
ATOM   1882 N N   . THR B 1 88  ? 26.209 117.279 -30.117 1.00 32.11 ? 87  THR B N   1 
ATOM   1883 C CA  . THR B 1 88  ? 26.199 117.934 -28.805 1.00 32.52 ? 87  THR B CA  1 
ATOM   1884 C C   . THR B 1 88  ? 24.959 117.565 -27.988 1.00 31.63 ? 87  THR B C   1 
ATOM   1885 O O   . THR B 1 88  ? 24.889 117.856 -26.794 1.00 32.95 ? 87  THR B O   1 
ATOM   1886 C CB  . THR B 1 88  ? 26.272 119.464 -28.945 1.00 33.31 ? 87  THR B CB  1 
ATOM   1887 O OG1 . THR B 1 88  ? 25.187 119.923 -29.757 1.00 34.21 ? 87  THR B OG1 1 
ATOM   1888 C CG2 . THR B 1 88  ? 27.591 119.875 -29.583 1.00 33.47 ? 87  THR B CG2 1 
ATOM   1889 N N   . PHE B 1 89  ? 23.983 116.941 -28.641 1.00 30.33 ? 88  PHE B N   1 
ATOM   1890 C CA  . PHE B 1 89  ? 22.768 116.471 -27.975 1.00 29.75 ? 88  PHE B CA  1 
ATOM   1891 C C   . PHE B 1 89  ? 23.096 115.185 -27.217 1.00 29.15 ? 88  PHE B C   1 
ATOM   1892 O O   . PHE B 1 89  ? 24.081 114.520 -27.535 1.00 29.02 ? 88  PHE B O   1 
ATOM   1893 C CB  . PHE B 1 89  ? 21.628 116.235 -28.982 1.00 29.84 ? 88  PHE B CB  1 
ATOM   1894 C CG  . PHE B 1 89  ? 22.018 115.382 -30.159 1.00 29.28 ? 88  PHE B CG  1 
ATOM   1895 C CD1 . PHE B 1 89  ? 22.477 115.967 -31.335 1.00 29.31 ? 88  PHE B CD1 1 
ATOM   1896 C CD2 . PHE B 1 89  ? 21.936 114.002 -30.093 1.00 29.14 ? 88  PHE B CD2 1 
ATOM   1897 C CE1 . PHE B 1 89  ? 22.849 115.188 -32.419 1.00 29.12 ? 88  PHE B CE1 1 
ATOM   1898 C CE2 . PHE B 1 89  ? 22.304 113.219 -31.175 1.00 29.14 ? 88  PHE B CE2 1 
ATOM   1899 C CZ  . PHE B 1 89  ? 22.763 113.811 -32.339 1.00 28.82 ? 88  PHE B CZ  1 
ATOM   1900 N N   . PRO B 1 90  ? 22.278 114.827 -26.213 1.00 28.89 ? 89  PRO B N   1 
ATOM   1901 C CA  . PRO B 1 90  ? 22.583 113.615 -25.456 1.00 28.65 ? 89  PRO B CA  1 
ATOM   1902 C C   . PRO B 1 90  ? 22.326 112.302 -26.198 1.00 28.42 ? 89  PRO B C   1 
ATOM   1903 O O   . PRO B 1 90  ? 21.257 112.109 -26.785 1.00 28.44 ? 89  PRO B O   1 
ATOM   1904 C CB  . PRO B 1 90  ? 21.651 113.710 -24.237 1.00 29.38 ? 89  PRO B CB  1 
ATOM   1905 C CG  . PRO B 1 90  ? 21.189 115.133 -24.192 1.00 29.40 ? 89  PRO B CG  1 
ATOM   1906 C CD  . PRO B 1 90  ? 21.158 115.574 -25.617 1.00 29.01 ? 89  PRO B CD  1 
ATOM   1907 N N   . LEU B 1 91  ? 23.331 111.432 -26.183 1.00 28.09 ? 90  LEU B N   1 
ATOM   1908 C CA  . LEU B 1 91  ? 23.227 110.081 -26.707 1.00 28.35 ? 90  LEU B CA  1 
ATOM   1909 C C   . LEU B 1 91  ? 23.175 109.220 -25.463 1.00 28.22 ? 90  LEU B C   1 
ATOM   1910 O O   . LEU B 1 91  ? 24.147 109.173 -24.710 1.00 28.79 ? 90  LEU B O   1 
ATOM   1911 C CB  . LEU B 1 91  ? 24.434 109.696 -27.564 1.00 28.73 ? 90  LEU B CB  1 
ATOM   1912 C CG  . LEU B 1 91  ? 24.469 110.211 -29.003 1.00 29.09 ? 90  LEU B CG  1 
ATOM   1913 C CD1 . LEU B 1 91  ? 24.413 111.727 -29.061 1.00 29.30 ? 90  LEU B CD1 1 
ATOM   1914 C CD2 . LEU B 1 91  ? 25.719 109.696 -29.699 1.00 29.69 ? 90  LEU B CD2 1 
ATOM   1915 N N   . LEU B 1 92  ? 22.043 108.560 -25.238 1.00 27.74 ? 91  LEU B N   1 
ATOM   1916 C CA  . LEU B 1 92  ? 21.842 107.752 -24.040 1.00 27.89 ? 91  LEU B CA  1 
ATOM   1917 C C   . LEU B 1 92  ? 22.149 106.280 -24.272 1.00 27.87 ? 91  LEU B C   1 
ATOM   1918 O O   . LEU B 1 92  ? 21.908 105.748 -25.350 1.00 27.72 ? 91  LEU B O   1 
ATOM   1919 C CB  . LEU B 1 92  ? 20.413 107.931 -23.526 1.00 27.91 ? 91  LEU B CB  1 
ATOM   1920 C CG  . LEU B 1 92  ? 19.992 109.390 -23.320 1.00 27.68 ? 91  LEU B CG  1 
ATOM   1921 C CD1 . LEU B 1 92  ? 18.615 109.458 -22.681 1.00 28.07 ? 91  LEU B CD1 1 
ATOM   1922 C CD2 . LEU B 1 92  ? 21.002 110.146 -22.475 1.00 27.88 ? 91  LEU B CD2 1 
ATOM   1923 N N   . SER B 1 93  ? 22.657 105.628 -23.231 1.00 28.84 ? 92  SER B N   1 
ATOM   1924 C CA  . SER B 1 93  ? 23.076 104.232 -23.305 1.00 29.38 ? 92  SER B CA  1 
ATOM   1925 C C   . SER B 1 93  ? 22.079 103.259 -22.702 1.00 30.26 ? 92  SER B C   1 
ATOM   1926 O O   . SER B 1 93  ? 21.934 103.175 -21.483 1.00 31.24 ? 92  SER B O   1 
ATOM   1927 C CB  . SER B 1 93  ? 24.425 104.064 -22.611 1.00 29.84 ? 92  SER B CB  1 
ATOM   1928 O OG  . SER B 1 93  ? 25.427 104.790 -23.304 1.00 29.79 ? 92  SER B OG  1 
ATOM   1929 N N   . ASP B 1 94  ? 21.411 102.512 -23.573 1.00 30.30 ? 93  ASP B N   1 
ATOM   1930 C CA  . ASP B 1 94  ? 20.464 101.478 -23.178 1.00 30.94 ? 93  ASP B CA  1 
ATOM   1931 C C   . ASP B 1 94  ? 21.284 100.181 -23.174 1.00 31.08 ? 93  ASP B C   1 
ATOM   1932 O O   . ASP B 1 94  ? 20.929 99.182  -23.799 1.00 30.74 ? 93  ASP B O   1 
ATOM   1933 C CB  . ASP B 1 94  ? 19.335 101.443 -24.208 1.00 31.04 ? 93  ASP B CB  1 
ATOM   1934 C CG  . ASP B 1 94  ? 18.119 100.690 -23.732 1.00 31.39 ? 93  ASP B CG  1 
ATOM   1935 O OD1 . ASP B 1 94  ? 17.983 100.454 -22.513 1.00 32.08 ? 93  ASP B OD1 1 
ATOM   1936 O OD2 . ASP B 1 94  ? 17.270 100.365 -24.589 1.00 31.28 ? 93  ASP B OD2 1 
ATOM   1937 N N   . PHE B 1 95  ? 22.378 100.220 -22.417 1.00 31.83 ? 94  PHE B N   1 
ATOM   1938 C CA  . PHE B 1 95  ? 23.406 99.184  -22.410 1.00 32.42 ? 94  PHE B CA  1 
ATOM   1939 C C   . PHE B 1 95  ? 23.220 98.034  -21.427 1.00 33.27 ? 94  PHE B C   1 
ATOM   1940 O O   . PHE B 1 95  ? 23.438 96.876  -21.788 1.00 33.22 ? 94  PHE B O   1 
ATOM   1941 C CB  . PHE B 1 95  ? 24.750 99.871  -22.147 1.00 32.52 ? 94  PHE B CB  1 
ATOM   1942 C CG  . PHE B 1 95  ? 25.919 98.936  -22.093 1.00 33.14 ? 94  PHE B CG  1 
ATOM   1943 C CD1 . PHE B 1 95  ? 26.481 98.442  -23.259 1.00 32.84 ? 94  PHE B CD1 1 
ATOM   1944 C CD2 . PHE B 1 95  ? 26.483 98.581  -20.875 1.00 33.97 ? 94  PHE B CD2 1 
ATOM   1945 C CE1 . PHE B 1 95  ? 27.568 97.591  -23.213 1.00 33.49 ? 94  PHE B CE1 1 
ATOM   1946 C CE2 . PHE B 1 95  ? 27.570 97.730  -20.822 1.00 34.34 ? 94  PHE B CE2 1 
ATOM   1947 C CZ  . PHE B 1 95  ? 28.113 97.236  -21.994 1.00 34.30 ? 94  PHE B CZ  1 
ATOM   1948 N N   . TRP B 1 96  ? 22.843 98.344  -20.191 1.00 33.72 ? 95  TRP B N   1 
ATOM   1949 C CA  . TRP B 1 96  ? 22.693 97.306  -19.169 1.00 34.64 ? 95  TRP B CA  1 
ATOM   1950 C C   . TRP B 1 96  ? 21.670 97.719  -18.103 1.00 34.95 ? 95  TRP B C   1 
ATOM   1951 O O   . TRP B 1 96  ? 21.929 98.654  -17.344 1.00 35.27 ? 95  TRP B O   1 
ATOM   1952 C CB  . TRP B 1 96  ? 24.054 97.024  -18.531 1.00 34.85 ? 95  TRP B CB  1 
ATOM   1953 C CG  . TRP B 1 96  ? 24.092 95.780  -17.706 1.00 35.19 ? 95  TRP B CG  1 
ATOM   1954 C CD1 . TRP B 1 96  ? 24.302 95.693  -16.365 1.00 35.79 ? 95  TRP B CD1 1 
ATOM   1955 C CD2 . TRP B 1 96  ? 23.903 94.439  -18.171 1.00 35.40 ? 95  TRP B CD2 1 
ATOM   1956 N NE1 . TRP B 1 96  ? 24.270 94.380  -15.963 1.00 36.19 ? 95  TRP B NE1 1 
ATOM   1957 C CE2 . TRP B 1 96  ? 24.025 93.589  -17.053 1.00 36.17 ? 95  TRP B CE2 1 
ATOM   1958 C CE3 . TRP B 1 96  ? 23.650 93.873  -19.426 1.00 35.40 ? 95  TRP B CE3 1 
ATOM   1959 C CZ2 . TRP B 1 96  ? 23.897 92.201  -17.149 1.00 36.77 ? 95  TRP B CZ2 1 
ATOM   1960 C CZ3 . TRP B 1 96  ? 23.520 92.490  -19.523 1.00 35.76 ? 95  TRP B CZ3 1 
ATOM   1961 C CH2 . TRP B 1 96  ? 23.645 91.672  -18.390 1.00 36.53 ? 95  TRP B CH2 1 
ATOM   1962 N N   . PRO B 1 97  ? 20.522 97.038  -18.027 1.00 35.48 ? 96  PRO B N   1 
ATOM   1963 C CA  . PRO B 1 97  ? 20.168 95.895  -18.887 1.00 35.46 ? 96  PRO B CA  1 
ATOM   1964 C C   . PRO B 1 97  ? 20.110 96.236  -20.380 1.00 34.90 ? 96  PRO B C   1 
ATOM   1965 O O   . PRO B 1 97  ? 19.669 97.323  -20.761 1.00 33.98 ? 96  PRO B O   1 
ATOM   1966 C CB  . PRO B 1 97  ? 18.793 95.447  -18.365 1.00 35.90 ? 96  PRO B CB  1 
ATOM   1967 C CG  . PRO B 1 97  ? 18.349 96.479  -17.385 1.00 36.11 ? 96  PRO B CG  1 
ATOM   1968 C CD  . PRO B 1 97  ? 19.552 97.252  -16.940 1.00 36.16 ? 96  PRO B CD  1 
ATOM   1969 N N   . HIS B 1 98  ? 20.558 95.289  -21.201 1.00 34.94 ? 97  HIS B N   1 
ATOM   1970 C CA  . HIS B 1 98  ? 20.678 95.471  -22.645 1.00 34.42 ? 97  HIS B CA  1 
ATOM   1971 C C   . HIS B 1 98  ? 19.356 95.713  -23.364 1.00 33.71 ? 97  HIS B C   1 
ATOM   1972 O O   . HIS B 1 98  ? 18.552 94.797  -23.527 1.00 33.92 ? 97  HIS B O   1 
ATOM   1973 C CB  . HIS B 1 98  ? 21.374 94.255  -23.260 1.00 34.92 ? 97  HIS B CB  1 
ATOM   1974 C CG  . HIS B 1 98  ? 21.651 94.398  -24.721 1.00 35.14 ? 97  HIS B CG  1 
ATOM   1975 N ND1 . HIS B 1 98  ? 22.890 94.742  -25.212 1.00 35.35 ? 97  HIS B ND1 1 
ATOM   1976 C CD2 . HIS B 1 98  ? 20.844 94.267  -25.799 1.00 35.20 ? 97  HIS B CD2 1 
ATOM   1977 C CE1 . HIS B 1 98  ? 22.841 94.802  -26.529 1.00 35.14 ? 97  HIS B CE1 1 
ATOM   1978 N NE2 . HIS B 1 98  ? 21.609 94.521  -26.911 1.00 35.22 ? 97  HIS B NE2 1 
ATOM   1979 N N   . GLY B 1 99  ? 19.152 96.947  -23.813 1.00 32.76 ? 98  GLY B N   1 
ATOM   1980 C CA  . GLY B 1 99  ? 17.948 97.302  -24.549 1.00 32.66 ? 98  GLY B CA  1 
ATOM   1981 C C   . GLY B 1 99  ? 16.673 97.325  -23.723 1.00 32.61 ? 98  GLY B C   1 
ATOM   1982 O O   . GLY B 1 99  ? 15.581 97.218  -24.275 1.00 32.71 ? 98  GLY B O   1 
ATOM   1983 N N   . ALA B 1 100 ? 16.796 97.471  -22.407 1.00 32.97 ? 99  ALA B N   1 
ATOM   1984 C CA  . ALA B 1 100 ? 15.619 97.483  -21.531 1.00 33.28 ? 99  ALA B CA  1 
ATOM   1985 C C   . ALA B 1 100 ? 14.641 98.582  -21.934 1.00 32.93 ? 99  ALA B C   1 
ATOM   1986 O O   . ALA B 1 100 ? 13.444 98.333  -22.083 1.00 32.85 ? 99  ALA B O   1 
ATOM   1987 C CB  . ALA B 1 100 ? 16.033 97.653  -20.078 1.00 33.52 ? 99  ALA B CB  1 
ATOM   1988 N N   . VAL B 1 101 ? 15.166 99.790  -22.124 1.00 32.64 ? 100 VAL B N   1 
ATOM   1989 C CA  . VAL B 1 101 ? 14.349 100.942 -22.515 1.00 32.43 ? 100 VAL B CA  1 
ATOM   1990 C C   . VAL B 1 101 ? 13.742 100.726 -23.905 1.00 32.32 ? 100 VAL B C   1 
ATOM   1991 O O   . VAL B 1 101 ? 12.563 101.009 -24.117 1.00 32.33 ? 100 VAL B O   1 
ATOM   1992 C CB  . VAL B 1 101 ? 15.161 102.258 -22.461 1.00 32.17 ? 100 VAL B CB  1 
ATOM   1993 C CG1 . VAL B 1 101 ? 14.332 103.437 -22.962 1.00 31.94 ? 100 VAL B CG1 1 
ATOM   1994 C CG2 . VAL B 1 101 ? 15.659 102.510 -21.040 1.00 32.59 ? 100 VAL B CG2 1 
ATOM   1995 N N   . SER B 1 102 ? 14.542 100.210 -24.837 1.00 32.33 ? 101 SER B N   1 
ATOM   1996 C CA  . SER B 1 102 ? 14.070 99.923  -26.192 1.00 32.51 ? 101 SER B CA  1 
ATOM   1997 C C   . SER B 1 102 ? 12.895 98.946  -26.174 1.00 32.52 ? 101 SER B C   1 
ATOM   1998 O O   . SER B 1 102 ? 11.946 99.105  -26.938 1.00 32.18 ? 101 SER B O   1 
ATOM   1999 C CB  . SER B 1 102 ? 15.197 99.343  -27.047 1.00 32.70 ? 101 SER B CB  1 
ATOM   2000 O OG  . SER B 1 102 ? 16.261 100.263 -27.174 1.00 33.58 ? 101 SER B OG  1 
ATOM   2001 N N   . GLN B 1 103 ? 12.973 97.937  -25.308 1.00 33.13 ? 102 GLN B N   1 
ATOM   2002 C CA  . GLN B 1 103 ? 11.907 96.940  -25.169 1.00 33.78 ? 102 GLN B CA  1 
ATOM   2003 C C   . GLN B 1 103 ? 10.644 97.567  -24.595 1.00 33.10 ? 102 GLN B C   1 
ATOM   2004 O O   . GLN B 1 103 ? 9.545  97.268  -25.053 1.00 33.13 ? 102 GLN B O   1 
ATOM   2005 C CB  . GLN B 1 103 ? 12.353 95.780  -24.276 1.00 35.05 ? 102 GLN B CB  1 
ATOM   2006 C CG  . GLN B 1 103 ? 13.471 94.937  -24.866 1.00 36.18 ? 102 GLN B CG  1 
ATOM   2007 C CD  . GLN B 1 103 ? 14.070 93.969  -23.857 1.00 37.65 ? 102 GLN B CD  1 
ATOM   2008 O OE1 . GLN B 1 103 ? 13.350 93.345  -23.077 1.00 39.14 ? 102 GLN B OE1 1 
ATOM   2009 N NE2 . GLN B 1 103 ? 15.392 93.833  -23.875 1.00 38.09 ? 102 GLN B NE2 1 
ATOM   2010 N N   . ALA B 1 104 ? 10.804 98.438  -23.599 1.00 32.50 ? 103 ALA B N   1 
ATOM   2011 C CA  . ALA B 1 104 ? 9.668  99.124  -22.981 1.00 32.27 ? 103 ALA B CA  1 
ATOM   2012 C C   . ALA B 1 104 ? 8.909  99.957  -24.013 1.00 31.83 ? 103 ALA B C   1 
ATOM   2013 O O   . ALA B 1 104 ? 7.683  100.019 -23.982 1.00 32.22 ? 103 ALA B O   1 
ATOM   2014 C CB  . ALA B 1 104 ? 10.132 100.001 -21.827 1.00 32.41 ? 103 ALA B CB  1 
ATOM   2015 N N   . TYR B 1 105 ? 9.641  100.588 -24.930 1.00 30.92 ? 104 TYR B N   1 
ATOM   2016 C CA  . TYR B 1 105 ? 9.025  101.374 -26.001 1.00 30.47 ? 104 TYR B CA  1 
ATOM   2017 C C   . TYR B 1 105 ? 8.577  100.526 -27.197 1.00 31.00 ? 104 TYR B C   1 
ATOM   2018 O O   . TYR B 1 105 ? 7.941  101.042 -28.120 1.00 30.67 ? 104 TYR B O   1 
ATOM   2019 C CB  . TYR B 1 105 ? 9.957  102.503 -26.446 1.00 29.69 ? 104 TYR B CB  1 
ATOM   2020 C CG  . TYR B 1 105 ? 9.949  103.664 -25.482 1.00 29.41 ? 104 TYR B CG  1 
ATOM   2021 C CD1 . TYR B 1 105 ? 10.687 103.624 -24.305 1.00 29.12 ? 104 TYR B CD1 1 
ATOM   2022 C CD2 . TYR B 1 105 ? 9.189  104.798 -25.742 1.00 29.26 ? 104 TYR B CD2 1 
ATOM   2023 C CE1 . TYR B 1 105 ? 10.670 104.681 -23.415 1.00 29.18 ? 104 TYR B CE1 1 
ATOM   2024 C CE2 . TYR B 1 105 ? 9.171  105.862 -24.859 1.00 29.29 ? 104 TYR B CE2 1 
ATOM   2025 C CZ  . TYR B 1 105 ? 9.913  105.797 -23.699 1.00 29.11 ? 104 TYR B CZ  1 
ATOM   2026 O OH  . TYR B 1 105 ? 9.893  106.848 -22.821 1.00 29.84 ? 104 TYR B OH  1 
ATOM   2027 N N   . GLY B 1 106 ? 8.902  99.235  -27.176 1.00 31.73 ? 105 GLY B N   1 
ATOM   2028 C CA  . GLY B 1 106 ? 8.505  98.311  -28.234 1.00 32.30 ? 105 GLY B CA  1 
ATOM   2029 C C   . GLY B 1 106 ? 9.291  98.488  -29.516 1.00 32.46 ? 105 GLY B C   1 
ATOM   2030 O O   . GLY B 1 106 ? 8.790  98.186  -30.600 1.00 32.89 ? 105 GLY B O   1 
ATOM   2031 N N   . VAL B 1 107 ? 10.531 98.960  -29.388 1.00 32.41 ? 106 VAL B N   1 
ATOM   2032 C CA  . VAL B 1 107 ? 11.395 99.208  -30.540 1.00 32.27 ? 106 VAL B CA  1 
ATOM   2033 C C   . VAL B 1 107 ? 12.703 98.432  -30.435 1.00 32.46 ? 106 VAL B C   1 
ATOM   2034 O O   . VAL B 1 107 ? 13.745 98.900  -30.892 1.00 32.62 ? 106 VAL B O   1 
ATOM   2035 C CB  . VAL B 1 107 ? 11.701 100.718 -30.708 1.00 32.20 ? 106 VAL B CB  1 
ATOM   2036 C CG1 . VAL B 1 107 ? 10.442 101.477 -31.089 1.00 32.43 ? 106 VAL B CG1 1 
ATOM   2037 C CG2 . VAL B 1 107 ? 12.311 101.305 -29.441 1.00 32.21 ? 106 VAL B CG2 1 
ATOM   2038 N N   . PHE B 1 108 ? 12.652 97.247  -29.835 1.00 33.07 ? 107 PHE B N   1 
ATOM   2039 C CA  . PHE B 1 108 ? 13.844 96.432  -29.686 1.00 33.50 ? 107 PHE B CA  1 
ATOM   2040 C C   . PHE B 1 108 ? 13.809 95.241  -30.635 1.00 34.67 ? 107 PHE B C   1 
ATOM   2041 O O   . PHE B 1 108 ? 12.797 94.552  -30.745 1.00 34.73 ? 107 PHE B O   1 
ATOM   2042 C CB  . PHE B 1 108 ? 13.997 95.956  -28.244 1.00 33.54 ? 107 PHE B CB  1 
ATOM   2043 C CG  . PHE B 1 108 ? 15.284 95.225  -27.987 1.00 33.37 ? 107 PHE B CG  1 
ATOM   2044 C CD1 . PHE B 1 108 ? 16.495 95.907  -27.998 1.00 33.02 ? 107 PHE B CD1 1 
ATOM   2045 C CD2 . PHE B 1 108 ? 15.288 93.864  -27.717 1.00 33.83 ? 107 PHE B CD2 1 
ATOM   2046 C CE1 . PHE B 1 108 ? 17.685 95.242  -27.761 1.00 32.95 ? 107 PHE B CE1 1 
ATOM   2047 C CE2 . PHE B 1 108 ? 16.476 93.195  -27.473 1.00 33.81 ? 107 PHE B CE2 1 
ATOM   2048 C CZ  . PHE B 1 108 ? 17.674 93.884  -27.495 1.00 33.47 ? 107 PHE B CZ  1 
ATOM   2049 N N   . ASN B 1 109 ? 14.924 95.025  -31.326 1.00 35.49 ? 108 ASN B N   1 
ATOM   2050 C CA  . ASN B 1 109 ? 15.080 93.906  -32.240 1.00 36.85 ? 108 ASN B CA  1 
ATOM   2051 C C   . ASN B 1 109 ? 15.734 92.754  -31.475 1.00 38.67 ? 108 ASN B C   1 
ATOM   2052 O O   . ASN B 1 109 ? 16.944 92.761  -31.248 1.00 38.31 ? 108 ASN B O   1 
ATOM   2053 C CB  . ASN B 1 109 ? 15.931 94.337  -33.439 1.00 36.59 ? 108 ASN B CB  1 
ATOM   2054 C CG  . ASN B 1 109 ? 16.068 93.257  -34.495 1.00 36.96 ? 108 ASN B CG  1 
ATOM   2055 O OD1 . ASN B 1 109 ? 15.859 92.075  -34.229 1.00 37.65 ? 108 ASN B OD1 1 
ATOM   2056 N ND2 . ASN B 1 109 ? 16.451 93.662  -35.701 1.00 36.54 ? 108 ASN B ND2 1 
ATOM   2057 N N   . GLU B 1 110 ? 14.919 91.786  -31.054 1.00 41.12 ? 109 GLU B N   1 
ATOM   2058 C CA  . GLU B 1 110 ? 15.400 90.610  -30.310 1.00 43.62 ? 109 GLU B CA  1 
ATOM   2059 C C   . GLU B 1 110 ? 16.384 89.727  -31.083 1.00 43.30 ? 109 GLU B C   1 
ATOM   2060 O O   . GLU B 1 110 ? 17.234 89.086  -30.471 1.00 43.63 ? 109 GLU B O   1 
ATOM   2061 C CB  . GLU B 1 110 ? 14.222 89.752  -29.819 1.00 46.14 ? 109 GLU B CB  1 
ATOM   2062 C CG  . GLU B 1 110 ? 13.583 90.233  -28.521 1.00 48.25 ? 109 GLU B CG  1 
ATOM   2063 C CD  . GLU B 1 110 ? 14.430 89.944  -27.287 1.00 51.10 ? 109 GLU B CD  1 
ATOM   2064 O OE1 . GLU B 1 110 ? 15.351 89.096  -27.358 1.00 53.58 ? 109 GLU B OE1 1 
ATOM   2065 O OE2 . GLU B 1 110 ? 14.161 90.554  -26.230 1.00 53.35 ? 109 GLU B OE2 1 
ATOM   2066 N N   . GLN B 1 111 ? 16.264 89.679  -32.408 1.00 43.19 ? 110 GLN B N   1 
ATOM   2067 C CA  . GLN B 1 111 ? 17.168 88.863  -33.225 1.00 44.01 ? 110 GLN B CA  1 
ATOM   2068 C C   . GLN B 1 111 ? 18.591 89.423  -33.258 1.00 42.28 ? 110 GLN B C   1 
ATOM   2069 O O   . GLN B 1 111 ? 19.554 88.688  -33.036 1.00 42.60 ? 110 GLN B O   1 
ATOM   2070 C CB  . GLN B 1 111 ? 16.646 88.733  -34.662 1.00 45.77 ? 110 GLN B CB  1 
ATOM   2071 C CG  . GLN B 1 111 ? 15.371 87.913  -34.833 1.00 48.46 ? 110 GLN B CG  1 
ATOM   2072 C CD  . GLN B 1 111 ? 15.584 86.407  -34.695 1.00 50.98 ? 110 GLN B CD  1 
ATOM   2073 O OE1 . GLN B 1 111 ? 16.397 85.946  -33.888 1.00 52.94 ? 110 GLN B OE1 1 
ATOM   2074 N NE2 . GLN B 1 111 ? 14.833 85.629  -35.477 1.00 52.12 ? 110 GLN B NE2 1 
ATOM   2075 N N   . ALA B 1 112 ? 18.712 90.722  -33.528 1.00 40.08 ? 111 ALA B N   1 
ATOM   2076 C CA  . ALA B 1 112 ? 20.017 91.391  -33.640 1.00 38.25 ? 111 ALA B CA  1 
ATOM   2077 C C   . ALA B 1 112 ? 20.531 92.009  -32.335 1.00 36.86 ? 111 ALA B C   1 
ATOM   2078 O O   . ALA B 1 112 ? 21.724 92.285  -32.213 1.00 36.83 ? 111 ALA B O   1 
ATOM   2079 C CB  . ALA B 1 112 ? 19.958 92.453  -34.727 1.00 37.56 ? 111 ALA B CB  1 
ATOM   2080 N N   . GLY B 1 113 ? 19.644 92.234  -31.370 1.00 35.46 ? 112 GLY B N   1 
ATOM   2081 C CA  . GLY B 1 113 ? 20.037 92.831  -30.093 1.00 34.72 ? 112 GLY B CA  1 
ATOM   2082 C C   . GLY B 1 113 ? 20.327 94.319  -30.190 1.00 33.72 ? 112 GLY B C   1 
ATOM   2083 O O   . GLY B 1 113 ? 21.200 94.836  -29.491 1.00 33.43 ? 112 GLY B O   1 
ATOM   2084 N N   . ILE B 1 114 ? 19.595 95.004  -31.061 1.00 32.86 ? 113 ILE B N   1 
ATOM   2085 C CA  . ILE B 1 114 ? 19.741 96.441  -31.259 1.00 32.40 ? 113 ILE B CA  1 
ATOM   2086 C C   . ILE B 1 114 ? 18.357 97.063  -31.310 1.00 32.13 ? 113 ILE B C   1 
ATOM   2087 O O   . ILE B 1 114 ? 17.365 96.366  -31.507 1.00 31.62 ? 113 ILE B O   1 
ATOM   2088 C CB  . ILE B 1 114 ? 20.502 96.775  -32.564 1.00 32.46 ? 113 ILE B CB  1 
ATOM   2089 C CG1 . ILE B 1 114 ? 19.735 96.270  -33.797 1.00 32.84 ? 113 ILE B CG1 1 
ATOM   2090 C CG2 . ILE B 1 114 ? 21.906 96.191  -32.524 1.00 33.01 ? 113 ILE B CG2 1 
ATOM   2091 C CD1 . ILE B 1 114 ? 20.470 96.452  -35.108 1.00 33.11 ? 113 ILE B CD1 1 
ATOM   2092 N N   . ALA B 1 115 ? 18.291 98.375  -31.127 1.00 31.93 ? 114 ALA B N   1 
ATOM   2093 C CA  . ALA B 1 115 ? 17.024 99.081  -31.200 1.00 31.76 ? 114 ALA B CA  1 
ATOM   2094 C C   . ALA B 1 115 ? 16.680 99.342  -32.658 1.00 32.08 ? 114 ALA B C   1 
ATOM   2095 O O   . ALA B 1 115 ? 17.563 99.632  -33.466 1.00 32.36 ? 114 ALA B O   1 
ATOM   2096 C CB  . ALA B 1 115 ? 17.106 100.398 -30.445 1.00 31.45 ? 114 ALA B CB  1 
ATOM   2097 N N   . ASN B 1 116 ? 15.402 99.214  -33.001 1.00 32.51 ? 115 ASN B N   1 
ATOM   2098 C CA  . ASN B 1 116 ? 14.948 99.561  -34.340 1.00 32.75 ? 115 ASN B CA  1 
ATOM   2099 C C   . ASN B 1 116 ? 14.905 101.082 -34.406 1.00 32.94 ? 115 ASN B C   1 
ATOM   2100 O O   . ASN B 1 116 ? 14.813 101.755 -33.374 1.00 32.91 ? 115 ASN B O   1 
ATOM   2101 C CB  . ASN B 1 116 ? 13.564 98.983  -34.641 1.00 33.06 ? 115 ASN B CB  1 
ATOM   2102 C CG  . ASN B 1 116 ? 13.555 97.465  -34.722 1.00 33.35 ? 115 ASN B CG  1 
ATOM   2103 O OD1 . ASN B 1 116 ? 12.700 96.814  -34.122 1.00 33.71 ? 115 ASN B OD1 1 
ATOM   2104 N ND2 . ASN B 1 116 ? 14.492 96.894  -35.472 1.00 33.48 ? 115 ASN B ND2 1 
ATOM   2105 N N   . ALA B 1 117 ? 14.969 101.625 -35.614 1.00 32.93 ? 116 ALA B N   1 
ATOM   2106 C CA  . ALA B 1 117 ? 14.969 103.071 -35.791 1.00 32.73 ? 116 ALA B CA  1 
ATOM   2107 C C   . ALA B 1 117 ? 13.575 103.663 -35.564 1.00 32.60 ? 116 ALA B C   1 
ATOM   2108 O O   . ALA B 1 117 ? 12.880 104.049 -36.505 1.00 33.30 ? 116 ALA B O   1 
ATOM   2109 C CB  . ALA B 1 117 ? 15.520 103.439 -37.161 1.00 32.97 ? 116 ALA B CB  1 
ATOM   2110 N N   . GLY B 1 118 ? 13.186 103.732 -34.294 1.00 32.05 ? 117 GLY B N   1 
ATOM   2111 C CA  . GLY B 1 118 ? 11.902 104.290 -33.892 1.00 31.72 ? 117 GLY B CA  1 
ATOM   2112 C C   . GLY B 1 118 ? 12.078 105.665 -33.273 1.00 30.91 ? 117 GLY B C   1 
ATOM   2113 O O   . GLY B 1 118 ? 13.065 105.923 -32.587 1.00 30.44 ? 117 GLY B O   1 
ATOM   2114 N N   . THR B 1 119 ? 11.129 106.554 -33.536 1.00 30.53 ? 118 THR B N   1 
ATOM   2115 C CA  . THR B 1 119 ? 11.154 107.908 -32.996 1.00 30.42 ? 118 THR B CA  1 
ATOM   2116 C C   . THR B 1 119 ? 9.843  108.203 -32.286 1.00 29.82 ? 118 THR B C   1 
ATOM   2117 O O   . THR B 1 119 ? 8.770  107.832 -32.766 1.00 30.16 ? 118 THR B O   1 
ATOM   2118 C CB  . THR B 1 119 ? 11.367 108.957 -34.104 1.00 30.86 ? 118 THR B CB  1 
ATOM   2119 O OG1 . THR B 1 119 ? 12.640 108.745 -34.721 1.00 32.30 ? 118 THR B OG1 1 
ATOM   2120 C CG2 . THR B 1 119 ? 11.325 110.373 -33.541 1.00 30.99 ? 118 THR B CG2 1 
ATOM   2121 N N   . PHE B 1 120 ? 9.942  108.873 -31.144 1.00 28.89 ? 119 PHE B N   1 
ATOM   2122 C CA  . PHE B 1 120 ? 8.778  109.265 -30.364 1.00 28.58 ? 119 PHE B CA  1 
ATOM   2123 C C   . PHE B 1 120 ? 8.884  110.720 -29.948 1.00 28.52 ? 119 PHE B C   1 
ATOM   2124 O O   . PHE B 1 120 ? 9.985  111.263 -29.815 1.00 28.52 ? 119 PHE B O   1 
ATOM   2125 C CB  . PHE B 1 120 ? 8.676  108.446 -29.078 1.00 28.41 ? 119 PHE B CB  1 
ATOM   2126 C CG  . PHE B 1 120 ? 8.554  106.970 -29.295 1.00 28.51 ? 119 PHE B CG  1 
ATOM   2127 C CD1 . PHE B 1 120 ? 9.684  106.173 -29.371 1.00 28.13 ? 119 PHE B CD1 1 
ATOM   2128 C CD2 . PHE B 1 120 ? 7.305  106.370 -29.399 1.00 28.73 ? 119 PHE B CD2 1 
ATOM   2129 C CE1 . PHE B 1 120 ? 9.574  104.807 -29.567 1.00 28.39 ? 119 PHE B CE1 1 
ATOM   2130 C CE2 . PHE B 1 120 ? 7.189  105.006 -29.594 1.00 28.53 ? 119 PHE B CE2 1 
ATOM   2131 C CZ  . PHE B 1 120 ? 8.324  104.223 -29.677 1.00 28.40 ? 119 PHE B CZ  1 
ATOM   2132 N N   . VAL B 1 121 ? 7.732  111.347 -29.749 1.00 28.51 ? 120 VAL B N   1 
ATOM   2133 C CA  . VAL B 1 121 ? 7.675  112.680 -29.189 1.00 28.82 ? 120 VAL B CA  1 
ATOM   2134 C C   . VAL B 1 121 ? 6.829  112.538 -27.935 1.00 29.62 ? 120 VAL B C   1 
ATOM   2135 O O   . VAL B 1 121 ? 5.683  112.090 -27.999 1.00 30.10 ? 120 VAL B O   1 
ATOM   2136 C CB  . VAL B 1 121 ? 7.055  113.724 -30.129 1.00 29.09 ? 120 VAL B CB  1 
ATOM   2137 C CG1 . VAL B 1 121 ? 6.918  115.062 -29.411 1.00 29.44 ? 120 VAL B CG1 1 
ATOM   2138 C CG2 . VAL B 1 121 ? 7.897  113.870 -31.385 1.00 28.69 ? 120 VAL B CG2 1 
ATOM   2139 N N   . VAL B 1 122 ? 7.419  112.886 -26.799 1.00 29.93 ? 121 VAL B N   1 
ATOM   2140 C CA  . VAL B 1 122 ? 6.753  112.825 -25.517 1.00 31.02 ? 121 VAL B CA  1 
ATOM   2141 C C   . VAL B 1 122 ? 6.401  114.257 -25.146 1.00 31.91 ? 121 VAL B C   1 
ATOM   2142 O O   . VAL B 1 122 ? 7.275  115.122 -25.145 1.00 31.48 ? 121 VAL B O   1 
ATOM   2143 C CB  . VAL B 1 122 ? 7.685  112.222 -24.452 1.00 31.10 ? 121 VAL B CB  1 
ATOM   2144 C CG1 . VAL B 1 122 ? 6.981  112.143 -23.109 1.00 31.87 ? 121 VAL B CG1 1 
ATOM   2145 C CG2 . VAL B 1 122 ? 8.155  110.843 -24.892 1.00 30.90 ? 121 VAL B CG2 1 
ATOM   2146 N N   . ASP B 1 123 ? 5.130  114.518 -24.846 1.00 33.12 ? 122 ASP B N   1 
ATOM   2147 C CA  . ASP B 1 123 ? 4.714  115.876 -24.492 1.00 34.56 ? 122 ASP B CA  1 
ATOM   2148 C C   . ASP B 1 123 ? 5.101  116.220 -23.051 1.00 35.06 ? 122 ASP B C   1 
ATOM   2149 O O   . ASP B 1 123 ? 5.687  115.399 -22.344 1.00 34.63 ? 122 ASP B O   1 
ATOM   2150 C CB  . ASP B 1 123 ? 3.211  116.098 -24.749 1.00 35.77 ? 122 ASP B CB  1 
ATOM   2151 C CG  . ASP B 1 123 ? 2.305  115.280 -23.832 1.00 36.72 ? 122 ASP B CG  1 
ATOM   2152 O OD1 . ASP B 1 123 ? 2.795  114.667 -22.863 1.00 38.01 ? 122 ASP B OD1 1 
ATOM   2153 O OD2 . ASP B 1 123 ? 1.080  115.270 -24.074 1.00 38.14 ? 122 ASP B OD2 1 
ATOM   2154 N N   . ARG B 1 124 ? 4.762  117.433 -22.625 1.00 36.38 ? 123 ARG B N   1 
ATOM   2155 C CA  . ARG B 1 124 ? 5.056  117.897 -21.269 1.00 37.57 ? 123 ARG B CA  1 
ATOM   2156 C C   . ARG B 1 124 ? 4.409  117.052 -20.175 1.00 37.22 ? 123 ARG B C   1 
ATOM   2157 O O   . ARG B 1 124 ? 4.799  117.152 -19.017 1.00 37.55 ? 123 ARG B O   1 
ATOM   2158 C CB  . ARG B 1 124 ? 4.626  119.356 -21.110 1.00 39.75 ? 123 ARG B CB  1 
ATOM   2159 C CG  . ARG B 1 124 ? 5.446  120.315 -21.955 1.00 41.46 ? 123 ARG B CG  1 
ATOM   2160 C CD  . ARG B 1 124 ? 4.937  121.743 -21.873 1.00 43.94 ? 123 ARG B CD  1 
ATOM   2161 N NE  . ARG B 1 124 ? 5.845  122.632 -22.590 1.00 46.34 ? 123 ARG B NE  1 
ATOM   2162 C CZ  . ARG B 1 124 ? 5.785  122.913 -23.894 1.00 48.32 ? 123 ARG B CZ  1 
ATOM   2163 N NH1 . ARG B 1 124 ? 4.833  122.396 -24.672 1.00 49.04 ? 123 ARG B NH1 1 
ATOM   2164 N NH2 . ARG B 1 124 ? 6.691  123.731 -24.425 1.00 48.66 ? 123 ARG B NH2 1 
ATOM   2165 N N   . SER B 1 125 ? 3.418  116.240 -20.540 1.00 37.22 ? 124 SER B N   1 
ATOM   2166 C CA  . SER B 1 125 ? 2.718  115.368 -19.598 1.00 37.58 ? 124 SER B CA  1 
ATOM   2167 C C   . SER B 1 125 ? 3.251  113.938 -19.546 1.00 37.09 ? 124 SER B C   1 
ATOM   2168 O O   . SER B 1 125 ? 2.752  113.128 -18.765 1.00 38.04 ? 124 SER B O   1 
ATOM   2169 C CB  . SER B 1 125 ? 1.227  115.327 -19.944 1.00 38.16 ? 124 SER B CB  1 
ATOM   2170 O OG  . SER B 1 125 ? 0.662  116.624 -19.898 1.00 38.88 ? 124 SER B OG  1 
ATOM   2171 N N   . GLY B 1 126 ? 4.253  113.622 -20.364 1.00 36.10 ? 125 GLY B N   1 
ATOM   2172 C CA  . GLY B 1 126 ? 4.820  112.275 -20.397 1.00 35.29 ? 125 GLY B CA  1 
ATOM   2173 C C   . GLY B 1 126 ? 4.019  111.316 -21.262 1.00 34.69 ? 125 GLY B C   1 
ATOM   2174 O O   . GLY B 1 126 ? 4.183  110.099 -21.165 1.00 34.73 ? 125 GLY B O   1 
ATOM   2175 N N   . ILE B 1 127 ? 3.153  111.866 -22.108 1.00 34.24 ? 126 ILE B N   1 
ATOM   2176 C CA  . ILE B 1 127 ? 2.325  111.078 -23.010 1.00 33.97 ? 126 ILE B CA  1 
ATOM   2177 C C   . ILE B 1 127 ? 2.953  111.106 -24.395 1.00 32.60 ? 126 ILE B C   1 
ATOM   2178 O O   . ILE B 1 127 ? 3.380  112.159 -24.865 1.00 32.14 ? 126 ILE B O   1 
ATOM   2179 C CB  . ILE B 1 127 ? 0.895  111.658 -23.120 1.00 34.89 ? 126 ILE B CB  1 
ATOM   2180 C CG1 . ILE B 1 127 ? 0.234  111.770 -21.737 1.00 35.81 ? 126 ILE B CG1 1 
ATOM   2181 C CG2 . ILE B 1 127 ? 0.043  110.824 -24.071 1.00 34.96 ? 126 ILE B CG2 1 
ATOM   2182 C CD1 . ILE B 1 127 ? 0.098  110.458 -20.991 1.00 35.84 ? 126 ILE B CD1 1 
ATOM   2183 N N   . ILE B 1 128 ? 3.011  109.945 -25.040 1.00 31.68 ? 127 ILE B N   1 
ATOM   2184 C CA  . ILE B 1 128 ? 3.544  109.843 -26.396 1.00 31.12 ? 127 ILE B CA  1 
ATOM   2185 C C   . ILE B 1 128 ? 2.547  110.498 -27.345 1.00 31.30 ? 127 ILE B C   1 
ATOM   2186 O O   . ILE B 1 128 ? 1.371  110.140 -27.357 1.00 31.72 ? 127 ILE B O   1 
ATOM   2187 C CB  . ILE B 1 128 ? 3.782  108.373 -26.798 1.00 30.81 ? 127 ILE B CB  1 
ATOM   2188 C CG1 . ILE B 1 128 ? 4.918  107.788 -25.950 1.00 30.55 ? 127 ILE B CG1 1 
ATOM   2189 C CG2 . ILE B 1 128 ? 4.111  108.270 -28.283 1.00 30.43 ? 127 ILE B CG2 1 
ATOM   2190 C CD1 . ILE B 1 128 ? 5.118  106.298 -26.114 1.00 30.70 ? 127 ILE B CD1 1 
ATOM   2191 N N   . ARG B 1 129 ? 3.015  111.475 -28.114 1.00 31.05 ? 128 ARG B N   1 
ATOM   2192 C CA  . ARG B 1 129 ? 2.161  112.203 -29.044 1.00 31.58 ? 128 ARG B CA  1 
ATOM   2193 C C   . ARG B 1 129 ? 2.482  111.917 -30.506 1.00 31.85 ? 128 ARG B C   1 
ATOM   2194 O O   . ARG B 1 129 ? 1.695  112.255 -31.387 1.00 32.20 ? 128 ARG B O   1 
ATOM   2195 C CB  . ARG B 1 129 ? 2.268  113.704 -28.771 1.00 31.68 ? 128 ARG B CB  1 
ATOM   2196 C CG  . ARG B 1 129 ? 1.825  114.109 -27.371 1.00 32.03 ? 128 ARG B CG  1 
ATOM   2197 C CD  . ARG B 1 129 ? 0.329  113.926 -27.140 1.00 32.64 ? 128 ARG B CD  1 
ATOM   2198 N NE  . ARG B 1 129 ? -0.443 114.933 -27.871 1.00 33.20 ? 128 ARG B NE  1 
ATOM   2199 C CZ  . ARG B 1 129 ? -0.765 116.145 -27.408 1.00 33.69 ? 128 ARG B CZ  1 
ATOM   2200 N NH1 . ARG B 1 129 ? -0.403 116.545 -26.189 1.00 33.57 ? 128 ARG B NH1 1 
ATOM   2201 N NH2 . ARG B 1 129 ? -1.461 116.973 -28.176 1.00 34.31 ? 128 ARG B NH2 1 
ATOM   2202 N N   . PHE B 1 130 ? 3.630  111.294 -30.753 1.00 31.96 ? 129 PHE B N   1 
ATOM   2203 C CA  . PHE B 1 130 ? 4.075  110.961 -32.097 1.00 32.10 ? 129 PHE B CA  1 
ATOM   2204 C C   . PHE B 1 130 ? 4.899  109.682 -32.027 1.00 32.87 ? 129 PHE B C   1 
ATOM   2205 O O   . PHE B 1 130 ? 5.682  109.499 -31.098 1.00 32.03 ? 129 PHE B O   1 
ATOM   2206 C CB  . PHE B 1 130 ? 4.913  112.111 -32.647 1.00 31.70 ? 129 PHE B CB  1 
ATOM   2207 C CG  . PHE B 1 130 ? 5.589  111.815 -33.954 1.00 31.11 ? 129 PHE B CG  1 
ATOM   2208 C CD1 . PHE B 1 130 ? 6.842  111.209 -33.978 1.00 30.63 ? 129 PHE B CD1 1 
ATOM   2209 C CD2 . PHE B 1 130 ? 4.995  112.167 -35.154 1.00 30.90 ? 129 PHE B CD2 1 
ATOM   2210 C CE1 . PHE B 1 130 ? 7.477  110.941 -35.179 1.00 30.20 ? 129 PHE B CE1 1 
ATOM   2211 C CE2 . PHE B 1 130 ? 5.626  111.903 -36.356 1.00 30.90 ? 129 PHE B CE2 1 
ATOM   2212 C CZ  . PHE B 1 130 ? 6.869  111.291 -36.368 1.00 30.54 ? 129 PHE B CZ  1 
ATOM   2213 N N   . ALA B 1 131 ? 4.706  108.798 -33.000 1.00 34.72 ? 130 ALA B N   1 
ATOM   2214 C CA  . ALA B 1 131 ? 5.435  107.533 -33.062 1.00 36.23 ? 130 ALA B CA  1 
ATOM   2215 C C   . ALA B 1 131 ? 5.650  107.160 -34.524 1.00 38.31 ? 130 ALA B C   1 
ATOM   2216 O O   . ALA B 1 131 ? 4.687  107.025 -35.275 1.00 39.13 ? 130 ALA B O   1 
ATOM   2217 C CB  . ALA B 1 131 ? 4.671  106.443 -32.334 1.00 36.30 ? 130 ALA B CB  1 
ATOM   2218 N N   . GLU B 1 132 ? 6.915  107.002 -34.914 1.00 40.44 ? 131 GLU B N   1 
ATOM   2219 C CA  . GLU B 1 132 ? 7.296  106.699 -36.293 1.00 42.74 ? 131 GLU B CA  1 
ATOM   2220 C C   . GLU B 1 132 ? 8.385  105.637 -36.346 1.00 44.11 ? 131 GLU B C   1 
ATOM   2221 O O   . GLU B 1 132 ? 9.447  105.811 -35.751 1.00 43.43 ? 131 GLU B O   1 
ATOM   2222 C CB  . GLU B 1 132 ? 7.850  107.966 -36.951 1.00 44.00 ? 131 GLU B CB  1 
ATOM   2223 C CG  . GLU B 1 132 ? 8.384  107.782 -38.372 1.00 45.17 ? 131 GLU B CG  1 
ATOM   2224 C CD  . GLU B 1 132 ? 9.391  108.851 -38.781 1.00 46.10 ? 131 GLU B CD  1 
ATOM   2225 O OE1 . GLU B 1 132 ? 9.464  109.179 -39.986 1.00 47.27 ? 131 GLU B OE1 1 
ATOM   2226 O OE2 . GLU B 1 132 ? 10.121 109.364 -37.905 1.00 45.56 ? 131 GLU B OE2 1 
ATOM   2227 N N   . MET B 1 133 ? 8.132  104.554 -37.074 1.00 46.40 ? 132 MET B N   1 
ATOM   2228 C CA  . MET B 1 133 ? 9.121  103.496 -37.258 1.00 48.43 ? 132 MET B CA  1 
ATOM   2229 C C   . MET B 1 133 ? 9.753  103.635 -38.640 1.00 50.11 ? 132 MET B C   1 
ATOM   2230 O O   . MET B 1 133 ? 9.049  103.767 -39.642 1.00 49.98 ? 132 MET B O   1 
ATOM   2231 C CB  . MET B 1 133 ? 8.475  102.115 -37.116 1.00 49.30 ? 132 MET B CB  1 
ATOM   2232 C CG  . MET B 1 133 ? 9.417  100.947 -37.382 1.00 49.93 ? 132 MET B CG  1 
ATOM   2233 S SD  . MET B 1 133 ? 10.879 100.927 -36.322 1.00 51.30 ? 132 MET B SD  1 
ATOM   2234 C CE  . MET B 1 133 ? 10.138 100.593 -34.725 1.00 50.79 ? 132 MET B CE  1 
ATOM   2235 N N   . LYS B 1 134 ? 11.082 103.614 -38.684 1.00 52.14 ? 133 LYS B N   1 
ATOM   2236 C CA  . LYS B 1 134 ? 11.817 103.699 -39.945 1.00 54.36 ? 133 LYS B CA  1 
ATOM   2237 C C   . LYS B 1 134 ? 11.527 102.494 -40.827 1.00 56.56 ? 133 LYS B C   1 
ATOM   2238 O O   . LYS B 1 134 ? 11.549 101.356 -40.354 1.00 55.09 ? 133 LYS B O   1 
ATOM   2239 C CB  . LYS B 1 134 ? 13.323 103.786 -39.683 1.00 55.13 ? 133 LYS B CB  1 
ATOM   2240 C CG  . LYS B 1 134 ? 14.195 103.374 -40.861 1.00 56.12 ? 133 LYS B CG  1 
ATOM   2241 C CD  . LYS B 1 134 ? 15.635 103.827 -40.701 1.00 56.82 ? 133 LYS B CD  1 
ATOM   2242 C CE  . LYS B 1 134 ? 16.592 102.889 -41.418 1.00 58.35 ? 133 LYS B CE  1 
ATOM   2243 N NZ  . LYS B 1 134 ? 16.165 102.510 -42.794 1.00 59.23 ? 133 LYS B NZ  1 
ATOM   2244 N N   . GLN B 1 135 ? 11.277 102.756 -42.109 1.00 60.46 ? 134 GLN B N   1 
ATOM   2245 C CA  . GLN B 1 135 ? 10.993 101.702 -43.080 1.00 63.79 ? 134 GLN B CA  1 
ATOM   2246 C C   . GLN B 1 135 ? 12.263 101.290 -43.833 1.00 65.76 ? 134 GLN B C   1 
ATOM   2247 O O   . GLN B 1 135 ? 13.186 102.096 -43.979 1.00 64.41 ? 134 GLN B O   1 
ATOM   2248 C CB  . GLN B 1 135 ? 9.923  102.158 -44.079 1.00 64.64 ? 134 GLN B CB  1 
ATOM   2249 C CG  . GLN B 1 135 ? 8.554  102.477 -43.482 1.00 66.04 ? 134 GLN B CG  1 
ATOM   2250 C CD  . GLN B 1 135 ? 7.824  101.258 -42.927 1.00 67.44 ? 134 GLN B CD  1 
ATOM   2251 O OE1 . GLN B 1 135 ? 8.422  100.390 -42.289 1.00 67.93 ? 134 GLN B OE1 1 
ATOM   2252 N NE2 . GLN B 1 135 ? 6.514  101.202 -43.150 1.00 68.01 ? 134 GLN B NE2 1 
ATOM   2253 N N   . PRO B 1 136 ? 12.312 100.026 -44.304 1.00 68.52 ? 135 PRO B N   1 
ATOM   2254 C CA  . PRO B 1 136 ? 13.439 99.465  -45.058 1.00 69.37 ? 135 PRO B CA  1 
ATOM   2255 C C   . PRO B 1 136 ? 13.924 100.323 -46.230 1.00 68.54 ? 135 PRO B C   1 
ATOM   2256 O O   . PRO B 1 136 ? 13.112 100.870 -46.978 1.00 67.92 ? 135 PRO B O   1 
ATOM   2257 C CB  . PRO B 1 136 ? 12.873 98.147  -45.593 1.00 70.29 ? 135 PRO B CB  1 
ATOM   2258 C CG  . PRO B 1 136 ? 11.875 97.730  -44.574 1.00 70.59 ? 135 PRO B CG  1 
ATOM   2259 C CD  . PRO B 1 136 ? 11.317 98.987  -43.967 1.00 69.75 ? 135 PRO B CD  1 
ATOM   2260 N N   . GLY B 1 137 ? 15.243 100.423 -46.375 1.00 67.79 ? 136 GLY B N   1 
ATOM   2261 C CA  . GLY B 1 137 ? 15.863 101.179 -47.460 1.00 67.33 ? 136 GLY B CA  1 
ATOM   2262 C C   . GLY B 1 137 ? 15.558 102.666 -47.475 1.00 66.60 ? 136 GLY B C   1 
ATOM   2263 O O   . GLY B 1 137 ? 15.496 103.272 -48.545 1.00 65.66 ? 136 GLY B O   1 
ATOM   2264 N N   . GLU B 1 138 ? 15.369 103.265 -46.300 1.00 66.37 ? 137 GLU B N   1 
ATOM   2265 C CA  . GLU B 1 138 ? 15.081 104.697 -46.233 1.00 65.43 ? 137 GLU B CA  1 
ATOM   2266 C C   . GLU B 1 138 ? 15.378 105.322 -44.863 1.00 62.55 ? 137 GLU B C   1 
ATOM   2267 O O   . GLU B 1 138 ? 15.411 104.639 -43.840 1.00 61.27 ? 137 GLU B O   1 
ATOM   2268 C CB  . GLU B 1 138 ? 13.616 104.963 -46.580 1.00 67.28 ? 137 GLU B CB  1 
ATOM   2269 C CG  . GLU B 1 138 ? 13.384 106.367 -47.120 1.00 68.73 ? 137 GLU B CG  1 
ATOM   2270 C CD  . GLU B 1 138 ? 12.004 106.909 -46.835 1.00 70.56 ? 137 GLU B CD  1 
ATOM   2271 O OE1 . GLU B 1 138 ? 11.094 106.129 -46.478 1.00 72.56 ? 137 GLU B OE1 1 
ATOM   2272 O OE2 . GLU B 1 138 ? 11.835 108.139 -46.976 1.00 70.47 ? 137 GLU B OE2 1 
ATOM   2273 N N   . VAL B 1 139 ? 15.595 106.634 -44.878 1.00 59.50 ? 138 VAL B N   1 
ATOM   2274 C CA  . VAL B 1 139 ? 15.848 107.443 -43.691 1.00 57.58 ? 138 VAL B CA  1 
ATOM   2275 C C   . VAL B 1 139 ? 14.549 108.102 -43.208 1.00 55.41 ? 138 VAL B C   1 
ATOM   2276 O O   . VAL B 1 139 ? 13.680 108.440 -44.014 1.00 56.58 ? 138 VAL B O   1 
ATOM   2277 C CB  . VAL B 1 139 ? 16.914 108.522 -44.016 1.00 57.86 ? 138 VAL B CB  1 
ATOM   2278 C CG1 . VAL B 1 139 ? 16.941 109.646 -42.988 1.00 58.46 ? 138 VAL B CG1 1 
ATOM   2279 C CG2 . VAL B 1 139 ? 18.285 107.878 -44.152 1.00 58.12 ? 138 VAL B CG2 1 
ATOM   2280 N N   . ARG B 1 140 ? 14.421 108.269 -41.891 1.00 51.66 ? 139 ARG B N   1 
ATOM   2281 C CA  . ARG B 1 140 ? 13.257 108.928 -41.293 1.00 49.24 ? 139 ARG B CA  1 
ATOM   2282 C C   . ARG B 1 140 ? 13.211 110.410 -41.670 1.00 48.49 ? 139 ARG B C   1 
ATOM   2283 O O   . ARG B 1 140 ? 14.248 111.067 -41.757 1.00 46.84 ? 139 ARG B O   1 
ATOM   2284 C CB  . ARG B 1 140 ? 13.278 108.775 -39.768 1.00 47.58 ? 139 ARG B CB  1 
ATOM   2285 C CG  . ARG B 1 140 ? 12.980 107.362 -39.300 1.00 46.62 ? 139 ARG B CG  1 
ATOM   2286 C CD  . ARG B 1 140 ? 13.227 107.160 -37.810 1.00 45.38 ? 139 ARG B CD  1 
ATOM   2287 N NE  . ARG B 1 140 ? 14.652 107.062 -37.490 1.00 44.11 ? 139 ARG B NE  1 
ATOM   2288 C CZ  . ARG B 1 140 ? 15.148 106.850 -36.270 1.00 43.39 ? 139 ARG B CZ  1 
ATOM   2289 N NH1 . ARG B 1 140 ? 14.344 106.723 -35.221 1.00 42.81 ? 139 ARG B NH1 1 
ATOM   2290 N NH2 . ARG B 1 140 ? 16.462 106.767 -36.095 1.00 43.20 ? 139 ARG B NH2 1 
ATOM   2291 N N   . ASP B 1 141 ? 12.002 110.924 -41.888 1.00 49.00 ? 140 ASP B N   1 
ATOM   2292 C CA  . ASP B 1 141 ? 11.807 112.326 -42.262 1.00 49.22 ? 140 ASP B CA  1 
ATOM   2293 C C   . ASP B 1 141 ? 11.816 113.182 -41.009 1.00 47.44 ? 140 ASP B C   1 
ATOM   2294 O O   . ASP B 1 141 ? 10.931 113.062 -40.165 1.00 47.70 ? 140 ASP B O   1 
ATOM   2295 C CB  . ASP B 1 141 ? 10.484 112.496 -43.008 1.00 50.91 ? 140 ASP B CB  1 
ATOM   2296 C CG  . ASP B 1 141 ? 10.246 113.922 -43.492 1.00 52.12 ? 140 ASP B CG  1 
ATOM   2297 O OD1 . ASP B 1 141 ? 11.192 114.744 -43.492 1.00 52.76 ? 140 ASP B OD1 1 
ATOM   2298 O OD2 . ASP B 1 141 ? 9.101  114.213 -43.897 1.00 53.49 ? 140 ASP B OD2 1 
ATOM   2299 N N   . GLN B 1 142 ? 12.811 114.056 -40.907 1.00 46.11 ? 141 GLN B N   1 
ATOM   2300 C CA  . GLN B 1 142 ? 12.971 114.905 -39.732 1.00 45.37 ? 141 GLN B CA  1 
ATOM   2301 C C   . GLN B 1 142 ? 12.157 116.193 -39.768 1.00 46.25 ? 141 GLN B C   1 
ATOM   2302 O O   . GLN B 1 142 ? 11.984 116.836 -38.731 1.00 46.21 ? 141 GLN B O   1 
ATOM   2303 C CB  . GLN B 1 142 ? 14.446 115.187 -39.492 1.00 44.60 ? 141 GLN B CB  1 
ATOM   2304 C CG  . GLN B 1 142 ? 15.238 113.906 -39.307 1.00 44.14 ? 141 GLN B CG  1 
ATOM   2305 C CD  . GLN B 1 142 ? 16.608 114.118 -38.701 1.00 43.63 ? 141 GLN B CD  1 
ATOM   2306 O OE1 . GLN B 1 142 ? 16.973 115.230 -38.317 1.00 43.59 ? 141 GLN B OE1 1 
ATOM   2307 N NE2 . GLN B 1 142 ? 17.371 113.038 -38.594 1.00 43.56 ? 141 GLN B NE2 1 
ATOM   2308 N N   . ARG B 1 143 ? 11.660 116.576 -40.942 1.00 47.35 ? 142 ARG B N   1 
ATOM   2309 C CA  . ARG B 1 143 ? 10.765 117.728 -41.036 1.00 48.64 ? 142 ARG B CA  1 
ATOM   2310 C C   . ARG B 1 143 ? 9.468  117.352 -40.320 1.00 47.20 ? 142 ARG B C   1 
ATOM   2311 O O   . ARG B 1 143 ? 8.778  118.202 -39.755 1.00 46.86 ? 142 ARG B O   1 
ATOM   2312 C CB  . ARG B 1 143 ? 10.481 118.106 -42.491 1.00 51.32 ? 142 ARG B CB  1 
ATOM   2313 C CG  . ARG B 1 143 ? 11.700 118.607 -43.257 1.00 53.15 ? 142 ARG B CG  1 
ATOM   2314 C CD  . ARG B 1 143 ? 11.315 119.086 -44.649 1.00 55.05 ? 142 ARG B CD  1 
ATOM   2315 N NE  . ARG B 1 143 ? 10.708 118.021 -45.447 1.00 56.82 ? 142 ARG B NE  1 
ATOM   2316 C CZ  . ARG B 1 143 ? 10.180 118.186 -46.659 1.00 57.98 ? 142 ARG B CZ  1 
ATOM   2317 N NH1 . ARG B 1 143 ? 10.166 119.383 -47.242 1.00 58.97 ? 142 ARG B NH1 1 
ATOM   2318 N NH2 . ARG B 1 143 ? 9.654  117.144 -47.293 1.00 58.07 ? 142 ARG B NH2 1 
ATOM   2319 N N   . LEU B 1 144 ? 9.157  116.058 -40.347 1.00 45.49 ? 143 LEU B N   1 
ATOM   2320 C CA  . LEU B 1 144 ? 7.988  115.515 -39.673 1.00 44.44 ? 143 LEU B CA  1 
ATOM   2321 C C   . LEU B 1 144 ? 8.157  115.586 -38.147 1.00 42.72 ? 143 LEU B C   1 
ATOM   2322 O O   . LEU B 1 144 ? 7.175  115.756 -37.421 1.00 42.94 ? 143 LEU B O   1 
ATOM   2323 C CB  . LEU B 1 144 ? 7.769  114.069 -40.122 1.00 44.62 ? 143 LEU B CB  1 
ATOM   2324 C CG  . LEU B 1 144 ? 6.448  113.392 -39.788 1.00 45.48 ? 143 LEU B CG  1 
ATOM   2325 C CD1 . LEU B 1 144 ? 5.294  114.144 -40.430 1.00 46.37 ? 143 LEU B CD1 1 
ATOM   2326 C CD2 . LEU B 1 144 ? 6.478  111.949 -40.272 1.00 45.69 ? 143 LEU B CD2 1 
ATOM   2327 N N   . TRP B 1 145 ? 9.394  115.452 -37.663 1.00 40.14 ? 144 TRP B N   1 
ATOM   2328 C CA  . TRP B 1 145 ? 9.666  115.550 -36.226 1.00 39.11 ? 144 TRP B CA  1 
ATOM   2329 C C   . TRP B 1 145 ? 9.534  116.987 -35.731 1.00 39.01 ? 144 TRP B C   1 
ATOM   2330 O O   . TRP B 1 145 ? 8.971  117.229 -34.664 1.00 38.60 ? 144 TRP B O   1 
ATOM   2331 C CB  . TRP B 1 145 ? 11.066 115.049 -35.851 1.00 38.11 ? 144 TRP B CB  1 
ATOM   2332 C CG  . TRP B 1 145 ? 11.417 113.669 -36.288 1.00 37.32 ? 144 TRP B CG  1 
ATOM   2333 C CD1 . TRP B 1 145 ? 10.563 112.677 -36.664 1.00 37.33 ? 144 TRP B CD1 1 
ATOM   2334 C CD2 . TRP B 1 145 ? 12.728 113.090 -36.284 1.00 36.56 ? 144 TRP B CD2 1 
ATOM   2335 N NE1 . TRP B 1 145 ? 11.269 111.535 -36.960 1.00 37.21 ? 144 TRP B NE1 1 
ATOM   2336 C CE2 . TRP B 1 145 ? 12.599 111.760 -36.725 1.00 36.33 ? 144 TRP B CE2 1 
ATOM   2337 C CE3 . TRP B 1 145 ? 14.004 113.579 -35.973 1.00 36.26 ? 144 TRP B CE3 1 
ATOM   2338 C CZ2 . TRP B 1 145 ? 13.697 110.907 -36.862 1.00 36.13 ? 144 TRP B CZ2 1 
ATOM   2339 C CZ3 . TRP B 1 145 ? 15.095 112.730 -36.108 1.00 35.86 ? 144 TRP B CZ3 1 
ATOM   2340 C CH2 . TRP B 1 145 ? 14.933 111.409 -36.553 1.00 35.82 ? 144 TRP B CH2 1 
ATOM   2341 N N   . THR B 1 146 ? 10.062 117.933 -36.507 1.00 39.51 ? 145 THR B N   1 
ATOM   2342 C CA  . THR B 1 146 ? 10.025 119.351 -36.137 1.00 40.44 ? 145 THR B CA  1 
ATOM   2343 C C   . THR B 1 146 ? 8.598  119.868 -36.128 1.00 40.56 ? 145 THR B C   1 
ATOM   2344 O O   . THR B 1 146 ? 8.219  120.665 -35.270 1.00 40.59 ? 145 THR B O   1 
ATOM   2345 C CB  . THR B 1 146 ? 10.829 120.241 -37.112 1.00 40.95 ? 145 THR B CB  1 
ATOM   2346 O OG1 . THR B 1 146 ? 10.250 120.175 -38.419 1.00 42.18 ? 145 THR B OG1 1 
ATOM   2347 C CG2 . THR B 1 146 ? 12.275 119.810 -37.189 1.00 40.83 ? 145 THR B CG2 1 
ATOM   2348 N N   . ASP B 1 147 ? 7.816  119.416 -37.102 1.00 40.99 ? 146 ASP B N   1 
ATOM   2349 C CA  . ASP B 1 147 ? 6.426  119.824 -37.226 1.00 42.13 ? 146 ASP B CA  1 
ATOM   2350 C C   . ASP B 1 147 ? 5.594  119.266 -36.070 1.00 41.46 ? 146 ASP B C   1 
ATOM   2351 O O   . ASP B 1 147 ? 4.715  119.952 -35.549 1.00 42.47 ? 146 ASP B O   1 
ATOM   2352 C CB  . ASP B 1 147 ? 5.862  119.357 -38.565 1.00 43.39 ? 146 ASP B CB  1 
ATOM   2353 C CG  . ASP B 1 147 ? 4.497  119.938 -38.856 1.00 45.47 ? 146 ASP B CG  1 
ATOM   2354 O OD1 . ASP B 1 147 ? 4.296  121.157 -38.655 1.00 47.11 ? 146 ASP B OD1 1 
ATOM   2355 O OD2 . ASP B 1 147 ? 3.628  119.172 -39.311 1.00 46.84 ? 146 ASP B OD2 1 
ATOM   2356 N N   . ALA B 1 148 ? 5.875  118.023 -35.679 1.00 40.25 ? 147 ALA B N   1 
ATOM   2357 C CA  . ALA B 1 148 ? 5.186  117.385 -34.554 1.00 39.76 ? 147 ALA B CA  1 
ATOM   2358 C C   . ALA B 1 148 ? 5.482  118.133 -33.258 1.00 39.88 ? 147 ALA B C   1 
ATOM   2359 O O   . ALA B 1 148 ? 4.588  118.334 -32.437 1.00 40.35 ? 147 ALA B O   1 
ATOM   2360 C CB  . ALA B 1 148 ? 5.603  115.928 -34.428 1.00 38.88 ? 147 ALA B CB  1 
ATOM   2361 N N   . LEU B 1 149 ? 6.744  118.528 -33.083 1.00 39.73 ? 148 LEU B N   1 
ATOM   2362 C CA  . LEU B 1 149 ? 7.174  119.294 -31.914 1.00 39.73 ? 148 LEU B CA  1 
ATOM   2363 C C   . LEU B 1 149 ? 6.584  120.696 -31.930 1.00 41.14 ? 148 LEU B C   1 
ATOM   2364 O O   . LEU B 1 149 ? 6.123  121.188 -30.901 1.00 41.84 ? 148 LEU B O   1 
ATOM   2365 C CB  . LEU B 1 149 ? 8.700  119.391 -31.855 1.00 38.56 ? 148 LEU B CB  1 
ATOM   2366 C CG  . LEU B 1 149 ? 9.450  118.126 -31.443 1.00 38.08 ? 148 LEU B CG  1 
ATOM   2367 C CD1 . LEU B 1 149 ? 10.931 118.263 -31.750 1.00 38.01 ? 148 LEU B CD1 1 
ATOM   2368 C CD2 . LEU B 1 149 ? 9.235  117.820 -29.968 1.00 37.93 ? 148 LEU B CD2 1 
ATOM   2369 N N   . ALA B 1 150 ? 6.608  121.333 -33.099 1.00 41.57 ? 149 ALA B N   1 
ATOM   2370 C CA  . ALA B 1 150 ? 6.055  122.676 -33.262 1.00 42.47 ? 149 ALA B CA  1 
ATOM   2371 C C   . ALA B 1 150 ? 4.560  122.698 -32.952 1.00 43.67 ? 149 ALA B C   1 
ATOM   2372 O O   . ALA B 1 150 ? 4.049  123.683 -32.424 1.00 44.44 ? 149 ALA B O   1 
ATOM   2373 C CB  . ALA B 1 150 ? 6.310  123.183 -34.675 1.00 42.56 ? 149 ALA B CB  1 
ATOM   2374 N N   . ALA B 1 151 ? 3.870  121.605 -33.276 1.00 44.37 ? 150 ALA B N   1 
ATOM   2375 C CA  . ALA B 1 151 ? 2.435  121.481 -33.030 1.00 45.78 ? 150 ALA B CA  1 
ATOM   2376 C C   . ALA B 1 151 ? 2.082  121.437 -31.541 1.00 47.45 ? 150 ALA B C   1 
ATOM   2377 O O   . ALA B 1 151 ? 0.954  121.754 -31.166 1.00 48.66 ? 150 ALA B O   1 
ATOM   2378 C CB  . ALA B 1 151 ? 1.893  120.244 -33.727 1.00 45.71 ? 150 ALA B CB  1 
ATOM   2379 N N   . LEU B 1 152 ? 3.042  121.049 -30.702 1.00 48.40 ? 151 LEU B N   1 
ATOM   2380 C CA  . LEU B 1 152 ? 2.836  120.956 -29.253 1.00 49.94 ? 151 LEU B CA  1 
ATOM   2381 C C   . LEU B 1 152 ? 3.256  122.224 -28.487 1.00 52.27 ? 151 LEU B C   1 
ATOM   2382 O O   . LEU B 1 152 ? 3.644  122.144 -27.320 1.00 52.71 ? 151 LEU B O   1 
ATOM   2383 C CB  . LEU B 1 152 ? 3.599  119.742 -28.708 1.00 48.98 ? 151 LEU B CB  1 
ATOM   2384 C CG  . LEU B 1 152 ? 3.161  118.370 -29.229 1.00 48.19 ? 151 LEU B CG  1 
ATOM   2385 C CD1 . LEU B 1 152 ? 4.176  117.302 -28.856 1.00 47.31 ? 151 LEU B CD1 1 
ATOM   2386 C CD2 . LEU B 1 152 ? 1.784  118.010 -28.696 1.00 48.69 ? 151 LEU B CD2 1 
ATOM   2387 N N   . THR B 1 153 ? 3.171  123.386 -29.138 1.00 55.17 ? 152 THR B N   1 
ATOM   2388 C CA  . THR B 1 153 ? 3.526  124.670 -28.518 1.00 56.47 ? 152 THR B CA  1 
ATOM   2389 C C   . THR B 1 153 ? 2.576  125.783 -28.952 1.00 57.88 ? 152 THR B C   1 
ATOM   2390 O O   . THR B 1 153 ? 1.858  125.653 -29.944 1.00 58.73 ? 152 THR B O   1 
ATOM   2391 C CB  . THR B 1 153 ? 4.967  125.091 -28.867 1.00 57.04 ? 152 THR B CB  1 
ATOM   2392 O OG1 . THR B 1 153 ? 5.144  125.087 -30.292 1.00 57.66 ? 152 THR B OG1 1 
ATOM   2393 C CG2 . THR B 1 153 ? 5.967  124.141 -28.241 1.00 55.99 ? 152 THR B CG2 1 
HETATM 2394 O O   . HOH C 2 .   ? 39.522 128.184 -49.946 1.00 30.28 ? 201 HOH A O   1 
HETATM 2395 O O   . HOH C 2 .   ? 44.827 120.561 -49.413 1.00 31.24 ? 202 HOH A O   1 
HETATM 2396 O O   . HOH C 2 .   ? 40.356 127.385 -38.881 1.00 27.19 ? 203 HOH A O   1 
HETATM 2397 O O   . HOH C 2 .   ? 45.945 134.392 -43.906 1.00 31.67 ? 204 HOH A O   1 
HETATM 2398 O O   . HOH C 2 .   ? 39.722 123.916 -43.162 1.00 32.31 ? 205 HOH A O   1 
HETATM 2399 O O   . HOH C 2 .   ? 25.489 125.689 -50.685 1.00 38.68 ? 206 HOH A O   1 
HETATM 2400 O O   . HOH C 2 .   ? 46.021 129.482 -53.113 1.00 46.04 ? 207 HOH A O   1 
HETATM 2401 O O   . HOH C 2 .   ? 43.966 132.724 -49.355 1.00 31.21 ? 208 HOH A O   1 
HETATM 2402 O O   . HOH C 2 .   ? 24.045 148.014 -43.424 1.00 36.63 ? 209 HOH A O   1 
HETATM 2403 O O   . HOH C 2 .   ? 38.894 151.771 -37.900 1.00 49.88 ? 210 HOH A O   1 
HETATM 2404 O O   . HOH C 2 .   ? 32.212 125.005 -54.242 1.00 37.74 ? 211 HOH A O   1 
HETATM 2405 O O   . HOH C 2 .   ? 24.458 146.041 -33.786 1.00 40.80 ? 212 HOH A O   1 
HETATM 2406 O O   . HOH C 2 .   ? 26.511 140.411 -31.062 1.00 34.64 ? 213 HOH A O   1 
HETATM 2407 O O   . HOH C 2 .   ? 30.074 145.391 -46.053 1.00 31.49 ? 214 HOH A O   1 
HETATM 2408 O O   . HOH C 2 .   ? 44.059 139.043 -45.863 1.00 33.76 ? 215 HOH A O   1 
HETATM 2409 O O   . HOH C 2 .   ? 46.938 139.024 -37.722 1.00 39.92 ? 216 HOH A O   1 
HETATM 2410 O O   . HOH C 2 .   ? 41.835 146.481 -42.194 1.00 45.53 ? 217 HOH A O   1 
HETATM 2411 O O   . HOH C 2 .   ? 37.776 149.638 -34.996 1.00 17.82 ? 218 HOH A O   1 
HETATM 2412 O O   . HOH C 2 .   ? 34.968 126.293 -31.515 1.00 42.16 ? 219 HOH A O   1 
HETATM 2413 O O   . HOH C 2 .   ? 42.362 140.940 -32.238 1.00 43.05 ? 220 HOH A O   1 
HETATM 2414 O O   . HOH C 2 .   ? 33.230 152.870 -46.255 1.00 57.04 ? 221 HOH A O   1 
HETATM 2415 O O   . HOH C 2 .   ? 46.466 120.315 -46.883 1.00 37.39 ? 222 HOH A O   1 
HETATM 2416 O O   . HOH C 2 .   ? 45.645 130.244 -49.734 1.00 37.63 ? 223 HOH A O   1 
HETATM 2417 O O   . HOH D 2 .   ? 19.277 104.415 -38.013 1.00 44.25 ? 201 HOH B O   1 
HETATM 2418 O O   . HOH D 2 .   ? 10.518 122.729 -30.907 1.00 35.87 ? 202 HOH B O   1 
HETATM 2419 O O   . HOH D 2 .   ? 25.780 107.310 -23.844 1.00 28.31 ? 203 HOH B O   1 
HETATM 2420 O O   . HOH D 2 .   ? 7.892  121.721 -28.733 1.00 43.95 ? 204 HOH B O   1 
HETATM 2421 O O   . HOH D 2 .   ? 20.440 100.150 -30.388 1.00 23.54 ? 205 HOH B O   1 
HETATM 2422 O O   . HOH D 2 .   ? 19.148 99.967  -20.176 1.00 28.67 ? 206 HOH B O   1 
HETATM 2423 O O   . HOH D 2 .   ? 3.221  119.661 -24.410 1.00 30.52 ? 207 HOH B O   1 
HETATM 2424 O O   . HOH D 2 .   ? 29.817 99.890  -28.606 1.00 36.35 ? 208 HOH B O   1 
HETATM 2425 O O   . HOH D 2 .   ? 32.791 101.318 -25.617 1.00 35.21 ? 209 HOH B O   1 
HETATM 2426 O O   . HOH D 2 .   ? 18.240 117.767 -26.103 1.00 40.75 ? 210 HOH B O   1 
HETATM 2427 O O   . HOH D 2 .   ? 16.726 102.957 -50.955 1.00 43.42 ? 211 HOH B O   1 
HETATM 2428 O O   . HOH D 2 .   ? 8.244  115.890 -21.232 1.00 34.25 ? 212 HOH B O   1 
HETATM 2429 O O   . HOH D 2 .   ? 15.768 117.845 -40.229 1.00 50.09 ? 213 HOH B O   1 
HETATM 2430 O O   . HOH D 2 .   ? 25.418 102.778 -30.307 1.00 32.12 ? 214 HOH B O   1 
HETATM 2431 O O   . HOH D 2 .   ? 25.105 118.599 -32.279 1.00 36.61 ? 215 HOH B O   1 
HETATM 2432 O O   . HOH D 2 .   ? 15.303 100.019 -41.850 1.00 49.82 ? 216 HOH B O   1 
HETATM 2433 O O   . HOH D 2 .   ? 0.682  101.529 -26.880 1.00 40.32 ? 217 HOH B O   1 
HETATM 2434 O O   . HOH D 2 .   ? 30.013 106.174 -39.128 1.00 38.45 ? 218 HOH B O   1 
HETATM 2435 O O   . HOH D 2 .   ? -0.785 113.135 -30.306 1.00 29.28 ? 219 HOH B O   1 
HETATM 2436 O O   . HOH D 2 .   ? 11.664 109.194 -16.449 1.00 46.95 ? 220 HOH B O   1 
HETATM 2437 O O   . HOH D 2 .   ? 25.938 108.618 -43.576 1.00 40.31 ? 221 HOH B O   1 
HETATM 2438 O O   . HOH D 2 .   ? 16.495 121.754 -24.746 1.00 39.92 ? 222 HOH B O   1 
HETATM 2439 O O   . HOH D 2 .   ? 8.764  113.830 -19.687 1.00 36.91 ? 223 HOH B O   1 
HETATM 2440 O O   . HOH D 2 .   ? 18.108 102.913 -45.480 1.00 50.32 ? 224 HOH B O   1 
HETATM 2441 O O   . HOH D 2 .   ? 10.510 95.624  -28.719 1.00 39.49 ? 225 HOH B O   1 
HETATM 2442 O O   . HOH D 2 .   ? 12.077 97.206  -19.714 1.00 41.00 ? 226 HOH B O   1 
HETATM 2443 O O   . HOH D 2 .   ? -0.320 104.034 -21.041 1.00 43.41 ? 227 HOH B O   1 
HETATM 2444 O O   . HOH D 2 .   ? 3.040  103.268 -32.613 1.00 35.13 ? 228 HOH B O   1 
HETATM 2445 O O   . HOH D 2 .   ? 13.997 120.033 -40.284 1.00 53.69 ? 229 HOH B O   1 
HETATM 2446 O O   . HOH D 2 .   ? 21.475 100.960 -19.265 1.00 37.30 ? 230 HOH B O   1 
HETATM 2447 O O   . HOH D 2 .   ? 20.444 92.400  -20.195 1.00 37.64 ? 231 HOH B O   1 
HETATM 2448 O O   . HOH D 2 .   ? 11.758 93.556  -34.514 1.00 36.39 ? 232 HOH B O   1 
HETATM 2449 O O   . HOH D 2 .   ? 4.415  121.921 -14.598 1.00 36.63 ? 233 HOH B O   1 
HETATM 2450 O O   . HOH D 2 .   ? 5.264  98.381  -35.876 1.00 50.19 ? 234 HOH B O   1 
HETATM 2451 O O   . HOH D 2 .   ? 25.608 102.723 -19.362 1.00 37.57 ? 235 HOH B O   1 
HETATM 2452 O O   . HOH D 2 .   ? 20.675 92.132  -17.059 1.00 37.02 ? 236 HOH B O   1 
HETATM 2453 O O   . HOH D 2 .   ? 17.847 100.560 -17.927 1.00 32.00 ? 237 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
11   N N   . MET A 2   ? 0.6998 0.6333 0.6245 -0.0617 0.0906  -0.0768 1   MET A N   
12   C CA  . MET A 2   ? 0.6613 0.5870 0.5871 -0.0536 0.0909  -0.0733 1   MET A CA  
13   C C   . MET A 2   ? 0.6422 0.5535 0.5638 -0.0525 0.0981  -0.0753 1   MET A C   
14   O O   . MET A 2   ? 0.6376 0.5456 0.5573 -0.0556 0.1028  -0.0792 1   MET A O   
15   C CB  . MET A 2   ? 0.6593 0.5896 0.5892 -0.0481 0.0870  -0.0705 1   MET A CB  
16   C CG  . MET A 2   ? 0.6626 0.5876 0.5945 -0.0397 0.0855  -0.0661 1   MET A CG  
17   S SD  . MET A 2   ? 0.6711 0.5999 0.6074 -0.0342 0.0829  -0.0641 1   MET A SD  
18   C CE  . MET A 2   ? 0.6714 0.5956 0.6094 -0.0257 0.0799  -0.0584 1   MET A CE  
19   N N   . LEU A 3   ? 0.6186 0.5209 0.5388 -0.0484 0.0993  -0.0727 2   LEU A N   
20   C CA  . LEU A 3   ? 0.6073 0.4949 0.5241 -0.0464 0.1056  -0.0736 2   LEU A CA  
21   C C   . LEU A 3   ? 0.5858 0.4718 0.5066 -0.0403 0.1055  -0.0722 2   LEU A C   
22   O O   . LEU A 3   ? 0.5703 0.4626 0.4953 -0.0350 0.1001  -0.0683 2   LEU A O   
23   C CB  . LEU A 3   ? 0.6131 0.4917 0.5270 -0.0433 0.1058  -0.0700 2   LEU A CB  
24   C CG  . LEU A 3   ? 0.6125 0.4912 0.5225 -0.0490 0.1068  -0.0714 2   LEU A CG  
25   C CD1 . LEU A 3   ? 0.6157 0.4839 0.5219 -0.0456 0.1075  -0.0677 2   LEU A CD1 
26   C CD2 . LEU A 3   ? 0.6218 0.4964 0.5276 -0.0567 0.1129  -0.0770 2   LEU A CD2 
27   N N   . ASN A 4   ? 0.5817 0.4596 0.5017 -0.0410 0.1118  -0.0757 3   ASN A N   
28   C CA  . ASN A 4   ? 0.5665 0.4435 0.4916 -0.0355 0.1125  -0.0753 3   ASN A CA  
29   C C   . ASN A 4   ? 0.5596 0.4220 0.4854 -0.0293 0.1163  -0.0732 3   ASN A C   
30   O O   . ASN A 4   ? 0.5578 0.4105 0.4791 -0.0300 0.1183  -0.0720 3   ASN A O   
31   C CB  . ASN A 4   ? 0.5759 0.4563 0.5008 -0.0412 0.1168  -0.0815 3   ASN A CB  
32   C CG  . ASN A 4   ? 0.5797 0.4673 0.5106 -0.0375 0.1149  -0.0811 3   ASN A CG  
33   O OD1 . ASN A 4   ? 0.5750 0.4628 0.5110 -0.0297 0.1115  -0.0766 3   ASN A OD1 
34   N ND2 . ASN A 4   ? 0.5847 0.4785 0.5146 -0.0436 0.1170  -0.0860 3   ASN A ND2 
35   N N   . VAL A 5   ? 0.5489 0.4101 0.4808 -0.0234 0.1170  -0.0725 4   VAL A N   
36   C CA  . VAL A 5   ? 0.5514 0.3997 0.4863 -0.0166 0.1199  -0.0698 4   VAL A CA  
37   C C   . VAL A 5   ? 0.5571 0.3910 0.4874 -0.0202 0.1279  -0.0736 4   VAL A C   
38   O O   . VAL A 5   ? 0.5575 0.3916 0.4852 -0.0269 0.1332  -0.0802 4   VAL A O   
39   C CB  . VAL A 5   ? 0.5544 0.4057 0.4984 -0.0108 0.1205  -0.0702 4   VAL A CB  
40   C CG1 . VAL A 5   ? 0.5692 0.4068 0.5178 -0.0039 0.1242  -0.0681 4   VAL A CG1 
41   C CG2 . VAL A 5   ? 0.5432 0.4072 0.4914 -0.0067 0.1124  -0.0657 4   VAL A CG2 
42   N N   . GLY A 6   ? 0.5564 0.3775 0.4848 -0.0162 0.1285  -0.0694 5   GLY A N   
43   C CA  . GLY A 6   ? 0.5659 0.3714 0.4896 -0.0191 0.1359  -0.0722 5   GLY A CA  
44   C C   . GLY A 6   ? 0.5641 0.3658 0.4784 -0.0250 0.1358  -0.0717 5   GLY A C   
45   O O   . GLY A 6   ? 0.5674 0.3546 0.4770 -0.0263 0.1406  -0.0719 5   GLY A O   
46   N N   . ALA A 7   ? 0.5478 0.3623 0.4598 -0.0286 0.1305  -0.0711 6   ALA A N   
47   C CA  . ALA A 7   ? 0.5476 0.3609 0.4521 -0.0344 0.1303  -0.0710 6   ALA A CA  
48   C C   . ALA A 7   ? 0.5503 0.3579 0.4521 -0.0299 0.1263  -0.0641 6   ALA A C   
49   O O   . ALA A 7   ? 0.5389 0.3490 0.4451 -0.0228 0.1213  -0.0589 6   ALA A O   
50   C CB  . ALA A 7   ? 0.5332 0.3629 0.4377 -0.0400 0.1264  -0.0734 6   ALA A CB  
51   N N   . THR A 8   ? 0.5612 0.3616 0.4555 -0.0348 0.1287  -0.0644 7   THR A N   
52   C CA  . THR A 8   ? 0.5681 0.3631 0.4579 -0.0326 0.1255  -0.0585 7   THR A CA  
53   C C   . THR A 8   ? 0.5533 0.3638 0.4446 -0.0333 0.1191  -0.0572 7   THR A C   
54   O O   . THR A 8   ? 0.5452 0.3662 0.4371 -0.0391 0.1192  -0.0616 7   THR A O   
55   C CB  . THR A 8   ? 0.5849 0.3681 0.4656 -0.0389 0.1307  -0.0600 7   THR A CB  
56   O OG1 . THR A 8   ? 0.5981 0.3666 0.4774 -0.0391 0.1374  -0.0622 7   THR A OG1 
57   C CG2 . THR A 8   ? 0.5937 0.3702 0.4685 -0.0372 0.1277  -0.0538 7   THR A CG2 
58   N N   . ALA A 9   ? 0.5497 0.3620 0.4424 -0.0275 0.1135  -0.0512 8   ALA A N   
59   C CA  . ALA A 9   ? 0.5349 0.3605 0.4290 -0.0279 0.1077  -0.0500 8   ALA A CA  
60   C C   . ALA A 9   ? 0.5426 0.3663 0.4298 -0.0339 0.1092  -0.0508 8   ALA A C   
61   O O   . ALA A 9   ? 0.5446 0.3564 0.4251 -0.0338 0.1105  -0.0475 8   ALA A O   
62   C CB  . ALA A 9   ? 0.5319 0.3588 0.4285 -0.0206 0.1019  -0.0436 8   ALA A CB  
63   N N   . PRO A 10  ? 0.5433 0.3783 0.4321 -0.0395 0.1091  -0.0552 9   PRO A N   
64   C CA  . PRO A 10  ? 0.5536 0.3882 0.4373 -0.0454 0.1108  -0.0566 9   PRO A CA  
65   C C   . PRO A 10  ? 0.5650 0.3974 0.4451 -0.0428 0.1075  -0.0516 9   PRO A C   
66   O O   . PRO A 10  ? 0.5491 0.3893 0.4334 -0.0382 0.1021  -0.0487 9   PRO A O   
67   C CB  . PRO A 10  ? 0.5362 0.3869 0.4258 -0.0494 0.1090  -0.0609 9   PRO A CB  
68   C CG  . PRO A 10  ? 0.5346 0.3894 0.4290 -0.0488 0.1093  -0.0634 9   PRO A CG  
69   C CD  . PRO A 10  ? 0.5351 0.3833 0.4306 -0.0413 0.1079  -0.0593 9   PRO A CD  
70   N N   . ASP A 11  ? 0.5896 0.4109 0.4612 -0.0462 0.1109  -0.0507 10  ASP A N   
71   C CA  . ASP A 11  ? 0.6071 0.4248 0.4731 -0.0453 0.1085  -0.0462 10  ASP A CA  
72   C C   . ASP A 11  ? 0.5957 0.4268 0.4648 -0.0486 0.1066  -0.0488 10  ASP A C   
73   O O   . ASP A 11  ? 0.5943 0.4336 0.4672 -0.0534 0.1088  -0.0541 10  ASP A O   
74   C CB  . ASP A 11  ? 0.6360 0.4376 0.4912 -0.0492 0.1132  -0.0448 10  ASP A CB  
75   C CG  . ASP A 11  ? 0.6586 0.4554 0.5063 -0.0491 0.1109  -0.0399 10  ASP A CG  
76   O OD1 . ASP A 11  ? 0.6520 0.4536 0.5023 -0.0439 0.1053  -0.0357 10  ASP A OD1 
77   O OD2 . ASP A 11  ? 0.6931 0.4811 0.5318 -0.0549 0.1148  -0.0403 10  ASP A OD2 
78   N N   . PHE A 12  ? 0.5860 0.4196 0.4539 -0.0459 0.1026  -0.0451 11  PHE A N   
79   C CA  . PHE A 12  ? 0.5722 0.4173 0.4431 -0.0486 0.1011  -0.0475 11  PHE A CA  
80   C C   . PHE A 12  ? 0.5783 0.4186 0.4418 -0.0487 0.0997  -0.0437 11  PHE A C   
81   O O   . PHE A 12  ? 0.5846 0.4150 0.4420 -0.0453 0.0978  -0.0381 11  PHE A O   
82   C CB  . PHE A 12  ? 0.5504 0.4103 0.4323 -0.0447 0.0963  -0.0485 11  PHE A CB  
83   C CG  . PHE A 12  ? 0.5418 0.4014 0.4252 -0.0376 0.0912  -0.0433 11  PHE A CG  
84   C CD1 . PHE A 12  ? 0.5396 0.3997 0.4202 -0.0355 0.0877  -0.0397 11  PHE A CD1 
85   C CD2 . PHE A 12  ? 0.5358 0.3952 0.4236 -0.0334 0.0900  -0.0425 11  PHE A CD2 
86   C CE1 . PHE A 12  ? 0.5359 0.3965 0.4182 -0.0294 0.0827  -0.0350 11  PHE A CE1 
87   C CE2 . PHE A 12  ? 0.5318 0.3919 0.4219 -0.0270 0.0854  -0.0380 11  PHE A CE2 
88   C CZ  . PHE A 12  ? 0.5324 0.3933 0.4199 -0.0249 0.0816  -0.0341 11  PHE A CZ  
89   N N   . THR A 13  ? 0.5774 0.4248 0.4416 -0.0529 0.1007  -0.0469 12  THR A N   
90   C CA  . THR A 13  ? 0.5837 0.4284 0.4409 -0.0544 0.1000  -0.0445 12  THR A CA  
91   C C   . THR A 13  ? 0.5646 0.4239 0.4306 -0.0544 0.0980  -0.0479 12  THR A C   
92   O O   . THR A 13  ? 0.5584 0.4253 0.4298 -0.0586 0.1010  -0.0535 12  THR A O   
93   C CB  . THR A 13  ? 0.6035 0.4387 0.4504 -0.0618 0.1058  -0.0462 12  THR A CB  
94   O OG1 . THR A 13  ? 0.6217 0.4428 0.4613 -0.0619 0.1080  -0.0433 12  THR A OG1 
95   C CG2 . THR A 13  ? 0.6136 0.4454 0.4517 -0.0641 0.1052  -0.0437 12  THR A CG2 
96   N N   . LEU A 14  ? 0.5559 0.4194 0.4240 -0.0496 0.0928  -0.0446 13  LEU A N   
97   C CA  . LEU A 14  ? 0.5432 0.4199 0.4202 -0.0488 0.0906  -0.0475 13  LEU A CA  
98   C C   . LEU A 14  ? 0.5502 0.4259 0.4218 -0.0483 0.0882  -0.0447 13  LEU A C   
99   O O   . LEU A 14  ? 0.5537 0.4204 0.4164 -0.0467 0.0860  -0.0393 13  LEU A O   
100  C CB  . LEU A 14  ? 0.5270 0.4126 0.4147 -0.0433 0.0861  -0.0471 13  LEU A CB  
101  C CG  . LEU A 14  ? 0.5220 0.4097 0.4151 -0.0437 0.0877  -0.0496 13  LEU A CG  
102  C CD1 . LEU A 14  ? 0.5121 0.4071 0.4132 -0.0383 0.0829  -0.0482 13  LEU A CD1 
103  C CD2 . LEU A 14  ? 0.5157 0.4109 0.4146 -0.0489 0.0911  -0.0556 13  LEU A CD2 
104  N N   . ARG A 15  ? 0.5498 0.4349 0.4273 -0.0499 0.0884  -0.0486 14  ARG A N   
105  C CA  . ARG A 15  ? 0.5629 0.4486 0.4363 -0.0502 0.0867  -0.0472 14  ARG A CA  
106  C C   . ARG A 15  ? 0.5509 0.4422 0.4298 -0.0438 0.0804  -0.0439 14  ARG A C   
107  O O   . ARG A 15  ? 0.5320 0.4322 0.4220 -0.0406 0.0783  -0.0456 14  ARG A O   
108  C CB  . ARG A 15  ? 0.5706 0.4644 0.4500 -0.0542 0.0902  -0.0535 14  ARG A CB  
109  C CG  . ARG A 15  ? 0.5930 0.4833 0.4682 -0.0613 0.0971  -0.0579 14  ARG A CG  
110  C CD  . ARG A 15  ? 0.6219 0.5015 0.4817 -0.0662 0.0995  -0.0559 14  ARG A CD  
111  N NE  . ARG A 15  ? 0.6479 0.5229 0.5024 -0.0733 0.1063  -0.0597 14  ARG A NE  
112  C CZ  . ARG A 15  ? 0.6718 0.5371 0.5121 -0.0793 0.1097  -0.0589 14  ARG A CZ  
113  N NH1 . ARG A 15  ? 0.6777 0.5370 0.5074 -0.0792 0.1066  -0.0540 14  ARG A NH1 
114  N NH2 . ARG A 15  ? 0.6877 0.5494 0.5241 -0.0861 0.1161  -0.0628 14  ARG A NH2 
115  N N   . ASP A 16  ? 0.5632 0.4497 0.4340 -0.0425 0.0772  -0.0391 15  ASP A N   
116  C CA  . ASP A 16  ? 0.5681 0.4604 0.4438 -0.0371 0.0713  -0.0361 15  ASP A CA  
117  C C   . ASP A 16  ? 0.5631 0.4630 0.4424 -0.0389 0.0713  -0.0397 15  ASP A C   
118  O O   . ASP A 16  ? 0.5577 0.4583 0.4364 -0.0440 0.0761  -0.0444 15  ASP A O   
119  C CB  . ASP A 16  ? 0.5885 0.4732 0.4554 -0.0344 0.0671  -0.0290 15  ASP A CB  
120  C CG  . ASP A 16  ? 0.6143 0.4921 0.4683 -0.0390 0.0677  -0.0269 15  ASP A CG  
121  O OD1 . ASP A 16  ? 0.6159 0.4968 0.4685 -0.0437 0.0706  -0.0311 15  ASP A OD1 
122  O OD2 . ASP A 16  ? 0.6473 0.5168 0.4926 -0.0381 0.0651  -0.0207 15  ASP A OD2 
123  N N   . GLN A 17  ? 0.5580 0.4635 0.4413 -0.0351 0.0665  -0.0377 16  GLN A N   
124  C CA  . GLN A 17  ? 0.5619 0.4741 0.4493 -0.0366 0.0667  -0.0413 16  GLN A CA  
125  C C   . GLN A 17  ? 0.5838 0.4909 0.4605 -0.0426 0.0700  -0.0427 16  GLN A C   
126  O O   . GLN A 17  ? 0.5789 0.4907 0.4595 -0.0452 0.0726  -0.0475 16  GLN A O   
127  C CB  . GLN A 17  ? 0.5514 0.4694 0.4436 -0.0318 0.0609  -0.0387 16  GLN A CB  
128  C CG  . GLN A 17  ? 0.5591 0.4725 0.4421 -0.0303 0.0565  -0.0325 16  GLN A CG  
129  C CD  . GLN A 17  ? 0.5580 0.4687 0.4416 -0.0254 0.0532  -0.0275 16  GLN A CD  
130  O OE1 . GLN A 17  ? 0.5547 0.4626 0.4402 -0.0250 0.0556  -0.0282 16  GLN A OE1 
131  N NE2 . GLN A 17  ? 0.5542 0.4661 0.4368 -0.0219 0.0479  -0.0228 16  GLN A NE2 
132  N N   . ASN A 18  ? 0.6090 0.5065 0.4726 -0.0449 0.0701  -0.0384 17  ASN A N   
133  C CA  . ASN A 18  ? 0.6363 0.5279 0.4875 -0.0516 0.0732  -0.0392 17  ASN A CA  
134  C C   . ASN A 18  ? 0.6520 0.5373 0.4975 -0.0573 0.0795  -0.0421 17  ASN A C   
135  O O   . ASN A 18  ? 0.6657 0.5432 0.4979 -0.0630 0.0818  -0.0409 17  ASN A O   
136  C CB  . ASN A 18  ? 0.6515 0.5365 0.4906 -0.0512 0.0682  -0.0318 17  ASN A CB  
137  C CG  . ASN A 18  ? 0.6463 0.5379 0.4904 -0.0464 0.0621  -0.0292 17  ASN A CG  
138  O OD1 . ASN A 18  ? 0.6394 0.5378 0.4887 -0.0472 0.0626  -0.0332 17  ASN A OD1 
139  N ND2 . ASN A 18  ? 0.6497 0.5392 0.4926 -0.0415 0.0565  -0.0225 17  ASN A ND2 
140  N N   . GLN A 19  ? 0.6549 0.5439 0.5103 -0.0561 0.0824  -0.0458 18  GLN A N   
141  C CA  . GLN A 19  ? 0.6745 0.5589 0.5264 -0.0615 0.0887  -0.0492 18  GLN A CA  
142  C C   . GLN A 19  ? 0.6848 0.5564 0.5234 -0.0633 0.0888  -0.0439 18  GLN A C   
143  O O   . GLN A 19  ? 0.6823 0.5481 0.5146 -0.0690 0.0942  -0.0462 18  GLN A O   
144  C CB  . GLN A 19  ? 0.6920 0.5779 0.5415 -0.0685 0.0946  -0.0554 18  GLN A CB  
145  C CG  . GLN A 19  ? 0.6920 0.5899 0.5564 -0.0671 0.0958  -0.0615 18  GLN A CG  
146  C CD  . GLN A 19  ? 0.6942 0.5998 0.5733 -0.0654 0.0978  -0.0659 18  GLN A CD  
147  O OE1 . GLN A 19  ? 0.7128 0.6149 0.5907 -0.0655 0.0986  -0.0647 18  GLN A OE1 
148  N NE2 . GLN A 19  ? 0.6888 0.6046 0.5818 -0.0640 0.0986  -0.0709 18  GLN A NE2 
149  N N   . GLN A 20  ? 0.6889 0.5560 0.5238 -0.0584 0.0830  -0.0368 19  GLN A N   
150  C CA  . GLN A 20  ? 0.7085 0.5632 0.5324 -0.0589 0.0825  -0.0310 19  GLN A CA  
151  C C   . GLN A 20  ? 0.6939 0.5477 0.5252 -0.0553 0.0834  -0.0314 19  GLN A C   
152  O O   . GLN A 20  ? 0.6724 0.5341 0.5154 -0.0497 0.0806  -0.0320 19  GLN A O   
153  C CB  . GLN A 20  ? 0.7296 0.5801 0.5471 -0.0552 0.0756  -0.0230 19  GLN A CB  
154  C CG  . GLN A 20  ? 0.7541 0.6018 0.5594 -0.0605 0.0748  -0.0213 19  GLN A CG  
155  C CD  . GLN A 20  ? 0.7949 0.6302 0.5844 -0.0678 0.0784  -0.0194 19  GLN A CD  
156  O OE1 . GLN A 20  ? 0.8255 0.6513 0.6106 -0.0670 0.0785  -0.0155 19  GLN A OE1 
157  N NE2 . GLN A 20  ? 0.8109 0.6457 0.5913 -0.0753 0.0814  -0.0222 19  GLN A NE2 
158  N N   . LEU A 21  ? 0.7000 0.5441 0.5240 -0.0592 0.0875  -0.0313 20  LEU A N   
159  C CA  . LEU A 21  ? 0.6953 0.5372 0.5247 -0.0569 0.0892  -0.0320 20  LEU A CA  
160  C C   . LEU A 21  ? 0.6907 0.5276 0.5207 -0.0500 0.0841  -0.0255 20  LEU A C   
161  O O   . LEU A 21  ? 0.7066 0.5351 0.5277 -0.0491 0.0809  -0.0190 20  LEU A O   
162  C CB  . LEU A 21  ? 0.7140 0.5459 0.5346 -0.0635 0.0953  -0.0337 20  LEU A CB  
163  C CG  . LEU A 21  ? 0.7185 0.5564 0.5419 -0.0702 0.1017  -0.0416 20  LEU A CG  
164  C CD1 . LEU A 21  ? 0.7334 0.5600 0.5461 -0.0771 0.1075  -0.0424 20  LEU A CD1 
165  C CD2 . LEU A 21  ? 0.7068 0.5573 0.5461 -0.0675 0.1021  -0.0470 20  LEU A CD2 
166  N N   . VAL A 22  ? 0.6711 0.5136 0.5122 -0.0455 0.0835  -0.0272 21  VAL A N   
167  C CA  . VAL A 22  ? 0.6600 0.4988 0.5039 -0.0389 0.0798  -0.0223 21  VAL A CA  
168  C C   . VAL A 22  ? 0.6540 0.4891 0.5013 -0.0391 0.0839  -0.0251 21  VAL A C   
169  O O   . VAL A 22  ? 0.6417 0.4855 0.4974 -0.0403 0.0861  -0.0308 21  VAL A O   
170  C CB  . VAL A 22  ? 0.6459 0.4965 0.5004 -0.0329 0.0746  -0.0220 21  VAL A CB  
171  C CG1 . VAL A 22  ? 0.6494 0.4967 0.5078 -0.0263 0.0715  -0.0177 21  VAL A CG1 
172  C CG2 . VAL A 22  ? 0.6442 0.4986 0.4952 -0.0332 0.0708  -0.0198 21  VAL A CG2 
173  N N   . THR A 23  ? 0.6626 0.4845 0.5034 -0.0384 0.0849  -0.0210 22  THR A N   
174  C CA  . THR A 23  ? 0.6688 0.4853 0.5120 -0.0387 0.0891  -0.0235 22  THR A CA  
175  C C   . THR A 23  ? 0.6667 0.4807 0.5155 -0.0313 0.0861  -0.0197 22  THR A C   
176  O O   . THR A 23  ? 0.6709 0.4810 0.5176 -0.0269 0.0815  -0.0135 22  THR A O   
177  C CB  . THR A 23  ? 0.6935 0.4952 0.5249 -0.0442 0.0939  -0.0225 22  THR A CB  
178  O OG1 . THR A 23  ? 0.7157 0.5055 0.5388 -0.0416 0.0907  -0.0147 22  THR A OG1 
179  C CG2 . THR A 23  ? 0.6938 0.4982 0.5196 -0.0520 0.0975  -0.0266 22  THR A CG2 
180  N N   . LEU A 24  ? 0.6612 0.4778 0.5173 -0.0304 0.0887  -0.0238 23  LEU A N   
181  C CA  . LEU A 24  ? 0.6671 0.4817 0.5295 -0.0239 0.0871  -0.0216 23  LEU A CA  
182  C C   . LEU A 24  ? 0.6887 0.4866 0.5449 -0.0223 0.0887  -0.0168 23  LEU A C   
183  O O   . LEU A 24  ? 0.6898 0.4841 0.5485 -0.0161 0.0850  -0.0115 23  LEU A O   
184  C CB  . LEU A 24  ? 0.6584 0.4799 0.5289 -0.0247 0.0902  -0.0278 23  LEU A CB  
185  C CG  . LEU A 24  ? 0.6547 0.4761 0.5328 -0.0188 0.0895  -0.0271 23  LEU A CG  
186  C CD1 . LEU A 24  ? 0.6426 0.4730 0.5269 -0.0128 0.0831  -0.0236 23  LEU A CD1 
187  C CD2 . LEU A 24  ? 0.6503 0.4781 0.5339 -0.0218 0.0932  -0.0339 23  LEU A CD2 
188  N N   . ARG A 25  ? 0.7110 0.4987 0.5595 -0.0280 0.0941  -0.0187 24  ARG A N   
189  C CA  . ARG A 25  ? 0.7417 0.5117 0.5835 -0.0272 0.0962  -0.0142 24  ARG A CA  
190  C C   . ARG A 25  ? 0.7404 0.5027 0.5751 -0.0246 0.0911  -0.0056 24  ARG A C   
191  O O   . ARG A 25  ? 0.7563 0.5051 0.5882 -0.0217 0.0908  -0.0003 24  ARG A O   
192  C CB  . ARG A 25  ? 0.7723 0.5333 0.6060 -0.0350 0.1031  -0.0182 24  ARG A CB  
193  C CG  . ARG A 25  ? 0.7975 0.5591 0.6218 -0.0421 0.1040  -0.0188 24  ARG A CG  
194  C CD  . ARG A 25  ? 0.8218 0.5784 0.6410 -0.0501 0.1112  -0.0245 24  ARG A CD  
195  N NE  . ARG A 25  ? 0.8482 0.6062 0.6592 -0.0574 0.1129  -0.0260 24  ARG A NE  
196  C CZ  . ARG A 25  ? 0.8500 0.6227 0.6654 -0.0601 0.1124  -0.0305 24  ARG A CZ  
197  N NH1 . ARG A 25  ? 0.8424 0.6298 0.6696 -0.0560 0.1095  -0.0333 24  ARG A NH1 
198  N NH2 . ARG A 25  ? 0.8597 0.6320 0.6674 -0.0669 0.1148  -0.0321 24  ARG A NH2 
199  N N   . GLY A 26  ? 0.7271 0.4978 0.5591 -0.0260 0.0870  -0.0042 25  GLY A N   
200  C CA  . GLY A 26  ? 0.7272 0.4924 0.5522 -0.0242 0.0815  0.0039  25  GLY A CA  
201  C C   . GLY A 26  ? 0.7206 0.4868 0.5536 -0.0153 0.0757  0.0097  25  GLY A C   
202  O O   . GLY A 26  ? 0.7310 0.4900 0.5589 -0.0130 0.0711  0.0175  25  GLY A O   
203  N N   . TYR A 27  ? 0.7014 0.4769 0.5470 -0.0106 0.0759  0.0059  26  TYR A N   
204  C CA  . TYR A 27  ? 0.6922 0.4703 0.5473 -0.0021 0.0712  0.0102  26  TYR A CA  
205  C C   . TYR A 27  ? 0.6972 0.4639 0.5571 0.0022  0.0743  0.0113  26  TYR A C   
206  O O   . TYR A 27  ? 0.6948 0.4612 0.5624 0.0094  0.0706  0.0158  26  TYR A O   
207  C CB  . TYR A 27  ? 0.6730 0.4680 0.5391 0.0004  0.0695  0.0055  26  TYR A CB  
208  C CG  . TYR A 27  ? 0.6671 0.4734 0.5306 -0.0022 0.0656  0.0054  26  TYR A CG  
209  C CD1 . TYR A 27  ? 0.6684 0.4778 0.5313 0.0012  0.0588  0.0116  26  TYR A CD1 
210  C CD2 . TYR A 27  ? 0.6599 0.4737 0.5220 -0.0080 0.0686  -0.0011 26  TYR A CD2 
211  C CE1 . TYR A 27  ? 0.6648 0.4838 0.5249 -0.0016 0.0557  0.0110  26  TYR A CE1 
212  C CE2 . TYR A 27  ? 0.6555 0.4789 0.5159 -0.0102 0.0655  -0.0016 26  TYR A CE2 
213  C CZ  . TYR A 27  ? 0.6559 0.4815 0.5149 -0.0071 0.0593  0.0042  26  TYR A CZ  
214  O OH  . TYR A 27  ? 0.6563 0.4908 0.5133 -0.0097 0.0567  0.0033  26  TYR A OH  
215  N N   . ARG A 28  ? 0.7017 0.4595 0.5580 -0.0021 0.0812  0.0069  27  ARG A N   
216  C CA  . ARG A 28  ? 0.7182 0.4640 0.5788 0.0015  0.0851  0.0072  27  ARG A CA  
217  C C   . ARG A 28  ? 0.7208 0.4527 0.5784 0.0060  0.0814  0.0167  27  ARG A C   
218  O O   . ARG A 28  ? 0.7342 0.4598 0.5807 0.0029  0.0786  0.0221  27  ARG A O   
219  C CB  . ARG A 28  ? 0.7354 0.4740 0.5913 -0.0051 0.0934  0.0005  27  ARG A CB  
220  C CG  . ARG A 28  ? 0.7401 0.4916 0.6045 -0.0064 0.0968  -0.0081 27  ARG A CG  
221  C CD  . ARG A 28  ? 0.7531 0.5042 0.6127 -0.0147 0.1034  -0.0156 27  ARG A CD  
222  N NE  . ARG A 28  ? 0.7821 0.5184 0.6392 -0.0165 0.1101  -0.0176 27  ARG A NE  
223  C CZ  . ARG A 28  ? 0.7902 0.5265 0.6460 -0.0228 0.1165  -0.0250 27  ARG A CZ  
224  N NH1 . ARG A 28  ? 0.7750 0.5261 0.6328 -0.0274 0.1167  -0.0308 27  ARG A NH1 
225  N NH2 . ARG A 28  ? 0.8025 0.5242 0.6557 -0.0244 0.1226  -0.0265 27  ARG A NH2 
226  N N   . GLY A 29  ? 0.7118 0.4398 0.5798 0.0135  0.0812  0.0187  28  GLY A N   
227  C CA  . GLY A 29  ? 0.7214 0.4372 0.5897 0.0193  0.0771  0.0281  28  GLY A CA  
228  C C   . GLY A 29  ? 0.7091 0.4329 0.5782 0.0231  0.0677  0.0357  28  GLY A C   
229  O O   . GLY A 29  ? 0.7244 0.4387 0.5913 0.0265  0.0628  0.0447  28  GLY A O   
230  N N   . ALA A 30  ? 0.6790 0.4202 0.5516 0.0224  0.0649  0.0324  29  ALA A N   
231  C CA  . ALA A 30  ? 0.6653 0.4155 0.5381 0.0250  0.0563  0.0386  29  ALA A CA  
232  C C   . ALA A 30  ? 0.6405 0.4085 0.5260 0.0292  0.0539  0.0350  29  ALA A C   
233  O O   . ALA A 30  ? 0.6383 0.4107 0.5329 0.0360  0.0486  0.0398  29  ALA A O   
234  C CB  . ALA A 30  ? 0.6630 0.4144 0.5211 0.0171  0.0545  0.0394  29  ALA A CB  
235  N N   . LYS A 31  ? 0.6164 0.3948 0.5027 0.0250  0.0577  0.0266  30  LYS A N   
236  C CA  . LYS A 31  ? 0.5957 0.3906 0.4925 0.0279  0.0555  0.0230  30  LYS A CA  
237  C C   . LYS A 31  ? 0.5756 0.3766 0.4782 0.0260  0.0619  0.0137  30  LYS A C   
238  O O   . LYS A 31  ? 0.5707 0.3666 0.4673 0.0203  0.0675  0.0089  30  LYS A O   
239  C CB  . LYS A 31  ? 0.5927 0.3984 0.4837 0.0243  0.0506  0.0238  30  LYS A CB  
240  C CG  . LYS A 31  ? 0.6113 0.4135 0.4958 0.0253  0.0436  0.0329  30  LYS A CG  
241  C CD  . LYS A 31  ? 0.6116 0.4247 0.4905 0.0212  0.0396  0.0324  30  LYS A CD  
242  C CE  . LYS A 31  ? 0.6287 0.4386 0.5001 0.0212  0.0325  0.0413  30  LYS A CE  
243  N NZ  . LYS A 31  ? 0.6272 0.4474 0.4928 0.0168  0.0292  0.0404  30  LYS A NZ  
244  N N   . ASN A 32  ? 0.5549 0.3672 0.4691 0.0303  0.0606  0.0114  31  ASN A N   
245  C CA  . ASN A 32  ? 0.5400 0.3604 0.4597 0.0282  0.0653  0.0031  31  ASN A CA  
246  C C   . ASN A 32  ? 0.5238 0.3557 0.4389 0.0232  0.0630  0.0005  31  ASN A C   
247  O O   . ASN A 32  ? 0.5221 0.3597 0.4355 0.0241  0.0572  0.0047  31  ASN A O   
248  C CB  . ASN A 32  ? 0.5355 0.3635 0.4686 0.0343  0.0646  0.0021  31  ASN A CB  
249  C CG  . ASN A 32  ? 0.5497 0.3666 0.4891 0.0402  0.0667  0.0050  31  ASN A CG  
250  O OD1 . ASN A 32  ? 0.5655 0.3695 0.5011 0.0384  0.0721  0.0036  31  ASN A OD1 
251  N ND2 . ASN A 32  ? 0.5525 0.3741 0.5021 0.0471  0.0626  0.0088  31  ASN A ND2 
252  N N   . VAL A 33  ? 0.5112 0.3466 0.4247 0.0178  0.0674  -0.0063 32  VAL A N   
253  C CA  . VAL A 33  ? 0.4984 0.3442 0.4087 0.0133  0.0654  -0.0087 32  VAL A CA  
254  C C   . VAL A 33  ? 0.4820 0.3405 0.3998 0.0125  0.0659  -0.0143 32  VAL A C   
255  O O   . VAL A 33  ? 0.4764 0.3343 0.3969 0.0108  0.0707  -0.0192 32  VAL A O   
256  C CB  . VAL A 33  ? 0.5028 0.3425 0.4035 0.0064  0.0693  -0.0112 32  VAL A CB  
257  C CG1 . VAL A 33  ? 0.4924 0.3426 0.3910 0.0023  0.0670  -0.0133 32  VAL A CG1 
258  C CG2 . VAL A 33  ? 0.5147 0.3404 0.4067 0.0062  0.0692  -0.0057 32  VAL A CG2 
259  N N   . LEU A 34  ? 0.4745 0.3443 0.3949 0.0134  0.0610  -0.0133 33  LEU A N   
260  C CA  . LEU A 34  ? 0.4634 0.3455 0.3899 0.0123  0.0605  -0.0178 33  LEU A CA  
261  C C   . LEU A 34  ? 0.4551 0.3413 0.3773 0.0063  0.0613  -0.0212 33  LEU A C   
262  O O   . LEU A 34  ? 0.4535 0.3409 0.3713 0.0050  0.0586  -0.0192 33  LEU A O   
263  C CB  . LEU A 34  ? 0.4586 0.3503 0.3903 0.0162  0.0547  -0.0149 33  LEU A CB  
264  C CG  . LEU A 34  ? 0.4504 0.3546 0.3879 0.0150  0.0536  -0.0188 33  LEU A CG  
265  C CD1 . LEU A 34  ? 0.4499 0.3554 0.3939 0.0161  0.0570  -0.0222 33  LEU A CD1 
266  C CD2 . LEU A 34  ? 0.4504 0.3632 0.3907 0.0176  0.0477  -0.0157 33  LEU A CD2 
267  N N   . LEU A 35  ? 0.4539 0.3422 0.3775 0.0025  0.0652  -0.0266 34  LEU A N   
268  C CA  . LEU A 35  ? 0.4525 0.3462 0.3742 -0.0029 0.0657  -0.0300 34  LEU A CA  
269  C C   . LEU A 35  ? 0.4406 0.3471 0.3691 -0.0031 0.0629  -0.0322 34  LEU A C   
270  O O   . LEU A 35  ? 0.4407 0.3501 0.3732 -0.0033 0.0643  -0.0348 34  LEU A O   
271  C CB  . LEU A 35  ? 0.4580 0.3462 0.3768 -0.0078 0.0714  -0.0341 34  LEU A CB  
272  C CG  . LEU A 35  ? 0.4717 0.3459 0.3832 -0.0086 0.0751  -0.0325 34  LEU A CG  
273  C CD1 . LEU A 35  ? 0.4776 0.3485 0.3868 -0.0144 0.0807  -0.0375 34  LEU A CD1 
274  C CD2 . LEU A 35  ? 0.4770 0.3482 0.3822 -0.0094 0.0730  -0.0291 34  LEU A CD2 
275  N N   . VAL A 36  ? 0.4377 0.3512 0.3668 -0.0035 0.0590  -0.0314 35  VAL A N   
276  C CA  . VAL A 36  ? 0.4334 0.3585 0.3686 -0.0038 0.0559  -0.0329 35  VAL A CA  
277  C C   . VAL A 36  ? 0.4294 0.3596 0.3653 -0.0084 0.0561  -0.0359 35  VAL A C   
278  O O   . VAL A 36  ? 0.4304 0.3616 0.3649 -0.0090 0.0547  -0.0352 35  VAL A O   
279  C CB  . VAL A 36  ? 0.4337 0.3636 0.3708 0.0000  0.0508  -0.0293 35  VAL A CB  
280  C CG1 . VAL A 36  ? 0.4263 0.3672 0.3693 -0.0007 0.0476  -0.0309 35  VAL A CG1 
281  C CG2 . VAL A 36  ? 0.4409 0.3669 0.3788 0.0048  0.0500  -0.0260 35  VAL A CG2 
282  N N   . PHE A 37  ? 0.4255 0.3591 0.3640 -0.0118 0.0580  -0.0395 36  PHE A N   
283  C CA  . PHE A 37  ? 0.4231 0.3630 0.3641 -0.0160 0.0577  -0.0422 36  PHE A CA  
284  C C   . PHE A 37  ? 0.4168 0.3670 0.3640 -0.0150 0.0527  -0.0416 36  PHE A C   
285  O O   . PHE A 37  ? 0.4200 0.3737 0.3695 -0.0136 0.0510  -0.0411 36  PHE A O   
286  C CB  . PHE A 37  ? 0.4239 0.3636 0.3650 -0.0206 0.0613  -0.0459 36  PHE A CB  
287  C CG  . PHE A 37  ? 0.4330 0.3623 0.3679 -0.0226 0.0666  -0.0470 36  PHE A CG  
288  C CD1 . PHE A 37  ? 0.4403 0.3602 0.3713 -0.0205 0.0694  -0.0460 36  PHE A CD1 
289  C CD2 . PHE A 37  ? 0.4330 0.3619 0.3666 -0.0266 0.0688  -0.0492 36  PHE A CD2 
290  C CE1 . PHE A 37  ? 0.4487 0.3582 0.3738 -0.0224 0.0742  -0.0467 36  PHE A CE1 
291  C CE2 . PHE A 37  ? 0.4418 0.3607 0.3691 -0.0290 0.0738  -0.0502 36  PHE A CE2 
292  C CZ  . PHE A 37  ? 0.4512 0.3600 0.3739 -0.0269 0.0764  -0.0488 36  PHE A CZ  
293  N N   . PHE A 38  ? 0.4156 0.3704 0.3655 -0.0157 0.0507  -0.0418 37  PHE A N   
294  C CA  . PHE A 38  ? 0.4128 0.3766 0.3688 -0.0149 0.0460  -0.0411 37  PHE A CA  
295  C C   . PHE A 38  ? 0.4130 0.3827 0.3743 -0.0180 0.0455  -0.0433 37  PHE A C   
296  O O   . PHE A 38  ? 0.4239 0.3907 0.3839 -0.0200 0.0486  -0.0451 37  PHE A O   
297  C CB  . PHE A 38  ? 0.4099 0.3734 0.3651 -0.0111 0.0431  -0.0382 37  PHE A CB  
298  C CG  . PHE A 38  ? 0.4128 0.3729 0.3653 -0.0115 0.0444  -0.0383 37  PHE A CG  
299  C CD1 . PHE A 38  ? 0.4191 0.3704 0.3645 -0.0113 0.0474  -0.0374 37  PHE A CD1 
300  C CD2 . PHE A 38  ? 0.4089 0.3742 0.3661 -0.0122 0.0427  -0.0393 37  PHE A CD2 
301  C CE1 . PHE A 38  ? 0.4196 0.3676 0.3613 -0.0126 0.0488  -0.0376 37  PHE A CE1 
302  C CE2 . PHE A 38  ? 0.4094 0.3715 0.3640 -0.0131 0.0446  -0.0401 37  PHE A CE2 
303  C CZ  . PHE A 38  ? 0.4184 0.3720 0.3646 -0.0136 0.0477  -0.0393 37  PHE A CZ  
304  N N   . PRO A 39  ? 0.4135 0.3915 0.3811 -0.0187 0.0417  -0.0432 38  PRO A N   
305  C CA  . PRO A 39  ? 0.4131 0.3975 0.3876 -0.0215 0.0406  -0.0450 38  PRO A CA  
306  C C   . PRO A 39  ? 0.4178 0.4030 0.3960 -0.0206 0.0407  -0.0457 38  PRO A C   
307  O O   . PRO A 39  ? 0.4222 0.4068 0.4017 -0.0229 0.0439  -0.0483 38  PRO A O   
308  C CB  . PRO A 39  ? 0.4078 0.4001 0.3876 -0.0219 0.0356  -0.0436 38  PRO A CB  
309  C CG  . PRO A 39  ? 0.4086 0.3986 0.3838 -0.0199 0.0346  -0.0416 38  PRO A CG  
310  C CD  . PRO A 39  ? 0.4129 0.3943 0.3812 -0.0179 0.0387  -0.0417 38  PRO A CD  
311  N N   . LEU A 40  ? 0.4230 0.4097 0.4032 -0.0176 0.0377  -0.0439 39  LEU A N   
312  C CA  . LEU A 40  ? 0.4302 0.4179 0.4145 -0.0171 0.0381  -0.0451 39  LEU A CA  
313  C C   . LEU A 40  ? 0.4337 0.4184 0.4145 -0.0142 0.0369  -0.0432 39  LEU A C   
314  O O   . LEU A 40  ? 0.4290 0.4149 0.4090 -0.0121 0.0334  -0.0406 39  LEU A O   
315  C CB  . LEU A 40  ? 0.4283 0.4245 0.4237 -0.0176 0.0345  -0.0454 39  LEU A CB  
316  C CG  . LEU A 40  ? 0.4303 0.4314 0.4317 -0.0209 0.0352  -0.0475 39  LEU A CG  
317  C CD1 . LEU A 40  ? 0.4283 0.4379 0.4406 -0.0207 0.0300  -0.0463 39  LEU A CD1 
318  C CD2 . LEU A 40  ? 0.4338 0.4330 0.4362 -0.0227 0.0402  -0.0511 39  LEU A CD2 
319  N N   . ALA A 41  ? 0.4385 0.4196 0.4171 -0.0147 0.0398  -0.0448 40  ALA A N   
320  C CA  . ALA A 41  ? 0.4435 0.4221 0.4186 -0.0129 0.0389  -0.0435 40  ALA A CA  
321  C C   . ALA A 41  ? 0.4431 0.4277 0.4267 -0.0116 0.0352  -0.0435 40  ALA A C   
322  O O   . ALA A 41  ? 0.4363 0.4261 0.4290 -0.0124 0.0345  -0.0450 40  ALA A O   
323  C CB  . ALA A 41  ? 0.4445 0.4181 0.4148 -0.0149 0.0433  -0.0458 40  ALA A CB  
324  N N   . PHE A 42  ? 0.4500 0.4338 0.4309 -0.0097 0.0327  -0.0414 41  PHE A N   
325  C CA  . PHE A 42  ? 0.4587 0.4467 0.4464 -0.0086 0.0294  -0.0411 41  PHE A CA  
326  C C   . PHE A 42  ? 0.4628 0.4563 0.4564 -0.0077 0.0249  -0.0389 41  PHE A C   
327  O O   . PHE A 42  ? 0.4659 0.4627 0.4663 -0.0070 0.0220  -0.0386 41  PHE A O   
328  C CB  . PHE A 42  ? 0.4575 0.4469 0.4528 -0.0097 0.0318  -0.0447 41  PHE A CB  
329  C CG  . PHE A 42  ? 0.4636 0.4479 0.4531 -0.0115 0.0368  -0.0475 41  PHE A CG  
330  C CD1 . PHE A 42  ? 0.4671 0.4473 0.4488 -0.0115 0.0369  -0.0467 41  PHE A CD1 
331  C CD2 . PHE A 42  ? 0.4635 0.4473 0.4550 -0.0139 0.0413  -0.0509 41  PHE A CD2 
332  C CE1 . PHE A 42  ? 0.4729 0.4483 0.4480 -0.0141 0.0414  -0.0491 41  PHE A CE1 
333  C CE2 . PHE A 42  ? 0.4710 0.4498 0.4562 -0.0163 0.0461  -0.0536 41  PHE A CE2 
334  C CZ  . PHE A 42  ? 0.4759 0.4503 0.4525 -0.0166 0.0461  -0.0526 41  PHE A CZ  
335  N N   . THR A 43  ? 0.4699 0.4639 0.4606 -0.0081 0.0243  -0.0376 42  THR A N   
336  C CA  . THR A 43  ? 0.4701 0.4689 0.4643 -0.0082 0.0202  -0.0355 42  THR A CA  
337  C C   . THR A 43  ? 0.4718 0.4695 0.4599 -0.0067 0.0185  -0.0330 42  THR A C   
338  O O   . THR A 43  ? 0.4705 0.4638 0.4519 -0.0058 0.0207  -0.0327 42  THR A O   
339  C CB  . THR A 43  ? 0.4742 0.4751 0.4695 -0.0104 0.0210  -0.0363 42  THR A CB  
340  O OG1 . THR A 43  ? 0.4869 0.4828 0.4745 -0.0107 0.0247  -0.0369 42  THR A OG1 
341  C CG2 . THR A 43  ? 0.4759 0.4795 0.4787 -0.0120 0.0222  -0.0387 42  THR A CG2 
342  N N   . GLY A 44  ? 0.4721 0.4737 0.4630 -0.0065 0.0143  -0.0310 43  GLY A N   
343  C CA  . GLY A 44  ? 0.4773 0.4789 0.4636 -0.0054 0.0126  -0.0289 43  GLY A CA  
344  C C   . GLY A 44  ? 0.4796 0.4800 0.4610 -0.0055 0.0146  -0.0288 43  GLY A C   
345  O O   . GLY A 44  ? 0.4738 0.4719 0.4508 -0.0037 0.0154  -0.0278 43  GLY A O   
346  N N   . ILE A 45  ? 0.4921 0.4939 0.4747 -0.0077 0.0154  -0.0298 44  ILE A N   
347  C CA  . ILE A 45  ? 0.5107 0.5110 0.4893 -0.0083 0.0179  -0.0303 44  ILE A CA  
348  C C   . ILE A 45  ? 0.5140 0.5078 0.4878 -0.0066 0.0221  -0.0311 44  ILE A C   
349  O O   . ILE A 45  ? 0.5166 0.5079 0.4870 -0.0051 0.0235  -0.0305 44  ILE A O   
350  C CB  . ILE A 45  ? 0.5291 0.5323 0.5095 -0.0120 0.0181  -0.0316 44  ILE A CB  
351  C CG1 . ILE A 45  ? 0.5448 0.5473 0.5212 -0.0133 0.0202  -0.0323 44  ILE A CG1 
352  C CG2 . ILE A 45  ? 0.5398 0.5413 0.5219 -0.0133 0.0206  -0.0336 44  ILE A CG2 
353  C CD1 . ILE A 45  ? 0.5539 0.5600 0.5298 -0.0134 0.0176  -0.0308 44  ILE A CD1 
354  N N   . CYS A 46  ? 0.5102 0.5011 0.4842 -0.0069 0.0241  -0.0324 45  CYS A N   
355  C CA  . CYS A 46  ? 0.5111 0.4951 0.4796 -0.0059 0.0278  -0.0328 45  CYS A CA  
356  C C   . CYS A 46  ? 0.5011 0.4828 0.4664 -0.0032 0.0266  -0.0307 45  CYS A C   
357  O O   . CYS A 46  ? 0.4931 0.4696 0.4534 -0.0017 0.0283  -0.0295 45  CYS A O   
358  C CB  . CYS A 46  ? 0.5129 0.4951 0.4823 -0.0079 0.0305  -0.0351 45  CYS A CB  
359  S SG  . CYS A 46  ? 0.5332 0.5188 0.5067 -0.0116 0.0317  -0.0376 45  CYS A SG  
360  N N   . GLN A 47  ? 0.4935 0.4789 0.4617 -0.0028 0.0235  -0.0300 46  GLN A N   
361  C CA  . GLN A 47  ? 0.5018 0.4860 0.4669 -0.0011 0.0220  -0.0282 46  GLN A CA  
362  C C   . GLN A 47  ? 0.5021 0.4873 0.4655 0.0011  0.0205  -0.0259 46  GLN A C   
363  O O   . GLN A 47  ? 0.5055 0.4873 0.4647 0.0029  0.0208  -0.0241 46  GLN A O   
364  C CB  . GLN A 47  ? 0.4961 0.4842 0.4651 -0.0015 0.0191  -0.0284 46  GLN A CB  
365  C CG  . GLN A 47  ? 0.4994 0.4862 0.4648 -0.0007 0.0179  -0.0271 46  GLN A CG  
366  C CD  . GLN A 47  ? 0.5096 0.4914 0.4708 -0.0019 0.0209  -0.0285 46  GLN A CD  
367  O OE1 . GLN A 47  ? 0.5174 0.4989 0.4816 -0.0036 0.0229  -0.0312 46  GLN A OE1 
368  N NE2 . GLN A 47  ? 0.5152 0.4933 0.4694 -0.0013 0.0212  -0.0266 46  GLN A NE2 
369  N N   . GLY A 48  ? 0.5036 0.4935 0.4706 0.0007  0.0189  -0.0259 47  GLY A N   
370  C CA  . GLY A 48  ? 0.5147 0.5065 0.4814 0.0025  0.0181  -0.0244 47  GLY A CA  
371  C C   . GLY A 48  ? 0.5316 0.5184 0.4956 0.0042  0.0212  -0.0242 47  GLY A C   
372  O O   . GLY A 48  ? 0.5373 0.5234 0.5003 0.0068  0.0207  -0.0222 47  GLY A O   
373  N N   . GLU A 49  ? 0.5445 0.5279 0.5077 0.0025  0.0244  -0.0262 48  GLU A N   
374  C CA  . GLU A 49  ? 0.5580 0.5355 0.5185 0.0037  0.0280  -0.0263 48  GLU A CA  
375  C C   . GLU A 49  ? 0.5398 0.5110 0.4958 0.0058  0.0285  -0.0241 48  GLU A C   
376  O O   . GLU A 49  ? 0.5336 0.5019 0.4887 0.0087  0.0288  -0.0221 48  GLU A O   
377  C CB  . GLU A 49  ? 0.5913 0.5664 0.5514 0.0006  0.0313  -0.0292 48  GLU A CB  
378  C CG  . GLU A 49  ? 0.6348 0.6024 0.5917 0.0014  0.0355  -0.0295 48  GLU A CG  
379  C CD  . GLU A 49  ? 0.6679 0.6337 0.6242 -0.0022 0.0390  -0.0327 48  GLU A CD  
380  O OE1 . GLU A 49  ? 0.6911 0.6530 0.6464 -0.0022 0.0423  -0.0339 48  GLU A OE1 
381  O OE2 . GLU A 49  ? 0.6838 0.6523 0.6412 -0.0051 0.0385  -0.0342 48  GLU A OE2 
382  N N   . LEU A 50  ? 0.5120 0.4813 0.4655 0.0041  0.0286  -0.0245 49  LEU A N   
383  C CA  . LEU A 50  ? 0.5074 0.4705 0.4551 0.0049  0.0291  -0.0224 49  LEU A CA  
384  C C   . LEU A 50  ? 0.5033 0.4688 0.4501 0.0071  0.0253  -0.0192 49  LEU A C   
385  O O   . LEU A 50  ? 0.5050 0.4658 0.4473 0.0085  0.0248  -0.0164 49  LEU A O   
386  C CB  . LEU A 50  ? 0.5067 0.4672 0.4517 0.0017  0.0311  -0.0244 49  LEU A CB  
387  C CG  . LEU A 50  ? 0.5079 0.4658 0.4533 -0.0008 0.0351  -0.0275 49  LEU A CG  
388  C CD1 . LEU A 50  ? 0.5076 0.4620 0.4495 -0.0037 0.0375  -0.0291 49  LEU A CD1 
389  C CD2 . LEU A 50  ? 0.5165 0.4685 0.4595 0.0002  0.0378  -0.0268 49  LEU A CD2 
390  N N   . ASP A 51  ? 0.4999 0.4723 0.4506 0.0070  0.0223  -0.0195 50  ASP A N   
391  C CA  . ASP A 51  ? 0.5087 0.4844 0.4590 0.0087  0.0185  -0.0168 50  ASP A CA  
392  C C   . ASP A 51  ? 0.5150 0.4910 0.4672 0.0122  0.0179  -0.0143 50  ASP A C   
393  O O   . ASP A 51  ? 0.5149 0.4900 0.4650 0.0141  0.0157  -0.0111 50  ASP A O   
394  C CB  . ASP A 51  ? 0.5010 0.4837 0.4553 0.0076  0.0158  -0.0178 50  ASP A CB  
395  C CG  . ASP A 51  ? 0.5078 0.4902 0.4612 0.0049  0.0159  -0.0197 50  ASP A CG  
396  O OD1 . ASP A 51  ? 0.5078 0.4851 0.4575 0.0034  0.0185  -0.0207 50  ASP A OD1 
397  O OD2 . ASP A 51  ? 0.5076 0.4946 0.4640 0.0041  0.0137  -0.0202 50  ASP A OD2 
398  N N   . GLN A 52  ? 0.5257 0.5031 0.4821 0.0127  0.0198  -0.0161 51  GLN A N   
399  C CA  . GLN A 52  ? 0.5428 0.5206 0.5025 0.0160  0.0202  -0.0147 51  GLN A CA  
400  C C   . GLN A 52  ? 0.5532 0.5226 0.5093 0.0181  0.0219  -0.0124 51  GLN A C   
401  O O   . GLN A 52  ? 0.5636 0.5325 0.5212 0.0216  0.0203  -0.0092 51  GLN A O   
402  C CB  . GLN A 52  ? 0.5491 0.5293 0.5130 0.0151  0.0229  -0.0179 51  GLN A CB  
403  C CG  . GLN A 52  ? 0.5662 0.5484 0.5350 0.0181  0.0238  -0.0176 51  GLN A CG  
404  C CD  . GLN A 52  ? 0.5719 0.5577 0.5441 0.0160  0.0263  -0.0212 51  GLN A CD  
405  O OE1 . GLN A 52  ? 0.5793 0.5650 0.5552 0.0177  0.0290  -0.0223 51  GLN A OE1 
406  N NE2 . GLN A 52  ? 0.5707 0.5598 0.5417 0.0120  0.0255  -0.0232 51  GLN A NE2 
407  N N   . LEU A 53  ? 0.5555 0.5183 0.5071 0.0159  0.0249  -0.0138 52  LEU A N   
408  C CA  . LEU A 53  ? 0.5599 0.5136 0.5066 0.0170  0.0266  -0.0115 52  LEU A CA  
409  C C   . LEU A 53  ? 0.5577 0.5103 0.4997 0.0175  0.0229  -0.0074 52  LEU A C   
410  O O   . LEU A 53  ? 0.5666 0.5152 0.5075 0.0204  0.0215  -0.0034 52  LEU A O   
411  C CB  . LEU A 53  ? 0.5683 0.5162 0.5108 0.0134  0.0306  -0.0144 52  LEU A CB  
412  C CG  . LEU A 53  ? 0.5862 0.5238 0.5221 0.0133  0.0327  -0.0122 52  LEU A CG  
413  C CD1 . LEU A 53  ? 0.5975 0.5298 0.5356 0.0171  0.0340  -0.0102 52  LEU A CD1 
414  C CD2 . LEU A 53  ? 0.5909 0.5244 0.5233 0.0090  0.0369  -0.0159 52  LEU A CD2 
415  N N   . ARG A 54  ? 0.5531 0.5090 0.4923 0.0146  0.0212  -0.0083 53  ARG A N   
416  C CA  . ARG A 54  ? 0.5597 0.5150 0.4933 0.0138  0.0179  -0.0051 53  ARG A CA  
417  C C   . ARG A 54  ? 0.5715 0.5318 0.5085 0.0172  0.0134  -0.0012 53  ARG A C   
418  O O   . ARG A 54  ? 0.5815 0.5390 0.5146 0.0183  0.0107  0.0032  53  ARG A O   
419  C CB  . ARG A 54  ? 0.5496 0.5087 0.4817 0.0100  0.0175  -0.0079 53  ARG A CB  
420  C CG  . ARG A 54  ? 0.5470 0.5066 0.4731 0.0083  0.0143  -0.0055 53  ARG A CG  
421  C CD  . ARG A 54  ? 0.5393 0.5040 0.4666 0.0054  0.0138  -0.0088 53  ARG A CD  
422  N NE  . ARG A 54  ? 0.5294 0.5018 0.4645 0.0073  0.0118  -0.0095 53  ARG A NE  
423  C CZ  . ARG A 54  ? 0.5284 0.5055 0.4667 0.0056  0.0112  -0.0122 53  ARG A CZ  
424  N NH1 . ARG A 54  ? 0.5319 0.5072 0.4676 0.0024  0.0129  -0.0148 53  ARG A NH1 
425  N NH2 . ARG A 54  ? 0.5192 0.5027 0.4637 0.0071  0.0093  -0.0123 53  ARG A NH2 
426  N N   . ASP A 55  ? 0.5759 0.5442 0.5202 0.0185  0.0123  -0.0028 54  ASP A N   
427  C CA  . ASP A 55  ? 0.5876 0.5624 0.5364 0.0214  0.0083  0.0001  54  ASP A CA  
428  C C   . ASP A 55  ? 0.6056 0.5778 0.5582 0.0261  0.0080  0.0035  54  ASP A C   
429  O O   . ASP A 55  ? 0.6156 0.5921 0.5712 0.0286  0.0041  0.0071  54  ASP A O   
430  C CB  . ASP A 55  ? 0.5829 0.5663 0.5383 0.0211  0.0079  -0.0029 54  ASP A CB  
431  C CG  . ASP A 55  ? 0.5812 0.5676 0.5339 0.0171  0.0070  -0.0052 54  ASP A CG  
432  O OD1 . ASP A 55  ? 0.5934 0.5774 0.5400 0.0150  0.0057  -0.0041 54  ASP A OD1 
433  O OD2 . ASP A 55  ? 0.5677 0.5586 0.5245 0.0159  0.0076  -0.0081 54  ASP A OD2 
434  N N   . HIS A 56  ? 0.6156 0.5811 0.5688 0.0272  0.0122  0.0022  55  HIS A N   
435  C CA  . HIS A 56  ? 0.6353 0.5967 0.5927 0.0318  0.0127  0.0051  55  HIS A CA  
436  C C   . HIS A 56  ? 0.6467 0.5964 0.5970 0.0313  0.0148  0.0071  55  HIS A C   
437  O O   . HIS A 56  ? 0.6422 0.5858 0.5953 0.0340  0.0176  0.0075  55  HIS A O   
438  C CB  . HIS A 56  ? 0.6403 0.6039 0.6059 0.0336  0.0166  0.0013  55  HIS A CB  
439  C CG  . HIS A 56  ? 0.6480 0.6225 0.6200 0.0335  0.0152  -0.0009 55  HIS A CG  
440  N ND1 . HIS A 56  ? 0.6619 0.6433 0.6409 0.0369  0.0121  0.0015  55  HIS A ND1 
441  C CD2 . HIS A 56  ? 0.6480 0.6278 0.6205 0.0301  0.0164  -0.0051 55  HIS A CD2 
442  C CE1 . HIS A 56  ? 0.6587 0.6489 0.6417 0.0353  0.0118  -0.0015 55  HIS A CE1 
443  N NE2 . HIS A 56  ? 0.6511 0.6401 0.6299 0.0312  0.0142  -0.0053 55  HIS A NE2 
444  N N   . LEU A 57  ? 0.6455 0.5919 0.5866 0.0275  0.0136  0.0082  56  LEU A N   
445  C CA  . LEU A 57  ? 0.6562 0.5914 0.5891 0.0258  0.0159  0.0096  56  LEU A CA  
446  C C   . LEU A 57  ? 0.6682 0.5962 0.6009 0.0297  0.0142  0.0155  56  LEU A C   
447  O O   . LEU A 57  ? 0.6719 0.5904 0.6025 0.0300  0.0179  0.0155  56  LEU A O   
448  C CB  . LEU A 57  ? 0.6628 0.5964 0.5857 0.0205  0.0150  0.0096  56  LEU A CB  
449  C CG  . LEU A 57  ? 0.6776 0.6002 0.5912 0.0173  0.0183  0.0099  56  LEU A CG  
450  C CD1 . LEU A 57  ? 0.6721 0.5916 0.5879 0.0161  0.0243  0.0046  56  LEU A CD1 
451  C CD2 . LEU A 57  ? 0.6806 0.6028 0.5849 0.0119  0.0175  0.0095  56  LEU A CD2 
452  N N   . PRO A 58  ? 0.6742 0.6065 0.6093 0.0325  0.0085  0.0208  57  PRO A N   
453  C CA  . PRO A 58  ? 0.6921 0.6178 0.6280 0.0366  0.0060  0.0272  57  PRO A CA  
454  C C   . PRO A 58  ? 0.7057 0.6270 0.6507 0.0416  0.0099  0.0262  57  PRO A C   
455  O O   . PRO A 58  ? 0.7157 0.6274 0.6595 0.0441  0.0098  0.0306  57  PRO A O   
456  C CB  . PRO A 58  ? 0.6886 0.6237 0.6290 0.0391  -0.0008 0.0317  57  PRO A CB  
457  C CG  . PRO A 58  ? 0.6784 0.6207 0.6136 0.0340  -0.0022 0.0288  57  PRO A CG  
458  C CD  . PRO A 58  ? 0.6667 0.6097 0.6031 0.0316  0.0038  0.0214  57  PRO A CD  
459  N N   . GLU A 59  ? 0.7134 0.6410 0.6668 0.0427  0.0134  0.0206  58  GLU A N   
460  C CA  . GLU A 59  ? 0.7340 0.6578 0.6958 0.0466  0.0180  0.0185  58  GLU A CA  
461  C C   . GLU A 59  ? 0.7396 0.6525 0.6953 0.0435  0.0242  0.0150  58  GLU A C   
462  O O   . GLU A 59  ? 0.7453 0.6513 0.7053 0.0463  0.0282  0.0143  58  GLU A O   
463  C CB  . GLU A 59  ? 0.7347 0.6693 0.7066 0.0477  0.0197  0.0134  58  GLU A CB  
464  C CG  . GLU A 59  ? 0.7445 0.6906 0.7232 0.0504  0.0141  0.0161  58  GLU A CG  
465  C CD  . GLU A 59  ? 0.7537 0.7098 0.7424 0.0513  0.0163  0.0112  58  GLU A CD  
466  O OE1 . GLU A 59  ? 0.7645 0.7181 0.7603 0.0538  0.0212  0.0082  58  GLU A OE1 
467  O OE2 . GLU A 59  ? 0.7475 0.7135 0.7367 0.0493  0.0133  0.0102  58  GLU A OE2 
468  N N   . PHE A 60  ? 0.7462 0.6581 0.6925 0.0377  0.0253  0.0125  59  PHE A N   
469  C CA  . PHE A 60  ? 0.7557 0.6586 0.6958 0.0340  0.0311  0.0090  59  PHE A CA  
470  C C   . PHE A 60  ? 0.7699 0.6622 0.6990 0.0314  0.0305  0.0129  59  PHE A C   
471  O O   . PHE A 60  ? 0.7778 0.6599 0.7030 0.0300  0.0351  0.0118  59  PHE A O   
472  C CB  . PHE A 60  ? 0.7403 0.6497 0.6788 0.0290  0.0334  0.0028  59  PHE A CB  
473  C CG  . PHE A 60  ? 0.7388 0.6578 0.6863 0.0302  0.0343  -0.0014 59  PHE A CG  
474  C CD1 . PHE A 60  ? 0.7374 0.6540 0.6901 0.0311  0.0392  -0.0050 59  PHE A CD1 
475  C CD2 . PHE A 60  ? 0.7310 0.6611 0.6813 0.0297  0.0305  -0.0018 59  PHE A CD2 
476  C CE1 . PHE A 60  ? 0.7328 0.6581 0.6928 0.0313  0.0403  -0.0090 59  PHE A CE1 
477  C CE2 . PHE A 60  ? 0.7267 0.6651 0.6844 0.0301  0.0314  -0.0055 59  PHE A CE2 
478  C CZ  . PHE A 60  ? 0.7238 0.6600 0.6861 0.0308  0.0362  -0.0090 59  PHE A CZ  
479  N N   . GLU A 61  ? 0.7772 0.6715 0.7004 0.0302  0.0254  0.0172  60  GLU A N   
480  C CA  . GLU A 61  ? 0.8085 0.6930 0.7198 0.0267  0.0247  0.0210  60  GLU A CA  
481  C C   . GLU A 61  ? 0.8053 0.6865 0.7160 0.0305  0.0188  0.0294  60  GLU A C   
482  O O   . GLU A 61  ? 0.8154 0.7035 0.7251 0.0304  0.0131  0.0327  60  GLU A O   
483  C CB  . GLU A 61  ? 0.8267 0.7153 0.7298 0.0205  0.0244  0.0185  60  GLU A CB  
484  C CG  . GLU A 61  ? 0.8721 0.7502 0.7622 0.0153  0.0260  0.0201  60  GLU A CG  
485  C CD  . GLU A 61  ? 0.8943 0.7764 0.7779 0.0089  0.0275  0.0158  60  GLU A CD  
486  O OE1 . GLU A 61  ? 0.8891 0.7815 0.7764 0.0088  0.0249  0.0140  60  GLU A OE1 
487  O OE2 . GLU A 61  ? 0.9317 0.8066 0.8070 0.0040  0.0314  0.0140  60  GLU A OE2 
488  N N   . ASN A 62  ? 0.7971 0.6676 0.7087 0.0336  0.0201  0.0329  61  ASN A N   
489  C CA  . ASN A 62  ? 0.7929 0.6589 0.7051 0.0378  0.0144  0.0416  61  ASN A CA  
490  C C   . ASN A 62  ? 0.8006 0.6504 0.7069 0.0378  0.0169  0.0451  61  ASN A C   
491  O O   . ASN A 62  ? 0.8047 0.6473 0.7037 0.0331  0.0227  0.0408  61  ASN A O   
492  C CB  . ASN A 62  ? 0.7855 0.6598 0.7132 0.0452  0.0119  0.0426  61  ASN A CB  
493  C CG  . ASN A 62  ? 0.7799 0.6526 0.7174 0.0483  0.0186  0.0368  61  ASN A CG  
494  O OD1 . ASN A 62  ? 0.7698 0.6307 0.7054 0.0485  0.0232  0.0363  61  ASN A OD1 
495  N ND2 . ASN A 62  ? 0.7764 0.6610 0.7242 0.0503  0.0194  0.0321  61  ASN A ND2 
496  N N   . ASP A 63  ? 0.7976 0.6414 0.7071 0.0429  0.0126  0.0529  62  ASP A N   
497  C CA  . ASP A 63  ? 0.8091 0.6364 0.7133 0.0433  0.0145  0.0571  62  ASP A CA  
498  C C   . ASP A 63  ? 0.7853 0.6056 0.6951 0.0447  0.0229  0.0510  62  ASP A C   
499  O O   . ASP A 63  ? 0.7911 0.5978 0.6928 0.0418  0.0269  0.0513  62  ASP A O   
500  C CB  . ASP A 63  ? 0.8343 0.6577 0.7439 0.0496  0.0077  0.0670  62  ASP A CB  
501  C CG  . ASP A 63  ? 0.8520 0.6800 0.7534 0.0471  -0.0010 0.0744  62  ASP A CG  
502  O OD1 . ASP A 63  ? 0.8555 0.6890 0.7468 0.0404  -0.0013 0.0713  62  ASP A OD1 
503  O OD2 . ASP A 63  ? 0.8678 0.6936 0.7732 0.0519  -0.0077 0.0832  62  ASP A OD2 
504  N N   . ASP A 64  ? 0.7448 0.5743 0.6677 0.0485  0.0256  0.0453  63  ASP A N   
505  C CA  . ASP A 64  ? 0.7280 0.5519 0.6570 0.0498  0.0335  0.0391  63  ASP A CA  
506  C C   . ASP A 64  ? 0.6872 0.5168 0.6136 0.0440  0.0395  0.0296  63  ASP A C   
507  O O   . ASP A 64  ? 0.6829 0.5077 0.6123 0.0436  0.0463  0.0242  63  ASP A O   
508  C CB  . ASP A 64  ? 0.7330 0.5623 0.6789 0.0577  0.0334  0.0389  63  ASP A CB  
509  C CG  . ASP A 64  ? 0.7585 0.5820 0.7100 0.0644  0.0278  0.0482  63  ASP A CG  
510  O OD1 . ASP A 64  ? 0.7807 0.5912 0.7232 0.0632  0.0262  0.0543  63  ASP A OD1 
511  O OD2 . ASP A 64  ? 0.7605 0.5928 0.7259 0.0707  0.0249  0.0495  63  ASP A OD2 
512  N N   . SER A 65  ? 0.6569 0.4965 0.5780 0.0396  0.0371  0.0276  64  SER A N   
513  C CA  A SER A 65  ? 0.6348 0.4809 0.5548 0.0345  0.0419  0.0193  64  SER A CA  
514  C CA  B SER A 65  ? 0.6351 0.4807 0.5547 0.0344  0.0420  0.0193  64  SER A CA  
515  C C   . SER A 65  ? 0.6222 0.4733 0.5324 0.0284  0.0399  0.0184  64  SER A C   
516  O O   . SER A 65  ? 0.6196 0.4739 0.5261 0.0284  0.0341  0.0233  64  SER A O   
517  C CB  A SER A 65  ? 0.6224 0.4810 0.5545 0.0377  0.0422  0.0149  64  SER A CB  
518  C CB  B SER A 65  ? 0.6229 0.4805 0.5549 0.0375  0.0429  0.0145  64  SER A CB  
519  O OG  A SER A 65  ? 0.6306 0.4853 0.5725 0.0430  0.0450  0.0145  64  SER A OG  
520  O OG  B SER A 65  ? 0.6213 0.4896 0.5582 0.0406  0.0365  0.0179  64  SER A OG  
521  N N   . ALA A 66  ? 0.6005 0.4529 0.5074 0.0231  0.0448  0.0119  65  ALA A N   
522  C CA  . ALA A 66  ? 0.5849 0.4426 0.4847 0.0173  0.0442  0.0095  65  ALA A CA  
523  C C   . ALA A 66  ? 0.5628 0.4308 0.4689 0.0155  0.0469  0.0022  65  ALA A C   
524  O O   . ALA A 66  ? 0.5594 0.4274 0.4718 0.0170  0.0505  -0.0013 65  ALA A O   
525  C CB  . ALA A 66  ? 0.5956 0.4425 0.4838 0.0116  0.0477  0.0094  65  ALA A CB  
526  N N   . ALA A 67  ? 0.5444 0.4210 0.4488 0.0122  0.0452  0.0000  66  ALA A N   
527  C CA  . ALA A 67  ? 0.5252 0.4118 0.4355 0.0105  0.0469  -0.0060 66  ALA A CA  
528  C C   . ALA A 67  ? 0.5172 0.4052 0.4223 0.0045  0.0490  -0.0098 66  ALA A C   
529  O O   . ALA A 67  ? 0.5211 0.4096 0.4206 0.0024  0.0469  -0.0081 66  ALA A O   
530  C CB  . ALA A 67  ? 0.5155 0.4135 0.4326 0.0136  0.0421  -0.0052 66  ALA A CB  
531  N N   . LEU A 68  ? 0.5058 0.3948 0.4131 0.0016  0.0534  -0.0150 67  LEU A N   
532  C CA  . LEU A 68  ? 0.4981 0.3894 0.4026 -0.0040 0.0558  -0.0191 67  LEU A CA  
533  C C   . LEU A 68  ? 0.4741 0.3765 0.3866 -0.0048 0.0557  -0.0237 67  LEU A C   
534  O O   . LEU A 68  ? 0.4690 0.3729 0.3862 -0.0042 0.0574  -0.0259 67  LEU A O   
535  C CB  . LEU A 68  ? 0.5105 0.3921 0.4094 -0.0077 0.0613  -0.0209 67  LEU A CB  
536  C CG  . LEU A 68  ? 0.5266 0.3954 0.4167 -0.0074 0.0618  -0.0161 67  LEU A CG  
537  C CD1 . LEU A 68  ? 0.5359 0.3951 0.4211 -0.0114 0.0676  -0.0185 67  LEU A CD1 
538  C CD2 . LEU A 68  ? 0.5345 0.4029 0.4174 -0.0096 0.0592  -0.0134 67  LEU A CD2 
539  N N   . ALA A 69  ? 0.4584 0.3682 0.3724 -0.0065 0.0537  -0.0251 68  ALA A N   
540  C CA  . ALA A 69  ? 0.4433 0.3632 0.3648 -0.0076 0.0531  -0.0289 68  ALA A CA  
541  C C   . ALA A 69  ? 0.4404 0.3600 0.3611 -0.0127 0.0570  -0.0330 68  ALA A C   
542  O O   . ALA A 69  ? 0.4478 0.3625 0.3625 -0.0153 0.0589  -0.0330 68  ALA A O   
543  C CB  . ALA A 69  ? 0.4393 0.3669 0.3638 -0.0063 0.0487  -0.0279 68  ALA A CB  
544  N N   . ILE A 70  ? 0.4291 0.3542 0.3556 -0.0145 0.0582  -0.0366 69  ILE A N   
545  C CA  . ILE A 70  ? 0.4241 0.3501 0.3512 -0.0194 0.0617  -0.0406 69  ILE A CA  
546  C C   . ILE A 70  ? 0.4123 0.3495 0.3484 -0.0206 0.0598  -0.0435 69  ILE A C   
547  O O   . ILE A 70  ? 0.4056 0.3479 0.3462 -0.0191 0.0574  -0.0432 69  ILE A O   
548  C CB  . ILE A 70  ? 0.4302 0.3489 0.3535 -0.0217 0.0663  -0.0421 69  ILE A CB  
549  C CG1 . ILE A 70  ? 0.4426 0.3492 0.3576 -0.0199 0.0678  -0.0385 69  ILE A CG1 
550  C CG2 . ILE A 70  ? 0.4302 0.3501 0.3539 -0.0272 0.0701  -0.0463 69  ILE A CG2 
551  C CD1 . ILE A 70  ? 0.4508 0.3486 0.3619 -0.0219 0.0724  -0.0397 69  ILE A CD1 
552  N N   . SER A 71  ? 0.4105 0.3517 0.3496 -0.0235 0.0609  -0.0462 70  SER A N   
553  C CA  . SER A 71  ? 0.4057 0.3573 0.3543 -0.0249 0.0590  -0.0487 70  SER A CA  
554  C C   . SER A 71  ? 0.4067 0.3599 0.3576 -0.0290 0.0625  -0.0524 70  SER A C   
555  O O   . SER A 71  ? 0.4172 0.3635 0.3616 -0.0310 0.0663  -0.0531 70  SER A O   
556  C CB  . SER A 71  ? 0.4037 0.3619 0.3578 -0.0218 0.0542  -0.0471 70  SER A CB  
557  O OG  . SER A 71  ? 0.4180 0.3754 0.3714 -0.0220 0.0550  -0.0476 70  SER A OG  
558  N N   . VAL A 72  ? 0.4016 0.3642 0.3621 -0.0305 0.0611  -0.0547 71  VAL A N   
559  C CA  . VAL A 72  ? 0.4055 0.3716 0.3708 -0.0344 0.0643  -0.0586 71  VAL A CA  
560  C C   . VAL A 72  ? 0.4047 0.3726 0.3733 -0.0340 0.0650  -0.0600 71  VAL A C   
561  O O   . VAL A 72  ? 0.4102 0.3805 0.3827 -0.0372 0.0685  -0.0637 71  VAL A O   
562  C CB  . VAL A 72  ? 0.4022 0.3783 0.3775 -0.0365 0.0623  -0.0604 71  VAL A CB  
563  C CG1 . VAL A 72  ? 0.4035 0.3773 0.3743 -0.0384 0.0629  -0.0601 71  VAL A CG1 
564  C CG2 . VAL A 72  ? 0.3984 0.3831 0.3830 -0.0334 0.0564  -0.0587 71  VAL A CG2 
565  N N   . GLY A 73  ? 0.3988 0.3656 0.3660 -0.0304 0.0622  -0.0575 72  GLY A N   
566  C CA  . GLY A 73  ? 0.3958 0.3637 0.3653 -0.0304 0.0632  -0.0592 72  GLY A CA  
567  C C   . GLY A 73  ? 0.4073 0.3669 0.3670 -0.0335 0.0685  -0.0606 72  GLY A C   
568  O O   . GLY A 73  ? 0.4136 0.3648 0.3627 -0.0341 0.0699  -0.0585 72  GLY A O   
569  N N   . PRO A 74  ? 0.4010 0.3626 0.3642 -0.0357 0.0717  -0.0643 73  PRO A N   
570  C CA  . PRO A 74  ? 0.4121 0.3660 0.3652 -0.0396 0.0769  -0.0659 73  PRO A CA  
571  C C   . PRO A 74  ? 0.4168 0.3644 0.3599 -0.0382 0.0753  -0.0627 73  PRO A C   
572  O O   . PRO A 74  ? 0.4075 0.3581 0.3537 -0.0343 0.0707  -0.0603 73  PRO A O   
573  C CB  . PRO A 74  ? 0.4108 0.3709 0.3734 -0.0424 0.0809  -0.0717 73  PRO A CB  
574  C CG  . PRO A 74  ? 0.4004 0.3694 0.3760 -0.0384 0.0764  -0.0716 73  PRO A CG  
575  C CD  . PRO A 74  ? 0.3937 0.3647 0.3708 -0.0349 0.0708  -0.0673 73  PRO A CD  
576  N N   . PRO A 75  ? 0.4350 0.3738 0.3656 -0.0418 0.0789  -0.0624 74  PRO A N   
577  C CA  . PRO A 75  ? 0.4452 0.3777 0.3649 -0.0414 0.0771  -0.0588 74  PRO A CA  
578  C C   . PRO A 75  ? 0.4471 0.3842 0.3708 -0.0403 0.0755  -0.0600 74  PRO A C   
579  O O   . PRO A 75  ? 0.4510 0.3868 0.3706 -0.0374 0.0710  -0.0559 74  PRO A O   
580  C CB  . PRO A 75  ? 0.4572 0.3809 0.3645 -0.0471 0.0824  -0.0598 74  PRO A CB  
581  C CG  . PRO A 75  ? 0.4563 0.3792 0.3657 -0.0492 0.0857  -0.0618 74  PRO A CG  
582  C CD  . PRO A 75  ? 0.4425 0.3767 0.3681 -0.0471 0.0848  -0.0652 74  PRO A CD  
583  N N   . PRO A 76  ? 0.4510 0.3933 0.3829 -0.0426 0.0792  -0.0657 75  PRO A N   
584  C CA  . PRO A 76  ? 0.4519 0.3976 0.3877 -0.0417 0.0781  -0.0672 75  PRO A CA  
585  C C   . PRO A 76  ? 0.4479 0.3992 0.3919 -0.0358 0.0716  -0.0641 75  PRO A C   
586  O O   . PRO A 76  ? 0.4439 0.3950 0.3856 -0.0344 0.0688  -0.0625 75  PRO A O   
587  C CB  . PRO A 76  ? 0.4496 0.4008 0.3964 -0.0444 0.0834  -0.0743 75  PRO A CB  
588  C CG  . PRO A 76  ? 0.4548 0.4030 0.3975 -0.0488 0.0885  -0.0764 75  PRO A CG  
589  C CD  . PRO A 76  ? 0.4527 0.3980 0.3911 -0.0463 0.0847  -0.0713 75  PRO A CD  
590  N N   . THR A 77  ? 0.4469 0.4032 0.4000 -0.0331 0.0693  -0.0634 76  THR A N   
591  C CA  . THR A 77  ? 0.4460 0.4075 0.4061 -0.0282 0.0633  -0.0603 76  THR A CA  
592  C C   . THR A 77  ? 0.4490 0.4057 0.3991 -0.0259 0.0593  -0.0547 76  THR A C   
593  O O   . THR A 77  ? 0.4396 0.3981 0.3904 -0.0234 0.0554  -0.0525 76  THR A O   
594  C CB  . THR A 77  ? 0.4459 0.4128 0.4152 -0.0270 0.0620  -0.0604 76  THR A CB  
595  O OG1 . THR A 77  ? 0.4564 0.4295 0.4375 -0.0286 0.0647  -0.0652 76  THR A OG1 
596  C CG2 . THR A 77  ? 0.4392 0.4106 0.4134 -0.0228 0.0557  -0.0567 76  THR A CG2 
597  N N   . HIS A 78  ? 0.4608 0.4115 0.4022 -0.0268 0.0604  -0.0525 77  HIS A N   
598  C CA  . HIS A 78  ? 0.4718 0.4180 0.4049 -0.0243 0.0568  -0.0471 77  HIS A CA  
599  C C   . HIS A 78  ? 0.4815 0.4236 0.4056 -0.0254 0.0561  -0.0453 77  HIS A C   
600  O O   . HIS A 78  ? 0.4806 0.4227 0.4020 -0.0225 0.0517  -0.0413 77  HIS A O   
601  C CB  . HIS A 78  ? 0.4755 0.4151 0.4017 -0.0251 0.0586  -0.0452 77  HIS A CB  
602  C CG  . HIS A 78  ? 0.4710 0.4140 0.4042 -0.0242 0.0587  -0.0462 77  HIS A CG  
603  N ND1 . HIS A 78  ? 0.4774 0.4162 0.4078 -0.0269 0.0627  -0.0478 77  HIS A ND1 
604  C CD2 . HIS A 78  ? 0.4658 0.4159 0.4081 -0.0215 0.0555  -0.0461 77  HIS A CD2 
605  C CE1 . HIS A 78  ? 0.4743 0.4178 0.4117 -0.0260 0.0619  -0.0486 77  HIS A CE1 
606  N NE2 . HIS A 78  ? 0.4661 0.4165 0.4106 -0.0228 0.0574  -0.0475 77  HIS A NE2 
607  N N   . LYS A 79  ? 0.4972 0.4363 0.4165 -0.0299 0.0605  -0.0485 78  LYS A N   
608  C CA  . LYS A 79  ? 0.5165 0.4515 0.4260 -0.0323 0.0602  -0.0473 78  LYS A CA  
609  C C   . LYS A 79  ? 0.5054 0.4461 0.4204 -0.0300 0.0567  -0.0474 78  LYS A C   
610  O O   . LYS A 79  ? 0.4981 0.4378 0.4077 -0.0285 0.0525  -0.0433 78  LYS A O   
611  C CB  . LYS A 79  ? 0.5388 0.4704 0.4432 -0.0384 0.0664  -0.0519 78  LYS A CB  
612  C CG  . LYS A 79  ? 0.5677 0.4949 0.4604 -0.0423 0.0667  -0.0512 78  LYS A CG  
613  C CD  . LYS A 79  ? 0.5882 0.5097 0.4695 -0.0410 0.0620  -0.0440 78  LYS A CD  
614  C CE  . LYS A 79  ? 0.6120 0.5286 0.4798 -0.0461 0.0622  -0.0428 78  LYS A CE  
615  N NZ  . LYS A 79  ? 0.6225 0.5344 0.4807 -0.0443 0.0567  -0.0350 78  LYS A NZ  
616  N N   . ILE A 80  ? 0.4963 0.4429 0.4226 -0.0299 0.0583  -0.0520 79  ILE A N   
617  C CA  . ILE A 80  ? 0.4922 0.4435 0.4247 -0.0280 0.0556  -0.0526 79  ILE A CA  
618  C C   . ILE A 80  ? 0.4800 0.4345 0.4152 -0.0231 0.0493  -0.0477 79  ILE A C   
619  O O   . ILE A 80  ? 0.4759 0.4311 0.4083 -0.0222 0.0459  -0.0456 79  ILE A O   
620  C CB  . ILE A 80  ? 0.4899 0.4468 0.4362 -0.0279 0.0582  -0.0580 79  ILE A CB  
621  C CG1 . ILE A 80  ? 0.5035 0.4580 0.4479 -0.0330 0.0650  -0.0638 79  ILE A CG1 
622  C CG2 . ILE A 80  ? 0.4851 0.4465 0.4390 -0.0251 0.0547  -0.0579 79  ILE A CG2 
623  C CD1 . ILE A 80  ? 0.5153 0.4667 0.4523 -0.0362 0.0664  -0.0653 79  ILE A CD1 
624  N N   . TRP A 81  ? 0.4691 0.4256 0.4093 -0.0205 0.0479  -0.0463 80  TRP A N   
625  C CA  . TRP A 81  ? 0.4691 0.4289 0.4122 -0.0163 0.0427  -0.0423 80  TRP A CA  
626  C C   . TRP A 81  ? 0.4743 0.4301 0.4076 -0.0152 0.0400  -0.0375 80  TRP A C   
627  O O   . TRP A 81  ? 0.4685 0.4272 0.4027 -0.0127 0.0357  -0.0347 80  TRP A O   
628  C CB  . TRP A 81  ? 0.4612 0.4237 0.4109 -0.0148 0.0427  -0.0425 80  TRP A CB  
629  C CG  . TRP A 81  ? 0.4553 0.4221 0.4093 -0.0114 0.0379  -0.0395 80  TRP A CG  
630  C CD1 . TRP A 81  ? 0.4479 0.4194 0.4069 -0.0097 0.0343  -0.0387 80  TRP A CD1 
631  C CD2 . TRP A 81  ? 0.4514 0.4182 0.4053 -0.0098 0.0369  -0.0374 80  TRP A CD2 
632  N NE1 . TRP A 81  ? 0.4419 0.4165 0.4033 -0.0073 0.0309  -0.0361 80  TRP A NE1 
633  C CE2 . TRP A 81  ? 0.4445 0.4164 0.4031 -0.0073 0.0326  -0.0355 80  TRP A CE2 
634  C CE3 . TRP A 81  ? 0.4556 0.4181 0.4056 -0.0105 0.0396  -0.0373 80  TRP A CE3 
635  C CZ2 . TRP A 81  ? 0.4427 0.4160 0.4022 -0.0058 0.0312  -0.0338 80  TRP A CZ2 
636  C CZ3 . TRP A 81  ? 0.4483 0.4118 0.3996 -0.0087 0.0382  -0.0356 80  TRP A CZ3 
637  C CH2 . TRP A 81  ? 0.4425 0.4116 0.3985 -0.0065 0.0341  -0.0340 80  TRP A CH2 
638  N N   . ALA A 82  ? 0.4900 0.4392 0.4143 -0.0172 0.0424  -0.0364 81  ALA A N   
639  C CA  . ALA A 82  ? 0.5096 0.4545 0.4249 -0.0161 0.0396  -0.0313 81  ALA A CA  
640  C C   . ALA A 82  ? 0.5230 0.4683 0.4329 -0.0175 0.0373  -0.0301 81  ALA A C   
641  O O   . ALA A 82  ? 0.5305 0.4769 0.4383 -0.0152 0.0329  -0.0259 81  ALA A O   
642  C CB  . ALA A 82  ? 0.5142 0.4510 0.4208 -0.0184 0.0428  -0.0303 81  ALA A CB  
643  N N   . THR A 83  ? 0.5433 0.4879 0.4515 -0.0217 0.0406  -0.0341 82  THR A N   
644  C CA  . THR A 83  ? 0.5542 0.4990 0.4568 -0.0243 0.0394  -0.0341 82  THR A CA  
645  C C   . THR A 83  ? 0.5570 0.5083 0.4672 -0.0213 0.0355  -0.0339 82  THR A C   
646  O O   . THR A 83  ? 0.5609 0.5132 0.4665 -0.0214 0.0318  -0.0310 82  THR A O   
647  C CB  . THR A 83  ? 0.5606 0.5033 0.4610 -0.0296 0.0450  -0.0399 82  THR A CB  
648  O OG1 . THR A 83  ? 0.5720 0.5082 0.4641 -0.0331 0.0488  -0.0400 82  THR A OG1 
649  C CG2 . THR A 83  ? 0.5656 0.5081 0.4596 -0.0331 0.0443  -0.0405 82  THR A CG2 
650  N N   . GLN A 84  ? 0.5630 0.5189 0.4846 -0.0191 0.0360  -0.0366 83  GLN A N   
651  C CA  . GLN A 84  ? 0.5704 0.5320 0.4995 -0.0166 0.0324  -0.0363 83  GLN A CA  
652  C C   . GLN A 84  ? 0.5612 0.5256 0.4910 -0.0126 0.0275  -0.0314 83  GLN A C   
653  O O   . GLN A 84  ? 0.5691 0.5373 0.5005 -0.0115 0.0239  -0.0299 83  GLN A O   
654  C CB  . GLN A 84  ? 0.5798 0.5453 0.5209 -0.0154 0.0339  -0.0399 83  GLN A CB  
655  C CG  . GLN A 84  ? 0.6054 0.5700 0.5496 -0.0185 0.0383  -0.0453 83  GLN A CG  
656  C CD  . GLN A 84  ? 0.6141 0.5830 0.5718 -0.0167 0.0389  -0.0480 83  GLN A CD  
657  O OE1 . GLN A 84  ? 0.6303 0.6026 0.5937 -0.0139 0.0363  -0.0459 83  GLN A OE1 
658  N NE2 . GLN A 84  ? 0.6183 0.5873 0.5815 -0.0185 0.0424  -0.0527 83  GLN A NE2 
659  N N   . SER A 85  ? 0.5501 0.5128 0.4794 -0.0107 0.0277  -0.0293 84  SER A N   
660  C CA  . SER A 85  ? 0.5417 0.5070 0.4728 -0.0070 0.0240  -0.0254 84  SER A CA  
661  C C   . SER A 85  ? 0.5404 0.5024 0.4634 -0.0063 0.0219  -0.0209 84  SER A C   
662  O O   . SER A 85  ? 0.5360 0.5006 0.4610 -0.0030 0.0187  -0.0177 84  SER A O   
663  C CB  . SER A 85  ? 0.5343 0.4997 0.4705 -0.0053 0.0256  -0.0261 84  SER A CB  
664  O OG  . SER A 85  ? 0.5300 0.4993 0.4744 -0.0058 0.0265  -0.0295 84  SER A OG  
665  N N   . GLY A 86  ? 0.5414 0.4980 0.4556 -0.0095 0.0236  -0.0206 85  GLY A N   
666  C CA  . GLY A 86  ? 0.5405 0.4934 0.4466 -0.0091 0.0211  -0.0157 85  GLY A CA  
667  C C   . GLY A 86  ? 0.5368 0.4853 0.4427 -0.0064 0.0219  -0.0131 85  GLY A C   
668  O O   . GLY A 86  ? 0.5420 0.4902 0.4469 -0.0035 0.0186  -0.0084 85  GLY A O   
669  N N   . PHE A 87  ? 0.5194 0.4648 0.4269 -0.0074 0.0263  -0.0163 86  PHE A N   
670  C CA  . PHE A 87  ? 0.5173 0.4574 0.4240 -0.0056 0.0279  -0.0145 86  PHE A CA  
671  C C   . PHE A 87  ? 0.5254 0.4568 0.4211 -0.0086 0.0294  -0.0123 86  PHE A C   
672  O O   . PHE A 87  ? 0.5364 0.4650 0.4272 -0.0132 0.0329  -0.0154 86  PHE A O   
673  C CB  . PHE A 87  ? 0.5076 0.4482 0.4202 -0.0060 0.0320  -0.0188 86  PHE A CB  
674  C CG  . PHE A 87  ? 0.4910 0.4397 0.4137 -0.0039 0.0306  -0.0210 86  PHE A CG  
675  C CD1 . PHE A 87  ? 0.4855 0.4388 0.4123 -0.0003 0.0267  -0.0184 86  PHE A CD1 
676  C CD2 . PHE A 87  ? 0.4863 0.4379 0.4146 -0.0057 0.0331  -0.0254 86  PHE A CD2 
677  C CE1 . PHE A 87  ? 0.4751 0.4353 0.4100 0.0008  0.0255  -0.0202 86  PHE A CE1 
678  C CE2 . PHE A 87  ? 0.4787 0.4373 0.4157 -0.0042 0.0314  -0.0267 86  PHE A CE2 
679  C CZ  . PHE A 87  ? 0.4725 0.4349 0.4121 -0.0012 0.0276  -0.0241 86  PHE A CZ  
680  N N   . THR A 88  ? 0.5264 0.4535 0.4184 -0.0061 0.0269  -0.0069 87  THR A N   
681  C CA  . THR A 88  ? 0.5404 0.4584 0.4213 -0.0088 0.0274  -0.0035 87  THR A CA  
682  C C   . THR A 88  ? 0.5476 0.4577 0.4278 -0.0076 0.0305  -0.0027 87  THR A C   
683  O O   . THR A 88  ? 0.5597 0.4610 0.4306 -0.0100 0.0313  0.0003  87  THR A O   
684  C CB  . THR A 88  ? 0.5492 0.4670 0.4257 -0.0072 0.0215  0.0030  87  THR A CB  
685  O OG1 . THR A 88  ? 0.5421 0.4633 0.4273 -0.0010 0.0184  0.0060  87  THR A OG1 
686  C CG2 . THR A 88  ? 0.5471 0.4713 0.4217 -0.0099 0.0189  0.0021  87  THR A CG2 
687  N N   . PHE A 89  ? 0.5366 0.4495 0.4259 -0.0045 0.0323  -0.0052 88  PHE A N   
688  C CA  . PHE A 89  ? 0.5374 0.4433 0.4269 -0.0037 0.0358  -0.0054 88  PHE A CA  
689  C C   . PHE A 89  ? 0.5291 0.4335 0.4172 -0.0085 0.0414  -0.0111 88  PHE A C   
690  O O   . PHE A 89  ? 0.5168 0.4274 0.4074 -0.0109 0.0422  -0.0150 88  PHE A O   
691  C CB  . PHE A 89  ? 0.5315 0.4413 0.4310 0.0014  0.0353  -0.0057 88  PHE A CB  
692  C CG  . PHE A 89  ? 0.5239 0.4443 0.4319 0.0019  0.0346  -0.0097 88  PHE A CG  
693  C CD1 . PHE A 89  ? 0.5189 0.4468 0.4311 0.0045  0.0300  -0.0080 88  PHE A CD1 
694  C CD2 . PHE A 89  ? 0.5207 0.4437 0.4326 -0.0005 0.0382  -0.0150 88  PHE A CD2 
695  C CE1 . PHE A 89  ? 0.5078 0.4446 0.4271 0.0046  0.0292  -0.0113 88  PHE A CE1 
696  C CE2 . PHE A 89  ? 0.5085 0.4408 0.4281 -0.0002 0.0370  -0.0179 88  PHE A CE2 
697  C CZ  . PHE A 89  ? 0.5033 0.4420 0.4262 0.0024  0.0326  -0.0160 88  PHE A CZ  
698  N N   . PRO A 90  ? 0.5264 0.4227 0.4112 -0.0098 0.0454  -0.0115 89  PRO A N   
699  C CA  . PRO A 90  ? 0.5221 0.4178 0.4061 -0.0147 0.0507  -0.0169 89  PRO A CA  
700  C C   . PRO A 90  ? 0.5064 0.4103 0.4010 -0.0141 0.0523  -0.0220 89  PRO A C   
701  O O   . PRO A 90  ? 0.5041 0.4088 0.4041 -0.0110 0.0520  -0.0218 89  PRO A O   
702  C CB  . PRO A 90  ? 0.5365 0.4206 0.4133 -0.0164 0.0541  -0.0154 89  PRO A CB  
703  C CG  . PRO A 90  ? 0.5449 0.4227 0.4171 -0.0129 0.0501  -0.0084 89  PRO A CG  
704  C CD  . PRO A 90  ? 0.5350 0.4217 0.4159 -0.0076 0.0453  -0.0069 89  PRO A CD  
705  N N   . LEU A 91  ? 0.4938 0.4037 0.3916 -0.0172 0.0538  -0.0265 90  LEU A N   
706  C CA  . LEU A 91  ? 0.4775 0.3950 0.3849 -0.0175 0.0552  -0.0311 90  LEU A CA  
707  C C   . LEU A 91  ? 0.4731 0.3871 0.3781 -0.0224 0.0607  -0.0350 90  LEU A C   
708  O O   . LEU A 91  ? 0.4752 0.3887 0.3770 -0.0262 0.0629  -0.0371 90  LEU A O   
709  C CB  . LEU A 91  ? 0.4732 0.4003 0.3876 -0.0171 0.0528  -0.0332 90  LEU A CB  
710  C CG  . LEU A 91  ? 0.4766 0.4092 0.3953 -0.0127 0.0475  -0.0304 90  LEU A CG  
711  C CD1 . LEU A 91  ? 0.4899 0.4183 0.4013 -0.0112 0.0447  -0.0257 90  LEU A CD1 
712  C CD2 . LEU A 91  ? 0.4748 0.4160 0.4009 -0.0131 0.0460  -0.0332 90  LEU A CD2 
713  N N   . LEU A 92  ? 0.4629 0.3746 0.3694 -0.0229 0.0632  -0.0362 91  LEU A N   
714  C CA  . LEU A 92  ? 0.4588 0.3668 0.3627 -0.0279 0.0686  -0.0398 91  LEU A CA  
715  C C   . LEU A 92  ? 0.4457 0.3633 0.3594 -0.0301 0.0699  -0.0450 91  LEU A C   
716  O O   . LEU A 92  ? 0.4375 0.3628 0.3596 -0.0276 0.0671  -0.0454 91  LEU A O   
717  C CB  . LEU A 92  ? 0.4620 0.3610 0.3612 -0.0279 0.0709  -0.0383 91  LEU A CB  
718  C CG  . LEU A 92  ? 0.4692 0.3585 0.3604 -0.0249 0.0690  -0.0324 91  LEU A CG  
719  C CD1 . LEU A 92  ? 0.4760 0.3555 0.3634 -0.0250 0.0720  -0.0315 91  LEU A CD1 
720  C CD2 . LEU A 92  ? 0.4784 0.3624 0.3602 -0.0275 0.0690  -0.0303 91  LEU A CD2 
721  N N   . SER A 93  ? 0.4470 0.3642 0.3597 -0.0350 0.0743  -0.0488 92  SER A N   
722  C CA  . SER A 93  ? 0.4427 0.3694 0.3656 -0.0372 0.0757  -0.0537 92  SER A CA  
723  C C   . SER A 93  ? 0.4434 0.3692 0.3673 -0.0405 0.0791  -0.0563 92  SER A C   
724  O O   . SER A 93  ? 0.4520 0.3708 0.3690 -0.0446 0.0838  -0.0576 92  SER A O   
725  C CB  . SER A 93  ? 0.4434 0.3722 0.3670 -0.0407 0.0787  -0.0571 92  SER A CB  
726  O OG  . SER A 93  ? 0.4394 0.3703 0.3634 -0.0381 0.0756  -0.0555 92  SER A OG  
727  N N   . ASP A 94  ? 0.4421 0.3750 0.3740 -0.0392 0.0768  -0.0570 93  ASP A N   
728  C CA  . ASP A 94  ? 0.4472 0.3812 0.3811 -0.0427 0.0794  -0.0597 93  ASP A CA  
729  C C   . ASP A 94  ? 0.4360 0.3815 0.3810 -0.0451 0.0794  -0.0638 93  ASP A C   
730  O O   . ASP A 94  ? 0.4358 0.3895 0.3888 -0.0457 0.0773  -0.0650 93  ASP A O   
731  C CB  . ASP A 94  ? 0.4505 0.3857 0.3861 -0.0399 0.0764  -0.0578 93  ASP A CB  
732  C CG  . ASP A 94  ? 0.4590 0.3937 0.3945 -0.0440 0.0793  -0.0605 93  ASP A CG  
733  O OD1 . ASP A 94  ? 0.4727 0.4043 0.4054 -0.0487 0.0840  -0.0633 93  ASP A OD1 
734  O OD2 . ASP A 94  ? 0.4571 0.3944 0.3948 -0.0428 0.0772  -0.0599 93  ASP A OD2 
735  N N   . PHE A 95  ? 0.4338 0.3798 0.3793 -0.0469 0.0819  -0.0659 94  PHE A N   
736  C CA  . PHE A 95  ? 0.4189 0.3757 0.3764 -0.0482 0.0819  -0.0696 94  PHE A CA  
737  C C   . PHE A 95  ? 0.4247 0.3858 0.3871 -0.0536 0.0862  -0.0743 94  PHE A C   
738  O O   . PHE A 95  ? 0.4133 0.3854 0.3881 -0.0540 0.0842  -0.0763 94  PHE A O   
739  C CB  . PHE A 95  ? 0.4177 0.3731 0.3739 -0.0476 0.0831  -0.0702 94  PHE A CB  
740  C CG  . PHE A 95  ? 0.4080 0.3734 0.3771 -0.0487 0.0841  -0.0745 94  PHE A CG  
741  C CD1 . PHE A 95  ? 0.3937 0.3685 0.3750 -0.0449 0.0792  -0.0739 94  PHE A CD1 
742  C CD2 . PHE A 95  ? 0.4111 0.3762 0.3803 -0.0535 0.0902  -0.0792 94  PHE A CD2 
743  C CE1 . PHE A 95  ? 0.3874 0.3710 0.3819 -0.0453 0.0800  -0.0778 94  PHE A CE1 
744  C CE2 . PHE A 95  ? 0.4048 0.3794 0.3875 -0.0542 0.0915  -0.0836 94  PHE A CE2 
745  C CZ  . PHE A 95  ? 0.3930 0.3768 0.3888 -0.0498 0.0863  -0.0828 94  PHE A CZ  
746  N N   . TRP A 96  ? 0.4366 0.3892 0.3895 -0.0580 0.0918  -0.0759 95  TRP A N   
747  C CA  . TRP A 96  ? 0.4428 0.3992 0.3996 -0.0638 0.0964  -0.0807 95  TRP A CA  
748  C C   . TRP A 96  ? 0.4629 0.4075 0.4065 -0.0681 0.1012  -0.0807 95  TRP A C   
749  O O   . TRP A 96  ? 0.4771 0.4114 0.4097 -0.0693 0.1043  -0.0796 95  TRP A O   
750  C CB  . TRP A 96  ? 0.4408 0.4019 0.4034 -0.0659 0.0998  -0.0848 95  TRP A CB  
751  C CG  . TRP A 96  ? 0.4379 0.4069 0.4092 -0.0711 0.1036  -0.0901 95  TRP A CG  
752  C CD1 . TRP A 96  ? 0.4453 0.4110 0.4124 -0.0771 0.1105  -0.0942 95  TRP A CD1 
753  C CD2 . TRP A 96  ? 0.4259 0.4079 0.4118 -0.0712 0.1007  -0.0918 95  TRP A CD2 
754  N NE1 . TRP A 96  ? 0.4409 0.4174 0.4200 -0.0807 0.1122  -0.0987 95  TRP A NE1 
755  C CE2 . TRP A 96  ? 0.4291 0.4158 0.4199 -0.0771 0.1060  -0.0971 95  TRP A CE2 
756  C CE3 . TRP A 96  ? 0.4147 0.4050 0.4097 -0.0673 0.0939  -0.0891 95  TRP A CE3 
757  C CZ2 . TRP A 96  ? 0.4218 0.4219 0.4272 -0.0789 0.1043  -0.0997 95  TRP A CZ2 
758  C CZ3 . TRP A 96  ? 0.4101 0.4129 0.4185 -0.0693 0.0920  -0.0913 95  TRP A CZ3 
759  C CH2 . TRP A 96  ? 0.4133 0.4212 0.4272 -0.0749 0.0971  -0.0965 95  TRP A CH2 
760  N N   . PRO A 97  ? 0.4736 0.4188 0.4175 -0.0706 0.1018  -0.0816 96  PRO A N   
761  C CA  . PRO A 97  ? 0.4678 0.4251 0.4234 -0.0701 0.0977  -0.0824 96  PRO A CA  
762  C C   . PRO A 97  ? 0.4633 0.4239 0.4225 -0.0638 0.0910  -0.0783 96  PRO A C   
763  O O   . PRO A 97  ? 0.4738 0.4256 0.4245 -0.0602 0.0898  -0.0745 96  PRO A O   
764  C CB  . PRO A 97  ? 0.4752 0.4281 0.4252 -0.0748 0.1006  -0.0837 96  PRO A CB  
765  C CG  . PRO A 97  ? 0.4870 0.4242 0.4223 -0.0767 0.1058  -0.0829 96  PRO A CG  
766  C CD  . PRO A 97  ? 0.4854 0.4202 0.4185 -0.0759 0.1073  -0.0828 96  PRO A CD  
767  N N   . HIS A 98  ? 0.4557 0.4290 0.4275 -0.0628 0.0866  -0.0788 97  HIS A N   
768  C CA  . HIS A 98  ? 0.4482 0.4260 0.4245 -0.0575 0.0801  -0.0752 97  HIS A CA  
769  C C   . HIS A 98  ? 0.4483 0.4221 0.4184 -0.0569 0.0782  -0.0727 97  HIS A C   
770  O O   . HIS A 98  ? 0.4435 0.4220 0.4160 -0.0605 0.0777  -0.0741 97  HIS A O   
771  C CB  . HIS A 98  ? 0.4439 0.4362 0.4357 -0.0573 0.0759  -0.0762 97  HIS A CB  
772  C CG  . HIS A 98  ? 0.4412 0.4381 0.4380 -0.0522 0.0692  -0.0725 97  HIS A CG  
773  N ND1 . HIS A 98  ? 0.4421 0.4426 0.4459 -0.0483 0.0670  -0.0718 97  HIS A ND1 
774  C CD2 . HIS A 98  ? 0.4420 0.4401 0.4373 -0.0507 0.0647  -0.0694 97  HIS A CD2 
775  C CE1 . HIS A 98  ? 0.4354 0.4390 0.4420 -0.0446 0.0611  -0.0682 97  HIS A CE1 
776  N NE2 . HIS A 98  ? 0.4379 0.4403 0.4393 -0.0461 0.0596  -0.0667 97  HIS A NE2 
777  N N   . GLY A 99  ? 0.4482 0.4137 0.4106 -0.0527 0.0772  -0.0693 98  GLY A N   
778  C CA  . GLY A 99  ? 0.4533 0.4148 0.4106 -0.0514 0.0757  -0.0671 98  GLY A CA  
779  C C   . GLY A 99  ? 0.4615 0.4137 0.4099 -0.0552 0.0808  -0.0686 98  GLY A C   
780  O O   . GLY A 99  ? 0.4732 0.4237 0.4191 -0.0553 0.0803  -0.0681 98  GLY A O   
781  N N   . ALA A 100 ? 0.4665 0.4121 0.4098 -0.0584 0.0860  -0.0706 99  ALA A N   
782  C CA  . ALA A 100 ? 0.4719 0.4076 0.4064 -0.0624 0.0913  -0.0722 99  ALA A CA  
783  C C   . ALA A 100 ? 0.4769 0.4016 0.4036 -0.0588 0.0916  -0.0691 99  ALA A C   
784  O O   . ALA A 100 ? 0.4779 0.3996 0.4021 -0.0606 0.0932  -0.0702 99  ALA A O   
785  C CB  . ALA A 100 ? 0.4806 0.4097 0.4098 -0.0661 0.0966  -0.0741 99  ALA A CB  
786  N N   . VAL A 101 ? 0.4783 0.3971 0.4013 -0.0538 0.0902  -0.0654 100 VAL A N   
787  C CA  . VAL A 101 ? 0.4817 0.3906 0.3987 -0.0495 0.0901  -0.0619 100 VAL A CA  
788  C C   . VAL A 101 ? 0.4719 0.3873 0.3943 -0.0469 0.0865  -0.0615 100 VAL A C   
789  O O   . VAL A 101 ? 0.4729 0.3822 0.3921 -0.0465 0.0884  -0.0615 100 VAL A O   
790  C CB  . VAL A 101 ? 0.4829 0.3864 0.3960 -0.0448 0.0881  -0.0576 100 VAL A CB  
791  C CG1 . VAL A 101 ? 0.4867 0.3822 0.3962 -0.0397 0.0869  -0.0537 100 VAL A CG1 
792  C CG2 . VAL A 101 ? 0.4947 0.3900 0.4003 -0.0483 0.0923  -0.0581 100 VAL A CG2 
793  N N   . SER A 102 ? 0.4584 0.3859 0.3888 -0.0456 0.0816  -0.0612 101 SER A N   
794  C CA  . SER A 102 ? 0.4520 0.3865 0.3871 -0.0440 0.0779  -0.0607 101 SER A CA  
795  C C   . SER A 102 ? 0.4561 0.3926 0.3912 -0.0494 0.0802  -0.0642 101 SER A C   
796  O O   . SER A 102 ? 0.4565 0.3921 0.3906 -0.0489 0.0801  -0.0642 101 SER A O   
797  C CB  . SER A 102 ? 0.4434 0.3900 0.3869 -0.0423 0.0723  -0.0597 101 SER A CB  
798  O OG  . SER A 102 ? 0.4426 0.3872 0.3856 -0.0377 0.0703  -0.0568 101 SER A OG  
799  N N   . GLN A 103 ? 0.4622 0.4019 0.3985 -0.0550 0.0824  -0.0674 102 GLN A N   
800  C CA  . GLN A 103 ? 0.4715 0.4136 0.4073 -0.0612 0.0846  -0.0710 102 GLN A CA  
801  C C   . GLN A 103 ? 0.4769 0.4055 0.4038 -0.0625 0.0907  -0.0723 102 GLN A C   
802  O O   . GLN A 103 ? 0.4825 0.4108 0.4077 -0.0656 0.0922  -0.0745 102 GLN A O   
803  C CB  . GLN A 103 ? 0.4870 0.4360 0.4268 -0.0668 0.0856  -0.0741 102 GLN A CB  
804  C CG  . GLN A 103 ? 0.4878 0.4509 0.4384 -0.0659 0.0798  -0.0732 102 GLN A CG  
805  C CD  . GLN A 103 ? 0.5045 0.4740 0.4604 -0.0706 0.0813  -0.0762 102 GLN A CD  
806  O OE1 . GLN A 103 ? 0.5244 0.4958 0.4795 -0.0768 0.0837  -0.0794 102 GLN A OE1 
807  N NE2 . GLN A 103 ? 0.5046 0.4778 0.4662 -0.0678 0.0800  -0.0756 102 GLN A NE2 
808  N N   . ALA A 104 ? 0.4767 0.3940 0.3979 -0.0604 0.0940  -0.0710 103 ALA A N   
809  C CA  . ALA A 104 ? 0.4834 0.3862 0.3964 -0.0609 0.0996  -0.0715 103 ALA A CA  
810  C C   . ALA A 104 ? 0.4823 0.3810 0.3951 -0.0559 0.0987  -0.0696 103 ALA A C   
811  O O   . ALA A 104 ? 0.4900 0.3805 0.3989 -0.0574 0.1031  -0.0715 103 ALA A O   
812  C CB  . ALA A 104 ? 0.4883 0.3801 0.3953 -0.0597 0.1023  -0.0695 103 ALA A CB  
813  N N   . TYR A 105 ? 0.4712 0.3756 0.3884 -0.0502 0.0934  -0.0661 104 TYR A N   
814  C CA  . TYR A 105 ? 0.4703 0.3730 0.3887 -0.0454 0.0923  -0.0644 104 TYR A CA  
815  C C   . TYR A 105 ? 0.4708 0.3840 0.3935 -0.0480 0.0901  -0.0667 104 TYR A C   
816  O O   . TYR A 105 ? 0.4698 0.3827 0.3937 -0.0453 0.0898  -0.0663 104 TYR A O   
817  C CB  . TYR A 105 ? 0.4606 0.3637 0.3809 -0.0383 0.0878  -0.0594 104 TYR A CB  
818  C CG  . TYR A 105 ? 0.4656 0.3558 0.3804 -0.0350 0.0900  -0.0563 104 TYR A CG  
819  C CD1 . TYR A 105 ? 0.4694 0.3553 0.3797 -0.0373 0.0915  -0.0559 104 TYR A CD1 
820  C CD2 . TYR A 105 ? 0.4688 0.3512 0.3829 -0.0297 0.0905  -0.0536 104 TYR A CD2 
821  C CE1 . TYR A 105 ? 0.4753 0.3490 0.3794 -0.0350 0.0931  -0.0526 104 TYR A CE1 
822  C CE2 . TYR A 105 ? 0.4740 0.3446 0.3832 -0.0266 0.0918  -0.0500 104 TYR A CE2 
823  C CZ  . TYR A 105 ? 0.4781 0.3441 0.3816 -0.0295 0.0929  -0.0493 104 TYR A CZ  
824  O OH  . TYR A 105 ? 0.4851 0.3389 0.3827 -0.0271 0.0937  -0.0452 104 TYR A OH  
825  N N   . GLY A 106 ? 0.4757 0.3983 0.4008 -0.0536 0.0887  -0.0691 105 GLY A N   
826  C CA  . GLY A 106 ? 0.4762 0.4091 0.4045 -0.0573 0.0861  -0.0709 105 GLY A CA  
827  C C   . GLY A 106 ? 0.4761 0.4181 0.4100 -0.0531 0.0796  -0.0676 105 GLY A C   
828  O O   . GLY A 106 ? 0.4800 0.4273 0.4149 -0.0545 0.0780  -0.0683 105 GLY A O   
829  N N   . VAL A 107 ? 0.4773 0.4211 0.4143 -0.0484 0.0763  -0.0644 106 VAL A N   
830  C CA  . VAL A 107 ? 0.4767 0.4282 0.4187 -0.0443 0.0702  -0.0612 106 VAL A CA  
831  C C   . VAL A 107 ? 0.4791 0.4402 0.4272 -0.0451 0.0657  -0.0603 106 VAL A C   
832  O O   . VAL A 107 ? 0.4807 0.4463 0.4329 -0.0411 0.0613  -0.0574 106 VAL A O   
833  C CB  . VAL A 107 ? 0.4790 0.4240 0.4197 -0.0372 0.0698  -0.0578 106 VAL A CB  
834  C CG1 . VAL A 107 ? 0.4885 0.4252 0.4256 -0.0356 0.0738  -0.0584 106 VAL A CG1 
835  C CG2 . VAL A 107 ? 0.4834 0.4222 0.4218 -0.0355 0.0713  -0.0565 106 VAL A CG2 
836  N N   . PHE A 108 ? 0.4908 0.4553 0.4403 -0.0503 0.0670  -0.0629 107 PHE A N   
837  C CA  . PHE A 108 ? 0.4981 0.4718 0.4551 -0.0510 0.0633  -0.0624 107 PHE A CA  
838  C C   . PHE A 108 ? 0.5077 0.4930 0.4703 -0.0543 0.0582  -0.0623 107 PHE A C   
839  O O   . PHE A 108 ? 0.5142 0.5011 0.4743 -0.0596 0.0594  -0.0644 107 PHE A O   
840  C CB  . PHE A 108 ? 0.4996 0.4713 0.4561 -0.0546 0.0673  -0.0653 107 PHE A CB  
841  C CG  . PHE A 108 ? 0.4956 0.4765 0.4610 -0.0549 0.0644  -0.0653 107 PHE A CG  
842  C CD1 . PHE A 108 ? 0.4902 0.4703 0.4582 -0.0501 0.0632  -0.0635 107 PHE A CD1 
843  C CD2 . PHE A 108 ? 0.4967 0.4870 0.4682 -0.0600 0.0630  -0.0674 107 PHE A CD2 
844  C CE1 . PHE A 108 ? 0.4866 0.4748 0.4637 -0.0502 0.0612  -0.0642 107 PHE A CE1 
845  C CE2 . PHE A 108 ? 0.4902 0.4892 0.4717 -0.0597 0.0604  -0.0675 107 PHE A CE2 
846  C CZ  . PHE A 108 ? 0.4878 0.4854 0.4723 -0.0547 0.0598  -0.0662 107 PHE A CZ  
847  N N   . ASN A 109 ? 0.5185 0.5115 0.4884 -0.0515 0.0526  -0.0596 108 ASN A N   
848  C CA  . ASN A 109 ? 0.5259 0.5299 0.5019 -0.0542 0.0468  -0.0584 108 ASN A CA  
849  C C   . ASN A 109 ? 0.5348 0.5465 0.5187 -0.0573 0.0456  -0.0597 108 ASN A C   
850  O O   . ASN A 109 ? 0.5246 0.5389 0.5155 -0.0541 0.0442  -0.0590 108 ASN A O   
851  C CB  . ASN A 109 ? 0.5216 0.5290 0.5016 -0.0493 0.0413  -0.0546 108 ASN A CB  
852  C CG  . ASN A 109 ? 0.5254 0.5433 0.5113 -0.0519 0.0347  -0.0525 108 ASN A CG  
853  O OD1 . ASN A 109 ? 0.5464 0.5710 0.5364 -0.0567 0.0332  -0.0534 108 ASN A OD1 
854  N ND2 . ASN A 109 ? 0.5224 0.5421 0.5092 -0.0490 0.0304  -0.0493 108 ASN A ND2 
855  N N   . GLU A 110 ? 0.5588 0.5743 0.5419 -0.0638 0.0463  -0.0619 109 GLU A N   
856  C CA  . GLU A 110 ? 0.5780 0.6018 0.5692 -0.0675 0.0453  -0.0635 109 GLU A CA  
857  C C   . GLU A 110 ? 0.5680 0.6039 0.5713 -0.0665 0.0376  -0.0604 109 GLU A C   
858  O O   . GLU A 110 ? 0.5693 0.6116 0.5820 -0.0671 0.0369  -0.0614 109 GLU A O   
859  C CB  . GLU A 110 ? 0.6054 0.6306 0.5920 -0.0755 0.0477  -0.0666 109 GLU A CB  
860  C CG  . GLU A 110 ? 0.6326 0.6468 0.6105 -0.0773 0.0560  -0.0704 109 GLU A CG  
861  C CD  . GLU A 110 ? 0.6549 0.6684 0.6371 -0.0767 0.0593  -0.0724 109 GLU A CD  
862  O OE1 . GLU A 110 ? 0.6698 0.6935 0.6631 -0.0765 0.0556  -0.0719 109 GLU A OE1 
863  O OE2 . GLU A 110 ? 0.6862 0.6889 0.6610 -0.0765 0.0657  -0.0745 109 GLU A OE2 
864  N N   . GLN A 111 ? 0.5670 0.6057 0.5704 -0.0650 0.0322  -0.0568 110 GLN A N   
865  C CA  . GLN A 111 ? 0.5676 0.6166 0.5822 -0.0638 0.0245  -0.0533 110 GLN A CA  
866  C C   . GLN A 111 ? 0.5414 0.5895 0.5638 -0.0569 0.0238  -0.0521 110 GLN A C   
867  O O   . GLN A 111 ? 0.5405 0.5958 0.5748 -0.0560 0.0213  -0.0518 110 GLN A O   
868  C CB  . GLN A 111 ? 0.5869 0.6385 0.5982 -0.0650 0.0188  -0.0495 110 GLN A CB  
869  C CG  . GLN A 111 ? 0.6110 0.6674 0.6175 -0.0731 0.0172  -0.0500 110 GLN A CG  
870  C CD  . GLN A 111 ? 0.6358 0.6836 0.6298 -0.0766 0.0245  -0.0541 110 GLN A CD  
871  O OE1 . GLN A 111 ? 0.6597 0.6980 0.6470 -0.0727 0.0289  -0.0550 110 GLN A OE1 
872  N NE2 . GLN A 111 ? 0.6485 0.6998 0.6395 -0.0842 0.0255  -0.0565 110 GLN A NE2 
873  N N   . ALA A 112 ? 0.5163 0.5557 0.5322 -0.0522 0.0262  -0.0515 111 ALA A N   
874  C CA  . ALA A 112 ? 0.4993 0.5369 0.5206 -0.0462 0.0259  -0.0505 111 ALA A CA  
875  C C   . ALA A 112 ? 0.4902 0.5214 0.5097 -0.0446 0.0325  -0.0540 111 ALA A C   
876  O O   . ALA A 112 ? 0.4932 0.5237 0.5177 -0.0406 0.0328  -0.0539 111 ALA A O   
877  C CB  . ALA A 112 ? 0.4954 0.5283 0.5110 -0.0424 0.0239  -0.0476 111 ALA A CB  
878  N N   . GLY A 113 ? 0.4808 0.5069 0.4928 -0.0480 0.0380  -0.0569 112 GLY A N   
879  C CA  . GLY A 113 ? 0.4697 0.4891 0.4786 -0.0475 0.0444  -0.0600 112 GLY A CA  
880  C C   . GLY A 113 ? 0.4636 0.4731 0.4645 -0.0429 0.0467  -0.0588 112 GLY A C   
881  O O   . GLY A 113 ? 0.4559 0.4616 0.4568 -0.0413 0.0499  -0.0602 112 GLY A O   
882  N N   . ILE A 114 ? 0.4567 0.4623 0.4509 -0.0413 0.0452  -0.0565 113 ILE A N   
883  C CA  . ILE A 114 ? 0.4593 0.4565 0.4465 -0.0370 0.0466  -0.0548 113 ILE A CA  
884  C C   . ILE A 114 ? 0.4600 0.4499 0.4375 -0.0378 0.0493  -0.0548 113 ILE A C   
885  O O   . ILE A 114 ? 0.4634 0.4555 0.4398 -0.0416 0.0494  -0.0558 113 ILE A O   
886  C CB  . ILE A 114 ? 0.4594 0.4601 0.4505 -0.0328 0.0412  -0.0516 113 ILE A CB  
887  C CG1 . ILE A 114 ? 0.4626 0.4688 0.4548 -0.0343 0.0367  -0.0497 113 ILE A CG1 
888  C CG2 . ILE A 114 ? 0.4610 0.4675 0.4622 -0.0315 0.0392  -0.0519 113 ILE A CG2 
889  C CD1 . ILE A 114 ? 0.4650 0.4751 0.4614 -0.0311 0.0312  -0.0464 113 ILE A CD1 
890  N N   . ALA A 115 ? 0.4540 0.4353 0.4248 -0.0344 0.0516  -0.0536 114 ALA A N   
891  C CA  . ALA A 115 ? 0.4578 0.4317 0.4209 -0.0342 0.0542  -0.0533 114 ALA A CA  
892  C C   . ALA A 115 ? 0.4570 0.4342 0.4209 -0.0320 0.0503  -0.0511 114 ALA A C   
893  O O   . ALA A 115 ? 0.4557 0.4366 0.4231 -0.0287 0.0463  -0.0487 114 ALA A O   
894  C CB  . ALA A 115 ? 0.4585 0.4220 0.4149 -0.0312 0.0576  -0.0523 114 ALA A CB  
895  N N   . ASN A 116 ? 0.4609 0.4370 0.4216 -0.0343 0.0518  -0.0521 115 ASN A N   
896  C CA  . ASN A 116 ? 0.4663 0.4448 0.4269 -0.0328 0.0491  -0.0505 115 ASN A CA  
897  C C   . ASN A 116 ? 0.4730 0.4446 0.4303 -0.0274 0.0503  -0.0486 115 ASN A C   
898  O O   . ASN A 116 ? 0.4794 0.4429 0.4329 -0.0258 0.0538  -0.0486 115 ASN A O   
899  C CB  . ASN A 116 ? 0.4741 0.4529 0.4316 -0.0375 0.0513  -0.0530 115 ASN A CB  
900  C CG  . ASN A 116 ? 0.4744 0.4621 0.4353 -0.0431 0.0484  -0.0540 115 ASN A CG  
901  O OD1 . ASN A 116 ? 0.4808 0.4680 0.4393 -0.0483 0.0514  -0.0569 115 ASN A OD1 
902  N ND2 . ASN A 116 ? 0.4677 0.4636 0.4342 -0.0424 0.0424  -0.0515 115 ASN A ND2 
903  N N   . ALA A 117 ? 0.4737 0.4485 0.4323 -0.0249 0.0472  -0.0466 116 ALA A N   
904  C CA  . ALA A 117 ? 0.4776 0.4473 0.4343 -0.0198 0.0477  -0.0445 116 ALA A CA  
905  C C   . ALA A 117 ? 0.4816 0.4439 0.4344 -0.0196 0.0527  -0.0461 116 ALA A C   
906  O O   . ALA A 117 ? 0.4863 0.4502 0.4395 -0.0197 0.0531  -0.0468 116 ALA A O   
907  C CB  . ALA A 117 ? 0.4759 0.4520 0.4357 -0.0176 0.0431  -0.0423 116 ALA A CB  
908  N N   . GLY A 118 ? 0.4720 0.4260 0.4211 -0.0196 0.0568  -0.0468 117 GLY A N   
909  C CA  . GLY A 118 ? 0.4703 0.4156 0.4160 -0.0193 0.0619  -0.0483 117 GLY A CA  
910  C C   . GLY A 118 ? 0.4608 0.3977 0.4045 -0.0139 0.0627  -0.0452 117 GLY A C   
911  O O   . GLY A 118 ? 0.4567 0.3913 0.3986 -0.0128 0.0615  -0.0431 117 GLY A O   
912  N N   . THR A 119 ? 0.4518 0.3845 0.3962 -0.0107 0.0647  -0.0448 118 THR A N   
913  C CA  . THR A 119 ? 0.4486 0.3734 0.3918 -0.0054 0.0649  -0.0413 118 THR A CA  
914  C C   . THR A 119 ? 0.4458 0.3600 0.3870 -0.0051 0.0707  -0.0428 118 THR A C   
915  O O   . THR A 119 ? 0.4437 0.3581 0.3866 -0.0070 0.0741  -0.0463 118 THR A O   
916  C CB  . THR A 119 ? 0.4460 0.3756 0.3940 -0.0003 0.0613  -0.0385 118 THR A CB  
917  O OG1 . THR A 119 ? 0.4349 0.3736 0.3845 -0.0006 0.0561  -0.0371 118 THR A OG1 
918  C CG2 . THR A 119 ? 0.4517 0.3737 0.3990 0.0052  0.0608  -0.0342 118 THR A CG2 
919  N N   . PHE A 120 ? 0.4478 0.3523 0.3851 -0.0032 0.0719  -0.0401 119 PHE A N   
920  C CA  . PHE A 120 ? 0.4576 0.3501 0.3927 -0.0026 0.0772  -0.0408 119 PHE A CA  
921  C C   . PHE A 120 ? 0.4652 0.3502 0.4003 0.0035  0.0756  -0.0354 119 PHE A C   
922  O O   . PHE A 120 ? 0.4696 0.3570 0.4035 0.0056  0.0708  -0.0313 119 PHE A O   
923  C CB  . PHE A 120 ? 0.4572 0.3430 0.3857 -0.0079 0.0809  -0.0429 119 PHE A CB  
924  C CG  . PHE A 120 ? 0.4516 0.3446 0.3801 -0.0144 0.0823  -0.0479 119 PHE A CG  
925  C CD1 . PHE A 120 ? 0.4555 0.3459 0.3836 -0.0182 0.0874  -0.0526 119 PHE A CD1 
926  C CD2 . PHE A 120 ? 0.4423 0.3445 0.3712 -0.0170 0.0785  -0.0480 119 PHE A CD2 
927  C CE1 . PHE A 120 ? 0.4512 0.3487 0.3789 -0.0247 0.0881  -0.0568 119 PHE A CE1 
928  C CE2 . PHE A 120 ? 0.4377 0.3471 0.3675 -0.0229 0.0792  -0.0520 119 PHE A CE2 
929  C CZ  . PHE A 120 ? 0.4430 0.3502 0.3719 -0.0269 0.0837  -0.0562 119 PHE A CZ  
930  N N   . VAL A 121 ? 0.4762 0.3520 0.4129 0.0063  0.0795  -0.0355 120 VAL A N   
931  C CA  . VAL A 121 ? 0.4886 0.3556 0.4254 0.0120  0.0781  -0.0299 120 VAL A CA  
932  C C   . VAL A 121 ? 0.5032 0.3557 0.4349 0.0101  0.0838  -0.0308 120 VAL A C   
933  O O   . VAL A 121 ? 0.5048 0.3535 0.4384 0.0084  0.0895  -0.0354 120 VAL A O   
934  C CB  . VAL A 121 ? 0.4908 0.3600 0.4366 0.0184  0.0771  -0.0283 120 VAL A CB  
935  C CG1 . VAL A 121 ? 0.5055 0.3646 0.4519 0.0242  0.0755  -0.0220 120 VAL A CG1 
936  C CG2 . VAL A 121 ? 0.4781 0.3614 0.4285 0.0198  0.0715  -0.0274 120 VAL A CG2 
937  N N   . VAL A 122 ? 0.5134 0.3580 0.4380 0.0096  0.0826  -0.0267 121 VAL A N   
938  C CA  . VAL A 122 ? 0.5298 0.3597 0.4484 0.0076  0.0875  -0.0267 121 VAL A CA  
939  C C   . VAL A 122 ? 0.5423 0.3620 0.4621 0.0141  0.0856  -0.0201 121 VAL A C   
940  O O   . VAL A 122 ? 0.5412 0.3635 0.4601 0.0171  0.0796  -0.0143 121 VAL A O   
941  C CB  . VAL A 122 ? 0.5325 0.3602 0.4413 0.0015  0.0876  -0.0267 121 VAL A CB  
942  C CG1 . VAL A 122 ? 0.5499 0.3620 0.4518 -0.0014 0.0933  -0.0272 121 VAL A CG1 
943  C CG2 . VAL A 122 ? 0.5183 0.3581 0.4277 -0.0041 0.0881  -0.0324 121 VAL A CG2 
944  N N   . ASP A 123 ? 0.5566 0.3648 0.4787 0.0161  0.0905  -0.0208 122 ASP A N   
945  C CA  . ASP A 123 ? 0.5722 0.3701 0.4968 0.0228  0.0885  -0.0140 122 ASP A CA  
946  C C   . ASP A 123 ? 0.5897 0.3741 0.5031 0.0202  0.0885  -0.0094 122 ASP A C   
947  O O   . ASP A 123 ? 0.5830 0.3671 0.4875 0.0134  0.0903  -0.0120 122 ASP A O   
948  C CB  . ASP A 123 ? 0.5817 0.3730 0.5153 0.0269  0.0938  -0.0166 122 ASP A CB  
949  C CG  . ASP A 123 ? 0.5966 0.3757 0.5252 0.0219  0.1020  -0.0217 122 ASP A CG  
950  O OD1 . ASP A 123 ? 0.6089 0.3847 0.5271 0.0152  0.1036  -0.0231 122 ASP A OD1 
951  O OD2 . ASP A 123 ? 0.6073 0.3800 0.5427 0.0246  0.1072  -0.0245 122 ASP A OD2 
952  N N   . ARG A 124 ? 0.6101 0.3835 0.5245 0.0256  0.0865  -0.0026 123 ARG A N   
953  C CA  . ARG A 124 ? 0.6330 0.3927 0.5363 0.0233  0.0857  0.0030  123 ARG A CA  
954  C C   . ARG A 124 ? 0.6347 0.3815 0.5302 0.0172  0.0934  -0.0013 123 ARG A C   
955  O O   . ARG A 124 ? 0.6420 0.3803 0.5261 0.0125  0.0935  0.0014  123 ARG A O   
956  C CB  . ARG A 124 ? 0.6629 0.4136 0.5698 0.0307  0.0811  0.0119  123 ARG A CB  
957  C CG  . ARG A 124 ? 0.6727 0.4360 0.5853 0.0357  0.0728  0.0170  123 ARG A CG  
958  C CD  . ARG A 124 ? 0.7058 0.4608 0.6213 0.0425  0.0673  0.0268  123 ARG A CD  
959  N NE  . ARG A 124 ? 0.7169 0.4855 0.6406 0.0476  0.0599  0.0306  123 ARG A NE  
960  C CZ  . ARG A 124 ? 0.7273 0.5039 0.6659 0.0541  0.0596  0.0291  123 ARG A CZ  
961  N NH1 . ARG A 124 ? 0.7348 0.5071 0.6821 0.0563  0.0666  0.0236  123 ARG A NH1 
962  N NH2 . ARG A 124 ? 0.7310 0.5202 0.6758 0.0579  0.0526  0.0327  123 ARG A NH2 
963  N N   . SER A 125 ? 0.6271 0.3725 0.5284 0.0167  0.1000  -0.0081 124 SER A N   
964  C CA  . SER A 125 ? 0.6311 0.3650 0.5255 0.0104  0.1078  -0.0130 124 SER A CA  
965  C C   . SER A 125 ? 0.6142 0.3578 0.5028 0.0017  0.1102  -0.0199 124 SER A C   
966  O O   . SER A 125 ? 0.6254 0.3609 0.5069 -0.0048 0.1160  -0.0238 124 SER A O   
967  C CB  . SER A 125 ? 0.6376 0.3652 0.5406 0.0131  0.1143  -0.0176 124 SER A CB  
968  O OG  . SER A 125 ? 0.6508 0.3683 0.5605 0.0214  0.1126  -0.0114 124 SER A OG  
969  N N   . GLY A 126 ? 0.5887 0.3494 0.4808 0.0015  0.1058  -0.0214 125 GLY A N   
970  C CA  . GLY A 126 ? 0.5712 0.3426 0.4597 -0.0059 0.1071  -0.0274 125 GLY A CA  
971  C C   . GLY A 126 ? 0.5568 0.3369 0.4519 -0.0080 0.1109  -0.0350 125 GLY A C   
972  O O   . GLY A 126 ? 0.5495 0.3364 0.4418 -0.0148 0.1130  -0.0403 125 GLY A O   
973  N N   . ILE A 127 ? 0.5501 0.3303 0.4540 -0.0025 0.1117  -0.0354 126 ILE A N   
974  C CA  . ILE A 127 ? 0.5397 0.3275 0.4495 -0.0046 0.1155  -0.0425 126 ILE A CA  
975  C C   . ILE A 127 ? 0.5188 0.3235 0.4357 -0.0018 0.1099  -0.0424 126 ILE A C   
976  O O   . ILE A 127 ? 0.5099 0.3173 0.4312 0.0047  0.1046  -0.0369 126 ILE A O   
977  C CB  . ILE A 127 ? 0.5499 0.3269 0.4654 -0.0008 0.1211  -0.0442 126 ILE A CB  
978  C CG1 . ILE A 127 ? 0.5706 0.3296 0.4789 -0.0040 0.1274  -0.0450 126 ILE A CG1 
979  C CG2 . ILE A 127 ? 0.5419 0.3275 0.4632 -0.0031 0.1249  -0.0517 126 ILE A CG2 
980  C CD1 . ILE A 127 ? 0.5715 0.3311 0.4724 -0.0139 0.1325  -0.0518 126 ILE A CD1 
981  N N   . ILE A 128 ? 0.5109 0.3267 0.4287 -0.0070 0.1110  -0.0482 127 ILE A N   
982  C CA  . ILE A 128 ? 0.5022 0.3336 0.4262 -0.0053 0.1062  -0.0486 127 ILE A CA  
983  C C   . ILE A 128 ? 0.5104 0.3416 0.4430 -0.0002 0.1082  -0.0497 127 ILE A C   
984  O O   . ILE A 128 ? 0.5164 0.3420 0.4501 -0.0023 0.1147  -0.0548 127 ILE A O   
985  C CB  . ILE A 128 ? 0.4903 0.3329 0.4126 -0.0127 0.1066  -0.0541 127 ILE A CB  
986  C CG1 . ILE A 128 ? 0.4889 0.3330 0.4046 -0.0171 0.1045  -0.0529 127 ILE A CG1 
987  C CG2 . ILE A 128 ? 0.4765 0.3340 0.4051 -0.0111 0.1020  -0.0544 127 ILE A CG2 
988  C CD1 . ILE A 128 ? 0.4825 0.3376 0.3974 -0.0243 0.1044  -0.0577 127 ILE A CD1 
989  N N   . ARG A 129 ? 0.5155 0.3527 0.4543 0.0064  0.1028  -0.0452 128 ARG A N   
990  C CA  . ARG A 129 ? 0.5313 0.3701 0.4799 0.0119  0.1040  -0.0458 128 ARG A CA  
991  C C   . ARG A 129 ? 0.5226 0.3774 0.4761 0.0111  0.1010  -0.0482 128 ARG A C   
992  O O   . ARG A 129 ? 0.5211 0.3790 0.4821 0.0134  0.1033  -0.0508 128 ARG A O   
993  C CB  . ARG A 129 ? 0.5441 0.3779 0.4972 0.0202  0.0999  -0.0385 128 ARG A CB  
994  C CG  . ARG A 129 ? 0.5679 0.3854 0.5158 0.0215  0.1018  -0.0347 128 ARG A CG  
995  C CD  . ARG A 129 ? 0.5905 0.3953 0.5408 0.0215  0.1100  -0.0388 128 ARG A CD  
996  N NE  . ARG A 129 ? 0.6066 0.4112 0.5691 0.0288  0.1111  -0.0383 128 ARG A NE  
997  C CZ  . ARG A 129 ? 0.6293 0.4215 0.5968 0.0318  0.1172  -0.0398 128 ARG A CZ  
998  N NH1 . ARG A 129 ? 0.6539 0.4317 0.6144 0.0280  0.1229  -0.0417 128 ARG A NH1 
999  N NH2 . ARG A 129 ? 0.6342 0.4282 0.6144 0.0387  0.1178  -0.0395 128 ARG A NH2 
1000 N N   . PHE A 130 ? 0.5240 0.3884 0.4735 0.0078  0.0959  -0.0471 129 PHE A N   
1001 C CA  . PHE A 130 ? 0.5162 0.3950 0.4691 0.0065  0.0924  -0.0487 129 PHE A CA  
1002 C C   . PHE A 130 ? 0.5151 0.4002 0.4618 -0.0003 0.0906  -0.0505 129 PHE A C   
1003 O O   . PHE A 130 ? 0.5151 0.3971 0.4566 -0.0013 0.0886  -0.0478 129 PHE A O   
1004 C CB  . PHE A 130 ? 0.5069 0.3920 0.4647 0.0128  0.0858  -0.0431 129 PHE A CB  
1005 C CG  . PHE A 130 ? 0.4953 0.3948 0.4560 0.0113  0.0817  -0.0440 129 PHE A CG  
1006 C CD1 . PHE A 130 ? 0.4918 0.3974 0.4590 0.0122  0.0833  -0.0470 129 PHE A CD1 
1007 C CD2 . PHE A 130 ? 0.4870 0.3935 0.4438 0.0089  0.0764  -0.0421 129 PHE A CD2 
1008 C CE1 . PHE A 130 ? 0.4824 0.4006 0.4515 0.0104  0.0795  -0.0476 129 PHE A CE1 
1009 C CE2 . PHE A 130 ? 0.4778 0.3965 0.4371 0.0076  0.0725  -0.0427 129 PHE A CE2 
1010 C CZ  . PHE A 130 ? 0.4732 0.3976 0.4382 0.0082  0.0739  -0.0452 129 PHE A CZ  
1011 N N   . ALA A 131 ? 0.5289 0.4227 0.4762 -0.0053 0.0914  -0.0550 130 ALA A N   
1012 C CA  . ALA A 131 ? 0.5432 0.4443 0.4863 -0.0117 0.0891  -0.0566 130 ALA A CA  
1013 C C   . ALA A 131 ? 0.5577 0.4714 0.5041 -0.0139 0.0864  -0.0584 130 ALA A C   
1014 O O   . ALA A 131 ? 0.5596 0.4743 0.5073 -0.0162 0.0902  -0.0625 130 ALA A O   
1015 C CB  . ALA A 131 ? 0.5483 0.4433 0.4860 -0.0182 0.0947  -0.0612 130 ALA A CB  
1016 N N   . GLU A 132 ? 0.5865 0.5090 0.5337 -0.0133 0.0800  -0.0553 131 GLU A N   
1017 C CA  . GLU A 132 ? 0.6243 0.5584 0.5743 -0.0152 0.0764  -0.0560 131 GLU A CA  
1018 C C   . GLU A 132 ? 0.6497 0.5913 0.5984 -0.0180 0.0710  -0.0543 131 GLU A C   
1019 O O   . GLU A 132 ? 0.6504 0.5906 0.5987 -0.0151 0.0681  -0.0509 131 GLU A O   
1020 C CB  . GLU A 132 ? 0.6354 0.5725 0.5908 -0.0088 0.0735  -0.0528 131 GLU A CB  
1021 C CG  . GLU A 132 ? 0.6390 0.5877 0.5970 -0.0100 0.0690  -0.0524 131 GLU A CG  
1022 C CD  . GLU A 132 ? 0.6413 0.5931 0.6043 -0.0037 0.0655  -0.0487 131 GLU A CD  
1023 O OE1 . GLU A 132 ? 0.6312 0.5869 0.5942 -0.0019 0.0600  -0.0450 131 GLU A OE1 
1024 O OE2 . GLU A 132 ? 0.6535 0.6036 0.6207 -0.0005 0.0684  -0.0496 131 GLU A OE2 
1025 N N   . MET A 133 ? 0.6946 0.6437 0.6426 -0.0239 0.0699  -0.0567 132 MET A N   
1026 C CA  . MET A 133 ? 0.7405 0.6972 0.6889 -0.0262 0.0645  -0.0549 132 MET A CA  
1027 C C   . MET A 133 ? 0.7751 0.7412 0.7266 -0.0260 0.0596  -0.0534 132 MET A C   
1028 O O   . MET A 133 ? 0.7829 0.7523 0.7341 -0.0291 0.0608  -0.0557 132 MET A O   
1029 C CB  . MET A 133 ? 0.7615 0.7200 0.7073 -0.0334 0.0658  -0.0580 132 MET A CB  
1030 C CG  . MET A 133 ? 0.7678 0.7321 0.7156 -0.0344 0.0610  -0.0560 132 MET A CG  
1031 S SD  . MET A 133 ? 0.7951 0.7628 0.7414 -0.0425 0.0619  -0.0591 132 MET A SD  
1032 C CE  . MET A 133 ? 0.8015 0.7567 0.7423 -0.0437 0.0701  -0.0625 132 MET A CE  
1033 N N   . LYS A 134 ? 0.8251 0.7952 0.7793 -0.0228 0.0544  -0.0497 133 LYS A N   
1034 C CA  . LYS A 134 ? 0.8728 0.8510 0.8298 -0.0222 0.0494  -0.0477 133 LYS A CA  
1035 C C   . LYS A 134 ? 0.9223 0.9073 0.8785 -0.0288 0.0479  -0.0494 133 LYS A C   
1036 O O   . LYS A 134 ? 0.9214 0.9080 0.8767 -0.0329 0.0472  -0.0502 133 LYS A O   
1037 C CB  . LYS A 134 ? 0.8746 0.8554 0.8339 -0.0195 0.0444  -0.0443 133 LYS A CB  
1038 C CG  . LYS A 134 ? 0.8899 0.8776 0.8521 -0.0181 0.0393  -0.0417 133 LYS A CG  
1039 C CD  . LYS A 134 ? 0.8986 0.8873 0.8629 -0.0155 0.0355  -0.0390 133 LYS A CD  
1040 C CE  . LYS A 134 ? 0.9077 0.9017 0.8746 -0.0135 0.0308  -0.0364 133 LYS A CE  
1041 N NZ  . LYS A 134 ? 0.9146 0.9154 0.8827 -0.0176 0.0275  -0.0363 133 LYS A NZ  
1042 N N   . GLN A 135 ? 0.9850 0.9741 0.9412 -0.0300 0.0473  -0.0498 134 GLN A N   
1043 C CA  . GLN A 135 ? 1.0367 1.0323 0.9910 -0.0368 0.0453  -0.0509 134 GLN A CA  
1044 C C   . GLN A 135 ? 1.0648 1.0667 1.0223 -0.0361 0.0381  -0.0469 134 GLN A C   
1045 O O   . GLN A 135 ? 1.0556 1.0603 1.0151 -0.0333 0.0350  -0.0445 134 GLN A O   
1046 C CB  . GLN A 135 ? 1.0524 1.0503 1.0056 -0.0385 0.0472  -0.0527 134 GLN A CB  
1047 C CG  . GLN A 135 ? 1.0690 1.0604 1.0222 -0.0359 0.0542  -0.0561 134 GLN A CG  
1048 C CD  . GLN A 135 ? 1.0871 1.0722 1.0368 -0.0394 0.0600  -0.0600 134 GLN A CD  
1049 O OE1 . GLN A 135 ? 1.1005 1.0877 1.0470 -0.0453 0.0592  -0.0611 134 GLN A OE1 
1050 N NE2 . GLN A 135 ? 1.0901 1.0676 1.0409 -0.0357 0.0659  -0.0622 134 GLN A NE2 
1051 N N   . PRO A 136 ? 1.0987 1.1026 1.0571 -0.0387 0.0356  -0.0462 135 PRO A N   
1052 C CA  . PRO A 136 ? 1.0965 1.1053 1.0593 -0.0371 0.0293  -0.0425 135 PRO A CA  
1053 C C   . PRO A 136 ? 1.0936 1.1083 1.0565 -0.0391 0.0247  -0.0403 135 PRO A C   
1054 O O   . PRO A 136 ? 1.1007 1.1195 1.0610 -0.0452 0.0234  -0.0408 135 PRO A O   
1055 C CB  . PRO A 136 ? 1.1004 1.1117 1.0650 -0.0409 0.0279  -0.0429 135 PRO A CB  
1056 C CG  . PRO A 136 ? 1.1047 1.1110 1.0652 -0.0435 0.0340  -0.0468 135 PRO A CG  
1057 C CD  . PRO A 136 ? 1.1084 1.1120 1.0645 -0.0443 0.0379  -0.0489 135 PRO A CD  
1058 N N   . GLY A 137 ? 1.0841 1.0991 1.0494 -0.0344 0.0224  -0.0379 136 GLY A N   
1059 C CA  . GLY A 137 ? 1.0719 1.0916 1.0370 -0.0358 0.0185  -0.0358 136 GLY A CA  
1060 C C   . GLY A 137 ? 1.0677 1.0854 1.0319 -0.0323 0.0215  -0.0366 136 GLY A C   
1061 O O   . GLY A 137 ? 1.0501 1.0708 1.0150 -0.0315 0.0186  -0.0347 136 GLY A O   
1062 N N   . GLU A 138 ? 1.0760 1.0886 1.0391 -0.0302 0.0272  -0.0394 137 GLU A N   
1063 C CA  . GLU A 138 ? 1.0869 1.0973 1.0506 -0.0261 0.0303  -0.0402 137 GLU A CA  
1064 C C   . GLU A 138 ? 1.0652 1.0702 1.0309 -0.0198 0.0314  -0.0391 137 GLU A C   
1065 O O   . GLU A 138 ? 1.0719 1.0730 1.0369 -0.0196 0.0326  -0.0395 137 GLU A O   
1066 C CB  . GLU A 138 ? 1.1204 1.1289 1.0817 -0.0289 0.0362  -0.0443 137 GLU A CB  
1067 C CG  . GLU A 138 ? 1.1472 1.1536 1.1109 -0.0243 0.0400  -0.0455 137 GLU A CG  
1068 C CD  . GLU A 138 ? 1.1571 1.1692 1.1230 -0.0231 0.0369  -0.0437 137 GLU A CD  
1069 O OE1 . GLU A 138 ? 1.1697 1.1872 1.1337 -0.0278 0.0335  -0.0429 137 GLU A OE1 
1070 O OE2 . GLU A 138 ? 1.1603 1.1716 1.1299 -0.0176 0.0376  -0.0428 137 GLU A OE2 
1071 N N   . VAL A 139 ? 1.0276 1.0326 0.9954 -0.0151 0.0309  -0.0376 138 VAL A N   
1072 C CA  . VAL A 139 ? 0.9901 0.9904 0.9590 -0.0096 0.0311  -0.0358 138 VAL A CA  
1073 C C   . VAL A 139 ? 0.9545 0.9490 0.9237 -0.0063 0.0360  -0.0371 138 VAL A C   
1074 O O   . VAL A 139 ? 0.9495 0.9449 0.9200 -0.0063 0.0389  -0.0390 138 VAL A O   
1075 C CB  . VAL A 139 ? 0.9816 0.9855 0.9527 -0.0065 0.0268  -0.0327 138 VAL A CB  
1076 C CG1 . VAL A 139 ? 0.9800 0.9796 0.9516 -0.0012 0.0271  -0.0308 138 VAL A CG1 
1077 C CG2 . VAL A 139 ? 0.9700 0.9772 0.9414 -0.0087 0.0222  -0.0311 138 VAL A CG2 
1078 N N   A ARG A 140 ? 0.9264 0.9144 0.8942 -0.0037 0.0373  -0.0362 139 ARG A N   
1079 N N   B ARG A 140 ? 0.9308 0.9190 0.8988 -0.0035 0.0370  -0.0360 139 ARG A N   
1080 C CA  A ARG A 140 ? 0.9058 0.8869 0.8738 -0.0004 0.0417  -0.0368 139 ARG A CA  
1081 C CA  B ARG A 140 ? 0.9116 0.8928 0.8797 0.0004  0.0407  -0.0359 139 ARG A CA  
1082 C C   A ARG A 140 ? 0.9065 0.8883 0.8780 0.0049  0.0405  -0.0343 139 ARG A C   
1083 C C   B ARG A 140 ? 0.9079 0.8910 0.8800 0.0050  0.0400  -0.0342 139 ARG A C   
1084 O O   A ARG A 140 ? 0.9030 0.8866 0.8748 0.0074  0.0364  -0.0311 139 ARG A O   
1085 O O   B ARG A 140 ? 0.8991 0.8857 0.8723 0.0071  0.0357  -0.0313 139 ARG A O   
1086 C CB  A ARG A 140 ? 0.8878 0.8612 0.8523 -0.0001 0.0435  -0.0365 139 ARG A CB  
1087 C CB  B ARG A 140 ? 0.8962 0.8719 0.8618 0.0025  0.0398  -0.0336 139 ARG A CB  
1088 C CG  A ARG A 140 ? 0.8720 0.8441 0.8340 -0.0054 0.0464  -0.0398 139 ARG A CG  
1089 C CG  B ARG A 140 ? 0.8863 0.8553 0.8484 0.0002  0.0435  -0.0354 139 ARG A CG  
1090 C CD  A ARG A 140 ? 0.8596 0.8234 0.8181 -0.0056 0.0494  -0.0402 139 ARG A CD  
1091 C CD  B ARG A 140 ? 0.8746 0.8470 0.8356 -0.0053 0.0434  -0.0379 139 ARG A CD  
1092 N NE  A ARG A 140 ? 0.8368 0.8017 0.7942 -0.0067 0.0467  -0.0390 139 ARG A NE  
1093 N NE  B ARG A 140 ? 0.8626 0.8281 0.8204 -0.0072 0.0476  -0.0398 139 ARG A NE  
1094 C CZ  A ARG A 140 ? 0.8236 0.7820 0.7778 -0.0072 0.0490  -0.0392 139 ARG A CZ  
1095 C CZ  B ARG A 140 ? 0.8551 0.8161 0.8117 -0.0086 0.0524  -0.0426 139 ARG A CZ  
1096 N NH1 A ARG A 140 ? 0.8272 0.7773 0.7787 -0.0065 0.0535  -0.0400 139 ARG A NH1 
1097 N NH1 B ARG A 140 ? 0.8539 0.8170 0.8125 -0.0084 0.0538  -0.0439 139 ARG A NH1 
1098 N NH2 A ARG A 140 ? 0.8121 0.7721 0.7659 -0.0085 0.0472  -0.0387 139 ARG A NH2 
1099 N NH2 B ARG A 140 ? 0.8492 0.8035 0.8024 -0.0107 0.0562  -0.0443 139 ARG A NH2 
1100 N N   . ASP A 141 ? 0.9094 0.8902 0.8841 0.0064  0.0442  -0.0362 140 ASP A N   
1101 C CA  . ASP A 141 ? 0.8966 0.8789 0.8766 0.0116  0.0437  -0.0343 140 ASP A CA  
1102 C C   . ASP A 141 ? 0.8777 0.8508 0.8572 0.0159  0.0453  -0.0322 140 ASP A C   
1103 O O   . ASP A 141 ? 0.8830 0.8497 0.8631 0.0163  0.0504  -0.0344 140 ASP A O   
1104 C CB  . ASP A 141 ? 0.9172 0.9029 0.9017 0.0108  0.0476  -0.0380 140 ASP A CB  
1105 C CG  . ASP A 141 ? 0.9296 0.9184 0.9214 0.0162  0.0469  -0.0363 140 ASP A CG  
1106 O OD1 . ASP A 141 ? 0.9255 0.9148 0.9183 0.0202  0.0426  -0.0319 140 ASP A OD1 
1107 O OD2 . ASP A 141 ? 0.9455 0.9366 0.9422 0.0162  0.0509  -0.0396 140 ASP A OD2 
1108 N N   . GLN A 142 ? 0.8399 0.8121 0.8181 0.0187  0.0411  -0.0279 141 GLN A N   
1109 C CA  . GLN A 142 ? 0.8218 0.7848 0.7977 0.0220  0.0418  -0.0250 141 GLN A CA  
1110 C C   . GLN A 142 ? 0.8134 0.7735 0.7951 0.0277  0.0428  -0.0228 141 GLN A C   
1111 O O   . GLN A 142 ? 0.7987 0.7505 0.7785 0.0304  0.0430  -0.0199 141 GLN A O   
1112 C CB  . GLN A 142 ? 0.8104 0.7732 0.7814 0.0218  0.0372  -0.0214 141 GLN A CB  
1113 C CG  . GLN A 142 ? 0.8042 0.7686 0.7708 0.0167  0.0370  -0.0236 141 GLN A CG  
1114 C CD  . GLN A 142 ? 0.8015 0.7645 0.7634 0.0162  0.0338  -0.0210 141 GLN A CD  
1115 O OE1 . GLN A 142 ? 0.8083 0.7686 0.7687 0.0191  0.0317  -0.0173 141 GLN A OE1 
1116 N NE2 . GLN A 142 ? 0.7975 0.7623 0.7571 0.0123  0.0336  -0.0230 141 GLN A NE2 
1117 N N   . ARG A 143 ? 0.8155 0.7822 0.8046 0.0294  0.0432  -0.0242 142 ARG A N   
1118 C CA  . ARG A 143 ? 0.8256 0.7904 0.8224 0.0351  0.0446  -0.0227 142 ARG A CA  
1119 C C   . ARG A 143 ? 0.8066 0.7629 0.8045 0.0350  0.0516  -0.0264 142 ARG A C   
1120 O O   . ARG A 143 ? 0.8134 0.7638 0.8166 0.0399  0.0535  -0.0249 142 ARG A O   
1121 C CB  . ARG A 143 ? 0.8461 0.8216 0.8511 0.0367  0.0432  -0.0235 142 ARG A CB  
1122 C CG  . ARG A 143 ? 0.8662 0.8494 0.8699 0.0367  0.0364  -0.0197 142 ARG A CG  
1123 C CD  . ARG A 143 ? 0.8831 0.8776 0.8937 0.0368  0.0351  -0.0211 142 ARG A CD  
1124 N NE  . ARG A 143 ? 0.8904 0.8889 0.8998 0.0315  0.0385  -0.0264 142 ARG A NE  
1125 C CZ  . ARG A 143 ? 0.9030 0.9111 0.9159 0.0295  0.0377  -0.0283 142 ARG A CZ  
1126 N NH1 . ARG A 143 ? 0.9056 0.9161 0.9159 0.0240  0.0407  -0.0328 142 ARG A NH1 
1127 N NH2 . ARG A 143 ? 0.8997 0.9149 0.9180 0.0324  0.0338  -0.0256 142 ARG A NH2 
1128 N N   . LEU A 144 ? 0.7851 0.7407 0.7782 0.0292  0.0552  -0.0312 143 LEU A N   
1129 C CA  . LEU A 144 ? 0.7846 0.7317 0.7768 0.0276  0.0621  -0.0353 143 LEU A CA  
1130 C C   . LEU A 144 ? 0.7698 0.7053 0.7565 0.0288  0.0626  -0.0325 143 LEU A C   
1131 O O   . LEU A 144 ? 0.7725 0.6987 0.7605 0.0302  0.0676  -0.0338 143 LEU A O   
1132 C CB  . LEU A 144 ? 0.7941 0.7444 0.7815 0.0202  0.0649  -0.0407 143 LEU A CB  
1133 C CG  . LEU A 144 ? 0.8075 0.7663 0.7991 0.0174  0.0671  -0.0452 143 LEU A CG  
1134 C CD1 . LEU A 144 ? 0.8029 0.7717 0.8000 0.0202  0.0624  -0.0427 143 LEU A CD1 
1135 C CD2 . LEU A 144 ? 0.8083 0.7703 0.7930 0.0095  0.0678  -0.0488 143 LEU A CD2 
1136 N N   . TRP A 145 ? 0.7428 0.6786 0.7234 0.0278  0.0578  -0.0288 144 TRP A N   
1137 C CA  . TRP A 145 ? 0.7345 0.6597 0.7088 0.0281  0.0580  -0.0259 144 TRP A CA  
1138 C C   . TRP A 145 ? 0.7426 0.6621 0.7205 0.0347  0.0561  -0.0205 144 TRP A C   
1139 O O   . TRP A 145 ? 0.7410 0.6493 0.7172 0.0362  0.0590  -0.0193 144 TRP A O   
1140 C CB  . TRP A 145 ? 0.7177 0.6450 0.6846 0.0249  0.0538  -0.0239 144 TRP A CB  
1141 C CG  . TRP A 145 ? 0.6977 0.6318 0.6621 0.0191  0.0539  -0.0279 144 TRP A CG  
1142 C CD1 . TRP A 145 ? 0.6960 0.6327 0.6613 0.0152  0.0576  -0.0330 144 TRP A CD1 
1143 C CD2 . TRP A 145 ? 0.6840 0.6223 0.6441 0.0163  0.0501  -0.0268 144 TRP A CD2 
1144 N NE1 . TRP A 145 ? 0.6796 0.6226 0.6421 0.0105  0.0555  -0.0345 144 TRP A NE1 
1145 C CE2 . TRP A 145 ? 0.6783 0.6223 0.6381 0.0113  0.0511  -0.0310 144 TRP A CE2 
1146 C CE3 . TRP A 145 ? 0.6850 0.6230 0.6415 0.0173  0.0459  -0.0229 144 TRP A CE3 
1147 C CZ2 . TRP A 145 ? 0.6735 0.6225 0.6310 0.0081  0.0481  -0.0311 144 TRP A CZ2 
1148 C CZ3 . TRP A 145 ? 0.6789 0.6217 0.6327 0.0137  0.0437  -0.0238 144 TRP A CZ3 
1149 C CH2 . TRP A 145 ? 0.6713 0.6196 0.6263 0.0095  0.0447  -0.0277 144 TRP A CH2 
1150 N N   . THR A 146 ? 0.7478 0.6752 0.7307 0.0383  0.0509  -0.0170 145 THR A N   
1151 C CA  . THR A 146 ? 0.7610 0.6850 0.7484 0.0445  0.0478  -0.0111 145 THR A CA  
1152 C C   . THR A 146 ? 0.7671 0.6853 0.7631 0.0489  0.0527  -0.0125 145 THR A C   
1153 O O   . THR A 146 ? 0.7647 0.6738 0.7619 0.0531  0.0524  -0.0082 145 THR A O   
1154 C CB  . THR A 146 ? 0.7622 0.6975 0.7546 0.0471  0.0416  -0.0079 145 THR A CB  
1155 O OG1 . THR A 146 ? 0.7745 0.7195 0.7746 0.0468  0.0435  -0.0124 145 THR A OG1 
1156 C CG2 . THR A 146 ? 0.7586 0.6982 0.7426 0.0433  0.0367  -0.0060 145 THR A CG2 
1157 N N   . ASP A 147 ? 0.7724 0.6957 0.7744 0.0477  0.0573  -0.0184 146 ASP A N   
1158 C CA  . ASP A 147 ? 0.7931 0.7112 0.8039 0.0512  0.0633  -0.0212 146 ASP A CA  
1159 C C   . ASP A 147 ? 0.7972 0.7013 0.8024 0.0493  0.0690  -0.0232 146 ASP A C   
1160 O O   . ASP A 147 ? 0.8026 0.6976 0.8134 0.0537  0.0724  -0.0223 146 ASP A O   
1161 C CB  . ASP A 147 ? 0.8016 0.7289 0.8185 0.0489  0.0673  -0.0279 146 ASP A CB  
1162 C CG  . ASP A 147 ? 0.8118 0.7524 0.8361 0.0514  0.0625  -0.0263 146 ASP A CG  
1163 O OD1 . ASP A 147 ? 0.8234 0.7655 0.8512 0.0564  0.0568  -0.0200 146 ASP A OD1 
1164 O OD2 . ASP A 147 ? 0.8161 0.7656 0.8422 0.0478  0.0643  -0.0311 146 ASP A OD2 
1165 N N   . ALA A 148 ? 0.7898 0.6922 0.7844 0.0427  0.0702  -0.0257 147 ALA A N   
1166 C CA  . ALA A 148 ? 0.7922 0.6818 0.7801 0.0397  0.0755  -0.0277 147 ALA A CA  
1167 C C   . ALA A 148 ? 0.7903 0.6689 0.7748 0.0434  0.0729  -0.0210 147 ALA A C   
1168 O O   . ALA A 148 ? 0.7921 0.6583 0.7769 0.0449  0.0773  -0.0210 147 ALA A O   
1169 C CB  . ALA A 148 ? 0.7877 0.6799 0.7660 0.0318  0.0763  -0.0315 147 ALA A CB  
1170 N N   . LEU A 149 ? 0.7828 0.6653 0.7635 0.0442  0.0658  -0.0153 148 LEU A N   
1171 C CA  . LEU A 149 ? 0.7961 0.6690 0.7723 0.0470  0.0623  -0.0082 148 LEU A CA  
1172 C C   . LEU A 149 ? 0.8092 0.6791 0.7958 0.0550  0.0606  -0.0034 148 LEU A C   
1173 O O   . LEU A 149 ? 0.8127 0.6705 0.7975 0.0578  0.0605  0.0013  148 LEU A O   
1174 C CB  . LEU A 149 ? 0.7870 0.6659 0.7560 0.0450  0.0554  -0.0040 148 LEU A CB  
1175 C CG  . LEU A 149 ? 0.7856 0.6654 0.7441 0.0376  0.0565  -0.0072 148 LEU A CG  
1176 C CD1 . LEU A 149 ? 0.7834 0.6720 0.7381 0.0362  0.0501  -0.0044 148 LEU A CD1 
1177 C CD2 . LEU A 149 ? 0.7911 0.6570 0.7406 0.0349  0.0598  -0.0063 148 LEU A CD2 
1178 N N   . ALA A 150 ? 0.8117 0.6925 0.8092 0.0586  0.0593  -0.0045 149 ALA A N   
1179 C CA  . ALA A 150 ? 0.8275 0.7079 0.8376 0.0665  0.0576  -0.0005 149 ALA A CA  
1180 C C   . ALA A 150 ? 0.8487 0.7167 0.8646 0.0695  0.0648  -0.0028 149 ALA A C   
1181 O O   . ALA A 150 ? 0.8630 0.7237 0.8854 0.0758  0.0633  0.0026  149 ALA A O   
1182 C CB  . ALA A 150 ? 0.8129 0.7084 0.8337 0.0686  0.0560  -0.0028 149 ALA A CB  
1183 N N   . ALA A 151 ? 0.8559 0.7214 0.8695 0.0647  0.0725  -0.0108 150 ALA A N   
1184 C CA  . ALA A 151 ? 0.8761 0.7296 0.8943 0.0663  0.0805  -0.0145 150 ALA A CA  
1185 C C   . ALA A 151 ? 0.8941 0.7306 0.9031 0.0653  0.0818  -0.0110 150 ALA A C   
1186 O O   . ALA A 151 ? 0.9038 0.7282 0.9169 0.0676  0.0877  -0.0125 150 ALA A O   
1187 C CB  . ALA A 151 ? 0.8671 0.7240 0.8846 0.0603  0.0881  -0.0244 150 ALA A CB  
1188 N N   . LEU A 152 ? 0.9010 0.7364 0.8977 0.0617  0.0767  -0.0066 151 LEU A N   
1189 C CA  . LEU A 152 ? 0.9296 0.7494 0.9159 0.0597  0.0778  -0.0033 151 LEU A CA  
1190 C C   . LEU A 152 ? 0.9657 0.7785 0.9521 0.0652  0.0712  0.0070  151 LEU A C   
1191 O O   . LEU A 152 ? 0.9778 0.7830 0.9523 0.0620  0.0686  0.0114  151 LEU A O   
1192 C CB  . LEU A 152 ? 0.9189 0.7409 0.8910 0.0512  0.0774  -0.0055 151 LEU A CB  
1193 C CG  . LEU A 152 ? 0.8999 0.7285 0.8700 0.0447  0.0829  -0.0146 151 LEU A CG  
1194 C CD1 . LEU A 152 ? 0.8887 0.7195 0.8463 0.0374  0.0814  -0.0155 151 LEU A CD1 
1195 C CD2 . LEU A 152 ? 0.9068 0.7250 0.8790 0.0435  0.0919  -0.0205 151 LEU A CD2 
1196 N N   . THR A 153 ? 0.9963 0.8118 0.9963 0.0732  0.0684  0.0107  152 THR A N   
1197 C CA  . THR A 153 ? 1.0199 0.8296 1.0216 0.0789  0.0614  0.0211  152 THR A CA  
1198 C C   . THR A 153 ? 1.0411 0.8451 1.0590 0.0876  0.0634  0.0228  152 THR A C   
1199 O O   . THR A 153 ? 1.0505 0.8632 1.0817 0.0907  0.0667  0.0176  152 THR A O   
1200 C CB  . THR A 153 ? 1.0136 0.8375 1.0154 0.0800  0.0519  0.0264  152 THR A CB  
1201 O OG1 . THR A 153 ? 0.9985 0.8377 1.0121 0.0820  0.0524  0.0216  152 THR A OG1 
1202 C CG2 . THR A 153 ? 1.0069 0.8336 0.9923 0.0720  0.0492  0.0264  152 THR A CG2 
1213 N N   . MET B 2   ? 0.6519 0.7383 0.6112 -0.0630 -0.0247 -0.0148 1   MET B N   
1214 C CA  . MET B 2   ? 0.6247 0.7155 0.5879 -0.0599 -0.0221 -0.0158 1   MET B CA  
1215 C C   . MET B 2   ? 0.5951 0.6959 0.5604 -0.0636 -0.0195 -0.0181 1   MET B C   
1216 O O   . MET B 2   ? 0.5929 0.7011 0.5597 -0.0666 -0.0194 -0.0194 1   MET B O   
1217 C CB  . MET B 2   ? 0.6314 0.7255 0.6004 -0.0527 -0.0214 -0.0165 1   MET B CB  
1218 C CG  . MET B 2   ? 0.6360 0.7211 0.6042 -0.0478 -0.0222 -0.0151 1   MET B CG  
1219 S SD  . MET B 2   ? 0.6459 0.7359 0.6203 -0.0403 -0.0211 -0.0157 1   MET B SD  
1220 C CE  . MET B 2   ? 0.6322 0.7124 0.6054 -0.0361 -0.0204 -0.0148 1   MET B CE  
1221 N N   . LEU B 3   ? 0.5565 0.6579 0.5222 -0.0637 -0.0170 -0.0190 2   LEU B N   
1222 C CA  . LEU B 3   ? 0.5373 0.6484 0.5060 -0.0667 -0.0134 -0.0221 2   LEU B CA  
1223 C C   . LEU B 3   ? 0.5150 0.6348 0.4932 -0.0605 -0.0118 -0.0240 2   LEU B C   
1224 O O   . LEU B 3   ? 0.5015 0.6181 0.4825 -0.0539 -0.0124 -0.0230 2   LEU B O   
1225 C CB  . LEU B 3   ? 0.5373 0.6463 0.5038 -0.0685 -0.0108 -0.0229 2   LEU B CB  
1226 C CG  . LEU B 3   ? 0.5460 0.6471 0.5031 -0.0753 -0.0127 -0.0206 2   LEU B CG  
1227 C CD1 . LEU B 3   ? 0.5475 0.6483 0.5027 -0.0771 -0.0099 -0.0219 2   LEU B CD1 
1228 C CD2 . LEU B 3   ? 0.5521 0.6560 0.5047 -0.0832 -0.0132 -0.0207 2   LEU B CD2 
1229 N N   . ASN B 4   ? 0.4972 0.6280 0.4805 -0.0626 -0.0101 -0.0264 3   ASN B N   
1230 C CA  . ASN B 4   ? 0.4887 0.6289 0.4822 -0.0568 -0.0092 -0.0277 3   ASN B CA  
1231 C C   . ASN B 4   ? 0.4720 0.6167 0.4728 -0.0531 -0.0047 -0.0304 3   ASN B C   
1232 O O   . ASN B 4   ? 0.4709 0.6135 0.4686 -0.0565 -0.0015 -0.0322 3   ASN B O   
1233 C CB  . ASN B 4   ? 0.4941 0.6451 0.4913 -0.0606 -0.0096 -0.0291 3   ASN B CB  
1234 C CG  . ASN B 4   ? 0.5066 0.6535 0.4976 -0.0636 -0.0139 -0.0267 3   ASN B CG  
1235 O OD1 . ASN B 4   ? 0.5068 0.6486 0.4969 -0.0594 -0.0168 -0.0244 3   ASN B OD1 
1236 N ND2 . ASN B 4   ? 0.5142 0.6629 0.5007 -0.0713 -0.0139 -0.0275 3   ASN B ND2 
1237 N N   . VAL B 5   ? 0.4567 0.6072 0.4669 -0.0463 -0.0046 -0.0306 4   VAL B N   
1238 C CA  . VAL B 5   ? 0.4503 0.6055 0.4694 -0.0418 -0.0002 -0.0332 4   VAL B CA  
1239 C C   . VAL B 5   ? 0.4448 0.6097 0.4679 -0.0472 0.0043  -0.0376 4   VAL B C   
1240 O O   . VAL B 5   ? 0.4338 0.6063 0.4582 -0.0514 0.0033  -0.0382 4   VAL B O   
1241 C CB  . VAL B 5   ? 0.4502 0.6110 0.4796 -0.0339 -0.0017 -0.0319 4   VAL B CB  
1242 C CG1 . VAL B 5   ? 0.4555 0.6223 0.4962 -0.0294 0.0032  -0.0350 4   VAL B CG1 
1243 C CG2 . VAL B 5   ? 0.4480 0.5988 0.4727 -0.0290 -0.0055 -0.0280 4   VAL B CG2 
1244 N N   . GLY B 6   ? 0.4421 0.6066 0.4667 -0.0478 0.0096  -0.0409 5   GLY B N   
1245 C CA  . GLY B 6   ? 0.4416 0.6148 0.4694 -0.0536 0.0149  -0.0458 5   GLY B CA  
1246 C C   . GLY B 6   ? 0.4417 0.6095 0.4569 -0.0632 0.0158  -0.0464 5   GLY B C   
1247 O O   . GLY B 6   ? 0.4429 0.6154 0.4583 -0.0687 0.0211  -0.0507 5   GLY B O   
1248 N N   . ALA B 7   ? 0.4442 0.6020 0.4484 -0.0653 0.0109  -0.0421 6   ALA B N   
1249 C CA  . ALA B 7   ? 0.4514 0.6028 0.4434 -0.0740 0.0106  -0.0415 6   ALA B CA  
1250 C C   . ALA B 7   ? 0.4557 0.6007 0.4438 -0.0741 0.0135  -0.0425 6   ALA B C   
1251 O O   . ALA B 7   ? 0.4483 0.5898 0.4405 -0.0670 0.0138  -0.0421 6   ALA B O   
1252 C CB  . ALA B 7   ? 0.4513 0.5936 0.4345 -0.0753 0.0043  -0.0364 6   ALA B CB  
1253 N N   . THR B 8   ? 0.4664 0.6098 0.4461 -0.0828 0.0156  -0.0439 7   THR B N   
1254 C CA  . THR B 8   ? 0.4762 0.6138 0.4504 -0.0848 0.0180  -0.0448 7   THR B CA  
1255 C C   . THR B 8   ? 0.4749 0.6008 0.4415 -0.0831 0.0121  -0.0393 7   THR B C   
1256 O O   . THR B 8   ? 0.4836 0.6048 0.4435 -0.0865 0.0072  -0.0353 7   THR B O   
1257 C CB  . THR B 8   ? 0.4909 0.6304 0.4568 -0.0959 0.0214  -0.0475 7   THR B CB  
1258 O OG1 . THR B 8   ? 0.5014 0.6525 0.4749 -0.0981 0.0270  -0.0529 7   THR B OG1 
1259 C CG2 . THR B 8   ? 0.4986 0.6332 0.4592 -0.0985 0.0245  -0.0491 7   THR B CG2 
1260 N N   . ALA B 9   ? 0.4683 0.5894 0.4366 -0.0777 0.0128  -0.0391 8   ALA B N   
1261 C CA  . ALA B 9   ? 0.4642 0.5751 0.4269 -0.0756 0.0077  -0.0344 8   ALA B CA  
1262 C C   . ALA B 9   ? 0.4729 0.5784 0.4242 -0.0843 0.0058  -0.0324 8   ALA B C   
1263 O O   . ALA B 9   ? 0.4823 0.5892 0.4301 -0.0893 0.0097  -0.0353 8   ALA B O   
1264 C CB  . ALA B 9   ? 0.4585 0.5663 0.4257 -0.0685 0.0096  -0.0353 8   ALA B CB  
1265 N N   . PRO B 10  ? 0.4751 0.5745 0.4205 -0.0865 -0.0002 -0.0274 9   PRO B N   
1266 C CA  . PRO B 10  ? 0.4862 0.5800 0.4211 -0.0945 -0.0028 -0.0245 9   PRO B CA  
1267 C C   . PRO B 10  ? 0.4934 0.5826 0.4260 -0.0936 -0.0027 -0.0241 9   PRO B C   
1268 O O   . PRO B 10  ? 0.4869 0.5728 0.4244 -0.0860 -0.0038 -0.0231 9   PRO B O   
1269 C CB  . PRO B 10  ? 0.4861 0.5730 0.4182 -0.0940 -0.0095 -0.0190 9   PRO B CB  
1270 C CG  . PRO B 10  ? 0.4802 0.5719 0.4186 -0.0902 -0.0089 -0.0204 9   PRO B CG  
1271 C CD  . PRO B 10  ? 0.4730 0.5707 0.4207 -0.0830 -0.0044 -0.0244 9   PRO B CD  
1272 N N   . ASP B 11  ? 0.5090 0.5985 0.4339 -0.1018 -0.0011 -0.0250 10  ASP B N   
1273 C CA  . ASP B 11  ? 0.5178 0.6037 0.4393 -0.1027 -0.0008 -0.0248 10  ASP B CA  
1274 C C   . ASP B 11  ? 0.5026 0.5802 0.4204 -0.1022 -0.0083 -0.0183 10  ASP B C   
1275 O O   . ASP B 11  ? 0.5011 0.5753 0.4158 -0.1044 -0.0133 -0.0139 10  ASP B O   
1276 C CB  . ASP B 11  ? 0.5514 0.6401 0.4643 -0.1132 0.0027  -0.0276 10  ASP B CB  
1277 C CG  . ASP B 11  ? 0.5771 0.6743 0.4949 -0.1140 0.0111  -0.0349 10  ASP B CG  
1278 O OD1 . ASP B 11  ? 0.5874 0.6874 0.5154 -0.1056 0.0148  -0.0382 10  ASP B OD1 
1279 O OD2 . ASP B 11  ? 0.6100 0.7110 0.5215 -0.1232 0.0141  -0.0374 10  ASP B OD2 
1280 N N   . PHE B 12  ? 0.4830 0.5575 0.4018 -0.0991 -0.0088 -0.0178 11  PHE B N   
1281 C CA  . PHE B 12  ? 0.4729 0.5404 0.3896 -0.0983 -0.0156 -0.0119 11  PHE B CA  
1282 C C   . PHE B 12  ? 0.4651 0.5313 0.3805 -0.0986 -0.0149 -0.0126 11  PHE B C   
1283 O O   . PHE B 12  ? 0.4571 0.5264 0.3755 -0.0963 -0.0090 -0.0176 11  PHE B O   
1284 C CB  . PHE B 12  ? 0.4645 0.5285 0.3891 -0.0892 -0.0186 -0.0096 11  PHE B CB  
1285 C CG  . PHE B 12  ? 0.4490 0.5146 0.3818 -0.0805 -0.0146 -0.0132 11  PHE B CG  
1286 C CD1 . PHE B 12  ? 0.4423 0.5051 0.3767 -0.0773 -0.0146 -0.0131 11  PHE B CD1 
1287 C CD2 . PHE B 12  ? 0.4422 0.5119 0.3809 -0.0758 -0.0112 -0.0163 11  PHE B CD2 
1288 C CE1 . PHE B 12  ? 0.4383 0.5017 0.3795 -0.0698 -0.0110 -0.0162 11  PHE B CE1 
1289 C CE2 . PHE B 12  ? 0.4358 0.5064 0.3815 -0.0680 -0.0080 -0.0189 11  PHE B CE2 
1290 C CZ  . PHE B 12  ? 0.4330 0.5000 0.3797 -0.0651 -0.0078 -0.0188 11  PHE B CZ  
1291 N N   . THR B 13  ? 0.4709 0.5325 0.3820 -0.1017 -0.0210 -0.0073 12  THR B N   
1292 C CA  . THR B 13  ? 0.4747 0.5349 0.3850 -0.1020 -0.0216 -0.0070 12  THR B CA  
1293 C C   . THR B 13  ? 0.4667 0.5215 0.3816 -0.0969 -0.0284 -0.0013 12  THR B C   
1294 O O   . THR B 13  ? 0.4687 0.5203 0.3809 -0.0999 -0.0346 0.0042  12  THR B O   
1295 C CB  . THR B 13  ? 0.4950 0.5563 0.3944 -0.1131 -0.0225 -0.0062 12  THR B CB  
1296 O OG1 . THR B 13  ? 0.5059 0.5724 0.4018 -0.1178 -0.0149 -0.0125 12  THR B OG1 
1297 C CG2 . THR B 13  ? 0.4972 0.5572 0.3960 -0.1135 -0.0241 -0.0053 12  THR B CG2 
1298 N N   . LEU B 14  ? 0.4523 0.5061 0.3746 -0.0891 -0.0270 -0.0029 13  LEU B N   
1299 C CA  . LEU B 14  ? 0.4475 0.4968 0.3757 -0.0836 -0.0323 0.0014  13  LEU B CA  
1300 C C   . LEU B 14  ? 0.4482 0.4973 0.3790 -0.0815 -0.0319 0.0006  13  LEU B C   
1301 O O   . LEU B 14  ? 0.4493 0.5010 0.3794 -0.0816 -0.0262 -0.0042 13  LEU B O   
1302 C CB  . LEU B 14  ? 0.4366 0.4843 0.3724 -0.0753 -0.0311 0.0004  13  LEU B CB  
1303 C CG  . LEU B 14  ? 0.4341 0.4821 0.3685 -0.0765 -0.0315 0.0010  13  LEU B CG  
1304 C CD1 . LEU B 14  ? 0.4264 0.4737 0.3680 -0.0684 -0.0295 -0.0010 13  LEU B CD1 
1305 C CD2 . LEU B 14  ? 0.4402 0.4839 0.3713 -0.0808 -0.0383 0.0069  13  LEU B CD2 
1306 N N   . ARG B 15  ? 0.4512 0.4972 0.3858 -0.0797 -0.0377 0.0052  14  ARG B N   
1307 C CA  . ARG B 15  ? 0.4618 0.5079 0.3999 -0.0777 -0.0380 0.0049  14  ARG B CA  
1308 C C   . ARG B 15  ? 0.4468 0.4916 0.3930 -0.0687 -0.0340 0.0016  14  ARG B C   
1309 O O   . ARG B 15  ? 0.4347 0.4769 0.3861 -0.0632 -0.0349 0.0025  14  ARG B O   
1310 C CB  . ARG B 15  ? 0.4748 0.5186 0.4157 -0.0787 -0.0460 0.0113  14  ARG B CB  
1311 C CG  . ARG B 15  ? 0.4973 0.5418 0.4298 -0.0881 -0.0513 0.0159  14  ARG B CG  
1312 C CD  . ARG B 15  ? 0.5151 0.5633 0.4418 -0.0944 -0.0504 0.0145  14  ARG B CD  
1313 N NE  . ARG B 15  ? 0.5414 0.5905 0.4584 -0.1045 -0.0553 0.0188  14  ARG B NE  
1314 C CZ  . ARG B 15  ? 0.5531 0.6052 0.4629 -0.1123 -0.0560 0.0188  14  ARG B CZ  
1315 N NH1 . ARG B 15  ? 0.5560 0.6104 0.4676 -0.1110 -0.0520 0.0146  14  ARG B NH1 
1316 N NH2 . ARG B 15  ? 0.5673 0.6198 0.4674 -0.1219 -0.0608 0.0232  14  ARG B NH2 
1317 N N   . ASP B 16  ? 0.4485 0.4946 0.3951 -0.0676 -0.0296 -0.0023 15  ASP B N   
1318 C CA  . ASP B 16  ? 0.4504 0.4948 0.4038 -0.0596 -0.0260 -0.0051 15  ASP B CA  
1319 C C   . ASP B 16  ? 0.4403 0.4829 0.3997 -0.0571 -0.0302 -0.0023 15  ASP B C   
1320 O O   . ASP B 16  ? 0.4391 0.4821 0.3981 -0.0610 -0.0360 0.0021  15  ASP B O   
1321 C CB  . ASP B 16  ? 0.4640 0.5098 0.4156 -0.0592 -0.0190 -0.0106 15  ASP B CB  
1322 C CG  . ASP B 16  ? 0.4897 0.5365 0.4385 -0.0636 -0.0186 -0.0115 15  ASP B CG  
1323 O OD1 . ASP B 16  ? 0.5045 0.5519 0.4527 -0.0674 -0.0242 -0.0076 15  ASP B OD1 
1324 O OD2 . ASP B 16  ? 0.5096 0.5566 0.4571 -0.0634 -0.0127 -0.0160 15  ASP B OD2 
1325 N N   . GLN B 17  ? 0.4325 0.4734 0.3976 -0.0509 -0.0273 -0.0046 16  GLN B N   
1326 C CA  . GLN B 17  ? 0.4325 0.4723 0.4044 -0.0483 -0.0304 -0.0026 16  GLN B CA  
1327 C C   . GLN B 17  ? 0.4492 0.4917 0.4198 -0.0533 -0.0326 -0.0016 16  GLN B C   
1328 O O   . GLN B 17  ? 0.4447 0.4875 0.4213 -0.0526 -0.0370 0.0014  16  GLN B O   
1329 C CB  . GLN B 17  ? 0.4165 0.4538 0.3939 -0.0414 -0.0262 -0.0057 16  GLN B CB  
1330 C CG  . GLN B 17  ? 0.4101 0.4474 0.3848 -0.0405 -0.0199 -0.0104 16  GLN B CG  
1331 C CD  . GLN B 17  ? 0.4028 0.4396 0.3742 -0.0386 -0.0155 -0.0130 16  GLN B CD  
1332 O OE1 . GLN B 17  ? 0.3952 0.4337 0.3628 -0.0415 -0.0164 -0.0122 16  GLN B OE1 
1333 N NE2 . GLN B 17  ? 0.3945 0.4291 0.3674 -0.0339 -0.0108 -0.0160 16  GLN B NE2 
1334 N N   . ASN B 18  ? 0.4742 0.5189 0.4376 -0.0583 -0.0293 -0.0043 17  ASN B N   
1335 C CA  . ASN B 18  ? 0.4930 0.5406 0.4535 -0.0644 -0.0310 -0.0037 17  ASN B CA  
1336 C C   . ASN B 18  ? 0.5147 0.5647 0.4678 -0.0727 -0.0356 -0.0002 17  ASN B C   
1337 O O   . ASN B 18  ? 0.5260 0.5787 0.4735 -0.0795 -0.0360 -0.0006 17  ASN B O   
1338 C CB  . ASN B 18  ? 0.4996 0.5473 0.4563 -0.0653 -0.0238 -0.0094 17  ASN B CB  
1339 C CG  . ASN B 18  ? 0.4988 0.5437 0.4617 -0.0580 -0.0197 -0.0124 17  ASN B CG  
1340 O OD1 . ASN B 18  ? 0.5128 0.5573 0.4829 -0.0545 -0.0225 -0.0105 17  ASN B OD1 
1341 N ND2 . ASN B 18  ? 0.5015 0.5444 0.4621 -0.0559 -0.0128 -0.0170 17  ASN B ND2 
1342 N N   . GLN B 19  ? 0.5431 0.5919 0.4954 -0.0728 -0.0389 0.0030  18  GLN B N   
1343 C CA  . GLN B 19  ? 0.5597 0.6099 0.5043 -0.0809 -0.0436 0.0069  18  GLN B CA  
1344 C C   . GLN B 19  ? 0.5639 0.6160 0.4980 -0.0877 -0.0386 0.0030  18  GLN B C   
1345 O O   . GLN B 19  ? 0.5647 0.6182 0.4911 -0.0955 -0.0419 0.0058  18  GLN B O   
1346 C CB  . GLN B 19  ? 0.5813 0.6336 0.5264 -0.0856 -0.0509 0.0121  18  GLN B CB  
1347 C CG  . GLN B 19  ? 0.5930 0.6439 0.5497 -0.0796 -0.0567 0.0165  18  GLN B CG  
1348 C CD  . GLN B 19  ? 0.6134 0.6607 0.5724 -0.0778 -0.0614 0.0212  18  GLN B CD  
1349 O OE1 . GLN B 19  ? 0.6401 0.6863 0.5915 -0.0814 -0.0608 0.0215  18  GLN B OE1 
1350 N NE2 . GLN B 19  ? 0.6201 0.6656 0.5900 -0.0722 -0.0657 0.0246  18  GLN B NE2 
1351 N N   . GLN B 20  ? 0.5693 0.6215 0.5032 -0.0849 -0.0306 -0.0033 19  GLN B N   
1352 C CA  . GLN B 20  ? 0.5810 0.6351 0.5066 -0.0907 -0.0249 -0.0077 19  GLN B CA  
1353 C C   . GLN B 20  ? 0.5731 0.6270 0.4972 -0.0904 -0.0246 -0.0073 19  GLN B C   
1354 O O   . GLN B 20  ? 0.5753 0.6272 0.5059 -0.0834 -0.0256 -0.0060 19  GLN B O   
1355 C CB  . GLN B 20  ? 0.5961 0.6498 0.5234 -0.0871 -0.0164 -0.0145 19  GLN B CB  
1356 C CG  . GLN B 20  ? 0.6137 0.6671 0.5424 -0.0871 -0.0153 -0.0161 19  GLN B CG  
1357 C CD  . GLN B 20  ? 0.6338 0.6863 0.5610 -0.0866 -0.0064 -0.0230 19  GLN B CD  
1358 O OE1 . GLN B 20  ? 0.6299 0.6798 0.5626 -0.0801 -0.0030 -0.0253 19  GLN B OE1 
1359 N NE2 . GLN B 20  ? 0.6460 0.7004 0.5657 -0.0938 -0.0023 -0.0265 19  GLN B NE2 
1360 N N   . LEU B 21  ? 0.5750 0.6312 0.4905 -0.0984 -0.0228 -0.0087 20  LEU B N   
1361 C CA  . LEU B 21  ? 0.5706 0.6275 0.4842 -0.0993 -0.0217 -0.0089 20  LEU B CA  
1362 C C   . LEU B 21  ? 0.5540 0.6123 0.4711 -0.0946 -0.0133 -0.0155 20  LEU B C   
1363 O O   . LEU B 21  ? 0.5521 0.6117 0.4674 -0.0965 -0.0072 -0.0206 20  LEU B O   
1364 C CB  . LEU B 21  ? 0.5886 0.6476 0.4911 -0.1106 -0.0232 -0.0077 20  LEU B CB  
1365 C CG  . LEU B 21  ? 0.6007 0.6582 0.4990 -0.1160 -0.0326 0.0001  20  LEU B CG  
1366 C CD1 . LEU B 21  ? 0.6167 0.6764 0.5022 -0.1286 -0.0331 0.0004  20  LEU B CD1 
1367 C CD2 . LEU B 21  ? 0.6007 0.6552 0.5033 -0.1119 -0.0378 0.0050  20  LEU B CD2 
1368 N N   . VAL B 22  ? 0.5425 0.6003 0.4649 -0.0886 -0.0131 -0.0152 21  VAL B N   
1369 C CA  . VAL B 22  ? 0.5312 0.5909 0.4581 -0.0836 -0.0062 -0.0205 21  VAL B CA  
1370 C C   . VAL B 22  ? 0.5201 0.5828 0.4449 -0.0867 -0.0057 -0.0208 21  VAL B C   
1371 O O   . VAL B 22  ? 0.5001 0.5614 0.4253 -0.0860 -0.0107 -0.0165 21  VAL B O   
1372 C CB  . VAL B 22  ? 0.5276 0.5848 0.4636 -0.0732 -0.0061 -0.0203 21  VAL B CB  
1373 C CG1 . VAL B 22  ? 0.5245 0.5839 0.4653 -0.0682 -0.0002 -0.0246 21  VAL B CG1 
1374 C CG2 . VAL B 22  ? 0.5237 0.5781 0.4617 -0.0707 -0.0058 -0.0206 21  VAL B CG2 
1375 N N   . THR B 23  ? 0.5235 0.5902 0.4462 -0.0903 0.0008  -0.0260 22  THR B N   
1376 C CA  . THR B 23  ? 0.5278 0.5984 0.4488 -0.0939 0.0024  -0.0273 22  THR B CA  
1377 C C   . THR B 23  ? 0.5224 0.5963 0.4520 -0.0870 0.0083  -0.0319 22  THR B C   
1378 O O   . THR B 23  ? 0.5175 0.5920 0.4506 -0.0842 0.0141  -0.0365 22  THR B O   
1379 C CB  . THR B 23  ? 0.5382 0.6116 0.4496 -0.1051 0.0053  -0.0299 22  THR B CB  
1380 O OG1 . THR B 23  ? 0.5523 0.6227 0.4555 -0.1117 -0.0009 -0.0249 22  THR B OG1 
1381 C CG2 . THR B 23  ? 0.5428 0.6205 0.4521 -0.1096 0.0070  -0.0312 22  THR B CG2 
1382 N N   . LEU B 24  ? 0.5244 0.6004 0.4575 -0.0844 0.0067  -0.0306 23  LEU B N   
1383 C CA  . LEU B 24  ? 0.5278 0.6080 0.4697 -0.0780 0.0113  -0.0343 23  LEU B CA  
1384 C C   . LEU B 24  ? 0.5432 0.6287 0.4857 -0.0817 0.0191  -0.0408 23  LEU B C   
1385 O O   . LEU B 24  ? 0.5259 0.6130 0.4761 -0.0759 0.0243  -0.0446 23  LEU B O   
1386 C CB  . LEU B 24  ? 0.5229 0.6053 0.4670 -0.0766 0.0080  -0.0318 23  LEU B CB  
1387 C CG  . LEU B 24  ? 0.5151 0.6031 0.4684 -0.0706 0.0117  -0.0349 23  LEU B CG  
1388 C CD1 . LEU B 24  ? 0.5093 0.5948 0.4701 -0.0612 0.0128  -0.0353 23  LEU B CD1 
1389 C CD2 . LEU B 24  ? 0.5139 0.6039 0.4680 -0.0706 0.0078  -0.0322 23  LEU B CD2 
1390 N N   . ARG B 25  ? 0.5750 0.6631 0.5097 -0.0915 0.0202  -0.0419 24  ARG B N   
1391 C CA  . ARG B 25  ? 0.6101 0.7036 0.5450 -0.0963 0.0283  -0.0488 24  ARG B CA  
1392 C C   . ARG B 25  ? 0.5930 0.6844 0.5280 -0.0962 0.0338  -0.0531 24  ARG B C   
1393 O O   . ARG B 25  ? 0.6056 0.7009 0.5446 -0.0970 0.0416  -0.0596 24  ARG B O   
1394 C CB  . ARG B 25  ? 0.6625 0.7587 0.5873 -0.1080 0.0282  -0.0490 24  ARG B CB  
1395 C CG  . ARG B 25  ? 0.7131 0.8157 0.6389 -0.1133 0.0373  -0.0567 24  ARG B CG  
1396 C CD  . ARG B 25  ? 0.7601 0.8668 0.6781 -0.1237 0.0375  -0.0571 24  ARG B CD  
1397 N NE  . ARG B 25  ? 0.8111 0.9134 0.7146 -0.1338 0.0328  -0.0531 24  ARG B NE  
1398 C CZ  . ARG B 25  ? 0.8427 0.9403 0.7404 -0.1351 0.0240  -0.0455 24  ARG B CZ  
1399 N NH1 . ARG B 25  ? 0.8510 0.9477 0.7555 -0.1273 0.0193  -0.0415 24  ARG B NH1 
1400 N NH2 . ARG B 25  ? 0.8656 0.9595 0.7507 -0.1444 0.0198  -0.0417 24  ARG B NH2 
1401 N N   . GLY B 26  ? 0.5721 0.6574 0.5034 -0.0952 0.0301  -0.0499 25  GLY B N   
1402 C CA  . GLY B 26  ? 0.5601 0.6427 0.4915 -0.0949 0.0350  -0.0538 25  GLY B CA  
1403 C C   . GLY B 26  ? 0.5439 0.6268 0.4870 -0.0850 0.0403  -0.0575 25  GLY B C   
1404 O O   . GLY B 26  ? 0.5380 0.6193 0.4826 -0.0849 0.0465  -0.0623 25  GLY B O   
1405 N N   . TYR B 27  ? 0.5250 0.6095 0.4764 -0.0771 0.0377  -0.0550 26  TYR B N   
1406 C CA  . TYR B 27  ? 0.5149 0.5998 0.4777 -0.0675 0.0416  -0.0574 26  TYR B CA  
1407 C C   . TYR B 27  ? 0.5044 0.5967 0.4749 -0.0670 0.0475  -0.0623 26  TYR B C   
1408 O O   . TYR B 27  ? 0.4873 0.5805 0.4680 -0.0597 0.0516  -0.0649 26  TYR B O   
1409 C CB  . TYR B 27  ? 0.5141 0.5967 0.4815 -0.0590 0.0353  -0.0518 26  TYR B CB  
1410 C CG  . TYR B 27  ? 0.5184 0.5938 0.4811 -0.0579 0.0306  -0.0478 26  TYR B CG  
1411 C CD1 . TYR B 27  ? 0.5214 0.5919 0.4865 -0.0534 0.0332  -0.0491 26  TYR B CD1 
1412 C CD2 . TYR B 27  ? 0.5243 0.5980 0.4808 -0.0612 0.0236  -0.0427 26  TYR B CD2 
1413 C CE1 . TYR B 27  ? 0.5291 0.5940 0.4906 -0.0526 0.0292  -0.0458 26  TYR B CE1 
1414 C CE2 . TYR B 27  ? 0.5259 0.5940 0.4797 -0.0599 0.0195  -0.0393 26  TYR B CE2 
1415 C CZ  . TYR B 27  ? 0.5277 0.5918 0.4841 -0.0558 0.0224  -0.0410 26  TYR B CZ  
1416 O OH  . TYR B 27  ? 0.5442 0.6034 0.4984 -0.0548 0.0185  -0.0379 26  TYR B OH  
1417 N N   . ARG B 28  ? 0.5151 0.6128 0.4813 -0.0746 0.0480  -0.0635 27  ARG B N   
1418 C CA  . ARG B 28  ? 0.5268 0.6326 0.5006 -0.0750 0.0541  -0.0687 27  ARG B CA  
1419 C C   . ARG B 28  ? 0.5189 0.6252 0.4981 -0.0748 0.0635  -0.0761 27  ARG B C   
1420 O O   . ARG B 28  ? 0.5272 0.6300 0.4986 -0.0813 0.0669  -0.0790 27  ARG B O   
1421 C CB  . ARG B 28  ? 0.5550 0.6660 0.5216 -0.0850 0.0536  -0.0693 27  ARG B CB  
1422 C CG  . ARG B 28  ? 0.5718 0.6885 0.5438 -0.0821 0.0499  -0.0666 27  ARG B CG  
1423 C CD  . ARG B 28  ? 0.6048 0.7258 0.5687 -0.0924 0.0493  -0.0669 27  ARG B CD  
1424 N NE  . ARG B 28  ? 0.6278 0.7441 0.5823 -0.0954 0.0406  -0.0598 27  ARG B NE  
1425 C CZ  . ARG B 28  ? 0.6592 0.7770 0.6051 -0.1042 0.0383  -0.0583 27  ARG B CZ  
1426 N NH1 . ARG B 28  ? 0.6739 0.7983 0.6185 -0.1118 0.0442  -0.0635 27  ARG B NH1 
1427 N NH2 . ARG B 28  ? 0.6636 0.7761 0.6023 -0.1057 0.0303  -0.0515 27  ARG B NH2 
1428 N N   . GLY B 29  ? 0.5044 0.6151 0.4974 -0.0671 0.0675  -0.0789 28  GLY B N   
1429 C CA  . GLY B 29  ? 0.5091 0.6202 0.5100 -0.0652 0.0767  -0.0859 28  GLY B CA  
1430 C C   . GLY B 29  ? 0.5103 0.6130 0.5140 -0.0581 0.0774  -0.0851 28  GLY B C   
1431 O O   . GLY B 29  ? 0.5192 0.6210 0.5309 -0.0551 0.0849  -0.0904 28  GLY B O   
1432 N N   . ALA B 30  ? 0.4986 0.5951 0.4964 -0.0554 0.0699  -0.0786 29  ALA B N   
1433 C CA  . ALA B 30  ? 0.4886 0.5767 0.4874 -0.0497 0.0701  -0.0775 29  ALA B CA  
1434 C C   . ALA B 30  ? 0.4730 0.5588 0.4778 -0.0397 0.0639  -0.0714 29  ALA B C   
1435 O O   . ALA B 30  ? 0.4753 0.5589 0.4894 -0.0317 0.0664  -0.0720 29  ALA B O   
1436 C CB  . ALA B 30  ? 0.4907 0.5727 0.4761 -0.0567 0.0679  -0.0762 29  ALA B CB  
1437 N N   . LYS B 31  ? 0.4546 0.5407 0.4539 -0.0404 0.0559  -0.0656 30  LYS B N   
1438 C CA  . LYS B 31  ? 0.4397 0.5231 0.4427 -0.0322 0.0500  -0.0599 30  LYS B CA  
1439 C C   . LYS B 31  ? 0.4141 0.5031 0.4180 -0.0316 0.0441  -0.0560 30  LYS B C   
1440 O O   . LYS B 31  ? 0.4021 0.4946 0.4001 -0.0385 0.0422  -0.0557 30  LYS B O   
1441 C CB  . LYS B 31  ? 0.4485 0.5238 0.4431 -0.0327 0.0459  -0.0564 30  LYS B CB  
1442 C CG  . LYS B 31  ? 0.4623 0.5312 0.4548 -0.0335 0.0510  -0.0597 30  LYS B CG  
1443 C CD  . LYS B 31  ? 0.4717 0.5338 0.4569 -0.0340 0.0464  -0.0559 30  LYS B CD  
1444 C CE  . LYS B 31  ? 0.4842 0.5402 0.4668 -0.0355 0.0514  -0.0593 30  LYS B CE  
1445 N NZ  . LYS B 31  ? 0.4934 0.5461 0.4847 -0.0282 0.0563  -0.0614 30  LYS B NZ  
1446 N N   . ASN B 32  ? 0.3966 0.4858 0.4075 -0.0236 0.0410  -0.0527 31  ASN B N   
1447 C CA  . ASN B 32  ? 0.3878 0.4811 0.3992 -0.0225 0.0349  -0.0485 31  ASN B CA  
1448 C C   . ASN B 32  ? 0.3805 0.4668 0.3827 -0.0239 0.0293  -0.0442 31  ASN B C   
1449 O O   . ASN B 32  ? 0.3866 0.4658 0.3865 -0.0216 0.0296  -0.0435 31  ASN B O   
1450 C CB  . ASN B 32  ? 0.3865 0.4820 0.4079 -0.0138 0.0335  -0.0465 31  ASN B CB  
1451 C CG  . ASN B 32  ? 0.3862 0.4890 0.4192 -0.0114 0.0389  -0.0506 31  ASN B CG  
1452 O OD1 . ASN B 32  ? 0.3871 0.4977 0.4221 -0.0158 0.0409  -0.0534 31  ASN B OD1 
1453 N ND2 . ASN B 32  ? 0.3872 0.4874 0.4283 -0.0042 0.0413  -0.0508 31  ASN B ND2 
1454 N N   . VAL B 33  ? 0.3683 0.4564 0.3655 -0.0276 0.0244  -0.0414 32  VAL B N   
1455 C CA  . VAL B 33  ? 0.3613 0.4429 0.3508 -0.0291 0.0193  -0.0375 32  VAL B CA  
1456 C C   . VAL B 33  ? 0.3516 0.4329 0.3420 -0.0256 0.0138  -0.0333 32  VAL B C   
1457 O O   . VAL B 33  ? 0.3474 0.4344 0.3397 -0.0266 0.0122  -0.0328 32  VAL B O   
1458 C CB  . VAL B 33  ? 0.3632 0.4450 0.3444 -0.0378 0.0181  -0.0375 32  VAL B CB  
1459 C CG1 . VAL B 33  ? 0.3620 0.4370 0.3370 -0.0388 0.0130  -0.0336 32  VAL B CG1 
1460 C CG2 . VAL B 33  ? 0.3683 0.4511 0.3476 -0.0427 0.0239  -0.0421 32  VAL B CG2 
1461 N N   . LEU B 34  ? 0.3438 0.4184 0.3325 -0.0219 0.0113  -0.0307 33  LEU B N   
1462 C CA  . LEU B 34  ? 0.3400 0.4130 0.3283 -0.0192 0.0065  -0.0271 33  LEU B CA  
1463 C C   . LEU B 34  ? 0.3340 0.4031 0.3157 -0.0237 0.0027  -0.0249 33  LEU B C   
1464 O O   . LEU B 34  ? 0.3414 0.4054 0.3198 -0.0249 0.0027  -0.0247 33  LEU B O   
1465 C CB  . LEU B 34  ? 0.3421 0.4099 0.3323 -0.0129 0.0064  -0.0258 33  LEU B CB  
1466 C CG  . LEU B 34  ? 0.3420 0.4073 0.3310 -0.0104 0.0020  -0.0226 33  LEU B CG  
1467 C CD1 . LEU B 34  ? 0.3468 0.4186 0.3396 -0.0090 0.0004  -0.0218 33  LEU B CD1 
1468 C CD2 . LEU B 34  ? 0.3468 0.4059 0.3360 -0.0056 0.0026  -0.0216 33  LEU B CD2 
1469 N N   . LEU B 35  ? 0.3265 0.3979 0.3067 -0.0263 -0.0006 -0.0233 34  LEU B N   
1470 C CA  . LEU B 35  ? 0.3213 0.3885 0.2962 -0.0302 -0.0046 -0.0208 34  LEU B CA  
1471 C C   . LEU B 35  ? 0.3132 0.3768 0.2886 -0.0267 -0.0079 -0.0184 34  LEU B C   
1472 O O   . LEU B 35  ? 0.3109 0.3778 0.2880 -0.0258 -0.0090 -0.0181 34  LEU B O   
1473 C CB  . LEU B 35  ? 0.3245 0.3956 0.2964 -0.0365 -0.0057 -0.0207 34  LEU B CB  
1474 C CG  . LEU B 35  ? 0.3304 0.4062 0.3012 -0.0412 -0.0019 -0.0236 34  LEU B CG  
1475 C CD1 . LEU B 35  ? 0.3349 0.4139 0.3017 -0.0479 -0.0035 -0.0231 34  LEU B CD1 
1476 C CD2 . LEU B 35  ? 0.3375 0.4092 0.3046 -0.0435 -0.0008 -0.0241 34  LEU B CD2 
1477 N N   . VAL B 36  ? 0.3056 0.3627 0.2797 -0.0251 -0.0092 -0.0171 35  VAL B N   
1478 C CA  . VAL B 36  ? 0.3014 0.3544 0.2758 -0.0223 -0.0116 -0.0155 35  VAL B CA  
1479 C C   . VAL B 36  ? 0.3055 0.3542 0.2774 -0.0256 -0.0150 -0.0134 35  VAL B C   
1480 O O   . VAL B 36  ? 0.3039 0.3486 0.2755 -0.0259 -0.0157 -0.0127 35  VAL B O   
1481 C CB  . VAL B 36  ? 0.2965 0.3453 0.2724 -0.0176 -0.0100 -0.0158 35  VAL B CB  
1482 C CG1 . VAL B 36  ? 0.2949 0.3396 0.2705 -0.0155 -0.0119 -0.0147 35  VAL B CG1 
1483 C CG2 . VAL B 36  ? 0.2962 0.3481 0.2748 -0.0142 -0.0068 -0.0173 35  VAL B CG2 
1484 N N   . PHE B 37  ? 0.3084 0.3582 0.2792 -0.0281 -0.0172 -0.0124 36  PHE B N   
1485 C CA  . PHE B 37  ? 0.3149 0.3597 0.2840 -0.0307 -0.0205 -0.0103 36  PHE B CA  
1486 C C   . PHE B 37  ? 0.3140 0.3535 0.2850 -0.0271 -0.0211 -0.0101 36  PHE B C   
1487 O O   . PHE B 37  ? 0.3136 0.3543 0.2851 -0.0243 -0.0199 -0.0112 36  PHE B O   
1488 C CB  . PHE B 37  ? 0.3162 0.3630 0.2829 -0.0352 -0.0224 -0.0094 36  PHE B CB  
1489 C CG  . PHE B 37  ? 0.3199 0.3709 0.2838 -0.0402 -0.0220 -0.0095 36  PHE B CG  
1490 C CD1 . PHE B 37  ? 0.3227 0.3810 0.2875 -0.0405 -0.0189 -0.0119 36  PHE B CD1 
1491 C CD2 . PHE B 37  ? 0.3265 0.3744 0.2873 -0.0448 -0.0246 -0.0071 36  PHE B CD2 
1492 C CE1 . PHE B 37  ? 0.3217 0.3841 0.2839 -0.0457 -0.0178 -0.0126 36  PHE B CE1 
1493 C CE2 . PHE B 37  ? 0.3296 0.3812 0.2866 -0.0504 -0.0240 -0.0073 36  PHE B CE2 
1494 C CZ  . PHE B 37  ? 0.3275 0.3864 0.2850 -0.0510 -0.0203 -0.0104 36  PHE B CZ  
1495 N N   . PHE B 38  ? 0.3217 0.3556 0.2937 -0.0272 -0.0229 -0.0087 37  PHE B N   
1496 C CA  . PHE B 38  ? 0.3297 0.3584 0.3039 -0.0242 -0.0229 -0.0091 37  PHE B CA  
1497 C C   . PHE B 38  ? 0.3435 0.3669 0.3193 -0.0260 -0.0258 -0.0071 37  PHE B C   
1498 O O   . PHE B 38  ? 0.3542 0.3775 0.3299 -0.0287 -0.0281 -0.0050 37  PHE B O   
1499 C CB  . PHE B 38  ? 0.3233 0.3507 0.2997 -0.0203 -0.0206 -0.0104 37  PHE B CB  
1500 C CG  . PHE B 38  ? 0.3203 0.3465 0.2985 -0.0210 -0.0213 -0.0094 37  PHE B CG  
1501 C CD1 . PHE B 38  ? 0.3194 0.3494 0.2958 -0.0226 -0.0205 -0.0095 37  PHE B CD1 
1502 C CD2 . PHE B 38  ? 0.3217 0.3433 0.3037 -0.0200 -0.0226 -0.0087 37  PHE B CD2 
1503 C CE1 . PHE B 38  ? 0.3188 0.3481 0.2963 -0.0239 -0.0213 -0.0086 37  PHE B CE1 
1504 C CE2 . PHE B 38  ? 0.3189 0.3404 0.3031 -0.0208 -0.0237 -0.0076 37  PHE B CE2 
1505 C CZ  . PHE B 38  ? 0.3202 0.3456 0.3016 -0.0230 -0.0233 -0.0074 37  PHE B CZ  
1506 N N   . PRO B 39  ? 0.3563 0.3752 0.3336 -0.0248 -0.0258 -0.0078 38  PRO B N   
1507 C CA  . PRO B 39  ? 0.3664 0.3795 0.3463 -0.0262 -0.0284 -0.0061 38  PRO B CA  
1508 C C   . PRO B 39  ? 0.3773 0.3873 0.3625 -0.0247 -0.0298 -0.0046 38  PRO B C   
1509 O O   . PRO B 39  ? 0.3793 0.3889 0.3648 -0.0273 -0.0331 -0.0016 38  PRO B O   
1510 C CB  . PRO B 39  ? 0.3678 0.3770 0.3483 -0.0250 -0.0267 -0.0084 38  PRO B CB  
1511 C CG  . PRO B 39  ? 0.3620 0.3753 0.3393 -0.0235 -0.0240 -0.0107 38  PRO B CG  
1512 C CD  . PRO B 39  ? 0.3604 0.3799 0.3361 -0.0231 -0.0236 -0.0101 38  PRO B CD  
1513 N N   . LEU B 40  ? 0.3893 0.3975 0.3785 -0.0211 -0.0275 -0.0066 39  LEU B N   
1514 C CA  . LEU B 40  ? 0.3996 0.4056 0.3952 -0.0196 -0.0288 -0.0055 39  LEU B CA  
1515 C C   . LEU B 40  ? 0.4032 0.4108 0.4007 -0.0167 -0.0259 -0.0077 39  LEU B C   
1516 O O   . LEU B 40  ? 0.4113 0.4189 0.4068 -0.0148 -0.0224 -0.0106 39  LEU B O   
1517 C CB  . LEU B 40  ? 0.4047 0.4044 0.4064 -0.0184 -0.0294 -0.0057 39  LEU B CB  
1518 C CG  . LEU B 40  ? 0.4142 0.4100 0.4160 -0.0211 -0.0327 -0.0031 39  LEU B CG  
1519 C CD1 . LEU B 40  ? 0.4229 0.4120 0.4314 -0.0191 -0.0316 -0.0046 39  LEU B CD1 
1520 C CD2 . LEU B 40  ? 0.4178 0.4144 0.4206 -0.0234 -0.0375 0.0016  39  LEU B CD2 
1521 N N   . ALA B 41  ? 0.4095 0.4183 0.4107 -0.0167 -0.0276 -0.0061 40  ALA B N   
1522 C CA  . ALA B 41  ? 0.4144 0.4244 0.4181 -0.0144 -0.0250 -0.0081 40  ALA B CA  
1523 C C   . ALA B 41  ? 0.4228 0.4287 0.4335 -0.0116 -0.0233 -0.0101 40  ALA B C   
1524 O O   . ALA B 41  ? 0.4155 0.4178 0.4308 -0.0116 -0.0252 -0.0091 40  ALA B O   
1525 C CB  . ALA B 41  ? 0.4202 0.4331 0.4260 -0.0161 -0.0277 -0.0057 40  ALA B CB  
1526 N N   . PHE B 42  ? 0.4347 0.4407 0.4460 -0.0095 -0.0194 -0.0131 41  PHE B N   
1527 C CA  . PHE B 42  ? 0.4491 0.4517 0.4667 -0.0073 -0.0166 -0.0160 41  PHE B CA  
1528 C C   . PHE B 42  ? 0.4678 0.4664 0.4833 -0.0071 -0.0144 -0.0183 41  PHE B C   
1529 O O   . PHE B 42  ? 0.4838 0.4788 0.5055 -0.0060 -0.0127 -0.0204 41  PHE B O   
1530 C CB  . PHE B 42  ? 0.4513 0.4533 0.4794 -0.0066 -0.0194 -0.0144 41  PHE B CB  
1531 C CG  . PHE B 42  ? 0.4478 0.4543 0.4778 -0.0075 -0.0222 -0.0119 41  PHE B CG  
1532 C CD1 . PHE B 42  ? 0.4438 0.4528 0.4732 -0.0070 -0.0194 -0.0139 41  PHE B CD1 
1533 C CD2 . PHE B 42  ? 0.4468 0.4545 0.4788 -0.0095 -0.0277 -0.0074 41  PHE B CD2 
1534 C CE1 . PHE B 42  ? 0.4433 0.4565 0.4740 -0.0085 -0.0218 -0.0119 41  PHE B CE1 
1535 C CE2 . PHE B 42  ? 0.4437 0.4556 0.4766 -0.0111 -0.0305 -0.0051 41  PHE B CE2 
1536 C CZ  . PHE B 42  ? 0.4413 0.4562 0.4736 -0.0107 -0.0274 -0.0075 41  PHE B CZ  
1537 N N   . THR B 43  ? 0.4806 0.4801 0.4878 -0.0085 -0.0142 -0.0181 42  THR B N   
1538 C CA  . THR B 43  ? 0.4906 0.4870 0.4944 -0.0091 -0.0122 -0.0203 42  THR B CA  
1539 C C   . THR B 43  ? 0.5054 0.5034 0.5020 -0.0088 -0.0093 -0.0220 42  THR B C   
1540 O O   . THR B 43  ? 0.4980 0.4999 0.4907 -0.0086 -0.0099 -0.0205 42  THR B O   
1541 C CB  . THR B 43  ? 0.4884 0.4845 0.4890 -0.0114 -0.0152 -0.0183 42  THR B CB  
1542 O OG1 . THR B 43  ? 0.4808 0.4820 0.4758 -0.0126 -0.0169 -0.0161 42  THR B OG1 
1543 C CG2 . THR B 43  ? 0.4906 0.4840 0.4981 -0.0118 -0.0184 -0.0160 42  THR B CG2 
1544 N N   . GLY B 44  ? 0.5184 0.5132 0.5133 -0.0088 -0.0059 -0.0251 43  GLY B N   
1545 C CA  . GLY B 44  ? 0.5315 0.5269 0.5194 -0.0088 -0.0033 -0.0265 43  GLY B CA  
1546 C C   . GLY B 44  ? 0.5378 0.5373 0.5189 -0.0093 -0.0051 -0.0242 43  GLY B C   
1547 O O   . GLY B 44  ? 0.5385 0.5398 0.5164 -0.0081 -0.0042 -0.0237 43  GLY B O   
1548 N N   . ILE B 45  ? 0.5469 0.5478 0.5263 -0.0110 -0.0076 -0.0230 44  ILE B N   
1549 C CA  . ILE B 45  ? 0.5589 0.5645 0.5331 -0.0115 -0.0093 -0.0211 44  ILE B CA  
1550 C C   . ILE B 45  ? 0.5426 0.5526 0.5181 -0.0103 -0.0107 -0.0189 44  ILE B C   
1551 O O   . ILE B 45  ? 0.5412 0.5543 0.5139 -0.0092 -0.0102 -0.0182 44  ILE B O   
1552 C CB  . ILE B 45  ? 0.5898 0.5962 0.5619 -0.0143 -0.0113 -0.0207 44  ILE B CB  
1553 C CG1 . ILE B 45  ? 0.6032 0.6152 0.5703 -0.0149 -0.0125 -0.0194 44  ILE B CG1 
1554 C CG2 . ILE B 45  ? 0.5966 0.6031 0.5726 -0.0155 -0.0139 -0.0191 44  ILE B CG2 
1555 C CD1 . ILE B 45  ? 0.6156 0.6273 0.5781 -0.0143 -0.0109 -0.0202 44  ILE B CD1 
1556 N N   . CYS B 46  ? 0.5274 0.5374 0.5073 -0.0108 -0.0123 -0.0179 45  CYS B N   
1557 C CA  . CYS B 46  ? 0.5142 0.5280 0.4947 -0.0107 -0.0134 -0.0162 45  CYS B CA  
1558 C C   . CYS B 46  ? 0.4917 0.5052 0.4727 -0.0085 -0.0109 -0.0171 45  CYS B C   
1559 O O   . CYS B 46  ? 0.4866 0.5031 0.4660 -0.0079 -0.0103 -0.0166 45  CYS B O   
1560 C CB  . CYS B 46  ? 0.5228 0.5360 0.5070 -0.0124 -0.0160 -0.0145 45  CYS B CB  
1561 S SG  . CYS B 46  ? 0.5642 0.5768 0.5474 -0.0155 -0.0190 -0.0132 45  CYS B SG  
1562 N N   . GLN B 47  ? 0.4755 0.4850 0.4591 -0.0075 -0.0091 -0.0187 46  GLN B N   
1563 C CA  . GLN B 47  ? 0.4716 0.4801 0.4554 -0.0058 -0.0064 -0.0198 46  GLN B CA  
1564 C C   . GLN B 47  ? 0.4615 0.4706 0.4398 -0.0046 -0.0046 -0.0199 46  GLN B C   
1565 O O   . GLN B 47  ? 0.4430 0.4535 0.4204 -0.0036 -0.0036 -0.0195 46  GLN B O   
1566 C CB  . GLN B 47  ? 0.4796 0.4840 0.4668 -0.0054 -0.0042 -0.0221 46  GLN B CB  
1567 C CG  . GLN B 47  ? 0.4865 0.4899 0.4748 -0.0043 -0.0014 -0.0235 46  GLN B CG  
1568 C CD  . GLN B 47  ? 0.4942 0.5000 0.4873 -0.0046 -0.0030 -0.0224 46  GLN B CD  
1569 O OE1 . GLN B 47  ? 0.5037 0.5097 0.5029 -0.0051 -0.0050 -0.0219 46  GLN B OE1 
1570 N NE2 . GLN B 47  ? 0.4991 0.5066 0.4896 -0.0045 -0.0021 -0.0220 46  GLN B NE2 
1571 N N   . GLY B 48  ? 0.4632 0.4711 0.4380 -0.0049 -0.0044 -0.0203 47  GLY B N   
1572 C CA  . GLY B 48  ? 0.4683 0.4769 0.4381 -0.0039 -0.0036 -0.0197 47  GLY B CA  
1573 C C   . GLY B 48  ? 0.4698 0.4833 0.4393 -0.0030 -0.0051 -0.0178 47  GLY B C   
1574 O O   . GLY B 48  ? 0.4705 0.4842 0.4385 -0.0011 -0.0039 -0.0171 47  GLY B O   
1575 N N   . GLU B 49  ? 0.4798 0.4969 0.4508 -0.0045 -0.0075 -0.0170 48  GLU B N   
1576 C CA  . GLU B 49  ? 0.4837 0.5063 0.4552 -0.0042 -0.0084 -0.0157 48  GLU B CA  
1577 C C   . GLU B 49  ? 0.4753 0.4985 0.4489 -0.0034 -0.0069 -0.0160 48  GLU B C   
1578 O O   . GLU B 49  ? 0.4669 0.4923 0.4405 -0.0017 -0.0056 -0.0157 48  GLU B O   
1579 C CB  . GLU B 49  ? 0.4986 0.5248 0.4706 -0.0068 -0.0110 -0.0151 48  GLU B CB  
1580 C CG  . GLU B 49  ? 0.5193 0.5464 0.4887 -0.0078 -0.0124 -0.0149 48  GLU B CG  
1581 C CD  . GLU B 49  ? 0.5316 0.5623 0.5013 -0.0108 -0.0147 -0.0144 48  GLU B CD  
1582 O OE1 . GLU B 49  ? 0.5538 0.5833 0.5251 -0.0127 -0.0155 -0.0142 48  GLU B OE1 
1583 O OE2 . GLU B 49  ? 0.5304 0.5652 0.4986 -0.0116 -0.0159 -0.0139 48  GLU B OE2 
1584 N N   . LEU B 50  ? 0.4665 0.4878 0.4420 -0.0048 -0.0069 -0.0165 49  LEU B N   
1585 C CA  . LEU B 50  ? 0.4738 0.4957 0.4505 -0.0049 -0.0055 -0.0170 49  LEU B CA  
1586 C C   . LEU B 50  ? 0.4787 0.4971 0.4548 -0.0027 -0.0024 -0.0180 49  LEU B C   
1587 O O   . LEU B 50  ? 0.4741 0.4930 0.4501 -0.0023 -0.0004 -0.0186 49  LEU B O   
1588 C CB  . LEU B 50  ? 0.4757 0.4976 0.4547 -0.0076 -0.0073 -0.0166 49  LEU B CB  
1589 C CG  . LEU B 50  ? 0.4794 0.5043 0.4585 -0.0105 -0.0104 -0.0152 49  LEU B CG  
1590 C CD1 . LEU B 50  ? 0.4807 0.5054 0.4616 -0.0132 -0.0124 -0.0142 49  LEU B CD1 
1591 C CD2 . LEU B 50  ? 0.4825 0.5123 0.4598 -0.0112 -0.0099 -0.0152 49  LEU B CD2 
1592 N N   . ASP B 51  ? 0.4897 0.5041 0.4648 -0.0017 -0.0016 -0.0185 50  ASP B N   
1593 C CA  . ASP B 51  ? 0.4991 0.5096 0.4725 0.0000  0.0014  -0.0194 50  ASP B CA  
1594 C C   . ASP B 51  ? 0.4995 0.5105 0.4705 0.0022  0.0023  -0.0183 50  ASP B C   
1595 O O   . ASP B 51  ? 0.4919 0.5007 0.4623 0.0034  0.0048  -0.0187 50  ASP B O   
1596 C CB  . ASP B 51  ? 0.5031 0.5093 0.4751 -0.0001 0.0024  -0.0203 50  ASP B CB  
1597 C CG  . ASP B 51  ? 0.5154 0.5203 0.4915 -0.0014 0.0027  -0.0219 50  ASP B CG  
1598 O OD1 . ASP B 51  ? 0.5202 0.5274 0.4998 -0.0024 0.0016  -0.0217 50  ASP B OD1 
1599 O OD2 . ASP B 51  ? 0.5191 0.5209 0.4952 -0.0017 0.0040  -0.0233 50  ASP B OD2 
1600 N N   . GLN B 52  ? 0.5035 0.5172 0.4735 0.0026  0.0002  -0.0169 51  GLN B N   
1601 C CA  . GLN B 52  ? 0.5226 0.5379 0.4918 0.0050  0.0002  -0.0154 51  GLN B CA  
1602 C C   . GLN B 52  ? 0.5110 0.5299 0.4836 0.0057  0.0013  -0.0158 51  GLN B C   
1603 O O   . GLN B 52  ? 0.5151 0.5332 0.4884 0.0082  0.0030  -0.0153 51  GLN B O   
1604 C CB  . GLN B 52  ? 0.5506 0.5693 0.5186 0.0046  -0.0027 -0.0139 51  GLN B CB  
1605 C CG  . GLN B 52  ? 0.5829 0.6033 0.5505 0.0073  -0.0035 -0.0117 51  GLN B CG  
1606 C CD  . GLN B 52  ? 0.6036 0.6285 0.5700 0.0063  -0.0068 -0.0102 51  GLN B CD  
1607 O OE1 . GLN B 52  ? 0.6245 0.6503 0.5899 0.0034  -0.0081 -0.0111 51  GLN B OE1 
1608 N NE2 . GLN B 52  ? 0.6208 0.6485 0.5879 0.0085  -0.0083 -0.0078 51  GLN B NE2 
1609 N N   . LEU B 53  ? 0.4972 0.5196 0.4717 0.0032  0.0004  -0.0167 52  LEU B N   
1610 C CA  . LEU B 53  ? 0.4884 0.5142 0.4652 0.0025  0.0018  -0.0177 52  LEU B CA  
1611 C C   . LEU B 53  ? 0.4748 0.4967 0.4514 0.0026  0.0051  -0.0192 52  LEU B C   
1612 O O   . LEU B 53  ? 0.4674 0.4897 0.4454 0.0036  0.0078  -0.0203 52  LEU B O   
1613 C CB  . LEU B 53  ? 0.4931 0.5230 0.4706 -0.0012 -0.0003 -0.0179 52  LEU B CB  
1614 C CG  . LEU B 53  ? 0.5017 0.5353 0.4803 -0.0036 0.0010  -0.0192 52  LEU B CG  
1615 C CD1 . LEU B 53  ? 0.5091 0.5457 0.4902 -0.0014 0.0036  -0.0201 52  LEU B CD1 
1616 C CD2 . LEU B 53  ? 0.5054 0.5427 0.4835 -0.0075 -0.0019 -0.0185 52  LEU B CD2 
1617 N N   . ARG B 54  ? 0.4606 0.4788 0.4359 0.0013  0.0051  -0.0197 53  ARG B N   
1618 C CA  . ARG B 54  ? 0.4553 0.4697 0.4301 0.0009  0.0081  -0.0212 53  ARG B CA  
1619 C C   . ARG B 54  ? 0.4582 0.4681 0.4316 0.0041  0.0109  -0.0211 53  ARG B C   
1620 O O   . ARG B 54  ? 0.4591 0.4671 0.4327 0.0044  0.0141  -0.0225 53  ARG B O   
1621 C CB  . ARG B 54  ? 0.4445 0.4564 0.4192 -0.0006 0.0072  -0.0216 53  ARG B CB  
1622 C CG  . ARG B 54  ? 0.4432 0.4514 0.4175 -0.0012 0.0101  -0.0232 53  ARG B CG  
1623 C CD  . ARG B 54  ? 0.4368 0.4427 0.4120 -0.0018 0.0095  -0.0235 53  ARG B CD  
1624 N NE  . ARG B 54  ? 0.4309 0.4337 0.4039 0.0003  0.0098  -0.0229 53  ARG B NE  
1625 C CZ  . ARG B 54  ? 0.4269 0.4280 0.4004 -0.0001 0.0094  -0.0234 53  ARG B CZ  
1626 N NH1 . ARG B 54  ? 0.4296 0.4320 0.4073 -0.0017 0.0085  -0.0244 53  ARG B NH1 
1627 N NH2 . ARG B 54  ? 0.4302 0.4285 0.4004 0.0010  0.0099  -0.0230 53  ARG B NH2 
1628 N N   . ASP B 55  ? 0.4563 0.4641 0.4280 0.0062  0.0098  -0.0195 54  ASP B N   
1629 C CA  . ASP B 55  ? 0.4687 0.4716 0.4383 0.0090  0.0117  -0.0185 54  ASP B CA  
1630 C C   . ASP B 55  ? 0.4770 0.4816 0.4493 0.0118  0.0127  -0.0177 54  ASP B C   
1631 O O   . ASP B 55  ? 0.4885 0.4882 0.4603 0.0139  0.0153  -0.0175 54  ASP B O   
1632 C CB  . ASP B 55  ? 0.4676 0.4685 0.4340 0.0097  0.0097  -0.0166 54  ASP B CB  
1633 C CG  . ASP B 55  ? 0.4698 0.4680 0.4341 0.0073  0.0100  -0.0179 54  ASP B CG  
1634 O OD1 . ASP B 55  ? 0.4803 0.4782 0.4464 0.0055  0.0114  -0.0200 54  ASP B OD1 
1635 O OD2 . ASP B 55  ? 0.4670 0.4638 0.4284 0.0069  0.0088  -0.0171 54  ASP B OD2 
1636 N N   . HIS B 56  ? 0.4797 0.4909 0.4552 0.0118  0.0107  -0.0174 55  HIS B N   
1637 C CA  . HIS B 56  ? 0.4838 0.4978 0.4635 0.0146  0.0117  -0.0170 55  HIS B CA  
1638 C C   . HIS B 56  ? 0.4801 0.4983 0.4629 0.0124  0.0138  -0.0199 55  HIS B C   
1639 O O   . HIS B 56  ? 0.4657 0.4888 0.4530 0.0137  0.0143  -0.0202 55  HIS B O   
1640 C CB  . HIS B 56  ? 0.4912 0.5107 0.4726 0.0160  0.0079  -0.0145 55  HIS B CB  
1641 C CG  . HIS B 56  ? 0.5002 0.5163 0.4775 0.0170  0.0054  -0.0117 55  HIS B CG  
1642 N ND1 . HIS B 56  ? 0.5105 0.5268 0.4840 0.0143  0.0030  -0.0115 55  HIS B ND1 
1643 C CD2 . HIS B 56  ? 0.5150 0.5274 0.4911 0.0200  0.0049  -0.0090 55  HIS B CD2 
1644 C CE1 . HIS B 56  ? 0.5152 0.5282 0.4847 0.0152  0.0016  -0.0092 55  HIS B CE1 
1645 N NE2 . HIS B 56  ? 0.5191 0.5297 0.4897 0.0185  0.0024  -0.0073 55  HIS B NE2 
1646 N N   . LEU B 57  ? 0.4824 0.4989 0.4629 0.0089  0.0152  -0.0220 56  LEU B N   
1647 C CA  . LEU B 57  ? 0.4857 0.5061 0.4674 0.0054  0.0168  -0.0246 56  LEU B CA  
1648 C C   . LEU B 57  ? 0.5004 0.5219 0.4857 0.0066  0.0210  -0.0268 56  LEU B C   
1649 O O   . LEU B 57  ? 0.4995 0.5267 0.4869 0.0045  0.0215  -0.0283 56  LEU B O   
1650 C CB  . LEU B 57  ? 0.4866 0.5043 0.4651 0.0015  0.0175  -0.0260 56  LEU B CB  
1651 C CG  . LEU B 57  ? 0.4868 0.5086 0.4648 -0.0034 0.0181  -0.0281 56  LEU B CG  
1652 C CD1 . LEU B 57  ? 0.4829 0.5106 0.4614 -0.0054 0.0144  -0.0268 56  LEU B CD1 
1653 C CD2 . LEU B 57  ? 0.4894 0.5088 0.4647 -0.0071 0.0180  -0.0289 56  LEU B CD2 
1654 N N   . PRO B 58  ? 0.5165 0.5322 0.5027 0.0098  0.0243  -0.0271 57  PRO B N   
1655 C CA  . PRO B 58  ? 0.5280 0.5442 0.5189 0.0113  0.0288  -0.0296 57  PRO B CA  
1656 C C   . PRO B 58  ? 0.5330 0.5558 0.5303 0.0142  0.0277  -0.0288 57  PRO B C   
1657 O O   . PRO B 58  ? 0.5405 0.5660 0.5425 0.0143  0.0315  -0.0317 57  PRO B O   
1658 C CB  . PRO B 58  ? 0.5359 0.5435 0.5265 0.0150  0.0314  -0.0289 57  PRO B CB  
1659 C CG  . PRO B 58  ? 0.5359 0.5388 0.5202 0.0129  0.0299  -0.0279 57  PRO B CG  
1660 C CD  . PRO B 58  ? 0.5256 0.5336 0.5085 0.0115  0.0246  -0.0258 57  PRO B CD  
1661 N N   . GLU B 59  ? 0.5442 0.5699 0.5419 0.0163  0.0230  -0.0252 58  GLU B N   
1662 C CA  . GLU B 59  ? 0.5601 0.5931 0.5639 0.0186  0.0213  -0.0242 58  GLU B CA  
1663 C C   . GLU B 59  ? 0.5494 0.5903 0.5533 0.0140  0.0203  -0.0260 58  GLU B C   
1664 O O   . GLU B 59  ? 0.5406 0.5886 0.5502 0.0148  0.0201  -0.0264 58  GLU B O   
1665 C CB  . GLU B 59  ? 0.5878 0.6208 0.5911 0.0218  0.0164  -0.0196 58  GLU B CB  
1666 C CG  . GLU B 59  ? 0.6248 0.6500 0.6275 0.0261  0.0169  -0.0171 58  GLU B CG  
1667 C CD  . GLU B 59  ? 0.6582 0.6829 0.6584 0.0281  0.0119  -0.0125 58  GLU B CD  
1668 O OE1 . GLU B 59  ? 0.6971 0.7142 0.6933 0.0296  0.0118  -0.0104 58  GLU B OE1 
1669 O OE2 . GLU B 59  ? 0.6660 0.6979 0.6677 0.0275  0.0082  -0.0111 58  GLU B OE2 
1670 N N   . PHE B 60  ? 0.5386 0.5781 0.5364 0.0090  0.0197  -0.0270 59  PHE B N   
1671 C CA  . PHE B 60  ? 0.5388 0.5844 0.5352 0.0039  0.0184  -0.0282 59  PHE B CA  
1672 C C   . PHE B 60  ? 0.5384 0.5838 0.5325 -0.0011 0.0221  -0.0319 59  PHE B C   
1673 O O   . PHE B 60  ? 0.5438 0.5950 0.5385 -0.0049 0.0230  -0.0337 59  PHE B O   
1674 C CB  . PHE B 60  ? 0.5342 0.5790 0.5256 0.0017  0.0135  -0.0256 59  PHE B CB  
1675 C CG  . PHE B 60  ? 0.5359 0.5808 0.5281 0.0053  0.0099  -0.0224 59  PHE B CG  
1676 C CD1 . PHE B 60  ? 0.5375 0.5889 0.5335 0.0063  0.0081  -0.0214 59  PHE B CD1 
1677 C CD2 . PHE B 60  ? 0.5385 0.5770 0.5273 0.0071  0.0085  -0.0205 59  PHE B CD2 
1678 C CE1 . PHE B 60  ? 0.5425 0.5944 0.5385 0.0089  0.0045  -0.0184 59  PHE B CE1 
1679 C CE2 . PHE B 60  ? 0.5441 0.5826 0.5325 0.0095  0.0054  -0.0177 59  PHE B CE2 
1680 C CZ  . PHE B 60  ? 0.5411 0.5862 0.5328 0.0103  0.0032  -0.0166 59  PHE B CZ  
1681 N N   . GLU B 61  ? 0.5409 0.5800 0.5317 -0.0018 0.0243  -0.0329 60  GLU B N   
1682 C CA  . GLU B 61  ? 0.5532 0.5918 0.5409 -0.0072 0.0277  -0.0363 60  GLU B CA  
1683 C C   . GLU B 61  ? 0.5472 0.5819 0.5380 -0.0048 0.0338  -0.0395 60  GLU B C   
1684 O O   . GLU B 61  ? 0.5446 0.5726 0.5339 -0.0029 0.0351  -0.0392 60  GLU B O   
1685 C CB  . GLU B 61  ? 0.5731 0.6081 0.5548 -0.0107 0.0250  -0.0350 60  GLU B CB  
1686 C CG  . GLU B 61  ? 0.6033 0.6383 0.5808 -0.0171 0.0275  -0.0380 60  GLU B CG  
1687 C CD  . GLU B 61  ? 0.6284 0.6619 0.6013 -0.0208 0.0235  -0.0359 60  GLU B CD  
1688 O OE1 . GLU B 61  ? 0.6476 0.6783 0.6175 -0.0238 0.0254  -0.0376 60  GLU B OE1 
1689 O OE2 . GLU B 61  ? 0.6365 0.6717 0.6091 -0.0207 0.0184  -0.0327 60  GLU B OE2 
1690 N N   . ASN B 62  ? 0.5371 0.5760 0.5324 -0.0052 0.0378  -0.0427 61  ASN B N   
1691 C CA  . ASN B 62  ? 0.5418 0.5772 0.5417 -0.0026 0.0443  -0.0462 61  ASN B CA  
1692 C C   . ASN B 62  ? 0.5474 0.5876 0.5494 -0.0070 0.0497  -0.0515 61  ASN B C   
1693 O O   . ASN B 62  ? 0.5479 0.5932 0.5455 -0.0133 0.0484  -0.0524 61  ASN B O   
1694 C CB  . ASN B 62  ? 0.5386 0.5728 0.5460 0.0055  0.0436  -0.0435 61  ASN B CB  
1695 C CG  . ASN B 62  ? 0.5358 0.5787 0.5492 0.0075  0.0407  -0.0420 61  ASN B CG  
1696 O OD1 . ASN B 62  ? 0.5251 0.5745 0.5417 0.0047  0.0434  -0.0453 61  ASN B OD1 
1697 N ND2 . ASN B 62  ? 0.5345 0.5778 0.5492 0.0119  0.0355  -0.0373 61  ASN B ND2 
1698 N N   . ASP B 63  ? 0.5581 0.5964 0.5665 -0.0040 0.0559  -0.0550 62  ASP B N   
1699 C CA  . ASP B 63  ? 0.5728 0.6153 0.5840 -0.0081 0.0623  -0.0610 62  ASP B CA  
1700 C C   . ASP B 63  ? 0.5566 0.6092 0.5726 -0.0089 0.0609  -0.0612 62  ASP B C   
1701 O O   . ASP B 63  ? 0.5508 0.6081 0.5655 -0.0151 0.0648  -0.0657 62  ASP B O   
1702 C CB  . ASP B 63  ? 0.5936 0.6313 0.6127 -0.0035 0.0695  -0.0647 62  ASP B CB  
1703 C CG  . ASP B 63  ? 0.6249 0.6527 0.6383 -0.0049 0.0726  -0.0662 62  ASP B CG  
1704 O OD1 . ASP B 63  ? 0.6409 0.6677 0.6451 -0.0126 0.0734  -0.0684 62  ASP B OD1 
1705 O OD2 . ASP B 63  ? 0.6361 0.6570 0.6542 0.0014  0.0742  -0.0650 62  ASP B OD2 
1706 N N   . ASP B 64  ? 0.5422 0.5981 0.5631 -0.0034 0.0556  -0.0565 63  ASP B N   
1707 C CA  . ASP B 64  ? 0.5319 0.5976 0.5578 -0.0038 0.0539  -0.0564 63  ASP B CA  
1708 C C   . ASP B 64  ? 0.4981 0.5672 0.5169 -0.0073 0.0467  -0.0523 63  ASP B C   
1709 O O   . ASP B 64  ? 0.4837 0.5606 0.5040 -0.0102 0.0457  -0.0529 63  ASP B O   
1710 C CB  . ASP B 64  ? 0.5507 0.6190 0.5884 0.0049  0.0529  -0.0541 63  ASP B CB  
1711 C CG  . ASP B 64  ? 0.5838 0.6484 0.6305 0.0097  0.0596  -0.0576 63  ASP B CG  
1712 O OD1 . ASP B 64  ? 0.6139 0.6772 0.6599 0.0054  0.0666  -0.0635 63  ASP B OD1 
1713 O OD2 . ASP B 64  ? 0.5988 0.6615 0.6531 0.0175  0.0579  -0.0543 63  ASP B OD2 
1714 N N   . SER B 65  ? 0.4681 0.5311 0.4798 -0.0072 0.0421  -0.0484 64  SER B N   
1715 C CA  . SER B 65  ? 0.4508 0.5159 0.4570 -0.0096 0.0354  -0.0444 64  SER B CA  
1716 C C   . SER B 65  ? 0.4343 0.4943 0.4308 -0.0145 0.0329  -0.0431 64  SER B C   
1717 O O   . SER B 65  ? 0.4415 0.4952 0.4354 -0.0143 0.0350  -0.0440 64  SER B O   
1718 C CB  . SER B 65  ? 0.4513 0.5156 0.4609 -0.0029 0.0307  -0.0397 64  SER B CB  
1719 O OG  . SER B 65  ? 0.4537 0.5232 0.4730 0.0020  0.0320  -0.0400 64  SER B OG  
1720 N N   . ALA B 66  ? 0.4116 0.4744 0.4033 -0.0188 0.0284  -0.0409 65  ALA B N   
1721 C CA  . ALA B 66  ? 0.3997 0.4586 0.3836 -0.0230 0.0247  -0.0387 65  ALA B CA  
1722 C C   . ALA B 66  ? 0.3821 0.4414 0.3653 -0.0214 0.0184  -0.0343 65  ALA B C   
1723 O O   . ALA B 66  ? 0.3788 0.4430 0.3650 -0.0204 0.0170  -0.0335 65  ALA B O   
1724 C CB  . ALA B 66  ? 0.4009 0.4624 0.3791 -0.0314 0.0258  -0.0408 65  ALA B CB  
1725 N N   . ALA B 67  ? 0.3730 0.4272 0.3526 -0.0212 0.0150  -0.0316 66  ALA B N   
1726 C CA  . ALA B 67  ? 0.3634 0.4168 0.3422 -0.0198 0.0097  -0.0279 66  ALA B CA  
1727 C C   . ALA B 67  ? 0.3561 0.4078 0.3300 -0.0249 0.0060  -0.0261 66  ALA B C   
1728 O O   . ALA B 67  ? 0.3648 0.4132 0.3364 -0.0265 0.0064  -0.0263 66  ALA B O   
1729 C CB  . ALA B 67  ? 0.3638 0.4124 0.3445 -0.0139 0.0091  -0.0264 66  ALA B CB  
1730 N N   . LEU B 68  ? 0.3469 0.4009 0.3194 -0.0274 0.0023  -0.0240 67  LEU B N   
1731 C CA  . LEU B 68  ? 0.3402 0.3924 0.3088 -0.0319 -0.0018 -0.0215 67  LEU B CA  
1732 C C   . LEU B 68  ? 0.3291 0.3792 0.2986 -0.0299 -0.0061 -0.0185 67  LEU B C   
1733 O O   . LEU B 68  ? 0.3258 0.3788 0.2962 -0.0294 -0.0068 -0.0182 67  LEU B O   
1734 C CB  . LEU B 68  ? 0.3495 0.4058 0.3142 -0.0387 -0.0019 -0.0220 67  LEU B CB  
1735 C CG  . LEU B 68  ? 0.3581 0.4170 0.3211 -0.0422 0.0030  -0.0257 67  LEU B CG  
1736 C CD1 . LEU B 68  ? 0.3624 0.4257 0.3212 -0.0494 0.0030  -0.0263 67  LEU B CD1 
1737 C CD2 . LEU B 68  ? 0.3604 0.4157 0.3208 -0.0440 0.0034  -0.0260 67  LEU B CD2 
1738 N N   . ALA B 69  ? 0.3187 0.3641 0.2884 -0.0288 -0.0087 -0.0166 68  ALA B N   
1739 C CA  . ALA B 69  ? 0.3119 0.3546 0.2828 -0.0272 -0.0123 -0.0143 68  ALA B CA  
1740 C C   . ALA B 69  ? 0.3093 0.3515 0.2778 -0.0323 -0.0163 -0.0117 68  ALA B C   
1741 O O   . ALA B 69  ? 0.3128 0.3549 0.2794 -0.0359 -0.0172 -0.0110 68  ALA B O   
1742 C CB  . ALA B 69  ? 0.3104 0.3483 0.2838 -0.0233 -0.0123 -0.0140 68  ALA B CB  
1743 N N   . ILE B 70  ? 0.3045 0.3462 0.2728 -0.0331 -0.0189 -0.0101 69  ILE B N   
1744 C CA  . ILE B 70  ? 0.3088 0.3493 0.2747 -0.0380 -0.0229 -0.0071 69  ILE B CA  
1745 C C   . ILE B 70  ? 0.3099 0.3456 0.2780 -0.0365 -0.0262 -0.0049 69  ILE B C   
1746 O O   . ILE B 70  ? 0.3073 0.3426 0.2766 -0.0339 -0.0253 -0.0060 69  ILE B O   
1747 C CB  . ILE B 70  ? 0.3106 0.3556 0.2724 -0.0429 -0.0224 -0.0075 69  ILE B CB  
1748 C CG1 . ILE B 70  ? 0.3105 0.3605 0.2710 -0.0443 -0.0181 -0.0107 69  ILE B CG1 
1749 C CG2 . ILE B 70  ? 0.3164 0.3594 0.2744 -0.0488 -0.0267 -0.0041 69  ILE B CG2 
1750 C CD1 . ILE B 70  ? 0.3146 0.3699 0.2720 -0.0491 -0.0166 -0.0120 69  ILE B CD1 
1751 N N   . SER B 71  ? 0.3132 0.3452 0.2821 -0.0384 -0.0300 -0.0019 70  SER B N   
1752 C CA  A SER B 71  ? 0.3153 0.3420 0.2873 -0.0371 -0.0330 0.0002  70  SER B CA  
1753 C CA  B SER B 71  ? 0.3141 0.3408 0.2860 -0.0372 -0.0330 0.0002  70  SER B CA  
1754 C C   . SER B 71  ? 0.3194 0.3435 0.2907 -0.0413 -0.0379 0.0045  70  SER B C   
1755 O O   . SER B 71  ? 0.3217 0.3481 0.2899 -0.0450 -0.0391 0.0058  70  SER B O   
1756 C CB  A SER B 71  ? 0.3133 0.3369 0.2911 -0.0317 -0.0317 -0.0011 70  SER B CB  
1757 C CB  B SER B 71  ? 0.3108 0.3342 0.2884 -0.0318 -0.0318 -0.0011 70  SER B CB  
1758 O OG  A SER B 71  ? 0.3196 0.3378 0.3015 -0.0305 -0.0342 0.0005  70  SER B OG  
1759 O OG  B SER B 71  ? 0.3108 0.3339 0.2913 -0.0315 -0.0329 0.0000  70  SER B OG  
1760 N N   . VAL B 72  ? 0.3246 0.3435 0.2985 -0.0409 -0.0408 0.0067  71  VAL B N   
1761 C CA  . VAL B 72  ? 0.3354 0.3508 0.3094 -0.0445 -0.0461 0.0116  71  VAL B CA  
1762 C C   . VAL B 72  ? 0.3397 0.3536 0.3195 -0.0427 -0.0489 0.0138  71  VAL B C   
1763 O O   . VAL B 72  ? 0.3488 0.3605 0.3293 -0.0456 -0.0540 0.0185  71  VAL B O   
1764 C CB  . VAL B 72  ? 0.3406 0.3500 0.3158 -0.0448 -0.0483 0.0134  71  VAL B CB  
1765 C CG1 . VAL B 72  ? 0.3405 0.3521 0.3095 -0.0476 -0.0460 0.0114  71  VAL B CG1 
1766 C CG2 . VAL B 72  ? 0.3398 0.3446 0.3230 -0.0390 -0.0471 0.0118  71  VAL B CG2 
1767 N N   . GLY B 73  ? 0.3344 0.3499 0.3187 -0.0381 -0.0457 0.0107  72  GLY B N   
1768 C CA  . GLY B 73  ? 0.3398 0.3550 0.3304 -0.0364 -0.0478 0.0122  72  GLY B CA  
1769 C C   . GLY B 73  ? 0.3468 0.3661 0.3333 -0.0410 -0.0500 0.0143  72  GLY B C   
1770 O O   . GLY B 73  ? 0.3473 0.3704 0.3264 -0.0442 -0.0475 0.0124  72  GLY B O   
1771 N N   . PRO B 74  ? 0.3543 0.3731 0.3458 -0.0416 -0.0547 0.0180  73  PRO B N   
1772 C CA  . PRO B 74  ? 0.3591 0.3820 0.3464 -0.0467 -0.0573 0.0202  73  PRO B CA  
1773 C C   . PRO B 74  ? 0.3554 0.3823 0.3439 -0.0448 -0.0532 0.0162  73  PRO B C   
1774 O O   . PRO B 74  ? 0.3538 0.3796 0.3479 -0.0392 -0.0495 0.0128  73  PRO B O   
1775 C CB  . PRO B 74  ? 0.3640 0.3847 0.3577 -0.0474 -0.0646 0.0262  73  PRO B CB  
1776 C CG  . PRO B 74  ? 0.3595 0.3763 0.3643 -0.0405 -0.0637 0.0250  73  PRO B CG  
1777 C CD  . PRO B 74  ? 0.3563 0.3707 0.3580 -0.0380 -0.0583 0.0207  73  PRO B CD  
1778 N N   . PRO B 75  ? 0.3595 0.3905 0.3423 -0.0500 -0.0537 0.0166  74  PRO B N   
1779 C CA  . PRO B 75  ? 0.3592 0.3934 0.3420 -0.0491 -0.0494 0.0125  74  PRO B CA  
1780 C C   . PRO B 75  ? 0.3576 0.3917 0.3503 -0.0442 -0.0494 0.0119  74  PRO B C   
1781 O O   . PRO B 75  ? 0.3526 0.3869 0.3464 -0.0407 -0.0440 0.0073  74  PRO B O   
1782 C CB  . PRO B 75  ? 0.3640 0.4020 0.3392 -0.0568 -0.0516 0.0142  74  PRO B CB  
1783 C CG  . PRO B 75  ? 0.3690 0.4060 0.3372 -0.0617 -0.0544 0.0172  74  PRO B CG  
1784 C CD  . PRO B 75  ? 0.3688 0.4012 0.3436 -0.0577 -0.0579 0.0204  74  PRO B CD  
1785 N N   . PRO B 76  ? 0.3653 0.3990 0.3654 -0.0439 -0.0554 0.0164  75  PRO B N   
1786 C CA  . PRO B 76  ? 0.3660 0.4004 0.3766 -0.0394 -0.0549 0.0151  75  PRO B CA  
1787 C C   . PRO B 76  ? 0.3656 0.3963 0.3810 -0.0328 -0.0498 0.0110  75  PRO B C   
1788 O O   . PRO B 76  ? 0.3613 0.3929 0.3809 -0.0297 -0.0458 0.0074  75  PRO B O   
1789 C CB  . PRO B 76  ? 0.3709 0.4052 0.3897 -0.0398 -0.0627 0.0212  75  PRO B CB  
1790 C CG  . PRO B 76  ? 0.3764 0.4113 0.3862 -0.0467 -0.0677 0.0259  75  PRO B CG  
1791 C CD  . PRO B 76  ? 0.3752 0.4080 0.3751 -0.0478 -0.0629 0.0228  75  PRO B CD  
1792 N N   . THR B 77  ? 0.3743 0.4010 0.3886 -0.0314 -0.0497 0.0115  76  THR B N   
1793 C CA  . THR B 77  ? 0.3775 0.4007 0.3946 -0.0263 -0.0449 0.0076  76  THR B CA  
1794 C C   . THR B 77  ? 0.3712 0.3957 0.3814 -0.0257 -0.0387 0.0029  76  THR B C   
1795 O O   . THR B 77  ? 0.3680 0.3917 0.3814 -0.0220 -0.0345 -0.0007 76  THR B O   
1796 C CB  . THR B 77  ? 0.3872 0.4061 0.4030 -0.0260 -0.0463 0.0091  76  THR B CB  
1797 O OG1 . THR B 77  ? 0.3953 0.4116 0.4192 -0.0254 -0.0516 0.0133  76  THR B OG1 
1798 C CG2 . THR B 77  ? 0.3870 0.4028 0.4031 -0.0219 -0.0410 0.0047  76  THR B CG2 
1799 N N   . HIS B 78  ? 0.3689 0.3953 0.3701 -0.0293 -0.0380 0.0028  77  HIS B N   
1800 C CA  . HIS B 78  ? 0.3655 0.3931 0.3611 -0.0285 -0.0322 -0.0013 77  HIS B CA  
1801 C C   . HIS B 78  ? 0.3713 0.4009 0.3676 -0.0285 -0.0296 -0.0036 77  HIS B C   
1802 O O   . HIS B 78  ? 0.3674 0.3962 0.3626 -0.0258 -0.0246 -0.0071 77  HIS B O   
1803 C CB  . HIS B 78  ? 0.3619 0.3916 0.3491 -0.0325 -0.0317 -0.0013 77  HIS B CB  
1804 C CG  . HIS B 78  ? 0.3594 0.3873 0.3448 -0.0327 -0.0331 0.0001  77  HIS B CG  
1805 N ND1 . HIS B 78  ? 0.3636 0.3932 0.3429 -0.0375 -0.0348 0.0017  77  HIS B ND1 
1806 C CD2 . HIS B 78  ? 0.3591 0.3836 0.3479 -0.0292 -0.0330 -0.0001 77  HIS B CD2 
1807 C CE1 . HIS B 78  ? 0.3636 0.3911 0.3428 -0.0368 -0.0357 0.0025  77  HIS B CE1 
1808 N NE2 . HIS B 78  ? 0.3612 0.3855 0.3461 -0.0319 -0.0347 0.0014  77  HIS B NE2 
1809 N N   . LYS B 79  ? 0.3858 0.4181 0.3838 -0.0319 -0.0332 -0.0013 78  LYS B N   
1810 C CA  . LYS B 79  ? 0.4005 0.4349 0.3991 -0.0327 -0.0310 -0.0034 78  LYS B CA  
1811 C C   . LYS B 79  ? 0.3959 0.4285 0.4019 -0.0277 -0.0283 -0.0057 78  LYS B C   
1812 O O   . LYS B 79  ? 0.3882 0.4202 0.3924 -0.0262 -0.0233 -0.0094 78  LYS B O   
1813 C CB  . LYS B 79  ? 0.4159 0.4540 0.4155 -0.0376 -0.0364 0.0002  78  LYS B CB  
1814 C CG  . LYS B 79  ? 0.4264 0.4675 0.4270 -0.0394 -0.0347 -0.0018 78  LYS B CG  
1815 C CD  . LYS B 79  ? 0.4408 0.4817 0.4331 -0.0411 -0.0286 -0.0061 78  LYS B CD  
1816 C CE  . LYS B 79  ? 0.4526 0.4962 0.4446 -0.0441 -0.0272 -0.0079 78  LYS B CE  
1817 N NZ  . LYS B 79  ? 0.4606 0.5029 0.4448 -0.0458 -0.0208 -0.0123 78  LYS B NZ  
1818 N N   . ILE B 80  ? 0.3998 0.4314 0.4143 -0.0252 -0.0315 -0.0038 79  ILE B N   
1819 C CA  . ILE B 80  ? 0.4012 0.4313 0.4235 -0.0209 -0.0287 -0.0064 79  ILE B CA  
1820 C C   . ILE B 80  ? 0.3944 0.4206 0.4130 -0.0176 -0.0232 -0.0100 79  ILE B C   
1821 O O   . ILE B 80  ? 0.3885 0.4137 0.4075 -0.0158 -0.0187 -0.0134 79  ILE B O   
1822 C CB  . ILE B 80  ? 0.4108 0.4401 0.4439 -0.0188 -0.0329 -0.0038 79  ILE B CB  
1823 C CG1 . ILE B 80  ? 0.4234 0.4572 0.4616 -0.0218 -0.0391 0.0004  79  ILE B CG1 
1824 C CG2 . ILE B 80  ? 0.4122 0.4400 0.4533 -0.0145 -0.0289 -0.0075 79  ILE B CG2 
1825 C CD1 . ILE B 80  ? 0.4279 0.4662 0.4682 -0.0235 -0.0381 -0.0011 79  ILE B CD1 
1826 N N   . TRP B 81  ? 0.3903 0.4143 0.4048 -0.0171 -0.0237 -0.0092 80  TRP B N   
1827 C CA  . TRP B 81  ? 0.3921 0.4129 0.4030 -0.0144 -0.0193 -0.0120 80  TRP B CA  
1828 C C   . TRP B 81  ? 0.3905 0.4119 0.3944 -0.0147 -0.0151 -0.0143 80  TRP B C   
1829 O O   . TRP B 81  ? 0.3945 0.4135 0.3974 -0.0123 -0.0110 -0.0170 80  TRP B O   
1830 C CB  . TRP B 81  ? 0.3932 0.4124 0.4013 -0.0145 -0.0212 -0.0104 80  TRP B CB  
1831 C CG  . TRP B 81  ? 0.3976 0.4138 0.4033 -0.0119 -0.0177 -0.0128 80  TRP B CG  
1832 C CD1 . TRP B 81  ? 0.4028 0.4161 0.4116 -0.0092 -0.0146 -0.0155 80  TRP B CD1 
1833 C CD2 . TRP B 81  ? 0.3996 0.4156 0.3992 -0.0122 -0.0172 -0.0128 80  TRP B CD2 
1834 N NE1 . TRP B 81  ? 0.4025 0.4137 0.4066 -0.0081 -0.0124 -0.0168 80  TRP B NE1 
1835 C CE2 . TRP B 81  ? 0.4011 0.4143 0.4001 -0.0097 -0.0142 -0.0151 80  TRP B CE2 
1836 C CE3 . TRP B 81  ? 0.4025 0.4211 0.3972 -0.0147 -0.0189 -0.0111 80  TRP B CE3 
1837 C CZ2 . TRP B 81  ? 0.4012 0.4142 0.3950 -0.0095 -0.0134 -0.0155 80  TRP B CZ2 
1838 C CZ3 . TRP B 81  ? 0.4050 0.4236 0.3955 -0.0142 -0.0177 -0.0118 80  TRP B CZ3 
1839 C CH2 . TRP B 81  ? 0.4005 0.4165 0.3907 -0.0116 -0.0153 -0.0138 80  TRP B CH2 
1840 N N   . ALA B 82  ? 0.3920 0.4160 0.3910 -0.0180 -0.0161 -0.0133 81  ALA B N   
1841 C CA  . ALA B 82  ? 0.3951 0.4195 0.3884 -0.0184 -0.0119 -0.0156 81  ALA B CA  
1842 C C   . ALA B 82  ? 0.4012 0.4247 0.3961 -0.0178 -0.0088 -0.0179 81  ALA B C   
1843 O O   . ALA B 82  ? 0.3937 0.4147 0.3857 -0.0158 -0.0044 -0.0203 81  ALA B O   
1844 C CB  . ALA B 82  ? 0.3957 0.4233 0.3842 -0.0228 -0.0132 -0.0146 81  ALA B CB  
1845 N N   . THR B 83  ? 0.4178 0.4436 0.4176 -0.0196 -0.0112 -0.0170 82  THR B N   
1846 C CA  . THR B 83  ? 0.4310 0.4568 0.4331 -0.0197 -0.0086 -0.0193 82  THR B CA  
1847 C C   . THR B 83  ? 0.4356 0.4577 0.4404 -0.0158 -0.0050 -0.0216 82  THR B C   
1848 O O   . THR B 83  ? 0.4509 0.4706 0.4525 -0.0151 -0.0005 -0.0241 82  THR B O   
1849 C CB  . THR B 83  ? 0.4370 0.4670 0.4455 -0.0224 -0.0128 -0.0174 82  THR B CB  
1850 O OG1 . THR B 83  ? 0.4422 0.4754 0.4462 -0.0271 -0.0158 -0.0153 82  THR B OG1 
1851 C CG2 . THR B 83  ? 0.4384 0.4691 0.4500 -0.0227 -0.0100 -0.0199 82  THR B CG2 
1852 N N   . GLN B 84  ? 0.4400 0.4612 0.4502 -0.0136 -0.0068 -0.0208 83  GLN B N   
1853 C CA  . GLN B 84  ? 0.4475 0.4652 0.4598 -0.0106 -0.0033 -0.0233 83  GLN B CA  
1854 C C   . GLN B 84  ? 0.4382 0.4520 0.4428 -0.0089 0.0001  -0.0245 83  GLN B C   
1855 O O   . GLN B 84  ? 0.4383 0.4490 0.4410 -0.0078 0.0042  -0.0268 83  GLN B O   
1856 C CB  . GLN B 84  ? 0.4661 0.4834 0.4858 -0.0090 -0.0058 -0.0225 83  GLN B CB  
1857 C CG  . GLN B 84  ? 0.4811 0.5019 0.5109 -0.0097 -0.0091 -0.0213 83  GLN B CG  
1858 C CD  . GLN B 84  ? 0.5029 0.5223 0.5407 -0.0076 -0.0112 -0.0206 83  GLN B CD  
1859 O OE1 . GLN B 84  ? 0.5130 0.5346 0.5612 -0.0070 -0.0131 -0.0202 83  GLN B OE1 
1860 N NE2 . GLN B 84  ? 0.5115 0.5273 0.5451 -0.0065 -0.0107 -0.0205 83  GLN B NE2 
1861 N N   . SER B 85  ? 0.4219 0.4361 0.4222 -0.0090 -0.0017 -0.0227 84  SER B N   
1862 C CA  . SER B 85  ? 0.4145 0.4261 0.4086 -0.0073 0.0005  -0.0232 84  SER B CA  
1863 C C   . SER B 85  ? 0.4084 0.4196 0.3972 -0.0076 0.0033  -0.0239 84  SER B C   
1864 O O   . SER B 85  ? 0.4031 0.4118 0.3877 -0.0057 0.0056  -0.0243 84  SER B O   
1865 C CB  . SER B 85  ? 0.4112 0.4243 0.4040 -0.0075 -0.0026 -0.0211 84  SER B CB  
1866 O OG  . SER B 85  ? 0.4128 0.4254 0.4104 -0.0073 -0.0050 -0.0204 84  SER B OG  
1867 N N   . GLY B 86  ? 0.4104 0.4238 0.3996 -0.0100 0.0032  -0.0240 85  GLY B N   
1868 C CA  . GLY B 86  ? 0.4122 0.4248 0.3968 -0.0107 0.0063  -0.0252 85  GLY B CA  
1869 C C   . GLY B 86  ? 0.4151 0.4296 0.3966 -0.0109 0.0056  -0.0243 85  GLY B C   
1870 O O   . GLY B 86  ? 0.4257 0.4385 0.4040 -0.0096 0.0086  -0.0252 85  GLY B O   
1871 N N   . PHE B 87  ? 0.4037 0.4217 0.3863 -0.0126 0.0017  -0.0224 86  PHE B N   
1872 C CA  . PHE B 87  ? 0.3960 0.4166 0.3759 -0.0136 0.0013  -0.0218 86  PHE B CA  
1873 C C   . PHE B 87  ? 0.4015 0.4245 0.3793 -0.0178 0.0020  -0.0227 86  PHE B C   
1874 O O   . PHE B 87  ? 0.4095 0.4345 0.3884 -0.0211 -0.0008 -0.0217 86  PHE B O   
1875 C CB  . PHE B 87  ? 0.3842 0.4071 0.3652 -0.0144 -0.0030 -0.0196 86  PHE B CB  
1876 C CG  . PHE B 87  ? 0.3738 0.3944 0.3566 -0.0114 -0.0038 -0.0190 86  PHE B CG  
1877 C CD1 . PHE B 87  ? 0.3721 0.3901 0.3533 -0.0081 -0.0011 -0.0200 86  PHE B CD1 
1878 C CD2 . PHE B 87  ? 0.3692 0.3900 0.3548 -0.0122 -0.0075 -0.0172 86  PHE B CD2 
1879 C CE1 . PHE B 87  ? 0.3716 0.3875 0.3533 -0.0063 -0.0018 -0.0196 86  PHE B CE1 
1880 C CE2 . PHE B 87  ? 0.3703 0.3887 0.3572 -0.0100 -0.0078 -0.0173 86  PHE B CE2 
1881 C CZ  . PHE B 87  ? 0.3707 0.3869 0.3552 -0.0073 -0.0048 -0.0186 86  PHE B CZ  
1882 N N   . THR B 88  ? 0.4074 0.4301 0.3824 -0.0177 0.0057  -0.0246 87  THR B N   
1883 C CA  . THR B 88  ? 0.4129 0.4376 0.3852 -0.0221 0.0074  -0.0263 87  THR B CA  
1884 C C   . THR B 88  ? 0.4010 0.4295 0.3714 -0.0245 0.0070  -0.0262 87  THR B C   
1885 O O   . THR B 88  ? 0.4179 0.4487 0.3854 -0.0293 0.0080  -0.0275 87  THR B O   
1886 C CB  . THR B 88  ? 0.4246 0.4457 0.3955 -0.0210 0.0130  -0.0293 87  THR B CB  
1887 O OG1 . THR B 88  ? 0.4363 0.4555 0.4079 -0.0164 0.0155  -0.0297 87  THR B OG1 
1888 C CG2 . THR B 88  ? 0.4273 0.4449 0.3993 -0.0201 0.0137  -0.0297 87  THR B CG2 
1889 N N   . PHE B 89  ? 0.3838 0.4132 0.3556 -0.0215 0.0058  -0.0250 88  PHE B N   
1890 C CA  . PHE B 89  ? 0.3754 0.4090 0.3460 -0.0237 0.0054  -0.0250 88  PHE B CA  
1891 C C   . PHE B 89  ? 0.3675 0.4034 0.3366 -0.0282 0.0003  -0.0223 88  PHE B C   
1892 O O   . PHE B 89  ? 0.3658 0.4001 0.3367 -0.0278 -0.0031 -0.0202 88  PHE B O   
1893 C CB  . PHE B 89  ? 0.3756 0.4099 0.3484 -0.0192 0.0055  -0.0244 88  PHE B CB  
1894 C CG  . PHE B 89  ? 0.3687 0.4008 0.3432 -0.0161 0.0022  -0.0220 88  PHE B CG  
1895 C CD1 . PHE B 89  ? 0.3700 0.3980 0.3457 -0.0119 0.0037  -0.0223 88  PHE B CD1 
1896 C CD2 . PHE B 89  ? 0.3663 0.3999 0.3409 -0.0179 -0.0020 -0.0198 88  PHE B CD2 
1897 C CE1 . PHE B 89  ? 0.3680 0.3938 0.3447 -0.0098 0.0014  -0.0207 88  PHE B CE1 
1898 C CE2 . PHE B 89  ? 0.3666 0.3977 0.3428 -0.0154 -0.0043 -0.0183 88  PHE B CE2 
1899 C CZ  . PHE B 89  ? 0.3634 0.3909 0.3407 -0.0115 -0.0024 -0.0189 88  PHE B CZ  
1900 N N   . PRO B 90  ? 0.3639 0.4036 0.3302 -0.0327 0.0000  -0.0225 89  PRO B N   
1901 C CA  . PRO B 90  ? 0.3611 0.4023 0.3253 -0.0374 -0.0051 -0.0194 89  PRO B CA  
1902 C C   . PRO B 90  ? 0.3576 0.3981 0.3241 -0.0352 -0.0092 -0.0165 89  PRO B C   
1903 O O   . PRO B 90  ? 0.3572 0.3989 0.3246 -0.0328 -0.0081 -0.0170 89  PRO B O   
1904 C CB  . PRO B 90  ? 0.3705 0.4157 0.3301 -0.0432 -0.0034 -0.0210 89  PRO B CB  
1905 C CG  . PRO B 90  ? 0.3706 0.4160 0.3305 -0.0418 0.0030  -0.0254 89  PRO B CG  
1906 C CD  . PRO B 90  ? 0.3649 0.4074 0.3298 -0.0342 0.0045  -0.0257 89  PRO B CD  
1907 N N   . LEU B 91  ? 0.3536 0.3923 0.3216 -0.0359 -0.0138 -0.0134 90  LEU B N   
1908 C CA  . LEU B 91  ? 0.3567 0.3939 0.3267 -0.0347 -0.0177 -0.0106 90  LEU B CA  
1909 C C   . LEU B 91  ? 0.3556 0.3943 0.3221 -0.0410 -0.0218 -0.0077 90  LEU B C   
1910 O O   . LEU B 91  ? 0.3630 0.4016 0.3291 -0.0440 -0.0246 -0.0058 90  LEU B O   
1911 C CB  . LEU B 91  ? 0.3610 0.3945 0.3362 -0.0311 -0.0197 -0.0093 90  LEU B CB  
1912 C CG  . LEU B 91  ? 0.3653 0.3965 0.3435 -0.0253 -0.0164 -0.0115 90  LEU B CG  
1913 C CD1 . LEU B 91  ? 0.3683 0.3999 0.3450 -0.0240 -0.0116 -0.0146 90  LEU B CD1 
1914 C CD2 . LEU B 91  ? 0.3722 0.4001 0.3556 -0.0228 -0.0182 -0.0106 90  LEU B CD2 
1915 N N   . LEU B 92  ? 0.3501 0.3904 0.3137 -0.0432 -0.0224 -0.0072 91  LEU B N   
1916 C CA  . LEU B 92  ? 0.3532 0.3946 0.3120 -0.0499 -0.0260 -0.0044 91  LEU B CA  
1917 C C   . LEU B 92  ? 0.3535 0.3913 0.3142 -0.0499 -0.0314 -0.0001 91  LEU B C   
1918 O O   . LEU B 92  ? 0.3510 0.3867 0.3154 -0.0456 -0.0313 -0.0003 91  LEU B O   
1919 C CB  . LEU B 92  ? 0.3536 0.3991 0.3078 -0.0534 -0.0229 -0.0067 91  LEU B CB  
1920 C CG  . LEU B 92  ? 0.3499 0.3986 0.3034 -0.0530 -0.0168 -0.0113 91  LEU B CG  
1921 C CD1 . LEU B 92  ? 0.3545 0.4077 0.3044 -0.0571 -0.0138 -0.0137 91  LEU B CD1 
1922 C CD2 . LEU B 92  ? 0.3533 0.4016 0.3043 -0.0563 -0.0165 -0.0117 91  LEU B CD2 
1923 N N   . SER B 93  ? 0.3669 0.4039 0.3249 -0.0551 -0.0362 0.0038  92  SER B N   
1924 C CA  . SER B 93  ? 0.3743 0.4072 0.3347 -0.0553 -0.0418 0.0085  92  SER B CA  
1925 C C   . SER B 93  ? 0.3876 0.4201 0.3422 -0.0606 -0.0439 0.0106  92  SER B C   
1926 O O   . SER B 93  ? 0.4016 0.4356 0.3497 -0.0674 -0.0459 0.0127  92  SER B O   
1927 C CB  . SER B 93  ? 0.3798 0.4116 0.3424 -0.0571 -0.0468 0.0124  92  SER B CB  
1928 O OG  . SER B 93  ? 0.3770 0.4088 0.3462 -0.0519 -0.0451 0.0105  92  SER B OG  
1929 N N   . ASP B 94  ? 0.3881 0.4184 0.3446 -0.0579 -0.0433 0.0102  93  ASP B N   
1930 C CA  . ASP B 94  ? 0.3982 0.4275 0.3498 -0.0626 -0.0452 0.0121  93  ASP B CA  
1931 C C   . ASP B 94  ? 0.4012 0.4239 0.3560 -0.0625 -0.0512 0.0173  93  ASP B C   
1932 O O   . ASP B 94  ? 0.3976 0.4163 0.3540 -0.0612 -0.0521 0.0182  93  ASP B O   
1933 C CB  . ASP B 94  ? 0.3986 0.4295 0.3512 -0.0596 -0.0412 0.0084  93  ASP B CB  
1934 C CG  . ASP B 94  ? 0.4046 0.4368 0.3514 -0.0652 -0.0415 0.0089  93  ASP B CG  
1935 O OD1 . ASP B 94  ? 0.4152 0.4479 0.3557 -0.0720 -0.0435 0.0112  93  ASP B OD1 
1936 O OD2 . ASP B 94  ? 0.4026 0.4355 0.3506 -0.0632 -0.0395 0.0069  93  ASP B OD2 
1937 N N   . PHE B 95  ? 0.4106 0.4323 0.3664 -0.0641 -0.0553 0.0210  94  PHE B N   
1938 C CA  . PHE B 95  ? 0.4181 0.4340 0.3796 -0.0627 -0.0612 0.0262  94  PHE B CA  
1939 C C   . PHE B 95  ? 0.4318 0.4439 0.3882 -0.0691 -0.0670 0.0321  94  PHE B C   
1940 O O   . PHE B 95  ? 0.4319 0.4376 0.3925 -0.0674 -0.0703 0.0353  94  PHE B O   
1941 C CB  . PHE B 95  ? 0.4172 0.4348 0.3837 -0.0609 -0.0631 0.0272  94  PHE B CB  
1942 C CG  . PHE B 95  ? 0.4240 0.4369 0.3984 -0.0590 -0.0693 0.0326  94  PHE B CG  
1943 C CD1 . PHE B 95  ? 0.4181 0.4270 0.4028 -0.0521 -0.0685 0.0315  94  PHE B CD1 
1944 C CD2 . PHE B 95  ? 0.4353 0.4481 0.4074 -0.0643 -0.0759 0.0386  94  PHE B CD2 
1945 C CE1 . PHE B 95  ? 0.4247 0.4295 0.4184 -0.0499 -0.0739 0.0361  94  PHE B CE1 
1946 C CE2 . PHE B 95  ? 0.4384 0.4472 0.4193 -0.0621 -0.0820 0.0440  94  PHE B CE2 
1947 C CZ  . PHE B 95  ? 0.4353 0.4401 0.4277 -0.0545 -0.0809 0.0426  94  PHE B CZ  
1948 N N   . TRP B 96  ? 0.4395 0.4549 0.3867 -0.0766 -0.0682 0.0336  95  TRP B N   
1949 C CA  . TRP B 96  ? 0.4546 0.4662 0.3954 -0.0837 -0.0741 0.0398  95  TRP B CA  
1950 C C   . TRP B 96  ? 0.4612 0.4773 0.3895 -0.0926 -0.0720 0.0385  95  TRP B C   
1951 O O   . TRP B 96  ? 0.4650 0.4860 0.3891 -0.0962 -0.0712 0.0375  95  TRP B O   
1952 C CB  . TRP B 96  ? 0.4566 0.4660 0.4013 -0.0843 -0.0813 0.0461  95  TRP B CB  
1953 C CG  . TRP B 96  ? 0.4643 0.4678 0.4050 -0.0898 -0.0886 0.0537  95  TRP B CG  
1954 C CD1 . TRP B 96  ? 0.4744 0.4785 0.4068 -0.0981 -0.0940 0.0591  95  TRP B CD1 
1955 C CD2 . TRP B 96  ? 0.4685 0.4639 0.4125 -0.0880 -0.0912 0.0569  95  TRP B CD2 
1956 N NE1 . TRP B 96  ? 0.4826 0.4794 0.4132 -0.1013 -0.1003 0.0660  95  TRP B NE1 
1957 C CE2 . TRP B 96  ? 0.4818 0.4729 0.4197 -0.0951 -0.0985 0.0646  95  TRP B CE2 
1958 C CE3 . TRP B 96  ? 0.4676 0.4587 0.4188 -0.0815 -0.0880 0.0539  95  TRP B CE3 
1959 C CZ2 . TRP B 96  ? 0.4919 0.4740 0.4311 -0.0954 -0.1026 0.0695  95  TRP B CZ2 
1960 C CZ3 . TRP B 96  ? 0.4747 0.4571 0.4271 -0.0821 -0.0917 0.0582  95  TRP B CZ3 
1961 C CH2 . TRP B 96  ? 0.4878 0.4655 0.4346 -0.0888 -0.0989 0.0660  95  TRP B CH2 
1962 N N   . PRO B 97  ? 0.4703 0.4851 0.3927 -0.0965 -0.0708 0.0381  96  PRO B N   
1963 C CA  . PRO B 97  ? 0.4707 0.4794 0.3971 -0.0933 -0.0716 0.0391  96  PRO B CA  
1964 C C   . PRO B 97  ? 0.4604 0.4699 0.3957 -0.0842 -0.0667 0.0338  96  PRO B C   
1965 O O   . PRO B 97  ? 0.4465 0.4623 0.3822 -0.0820 -0.0611 0.0282  96  PRO B O   
1966 C CB  . PRO B 97  ? 0.4793 0.4890 0.3957 -0.1008 -0.0698 0.0384  96  PRO B CB  
1967 C CG  . PRO B 97  ? 0.4821 0.4993 0.3904 -0.1071 -0.0667 0.0356  96  PRO B CG  
1968 C CD  . PRO B 97  ? 0.4816 0.5003 0.3921 -0.1060 -0.0691 0.0372  96  PRO B CD  
1969 N N   . HIS B 98  ? 0.4608 0.4635 0.4032 -0.0795 -0.0689 0.0357  97  HIS B N   
1970 C CA  . HIS B 98  ? 0.4515 0.4538 0.4023 -0.0715 -0.0650 0.0312  97  HIS B CA  
1971 C C   . HIS B 98  ? 0.4422 0.4484 0.3900 -0.0712 -0.0593 0.0258  97  HIS B C   
1972 O O   . HIS B 98  ? 0.4470 0.4503 0.3917 -0.0739 -0.0594 0.0262  97  HIS B O   
1973 C CB  . HIS B 98  ? 0.4584 0.4518 0.4165 -0.0678 -0.0684 0.0344  97  HIS B CB  
1974 C CG  . HIS B 98  ? 0.4588 0.4512 0.4252 -0.0602 -0.0644 0.0298  97  HIS B CG  
1975 N ND1 . HIS B 98  ? 0.4586 0.4502 0.4343 -0.0543 -0.0646 0.0295  97  HIS B ND1 
1976 C CD2 . HIS B 98  ? 0.4595 0.4520 0.4258 -0.0582 -0.0599 0.0253  97  HIS B CD2 
1977 C CE1 . HIS B 98  ? 0.4547 0.4453 0.4351 -0.0492 -0.0603 0.0249  97  HIS B CE1 
1978 N NE2 . HIS B 98  ? 0.4575 0.4486 0.4322 -0.0514 -0.0576 0.0225  97  HIS B NE2 
1979 N N   . GLY B 99  ? 0.4276 0.4403 0.3767 -0.0680 -0.0544 0.0208  98  GLY B N   
1980 C CA  . GLY B 99  ? 0.4253 0.4427 0.3731 -0.0670 -0.0494 0.0159  98  GLY B CA  
1981 C C   . GLY B 99  ? 0.4256 0.4480 0.3655 -0.0739 -0.0479 0.0150  98  GLY B C   
1982 O O   . GLY B 99  ? 0.4261 0.4517 0.3651 -0.0741 -0.0449 0.0120  98  GLY B O   
1983 N N   . ALA B 100 ? 0.4317 0.4552 0.3657 -0.0799 -0.0498 0.0174  99  ALA B N   
1984 C CA  . ALA B 100 ? 0.4367 0.4651 0.3627 -0.0874 -0.0480 0.0163  99  ALA B CA  
1985 C C   . ALA B 100 ? 0.4289 0.4659 0.3564 -0.0854 -0.0415 0.0100  99  ALA B C   
1986 O O   . ALA B 100 ? 0.4272 0.4681 0.3529 -0.0879 -0.0391 0.0076  99  ALA B O   
1987 C CB  . ALA B 100 ? 0.4420 0.4705 0.3611 -0.0944 -0.0506 0.0194  99  ALA B CB  
1988 N N   . VAL B 101 ? 0.4229 0.4630 0.3544 -0.0809 -0.0390 0.0075  100 VAL B N   
1989 C CA  . VAL B 101 ? 0.4168 0.4645 0.3509 -0.0781 -0.0331 0.0020  100 VAL B CA  
1990 C C   . VAL B 101 ? 0.4134 0.4619 0.3528 -0.0725 -0.0316 -0.0001 100 VAL B C   
1991 O O   . VAL B 101 ? 0.4111 0.4661 0.3512 -0.0730 -0.0282 -0.0034 100 VAL B O   
1992 C CB  . VAL B 101 ? 0.4120 0.4611 0.3491 -0.0743 -0.0309 0.0001  100 VAL B CB  
1993 C CG1 . VAL B 101 ? 0.4057 0.4615 0.3465 -0.0705 -0.0250 -0.0052 100 VAL B CG1 
1994 C CG2 . VAL B 101 ? 0.4195 0.4686 0.3502 -0.0809 -0.0322 0.0017  100 VAL B CG2 
1995 N N   . SER B 102 ? 0.4142 0.4567 0.3576 -0.0676 -0.0341 0.0018  101 SER B N   
1996 C CA  . SER B 102 ? 0.4152 0.4577 0.3626 -0.0632 -0.0330 0.0001  101 SER B CA  
1997 C C   . SER B 102 ? 0.4159 0.4599 0.3599 -0.0679 -0.0333 0.0000  101 SER B C   
1998 O O   . SER B 102 ? 0.4092 0.4583 0.3552 -0.0663 -0.0310 -0.0028 101 SER B O   
1999 C CB  . SER B 102 ? 0.4188 0.4535 0.3701 -0.0587 -0.0356 0.0021  101 SER B CB  
2000 O OG  . SER B 102 ? 0.4291 0.4630 0.3840 -0.0542 -0.0350 0.0017  101 SER B OG  
2001 N N   . GLN B 103 ? 0.4268 0.4664 0.3657 -0.0739 -0.0365 0.0034  102 GLN B N   
2002 C CA  . GLN B 103 ? 0.4362 0.4765 0.3709 -0.0796 -0.0369 0.0036  102 GLN B CA  
2003 C C   . GLN B 103 ? 0.4249 0.4751 0.3574 -0.0836 -0.0331 0.0001  102 GLN B C   
2004 O O   . GLN B 103 ? 0.4237 0.4785 0.3566 -0.0849 -0.0314 -0.0021 102 GLN B O   
2005 C CB  . GLN B 103 ? 0.4567 0.4891 0.3858 -0.0854 -0.0414 0.0085  102 GLN B CB  
2006 C CG  . GLN B 103 ? 0.4732 0.4956 0.4059 -0.0817 -0.0452 0.0119  102 GLN B CG  
2007 C CD  . GLN B 103 ? 0.4959 0.5105 0.4242 -0.0868 -0.0503 0.0177  102 GLN B CD  
2008 O OE1 . GLN B 103 ? 0.5171 0.5314 0.4384 -0.0941 -0.0513 0.0193  102 GLN B OE1 
2009 N NE2 . GLN B 103 ? 0.5021 0.5104 0.4348 -0.0831 -0.0537 0.0210  102 GLN B NE2 
2010 N N   . ALA B 104 ? 0.4170 0.4706 0.3475 -0.0857 -0.0315 -0.0006 103 ALA B N   
2011 C CA  . ALA B 104 ? 0.4113 0.4743 0.3406 -0.0895 -0.0270 -0.0046 103 ALA B CA  
2012 C C   . ALA B 104 ? 0.4006 0.4712 0.3375 -0.0834 -0.0232 -0.0089 103 ALA B C   
2013 O O   . ALA B 104 ? 0.4026 0.4810 0.3407 -0.0858 -0.0203 -0.0118 103 ALA B O   
2014 C CB  . ALA B 104 ? 0.4136 0.4781 0.3398 -0.0924 -0.0255 -0.0050 103 ALA B CB  
2015 N N   . TYR B 105 ? 0.3880 0.4565 0.3303 -0.0756 -0.0233 -0.0090 104 TYR B N   
2016 C CA  . TYR B 105 ? 0.3779 0.4525 0.3273 -0.0695 -0.0205 -0.0121 104 TYR B CA  
2017 C C   . TYR B 105 ? 0.3843 0.4582 0.3353 -0.0678 -0.0224 -0.0116 104 TYR B C   
2018 O O   . TYR B 105 ? 0.3766 0.4561 0.3327 -0.0636 -0.0208 -0.0137 104 TYR B O   
2019 C CB  . TYR B 105 ? 0.3674 0.4399 0.3208 -0.0626 -0.0195 -0.0126 104 TYR B CB  
2020 C CG  . TYR B 105 ? 0.3624 0.4389 0.3160 -0.0637 -0.0158 -0.0150 104 TYR B CG  
2021 C CD1 . TYR B 105 ? 0.3618 0.4348 0.3100 -0.0684 -0.0167 -0.0136 104 TYR B CD1 
2022 C CD2 . TYR B 105 ? 0.3561 0.4399 0.3156 -0.0601 -0.0115 -0.0187 104 TYR B CD2 
2023 C CE1 . TYR B 105 ? 0.3616 0.4380 0.3092 -0.0702 -0.0129 -0.0163 104 TYR B CE1 
2024 C CE2 . TYR B 105 ? 0.3554 0.4422 0.3153 -0.0612 -0.0075 -0.0214 104 TYR B CE2 
2025 C CZ  . TYR B 105 ? 0.3565 0.4395 0.3100 -0.0665 -0.0080 -0.0205 104 TYR B CZ  
2026 O OH  . TYR B 105 ? 0.3649 0.4507 0.3181 -0.0683 -0.0036 -0.0237 104 TYR B OH  
2027 N N   . GLY B 106 ? 0.3974 0.4642 0.3440 -0.0713 -0.0258 -0.0087 105 GLY B N   
2028 C CA  . GLY B 106 ? 0.4051 0.4702 0.3521 -0.0709 -0.0273 -0.0085 105 GLY B CA  
2029 C C   . GLY B 106 ? 0.4074 0.4679 0.3580 -0.0641 -0.0280 -0.0083 105 GLY B C   
2030 O O   . GLY B 106 ? 0.4118 0.4738 0.3639 -0.0627 -0.0281 -0.0094 105 GLY B O   
2031 N N   . VAL B 107 ? 0.4082 0.4633 0.3600 -0.0606 -0.0286 -0.0070 106 VAL B N   
2032 C CA  . VAL B 107 ? 0.4068 0.4574 0.3620 -0.0544 -0.0288 -0.0071 106 VAL B CA  
2033 C C   . VAL B 107 ? 0.4127 0.4531 0.3673 -0.0542 -0.0315 -0.0043 106 VAL B C   
2034 O O   . VAL B 107 ? 0.4150 0.4517 0.3727 -0.0495 -0.0313 -0.0043 106 VAL B O   
2035 C CB  . VAL B 107 ? 0.4033 0.4577 0.3623 -0.0492 -0.0264 -0.0086 106 VAL B CB  
2036 C CG1 . VAL B 107 ? 0.4022 0.4660 0.3638 -0.0479 -0.0240 -0.0112 106 VAL B CG1 
2037 C CG2 . VAL B 107 ? 0.4040 0.4579 0.3619 -0.0506 -0.0260 -0.0079 106 VAL B CG2 
2038 N N   . PHE B 108 ? 0.4233 0.4590 0.3744 -0.0592 -0.0340 -0.0020 107 PHE B N   
2039 C CA  . PHE B 108 ? 0.4316 0.4577 0.3834 -0.0589 -0.0369 0.0010  107 PHE B CA  
2040 C C   . PHE B 108 ? 0.4485 0.4681 0.4005 -0.0591 -0.0376 0.0009  107 PHE B C   
2041 O O   . PHE B 108 ? 0.4500 0.4711 0.3987 -0.0632 -0.0375 0.0002  107 PHE B O   
2042 C CB  . PHE B 108 ? 0.4344 0.4581 0.3820 -0.0644 -0.0397 0.0045  107 PHE B CB  
2043 C CG  . PHE B 108 ? 0.4346 0.4490 0.3843 -0.0636 -0.0434 0.0084  107 PHE B CG  
2044 C CD1 . PHE B 108 ? 0.4291 0.4422 0.3835 -0.0591 -0.0438 0.0090  107 PHE B CD1 
2045 C CD2 . PHE B 108 ? 0.4436 0.4506 0.3911 -0.0675 -0.0465 0.0115  107 PHE B CD2 
2046 C CE1 . PHE B 108 ? 0.4296 0.4350 0.3874 -0.0580 -0.0475 0.0126  107 PHE B CE1 
2047 C CE2 . PHE B 108 ? 0.4451 0.4436 0.3959 -0.0662 -0.0501 0.0154  107 PHE B CE2 
2048 C CZ  . PHE B 108 ? 0.4390 0.4371 0.3954 -0.0614 -0.0507 0.0160  107 PHE B CZ  
2049 N N   . ASN B 109 ? 0.4598 0.4727 0.4161 -0.0548 -0.0380 0.0011  108 ASN B N   
2050 C CA  . ASN B 109 ? 0.4790 0.4846 0.4363 -0.0548 -0.0381 0.0005  108 ASN B CA  
2051 C C   . ASN B 109 ? 0.5050 0.5015 0.4627 -0.0573 -0.0415 0.0044  108 ASN B C   
2052 O O   . ASN B 109 ? 0.5004 0.4921 0.4629 -0.0542 -0.0431 0.0064  108 ASN B O   
2053 C CB  . ASN B 109 ? 0.4750 0.4782 0.4371 -0.0490 -0.0360 -0.0020 108 ASN B CB  
2054 C CG  . ASN B 109 ? 0.4818 0.4777 0.4448 -0.0492 -0.0350 -0.0037 108 ASN B CG  
2055 O OD1 . ASN B 109 ? 0.4929 0.4831 0.4544 -0.0528 -0.0365 -0.0023 108 ASN B OD1 
2056 N ND2 . ASN B 109 ? 0.4759 0.4715 0.4411 -0.0455 -0.0323 -0.0068 108 ASN B ND2 
2057 N N   . GLU B 110 ? 0.5384 0.5329 0.4913 -0.0629 -0.0428 0.0057  109 GLU B N   
2058 C CA  . GLU B 110 ? 0.5733 0.5584 0.5257 -0.0660 -0.0465 0.0101  109 GLU B CA  
2059 C C   . GLU B 110 ? 0.5708 0.5453 0.5293 -0.0625 -0.0467 0.0102  109 GLU B C   
2060 O O   . GLU B 110 ? 0.5764 0.5434 0.5380 -0.0623 -0.0501 0.0142  109 GLU B O   
2061 C CB  . GLU B 110 ? 0.6077 0.5925 0.5529 -0.0733 -0.0472 0.0110  109 GLU B CB  
2062 C CG  . GLU B 110 ? 0.6342 0.6257 0.5735 -0.0783 -0.0484 0.0129  109 GLU B CG  
2063 C CD  . GLU B 110 ? 0.6724 0.6584 0.6109 -0.0802 -0.0528 0.0185  109 GLU B CD  
2064 O OE1 . GLU B 110 ? 0.7058 0.6817 0.6482 -0.0785 -0.0557 0.0217  109 GLU B OE1 
2065 O OE2 . GLU B 110 ? 0.7004 0.6920 0.6345 -0.0838 -0.0535 0.0198  109 GLU B OE2 
2066 N N   . GLN B 111 ? 0.5689 0.5430 0.5292 -0.0601 -0.0432 0.0057  110 GLN B N   
2067 C CA  . GLN B 111 ? 0.5805 0.5447 0.5468 -0.0571 -0.0423 0.0047  110 GLN B CA  
2068 C C   . GLN B 111 ? 0.5563 0.5190 0.5310 -0.0510 -0.0427 0.0053  110 GLN B C   
2069 O O   . GLN B 111 ? 0.5611 0.5155 0.5422 -0.0492 -0.0447 0.0078  110 GLN B O   
2070 C CB  . GLN B 111 ? 0.6032 0.5678 0.5681 -0.0569 -0.0380 -0.0007 110 GLN B CB  
2071 C CG  . GLN B 111 ? 0.6397 0.6041 0.5976 -0.0631 -0.0375 -0.0019 110 GLN B CG  
2072 C CD  . GLN B 111 ? 0.6755 0.6276 0.6340 -0.0660 -0.0386 -0.0003 110 GLN B CD  
2073 O OE1 . GLN B 111 ? 0.7012 0.6464 0.6638 -0.0649 -0.0417 0.0040  110 GLN B OE1 
2074 N NE2 . GLN B 111 ? 0.6922 0.6415 0.6466 -0.0699 -0.0362 -0.0035 110 GLN B NE2 
2075 N N   . ALA B 112 ? 0.5256 0.4964 0.5009 -0.0478 -0.0408 0.0032  111 ALA B N   
2076 C CA  . ALA B 112 ? 0.4999 0.4705 0.4827 -0.0423 -0.0406 0.0032  111 ALA B CA  
2077 C C   . ALA B 112 ? 0.4809 0.4550 0.4647 -0.0422 -0.0442 0.0075  111 ALA B C   
2078 O O   . ALA B 112 ? 0.4787 0.4513 0.4696 -0.0385 -0.0452 0.0085  111 ALA B O   
2079 C CB  . ALA B 112 ? 0.4895 0.4657 0.4720 -0.0392 -0.0363 -0.0015 111 ALA B CB  
2080 N N   . GLY B 113 ? 0.4639 0.4428 0.4406 -0.0467 -0.0461 0.0096  112 GLY B N   
2081 C CA  . GLY B 113 ? 0.4536 0.4360 0.4295 -0.0479 -0.0493 0.0134  112 GLY B CA  
2082 C C   . GLY B 113 ? 0.4381 0.4282 0.4151 -0.0447 -0.0469 0.0110  112 GLY B C   
2083 O O   . GLY B 113 ? 0.4330 0.4243 0.4128 -0.0436 -0.0490 0.0132  112 GLY B O   
2084 N N   . ILE B 114 ? 0.4263 0.4214 0.4010 -0.0433 -0.0428 0.0067  113 ILE B N   
2085 C CA  . ILE B 114 ? 0.4181 0.4197 0.3933 -0.0402 -0.0402 0.0043  113 ILE B CA  
2086 C C   . ILE B 114 ? 0.4141 0.4231 0.3835 -0.0423 -0.0379 0.0021  113 ILE B C   
2087 O O   . ILE B 114 ? 0.4088 0.4180 0.3747 -0.0454 -0.0378 0.0016  113 ILE B O   
2088 C CB  . ILE B 114 ? 0.4178 0.4173 0.3983 -0.0349 -0.0372 0.0011  113 ILE B CB  
2089 C CG1 . ILE B 114 ? 0.4237 0.4219 0.4021 -0.0351 -0.0346 -0.0021 113 ILE B CG1 
2090 C CG2 . ILE B 114 ? 0.4244 0.4174 0.4125 -0.0325 -0.0390 0.0028  113 ILE B CG2 
2091 C CD1 . ILE B 114 ? 0.4268 0.4219 0.4092 -0.0310 -0.0315 -0.0054 113 ILE B CD1 
2092 N N   . ALA B 115 ? 0.4097 0.4249 0.3787 -0.0407 -0.0359 0.0006  114 ALA B N   
2093 C CA  . ALA B 115 ? 0.4062 0.4289 0.3716 -0.0417 -0.0335 -0.0016 114 ALA B CA  
2094 C C   . ALA B 115 ? 0.4095 0.4332 0.3762 -0.0382 -0.0309 -0.0046 114 ALA B C   
2095 O O   . ALA B 115 ? 0.4131 0.4335 0.3830 -0.0343 -0.0298 -0.0056 114 ALA B O   
2096 C CB  . ALA B 115 ? 0.4006 0.4287 0.3658 -0.0412 -0.0321 -0.0021 114 ALA B CB  
2097 N N   . ASN B 116 ? 0.4143 0.4427 0.3783 -0.0402 -0.0300 -0.0059 115 ASN B N   
2098 C CA  . ASN B 116 ? 0.4164 0.4470 0.3808 -0.0375 -0.0281 -0.0083 115 ASN B CA  
2099 C C   . ASN B 116 ? 0.4165 0.4525 0.3825 -0.0338 -0.0260 -0.0094 115 ASN B C   
2100 O O   . ASN B 116 ? 0.4149 0.4544 0.3811 -0.0345 -0.0256 -0.0090 115 ASN B O   
2101 C CB  . ASN B 116 ? 0.4199 0.4550 0.3814 -0.0410 -0.0283 -0.0091 115 ASN B CB  
2102 C CG  . ASN B 116 ? 0.4263 0.4552 0.3857 -0.0449 -0.0300 -0.0084 115 ASN B CG  
2103 O OD1 . ASN B 116 ? 0.4311 0.4621 0.3877 -0.0496 -0.0310 -0.0077 115 ASN B OD1 
2104 N ND2 . ASN B 116 ? 0.4300 0.4510 0.3909 -0.0431 -0.0298 -0.0088 115 ASN B ND2 
2105 N N   . ALA B 117 ? 0.4161 0.4522 0.3829 -0.0304 -0.0245 -0.0108 116 ALA B N   
2106 C CA  . ALA B 117 ? 0.4118 0.4517 0.3802 -0.0266 -0.0225 -0.0116 116 ALA B CA  
2107 C C   . ALA B 117 ? 0.4072 0.4558 0.3758 -0.0271 -0.0220 -0.0121 116 ALA B C   
2108 O O   . ALA B 117 ? 0.4147 0.4670 0.3836 -0.0254 -0.0217 -0.0126 116 ALA B O   
2109 C CB  . ALA B 117 ? 0.4159 0.4524 0.3843 -0.0232 -0.0213 -0.0126 116 ALA B CB  
2110 N N   . GLY B 118 ? 0.3989 0.4510 0.3676 -0.0297 -0.0219 -0.0118 117 GLY B N   
2111 C CA  . GLY B 118 ? 0.3914 0.4523 0.3616 -0.0305 -0.0207 -0.0128 117 GLY B CA  
2112 C C   . GLY B 118 ? 0.3795 0.4427 0.3523 -0.0279 -0.0181 -0.0137 117 GLY B C   
2113 O O   . GLY B 118 ? 0.3752 0.4342 0.3471 -0.0280 -0.0176 -0.0134 117 GLY B O   
2114 N N   . THR B 119 ? 0.3713 0.4412 0.3476 -0.0255 -0.0164 -0.0148 118 THR B N   
2115 C CA  . THR B 119 ? 0.3681 0.4402 0.3476 -0.0228 -0.0134 -0.0161 118 THR B CA  
2116 C C   . THR B 119 ? 0.3564 0.4373 0.3393 -0.0246 -0.0115 -0.0179 118 THR B C   
2117 O O   . THR B 119 ? 0.3580 0.4450 0.3431 -0.0250 -0.0125 -0.0179 118 THR B O   
2118 C CB  . THR B 119 ? 0.3732 0.4439 0.3554 -0.0169 -0.0126 -0.0158 118 THR B CB  
2119 O OG1 . THR B 119 ? 0.3952 0.4577 0.3742 -0.0157 -0.0136 -0.0148 118 THR B OG1 
2120 C CG2 . THR B 119 ? 0.3731 0.4453 0.3589 -0.0142 -0.0090 -0.0173 118 THR B CG2 
2121 N N   . PHE B 120 ? 0.3440 0.4260 0.3276 -0.0259 -0.0085 -0.0196 119 PHE B N   
2122 C CA  . PHE B 120 ? 0.3361 0.4265 0.3235 -0.0278 -0.0055 -0.0222 119 PHE B CA  
2123 C C   . PHE B 120 ? 0.3337 0.4246 0.3252 -0.0246 -0.0013 -0.0244 119 PHE B C   
2124 O O   . PHE B 120 ? 0.3367 0.4211 0.3258 -0.0232 -0.0005 -0.0242 119 PHE B O   
2125 C CB  . PHE B 120 ? 0.3353 0.4265 0.3178 -0.0352 -0.0054 -0.0229 119 PHE B CB  
2126 C CG  . PHE B 120 ? 0.3384 0.4283 0.3166 -0.0391 -0.0092 -0.0208 119 PHE B CG  
2127 C CD1 . PHE B 120 ? 0.3381 0.4195 0.3111 -0.0404 -0.0124 -0.0182 119 PHE B CD1 
2128 C CD2 . PHE B 120 ? 0.3382 0.4353 0.3181 -0.0418 -0.0095 -0.0215 119 PHE B CD2 
2129 C CE1 . PHE B 120 ? 0.3434 0.4226 0.3127 -0.0440 -0.0156 -0.0164 119 PHE B CE1 
2130 C CE2 . PHE B 120 ? 0.3379 0.4330 0.3133 -0.0459 -0.0128 -0.0198 119 PHE B CE2 
2131 C CZ  . PHE B 120 ? 0.3411 0.4268 0.3112 -0.0469 -0.0157 -0.0172 119 PHE B CZ  
2132 N N   . VAL B 121 ? 0.3287 0.4275 0.3269 -0.0234 0.0017  -0.0268 120 VAL B N   
2133 C CA  . VAL B 121 ? 0.3308 0.4305 0.3336 -0.0211 0.0067  -0.0297 120 VAL B CA  
2134 C C   . VAL B 121 ? 0.3385 0.4449 0.3422 -0.0267 0.0102  -0.0333 120 VAL B C   
2135 O O   . VAL B 121 ? 0.3404 0.4549 0.3484 -0.0280 0.0101  -0.0341 120 VAL B O   
2136 C CB  . VAL B 121 ? 0.3304 0.4330 0.3421 -0.0138 0.0076  -0.0296 120 VAL B CB  
2137 C CG1 . VAL B 121 ? 0.3327 0.4359 0.3498 -0.0119 0.0135  -0.0332 120 VAL B CG1 
2138 C CG2 . VAL B 121 ? 0.3284 0.4239 0.3377 -0.0091 0.0043  -0.0260 120 VAL B CG2 
2139 N N   . VAL B 122 ? 0.3448 0.4481 0.3442 -0.0307 0.0134  -0.0355 121 VAL B N   
2140 C CA  . VAL B 122 ? 0.3571 0.4658 0.3558 -0.0371 0.0174  -0.0393 121 VAL B CA  
2141 C C   . VAL B 122 ? 0.3652 0.4761 0.3711 -0.0341 0.0239  -0.0437 121 VAL B C   
2142 O O   . VAL B 122 ? 0.3622 0.4667 0.3671 -0.0315 0.0255  -0.0440 121 VAL B O   
2143 C CB  . VAL B 122 ? 0.3635 0.4669 0.3514 -0.0445 0.0164  -0.0387 121 VAL B CB  
2144 C CG1 . VAL B 122 ? 0.3722 0.4810 0.3579 -0.0523 0.0207  -0.0427 121 VAL B CG1 
2145 C CG2 . VAL B 122 ? 0.3642 0.4638 0.3460 -0.0465 0.0100  -0.0340 121 VAL B CG2 
2146 N N   . ASP B 123 ? 0.3748 0.4947 0.3887 -0.0344 0.0278  -0.0473 122 ASP B N   
2147 C CA  . ASP B 123 ? 0.3895 0.5116 0.4119 -0.0312 0.0345  -0.0520 122 ASP B CA  
2148 C C   . ASP B 123 ? 0.3987 0.5187 0.4148 -0.0384 0.0400  -0.0565 122 ASP B C   
2149 O O   . ASP B 123 ? 0.3979 0.5150 0.4030 -0.0457 0.0379  -0.0554 122 ASP B O   
2150 C CB  . ASP B 123 ? 0.3970 0.5300 0.4323 -0.0282 0.0370  -0.0544 122 ASP B CB  
2151 C CG  . ASP B 123 ? 0.4066 0.5480 0.4407 -0.0361 0.0391  -0.0576 122 ASP B CG  
2152 O OD1 . ASP B 123 ? 0.4276 0.5661 0.4506 -0.0444 0.0395  -0.0584 122 ASP B OD1 
2153 O OD2 . ASP B 123 ? 0.4177 0.5691 0.4623 -0.0343 0.0404  -0.0593 122 ASP B OD2 
2154 N N   . ARG B 124 ? 0.4127 0.5339 0.4359 -0.0364 0.0470  -0.0615 123 ARG B N   
2155 C CA  . ARG B 124 ? 0.4302 0.5496 0.4478 -0.0435 0.0532  -0.0666 123 ARG B CA  
2156 C C   . ARG B 124 ? 0.4254 0.5512 0.4378 -0.0533 0.0552  -0.0695 123 ARG B C   
2157 O O   . ARG B 124 ? 0.4330 0.5567 0.4370 -0.0613 0.0588  -0.0727 123 ARG B O   
2158 C CB  . ARG B 124 ? 0.4541 0.5741 0.4822 -0.0390 0.0611  -0.0721 123 ARG B CB  
2159 C CG  . ARG B 124 ? 0.4777 0.5893 0.5083 -0.0311 0.0601  -0.0696 123 ARG B CG  
2160 C CD  . ARG B 124 ? 0.5051 0.6168 0.5474 -0.0260 0.0678  -0.0747 123 ARG B CD  
2161 N NE  . ARG B 124 ? 0.5387 0.6408 0.5811 -0.0197 0.0668  -0.0722 123 ARG B NE  
2162 C CZ  . ARG B 124 ? 0.5622 0.6625 0.6113 -0.0107 0.0626  -0.0675 123 ARG B CZ  
2163 N NH1 . ARG B 124 ? 0.5662 0.6740 0.6232 -0.0065 0.0587  -0.0646 123 ARG B NH1 
2164 N NH2 . ARG B 124 ? 0.5703 0.6611 0.6176 -0.0063 0.0623  -0.0656 123 ARG B NH2 
2165 N N   . SER B 125 ? 0.4211 0.5549 0.4381 -0.0533 0.0529  -0.0685 124 SER B N   
2166 C CA  . SER B 125 ? 0.4252 0.5653 0.4374 -0.0627 0.0545  -0.0710 124 SER B CA  
2167 C C   . SER B 125 ? 0.4243 0.5610 0.4239 -0.0686 0.0472  -0.0655 124 SER B C   
2168 O O   . SER B 125 ? 0.4369 0.5776 0.4308 -0.0770 0.0479  -0.0668 124 SER B O   
2169 C CB  . SER B 125 ? 0.4243 0.5761 0.4497 -0.0600 0.0569  -0.0737 124 SER B CB  
2170 O OG  . SER B 125 ? 0.4279 0.5832 0.4662 -0.0548 0.0641  -0.0790 124 SER B OG  
2171 N N   . GLY B 126 ? 0.4157 0.5448 0.4113 -0.0642 0.0405  -0.0596 125 GLY B N   
2172 C CA  . GLY B 126 ? 0.4102 0.5352 0.3953 -0.0688 0.0335  -0.0543 125 GLY B CA  
2173 C C   . GLY B 126 ? 0.3997 0.5296 0.3887 -0.0668 0.0293  -0.0516 125 GLY B C   
2174 O O   . GLY B 126 ? 0.4035 0.5313 0.3847 -0.0718 0.0246  -0.0482 125 GLY B O   
2175 N N   . ILE B 127 ? 0.3878 0.5241 0.3891 -0.0597 0.0309  -0.0530 126 ILE B N   
2176 C CA  . ILE B 127 ? 0.3809 0.5230 0.3870 -0.0576 0.0270  -0.0508 126 ILE B CA  
2177 C C   . ILE B 127 ? 0.3647 0.5014 0.3725 -0.0496 0.0215  -0.0459 126 ILE B C   
2178 O O   . ILE B 127 ? 0.3584 0.4919 0.3710 -0.0429 0.0228  -0.0459 126 ILE B O   
2179 C CB  . ILE B 127 ? 0.3840 0.5380 0.4036 -0.0549 0.0317  -0.0552 126 ILE B CB  
2180 C CG1 . ILE B 127 ? 0.3939 0.5538 0.4129 -0.0630 0.0386  -0.0612 126 ILE B CG1 
2181 C CG2 . ILE B 127 ? 0.3810 0.5418 0.4054 -0.0533 0.0272  -0.0526 126 ILE B CG2 
2182 C CD1 . ILE B 127 ? 0.3978 0.5582 0.4057 -0.0733 0.0368  -0.0605 126 ILE B CD1 
2183 N N   . ILE B 128 ? 0.3550 0.4903 0.3585 -0.0507 0.0158  -0.0419 127 ILE B N   
2184 C CA  . ILE B 128 ? 0.3492 0.4797 0.3535 -0.0442 0.0108  -0.0376 127 ILE B CA  
2185 C C   . ILE B 128 ? 0.3448 0.4833 0.3611 -0.0375 0.0113  -0.0382 127 ILE B C   
2186 O O   . ILE B 128 ? 0.3451 0.4933 0.3668 -0.0393 0.0118  -0.0398 127 ILE B O   
2187 C CB  . ILE B 128 ? 0.3490 0.4760 0.3457 -0.0479 0.0052  -0.0339 127 ILE B CB  
2188 C CG1 . ILE B 128 ? 0.3523 0.4702 0.3381 -0.0533 0.0038  -0.0323 127 ILE B CG1 
2189 C CG2 . ILE B 128 ? 0.3447 0.4684 0.3432 -0.0416 0.0008  -0.0304 127 ILE B CG2 
2190 C CD1 . ILE B 128 ? 0.3579 0.4718 0.3365 -0.0578 -0.0011 -0.0289 127 ILE B CD1 
2191 N N   . ARG B 129 ? 0.3414 0.4762 0.3620 -0.0300 0.0110  -0.0369 128 ARG B N   
2192 C CA  . ARG B 129 ? 0.3421 0.4835 0.3742 -0.0231 0.0109  -0.0366 128 ARG B CA  
2193 C C   . ARG B 129 ? 0.3472 0.4852 0.3779 -0.0187 0.0050  -0.0318 128 ARG B C   
2194 O O   . ARG B 129 ? 0.3467 0.4910 0.3856 -0.0141 0.0033  -0.0306 128 ARG B O   
2195 C CB  . ARG B 129 ? 0.3414 0.4816 0.3806 -0.0180 0.0158  -0.0391 128 ARG B CB  
2196 C CG  . ARG B 129 ? 0.3436 0.4881 0.3854 -0.0224 0.0226  -0.0447 128 ARG B CG  
2197 C CD  . ARG B 129 ? 0.3436 0.5012 0.3952 -0.0239 0.0248  -0.0478 128 ARG B CD  
2198 N NE  . ARG B 129 ? 0.3438 0.5074 0.4101 -0.0156 0.0257  -0.0479 128 ARG B NE  
2199 C CZ  . ARG B 129 ? 0.3461 0.5116 0.4222 -0.0121 0.0318  -0.0518 128 ARG B CZ  
2200 N NH1 . ARG B 129 ? 0.3470 0.5091 0.4193 -0.0165 0.0381  -0.0566 128 ARG B NH1 
2201 N NH2 . ARG B 129 ? 0.3477 0.5183 0.4376 -0.0041 0.0315  -0.0508 128 ARG B NH2 
2202 N N   . PHE B 130 ? 0.3551 0.4835 0.3757 -0.0203 0.0020  -0.0293 129 PHE B N   
2203 C CA  . PHE B 130 ? 0.3594 0.4833 0.3771 -0.0171 -0.0029 -0.0253 129 PHE B CA  
2204 C C   . PHE B 130 ? 0.3749 0.4919 0.3822 -0.0222 -0.0058 -0.0238 129 PHE B C   
2205 O O   . PHE B 130 ? 0.3680 0.4795 0.3697 -0.0257 -0.0044 -0.0246 129 PHE B O   
2206 C CB  . PHE B 130 ? 0.3562 0.4732 0.3750 -0.0109 -0.0022 -0.0240 129 PHE B CB  
2207 C CG  . PHE B 130 ? 0.3524 0.4632 0.3665 -0.0085 -0.0065 -0.0204 129 PHE B CG  
2208 C CD1 . PHE B 130 ? 0.3523 0.4538 0.3576 -0.0107 -0.0078 -0.0193 129 PHE B CD1 
2209 C CD2 . PHE B 130 ? 0.3470 0.4614 0.3657 -0.0041 -0.0092 -0.0180 129 PHE B CD2 
2210 C CE1 . PHE B 130 ? 0.3502 0.4459 0.3513 -0.0089 -0.0110 -0.0167 129 PHE B CE1 
2211 C CE2 . PHE B 130 ? 0.3508 0.4593 0.3640 -0.0028 -0.0128 -0.0149 129 PHE B CE2 
2212 C CZ  . PHE B 130 ? 0.3523 0.4514 0.3568 -0.0052 -0.0133 -0.0146 129 PHE B CZ  
2213 N N   . ALA B 131 ? 0.3990 0.5163 0.4039 -0.0229 -0.0099 -0.0215 130 ALA B N   
2214 C CA  . ALA B 131 ? 0.4234 0.5336 0.4194 -0.0273 -0.0126 -0.0200 130 ALA B CA  
2215 C C   . ALA B 131 ? 0.4514 0.5587 0.4455 -0.0250 -0.0162 -0.0176 130 ALA B C   
2216 O O   . ALA B 131 ? 0.4584 0.5726 0.4558 -0.0245 -0.0180 -0.0170 130 ALA B O   
2217 C CB  . ALA B 131 ? 0.4234 0.5384 0.4174 -0.0341 -0.0128 -0.0212 130 ALA B CB  
2218 N N   . GLU B 132 ? 0.4835 0.5808 0.4723 -0.0239 -0.0171 -0.0163 131 GLU B N   
2219 C CA  . GLU B 132 ? 0.5150 0.6081 0.5008 -0.0221 -0.0198 -0.0144 131 GLU B CA  
2220 C C   . GLU B 132 ? 0.5377 0.6214 0.5168 -0.0250 -0.0209 -0.0140 131 GLU B C   
2221 O O   . GLU B 132 ? 0.5318 0.6090 0.5093 -0.0245 -0.0197 -0.0140 131 GLU B O   
2222 C CB  . GLU B 132 ? 0.5313 0.6213 0.5192 -0.0162 -0.0190 -0.0135 131 GLU B CB  
2223 C CG  . GLU B 132 ? 0.5492 0.6339 0.5330 -0.0147 -0.0211 -0.0118 131 GLU B CG  
2224 C CD  . GLU B 132 ? 0.5633 0.6415 0.5467 -0.0102 -0.0197 -0.0112 131 GLU B CD  
2225 O OE1 . GLU B 132 ? 0.5793 0.6558 0.5611 -0.0081 -0.0212 -0.0096 131 GLU B OE1 
2226 O OE2 . GLU B 132 ? 0.5576 0.6320 0.5416 -0.0093 -0.0172 -0.0122 131 GLU B OE2 
2227 N N   . MET B 133 ? 0.5681 0.6510 0.5439 -0.0280 -0.0232 -0.0135 132 MET B N   
2228 C CA  . MET B 133 ? 0.5986 0.6722 0.5692 -0.0303 -0.0240 -0.0133 132 MET B CA  
2229 C C   . MET B 133 ? 0.6223 0.6909 0.5907 -0.0277 -0.0246 -0.0129 132 MET B C   
2230 O O   . MET B 133 ? 0.6193 0.6922 0.5876 -0.0273 -0.0258 -0.0125 132 MET B O   
2231 C CB  . MET B 133 ? 0.6102 0.6849 0.5779 -0.0361 -0.0255 -0.0136 132 MET B CB  
2232 C CG  . MET B 133 ? 0.6231 0.6877 0.5863 -0.0384 -0.0263 -0.0134 132 MET B CG  
2233 S SD  . MET B 133 ? 0.6434 0.6993 0.6066 -0.0375 -0.0257 -0.0125 132 MET B SD  
2234 C CE  . MET B 133 ? 0.6355 0.6960 0.5982 -0.0424 -0.0259 -0.0121 132 MET B CE  
2235 N N   . LYS B 134 ? 0.6514 0.7113 0.6183 -0.0263 -0.0237 -0.0129 133 LYS B N   
2236 C CA  . LYS B 134 ? 0.6822 0.7365 0.6466 -0.0244 -0.0234 -0.0131 133 LYS B CA  
2237 C C   . LYS B 134 ? 0.7121 0.7645 0.6725 -0.0283 -0.0246 -0.0138 133 LYS B C   
2238 O O   . LYS B 134 ? 0.6948 0.7445 0.6540 -0.0319 -0.0251 -0.0143 133 LYS B O   
2239 C CB  . LYS B 134 ? 0.6947 0.7406 0.6593 -0.0227 -0.0219 -0.0135 133 LYS B CB  
2240 C CG  . LYS B 134 ? 0.7106 0.7494 0.6724 -0.0226 -0.0212 -0.0145 133 LYS B CG  
2241 C CD  . LYS B 134 ? 0.7210 0.7534 0.6845 -0.0199 -0.0194 -0.0149 133 LYS B CD  
2242 C CE  . LYS B 134 ? 0.7433 0.7681 0.7057 -0.0211 -0.0184 -0.0166 133 LYS B CE  
2243 N NZ  . LYS B 134 ? 0.7561 0.7802 0.7140 -0.0230 -0.0181 -0.0178 133 LYS B NZ  
2244 N N   . GLN B 135 ? 0.7620 0.8154 0.7199 -0.0278 -0.0251 -0.0138 134 GLN B N   
2245 C CA  . GLN B 135 ? 0.8063 0.8580 0.7595 -0.0320 -0.0260 -0.0149 134 GLN B CA  
2246 C C   . GLN B 135 ? 0.8356 0.8773 0.7857 -0.0321 -0.0240 -0.0166 134 GLN B C   
2247 O O   . GLN B 135 ? 0.8194 0.8574 0.7704 -0.0286 -0.0224 -0.0166 134 GLN B O   
2248 C CB  . GLN B 135 ? 0.8150 0.8743 0.7666 -0.0324 -0.0280 -0.0139 134 GLN B CB  
2249 C CG  . GLN B 135 ? 0.8276 0.8980 0.7836 -0.0325 -0.0299 -0.0126 134 GLN B CG  
2250 C CD  . GLN B 135 ? 0.8446 0.9178 0.8000 -0.0377 -0.0306 -0.0136 134 GLN B CD  
2251 O OE1 . GLN B 135 ? 0.8535 0.9201 0.8075 -0.0399 -0.0295 -0.0148 134 GLN B OE1 
2252 N NE2 . GLN B 135 ? 0.8481 0.9312 0.8048 -0.0399 -0.0328 -0.0131 134 GLN B NE2 
2253 N N   . PRO B 136 ? 0.8731 0.9104 0.8198 -0.0364 -0.0237 -0.0185 135 PRO B N   
2254 C CA  . PRO B 136 ? 0.8878 0.9156 0.8322 -0.0372 -0.0212 -0.0209 135 PRO B CA  
2255 C C   . PRO B 136 ? 0.8789 0.9052 0.8201 -0.0356 -0.0198 -0.0215 135 PRO B C   
2256 O O   . PRO B 136 ? 0.8704 0.9022 0.8081 -0.0363 -0.0214 -0.0203 135 PRO B O   
2257 C CB  . PRO B 136 ? 0.9015 0.9276 0.8417 -0.0429 -0.0213 -0.0228 135 PRO B CB  
2258 C CG  . PRO B 136 ? 0.9027 0.9346 0.8448 -0.0448 -0.0236 -0.0213 135 PRO B CG  
2259 C CD  . PRO B 136 ? 0.8881 0.9286 0.8336 -0.0411 -0.0252 -0.0187 135 PRO B CD  
2260 N N   . GLY B 137 ? 0.8714 0.8902 0.8139 -0.0336 -0.0169 -0.0231 136 GLY B N   
2261 C CA  . GLY B 137 ? 0.8677 0.8838 0.8068 -0.0327 -0.0150 -0.0240 136 GLY B CA  
2262 C C   . GLY B 137 ? 0.8567 0.8779 0.7958 -0.0290 -0.0163 -0.0211 136 GLY B C   
2263 O O   . GLY B 137 ? 0.8464 0.8677 0.7805 -0.0296 -0.0162 -0.0207 136 GLY B O   
2264 N N   . GLU B 138 ? 0.8507 0.8759 0.7953 -0.0256 -0.0175 -0.0190 137 GLU B N   
2265 C CA  . GLU B 138 ? 0.8370 0.8664 0.7826 -0.0218 -0.0184 -0.0164 137 GLU B CA  
2266 C C   . GLU B 138 ? 0.7980 0.8287 0.7499 -0.0181 -0.0179 -0.0155 137 GLU B C   
2267 O O   . GLU B 138 ? 0.7806 0.8115 0.7357 -0.0190 -0.0182 -0.0159 137 GLU B O   
2268 C CB  . GLU B 138 ? 0.8580 0.8958 0.8023 -0.0226 -0.0216 -0.0141 137 GLU B CB  
2269 C CG  . GLU B 138 ? 0.8759 0.9161 0.8195 -0.0193 -0.0225 -0.0115 137 GLU B CG  
2270 C CD  . GLU B 138 ? 0.8946 0.9444 0.8419 -0.0178 -0.0257 -0.0087 137 GLU B CD  
2271 O OE1 . GLU B 138 ? 0.9175 0.9731 0.8664 -0.0203 -0.0274 -0.0089 137 GLU B OE1 
2272 O OE2 . GLU B 138 ? 0.8924 0.9438 0.8414 -0.0140 -0.0262 -0.0063 137 GLU B OE2 
2273 N N   . VAL B 139 ? 0.7590 0.7900 0.7118 -0.0145 -0.0172 -0.0142 138 VAL B N   
2274 C CA  . VAL B 139 ? 0.7326 0.7648 0.6904 -0.0113 -0.0164 -0.0135 138 VAL B CA  
2275 C C   . VAL B 139 ? 0.7015 0.7418 0.6622 -0.0098 -0.0182 -0.0115 138 VAL B C   
2276 O O   . VAL B 139 ? 0.7154 0.7597 0.6746 -0.0095 -0.0199 -0.0099 138 VAL B O   
2277 C CB  . VAL B 139 ? 0.7380 0.7651 0.6952 -0.0085 -0.0139 -0.0137 138 VAL B CB  
2278 C CG1 . VAL B 139 ? 0.7436 0.7726 0.7050 -0.0053 -0.0130 -0.0128 138 VAL B CG1 
2279 C CG2 . VAL B 139 ? 0.7437 0.7639 0.7006 -0.0098 -0.0117 -0.0161 138 VAL B CG2 
2280 N N   . ARG B 140 ? 0.6516 0.6946 0.6167 -0.0090 -0.0177 -0.0117 139 ARG B N   
2281 C CA  . ARG B 140 ? 0.6170 0.6678 0.5862 -0.0075 -0.0183 -0.0106 139 ARG B CA  
2282 C C   . ARG B 140 ? 0.6069 0.6577 0.5777 -0.0032 -0.0174 -0.0093 139 ARG B C   
2283 O O   . ARG B 140 ? 0.5885 0.6332 0.5581 -0.0014 -0.0153 -0.0096 139 ARG B O   
2284 C CB  . ARG B 140 ? 0.5942 0.6469 0.5667 -0.0086 -0.0173 -0.0116 139 ARG B CB  
2285 C CG  . ARG B 140 ? 0.5820 0.6359 0.5534 -0.0130 -0.0188 -0.0122 139 ARG B CG  
2286 C CD  . ARG B 140 ? 0.5658 0.6198 0.5388 -0.0148 -0.0180 -0.0128 139 ARG B CD  
2287 N NE  . ARG B 140 ? 0.5523 0.5991 0.5244 -0.0146 -0.0172 -0.0131 139 ARG B NE  
2288 C CZ  . ARG B 140 ? 0.5434 0.5890 0.5161 -0.0165 -0.0170 -0.0131 139 ARG B CZ  
2289 N NH1 . ARG B 140 ? 0.5341 0.5849 0.5074 -0.0191 -0.0172 -0.0132 139 ARG B NH1 
2290 N NH2 . ARG B 140 ? 0.5430 0.5827 0.5158 -0.0161 -0.0168 -0.0131 139 ARG B NH2 
2291 N N   . ASP B 141 ? 0.6100 0.6677 0.5839 -0.0015 -0.0189 -0.0077 140 ASP B N   
2292 C CA  . ASP B 141 ? 0.6120 0.6698 0.5884 0.0029  -0.0185 -0.0059 140 ASP B CA  
2293 C C   . ASP B 141 ? 0.5872 0.6461 0.5692 0.0053  -0.0155 -0.0071 140 ASP B C   
2294 O O   . ASP B 141 ? 0.5866 0.6523 0.5736 0.0048  -0.0153 -0.0080 140 ASP B O   
2295 C CB  . ASP B 141 ? 0.6301 0.6953 0.6089 0.0039  -0.0218 -0.0033 140 ASP B CB  
2296 C CG  . ASP B 141 ? 0.6446 0.7094 0.6264 0.0088  -0.0220 -0.0006 140 ASP B CG  
2297 O OD1 . ASP B 141 ? 0.6557 0.7130 0.6357 0.0109  -0.0195 -0.0007 140 ASP B OD1 
2298 O OD2 . ASP B 141 ? 0.6581 0.7300 0.6442 0.0104  -0.0248 0.0018  140 ASP B OD2 
2299 N N   . GLN B 142 ? 0.5730 0.6251 0.5539 0.0074  -0.0129 -0.0075 141 GLN B N   
2300 C CA  . GLN B 142 ? 0.5622 0.6142 0.5474 0.0090  -0.0095 -0.0092 141 GLN B CA  
2301 C C   . GLN B 142 ? 0.5705 0.6252 0.5616 0.0135  -0.0086 -0.0081 141 GLN B C   
2302 O O   . GLN B 142 ? 0.5680 0.6242 0.5637 0.0145  -0.0055 -0.0100 141 GLN B O   
2303 C CB  . GLN B 142 ? 0.5564 0.6002 0.5379 0.0085  -0.0070 -0.0106 141 GLN B CB  
2304 C CG  . GLN B 142 ? 0.5525 0.5941 0.5304 0.0046  -0.0080 -0.0117 141 GLN B CG  
2305 C CD  . GLN B 142 ? 0.5484 0.5843 0.5250 0.0038  -0.0056 -0.0133 141 GLN B CD  
2306 O OE1 . GLN B 142 ? 0.5484 0.5819 0.5261 0.0056  -0.0030 -0.0140 141 GLN B OE1 
2307 N NE2 . GLN B 142 ? 0.5489 0.5826 0.5236 0.0009  -0.0067 -0.0139 141 GLN B NE2 
2308 N N   . ARG B 143 ? 0.5843 0.6395 0.5753 0.0160  -0.0111 -0.0050 142 ARG B N   
2309 C CA  . ARG B 143 ? 0.5972 0.6555 0.5953 0.0206  -0.0110 -0.0032 142 ARG B CA  
2310 C C   . ARG B 143 ? 0.5729 0.6419 0.5787 0.0203  -0.0115 -0.0043 142 ARG B C   
2311 O O   . ARG B 143 ? 0.5646 0.6372 0.5786 0.0236  -0.0094 -0.0050 142 ARG B O   
2312 C CB  . ARG B 143 ? 0.6323 0.6892 0.6282 0.0228  -0.0147 0.0012  142 ARG B CB  
2313 C CG  . ARG B 143 ? 0.6616 0.7080 0.6498 0.0230  -0.0138 0.0023  142 ARG B CG  
2314 C CD  . ARG B 143 ? 0.6869 0.7320 0.6726 0.0247  -0.0176 0.0071  142 ARG B CD  
2315 N NE  . ARG B 143 ? 0.7086 0.7593 0.6911 0.0216  -0.0221 0.0086  142 ARG B NE  
2316 C CZ  . ARG B 143 ? 0.7237 0.7756 0.7035 0.0218  -0.0265 0.0130  142 ARG B CZ  
2317 N NH1 . ARG B 143 ? 0.7376 0.7851 0.7177 0.0255  -0.0273 0.0168  142 ARG B NH1 
2318 N NH2 . ARG B 143 ? 0.7242 0.7816 0.7006 0.0180  -0.0302 0.0138  142 ARG B NH2 
2319 N N   . LEU B 144 ? 0.5506 0.6242 0.5538 0.0162  -0.0139 -0.0048 143 LEU B N   
2320 C CA  . LEU B 144 ? 0.5318 0.6156 0.5411 0.0146  -0.0143 -0.0062 143 LEU B CA  
2321 C C   . LEU B 144 ? 0.5091 0.5934 0.5208 0.0129  -0.0098 -0.0101 143 LEU B C   
2322 O O   . LEU B 144 ? 0.5068 0.5989 0.5258 0.0131  -0.0082 -0.0118 143 LEU B O   
2323 C CB  . LEU B 144 ? 0.5349 0.6216 0.5390 0.0098  -0.0177 -0.0058 143 LEU B CB  
2324 C CG  . LEU B 144 ? 0.5402 0.6381 0.5497 0.0076  -0.0193 -0.0065 143 LEU B CG  
2325 C CD1 . LEU B 144 ? 0.5461 0.6518 0.5638 0.0118  -0.0216 -0.0038 143 LEU B CD1 
2326 C CD2 . LEU B 144 ? 0.5451 0.6432 0.5476 0.0023  -0.0222 -0.0063 143 LEU B CD2 
2327 N N   . TRP B 145 ? 0.4810 0.5575 0.4866 0.0108  -0.0078 -0.0117 144 TRP B N   
2328 C CA  . TRP B 145 ? 0.4677 0.5442 0.4742 0.0084  -0.0039 -0.0151 144 TRP B CA  
2329 C C   . TRP B 145 ? 0.4648 0.5404 0.4771 0.0122  0.0003  -0.0166 144 TRP B C   
2330 O O   . TRP B 145 ? 0.4564 0.5367 0.4734 0.0110  0.0036  -0.0196 144 TRP B O   
2331 C CB  . TRP B 145 ? 0.4601 0.5289 0.4590 0.0051  -0.0034 -0.0159 144 TRP B CB  
2332 C CG  . TRP B 145 ? 0.4524 0.5199 0.4457 0.0016  -0.0068 -0.0148 144 TRP B CG  
2333 C CD1 . TRP B 145 ? 0.4507 0.5236 0.4440 -0.0005 -0.0098 -0.0139 144 TRP B CD1 
2334 C CD2 . TRP B 145 ? 0.4471 0.5074 0.4347 -0.0006 -0.0073 -0.0147 144 TRP B CD2 
2335 N NE1 . TRP B 145 ? 0.4525 0.5211 0.4400 -0.0037 -0.0118 -0.0134 144 TRP B NE1 
2336 C CE2 . TRP B 145 ? 0.4449 0.5060 0.4295 -0.0035 -0.0104 -0.0139 144 TRP B CE2 
2337 C CE3 . TRP B 145 ? 0.4463 0.4999 0.4316 -0.0003 -0.0054 -0.0155 144 TRP B CE3 
2338 C CZ2 . TRP B 145 ? 0.4459 0.5008 0.4260 -0.0057 -0.0115 -0.0138 144 TRP B CZ2 
2339 C CZ3 . TRP B 145 ? 0.4444 0.4928 0.4255 -0.0025 -0.0067 -0.0152 144 TRP B CZ3 
2340 C CH2 . TRP B 145 ? 0.4443 0.4933 0.4234 -0.0050 -0.0097 -0.0143 144 TRP B CH2 
2341 N N   . THR B 146 ? 0.4733 0.5426 0.4852 0.0163  0.0006  -0.0147 145 THR B N   
2342 C CA  . THR B 146 ? 0.4843 0.5509 0.5014 0.0202  0.0047  -0.0160 145 THR B CA  
2343 C C   . THR B 146 ? 0.4796 0.5543 0.5074 0.0238  0.0051  -0.0158 145 THR B C   
2344 O O   . THR B 146 ? 0.4772 0.5535 0.5115 0.0251  0.0097  -0.0189 145 THR B O   
2345 C CB  . THR B 146 ? 0.4948 0.5523 0.5088 0.0238  0.0044  -0.0134 145 THR B CB  
2346 O OG1 . THR B 146 ? 0.5094 0.5688 0.5243 0.0266  -0.0001 -0.0091 145 THR B OG1 
2347 C CG2 . THR B 146 ? 0.4988 0.5488 0.5036 0.0206  0.0044  -0.0137 145 THR B CG2 
2348 N N   . ASP B 147 ? 0.4824 0.5626 0.5124 0.0252  0.0004  -0.0125 146 ASP B N   
2349 C CA  . ASP B 147 ? 0.4901 0.5792 0.5313 0.0289  -0.0003 -0.0117 146 ASP B CA  
2350 C C   . ASP B 147 ? 0.4768 0.5753 0.5232 0.0255  0.0023  -0.0158 146 ASP B C   
2351 O O   . ASP B 147 ? 0.4841 0.5884 0.5413 0.0282  0.0054  -0.0179 146 ASP B O   
2352 C CB  . ASP B 147 ? 0.5049 0.5980 0.5458 0.0301  -0.0067 -0.0069 146 ASP B CB  
2353 C CG  . ASP B 147 ? 0.5239 0.6261 0.5775 0.0348  -0.0082 -0.0051 146 ASP B CG  
2354 O OD1 . ASP B 147 ? 0.5426 0.6431 0.6044 0.0399  -0.0053 -0.0052 146 ASP B OD1 
2355 O OD2 . ASP B 147 ? 0.5375 0.6487 0.5934 0.0334  -0.0124 -0.0034 146 ASP B OD2 
2356 N N   . ALA B 148 ? 0.4635 0.5633 0.5027 0.0194  0.0011  -0.0171 147 ALA B N   
2357 C CA  . ALA B 148 ? 0.4537 0.5614 0.4956 0.0149  0.0034  -0.0208 147 ALA B CA  
2358 C C   . ALA B 148 ? 0.4555 0.5607 0.4990 0.0139  0.0099  -0.0254 147 ALA B C   
2359 O O   . ALA B 148 ? 0.4565 0.5691 0.5076 0.0130  0.0136  -0.0289 147 ALA B O   
2360 C CB  . ALA B 148 ? 0.4460 0.5530 0.4783 0.0086  0.0007  -0.0206 147 ALA B CB  
2361 N N   . LEU B 149 ? 0.4594 0.5545 0.4958 0.0135  0.0115  -0.0256 148 LEU B N   
2362 C CA  . LEU B 149 ? 0.4604 0.5521 0.4969 0.0120  0.0176  -0.0299 148 LEU B CA  
2363 C C   . LEU B 149 ? 0.4746 0.5668 0.5217 0.0178  0.0217  -0.0313 148 LEU B C   
2364 O O   . LEU B 149 ? 0.4807 0.5760 0.5330 0.0165  0.0273  -0.0359 148 LEU B O   
2365 C CB  . LEU B 149 ? 0.4525 0.5336 0.4792 0.0102  0.0177  -0.0293 148 LEU B CB  
2366 C CG  . LEU B 149 ? 0.4500 0.5297 0.4672 0.0039  0.0150  -0.0290 148 LEU B CG  
2367 C CD1 . LEU B 149 ? 0.4548 0.5247 0.4646 0.0039  0.0141  -0.0275 148 LEU B CD1 
2368 C CD2 . LEU B 149 ? 0.4474 0.5308 0.4632 -0.0022 0.0184  -0.0329 148 LEU B CD2 
2369 N N   . ALA B 150 ? 0.4802 0.5689 0.5302 0.0239  0.0190  -0.0273 149 ALA B N   
2370 C CA  . ALA B 150 ? 0.4884 0.5764 0.5490 0.0303  0.0221  -0.0276 149 ALA B CA  
2371 C C   . ALA B 150 ? 0.4952 0.5952 0.5689 0.0320  0.0234  -0.0295 149 ALA B C   
2372 O O   . ALA B 150 ? 0.5012 0.6023 0.5849 0.0351  0.0287  -0.0327 149 ALA B O   
2373 C CB  . ALA B 150 ? 0.4915 0.5739 0.5518 0.0359  0.0177  -0.0219 149 ALA B CB  
2374 N N   . ALA B 151 ? 0.5010 0.6097 0.5750 0.0298  0.0189  -0.0278 150 ALA B N   
2375 C CA  . ALA B 151 ? 0.5106 0.6320 0.5970 0.0308  0.0196  -0.0295 150 ALA B CA  
2376 C C   . ALA B 151 ? 0.5293 0.6553 0.6184 0.0260  0.0266  -0.0364 150 ALA B C   
2377 O O   . ALA B 151 ? 0.5372 0.6725 0.6391 0.0277  0.0297  -0.0393 150 ALA B O   
2378 C CB  . ALA B 151 ? 0.5078 0.6369 0.5919 0.0284  0.0131  -0.0262 150 ALA B CB  
2379 N N   . LEU B 152 ? 0.5472 0.6671 0.6246 0.0197  0.0290  -0.0390 151 LEU B N   
2380 C CA  . LEU B 152 ? 0.5657 0.6889 0.6428 0.0137  0.0353  -0.0453 151 LEU B CA  
2381 C C   . LEU B 152 ? 0.5967 0.7134 0.6760 0.0148  0.0428  -0.0498 151 LEU B C   
2382 O O   . LEU B 152 ? 0.6048 0.7198 0.6780 0.0083  0.0475  -0.0544 151 LEU B O   
2383 C CB  . LEU B 152 ? 0.5592 0.6799 0.6219 0.0054  0.0332  -0.0452 151 LEU B CB  
2384 C CG  . LEU B 152 ? 0.5483 0.6750 0.6078 0.0026  0.0270  -0.0420 151 LEU B CG  
2385 C CD1 . LEU B 152 ? 0.5438 0.6647 0.5889 -0.0041 0.0244  -0.0408 151 LEU B CD1 
2386 C CD2 . LEU B 152 ? 0.5476 0.6869 0.6157 0.0001  0.0293  -0.0453 151 LEU B CD2 
2387 N N   . THR B 153 ? 0.6319 0.7447 0.7198 0.0226  0.0437  -0.0484 152 THR B N   
2388 C CA  . THR B 153 ? 0.6496 0.7555 0.7406 0.0242  0.0510  -0.0526 152 THR B CA  
2389 C C   . THR B 153 ? 0.6609 0.7694 0.7689 0.0327  0.0535  -0.0527 152 THR B C   
2390 O O   . THR B 153 ? 0.6672 0.7812 0.7832 0.0381  0.0482  -0.0480 152 THR B O   
2391 C CB  . THR B 153 ? 0.6648 0.7574 0.7448 0.0246  0.0498  -0.0501 152 THR B CB  
2392 O OG1 . THR B 153 ? 0.6739 0.7634 0.7537 0.0304  0.0430  -0.0432 152 THR B OG1 
2393 C CG2 . THR B 153 ? 0.6575 0.7473 0.7224 0.0163  0.0484  -0.0507 152 THR B CG2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   HIS 1   0   0   HIS HIS A . n 
A 1 2   MET 2   1   1   MET MET A . n 
A 1 3   LEU 3   2   2   LEU LEU A . n 
A 1 4   ASN 4   3   3   ASN ASN A . n 
A 1 5   VAL 5   4   4   VAL VAL A . n 
A 1 6   GLY 6   5   5   GLY GLY A . n 
A 1 7   ALA 7   6   6   ALA ALA A . n 
A 1 8   THR 8   7   7   THR THR A . n 
A 1 9   ALA 9   8   8   ALA ALA A . n 
A 1 10  PRO 10  9   9   PRO PRO A . n 
A 1 11  ASP 11  10  10  ASP ASP A . n 
A 1 12  PHE 12  11  11  PHE PHE A . n 
A 1 13  THR 13  12  12  THR THR A . n 
A 1 14  LEU 14  13  13  LEU LEU A . n 
A 1 15  ARG 15  14  14  ARG ARG A . n 
A 1 16  ASP 16  15  15  ASP ASP A . n 
A 1 17  GLN 17  16  16  GLN GLN A . n 
A 1 18  ASN 18  17  17  ASN ASN A . n 
A 1 19  GLN 19  18  18  GLN GLN A . n 
A 1 20  GLN 20  19  19  GLN GLN A . n 
A 1 21  LEU 21  20  20  LEU LEU A . n 
A 1 22  VAL 22  21  21  VAL VAL A . n 
A 1 23  THR 23  22  22  THR THR A . n 
A 1 24  LEU 24  23  23  LEU LEU A . n 
A 1 25  ARG 25  24  24  ARG ARG A . n 
A 1 26  GLY 26  25  25  GLY GLY A . n 
A 1 27  TYR 27  26  26  TYR TYR A . n 
A 1 28  ARG 28  27  27  ARG ARG A . n 
A 1 29  GLY 29  28  28  GLY GLY A . n 
A 1 30  ALA 30  29  29  ALA ALA A . n 
A 1 31  LYS 31  30  30  LYS LYS A . n 
A 1 32  ASN 32  31  31  ASN ASN A . n 
A 1 33  VAL 33  32  32  VAL VAL A . n 
A 1 34  LEU 34  33  33  LEU LEU A . n 
A 1 35  LEU 35  34  34  LEU LEU A . n 
A 1 36  VAL 36  35  35  VAL VAL A . n 
A 1 37  PHE 37  36  36  PHE PHE A . n 
A 1 38  PHE 38  37  37  PHE PHE A . n 
A 1 39  PRO 39  38  38  PRO PRO A . n 
A 1 40  LEU 40  39  39  LEU LEU A . n 
A 1 41  ALA 41  40  40  ALA ALA A . n 
A 1 42  PHE 42  41  41  PHE PHE A . n 
A 1 43  THR 43  42  42  THR THR A . n 
A 1 44  GLY 44  43  43  GLY GLY A . n 
A 1 45  ILE 45  44  44  ILE ILE A . n 
A 1 46  CYS 46  45  45  CYS CYS A . n 
A 1 47  GLN 47  46  46  GLN GLN A . n 
A 1 48  GLY 48  47  47  GLY GLY A . n 
A 1 49  GLU 49  48  48  GLU GLU A . n 
A 1 50  LEU 50  49  49  LEU LEU A . n 
A 1 51  ASP 51  50  50  ASP ASP A . n 
A 1 52  GLN 52  51  51  GLN GLN A . n 
A 1 53  LEU 53  52  52  LEU LEU A . n 
A 1 54  ARG 54  53  53  ARG ARG A . n 
A 1 55  ASP 55  54  54  ASP ASP A . n 
A 1 56  HIS 56  55  55  HIS HIS A . n 
A 1 57  LEU 57  56  56  LEU LEU A . n 
A 1 58  PRO 58  57  57  PRO PRO A . n 
A 1 59  GLU 59  58  58  GLU GLU A . n 
A 1 60  PHE 60  59  59  PHE PHE A . n 
A 1 61  GLU 61  60  60  GLU GLU A . n 
A 1 62  ASN 62  61  61  ASN ASN A . n 
A 1 63  ASP 63  62  62  ASP ASP A . n 
A 1 64  ASP 64  63  63  ASP ASP A . n 
A 1 65  SER 65  64  64  SER SER A . n 
A 1 66  ALA 66  65  65  ALA ALA A . n 
A 1 67  ALA 67  66  66  ALA ALA A . n 
A 1 68  LEU 68  67  67  LEU LEU A . n 
A 1 69  ALA 69  68  68  ALA ALA A . n 
A 1 70  ILE 70  69  69  ILE ILE A . n 
A 1 71  SER 71  70  70  SER SER A . n 
A 1 72  VAL 72  71  71  VAL VAL A . n 
A 1 73  GLY 73  72  72  GLY GLY A . n 
A 1 74  PRO 74  73  73  PRO PRO A . n 
A 1 75  PRO 75  74  74  PRO PRO A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  THR 77  76  76  THR THR A . n 
A 1 78  HIS 78  77  77  HIS HIS A . n 
A 1 79  LYS 79  78  78  LYS LYS A . n 
A 1 80  ILE 80  79  79  ILE ILE A . n 
A 1 81  TRP 81  80  80  TRP TRP A . n 
A 1 82  ALA 82  81  81  ALA ALA A . n 
A 1 83  THR 83  82  82  THR THR A . n 
A 1 84  GLN 84  83  83  GLN GLN A . n 
A 1 85  SER 85  84  84  SER SER A . n 
A 1 86  GLY 86  85  85  GLY GLY A . n 
A 1 87  PHE 87  86  86  PHE PHE A . n 
A 1 88  THR 88  87  87  THR THR A . n 
A 1 89  PHE 89  88  88  PHE PHE A . n 
A 1 90  PRO 90  89  89  PRO PRO A . n 
A 1 91  LEU 91  90  90  LEU LEU A . n 
A 1 92  LEU 92  91  91  LEU LEU A . n 
A 1 93  SER 93  92  92  SER SER A . n 
A 1 94  ASP 94  93  93  ASP ASP A . n 
A 1 95  PHE 95  94  94  PHE PHE A . n 
A 1 96  TRP 96  95  95  TRP TRP A . n 
A 1 97  PRO 97  96  96  PRO PRO A . n 
A 1 98  HIS 98  97  97  HIS HIS A . n 
A 1 99  GLY 99  98  98  GLY GLY A . n 
A 1 100 ALA 100 99  99  ALA ALA A . n 
A 1 101 VAL 101 100 100 VAL VAL A . n 
A 1 102 SER 102 101 101 SER SER A . n 
A 1 103 GLN 103 102 102 GLN GLN A . n 
A 1 104 ALA 104 103 103 ALA ALA A . n 
A 1 105 TYR 105 104 104 TYR TYR A . n 
A 1 106 GLY 106 105 105 GLY GLY A . n 
A 1 107 VAL 107 106 106 VAL VAL A . n 
A 1 108 PHE 108 107 107 PHE PHE A . n 
A 1 109 ASN 109 108 108 ASN ASN A . n 
A 1 110 GLU 110 109 109 GLU GLU A . n 
A 1 111 GLN 111 110 110 GLN GLN A . n 
A 1 112 ALA 112 111 111 ALA ALA A . n 
A 1 113 GLY 113 112 112 GLY GLY A . n 
A 1 114 ILE 114 113 113 ILE ILE A . n 
A 1 115 ALA 115 114 114 ALA ALA A . n 
A 1 116 ASN 116 115 115 ASN ASN A . n 
A 1 117 ALA 117 116 116 ALA ALA A . n 
A 1 118 GLY 118 117 117 GLY GLY A . n 
A 1 119 THR 119 118 118 THR THR A . n 
A 1 120 PHE 120 119 119 PHE PHE A . n 
A 1 121 VAL 121 120 120 VAL VAL A . n 
A 1 122 VAL 122 121 121 VAL VAL A . n 
A 1 123 ASP 123 122 122 ASP ASP A . n 
A 1 124 ARG 124 123 123 ARG ARG A . n 
A 1 125 SER 125 124 124 SER SER A . n 
A 1 126 GLY 126 125 125 GLY GLY A . n 
A 1 127 ILE 127 126 126 ILE ILE A . n 
A 1 128 ILE 128 127 127 ILE ILE A . n 
A 1 129 ARG 129 128 128 ARG ARG A . n 
A 1 130 PHE 130 129 129 PHE PHE A . n 
A 1 131 ALA 131 130 130 ALA ALA A . n 
A 1 132 GLU 132 131 131 GLU GLU A . n 
A 1 133 MET 133 132 132 MET MET A . n 
A 1 134 LYS 134 133 133 LYS LYS A . n 
A 1 135 GLN 135 134 134 GLN GLN A . n 
A 1 136 PRO 136 135 135 PRO PRO A . n 
A 1 137 GLY 137 136 136 GLY GLY A . n 
A 1 138 GLU 138 137 137 GLU GLU A . n 
A 1 139 VAL 139 138 138 VAL VAL A . n 
A 1 140 ARG 140 139 139 ARG ARG A . n 
A 1 141 ASP 141 140 140 ASP ASP A . n 
A 1 142 GLN 142 141 141 GLN GLN A . n 
A 1 143 ARG 143 142 142 ARG ARG A . n 
A 1 144 LEU 144 143 143 LEU LEU A . n 
A 1 145 TRP 145 144 144 TRP TRP A . n 
A 1 146 THR 146 145 145 THR THR A . n 
A 1 147 ASP 147 146 146 ASP ASP A . n 
A 1 148 ALA 148 147 147 ALA ALA A . n 
A 1 149 LEU 149 148 148 LEU LEU A . n 
A 1 150 ALA 150 149 149 ALA ALA A . n 
A 1 151 ALA 151 150 150 ALA ALA A . n 
A 1 152 LEU 152 151 151 LEU LEU A . n 
A 1 153 THR 153 152 152 THR THR A . n 
B 1 1   HIS 1   0   0   HIS HIS B . n 
B 1 2   MET 2   1   1   MET MET B . n 
B 1 3   LEU 3   2   2   LEU LEU B . n 
B 1 4   ASN 4   3   3   ASN ASN B . n 
B 1 5   VAL 5   4   4   VAL VAL B . n 
B 1 6   GLY 6   5   5   GLY GLY B . n 
B 1 7   ALA 7   6   6   ALA ALA B . n 
B 1 8   THR 8   7   7   THR THR B . n 
B 1 9   ALA 9   8   8   ALA ALA B . n 
B 1 10  PRO 10  9   9   PRO PRO B . n 
B 1 11  ASP 11  10  10  ASP ASP B . n 
B 1 12  PHE 12  11  11  PHE PHE B . n 
B 1 13  THR 13  12  12  THR THR B . n 
B 1 14  LEU 14  13  13  LEU LEU B . n 
B 1 15  ARG 15  14  14  ARG ARG B . n 
B 1 16  ASP 16  15  15  ASP ASP B . n 
B 1 17  GLN 17  16  16  GLN GLN B . n 
B 1 18  ASN 18  17  17  ASN ASN B . n 
B 1 19  GLN 19  18  18  GLN GLN B . n 
B 1 20  GLN 20  19  19  GLN GLN B . n 
B 1 21  LEU 21  20  20  LEU LEU B . n 
B 1 22  VAL 22  21  21  VAL VAL B . n 
B 1 23  THR 23  22  22  THR THR B . n 
B 1 24  LEU 24  23  23  LEU LEU B . n 
B 1 25  ARG 25  24  24  ARG ARG B . n 
B 1 26  GLY 26  25  25  GLY GLY B . n 
B 1 27  TYR 27  26  26  TYR TYR B . n 
B 1 28  ARG 28  27  27  ARG ARG B . n 
B 1 29  GLY 29  28  28  GLY GLY B . n 
B 1 30  ALA 30  29  29  ALA ALA B . n 
B 1 31  LYS 31  30  30  LYS LYS B . n 
B 1 32  ASN 32  31  31  ASN ASN B . n 
B 1 33  VAL 33  32  32  VAL VAL B . n 
B 1 34  LEU 34  33  33  LEU LEU B . n 
B 1 35  LEU 35  34  34  LEU LEU B . n 
B 1 36  VAL 36  35  35  VAL VAL B . n 
B 1 37  PHE 37  36  36  PHE PHE B . n 
B 1 38  PHE 38  37  37  PHE PHE B . n 
B 1 39  PRO 39  38  38  PRO PRO B . n 
B 1 40  LEU 40  39  39  LEU LEU B . n 
B 1 41  ALA 41  40  40  ALA ALA B . n 
B 1 42  PHE 42  41  41  PHE PHE B . n 
B 1 43  THR 43  42  42  THR THR B . n 
B 1 44  GLY 44  43  43  GLY GLY B . n 
B 1 45  ILE 45  44  44  ILE ILE B . n 
B 1 46  CYS 46  45  45  CYS CYS B . n 
B 1 47  GLN 47  46  46  GLN GLN B . n 
B 1 48  GLY 48  47  47  GLY GLY B . n 
B 1 49  GLU 49  48  48  GLU GLU B . n 
B 1 50  LEU 50  49  49  LEU LEU B . n 
B 1 51  ASP 51  50  50  ASP ASP B . n 
B 1 52  GLN 52  51  51  GLN GLN B . n 
B 1 53  LEU 53  52  52  LEU LEU B . n 
B 1 54  ARG 54  53  53  ARG ARG B . n 
B 1 55  ASP 55  54  54  ASP ASP B . n 
B 1 56  HIS 56  55  55  HIS HIS B . n 
B 1 57  LEU 57  56  56  LEU LEU B . n 
B 1 58  PRO 58  57  57  PRO PRO B . n 
B 1 59  GLU 59  58  58  GLU GLU B . n 
B 1 60  PHE 60  59  59  PHE PHE B . n 
B 1 61  GLU 61  60  60  GLU GLU B . n 
B 1 62  ASN 62  61  61  ASN ASN B . n 
B 1 63  ASP 63  62  62  ASP ASP B . n 
B 1 64  ASP 64  63  63  ASP ASP B . n 
B 1 65  SER 65  64  64  SER SER B . n 
B 1 66  ALA 66  65  65  ALA ALA B . n 
B 1 67  ALA 67  66  66  ALA ALA B . n 
B 1 68  LEU 68  67  67  LEU LEU B . n 
B 1 69  ALA 69  68  68  ALA ALA B . n 
B 1 70  ILE 70  69  69  ILE ILE B . n 
B 1 71  SER 71  70  70  SER SER B . n 
B 1 72  VAL 72  71  71  VAL VAL B . n 
B 1 73  GLY 73  72  72  GLY GLY B . n 
B 1 74  PRO 74  73  73  PRO PRO B . n 
B 1 75  PRO 75  74  74  PRO PRO B . n 
B 1 76  PRO 76  75  75  PRO PRO B . n 
B 1 77  THR 77  76  76  THR THR B . n 
B 1 78  HIS 78  77  77  HIS HIS B . n 
B 1 79  LYS 79  78  78  LYS LYS B . n 
B 1 80  ILE 80  79  79  ILE ILE B . n 
B 1 81  TRP 81  80  80  TRP TRP B . n 
B 1 82  ALA 82  81  81  ALA ALA B . n 
B 1 83  THR 83  82  82  THR THR B . n 
B 1 84  GLN 84  83  83  GLN GLN B . n 
B 1 85  SER 85  84  84  SER SER B . n 
B 1 86  GLY 86  85  85  GLY GLY B . n 
B 1 87  PHE 87  86  86  PHE PHE B . n 
B 1 88  THR 88  87  87  THR THR B . n 
B 1 89  PHE 89  88  88  PHE PHE B . n 
B 1 90  PRO 90  89  89  PRO PRO B . n 
B 1 91  LEU 91  90  90  LEU LEU B . n 
B 1 92  LEU 92  91  91  LEU LEU B . n 
B 1 93  SER 93  92  92  SER SER B . n 
B 1 94  ASP 94  93  93  ASP ASP B . n 
B 1 95  PHE 95  94  94  PHE PHE B . n 
B 1 96  TRP 96  95  95  TRP TRP B . n 
B 1 97  PRO 97  96  96  PRO PRO B . n 
B 1 98  HIS 98  97  97  HIS HIS B . n 
B 1 99  GLY 99  98  98  GLY GLY B . n 
B 1 100 ALA 100 99  99  ALA ALA B . n 
B 1 101 VAL 101 100 100 VAL VAL B . n 
B 1 102 SER 102 101 101 SER SER B . n 
B 1 103 GLN 103 102 102 GLN GLN B . n 
B 1 104 ALA 104 103 103 ALA ALA B . n 
B 1 105 TYR 105 104 104 TYR TYR B . n 
B 1 106 GLY 106 105 105 GLY GLY B . n 
B 1 107 VAL 107 106 106 VAL VAL B . n 
B 1 108 PHE 108 107 107 PHE PHE B . n 
B 1 109 ASN 109 108 108 ASN ASN B . n 
B 1 110 GLU 110 109 109 GLU GLU B . n 
B 1 111 GLN 111 110 110 GLN GLN B . n 
B 1 112 ALA 112 111 111 ALA ALA B . n 
B 1 113 GLY 113 112 112 GLY GLY B . n 
B 1 114 ILE 114 113 113 ILE ILE B . n 
B 1 115 ALA 115 114 114 ALA ALA B . n 
B 1 116 ASN 116 115 115 ASN ASN B . n 
B 1 117 ALA 117 116 116 ALA ALA B . n 
B 1 118 GLY 118 117 117 GLY GLY B . n 
B 1 119 THR 119 118 118 THR THR B . n 
B 1 120 PHE 120 119 119 PHE PHE B . n 
B 1 121 VAL 121 120 120 VAL VAL B . n 
B 1 122 VAL 122 121 121 VAL VAL B . n 
B 1 123 ASP 123 122 122 ASP ASP B . n 
B 1 124 ARG 124 123 123 ARG ARG B . n 
B 1 125 SER 125 124 124 SER SER B . n 
B 1 126 GLY 126 125 125 GLY GLY B . n 
B 1 127 ILE 127 126 126 ILE ILE B . n 
B 1 128 ILE 128 127 127 ILE ILE B . n 
B 1 129 ARG 129 128 128 ARG ARG B . n 
B 1 130 PHE 130 129 129 PHE PHE B . n 
B 1 131 ALA 131 130 130 ALA ALA B . n 
B 1 132 GLU 132 131 131 GLU GLU B . n 
B 1 133 MET 133 132 132 MET MET B . n 
B 1 134 LYS 134 133 133 LYS LYS B . n 
B 1 135 GLN 135 134 134 GLN GLN B . n 
B 1 136 PRO 136 135 135 PRO PRO B . n 
B 1 137 GLY 137 136 136 GLY GLY B . n 
B 1 138 GLU 138 137 137 GLU GLU B . n 
B 1 139 VAL 139 138 138 VAL VAL B . n 
B 1 140 ARG 140 139 139 ARG ARG B . n 
B 1 141 ASP 141 140 140 ASP ASP B . n 
B 1 142 GLN 142 141 141 GLN GLN B . n 
B 1 143 ARG 143 142 142 ARG ARG B . n 
B 1 144 LEU 144 143 143 LEU LEU B . n 
B 1 145 TRP 145 144 144 TRP TRP B . n 
B 1 146 THR 146 145 145 THR THR B . n 
B 1 147 ASP 147 146 146 ASP ASP B . n 
B 1 148 ALA 148 147 147 ALA ALA B . n 
B 1 149 LEU 149 148 148 LEU LEU B . n 
B 1 150 ALA 150 149 149 ALA ALA B . n 
B 1 151 ALA 151 150 150 ALA ALA B . n 
B 1 152 LEU 152 151 151 LEU LEU B . n 
B 1 153 THR 153 152 152 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  201 12 HOH HOH A . 
C 2 HOH 2  202 5  HOH HOH A . 
C 2 HOH 3  203 3  HOH HOH A . 
C 2 HOH 4  204 32 HOH HOH A . 
C 2 HOH 5  205 31 HOH HOH A . 
C 2 HOH 6  206 45 HOH HOH A . 
C 2 HOH 7  207 56 HOH HOH A . 
C 2 HOH 8  208 28 HOH HOH A . 
C 2 HOH 9  209 30 HOH HOH A . 
C 2 HOH 10 210 35 HOH HOH A . 
C 2 HOH 11 211 59 HOH HOH A . 
C 2 HOH 12 212 34 HOH HOH A . 
C 2 HOH 13 213 6  HOH HOH A . 
C 2 HOH 14 214 29 HOH HOH A . 
C 2 HOH 15 215 27 HOH HOH A . 
C 2 HOH 16 216 46 HOH HOH A . 
C 2 HOH 17 217 26 HOH HOH A . 
C 2 HOH 18 218 4  HOH HOH A . 
C 2 HOH 19 219 33 HOH HOH A . 
C 2 HOH 20 220 24 HOH HOH A . 
C 2 HOH 21 221 49 HOH HOH A . 
C 2 HOH 22 222 17 HOH HOH A . 
C 2 HOH 23 223 52 HOH HOH A . 
D 2 HOH 1  201 57 HOH HOH B . 
D 2 HOH 2  202 48 HOH HOH B . 
D 2 HOH 3  203 2  HOH HOH B . 
D 2 HOH 4  204 22 HOH HOH B . 
D 2 HOH 5  205 1  HOH HOH B . 
D 2 HOH 6  206 7  HOH HOH B . 
D 2 HOH 7  207 20 HOH HOH B . 
D 2 HOH 8  208 16 HOH HOH B . 
D 2 HOH 9  209 13 HOH HOH B . 
D 2 HOH 10 210 42 HOH HOH B . 
D 2 HOH 11 211 43 HOH HOH B . 
D 2 HOH 12 212 18 HOH HOH B . 
D 2 HOH 13 213 15 HOH HOH B . 
D 2 HOH 14 214 39 HOH HOH B . 
D 2 HOH 15 215 23 HOH HOH B . 
D 2 HOH 16 216 61 HOH HOH B . 
D 2 HOH 17 217 10 HOH HOH B . 
D 2 HOH 18 218 53 HOH HOH B . 
D 2 HOH 19 219 11 HOH HOH B . 
D 2 HOH 20 220 40 HOH HOH B . 
D 2 HOH 21 221 19 HOH HOH B . 
D 2 HOH 22 222 51 HOH HOH B . 
D 2 HOH 23 223 47 HOH HOH B . 
D 2 HOH 24 224 21 HOH HOH B . 
D 2 HOH 25 225 8  HOH HOH B . 
D 2 HOH 26 226 25 HOH HOH B . 
D 2 HOH 27 227 50 HOH HOH B . 
D 2 HOH 28 228 58 HOH HOH B . 
D 2 HOH 29 229 38 HOH HOH B . 
D 2 HOH 30 230 14 HOH HOH B . 
D 2 HOH 31 231 44 HOH HOH B . 
D 2 HOH 32 232 36 HOH HOH B . 
D 2 HOH 33 233 9  HOH HOH B . 
D 2 HOH 34 234 60 HOH HOH B . 
D 2 HOH 35 235 55 HOH HOH B . 
D 2 HOH 36 236 54 HOH HOH B . 
D 2 HOH 37 237 37 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
1 2 B,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1450  ? 
1 MORE         -13   ? 
1 'SSA (A^2)'  13040 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z               1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000   
2 'crystal symmetry operation' 6_564 -x+1/2,-y+3/2,z-1/2 -1.0000000000 0.0000000000 0.0000000000 73.6300000000 0.0000000000 
-1.0000000000 0.0000000000 220.8900000000 0.0000000000 0.0000000000 1.0000000000 -16.6515000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-29 
2 'Structure model' 1 1 2016-07-27 
3 'Structure model' 1 2 2016-08-10 
4 'Structure model' 1 3 2016-08-24 
5 'Structure model' 2 0 2020-03-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Database references'        
4 5 'Structure model' 'Atomic model'               
5 5 'Structure model' 'Author supporting evidence' 
6 5 'Structure model' 'Data collection'            
7 5 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' atom_site                 
2 5 'Structure model' pdbx_audit_support        
3 5 'Structure model' pdbx_nonpoly_scheme       
4 5 'Structure model' pdbx_struct_assembly_gen  
5 5 'Structure model' pdbx_struct_assembly_prop 
6 5 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_atom_site.B_iso_or_equiv'                
2 5 'Structure model' '_atom_site.Cartn_x'                       
3 5 'Structure model' '_atom_site.Cartn_y'                       
4 5 'Structure model' '_atom_site.Cartn_z'                       
5 5 'Structure model' '_pdbx_audit_support.funding_organization' 
6 5 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num'        
7 5 'Structure model' '_pdbx_struct_assembly_prop.value'         
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         24.5177 
_pdbx_refine_tls.origin_y         121.1007 
_pdbx_refine_tls.origin_z         -35.7148 
_pdbx_refine_tls.T[1][1]          0.0615 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0022 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0178 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.0637 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          -0.0249 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.0332 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          0.5903 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          0.4783 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          -0.1123 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          0.6289 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          0.0719 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          0.5138 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0908 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.0427 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0672 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.0302 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0220 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0229 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.0897 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          -0.0537 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          -0.0688 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 152 ? ? 
2 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? B 152 ? ? 
# 
_pdbx_phasing_MR.entry_id                     4XIH 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                'Phaser MODE: MR_AUTO' 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          6.400 
_pdbx_phasing_MR.d_res_low_rotation           36.810 
_pdbx_phasing_MR.d_res_high_translation       6.400 
_pdbx_phasing_MR.d_res_low_translation        36.810 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .        1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? 2.5.6    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0073 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .        5 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? .        6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG1 A THR 118 ? ? NH1 A ARG 139 ? A 1.97 
2 1 OE1 A GLU 48  ? ? NH2 A ARG 139 ? A 2.12 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 29  ? ? -139.70 -56.54 
2 1 ASP A 93  ? ? -100.26 52.22  
3 1 LEU A 151 ? ? -98.20  36.56  
4 1 ALA B 29  ? ? -120.80 -58.04 
5 1 ASP B 93  ? ? -94.68  54.87  
# 
_pdbx_audit_support.funding_organization   'Research Foundation - Flanders (FWO)' 
_pdbx_audit_support.country                Belgium 
_pdbx_audit_support.grant_number           G030512N 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#