data_4XRS
# 
_entry.id   4XRS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4XRS         
WWPDB D_1000206212 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4XRS 
_pdbx_database_status.recvd_initial_deposition_date   2015-01-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jorma, A.'     1 
'Yin, Y.'       2 
'Nitta, K.R.'   3 
'Dave, K.'      4 
'Enge, M.'      5 
'Kivioja, T.'   6 
'Popov, A.'     7 
'Morgunova, E.' 8 
'Taipale, J.'   9 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            527 
_citation.language                  ? 
_citation.page_first                384 
_citation.page_last                 388 
_citation.title                     'DNA-dependent formation of transcription factor pairs alters their binding specificity.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature15518 
_citation.pdbx_database_id_PubMed   26550823 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jolma, A.'     1  ? 
primary 'Yin, Y.'       2  ? 
primary 'Nitta, K.R.'   3  ? 
primary 'Dave, K.'      4  ? 
primary 'Popov, A.'     5  ? 
primary 'Taipale, M.'   6  ? 
primary 'Enge, M.'      7  ? 
primary 'Kivioja, T.'   8  ? 
primary 'Morgunova, E.' 9  ? 
primary 'Taipale, J.'   10 ? 
# 
_cell.length_a           69.636 
_cell.length_b           69.845 
_cell.length_c           116.888 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           4XRS 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         4XRS 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(P*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*A)-3')
;
4527.974 1 ? ? ?                      ? 
2 polymer syn 
;DNA (5'-D(P*AP*CP*AP*AP*TP*TP*AP*TP*CP*CP*TP*GP*TP*CP*AP*AP*C)-3')
;
5130.362 1 ? ? ?                      ? 
3 polymer syn 
;DNA (5'-D(P*GP*TP*TP*GP*AP*CP*AP*GP*GP*AP*TP*AP*AP*TP*TP*GP*TP*T)-3')
;
5585.637 1 ? ? ?                      ? 
4 polymer syn 
;DNA (5'-D(P*TP*TP*GP*AP*CP*AP*GP*GP*AP*TP*AP*AP*TP*TP*GP*T)-3')
;
5281.444 1 ? ? ?                      ? 
5 polymer man 'Homeobox protein Meis1'                                                6914.002 2 ? ? 'UNP residues 283-340' ? 
6 polymer man 'Homeobox protein DLX-3'                                                6681.791 2 ? ? ?                      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DC)(DA)(DA)(DT)(DT)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DC)(DA)(DA)'             CAATTATCCTGTCAA M   ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DA)(DA)(DT)(DT)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DC)(DA)(DA)(DC)'     ACAATTATCCTGTCAAC D   ? 
3 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DG)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DA)(DA)(DT)(DT)(DG)(DT)(DT)' GTTGACAGGATAATTGTT E   
? 
4 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DG)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DA)(DA)(DT)(DT)(DG)(DT)'     GTTGACAGGATAATTGT L   ? 
5 'polypeptide(L)'        no no FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID                 
FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID A,B ? 
6 'polypeptide(L)'        no no KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK                   
KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK   G,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DC  n 
1 2  DA  n 
1 3  DA  n 
1 4  DT  n 
1 5  DT  n 
1 6  DA  n 
1 7  DT  n 
1 8  DC  n 
1 9  DC  n 
1 10 DT  n 
1 11 DG  n 
1 12 DT  n 
1 13 DC  n 
1 14 DA  n 
1 15 DA  n 
2 1  DA  n 
2 2  DC  n 
2 3  DA  n 
2 4  DA  n 
2 5  DT  n 
2 6  DT  n 
2 7  DA  n 
2 8  DT  n 
2 9  DC  n 
2 10 DC  n 
2 11 DT  n 
2 12 DG  n 
2 13 DT  n 
2 14 DC  n 
2 15 DA  n 
2 16 DA  n 
2 17 DC  n 
3 1  DG  n 
3 2  DT  n 
3 3  DT  n 
3 4  DG  n 
3 5  DA  n 
3 6  DC  n 
3 7  DA  n 
3 8  DG  n 
3 9  DG  n 
3 10 DA  n 
3 11 DT  n 
3 12 DA  n 
3 13 DA  n 
3 14 DT  n 
3 15 DT  n 
3 16 DG  n 
3 17 DT  n 
3 18 DT  n 
4 1  DG  n 
4 2  DT  n 
4 3  DT  n 
4 4  DG  n 
4 5  DA  n 
4 6  DC  n 
4 7  DA  n 
4 8  DG  n 
4 9  DG  n 
4 10 DA  n 
4 11 DT  n 
4 12 DA  n 
4 13 DA  n 
4 14 DT  n 
4 15 DT  n 
4 16 DG  n 
4 17 DT  n 
5 1  PHE n 
5 2  PRO n 
5 3  LYS n 
5 4  VAL n 
5 5  ALA n 
5 6  THR n 
5 7  ASN n 
5 8  ILE n 
5 9  MET n 
5 10 ARG n 
5 11 ALA n 
5 12 TRP n 
5 13 LEU n 
5 14 PHE n 
5 15 GLN n 
5 16 HIS n 
5 17 LEU n 
5 18 THR n 
5 19 HIS n 
5 20 PRO n 
5 21 TYR n 
5 22 PRO n 
5 23 SER n 
5 24 GLU n 
5 25 GLU n 
5 26 GLN n 
5 27 LYS n 
5 28 LYS n 
5 29 GLN n 
5 30 LEU n 
5 31 ALA n 
5 32 GLN n 
5 33 ASP n 
5 34 THR n 
5 35 GLY n 
5 36 LEU n 
5 37 THR n 
5 38 ILE n 
5 39 LEU n 
5 40 GLN n 
5 41 VAL n 
5 42 ASN n 
5 43 ASN n 
5 44 TRP n 
5 45 PHE n 
5 46 ILE n 
5 47 ASN n 
5 48 ALA n 
5 49 ARG n 
5 50 ARG n 
5 51 ARG n 
5 52 ILE n 
5 53 VAL n 
5 54 GLN n 
5 55 PRO n 
5 56 MET n 
5 57 ILE n 
5 58 ASP n 
6 1  LYS n 
6 2  PRO n 
6 3  ARG n 
6 4  THR n 
6 5  ILE n 
6 6  TYR n 
6 7  SER n 
6 8  SER n 
6 9  TYR n 
6 10 GLN n 
6 11 LEU n 
6 12 ALA n 
6 13 ALA n 
6 14 LEU n 
6 15 GLN n 
6 16 ARG n 
6 17 ARG n 
6 18 PHE n 
6 19 GLN n 
6 20 LYS n 
6 21 ALA n 
6 22 GLN n 
6 23 TYR n 
6 24 LEU n 
6 25 ALA n 
6 26 LEU n 
6 27 PRO n 
6 28 GLU n 
6 29 ARG n 
6 30 ALA n 
6 31 GLU n 
6 32 LEU n 
6 33 ALA n 
6 34 ALA n 
6 35 GLN n 
6 36 LEU n 
6 37 GLY n 
6 38 LEU n 
6 39 THR n 
6 40 GLN n 
6 41 THR n 
6 42 GLN n 
6 43 VAL n 
6 44 LYS n 
6 45 ILE n 
6 46 TRP n 
6 47 PHE n 
6 48 GLN n 
6 49 ASN n 
6 50 ARG n 
6 51 ARG n 
6 52 SER n 
6 53 LYS n 
6 54 PHE n 
6 55 LYS n 
6 56 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
5 1 sample 'Biological sequence' 1 58 Human ? MEIS1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 ? ? ? ? ? ? ? Rosetta ? ? ? ? ? ? Plasmid ? ? ? PETG20A ? ? 
6 1 sample 'Biological sequence' 1 56 Human ? DLX3  ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 
469008 ? ? ? ? ? ? ? Rosetta ? ? ? ? ? ? Plasmid ? ? ? PETG20A ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 15 'synthetic construct' ? 32630 ? 
2 1 sample 1 17 'synthetic construct' ? 32630 ? 
3 1 sample 1 18 'synthetic construct' ? 32630 ? 
4 1 sample 1 17 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 4XRS        4XRS   ? 1 ?                                                          1   
2 PDB 4XRS        4XRS   ? 2 ?                                                          1   
3 PDB 4XRS        4XRS   ? 3 ?                                                          1   
4 PDB 4XRS        4XRS   ? 4 ?                                                          1   
5 UNP MEIS1_HUMAN O00470 ? 5 FPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID 279 
6 UNP DLX3_HUMAN  O60479 ? 6 KPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKK   131 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4XRS M 1 ? 15 ? 4XRS   21  ? 35  ? 21  35  
2 2 4XRS D 1 ? 17 ? 4XRS   20  ? 36  ? 20  36  
3 3 4XRS E 1 ? 18 ? 4XRS   1   ? 18  ? 1   18  
4 4 4XRS L 1 ? 17 ? 4XRS   1   ? 17  ? 1   17  
5 5 4XRS A 1 ? 58 ? O00470 279 ? 336 ? 279 336 
6 5 4XRS B 1 ? 58 ? O00470 279 ? 336 ? 279 336 
7 6 4XRS G 1 ? 56 ? O60479 131 ? 186 ? 131 186 
8 6 4XRS I 1 ? 56 ? O60479 131 ? 186 ? 131 186 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4XRS 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.98 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.70 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 8000, TRIS, Magnesium chloride, buthanol' 
_exptl_crystal_grow.pdbx_pH_range   '7 - 8' 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-14 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    mirror 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9724 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9724 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            109.76 
_reflns.entry_id                         4XRS 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.9 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       46033 
_reflns.number_obs                       11191 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             90.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.1 
_reflns.pdbx_Rmerge_I_obs                0.0608 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.08 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.964 
_reflns_shell.d_res_low                   3.07 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.63 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        88.39 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.0608 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.entry_id                                 4XRS 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.5000 
_refine.ls_d_res_low                             49.3140 
_refine.pdbx_ls_sigma_F                          1.270 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    88.0800 
_refine.ls_number_reflns_obs                     6829 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.3427 
_refine.ls_R_factor_R_work                       0.3305 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.3591 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.3300 
_refine.ls_number_reflns_R_free                  651 
_refine.ls_number_reflns_R_work                  11570 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               136.3207 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      '3K2A, 2DJN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       TWIN_LSQ_F 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                232.960 
_refine.B_iso_min                                82.430 
_refine.pdbx_overall_phase_error                 45.0100 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.5000 
_refine_hist.d_res_low                        49.3140 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3247 
_refine_hist.pdbx_number_residues_total       292 
_refine_hist.pdbx_number_atoms_protein        1895 
_refine_hist.pdbx_number_atoms_nucleic_acid   1352 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           3471 0.007  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          4961 1.179  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     550  0.183  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      398  0.007  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 1390 27.214 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_obs 
3.5029 3.8552  4 84.0000 2894 . 0.3823 0.4685 . 163 . 3057 . 'X-RAY DIFFRACTION' . 
3.8552 4.4127  4 85.0000 2941 . 0.3819 0.4272 . 153 . 3094 . 'X-RAY DIFFRACTION' . 
4.4127 5.5578  4 84.0000 2890 . 0.3674 0.4049 . 157 . 3047 . 'X-RAY DIFFRACTION' . 
5.5578 44.7704 4 82.0000 2845 . 0.3022 0.3086 . 139 . 2984 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                     4XRS 
_struct.title                        'Heterodimeric complex of transcription factors MEIS1 and DLX3 on specific DNA' 
_struct.pdbx_descriptor              'MEIS1, DLX3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4XRS 
_struct_keywords.text            'Transcription, heterodimer, DNA' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR E 6  ? TRP E 12 ? THR A 284 TRP A 290 1 ? 7  
HELX_P HELX_P2  AA2 GLU E 25 ? GLN E 32 ? GLU A 303 GLN A 310 1 ? 8  
HELX_P HELX_P3  AA3 THR E 37 ? PHE E 45 ? THR A 315 PHE A 323 1 ? 9  
HELX_P HELX_P4  AA4 LYS F 3  ? PHE F 14 ? LYS B 281 PHE B 292 1 ? 12 
HELX_P HELX_P5  AA5 GLN F 15 ? LEU F 17 ? GLN B 293 LEU B 295 5 ? 3  
HELX_P HELX_P6  AA6 SER F 23 ? GLN F 32 ? SER B 301 GLN B 310 1 ? 10 
HELX_P HELX_P7  AA7 VAL F 41 ? ILE F 46 ? VAL B 319 ILE B 324 1 ? 6  
HELX_P HELX_P8  AA8 VAL F 53 ? ILE F 57 ? VAL B 331 ILE B 335 5 ? 5  
HELX_P HELX_P9  AA9 LEU G 14 ? ALA G 21 ? LEU G 144 ALA G 151 1 ? 8  
HELX_P HELX_P10 AB1 GLU G 28 ? ALA G 34 ? GLU G 158 ALA G 164 1 ? 7  
HELX_P HELX_P11 AB2 GLN G 40 ? ASN G 49 ? GLN G 170 ASN G 179 1 ? 10 
HELX_P HELX_P12 AB3 LEU H 11 ? ALA H 13 ? LEU I 141 ALA I 143 5 ? 3  
HELX_P HELX_P13 AB4 LEU H 14 ? GLN H 19 ? LEU I 144 GLN I 149 1 ? 6  
HELX_P HELX_P14 AB5 ALA H 25 ? ALA H 33 ? ALA I 155 ALA I 163 1 ? 9  
HELX_P HELX_P15 AB6 THR H 39 ? GLN H 42 ? THR I 169 GLN I 172 5 ? 4  
HELX_P HELX_P16 AB7 VAL H 43 ? SER H 52 ? VAL I 173 SER I 182 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DA 3  N1 ? ? ? 1_555 C DG 16 N1 ? ? D DA 22 E DG 16 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog2  hydrog ? ? B DA 3  N6 ? ? ? 1_555 C DG 16 O6 ? ? D DA 22 E DG 16 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog3  hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DG 16 N1 ? ? D DA 23 E DG 16 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog4  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DG 16 O6 ? ? D DA 23 E DG 16 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog5  hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 9  N1 ? ? D DC 28 E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 9  O6 ? ? D DC 28 E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 9  N2 ? ? D DC 28 E DG 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? B DT 11 O4 ? ? ? 1_555 C DC 6  N4 ? ? D DT 30 E DC 6  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog9  hydrog ? ? B DG 12 N2 ? ? ? 1_555 C DC 6  N3 ? ? D DG 31 E DC 6  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog10 hydrog ? ? B DA 16 N1 ? ? ? 1_555 C DG 1  N2 ? ? D DA 35 E DG 1  1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? 
hydrog11 hydrog ? ? A DA 2  N6 ? ? ? 1_555 D DT 15 O4 ? ? M DA 22 L DT 15 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog12 hydrog ? ? A DT 4  N3 ? ? ? 1_555 D DA 13 N1 ? ? M DT 24 L DA 13 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog13 hydrog ? ? A DT 7  N3 ? ? ? 1_555 D DA 10 N1 ? ? M DT 27 L DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? A DT 7  O4 ? ? ? 1_555 D DA 10 N6 ? ? M DT 27 L DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? A DC 8  N4 ? ? ? 1_555 D DG 9  O6 ? ? M DC 28 L DG 9  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog16 hydrog ? ? A DC 8  N4 ? ? ? 1_555 D DA 10 N1 ? ? M DC 28 L DA 10 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ? ? 
hydrog17 hydrog ? ? A DT 10 O4 ? ? ? 1_555 D DC 6  N4 ? ? M DT 30 L DC 6  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog18 hydrog ? ? A DG 11 N2 ? ? ? 1_555 D DC 6  N3 ? ? M DG 31 L DC 6  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 1  G . ? LYS 131 G PRO 2  G ? PRO 132 G 1 0.45   
2 TYR 6  G . ? TYR 136 G SER 7  G ? SER 137 G 1 -25.55 
3 TYR 9  G . ? TYR 139 G GLN 10 G ? GLN 140 G 1 -7.26  
4 SER 52 G . ? SER 182 G LYS 53 G ? LYS 183 G 1 28.82  
5 LYS 1  H . ? LYS 131 I PRO 2  H ? PRO 132 I 1 -6.10  
6 TYR 6  H . ? TYR 136 I SER 7  H ? SER 137 I 1 -5.32  
7 TYR 9  H . ? TYR 139 I GLN 10 H ? GLN 140 I 1 -12.04 
8 PHE 54 H . ? PHE 184 I LYS 55 H ? LYS 185 I 1 -0.63  
# 
_atom_sites.entry_id                    4XRS 
_atom_sites.fract_transf_matrix[1][1]   0.014360 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014317 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008555 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    P P     . DC  A 1 1  ? -37.222 -13.998 -1.652  1.00 136.86 ? 21  DC  M P     1 
ATOM 2    O OP1   . DC  A 1 1  ? -37.341 -15.122 -0.697  1.00 140.66 ? 21  DC  M OP1   1 
ATOM 3    O OP2   . DC  A 1 1  ? -36.099 -13.959 -2.612  1.00 138.85 ? 21  DC  M OP2   1 
ATOM 4    O "O5'" . DC  A 1 1  ? -38.580 -13.820 -2.482  1.00 141.31 ? 21  DC  M "O5'" 1 
ATOM 5    C "C5'" . DC  A 1 1  ? -39.457 -14.926 -2.687  1.00 132.31 ? 21  DC  M "C5'" 1 
ATOM 6    C "C4'" . DC  A 1 1  ? -40.896 -14.462 -2.779  1.00 131.60 ? 21  DC  M "C4'" 1 
ATOM 7    O "O4'" . DC  A 1 1  ? -41.134 -13.459 -1.757  1.00 144.86 ? 21  DC  M "O4'" 1 
ATOM 8    C "C3'" . DC  A 1 1  ? -41.286 -13.835 -4.122  1.00 121.31 ? 21  DC  M "C3'" 1 
ATOM 9    O "O3'" . DC  A 1 1  ? -42.256 -14.652 -4.782  1.00 119.33 ? 21  DC  M "O3'" 1 
ATOM 10   C "C2'" . DC  A 1 1  ? -41.847 -12.457 -3.758  1.00 120.67 ? 21  DC  M "C2'" 1 
ATOM 11   C "C1'" . DC  A 1 1  ? -41.312 -12.194 -2.348  1.00 128.57 ? 21  DC  M "C1'" 1 
ATOM 12   N N1    . DC  A 1 1  ? -39.997 -11.427 -2.255  1.00 129.72 ? 21  DC  M N1    1 
ATOM 13   C C2    . DC  A 1 1  ? -39.437 -11.192 -0.988  1.00 130.78 ? 21  DC  M C2    1 
ATOM 14   O O2    . DC  A 1 1  ? -40.020 -11.617 0.019   1.00 134.38 ? 21  DC  M O2    1 
ATOM 15   N N3    . DC  A 1 1  ? -38.270 -10.508 -0.899  1.00 140.46 ? 21  DC  M N3    1 
ATOM 16   C C4    . DC  A 1 1  ? -37.669 -10.062 -2.001  1.00 154.99 ? 21  DC  M C4    1 
ATOM 17   N N4    . DC  A 1 1  ? -36.519 -9.396  -1.858  1.00 164.11 ? 21  DC  M N4    1 
ATOM 18   C C5    . DC  A 1 1  ? -38.216 -10.285 -3.299  1.00 147.14 ? 21  DC  M C5    1 
ATOM 19   C C6    . DC  A 1 1  ? -39.367 -10.965 -3.380  1.00 136.97 ? 21  DC  M C6    1 
ATOM 20   P P     . DA  A 1 2  ? -42.645 -14.396 -6.319  1.00 128.38 ? 22  DA  M P     1 
ATOM 21   O OP1   . DA  A 1 2  ? -43.499 -15.529 -6.736  1.00 126.71 ? 22  DA  M OP1   1 
ATOM 22   O OP2   . DA  A 1 2  ? -41.398 -14.120 -7.064  1.00 119.01 ? 22  DA  M OP2   1 
ATOM 23   O "O5'" . DA  A 1 2  ? -43.510 -13.044 -6.287  1.00 106.56 ? 22  DA  M "O5'" 1 
ATOM 24   C "C5'" . DA  A 1 2  ? -44.757 -12.999 -5.589  1.00 98.22  ? 22  DA  M "C5'" 1 
ATOM 25   C "C4'" . DA  A 1 2  ? -45.438 -11.649 -5.752  1.00 103.88 ? 22  DA  M "C4'" 1 
ATOM 26   O "O4'" . DA  A 1 2  ? -44.429 -10.593 -5.731  1.00 110.10 ? 22  DA  M "O4'" 1 
ATOM 27   C "C3'" . DA  A 1 2  ? -46.215 -11.474 -7.060  1.00 103.91 ? 22  DA  M "C3'" 1 
ATOM 28   O "O3'" . DA  A 1 2  ? -47.467 -10.818 -6.826  1.00 101.92 ? 22  DA  M "O3'" 1 
ATOM 29   C "C2'" . DA  A 1 2  ? -45.270 -10.643 -7.924  1.00 105.64 ? 22  DA  M "C2'" 1 
ATOM 30   C "C1'" . DA  A 1 2  ? -44.531 -9.793  -6.896  1.00 106.35 ? 22  DA  M "C1'" 1 
ATOM 31   N N9    . DA  A 1 2  ? -43.190 -9.392  -7.335  1.00 110.09 ? 22  DA  M N9    1 
ATOM 32   C C8    . DA  A 1 2  ? -42.754 -9.304  -8.626  1.00 108.57 ? 22  DA  M C8    1 
ATOM 33   N N7    . DA  A 1 2  ? -41.505 -8.926  -8.744  1.00 111.34 ? 22  DA  M N7    1 
ATOM 34   C C5    . DA  A 1 2  ? -41.086 -8.746  -7.438  1.00 112.99 ? 22  DA  M C5    1 
ATOM 35   C C6    . DA  A 1 2  ? -39.854 -8.346  -6.888  1.00 114.05 ? 22  DA  M C6    1 
ATOM 36   N N6    . DA  A 1 2  ? -38.780 -8.048  -7.623  1.00 110.34 ? 22  DA  M N6    1 
ATOM 37   N N1    . DA  A 1 2  ? -39.764 -8.269  -5.548  1.00 123.68 ? 22  DA  M N1    1 
ATOM 38   C C2    . DA  A 1 2  ? -40.838 -8.568  -4.811  1.00 121.66 ? 22  DA  M C2    1 
ATOM 39   N N3    . DA  A 1 2  ? -42.051 -8.959  -5.210  1.00 113.74 ? 22  DA  M N3    1 
ATOM 40   C C4    . DA  A 1 2  ? -42.110 -9.027  -6.551  1.00 105.73 ? 22  DA  M C4    1 
ATOM 41   P P     . DA  A 1 3  ? -48.411 -10.395 -8.057  1.00 96.73  ? 23  DA  M P     1 
ATOM 42   O OP1   . DA  A 1 3  ? -49.810 -10.445 -7.573  1.00 88.77  ? 23  DA  M OP1   1 
ATOM 43   O OP2   . DA  A 1 3  ? -48.036 -11.218 -9.233  1.00 116.30 ? 23  DA  M OP2   1 
ATOM 44   O "O5'" . DA  A 1 3  ? -47.997 -8.869  -8.320  1.00 105.20 ? 23  DA  M "O5'" 1 
ATOM 45   C "C5'" . DA  A 1 3  ? -47.944 -8.344  -9.644  1.00 114.63 ? 23  DA  M "C5'" 1 
ATOM 46   C "C4'" . DA  A 1 3  ? -46.994 -7.158  -9.710  1.00 118.60 ? 23  DA  M "C4'" 1 
ATOM 47   O "O4'" . DA  A 1 3  ? -45.630 -7.625  -9.581  1.00 118.22 ? 23  DA  M "O4'" 1 
ATOM 48   C "C3'" . DA  A 1 3  ? -47.010 -6.377  -11.014 1.00 123.82 ? 23  DA  M "C3'" 1 
ATOM 49   O "O3'" . DA  A 1 3  ? -48.023 -5.369  -11.009 1.00 129.32 ? 23  DA  M "O3'" 1 
ATOM 50   C "C2'" . DA  A 1 3  ? -45.612 -5.773  -11.068 1.00 123.50 ? 23  DA  M "C2'" 1 
ATOM 51   C "C1'" . DA  A 1 3  ? -44.750 -6.733  -10.248 1.00 119.51 ? 23  DA  M "C1'" 1 
ATOM 52   N N9    . DA  A 1 3  ? -43.808 -7.512  -11.056 1.00 120.55 ? 23  DA  M N9    1 
ATOM 53   C C8    . DA  A 1 3  ? -44.099 -8.530  -11.927 1.00 125.74 ? 23  DA  M C8    1 
ATOM 54   N N7    . DA  A 1 3  ? -43.041 -9.046  -12.511 1.00 131.43 ? 23  DA  M N7    1 
ATOM 55   C C5    . DA  A 1 3  ? -41.984 -8.318  -11.987 1.00 126.20 ? 23  DA  M C5    1 
ATOM 56   C C6    . DA  A 1 3  ? -40.591 -8.373  -12.199 1.00 128.71 ? 23  DA  M C6    1 
ATOM 57   N N6    . DA  A 1 3  ? -40.003 -9.232  -13.029 1.00 133.09 ? 23  DA  M N6    1 
ATOM 58   N N1    . DA  A 1 3  ? -39.821 -7.504  -11.515 1.00 124.59 ? 23  DA  M N1    1 
ATOM 59   C C2    . DA  A 1 3  ? -40.409 -6.642  -10.679 1.00 120.00 ? 23  DA  M C2    1 
ATOM 60   N N3    . DA  A 1 3  ? -41.699 -6.494  -10.397 1.00 115.97 ? 23  DA  M N3    1 
ATOM 61   C C4    . DA  A 1 3  ? -42.441 -7.367  -11.094 1.00 122.14 ? 23  DA  M C4    1 
ATOM 62   P P     . DT  A 1 4  ? -48.236 -4.417  -12.292 1.00 145.18 ? 24  DT  M P     1 
ATOM 63   O OP1   . DT  A 1 4  ? -49.303 -3.463  -11.919 1.00 137.15 ? 24  DT  M OP1   1 
ATOM 64   O OP2   . DT  A 1 4  ? -48.430 -5.288  -13.472 1.00 154.97 ? 24  DT  M OP2   1 
ATOM 65   O "O5'" . DT  A 1 4  ? -46.852 -3.601  -12.431 1.00 137.50 ? 24  DT  M "O5'" 1 
ATOM 66   C "C5'" . DT  A 1 4  ? -46.044 -3.689  -13.631 1.00 141.26 ? 24  DT  M "C5'" 1 
ATOM 67   C "C4'" . DT  A 1 4  ? -44.572 -3.462  -13.310 1.00 141.41 ? 24  DT  M "C4'" 1 
ATOM 68   O "O4'" . DT  A 1 4  ? -43.826 -4.680  -13.526 1.00 139.12 ? 24  DT  M "O4'" 1 
ATOM 69   C "C3'" . DT  A 1 4  ? -43.849 -2.453  -14.181 1.00 149.44 ? 24  DT  M "C3'" 1 
ATOM 70   O "O3'" . DT  A 1 4  ? -44.098 -1.114  -13.754 1.00 159.36 ? 24  DT  M "O3'" 1 
ATOM 71   C "C2'" . DT  A 1 4  ? -42.384 -2.861  -14.003 1.00 145.85 ? 24  DT  M "C2'" 1 
ATOM 72   C "C1'" . DT  A 1 4  ? -42.454 -4.349  -13.647 1.00 138.01 ? 24  DT  M "C1'" 1 
ATOM 73   N N1    . DT  A 1 4  ? -41.802 -5.228  -14.669 1.00 138.18 ? 24  DT  M N1    1 
ATOM 74   C C2    . DT  A 1 4  ? -40.432 -5.196  -14.781 1.00 134.86 ? 24  DT  M C2    1 
ATOM 75   O O2    . DT  A 1 4  ? -39.724 -4.492  -14.085 1.00 135.99 ? 24  DT  M O2    1 
ATOM 76   N N3    . DT  A 1 4  ? -39.912 -6.018  -15.741 1.00 134.12 ? 24  DT  M N3    1 
ATOM 77   C C4    . DT  A 1 4  ? -40.607 -6.861  -16.578 1.00 135.24 ? 24  DT  M C4    1 
ATOM 78   O O4    . DT  A 1 4  ? -40.046 -7.564  -17.413 1.00 136.59 ? 24  DT  M O4    1 
ATOM 79   C C5    . DT  A 1 4  ? -42.040 -6.846  -16.421 1.00 137.38 ? 24  DT  M C5    1 
ATOM 80   C C7    . DT  A 1 4  ? -42.891 -7.716  -17.286 1.00 135.74 ? 24  DT  M C7    1 
ATOM 81   C C6    . DT  A 1 4  ? -42.570 -6.040  -15.483 1.00 138.64 ? 24  DT  M C6    1 
ATOM 82   P P     . DT  A 1 5  ? -43.719 0.119   -14.714 1.00 183.11 ? 25  DT  M P     1 
ATOM 83   O OP1   . DT  A 1 5  ? -43.170 1.210   -13.878 1.00 193.65 ? 25  DT  M OP1   1 
ATOM 84   O OP2   . DT  A 1 5  ? -44.883 0.384   -15.587 1.00 199.04 ? 25  DT  M OP2   1 
ATOM 85   O "O5'" . DT  A 1 5  ? -42.546 -0.467  -15.624 1.00 169.52 ? 25  DT  M "O5'" 1 
ATOM 86   C "C5'" . DT  A 1 5  ? -41.678 0.406   -16.317 1.00 163.39 ? 25  DT  M "C5'" 1 
ATOM 87   C "C4'" . DT  A 1 5  ? -40.380 -0.294  -16.663 1.00 159.44 ? 25  DT  M "C4'" 1 
ATOM 88   O "O4'" . DT  A 1 5  ? -40.623 -1.710  -16.826 1.00 154.20 ? 25  DT  M "O4'" 1 
ATOM 89   C "C3'" . DT  A 1 5  ? -39.724 0.170   -17.965 1.00 146.21 ? 25  DT  M "C3'" 1 
ATOM 90   O "O3'" . DT  A 1 5  ? -38.583 0.978   -17.678 1.00 151.19 ? 25  DT  M "O3'" 1 
ATOM 91   C "C2'" . DT  A 1 5  ? -39.360 -1.132  -18.706 1.00 132.43 ? 25  DT  M "C2'" 1 
ATOM 92   C "C1'" . DT  A 1 5  ? -39.653 -2.233  -17.695 1.00 134.40 ? 25  DT  M "C1'" 1 
ATOM 93   N N1    . DT  A 1 5  ? -40.171 -3.500  -18.319 1.00 131.53 ? 25  DT  M N1    1 
ATOM 94   C C2    . DT  A 1 5  ? -39.290 -4.525  -18.588 1.00 124.11 ? 25  DT  M C2    1 
ATOM 95   O O2    . DT  A 1 5  ? -38.100 -4.467  -18.337 1.00 120.14 ? 25  DT  M O2    1 
ATOM 96   N N3    . DT  A 1 5  ? -39.856 -5.631  -19.166 1.00 128.56 ? 25  DT  M N3    1 
ATOM 97   C C4    . DT  A 1 5  ? -41.184 -5.811  -19.501 1.00 142.44 ? 25  DT  M C4    1 
ATOM 98   O O4    . DT  A 1 5  ? -41.595 -6.847  -20.012 1.00 161.34 ? 25  DT  M O4    1 
ATOM 99   C C5    . DT  A 1 5  ? -42.054 -4.705  -19.191 1.00 144.36 ? 25  DT  M C5    1 
ATOM 100  C C7    . DT  A 1 5  ? -43.514 -4.789  -19.507 1.00 150.49 ? 25  DT  M C7    1 
ATOM 101  C C6    . DT  A 1 5  ? -41.515 -3.612  -18.626 1.00 139.74 ? 25  DT  M C6    1 
ATOM 102  P P     . DA  A 1 6  ? -37.588 1.440   -18.851 1.00 141.88 ? 26  DA  M P     1 
ATOM 103  O OP1   . DA  A 1 6  ? -36.981 2.724   -18.430 1.00 155.31 ? 26  DA  M OP1   1 
ATOM 104  O OP2   . DA  A 1 6  ? -38.321 1.373   -20.138 1.00 142.18 ? 26  DA  M OP2   1 
ATOM 105  O "O5'" . DA  A 1 6  ? -36.467 0.296   -18.846 1.00 141.03 ? 26  DA  M "O5'" 1 
ATOM 106  C "C5'" . DA  A 1 6  ? -35.575 0.165   -19.943 1.00 125.34 ? 26  DA  M "C5'" 1 
ATOM 107  C "C4'" . DA  A 1 6  ? -35.139 -1.281  -20.132 1.00 122.23 ? 26  DA  M "C4'" 1 
ATOM 108  O "O4'" . DA  A 1 6  ? -36.297 -2.149  -20.221 1.00 116.43 ? 26  DA  M "O4'" 1 
ATOM 109  C "C3'" . DA  A 1 6  ? -34.351 -1.536  -21.418 1.00 123.98 ? 26  DA  M "C3'" 1 
ATOM 110  O "O3'" . DA  A 1 6  ? -32.970 -1.716  -21.147 1.00 121.08 ? 26  DA  M "O3'" 1 
ATOM 111  C "C2'" . DA  A 1 6  ? -34.978 -2.800  -22.028 1.00 119.46 ? 26  DA  M "C2'" 1 
ATOM 112  C "C1'" . DA  A 1 6  ? -35.914 -3.298  -20.940 1.00 123.16 ? 26  DA  M "C1'" 1 
ATOM 113  N N9    . DA  A 1 6  ? -37.100 -3.990  -21.454 1.00 117.67 ? 26  DA  M N9    1 
ATOM 114  C C8    . DA  A 1 6  ? -38.102 -3.466  -22.230 1.00 114.84 ? 26  DA  M C8    1 
ATOM 115  N N7    . DA  A 1 6  ? -39.033 -4.335  -22.550 1.00 115.06 ? 26  DA  M N7    1 
ATOM 116  C C5    . DA  A 1 6  ? -38.612 -5.512  -21.949 1.00 118.19 ? 26  DA  M C5    1 
ATOM 117  C C6    . DA  A 1 6  ? -39.158 -6.813  -21.913 1.00 114.66 ? 26  DA  M C6    1 
ATOM 118  N N6    . DA  A 1 6  ? -40.301 -7.153  -22.506 1.00 117.12 ? 26  DA  M N6    1 
ATOM 119  N N1    . DA  A 1 6  ? -38.492 -7.751  -21.221 1.00 133.68 ? 26  DA  M N1    1 
ATOM 120  C C2    . DA  A 1 6  ? -37.350 -7.418  -20.616 1.00 116.69 ? 26  DA  M C2    1 
ATOM 121  N N3    . DA  A 1 6  ? -36.733 -6.239  -20.579 1.00 120.78 ? 26  DA  M N3    1 
ATOM 122  C C4    . DA  A 1 6  ? -37.423 -5.318  -21.272 1.00 117.89 ? 26  DA  M C4    1 
ATOM 123  P P     . DT  A 1 7  ? -31.916 -1.621  -22.354 1.00 118.08 ? 27  DT  M P     1 
ATOM 124  O OP1   . DT  A 1 7  ? -30.651 -1.085  -21.810 1.00 121.08 ? 27  DT  M OP1   1 
ATOM 125  O OP2   . DT  A 1 7  ? -32.620 -0.935  -23.462 1.00 128.75 ? 27  DT  M OP2   1 
ATOM 126  O "O5'" . DT  A 1 7  ? -31.684 -3.140  -22.795 1.00 116.89 ? 27  DT  M "O5'" 1 
ATOM 127  C "C5'" . DT  A 1 7  ? -32.316 -3.650  -23.961 1.00 114.19 ? 27  DT  M "C5'" 1 
ATOM 128  C "C4'" . DT  A 1 7  ? -32.454 -5.156  -23.875 1.00 108.12 ? 27  DT  M "C4'" 1 
ATOM 129  O "O4'" . DT  A 1 7  ? -33.844 -5.520  -23.718 1.00 101.83 ? 27  DT  M "O4'" 1 
ATOM 130  C "C3'" . DT  A 1 7  ? -32.005 -5.928  -25.110 1.00 112.06 ? 27  DT  M "C3'" 1 
ATOM 131  O "O3'" . DT  A 1 7  ? -30.635 -6.332  -24.998 1.00 114.86 ? 27  DT  M "O3'" 1 
ATOM 132  C "C2'" . DT  A 1 7  ? -32.953 -7.139  -25.144 1.00 106.88 ? 27  DT  M "C2'" 1 
ATOM 133  C "C1'" . DT  A 1 7  ? -33.935 -6.889  -24.007 1.00 106.77 ? 27  DT  M "C1'" 1 
ATOM 134  N N1    . DT  A 1 7  ? -35.356 -7.276  -24.360 1.00 105.20 ? 27  DT  M N1    1 
ATOM 135  C C2    . DT  A 1 7  ? -35.833 -8.490  -23.919 1.00 102.71 ? 27  DT  M C2    1 
ATOM 136  O O2    . DT  A 1 7  ? -35.183 -9.249  -23.236 1.00 111.51 ? 27  DT  M O2    1 
ATOM 137  N N3    . DT  A 1 7  ? -37.109 -8.785  -24.295 1.00 103.31 ? 27  DT  M N3    1 
ATOM 138  C C4    . DT  A 1 7  ? -37.947 -8.015  -25.065 1.00 103.66 ? 27  DT  M C4    1 
ATOM 139  O O4    . DT  A 1 7  ? -39.085 -8.369  -25.352 1.00 104.65 ? 27  DT  M O4    1 
ATOM 140  C C5    . DT  A 1 7  ? -37.394 -6.762  -25.512 1.00 104.38 ? 27  DT  M C5    1 
ATOM 141  C C7    . DT  A 1 7  ? -38.221 -5.852  -26.356 1.00 93.64  ? 27  DT  M C7    1 
ATOM 142  C C6    . DT  A 1 7  ? -36.133 -6.452  -25.152 1.00 106.09 ? 27  DT  M C6    1 
ATOM 143  P P     . DC  A 1 8  ? -29.470 -5.521  -25.752 1.00 114.16 ? 28  DC  M P     1 
ATOM 144  O OP1   . DC  A 1 8  ? -28.310 -5.529  -24.836 1.00 137.74 ? 28  DC  M OP1   1 
ATOM 145  O OP2   . DC  A 1 8  ? -29.997 -4.224  -26.227 1.00 126.01 ? 28  DC  M OP2   1 
ATOM 146  O "O5'" . DC  A 1 8  ? -29.129 -6.422  -27.036 1.00 124.83 ? 28  DC  M "O5'" 1 
ATOM 147  C "C5'" . DC  A 1 8  ? -30.160 -6.840  -27.935 1.00 117.08 ? 28  DC  M "C5'" 1 
ATOM 148  C "C4'" . DC  A 1 8  ? -30.533 -8.296  -27.695 1.00 113.29 ? 28  DC  M "C4'" 1 
ATOM 149  O "O4'" . DC  A 1 8  ? -31.929 -8.391  -27.357 1.00 102.06 ? 28  DC  M "O4'" 1 
ATOM 150  C "C3'" . DC  A 1 8  ? -30.356 -9.245  -28.891 1.00 118.33 ? 28  DC  M "C3'" 1 
ATOM 151  O "O3'" . DC  A 1 8  ? -29.205 -10.072 -28.714 1.00 124.16 ? 28  DC  M "O3'" 1 
ATOM 152  C "C2'" . DC  A 1 8  ? -31.657 -10.072 -28.914 1.00 115.25 ? 28  DC  M "C2'" 1 
ATOM 153  C "C1'" . DC  A 1 8  ? -32.330 -9.707  -27.601 1.00 107.58 ? 28  DC  M "C1'" 1 
ATOM 154  N N1    . DC  A 1 8  ? -33.842 -9.791  -27.624 1.00 101.51 ? 28  DC  M N1    1 
ATOM 155  C C2    . DC  A 1 8  ? -34.508 -10.700 -26.779 1.00 100.82 ? 28  DC  M C2    1 
ATOM 156  O O2    . DC  A 1 8  ? -33.851 -11.424 -26.012 1.00 101.19 ? 28  DC  M O2    1 
ATOM 157  N N3    . DC  A 1 8  ? -35.859 -10.761 -26.825 1.00 101.58 ? 28  DC  M N3    1 
ATOM 158  C C4    . DC  A 1 8  ? -36.544 -9.978  -27.653 1.00 111.72 ? 28  DC  M C4    1 
ATOM 159  N N4    . DC  A 1 8  ? -37.877 -10.084 -27.649 1.00 101.05 ? 28  DC  M N4    1 
ATOM 160  C C5    . DC  A 1 8  ? -35.896 -9.050  -28.519 1.00 101.19 ? 28  DC  M C5    1 
ATOM 161  C C6    . DC  A 1 8  ? -34.557 -8.988  -28.473 1.00 101.00 ? 28  DC  M C6    1 
ATOM 162  P P     . DC  A 1 9  ? -28.679 -11.009 -29.909 1.00 126.98 ? 29  DC  M P     1 
ATOM 163  O OP1   . DC  A 1 9  ? -27.364 -11.544 -29.501 1.00 132.67 ? 29  DC  M OP1   1 
ATOM 164  O OP2   . DC  A 1 9  ? -28.795 -10.244 -31.163 1.00 132.74 ? 29  DC  M OP2   1 
ATOM 165  O "O5'" . DC  A 1 9  ? -29.743 -12.204 -29.985 1.00 119.89 ? 29  DC  M "O5'" 1 
ATOM 166  C "C5'" . DC  A 1 9  ? -29.741 -13.228 -29.008 1.00 115.36 ? 29  DC  M "C5'" 1 
ATOM 167  C "C4'" . DC  A 1 9  ? -30.952 -14.136 -29.143 1.00 112.55 ? 29  DC  M "C4'" 1 
ATOM 168  O "O4'" . DC  A 1 9  ? -32.163 -13.353 -29.227 1.00 104.49 ? 29  DC  M "O4'" 1 
ATOM 169  C "C3'" . DC  A 1 9  ? -30.974 -15.013 -30.395 1.00 116.87 ? 29  DC  M "C3'" 1 
ATOM 170  O "O3'" . DC  A 1 9  ? -30.404 -16.302 -30.122 1.00 118.76 ? 29  DC  M "O3'" 1 
ATOM 171  C "C2'" . DC  A 1 9  ? -32.469 -15.094 -30.760 1.00 116.22 ? 29  DC  M "C2'" 1 
ATOM 172  C "C1'" . DC  A 1 9  ? -33.167 -14.193 -29.737 1.00 109.46 ? 29  DC  M "C1'" 1 
ATOM 173  N N1    . DC  A 1 9  ? -34.309 -13.364 -30.317 1.00 112.66 ? 29  DC  M N1    1 
ATOM 174  C C2    . DC  A 1 9  ? -35.638 -13.741 -30.059 1.00 117.02 ? 29  DC  M C2    1 
ATOM 175  O O2    . DC  A 1 9  ? -35.862 -14.735 -29.352 1.00 113.56 ? 29  DC  M O2    1 
ATOM 176  N N3    . DC  A 1 9  ? -36.648 -13.001 -30.589 1.00 128.29 ? 29  DC  M N3    1 
ATOM 177  C C4    . DC  A 1 9  ? -36.376 -11.934 -31.348 1.00 130.87 ? 29  DC  M C4    1 
ATOM 178  N N4    . DC  A 1 9  ? -37.410 -11.237 -31.849 1.00 123.36 ? 29  DC  M N4    1 
ATOM 179  C C5    . DC  A 1 9  ? -35.035 -11.535 -31.627 1.00 131.70 ? 29  DC  M C5    1 
ATOM 180  C C6    . DC  A 1 9  ? -34.041 -12.271 -31.099 1.00 120.41 ? 29  DC  M C6    1 
ATOM 181  P P     . DT  A 1 10 ? -30.338 -17.459 -31.243 1.00 110.36 ? 30  DT  M P     1 
ATOM 182  O OP1   . DT  A 1 10 ? -31.138 -18.597 -30.742 1.00 118.20 ? 30  DT  M OP1   1 
ATOM 183  O OP2   . DT  A 1 10 ? -28.906 -17.677 -31.543 1.00 113.17 ? 30  DT  M OP2   1 
ATOM 184  O "O5'" . DT  A 1 10 ? -31.039 -16.827 -32.543 1.00 118.97 ? 30  DT  M "O5'" 1 
ATOM 185  C "C5'" . DT  A 1 10 ? -31.876 -17.642 -33.396 1.00 129.51 ? 30  DT  M "C5'" 1 
ATOM 186  C "C4'" . DT  A 1 10 ? -33.294 -17.718 -32.851 1.00 132.94 ? 30  DT  M "C4'" 1 
ATOM 187  O "O4'" . DT  A 1 10 ? -33.904 -16.413 -32.911 1.00 134.28 ? 30  DT  M "O4'" 1 
ATOM 188  C "C3'" . DT  A 1 10 ? -34.264 -18.595 -33.623 1.00 143.27 ? 30  DT  M "C3'" 1 
ATOM 189  O "O3'" . DT  A 1 10 ? -34.141 -19.970 -33.247 1.00 158.02 ? 30  DT  M "O3'" 1 
ATOM 190  C "C2'" . DT  A 1 10 ? -35.625 -18.002 -33.235 1.00 142.38 ? 30  DT  M "C2'" 1 
ATOM 191  C "C1'" . DT  A 1 10 ? -35.301 -16.569 -32.790 1.00 136.10 ? 30  DT  M "C1'" 1 
ATOM 192  N N1    . DT  A 1 10 ? -36.000 -15.499 -33.597 1.00 137.52 ? 30  DT  M N1    1 
ATOM 193  C C2    . DT  A 1 10 ? -37.375 -15.398 -33.524 1.00 139.92 ? 30  DT  M C2    1 
ATOM 194  O O2    . DT  A 1 10 ? -38.064 -16.138 -32.844 1.00 142.00 ? 30  DT  M O2    1 
ATOM 195  N N3    . DT  A 1 10 ? -37.919 -14.393 -34.283 1.00 149.04 ? 30  DT  M N3    1 
ATOM 196  C C4    . DT  A 1 10 ? -37.242 -13.497 -35.089 1.00 147.30 ? 30  DT  M C4    1 
ATOM 197  O O4    . DT  A 1 10 ? -37.818 -12.625 -35.734 1.00 139.20 ? 30  DT  M O4    1 
ATOM 198  C C5    . DT  A 1 10 ? -35.808 -13.653 -35.117 1.00 150.66 ? 30  DT  M C5    1 
ATOM 199  C C7    . DT  A 1 10 ? -34.975 -12.739 -35.959 1.00 149.67 ? 30  DT  M C7    1 
ATOM 200  C C6    . DT  A 1 10 ? -35.258 -14.631 -34.380 1.00 144.56 ? 30  DT  M C6    1 
ATOM 201  P P     . DG  A 1 11 ? -34.891 -21.114 -34.095 1.00 174.99 ? 31  DG  M P     1 
ATOM 202  O OP1   . DG  A 1 11 ? -34.692 -22.390 -33.374 1.00 172.40 ? 31  DG  M OP1   1 
ATOM 203  O OP2   . DG  A 1 11 ? -34.454 -21.002 -35.505 1.00 153.80 ? 31  DG  M OP2   1 
ATOM 204  O "O5'" . DG  A 1 11 ? -36.440 -20.718 -33.990 1.00 162.99 ? 31  DG  M "O5'" 1 
ATOM 205  C "C5'" . DG  A 1 11 ? -37.345 -21.016 -35.056 1.00 161.88 ? 31  DG  M "C5'" 1 
ATOM 206  C "C4'" . DG  A 1 11 ? -38.669 -20.313 -34.834 1.00 164.34 ? 31  DG  M "C4'" 1 
ATOM 207  O "O4'" . DG  A 1 11 ? -38.409 -18.968 -34.333 1.00 162.18 ? 31  DG  M "O4'" 1 
ATOM 208  C "C3'" . DG  A 1 11 ? -39.525 -20.115 -36.085 1.00 166.96 ? 31  DG  M "C3'" 1 
ATOM 209  O "O3'" . DG  A 1 11 ? -40.449 -21.174 -36.288 1.00 176.13 ? 31  DG  M "O3'" 1 
ATOM 210  C "C2'" . DG  A 1 11 ? -40.223 -18.799 -35.786 1.00 165.76 ? 31  DG  M "C2'" 1 
ATOM 211  C "C1'" . DG  A 1 11 ? -39.116 -18.024 -35.112 1.00 160.50 ? 31  DG  M "C1'" 1 
ATOM 212  N N9    . DG  A 1 11 ? -38.194 -17.402 -36.059 1.00 160.50 ? 31  DG  M N9    1 
ATOM 213  C C8    . DG  A 1 11 ? -36.973 -17.883 -36.473 1.00 161.49 ? 31  DG  M C8    1 
ATOM 214  N N7    . DG  A 1 11 ? -36.376 -17.112 -37.341 1.00 160.18 ? 31  DG  M N7    1 
ATOM 215  C C5    . DG  A 1 11 ? -37.263 -16.061 -37.526 1.00 151.28 ? 31  DG  M C5    1 
ATOM 216  C C6    . DG  A 1 11 ? -37.165 -14.918 -38.355 1.00 141.87 ? 31  DG  M C6    1 
ATOM 217  O O6    . DG  A 1 11 ? -36.242 -14.598 -39.117 1.00 138.10 ? 31  DG  M O6    1 
ATOM 218  N N1    . DG  A 1 11 ? -38.291 -14.104 -38.240 1.00 146.69 ? 31  DG  M N1    1 
ATOM 219  C C2    . DG  A 1 11 ? -39.372 -14.367 -37.432 1.00 151.41 ? 31  DG  M C2    1 
ATOM 220  N N2    . DG  A 1 11 ? -40.358 -13.469 -37.448 1.00 153.77 ? 31  DG  M N2    1 
ATOM 221  N N3    . DG  A 1 11 ? -39.474 -15.428 -36.650 1.00 151.22 ? 31  DG  M N3    1 
ATOM 222  C C4    . DG  A 1 11 ? -38.390 -16.230 -36.749 1.00 154.70 ? 31  DG  M C4    1 
ATOM 223  P P     . DT  A 1 12 ? -41.574 -21.010 -37.423 1.00 180.06 ? 32  DT  M P     1 
ATOM 224  O OP1   . DT  A 1 12 ? -42.718 -20.324 -36.780 1.00 167.47 ? 32  DT  M OP1   1 
ATOM 225  O OP2   . DT  A 1 12 ? -41.778 -22.326 -38.069 1.00 196.14 ? 32  DT  M OP2   1 
ATOM 226  O "O5'" . DT  A 1 12 ? -40.882 -20.017 -38.479 1.00 174.84 ? 32  DT  M "O5'" 1 
ATOM 227  C "C5'" . DT  A 1 12 ? -41.549 -19.626 -39.687 1.00 178.02 ? 32  DT  M "C5'" 1 
ATOM 228  C "C4'" . DT  A 1 12 ? -42.811 -18.831 -39.392 1.00 178.35 ? 32  DT  M "C4'" 1 
ATOM 229  O "O4'" . DT  A 1 12 ? -42.499 -17.664 -38.581 1.00 170.01 ? 32  DT  M "O4'" 1 
ATOM 230  C "C3'" . DT  A 1 12 ? -43.499 -18.239 -40.601 1.00 183.49 ? 32  DT  M "C3'" 1 
ATOM 231  O "O3'" . DT  A 1 12 ? -44.249 -19.209 -41.316 1.00 192.83 ? 32  DT  M "O3'" 1 
ATOM 232  C "C2'" . DT  A 1 12 ? -44.369 -17.175 -39.954 1.00 183.45 ? 32  DT  M "C2'" 1 
ATOM 233  C "C1'" . DT  A 1 12 ? -43.451 -16.634 -38.859 1.00 174.36 ? 32  DT  M "C1'" 1 
ATOM 234  N N1    . DT  A 1 12 ? -42.733 -15.385 -39.266 1.00 166.94 ? 32  DT  M N1    1 
ATOM 235  C C2    . DT  A 1 12 ? -43.304 -14.155 -39.001 1.00 164.92 ? 32  DT  M C2    1 
ATOM 236  O O2    . DT  A 1 12 ? -44.369 -14.020 -38.427 1.00 171.02 ? 32  DT  M O2    1 
ATOM 237  N N3    . DT  A 1 12 ? -42.571 -13.079 -39.427 1.00 152.36 ? 32  DT  M N3    1 
ATOM 238  C C4    . DT  A 1 12 ? -41.361 -13.108 -40.089 1.00 146.37 ? 32  DT  M C4    1 
ATOM 239  O O4    . DT  A 1 12 ? -40.777 -12.087 -40.425 1.00 142.66 ? 32  DT  M O4    1 
ATOM 240  C C5    . DT  A 1 12 ? -40.823 -14.425 -40.339 1.00 150.40 ? 32  DT  M C5    1 
ATOM 241  C C7    . DT  A 1 12 ? -39.513 -14.582 -41.041 1.00 145.46 ? 32  DT  M C7    1 
ATOM 242  C C6    . DT  A 1 12 ? -41.528 -15.488 -39.927 1.00 160.48 ? 32  DT  M C6    1 
ATOM 243  P P     . DC  A 1 13 ? -44.376 -19.084 -42.913 1.00 175.53 ? 33  DC  M P     1 
ATOM 244  O OP1   . DC  A 1 13 ? -45.712 -19.585 -43.305 1.00 192.43 ? 33  DC  M OP1   1 
ATOM 245  O OP2   . DC  A 1 13 ? -43.168 -19.700 -43.506 1.00 177.99 ? 33  DC  M OP2   1 
ATOM 246  O "O5'" . DC  A 1 13 ? -44.310 -17.503 -43.175 1.00 163.78 ? 33  DC  M "O5'" 1 
ATOM 247  C "C5'" . DC  A 1 13 ? -44.044 -17.008 -44.486 1.00 161.00 ? 33  DC  M "C5'" 1 
ATOM 248  C "C4'" . DC  A 1 13 ? -44.158 -15.492 -44.539 1.00 155.20 ? 33  DC  M "C4'" 1 
ATOM 249  O "O4'" . DC  A 1 13 ? -42.919 -14.890 -44.047 1.00 152.86 ? 33  DC  M "O4'" 1 
ATOM 250  C "C3'" . DC  A 1 13 ? -44.363 -14.911 -45.940 1.00 154.55 ? 33  DC  M "C3'" 1 
ATOM 251  O "O3'" . DC  A 1 13 ? -45.225 -13.772 -45.899 1.00 155.22 ? 33  DC  M "O3'" 1 
ATOM 252  C "C2'" . DC  A 1 13 ? -42.945 -14.554 -46.352 1.00 154.83 ? 33  DC  M "C2'" 1 
ATOM 253  C "C1'" . DC  A 1 13 ? -42.392 -14.025 -45.038 1.00 162.60 ? 33  DC  M "C1'" 1 
ATOM 254  N N1    . DC  A 1 13 ? -40.889 -14.004 -44.934 1.00 162.17 ? 33  DC  M N1    1 
ATOM 255  C C2    . DC  A 1 13 ? -40.288 -13.306 -43.879 1.00 155.82 ? 33  DC  M C2    1 
ATOM 256  O O2    . DC  A 1 13 ? -41.006 -12.728 -43.053 1.00 150.78 ? 33  DC  M O2    1 
ATOM 257  N N3    . DC  A 1 13 ? -38.936 -13.288 -43.787 1.00 149.02 ? 33  DC  M N3    1 
ATOM 258  C C4    . DC  A 1 13 ? -38.199 -13.922 -44.697 1.00 141.52 ? 33  DC  M C4    1 
ATOM 259  N N4    . DC  A 1 13 ? -36.872 -13.878 -44.563 1.00 131.99 ? 33  DC  M N4    1 
ATOM 260  C C5    . DC  A 1 13 ? -38.788 -14.636 -45.780 1.00 140.79 ? 33  DC  M C5    1 
ATOM 261  C C6    . DC  A 1 13 ? -40.122 -14.649 -45.861 1.00 148.43 ? 33  DC  M C6    1 
ATOM 262  P P     . DA  A 1 14 ? -45.549 -12.949 -47.241 1.00 177.83 ? 34  DA  M P     1 
ATOM 263  O OP1   . DA  A 1 14 ? -46.793 -12.180 -47.006 1.00 179.66 ? 34  DA  M OP1   1 
ATOM 264  O OP2   . DA  A 1 14 ? -45.487 -13.901 -48.374 1.00 188.88 ? 34  DA  M OP2   1 
ATOM 265  O "O5'" . DA  A 1 14 ? -44.330 -11.914 -47.358 1.00 158.14 ? 34  DA  M "O5'" 1 
ATOM 266  C "C5'" . DA  A 1 14 ? -44.171 -11.120 -48.534 1.00 150.53 ? 34  DA  M "C5'" 1 
ATOM 267  C "C4'" . DA  A 1 14 ? -42.917 -10.264 -48.447 1.00 148.41 ? 34  DA  M "C4'" 1 
ATOM 268  O "O4'" . DA  A 1 14 ? -41.757 -11.105 -48.316 1.00 140.96 ? 34  DA  M "O4'" 1 
ATOM 269  C "C3'" . DA  A 1 14 ? -42.616 -9.413  -49.673 1.00 154.73 ? 34  DA  M "C3'" 1 
ATOM 270  O "O3'" . DA  A 1 14 ? -43.273 -8.152  -49.592 1.00 160.03 ? 34  DA  M "O3'" 1 
ATOM 271  C "C2'" . DA  A 1 14 ? -41.088 -9.270  -49.651 1.00 148.76 ? 34  DA  M "C2'" 1 
ATOM 272  C "C1'" . DA  A 1 14 ? -40.623 -10.337 -48.650 1.00 139.74 ? 34  DA  M "C1'" 1 
ATOM 273  N N9    . DA  A 1 14 ? -39.572 -11.221 -49.162 1.00 130.92 ? 34  DA  M N9    1 
ATOM 274  C C8    . DA  A 1 14 ? -39.695 -12.225 -50.087 1.00 139.27 ? 34  DA  M C8    1 
ATOM 275  N N7    . DA  A 1 14 ? -38.565 -12.848 -50.342 1.00 142.51 ? 34  DA  M N7    1 
ATOM 276  C C5    . DA  A 1 14 ? -37.644 -12.211 -49.524 1.00 128.84 ? 34  DA  M C5    1 
ATOM 277  C C6    . DA  A 1 14 ? -36.260 -12.395 -49.317 1.00 121.88 ? 34  DA  M C6    1 
ATOM 278  N N6    . DA  A 1 14 ? -35.531 -13.313 -49.949 1.00 127.55 ? 34  DA  M N6    1 
ATOM 279  N N1    . DA  A 1 14 ? -35.649 -11.586 -48.432 1.00 131.18 ? 34  DA  M N1    1 
ATOM 280  C C2    . DA  A 1 14 ? -36.374 -10.658 -47.801 1.00 134.98 ? 34  DA  M C2    1 
ATOM 281  N N3    . DA  A 1 14 ? -37.671 -10.392 -47.908 1.00 134.88 ? 34  DA  M N3    1 
ATOM 282  C C4    . DA  A 1 14 ? -38.252 -11.210 -48.793 1.00 128.84 ? 34  DA  M C4    1 
ATOM 283  P P     . DA  A 1 15 ? -43.505 -7.267  -50.915 1.00 133.77 ? 35  DA  M P     1 
ATOM 284  O OP1   . DA  A 1 15 ? -44.649 -6.376  -50.626 1.00 122.79 ? 35  DA  M OP1   1 
ATOM 285  O OP2   . DA  A 1 15 ? -43.581 -8.179  -52.078 1.00 155.54 ? 35  DA  M OP2   1 
ATOM 286  O "O5'" . DA  A 1 15 ? -42.184 -6.359  -51.027 1.00 143.63 ? 35  DA  M "O5'" 1 
ATOM 287  C "C5'" . DA  A 1 15 ? -41.103 -6.729  -51.892 1.00 155.54 ? 35  DA  M "C5'" 1 
ATOM 288  C "C4'" . DA  A 1 15 ? -40.428 -5.494  -52.464 1.00 152.70 ? 35  DA  M "C4'" 1 
ATOM 289  O "O4'" . DA  A 1 15 ? -39.012 -5.528  -52.158 1.00 163.18 ? 35  DA  M "O4'" 1 
ATOM 290  C "C3'" . DA  A 1 15 ? -40.534 -5.341  -53.977 1.00 138.66 ? 35  DA  M "C3'" 1 
ATOM 291  O "O3'" . DA  A 1 15 ? -40.785 -3.979  -54.329 1.00 167.73 ? 35  DA  M "O3'" 1 
ATOM 292  C "C2'" . DA  A 1 15 ? -39.190 -5.848  -54.516 1.00 135.56 ? 35  DA  M "C2'" 1 
ATOM 293  C "C1'" . DA  A 1 15 ? -38.254 -5.869  -53.303 1.00 145.46 ? 35  DA  M "C1'" 1 
ATOM 294  N N9    . DA  A 1 15 ? -37.628 -7.175  -53.080 1.00 142.97 ? 35  DA  M N9    1 
ATOM 295  C C8    . DA  A 1 15 ? -37.919 -8.068  -52.089 1.00 139.49 ? 35  DA  M C8    1 
ATOM 296  N N7    . DA  A 1 15 ? -37.203 -9.168  -52.138 1.00 137.82 ? 35  DA  M N7    1 
ATOM 297  C C5    . DA  A 1 15 ? -36.385 -8.986  -53.239 1.00 139.54 ? 35  DA  M C5    1 
ATOM 298  C C6    . DA  A 1 15 ? -35.388 -9.794  -53.830 1.00 144.34 ? 35  DA  M C6    1 
ATOM 299  N N6    . DA  A 1 15 ? -35.040 -11.001 -53.367 1.00 164.17 ? 35  DA  M N6    1 
ATOM 300  N N1    . DA  A 1 15 ? -34.763 -9.312  -54.923 1.00 140.85 ? 35  DA  M N1    1 
ATOM 301  C C2    . DA  A 1 15 ? -35.109 -8.106  -55.387 1.00 138.86 ? 35  DA  M C2    1 
ATOM 302  N N3    . DA  A 1 15 ? -36.025 -7.257  -54.920 1.00 142.44 ? 35  DA  M N3    1 
ATOM 303  C C4    . DA  A 1 15 ? -36.633 -7.762  -53.834 1.00 144.35 ? 35  DA  M C4    1 
ATOM 304  P P     . DA  B 2 1  ? 2.657   7.956   0.111   1.00 109.18 ? 20  DA  D P     1 
ATOM 305  O OP1   . DA  B 2 1  ? 3.171   7.673   1.469   1.00 123.07 ? 20  DA  D OP1   1 
ATOM 306  O OP2   . DA  B 2 1  ? 2.922   6.996   -0.982  1.00 112.11 ? 20  DA  D OP2   1 
ATOM 307  O "O5'" . DA  B 2 1  ? 1.083   8.252   0.184   1.00 123.47 ? 20  DA  D "O5'" 1 
ATOM 308  C "C5'" . DA  B 2 1  ? 0.154   7.388   -0.478  1.00 125.76 ? 20  DA  D "C5'" 1 
ATOM 309  C "C4'" . DA  B 2 1  ? -1.281  7.725   -0.097  1.00 132.26 ? 20  DA  D "C4'" 1 
ATOM 310  O "O4'" . DA  B 2 1  ? -1.437  9.154   0.016   1.00 129.20 ? 20  DA  D "O4'" 1 
ATOM 311  C "C3'" . DA  B 2 1  ? -2.331  7.318   -1.118  1.00 131.03 ? 20  DA  D "C3'" 1 
ATOM 312  O "O3'" . DA  B 2 1  ? -2.748  5.975   -0.923  1.00 147.90 ? 20  DA  D "O3'" 1 
ATOM 313  C "C2'" . DA  B 2 1  ? -3.468  8.317   -0.881  1.00 127.54 ? 20  DA  D "C2'" 1 
ATOM 314  C "C1'" . DA  B 2 1  ? -2.809  9.468   -0.112  1.00 126.19 ? 20  DA  D "C1'" 1 
ATOM 315  N N9    . DA  B 2 1  ? -2.945  10.759  -0.779  1.00 117.30 ? 20  DA  D N9    1 
ATOM 316  C C8    . DA  B 2 1  ? -2.377  11.148  -1.961  1.00 116.13 ? 20  DA  D C8    1 
ATOM 317  N N7    . DA  B 2 1  ? -2.689  12.373  -2.319  1.00 119.54 ? 20  DA  D N7    1 
ATOM 318  C C5    . DA  B 2 1  ? -3.519  12.815  -1.301  1.00 118.61 ? 20  DA  D C5    1 
ATOM 319  C C6    . DA  B 2 1  ? -4.193  14.034  -1.085  1.00 108.03 ? 20  DA  D C6    1 
ATOM 320  N N6    . DA  B 2 1  ? -4.120  15.074  -1.921  1.00 98.38  ? 20  DA  D N6    1 
ATOM 321  N N1    . DA  B 2 1  ? -4.943  14.146  0.030   1.00 109.01 ? 20  DA  D N1    1 
ATOM 322  C C2    . DA  B 2 1  ? -5.013  13.105  0.866   1.00 112.06 ? 20  DA  D C2    1 
ATOM 323  N N3    . DA  B 2 1  ? -4.430  11.913  0.769   1.00 114.73 ? 20  DA  D N3    1 
ATOM 324  C C4    . DA  B 2 1  ? -3.691  11.831  -0.348  1.00 119.39 ? 20  DA  D C4    1 
ATOM 325  P P     . DC  B 2 2  ? -3.473  5.185   -2.120  1.00 155.82 ? 21  DC  D P     1 
ATOM 326  O OP1   . DC  B 2 2  ? -3.756  3.811   -1.657  1.00 149.26 ? 21  DC  D OP1   1 
ATOM 327  O OP2   . DC  B 2 2  ? -2.663  5.384   -3.343  1.00 139.67 ? 21  DC  D OP2   1 
ATOM 328  O "O5'" . DC  B 2 2  ? -4.856  5.965   -2.310  1.00 140.87 ? 21  DC  D "O5'" 1 
ATOM 329  C "C5'" . DC  B 2 2  ? -5.706  5.654   -3.410  1.00 146.15 ? 21  DC  D "C5'" 1 
ATOM 330  C "C4'" . DC  B 2 2  ? -7.164  5.835   -3.030  1.00 142.19 ? 21  DC  D "C4'" 1 
ATOM 331  O "O4'" . DC  B 2 2  ? -7.337  7.154   -2.450  1.00 132.99 ? 21  DC  D "O4'" 1 
ATOM 332  C "C3'" . DC  B 2 2  ? -8.148  5.788   -4.187  1.00 145.69 ? 21  DC  D "C3'" 1 
ATOM 333  O "O3'" . DC  B 2 2  ? -9.449  5.398   -3.738  1.00 138.00 ? 21  DC  D "O3'" 1 
ATOM 334  C "C2'" . DC  B 2 2  ? -8.115  7.223   -4.694  1.00 138.98 ? 21  DC  D "C2'" 1 
ATOM 335  C "C1'" . DC  B 2 2  ? -7.907  8.035   -3.408  1.00 133.40 ? 21  DC  D "C1'" 1 
ATOM 336  N N1    . DC  B 2 2  ? -6.997  9.239   -3.572  1.00 135.23 ? 21  DC  D N1    1 
ATOM 337  C C2    . DC  B 2 2  ? -7.335  10.462  -2.967  1.00 138.80 ? 21  DC  D C2    1 
ATOM 338  O O2    . DC  B 2 2  ? -8.372  10.545  -2.300  1.00 146.37 ? 21  DC  D O2    1 
ATOM 339  N N3    . DC  B 2 2  ? -6.508  11.525  -3.133  1.00 133.36 ? 21  DC  D N3    1 
ATOM 340  C C4    . DC  B 2 2  ? -5.393  11.401  -3.858  1.00 124.32 ? 21  DC  D C4    1 
ATOM 341  N N4    . DC  B 2 2  ? -4.609  12.474  -3.993  1.00 117.46 ? 21  DC  D N4    1 
ATOM 342  C C5    . DC  B 2 2  ? -5.032  10.175  -4.480  1.00 127.75 ? 21  DC  D C5    1 
ATOM 343  C C6    . DC  B 2 2  ? -5.848  9.130   -4.312  1.00 132.32 ? 21  DC  D C6    1 
ATOM 344  P P     . DA  B 2 3  ? -10.646 5.179   -4.790  1.00 127.43 ? 22  DA  D P     1 
ATOM 345  O OP1   . DA  B 2 3  ? -11.652 4.314   -4.137  1.00 115.49 ? 22  DA  D OP1   1 
ATOM 346  O OP2   . DA  B 2 3  ? -10.051 4.762   -6.081  1.00 129.68 ? 22  DA  D OP2   1 
ATOM 347  O "O5'" . DA  B 2 3  ? -11.280 6.640   -4.963  1.00 132.76 ? 22  DA  D "O5'" 1 
ATOM 348  C "C5'" . DA  B 2 3  ? -11.405 7.212   -6.262  1.00 130.27 ? 22  DA  D "C5'" 1 
ATOM 349  C "C4'" . DA  B 2 3  ? -12.539 8.218   -6.315  1.00 122.55 ? 22  DA  D "C4'" 1 
ATOM 350  O "O4'" . DA  B 2 3  ? -12.042 9.522   -5.906  1.00 120.35 ? 22  DA  D "O4'" 1 
ATOM 351  C "C3'" . DA  B 2 3  ? -13.140 8.428   -7.700  1.00 119.57 ? 22  DA  D "C3'" 1 
ATOM 352  O "O3'" . DA  B 2 3  ? -14.529 8.784   -7.625  1.00 108.39 ? 22  DA  D "O3'" 1 
ATOM 353  C "C2'" . DA  B 2 3  ? -12.275 9.550   -8.281  1.00 125.30 ? 22  DA  D "C2'" 1 
ATOM 354  C "C1'" . DA  B 2 3  ? -11.813 10.342  -7.041  1.00 125.43 ? 22  DA  D "C1'" 1 
ATOM 355  N N9    . DA  B 2 3  ? -10.389 10.717  -7.066  1.00 126.04 ? 22  DA  D N9    1 
ATOM 356  C C8    . DA  B 2 3  ? -9.363  10.017  -7.643  1.00 127.94 ? 22  DA  D C8    1 
ATOM 357  N N7    . DA  B 2 3  ? -8.189  10.587  -7.513  1.00 126.93 ? 22  DA  D N7    1 
ATOM 358  C C5    . DA  B 2 3  ? -8.450  11.741  -6.796  1.00 125.62 ? 22  DA  D C5    1 
ATOM 359  C C6    . DA  B 2 3  ? -7.613  12.778  -6.334  1.00 122.84 ? 22  DA  D C6    1 
ATOM 360  N N6    . DA  B 2 3  ? -6.293  12.808  -6.541  1.00 119.93 ? 22  DA  D N6    1 
ATOM 361  N N1    . DA  B 2 3  ? -8.187  13.785  -5.650  1.00 127.28 ? 22  DA  D N1    1 
ATOM 362  C C2    . DA  B 2 3  ? -9.509  13.756  -5.442  1.00 134.46 ? 22  DA  D C2    1 
ATOM 363  N N3    . DA  B 2 3  ? -10.401 12.838  -5.826  1.00 137.00 ? 22  DA  D N3    1 
ATOM 364  C C4    . DA  B 2 3  ? -9.801  11.844  -6.507  1.00 124.10 ? 22  DA  D C4    1 
ATOM 365  P P     . DA  B 2 4  ? -15.449 8.748   -8.941  1.00 107.69 ? 23  DA  D P     1 
ATOM 366  O OP1   . DA  B 2 4  ? -16.861 8.823   -8.510  1.00 103.06 ? 23  DA  D OP1   1 
ATOM 367  O OP2   . DA  B 2 4  ? -15.012 7.603   -9.766  1.00 122.18 ? 23  DA  D OP2   1 
ATOM 368  O "O5'" . DA  B 2 4  ? -15.047 10.090  -9.710  1.00 118.43 ? 23  DA  D "O5'" 1 
ATOM 369  C "C5'" . DA  B 2 4  ? -15.128 11.341  -9.050  1.00 126.33 ? 23  DA  D "C5'" 1 
ATOM 370  C "C4'" . DA  B 2 4  ? -14.507 12.462  -9.869  1.00 136.19 ? 23  DA  D "C4'" 1 
ATOM 371  O "O4'" . DA  B 2 4  ? -13.087 12.576  -9.594  1.00 129.99 ? 23  DA  D "O4'" 1 
ATOM 372  C "C3'" . DA  B 2 4  ? -14.618 12.315  -11.397 1.00 144.71 ? 23  DA  D "C3'" 1 
ATOM 373  O "O3'" . DA  B 2 4  ? -15.500 13.320  -11.905 1.00 150.40 ? 23  DA  D "O3'" 1 
ATOM 374  C "C2'" . DA  B 2 4  ? -13.165 12.479  -11.891 1.00 146.69 ? 23  DA  D "C2'" 1 
ATOM 375  C "C1'" . DA  B 2 4  ? -12.508 13.186  -10.719 1.00 137.37 ? 23  DA  D "C1'" 1 
ATOM 376  N N9    . DA  B 2 4  ? -11.041 13.086  -10.655 1.00 129.73 ? 23  DA  D N9    1 
ATOM 377  C C8    . DA  B 2 4  ? -10.244 12.038  -11.042 1.00 127.83 ? 23  DA  D C8    1 
ATOM 378  N N7    . DA  B 2 4  ? -8.957  12.254  -10.858 1.00 124.94 ? 23  DA  D N7    1 
ATOM 379  C C5    . DA  B 2 4  ? -8.909  13.529  -10.315 1.00 129.34 ? 23  DA  D C5    1 
ATOM 380  C C6    . DA  B 2 4  ? -7.840  14.350  -9.889  1.00 133.15 ? 23  DA  D C6    1 
ATOM 381  N N6    . DA  B 2 4  ? -6.555  13.985  -9.942  1.00 135.80 ? 23  DA  D N6    1 
ATOM 382  N N1    . DA  B 2 4  ? -8.146  15.568  -9.397  1.00 134.99 ? 23  DA  D N1    1 
ATOM 383  C C2    . DA  B 2 4  ? -9.427  15.937  -9.338  1.00 137.55 ? 23  DA  D C2    1 
ATOM 384  N N3    . DA  B 2 4  ? -10.512 15.259  -9.699  1.00 135.56 ? 23  DA  D N3    1 
ATOM 385  C C4    . DA  B 2 4  ? -10.182 14.052  -10.186 1.00 132.70 ? 23  DA  D C4    1 
ATOM 386  P P     . DT  B 2 5  ? -15.876 13.404  -13.465 1.00 181.94 ? 24  DT  D P     1 
ATOM 387  O OP1   . DT  B 2 5  ? -17.327 13.128  -13.560 1.00 178.78 ? 24  DT  D OP1   1 
ATOM 388  O OP2   . DT  B 2 5  ? -14.931 12.580  -14.253 1.00 183.40 ? 24  DT  D OP2   1 
ATOM 389  O "O5'" . DT  B 2 5  ? -15.615 14.946  -13.823 1.00 171.33 ? 24  DT  D "O5'" 1 
ATOM 390  C "C5'" . DT  B 2 5  ? -14.547 15.664  -13.184 1.00 154.71 ? 24  DT  D "C5'" 1 
ATOM 391  C "C4'" . DT  B 2 5  ? -13.775 16.517  -14.176 1.00 146.87 ? 24  DT  D "C4'" 1 
ATOM 392  O "O4'" . DT  B 2 5  ? -12.463 16.830  -13.607 1.00 131.88 ? 24  DT  D "O4'" 1 
ATOM 393  C "C3'" . DT  B 2 5  ? -13.505 15.840  -15.534 1.00 145.95 ? 24  DT  D "C3'" 1 
ATOM 394  O "O3'" . DT  B 2 5  ? -13.903 16.671  -16.663 1.00 138.51 ? 24  DT  D "O3'" 1 
ATOM 395  C "C2'" . DT  B 2 5  ? -12.011 15.547  -15.501 1.00 137.67 ? 24  DT  D "C2'" 1 
ATOM 396  C "C1'" . DT  B 2 5  ? -11.466 16.632  -14.584 1.00 132.58 ? 24  DT  D "C1'" 1 
ATOM 397  N N1    . DT  B 2 5  ? -10.148 16.262  -13.944 1.00 132.29 ? 24  DT  D N1    1 
ATOM 398  C C2    . DT  B 2 5  ? -9.729  16.881  -12.782 1.00 139.96 ? 24  DT  D C2    1 
ATOM 399  O O2    . DT  B 2 5  ? -10.378 17.725  -12.196 1.00 147.62 ? 24  DT  D O2    1 
ATOM 400  N N3    . DT  B 2 5  ? -8.504  16.457  -12.324 1.00 143.66 ? 24  DT  D N3    1 
ATOM 401  C C4    . DT  B 2 5  ? -7.678  15.510  -12.905 1.00 135.44 ? 24  DT  D C4    1 
ATOM 402  O O4    . DT  B 2 5  ? -6.598  15.196  -12.422 1.00 136.56 ? 24  DT  D O4    1 
ATOM 403  C C5    . DT  B 2 5  ? -8.177  14.919  -14.120 1.00 130.58 ? 24  DT  D C5    1 
ATOM 404  C C7    . DT  B 2 5  ? -7.384  13.881  -14.839 1.00 127.68 ? 24  DT  D C7    1 
ATOM 405  C C6    . DT  B 2 5  ? -9.360  15.318  -14.576 1.00 131.29 ? 24  DT  D C6    1 
ATOM 406  P P     . DT  B 2 6  ? -13.229 18.101  -16.982 1.00 117.40 ? 25  DT  D P     1 
ATOM 407  O OP1   . DT  B 2 6  ? -13.269 18.943  -15.770 1.00 134.68 ? 25  DT  D OP1   1 
ATOM 408  O OP2   . DT  B 2 6  ? -13.899 18.600  -18.202 1.00 122.43 ? 25  DT  D OP2   1 
ATOM 409  O "O5'" . DT  B 2 6  ? -11.708 17.773  -17.381 1.00 126.70 ? 25  DT  D "O5'" 1 
ATOM 410  C "C5'" . DT  B 2 6  ? -10.727 18.822  -17.352 1.00 132.62 ? 25  DT  D "C5'" 1 
ATOM 411  C "C4'" . DT  B 2 6  ? -9.307  18.274  -17.248 1.00 124.56 ? 25  DT  D "C4'" 1 
ATOM 412  O "O4'" . DT  B 2 6  ? -9.291  16.848  -17.469 1.00 122.70 ? 25  DT  D "O4'" 1 
ATOM 413  C "C3'" . DT  B 2 6  ? -8.318  18.814  -18.276 1.00 120.40 ? 25  DT  D "C3'" 1 
ATOM 414  O "O3'" . DT  B 2 6  ? -7.676  19.992  -17.801 1.00 117.32 ? 25  DT  D "O3'" 1 
ATOM 415  C "C2'" . DT  B 2 6  ? -7.327  17.654  -18.473 1.00 117.26 ? 25  DT  D "C2'" 1 
ATOM 416  C "C1'" . DT  B 2 6  ? -7.948  16.489  -17.698 1.00 122.75 ? 25  DT  D "C1'" 1 
ATOM 417  N N1    . DT  B 2 6  ? -7.865  15.175  -18.428 1.00 120.41 ? 25  DT  D N1    1 
ATOM 418  C C2    . DT  B 2 6  ? -6.623  14.651  -18.690 1.00 111.55 ? 25  DT  D C2    1 
ATOM 419  O O2    . DT  B 2 6  ? -5.595  15.203  -18.367 1.00 113.26 ? 25  DT  D O2    1 
ATOM 420  N N3    . DT  B 2 6  ? -6.625  13.456  -19.356 1.00 108.40 ? 25  DT  D N3    1 
ATOM 421  C C4    . DT  B 2 6  ? -7.725  12.742  -19.782 1.00 107.25 ? 25  DT  D C4    1 
ATOM 422  O O4    . DT  B 2 6  ? -7.621  11.675  -20.376 1.00 106.89 ? 25  DT  D O4    1 
ATOM 423  C C5    . DT  B 2 6  ? -9.003  13.340  -19.479 1.00 114.31 ? 25  DT  D C5    1 
ATOM 424  C C7    . DT  B 2 6  ? -10.264 12.653  -19.891 1.00 110.03 ? 25  DT  D C7    1 
ATOM 425  C C6    . DT  B 2 6  ? -9.017  14.515  -18.822 1.00 119.41 ? 25  DT  D C6    1 
ATOM 426  P P     . DA  B 2 7  ? -6.743  20.855  -18.786 1.00 126.04 ? 26  DA  D P     1 
ATOM 427  O OP1   . DA  B 2 7  ? -6.427  22.130  -18.107 1.00 121.87 ? 26  DA  D OP1   1 
ATOM 428  O OP2   . DA  B 2 7  ? -7.381  20.875  -20.124 1.00 113.69 ? 26  DA  D OP2   1 
ATOM 429  O "O5'" . DA  B 2 7  ? -5.399  19.995  -18.885 1.00 122.22 ? 26  DA  D "O5'" 1 
ATOM 430  C "C5'" . DA  B 2 7  ? -4.486  20.238  -19.934 1.00 129.34 ? 26  DA  D "C5'" 1 
ATOM 431  C "C4'" . DA  B 2 7  ? -3.202  19.463  -19.727 1.00 127.42 ? 26  DA  D "C4'" 1 
ATOM 432  O "O4'" . DA  B 2 7  ? -3.502  18.030  -19.722 1.00 119.23 ? 26  DA  D "O4'" 1 
ATOM 433  C "C3'" . DA  B 2 7  ? -2.173  19.646  -20.832 1.00 127.68 ? 26  DA  D "C3'" 1 
ATOM 434  O "O3'" . DA  B 2 7  ? -0.835  19.412  -20.347 1.00 121.01 ? 26  DA  D "O3'" 1 
ATOM 435  C "C2'" . DA  B 2 7  ? -2.638  18.602  -21.834 1.00 123.34 ? 26  DA  D "C2'" 1 
ATOM 436  C "C1'" . DA  B 2 7  ? -3.004  17.437  -20.914 1.00 118.45 ? 26  DA  D "C1'" 1 
ATOM 437  N N9    . DA  B 2 7  ? -4.012  16.519  -21.472 1.00 112.18 ? 26  DA  D N9    1 
ATOM 438  C C8    . DA  B 2 7  ? -5.093  16.842  -22.252 1.00 109.95 ? 26  DA  D C8    1 
ATOM 439  N N7    . DA  B 2 7  ? -5.815  15.806  -22.618 1.00 104.33 ? 26  DA  D N7    1 
ATOM 440  C C5    . DA  B 2 7  ? -5.167  14.725  -22.044 1.00 103.54 ? 26  DA  D C5    1 
ATOM 441  C C6    . DA  B 2 7  ? -5.431  13.338  -22.056 1.00 101.13 ? 26  DA  D C6    1 
ATOM 442  N N6    . DA  B 2 7  ? -6.461  12.779  -22.693 1.00 96.62  ? 26  DA  D N6    1 
ATOM 443  N N1    . DA  B 2 7  ? -4.594  12.538  -21.378 1.00 98.82  ? 26  DA  D N1    1 
ATOM 444  C C2    . DA  B 2 7  ? -3.554  13.080  -20.741 1.00 101.72 ? 26  DA  D C2    1 
ATOM 445  N N3    . DA  B 2 7  ? -3.195  14.360  -20.656 1.00 106.30 ? 26  DA  D N3    1 
ATOM 446  C C4    . DA  B 2 7  ? -4.052  15.142  -21.336 1.00 96.29  ? 26  DA  D C4    1 
ATOM 447  P P     . DT  B 2 8  ? 0.384   19.179  -21.372 1.00 124.83 ? 27  DT  D P     1 
ATOM 448  O OP1   . DT  B 2 8  ? 1.641   19.356  -20.610 1.00 124.19 ? 27  DT  D OP1   1 
ATOM 449  O OP2   . DT  B 2 8  ? 0.154   20.020  -22.570 1.00 136.23 ? 27  DT  D OP2   1 
ATOM 450  O "O5'" . DT  B 2 8  ? 0.259   17.623  -21.747 1.00 110.64 ? 27  DT  D "O5'" 1 
ATOM 451  C "C5'" . DT  B 2 8  ? 0.373   17.188  -23.105 1.00 101.12 ? 27  DT  D "C5'" 1 
ATOM 452  C "C4'" . DT  B 2 8  ? 0.313   15.668  -23.194 1.00 105.60 ? 27  DT  D "C4'" 1 
ATOM 453  O "O4'" . DT  B 2 8  ? -1.062  15.212  -23.233 1.00 92.82  ? 27  DT  D "O4'" 1 
ATOM 454  C "C3'" . DT  B 2 8  ? 0.945   15.069  -24.446 1.00 92.61  ? 27  DT  D "C3'" 1 
ATOM 455  O "O3'" . DT  B 2 8  ? 2.312   14.729  -24.212 1.00 111.05 ? 27  DT  D "O3'" 1 
ATOM 456  C "C2'" . DT  B 2 8  ? 0.083   13.829  -24.751 1.00 88.14  ? 27  DT  D "C2'" 1 
ATOM 457  C "C1'" . DT  B 2 8  ? -1.062  13.894  -23.742 1.00 98.57  ? 27  DT  D "C1'" 1 
ATOM 458  N N1    . DT  B 2 8  ? -2.422  13.560  -24.352 1.00 95.83  ? 27  DT  D N1    1 
ATOM 459  C C2    . DT  B 2 8  ? -3.083  12.409  -23.953 1.00 90.09  ? 27  DT  D C2    1 
ATOM 460  O O2    . DT  B 2 8  ? -2.649  11.643  -23.109 1.00 96.99  ? 27  DT  D O2    1 
ATOM 461  N N3    . DT  B 2 8  ? -4.287  12.185  -24.571 1.00 94.44  ? 27  DT  D N3    1 
ATOM 462  C C4    . DT  B 2 8  ? -4.884  12.970  -25.533 1.00 96.47  ? 27  DT  D C4    1 
ATOM 463  O O4    . DT  B 2 8  ? -5.970  12.688  -26.033 1.00 95.19  ? 27  DT  D O4    1 
ATOM 464  C C5    . DT  B 2 8  ? -4.144  14.148  -25.916 1.00 90.66  ? 27  DT  D C5    1 
ATOM 465  C C7    . DT  B 2 8  ? -4.699  15.064  -26.956 1.00 97.83  ? 27  DT  D C7    1 
ATOM 466  C C6    . DT  B 2 8  ? -2.960  14.386  -25.323 1.00 88.95  ? 27  DT  D C6    1 
ATOM 467  P P     . DC  B 2 9  ? 3.345   14.573  -25.436 1.00 132.65 ? 28  DC  D P     1 
ATOM 468  O OP1   . DC  B 2 9  ? 4.698   14.575  -24.841 1.00 118.35 ? 28  DC  D OP1   1 
ATOM 469  O OP2   . DC  B 2 9  ? 3.008   15.560  -26.482 1.00 123.83 ? 28  DC  D OP2   1 
ATOM 470  O "O5'" . DC  B 2 9  ? 3.072   13.100  -26.000 1.00 106.52 ? 28  DC  D "O5'" 1 
ATOM 471  C "C5'" . DC  B 2 9  ? 2.078   12.865  -26.996 1.00 103.13 ? 28  DC  D "C5'" 1 
ATOM 472  C "C4'" . DC  B 2 9  ? 1.462   11.491  -26.805 1.00 96.93  ? 28  DC  D "C4'" 1 
ATOM 473  O "O4'" . DC  B 2 9  ? 0.019   11.554  -26.779 1.00 116.30 ? 28  DC  D "O4'" 1 
ATOM 474  C "C3'" . DC  B 2 9  ? 1.741   10.510  -27.917 1.00 98.11  ? 28  DC  D "C3'" 1 
ATOM 475  O "O3'" . DC  B 2 9  ? 3.029   9.947   -27.786 1.00 111.03 ? 28  DC  D "O3'" 1 
ATOM 476  C "C2'" . DC  B 2 9  ? 0.624   9.474   -27.744 1.00 96.30  ? 28  DC  D "C2'" 1 
ATOM 477  C "C1'" . DC  B 2 9  ? -0.461  10.232  -26.961 1.00 82.43  ? 28  DC  D "C1'" 1 
ATOM 478  N N1    . DC  B 2 9  ? -1.794  10.261  -27.656 1.00 89.04  ? 28  DC  D N1    1 
ATOM 479  C C2    . DC  B 2 9  ? -2.739  9.257   -27.374 1.00 90.60  ? 28  DC  D C2    1 
ATOM 480  O O2    . DC  B 2 9  ? -2.460  8.371   -26.555 1.00 93.35  ? 28  DC  D O2    1 
ATOM 481  N N3    . DC  B 2 9  ? -3.937  9.284   -28.010 1.00 93.65  ? 28  DC  D N3    1 
ATOM 482  C C4    . DC  B 2 9  ? -4.206  10.250  -28.890 1.00 94.70  ? 28  DC  D C4    1 
ATOM 483  N N4    . DC  B 2 9  ? -5.404  10.232  -29.489 1.00 95.64  ? 28  DC  D N4    1 
ATOM 484  C C5    . DC  B 2 9  ? -3.262  11.280  -29.192 1.00 93.89  ? 28  DC  D C5    1 
ATOM 485  C C6    . DC  B 2 9  ? -2.079  11.246  -28.559 1.00 89.26  ? 28  DC  D C6    1 
ATOM 486  P P     . DC  B 2 10 ? 3.759   9.337   -29.075 1.00 125.18 ? 29  DC  D P     1 
ATOM 487  O OP1   . DC  B 2 10 ? 5.135   8.977   -28.679 1.00 118.74 ? 29  DC  D OP1   1 
ATOM 488  O OP2   . DC  B 2 10 ? 3.565   10.327  -30.151 1.00 123.14 ? 29  DC  D OP2   1 
ATOM 489  O "O5'" . DC  B 2 10 ? 2.923   8.003   -29.390 1.00 115.09 ? 29  DC  D "O5'" 1 
ATOM 490  C "C5'" . DC  B 2 10 ? 2.934   6.943   -28.451 1.00 107.12 ? 29  DC  D "C5'" 1 
ATOM 491  C "C4'" . DC  B 2 10 ? 1.877   5.886   -28.747 1.00 107.69 ? 29  DC  D "C4'" 1 
ATOM 492  O "O4'" . DC  B 2 10 ? 0.571   6.484   -28.896 1.00 105.41 ? 29  DC  D "O4'" 1 
ATOM 493  C "C3'" . DC  B 2 10 ? 2.070   5.105   -30.039 1.00 117.85 ? 29  DC  D "C3'" 1 
ATOM 494  O "O3'" . DC  B 2 10 ? 2.912   3.972   -29.830 1.00 130.08 ? 29  DC  D "O3'" 1 
ATOM 495  C "C2'" . DC  B 2 10 ? 0.636   4.700   -30.426 1.00 117.34 ? 29  DC  D "C2'" 1 
ATOM 496  C "C1'" . DC  B 2 10 ? -0.261  5.496   -29.466 1.00 107.36 ? 29  DC  D "C1'" 1 
ATOM 497  N N1    . DC  B 2 10 ? -1.468  6.134   -30.141 1.00 105.74 ? 29  DC  D N1    1 
ATOM 498  C C2    . DC  B 2 10 ? -2.770  5.806   -29.714 1.00 104.31 ? 29  DC  D C2    1 
ATOM 499  O O2    . DC  B 2 10 ? -2.927  5.015   -28.770 1.00 105.29 ? 29  DC  D O2    1 
ATOM 500  N N3    . DC  B 2 10 ? -3.827  6.374   -30.345 1.00 99.65  ? 29  DC  D N3    1 
ATOM 501  C C4    . DC  B 2 10 ? -3.631  7.221   -31.356 1.00 108.06 ? 29  DC  D C4    1 
ATOM 502  N N4    . DC  B 2 10 ? -4.709  7.751   -31.943 1.00 107.72 ? 29  DC  D N4    1 
ATOM 503  C C5    . DC  B 2 10 ? -2.327  7.563   -31.810 1.00 109.03 ? 29  DC  D C5    1 
ATOM 504  C C6    . DC  B 2 10 ? -1.284  6.999   -31.187 1.00 108.64 ? 29  DC  D C6    1 
ATOM 505  P P     . DT  B 2 11 ? 3.307   3.008   -31.058 1.00 124.12 ? 30  DT  D P     1 
ATOM 506  O OP1   . DT  B 2 11 ? 4.459   2.198   -30.609 1.00 137.42 ? 30  DT  D OP1   1 
ATOM 507  O OP2   . DT  B 2 11 ? 3.424   3.830   -32.284 1.00 124.54 ? 30  DT  D OP2   1 
ATOM 508  O "O5'" . DT  B 2 11 ? 2.047   2.026   -31.204 1.00 121.57 ? 30  DT  D "O5'" 1 
ATOM 509  C "C5'" . DT  B 2 11 ? 1.186   2.119   -32.338 1.00 125.25 ? 30  DT  D "C5'" 1 
ATOM 510  C "C4'" . DT  B 2 11 ? -0.050  1.247   -32.165 1.00 127.87 ? 30  DT  D "C4'" 1 
ATOM 511  O "O4'" . DT  B 2 11 ? -1.228  2.101   -32.006 1.00 122.69 ? 30  DT  D "O4'" 1 
ATOM 512  C "C3'" . DT  B 2 11 ? -0.375  0.347   -33.350 1.00 127.00 ? 30  DT  D "C3'" 1 
ATOM 513  O "O3'" . DT  B 2 11 ? -1.041  -0.843  -32.921 1.00 147.58 ? 30  DT  D "O3'" 1 
ATOM 514  C "C2'" . DT  B 2 11 ? -1.272  1.249   -34.185 1.00 123.77 ? 30  DT  D "C2'" 1 
ATOM 515  C "C1'" . DT  B 2 11 ? -2.111  1.911   -33.104 1.00 122.48 ? 30  DT  D "C1'" 1 
ATOM 516  N N1    . DT  B 2 11 ? -2.714  3.243   -33.503 1.00 121.83 ? 30  DT  D N1    1 
ATOM 517  C C2    . DT  B 2 11 ? -4.087  3.407   -33.476 1.00 123.02 ? 30  DT  D C2    1 
ATOM 518  O O2    . DT  B 2 11 ? -4.861  2.530   -33.140 1.00 126.14 ? 30  DT  D O2    1 
ATOM 519  N N3    . DT  B 2 11 ? -4.527  4.650   -33.856 1.00 122.63 ? 30  DT  D N3    1 
ATOM 520  C C4    . DT  B 2 11 ? -3.756  5.720   -34.256 1.00 119.24 ? 30  DT  D C4    1 
ATOM 521  O O4    . DT  B 2 11 ? -4.246  6.799   -34.580 1.00 119.25 ? 30  DT  D O4    1 
ATOM 522  C C5    . DT  B 2 11 ? -2.334  5.484   -34.267 1.00 120.47 ? 30  DT  D C5    1 
ATOM 523  C C7    . DT  B 2 11 ? -1.403  6.574   -34.676 1.00 121.80 ? 30  DT  D C7    1 
ATOM 524  C C6    . DT  B 2 11 ? -1.883  4.275   -33.893 1.00 122.81 ? 30  DT  D C6    1 
ATOM 525  P P     . DG  B 2 12 ? -1.655  -1.862  -34.002 1.00 123.71 ? 31  DG  D P     1 
ATOM 526  O OP1   . DG  B 2 12 ? -1.798  -3.180  -33.349 1.00 143.14 ? 31  DG  D OP1   1 
ATOM 527  O OP2   . DG  B 2 12 ? -0.830  -1.757  -35.226 1.00 126.20 ? 31  DG  D OP2   1 
ATOM 528  O "O5'" . DG  B 2 12 ? -3.117  -1.271  -34.300 1.00 127.95 ? 31  DG  D "O5'" 1 
ATOM 529  C "C5'" . DG  B 2 12 ? -3.567  -1.120  -35.648 1.00 137.42 ? 31  DG  D "C5'" 1 
ATOM 530  C "C4'" . DG  B 2 12 ? -5.041  -0.757  -35.706 1.00 142.52 ? 31  DG  D "C4'" 1 
ATOM 531  O "O4'" . DG  B 2 12 ? -5.242  0.560   -35.112 1.00 141.79 ? 31  DG  D "O4'" 1 
ATOM 532  C "C3'" . DG  B 2 12 ? -5.621  -0.670  -37.116 1.00 146.26 ? 31  DG  D "C3'" 1 
ATOM 533  O "O3'" . DG  B 2 12 ? -6.215  -1.907  -37.505 1.00 165.22 ? 31  DG  D "O3'" 1 
ATOM 534  C "C2'" . DG  B 2 12 ? -6.636  0.461   -36.999 1.00 130.31 ? 31  DG  D "C2'" 1 
ATOM 535  C "C1'" . DG  B 2 12 ? -5.975  1.393   -35.994 1.00 126.55 ? 31  DG  D "C1'" 1 
ATOM 536  N N9    . DG  B 2 12 ? -5.049  2.366   -36.581 1.00 124.97 ? 31  DG  D N9    1 
ATOM 537  C C8    . DG  B 2 12 ? -3.805  2.107   -37.111 1.00 122.49 ? 31  DG  D C8    1 
ATOM 538  N N7    . DG  B 2 12 ? -3.191  3.171   -37.548 1.00 120.71 ? 31  DG  D N7    1 
ATOM 539  C C5    . DG  B 2 12 ? -4.078  4.208   -37.284 1.00 123.49 ? 31  DG  D C5    1 
ATOM 540  C C6    . DG  B 2 12 ? -3.957  5.598   -37.537 1.00 126.29 ? 31  DG  D C6    1 
ATOM 541  O O6    . DG  B 2 12 ? -3.013  6.205   -38.064 1.00 122.22 ? 31  DG  D O6    1 
ATOM 542  N N1    . DG  B 2 12 ? -5.085  6.297   -37.114 1.00 125.82 ? 31  DG  D N1    1 
ATOM 543  C C2    . DG  B 2 12 ? -6.186  5.726   -36.524 1.00 124.39 ? 31  DG  D C2    1 
ATOM 544  N N2    . DG  B 2 12 ? -7.170  6.567   -36.184 1.00 125.23 ? 31  DG  D N2    1 
ATOM 545  N N3    . DG  B 2 12 ? -6.313  4.427   -36.279 1.00 121.62 ? 31  DG  D N3    1 
ATOM 546  C C4    . DG  B 2 12 ? -5.226  3.731   -36.685 1.00 121.82 ? 31  DG  D C4    1 
ATOM 547  P P     . DT  B 2 13 ? -6.776  -2.087  -39.000 1.00 139.74 ? 32  DT  D P     1 
ATOM 548  O OP1   . DT  B 2 13 ? -7.308  -3.462  -39.127 1.00 153.12 ? 32  DT  D OP1   1 
ATOM 549  O OP2   . DT  B 2 13 ? -5.712  -1.650  -39.934 1.00 170.42 ? 32  DT  D OP2   1 
ATOM 550  O "O5'" . DT  B 2 13 ? -7.981  -1.034  -39.067 1.00 135.23 ? 32  DT  D "O5'" 1 
ATOM 551  C "C5'" . DT  B 2 13 ? -8.765  -0.918  -40.237 1.00 142.23 ? 32  DT  D "C5'" 1 
ATOM 552  C "C4'" . DT  B 2 13 ? -9.427  0.450   -40.318 1.00 150.39 ? 32  DT  D "C4'" 1 
ATOM 553  O "O4'" . DT  B 2 13 ? -8.646  1.442   -39.605 1.00 139.68 ? 32  DT  D "O4'" 1 
ATOM 554  C "C3'" . DT  B 2 13 ? -9.540  1.027   -41.711 1.00 146.18 ? 32  DT  D "C3'" 1 
ATOM 555  O "O3'" . DT  B 2 13 ? -10.634 0.470   -42.417 1.00 153.30 ? 32  DT  D "O3'" 1 
ATOM 556  C "C2'" . DT  B 2 13 ? -9.724  2.519   -41.431 1.00 131.84 ? 32  DT  D "C2'" 1 
ATOM 557  C "C1'" . DT  B 2 13 ? -8.997  2.732   -40.096 1.00 134.00 ? 32  DT  D "C1'" 1 
ATOM 558  N N1    . DT  B 2 13 ? -7.754  3.589   -40.215 1.00 130.91 ? 32  DT  D N1    1 
ATOM 559  C C2    . DT  B 2 13 ? -7.608  4.692   -39.395 1.00 138.19 ? 32  DT  D C2    1 
ATOM 560  O O2    . DT  B 2 13 ? -8.428  5.016   -38.550 1.00 150.81 ? 32  DT  D O2    1 
ATOM 561  N N3    . DT  B 2 13 ? -6.454  5.404   -39.593 1.00 132.77 ? 32  DT  D N3    1 
ATOM 562  C C4    . DT  B 2 13 ? -5.455  5.137   -40.510 1.00 128.57 ? 32  DT  D C4    1 
ATOM 563  O O4    . DT  B 2 13 ? -4.453  5.839   -40.613 1.00 123.81 ? 32  DT  D O4    1 
ATOM 564  C C5    . DT  B 2 13 ? -5.674  3.980   -41.344 1.00 125.29 ? 32  DT  D C5    1 
ATOM 565  C C7    . DT  B 2 13 ? -4.657  3.596   -42.373 1.00 126.47 ? 32  DT  D C7    1 
ATOM 566  C C6    . DT  B 2 13 ? -6.797  3.270   -41.162 1.00 124.60 ? 32  DT  D C6    1 
ATOM 567  P P     . DC  B 2 14 ? -10.677 0.564   -44.020 1.00 145.62 ? 33  DC  D P     1 
ATOM 568  O OP1   . DC  B 2 14 ? -11.943 -0.061  -44.459 1.00 135.01 ? 33  DC  D OP1   1 
ATOM 569  O OP2   . DC  B 2 14 ? -9.390  0.041   -44.530 1.00 129.82 ? 33  DC  D OP2   1 
ATOM 570  O "O5'" . DC  B 2 14 ? -10.734 2.139   -44.312 1.00 142.63 ? 33  DC  D "O5'" 1 
ATOM 571  C "C5'" . DC  B 2 14 ? -11.887 2.886   -43.944 1.00 141.89 ? 33  DC  D "C5'" 1 
ATOM 572  C "C4'" . DC  B 2 14 ? -11.731 4.359   -44.279 1.00 145.31 ? 33  DC  D "C4'" 1 
ATOM 573  O "O4'" . DC  B 2 14 ? -10.511 4.898   -43.658 1.00 138.23 ? 33  DC  D "O4'" 1 
ATOM 574  C "C3'" . DC  B 2 14 ? -11.586 4.670   -45.780 1.00 137.87 ? 33  DC  D "C3'" 1 
ATOM 575  O "O3'" . DC  B 2 14 ? -12.325 5.859   -46.130 1.00 135.21 ? 33  DC  D "O3'" 1 
ATOM 576  C "C2'" . DC  B 2 14 ? -10.090 4.870   -45.898 1.00 139.68 ? 33  DC  D "C2'" 1 
ATOM 577  C "C1'" . DC  B 2 14 ? -9.866  5.679   -44.641 1.00 132.80 ? 33  DC  D "C1'" 1 
ATOM 578  N N1    . DC  B 2 14 ? -8.420  5.961   -44.296 1.00 125.01 ? 33  DC  D N1    1 
ATOM 579  C C2    . DC  B 2 14 ? -8.080  6.415   -43.012 1.00 128.85 ? 33  DC  D C2    1 
ATOM 580  O O2    . DC  B 2 14 ? -8.965  6.534   -42.153 1.00 136.26 ? 33  DC  D O2    1 
ATOM 581  N N3    . DC  B 2 14 ? -6.780  6.693   -42.739 1.00 126.62 ? 33  DC  D N3    1 
ATOM 582  C C4    . DC  B 2 14 ? -5.848  6.558   -43.686 1.00 122.58 ? 33  DC  D C4    1 
ATOM 583  N N4    . DC  B 2 14 ? -4.581  6.847   -43.365 1.00 118.16 ? 33  DC  D N4    1 
ATOM 584  C C5    . DC  B 2 14 ? -6.173  6.122   -45.002 1.00 123.51 ? 33  DC  D C5    1 
ATOM 585  C C6    . DC  B 2 14 ? -7.457  5.849   -45.266 1.00 127.29 ? 33  DC  D C6    1 
ATOM 586  P P     . DA  B 2 15 ? -12.302 6.446   -47.631 1.00 133.43 ? 34  DA  D P     1 
ATOM 587  O OP1   . DA  B 2 15 ? -13.698 6.821   -47.949 1.00 132.66 ? 34  DA  D OP1   1 
ATOM 588  O OP2   . DA  B 2 15 ? -11.587 5.482   -48.499 1.00 138.27 ? 34  DA  D OP2   1 
ATOM 589  O "O5'" . DA  B 2 15 ? -11.435 7.803   -47.532 1.00 141.68 ? 34  DA  D "O5'" 1 
ATOM 590  C "C5'" . DA  B 2 15 ? -10.010 7.745   -47.411 1.00 148.21 ? 34  DA  D "C5'" 1 
ATOM 591  C "C4'" . DA  B 2 15 ? -9.359  9.110   -47.563 1.00 151.55 ? 34  DA  D "C4'" 1 
ATOM 592  O "O4'" . DA  B 2 15 ? -8.049  9.070   -46.936 1.00 145.17 ? 34  DA  D "O4'" 1 
ATOM 593  C "C3'" . DA  B 2 15 ? -9.118  9.558   -48.998 1.00 170.36 ? 34  DA  D "C3'" 1 
ATOM 594  O "O3'" . DA  B 2 15 ? -10.217 10.336  -49.479 1.00 200.66 ? 34  DA  D "O3'" 1 
ATOM 595  C "C2'" . DA  B 2 15 ? -7.830  10.373  -48.905 1.00 160.17 ? 34  DA  D "C2'" 1 
ATOM 596  C "C1'" . DA  B 2 15 ? -7.094  9.764   -47.719 1.00 151.63 ? 34  DA  D "C1'" 1 
ATOM 597  N N9    . DA  B 2 15 ? -6.036  8.835   -48.112 1.00 149.15 ? 34  DA  D N9    1 
ATOM 598  C C8    . DA  B 2 15 ? -6.045  7.472   -47.996 1.00 146.99 ? 34  DA  D C8    1 
ATOM 599  N N7    . DA  B 2 15 ? -4.954  6.897   -48.438 1.00 140.12 ? 34  DA  D N7    1 
ATOM 600  C C5    . DA  B 2 15 ? -4.177  7.958   -48.879 1.00 135.54 ? 34  DA  D C5    1 
ATOM 601  C C6    . DA  B 2 15 ? -2.897  8.020   -49.459 1.00 129.67 ? 34  DA  D C6    1 
ATOM 602  N N6    . DA  B 2 15 ? -2.151  6.950   -49.709 1.00 129.58 ? 34  DA  D N6    1 
ATOM 603  N N1    . DA  B 2 15 ? -2.414  9.234   -49.782 1.00 126.78 ? 34  DA  D N1    1 
ATOM 604  C C2    . DA  B 2 15 ? -3.163  10.311  -49.532 1.00 133.81 ? 34  DA  D C2    1 
ATOM 605  N N3    . DA  B 2 15 ? -4.379  10.382  -48.993 1.00 138.42 ? 34  DA  D N3    1 
ATOM 606  C C4    . DA  B 2 15 ? -4.831  9.158   -48.685 1.00 139.20 ? 34  DA  D C4    1 
ATOM 607  P P     . DA  B 2 16 ? -10.305 10.760  -51.028 1.00 217.76 ? 35  DA  D P     1 
ATOM 608  O OP1   . DA  B 2 16 ? -11.464 11.667  -51.171 1.00 217.59 ? 35  DA  D OP1   1 
ATOM 609  O OP2   . DA  B 2 16 ? -10.232 9.530   -51.846 1.00 211.98 ? 35  DA  D OP2   1 
ATOM 610  O "O5'" . DA  B 2 16 ? -8.975  11.612  -51.279 1.00 193.22 ? 35  DA  D "O5'" 1 
ATOM 611  C "C5'" . DA  B 2 16 ? -7.949  11.110  -52.129 1.00 177.92 ? 35  DA  D "C5'" 1 
ATOM 612  C "C4'" . DA  B 2 16 ? -6.705  11.966  -52.024 1.00 159.20 ? 35  DA  D "C4'" 1 
ATOM 613  O "O4'" . DA  B 2 16 ? -5.579  11.149  -51.625 1.00 145.28 ? 35  DA  D "O4'" 1 
ATOM 614  C "C3'" . DA  B 2 16 ? -6.254  12.616  -53.317 1.00 158.31 ? 35  DA  D "C3'" 1 
ATOM 615  O "O3'" . DA  B 2 16 ? -6.982  13.814  -53.588 1.00 162.53 ? 35  DA  D "O3'" 1 
ATOM 616  C "C2'" . DA  B 2 16 ? -4.787  12.879  -53.033 1.00 145.02 ? 35  DA  D "C2'" 1 
ATOM 617  C "C1'" . DA  B 2 16 ? -4.385  11.699  -52.160 1.00 137.59 ? 35  DA  D "C1'" 1 
ATOM 618  N N9    . DA  B 2 16 ? -3.675  10.664  -52.903 1.00 127.72 ? 35  DA  D N9    1 
ATOM 619  C C8    . DA  B 2 16 ? -4.223  9.699   -53.704 1.00 131.81 ? 35  DA  D C8    1 
ATOM 620  N N7    . DA  B 2 16 ? -3.337  8.908   -54.261 1.00 127.31 ? 35  DA  D N7    1 
ATOM 621  C C5    . DA  B 2 16 ? -2.124  9.392   -53.800 1.00 116.03 ? 35  DA  D C5    1 
ATOM 622  C C6    . DA  B 2 16 ? -0.795  8.988   -54.025 1.00 113.61 ? 35  DA  D C6    1 
ATOM 623  N N6    . DA  B 2 16 ? -0.461  7.962   -54.804 1.00 115.24 ? 35  DA  D N6    1 
ATOM 624  N N1    . DA  B 2 16 ? 0.182   9.682   -53.413 1.00 114.11 ? 35  DA  D N1    1 
ATOM 625  C C2    . DA  B 2 16 ? -0.152  10.713  -52.632 1.00 118.10 ? 35  DA  D C2    1 
ATOM 626  N N3    . DA  B 2 16 ? -1.362  11.190  -52.343 1.00 125.90 ? 35  DA  D N3    1 
ATOM 627  C C4    . DA  B 2 16 ? -2.314  10.477  -52.965 1.00 122.28 ? 35  DA  D C4    1 
ATOM 628  P P     . DC  B 2 17 ? -7.226  14.297  -55.104 1.00 173.91 ? 36  DC  D P     1 
ATOM 629  O OP1   . DC  B 2 17 ? -8.367  15.235  -55.065 1.00 175.78 ? 36  DC  D OP1   1 
ATOM 630  O OP2   . DC  B 2 17 ? -7.316  13.099  -55.967 1.00 150.72 ? 36  DC  D OP2   1 
ATOM 631  O "O5'" . DC  B 2 17 ? -5.908  15.144  -55.471 1.00 152.73 ? 36  DC  D "O5'" 1 
ATOM 632  C "C5'" . DC  B 2 17 ? -4.715  14.481  -55.904 1.00 142.72 ? 36  DC  D "C5'" 1 
ATOM 633  C "C4'" . DC  B 2 17 ? -3.498  14.950  -55.117 1.00 135.83 ? 36  DC  D "C4'" 1 
ATOM 634  O "O4'" . DC  B 2 17 ? -2.539  13.865  -55.024 1.00 130.03 ? 36  DC  D "O4'" 1 
ATOM 635  C "C3'" . DC  B 2 17 ? -2.720  16.099  -55.736 1.00 135.45 ? 36  DC  D "C3'" 1 
ATOM 636  O "O3'" . DC  B 2 17 ? -2.041  16.853  -54.732 1.00 141.00 ? 36  DC  D "O3'" 1 
ATOM 637  C "C2'" . DC  B 2 17 ? -1.753  15.382  -56.674 1.00 133.44 ? 36  DC  D "C2'" 1 
ATOM 638  C "C1'" . DC  B 2 17 ? -1.493  14.048  -55.964 1.00 133.36 ? 36  DC  D "C1'" 1 
ATOM 639  N N1    . DC  B 2 17 ? -1.470  12.860  -56.887 1.00 133.52 ? 36  DC  D N1    1 
ATOM 640  C C2    . DC  B 2 17 ? -0.248  12.382  -57.391 1.00 138.29 ? 36  DC  D C2    1 
ATOM 641  O O2    . DC  B 2 17 ? 0.808   12.946  -57.069 1.00 141.58 ? 36  DC  D O2    1 
ATOM 642  N N3    . DC  B 2 17 ? -0.258  11.308  -58.224 1.00 145.04 ? 36  DC  D N3    1 
ATOM 643  C C4    . DC  B 2 17 ? -1.416  10.726  -58.551 1.00 153.00 ? 36  DC  D C4    1 
ATOM 644  N N4    . DC  B 2 17 ? -1.378  9.669   -59.371 1.00 163.58 ? 36  DC  D N4    1 
ATOM 645  C C5    . DC  B 2 17 ? -2.663  11.197  -58.047 1.00 143.38 ? 36  DC  D C5    1 
ATOM 646  C C6    . DC  B 2 17 ? -2.642  12.253  -57.228 1.00 132.64 ? 36  DC  D C6    1 
ATOM 647  P P     . DG  C 3 1  ? 12.206  2.672   -56.027 1.00 112.34 ? 1   DG  E P     1 
ATOM 648  O OP1   . DG  C 3 1  ? 11.964  2.383   -57.454 1.00 138.99 ? 1   DG  E OP1   1 
ATOM 649  O OP2   . DG  C 3 1  ? 13.431  3.389   -55.623 1.00 118.74 ? 1   DG  E OP2   1 
ATOM 650  O "O5'" . DG  C 3 1  ? 10.971  3.478   -55.412 1.00 109.88 ? 1   DG  E "O5'" 1 
ATOM 651  C "C5'" . DG  C 3 1  ? 9.655   3.269   -55.906 1.00 113.99 ? 1   DG  E "C5'" 1 
ATOM 652  C "C4'" . DG  C 3 1  ? 8.709   4.352   -55.405 1.00 109.94 ? 1   DG  E "C4'" 1 
ATOM 653  O "O4'" . DG  C 3 1  ? 7.672   4.601   -56.383 1.00 109.88 ? 1   DG  E "O4'" 1 
ATOM 654  C "C3'" . DG  C 3 1  ? 7.934   4.021   -54.140 1.00 113.57 ? 1   DG  E "C3'" 1 
ATOM 655  O "O3'" . DG  C 3 1  ? 8.700   4.313   -52.940 1.00 123.77 ? 1   DG  E "O3'" 1 
ATOM 656  C "C2'" . DG  C 3 1  ? 6.696   4.916   -54.264 1.00 109.46 ? 1   DG  E "C2'" 1 
ATOM 657  C "C1'" . DG  C 3 1  ? 6.637   5.311   -55.737 1.00 109.27 ? 1   DG  E "C1'" 1 
ATOM 658  N N9    . DG  C 3 1  ? 5.338   5.019   -56.360 1.00 117.28 ? 1   DG  E N9    1 
ATOM 659  C C8    . DG  C 3 1  ? 4.990   3.925   -57.116 1.00 111.64 ? 1   DG  E C8    1 
ATOM 660  N N7    . DG  C 3 1  ? 3.752   3.944   -57.523 1.00 108.84 ? 1   DG  E N7    1 
ATOM 661  C C5    . DG  C 3 1  ? 3.240   5.120   -56.997 1.00 112.02 ? 1   DG  E C5    1 
ATOM 662  C C6    . DG  C 3 1  ? 1.944   5.679   -57.100 1.00 113.46 ? 1   DG  E C6    1 
ATOM 663  O O6    . DG  C 3 1  ? 0.956   5.230   -57.698 1.00 117.24 ? 1   DG  E O6    1 
ATOM 664  N N1    . DG  C 3 1  ? 1.852   6.887   -56.414 1.00 111.78 ? 1   DG  E N1    1 
ATOM 665  C C2    . DG  C 3 1  ? 2.879   7.475   -55.719 1.00 110.21 ? 1   DG  E C2    1 
ATOM 666  N N2    . DG  C 3 1  ? 2.602   8.639   -55.130 1.00 107.47 ? 1   DG  E N2    1 
ATOM 667  N N3    . DG  C 3 1  ? 4.096   6.964   -55.616 1.00 112.75 ? 1   DG  E N3    1 
ATOM 668  C C4    . DG  C 3 1  ? 4.204   5.791   -56.279 1.00 112.84 ? 1   DG  E C4    1 
ATOM 669  P P     . DT  C 3 2  ? 8.758   3.265   -51.712 1.00 121.13 ? 2   DT  E P     1 
ATOM 670  O OP1   . DT  C 3 2  ? 10.180  2.881   -51.578 1.00 113.54 ? 2   DT  E OP1   1 
ATOM 671  O OP2   . DT  C 3 2  ? 7.740   2.214   -51.916 1.00 116.52 ? 2   DT  E OP2   1 
ATOM 672  O "O5'" . DT  C 3 2  ? 8.347   4.117   -50.403 1.00 124.29 ? 2   DT  E "O5'" 1 
ATOM 673  C "C5'" . DT  C 3 2  ? 6.963   4.427   -50.109 1.00 116.52 ? 2   DT  E "C5'" 1 
ATOM 674  C "C4'" . DT  C 3 2  ? 6.433   5.454   -51.087 1.00 110.59 ? 2   DT  E "C4'" 1 
ATOM 675  O "O4'" . DT  C 3 2  ? 5.245   4.965   -51.763 1.00 116.08 ? 2   DT  E "O4'" 1 
ATOM 676  C "C3'" . DT  C 3 2  ? 5.963   6.766   -50.505 1.00 111.67 ? 2   DT  E "C3'" 1 
ATOM 677  O "O3'" . DT  C 3 2  ? 7.048   7.582   -50.073 1.00 107.60 ? 2   DT  E "O3'" 1 
ATOM 678  C "C2'" . DT  C 3 2  ? 5.230   7.336   -51.714 1.00 114.23 ? 2   DT  E "C2'" 1 
ATOM 679  C "C1'" . DT  C 3 2  ? 4.555   6.090   -52.309 1.00 110.67 ? 2   DT  E "C1'" 1 
ATOM 680  N N1    . DT  C 3 2  ? 3.083   5.980   -52.008 1.00 115.40 ? 2   DT  E N1    1 
ATOM 681  C C2    . DT  C 3 2  ? 2.250   5.363   -52.917 1.00 120.25 ? 2   DT  E C2    1 
ATOM 682  O O2    . DT  C 3 2  ? 2.640   4.880   -53.961 1.00 117.83 ? 2   DT  E O2    1 
ATOM 683  N N3    . DT  C 3 2  ? 0.932   5.324   -52.554 1.00 117.37 ? 2   DT  E N3    1 
ATOM 684  C C4    . DT  C 3 2  ? 0.372   5.831   -51.401 1.00 116.53 ? 2   DT  E C4    1 
ATOM 685  O O4    . DT  C 3 2  ? -0.830  5.745   -51.165 1.00 116.84 ? 2   DT  E O4    1 
ATOM 686  C C5    . DT  C 3 2  ? 1.295   6.472   -50.496 1.00 113.54 ? 2   DT  E C5    1 
ATOM 687  C C7    . DT  C 3 2  ? 0.807   7.054   -49.212 1.00 120.23 ? 2   DT  E C7    1 
ATOM 688  C C6    . DT  C 3 2  ? 2.589   6.513   -50.836 1.00 116.23 ? 2   DT  E C6    1 
ATOM 689  P P     . DT  C 3 3  ? 7.130   8.099   -48.554 1.00 111.90 ? 3   DT  E P     1 
ATOM 690  O OP1   . DT  C 3 3  ? 8.251   9.063   -48.475 1.00 110.19 ? 3   DT  E OP1   1 
ATOM 691  O OP2   . DT  C 3 3  ? 7.135   6.896   -47.696 1.00 138.43 ? 3   DT  E OP2   1 
ATOM 692  O "O5'" . DT  C 3 3  ? 5.741   8.867   -48.319 1.00 103.97 ? 3   DT  E "O5'" 1 
ATOM 693  C "C5'" . DT  C 3 3  ? 5.272   9.790   -49.281 1.00 105.77 ? 3   DT  E "C5'" 1 
ATOM 694  C "C4'" . DT  C 3 3  ? 4.195   10.711  -48.729 1.00 114.24 ? 3   DT  E "C4'" 1 
ATOM 695  O "O4'" . DT  C 3 3  ? 2.977   9.976   -48.432 1.00 115.88 ? 3   DT  E "O4'" 1 
ATOM 696  C "C3'" . DT  C 3 3  ? 4.559   11.446  -47.428 1.00 116.17 ? 3   DT  E "C3'" 1 
ATOM 697  O "O3'" . DT  C 3 3  ? 4.635   12.858  -47.685 1.00 139.46 ? 3   DT  E "O3'" 1 
ATOM 698  C "C2'" . DT  C 3 3  ? 3.427   11.056  -46.459 1.00 121.72 ? 3   DT  E "C2'" 1 
ATOM 699  C "C1'" . DT  C 3 3  ? 2.317   10.695  -47.423 1.00 121.59 ? 3   DT  E "C1'" 1 
ATOM 700  N N1    . DT  C 3 3  ? 1.181   9.874   -46.839 1.00 123.70 ? 3   DT  E N1    1 
ATOM 701  C C2    . DT  C 3 3  ? -0.122  10.232  -47.141 1.00 125.78 ? 3   DT  E C2    1 
ATOM 702  O O2    . DT  C 3 3  ? -0.408  11.176  -47.861 1.00 133.39 ? 3   DT  E O2    1 
ATOM 703  N N3    . DT  C 3 3  ? -1.084  9.443   -46.573 1.00 126.95 ? 3   DT  E N3    1 
ATOM 704  C C4    . DT  C 3 3  ? -0.888  8.354   -45.750 1.00 123.56 ? 3   DT  E C4    1 
ATOM 705  O O4    . DT  C 3 3  ? -1.823  7.702   -45.286 1.00 126.71 ? 3   DT  E O4    1 
ATOM 706  C C5    . DT  C 3 3  ? 0.492   8.031   -45.467 1.00 121.36 ? 3   DT  E C5    1 
ATOM 707  C C7    . DT  C 3 3  ? 0.817   6.868   -44.582 1.00 131.78 ? 3   DT  E C7    1 
ATOM 708  C C6    . DT  C 3 3  ? 1.453   8.794   -46.016 1.00 124.96 ? 3   DT  E C6    1 
ATOM 709  P P     . DG  C 3 4  ? 4.541   13.944  -46.503 1.00 166.75 ? 4   DG  E P     1 
ATOM 710  O OP1   . DG  C 3 4  ? 5.181   15.180  -47.006 1.00 154.22 ? 4   DG  E OP1   1 
ATOM 711  O OP2   . DG  C 3 4  ? 5.038   13.333  -45.250 1.00 150.90 ? 4   DG  E OP2   1 
ATOM 712  O "O5'" . DG  C 3 4  ? 2.965   14.208  -46.359 1.00 136.35 ? 4   DG  E "O5'" 1 
ATOM 713  C "C5'" . DG  C 3 4  ? 2.489   15.227  -45.477 1.00 128.61 ? 4   DG  E "C5'" 1 
ATOM 714  C "C4'" . DG  C 3 4  ? 0.996   15.462  -45.649 1.00 129.26 ? 4   DG  E "C4'" 1 
ATOM 715  O "O4'" . DG  C 3 4  ? 0.284   14.188  -45.553 1.00 130.10 ? 4   DG  E "O4'" 1 
ATOM 716  C "C3'" . DG  C 3 4  ? 0.358   16.350  -44.580 1.00 123.65 ? 4   DG  E "C3'" 1 
ATOM 717  O "O3'" . DG  C 3 4  ? -0.747  17.088  -45.126 1.00 123.92 ? 4   DG  E "O3'" 1 
ATOM 718  C "C2'" . DG  C 3 4  ? -0.075  15.316  -43.553 1.00 124.66 ? 4   DG  E "C2'" 1 
ATOM 719  C "C1'" . DG  C 3 4  ? -0.642  14.252  -44.476 1.00 125.66 ? 4   DG  E "C1'" 1 
ATOM 720  N N9    . DG  C 3 4  ? -0.803  12.923  -43.869 1.00 124.22 ? 4   DG  E N9    1 
ATOM 721  C C8    . DG  C 3 4  ? 0.013   12.327  -42.939 1.00 129.09 ? 4   DG  E C8    1 
ATOM 722  N N7    . DG  C 3 4  ? -0.390  11.142  -42.579 1.00 119.96 ? 4   DG  E N7    1 
ATOM 723  C C5    . DG  C 3 4  ? -1.541  10.935  -43.325 1.00 125.42 ? 4   DG  E C5    1 
ATOM 724  C C6    . DG  C 3 4  ? -2.419  9.828   -43.353 1.00 132.42 ? 4   DG  E C6    1 
ATOM 725  O O6    . DG  C 3 4  ? -2.342  8.767   -42.712 1.00 119.28 ? 4   DG  E O6    1 
ATOM 726  N N1    . DG  C 3 4  ? -3.469  10.027  -44.245 1.00 130.47 ? 4   DG  E N1    1 
ATOM 727  C C2    . DG  C 3 4  ? -3.650  11.159  -45.002 1.00 132.45 ? 4   DG  E C2    1 
ATOM 728  N N2    . DG  C 3 4  ? -4.721  11.167  -45.797 1.00 137.17 ? 4   DG  E N2    1 
ATOM 729  N N3    . DG  C 3 4  ? -2.838  12.205  -44.981 1.00 132.12 ? 4   DG  E N3    1 
ATOM 730  C C4    . DG  C 3 4  ? -1.810  12.024  -44.119 1.00 134.53 ? 4   DG  E C4    1 
ATOM 731  P P     . DA  C 3 5  ? -1.854  17.750  -44.163 1.00 129.43 ? 5   DA  E P     1 
ATOM 732  O OP1   . DA  C 3 5  ? -2.596  18.741  -44.970 1.00 131.07 ? 5   DA  E OP1   1 
ATOM 733  O OP2   . DA  C 3 5  ? -1.179  18.183  -42.917 1.00 120.61 ? 5   DA  E OP2   1 
ATOM 734  O "O5'" . DA  C 3 5  ? -2.849  16.537  -43.823 1.00 129.66 ? 5   DA  E "O5'" 1 
ATOM 735  C "C5'" . DA  C 3 5  ? -3.392  16.420  -42.515 1.00 123.12 ? 5   DA  E "C5'" 1 
ATOM 736  C "C4'" . DA  C 3 5  ? -4.601  15.495  -42.481 1.00 117.99 ? 5   DA  E "C4'" 1 
ATOM 737  O "O4'" . DA  C 3 5  ? -4.198  14.119  -42.675 1.00 120.07 ? 5   DA  E "O4'" 1 
ATOM 738  C "C3'" . DA  C 3 5  ? -5.353  15.460  -41.161 1.00 124.09 ? 5   DA  E "C3'" 1 
ATOM 739  O "O3'" . DA  C 3 5  ? -6.246  16.564  -41.039 1.00 113.60 ? 5   DA  E "O3'" 1 
ATOM 740  C "C2'" . DA  C 3 5  ? -6.085  14.123  -41.232 1.00 123.13 ? 5   DA  E "C2'" 1 
ATOM 741  C "C1'" . DA  C 3 5  ? -5.235  13.281  -42.186 1.00 123.24 ? 5   DA  E "C1'" 1 
ATOM 742  N N9    . DA  C 3 5  ? -4.658  12.107  -41.542 1.00 124.55 ? 5   DA  E N9    1 
ATOM 743  C C8    . DA  C 3 5  ? -3.399  11.969  -41.031 1.00 127.46 ? 5   DA  E C8    1 
ATOM 744  N N7    . DA  C 3 5  ? -3.170  10.788  -40.500 1.00 126.43 ? 5   DA  E N7    1 
ATOM 745  C C5    . DA  C 3 5  ? -4.368  10.115  -40.663 1.00 128.78 ? 5   DA  E C5    1 
ATOM 746  C C6    . DA  C 3 5  ? -4.787  8.818   -40.311 1.00 126.36 ? 5   DA  E C6    1 
ATOM 747  N N6    . DA  C 3 5  ? -4.006  7.933   -39.694 1.00 122.54 ? 5   DA  E N6    1 
ATOM 748  N N1    . DA  C 3 5  ? -6.050  8.462   -40.620 1.00 128.34 ? 5   DA  E N1    1 
ATOM 749  C C2    . DA  C 3 5  ? -6.837  9.347   -41.240 1.00 124.95 ? 5   DA  E C2    1 
ATOM 750  N N3    . DA  C 3 5  ? -6.559  10.589  -41.622 1.00 125.87 ? 5   DA  E N3    1 
ATOM 751  C C4    . DA  C 3 5  ? -5.296  10.915  -41.301 1.00 123.02 ? 5   DA  E C4    1 
ATOM 752  P P     . DC  C 3 6  ? -6.873  16.950  -39.611 1.00 108.34 ? 6   DC  E P     1 
ATOM 753  O OP1   . DC  C 3 6  ? -7.819  18.063  -39.830 1.00 136.22 ? 6   DC  E OP1   1 
ATOM 754  O OP2   . DC  C 3 6  ? -5.757  17.106  -38.652 1.00 107.75 ? 6   DC  E OP2   1 
ATOM 755  O "O5'" . DC  C 3 6  ? -7.697  15.650  -39.189 1.00 119.01 ? 6   DC  E "O5'" 1 
ATOM 756  C "C5'" . DC  C 3 6  ? -8.838  15.273  -39.921 1.00 126.72 ? 6   DC  E "C5'" 1 
ATOM 757  C "C4'" . DC  C 3 6  ? -9.304  13.874  -39.552 1.00 131.50 ? 6   DC  E "C4'" 1 
ATOM 758  O "O4'" . DC  C 3 6  ? -8.193  13.019  -39.204 1.00 124.84 ? 6   DC  E "O4'" 1 
ATOM 759  C "C3'" . DC  C 3 6  ? -10.193 13.795  -38.332 1.00 138.62 ? 6   DC  E "C3'" 1 
ATOM 760  O "O3'" . DC  C 3 6  ? -11.535 14.123  -38.672 1.00 154.67 ? 6   DC  E "O3'" 1 
ATOM 761  C "C2'" . DC  C 3 6  ? -10.024 12.331  -37.880 1.00 132.82 ? 6   DC  E "C2'" 1 
ATOM 762  C "C1'" . DC  C 3 6  ? -8.739  11.868  -38.585 1.00 124.04 ? 6   DC  E "C1'" 1 
ATOM 763  N N1    . DC  C 3 6  ? -7.733  11.226  -37.657 1.00 125.65 ? 6   DC  E N1    1 
ATOM 764  C C2    . DC  C 3 6  ? -8.052  9.993   -37.063 1.00 122.44 ? 6   DC  E C2    1 
ATOM 765  O O2    . DC  C 3 6  ? -9.148  9.469   -37.308 1.00 122.40 ? 6   DC  E O2    1 
ATOM 766  N N3    . DC  C 3 6  ? -7.156  9.406   -36.234 1.00 119.45 ? 6   DC  E N3    1 
ATOM 767  C C4    . DC  C 3 6  ? -5.990  9.992   -35.988 1.00 117.64 ? 6   DC  E C4    1 
ATOM 768  N N4    . DC  C 3 6  ? -5.148  9.369   -35.157 1.00 108.15 ? 6   DC  E N4    1 
ATOM 769  C C5    . DC  C 3 6  ? -5.635  11.245  -36.580 1.00 117.12 ? 6   DC  E C5    1 
ATOM 770  C C6    . DC  C 3 6  ? -6.527  11.822  -37.404 1.00 119.23 ? 6   DC  E C6    1 
ATOM 771  P P     . DA  C 3 7  ? -12.686 14.090  -37.555 1.00 185.37 ? 7   DA  E P     1 
ATOM 772  O OP1   . DA  C 3 7  ? -13.864 14.790  -38.113 1.00 205.17 ? 7   DA  E OP1   1 
ATOM 773  O OP2   . DA  C 3 7  ? -12.099 14.565  -36.281 1.00 170.42 ? 7   DA  E OP2   1 
ATOM 774  O "O5'" . DA  C 3 7  ? -13.018 12.531  -37.417 1.00 162.37 ? 7   DA  E "O5'" 1 
ATOM 775  C "C5'" . DA  C 3 7  ? -13.567 12.023  -36.213 1.00 152.90 ? 7   DA  E "C5'" 1 
ATOM 776  C "C4'" . DA  C 3 7  ? -13.419 10.515  -36.148 1.00 157.38 ? 7   DA  E "C4'" 1 
ATOM 777  O "O4'" . DA  C 3 7  ? -12.028 10.161  -36.374 1.00 152.70 ? 7   DA  E "O4'" 1 
ATOM 778  C "C3'" . DA  C 3 7  ? -13.827 9.899   -34.811 1.00 150.57 ? 7   DA  E "C3'" 1 
ATOM 779  O "O3'" . DA  C 3 7  ? -15.091 9.246   -34.927 1.00 154.08 ? 7   DA  E "O3'" 1 
ATOM 780  C "C2'" . DA  C 3 7  ? -12.706 8.917   -34.480 1.00 137.79 ? 7   DA  E "C2'" 1 
ATOM 781  C "C1'" . DA  C 3 7  ? -11.516 9.402   -35.299 1.00 138.59 ? 7   DA  E "C1'" 1 
ATOM 782  N N9    . DA  C 3 7  ? -10.566 10.238  -34.561 1.00 137.72 ? 7   DA  E N9    1 
ATOM 783  C C8    . DA  C 3 7  ? -10.669 11.580  -34.307 1.00 141.98 ? 7   DA  E C8    1 
ATOM 784  N N7    . DA  C 3 7  ? -9.652  12.074  -33.637 1.00 144.67 ? 7   DA  E N7    1 
ATOM 785  C C5    . DA  C 3 7  ? -8.818  10.984  -33.446 1.00 126.94 ? 7   DA  E C5    1 
ATOM 786  C C6    . DA  C 3 7  ? -7.570  10.842  -32.802 1.00 118.92 ? 7   DA  E C6    1 
ATOM 787  N N6    . DA  C 3 7  ? -6.922  11.849  -32.209 1.00 122.28 ? 7   DA  E N6    1 
ATOM 788  N N1    . DA  C 3 7  ? -7.010  9.617   -32.794 1.00 115.11 ? 7   DA  E N1    1 
ATOM 789  C C2    . DA  C 3 7  ? -7.656  8.607   -33.389 1.00 114.92 ? 7   DA  E C2    1 
ATOM 790  N N3    . DA  C 3 7  ? -8.829  8.615   -34.019 1.00 121.43 ? 7   DA  E N3    1 
ATOM 791  C C4    . DA  C 3 7  ? -9.363  9.845   -34.014 1.00 123.88 ? 7   DA  E C4    1 
ATOM 792  P P     . DG  C 3 8  ? -15.967 8.903   -33.622 1.00 158.56 ? 8   DG  E P     1 
ATOM 793  O OP1   . DG  C 3 8  ? -17.018 7.955   -34.048 1.00 134.07 ? 8   DG  E OP1   1 
ATOM 794  O OP2   . DG  C 3 8  ? -16.373 10.186  -33.010 1.00 160.72 ? 8   DG  E OP2   1 
ATOM 795  O "O5'" . DG  C 3 8  ? -14.929 8.181   -32.636 1.00 162.09 ? 8   DG  E "O5'" 1 
ATOM 796  C "C5'" . DG  C 3 8  ? -15.291 6.989   -31.923 1.00 175.33 ? 8   DG  E "C5'" 1 
ATOM 797  C "C4'" . DG  C 3 8  ? -14.251 5.909   -32.136 1.00 161.51 ? 8   DG  E "C4'" 1 
ATOM 798  O "O4'" . DG  C 3 8  ? -13.055 6.516   -32.698 1.00 148.96 ? 8   DG  E "O4'" 1 
ATOM 799  C "C3'" . DG  C 3 8  ? -13.803 5.175   -30.868 1.00 161.85 ? 8   DG  E "C3'" 1 
ATOM 800  O "O3'" . DG  C 3 8  ? -14.474 3.921   -30.733 1.00 165.30 ? 8   DG  E "O3'" 1 
ATOM 801  C "C2'" . DG  C 3 8  ? -12.305 5.012   -31.079 1.00 150.51 ? 8   DG  E "C2'" 1 
ATOM 802  C "C1'" . DG  C 3 8  ? -11.950 6.259   -31.869 1.00 140.53 ? 8   DG  E "C1'" 1 
ATOM 803  N N9    . DG  C 3 8  ? -11.701 7.446   -31.049 1.00 129.78 ? 8   DG  E N9    1 
ATOM 804  C C8    . DG  C 3 8  ? -12.632 8.327   -30.552 1.00 128.70 ? 8   DG  E C8    1 
ATOM 805  N N7    . DG  C 3 8  ? -12.109 9.304   -29.862 1.00 123.04 ? 8   DG  E N7    1 
ATOM 806  C C5    . DG  C 3 8  ? -10.744 9.055   -29.913 1.00 115.24 ? 8   DG  E C5    1 
ATOM 807  C C6    . DG  C 3 8  ? -9.663  9.772   -29.349 1.00 113.83 ? 8   DG  E C6    1 
ATOM 808  O O6    . DG  C 3 8  ? -9.694  10.809  -28.667 1.00 113.90 ? 8   DG  E O6    1 
ATOM 809  N N1    . DG  C 3 8  ? -8.446  9.174   -29.645 1.00 104.83 ? 8   DG  E N1    1 
ATOM 810  C C2    . DG  C 3 8  ? -8.292  8.032   -30.390 1.00 106.78 ? 8   DG  E C2    1 
ATOM 811  N N2    . DG  C 3 8  ? -7.044  7.605   -30.563 1.00 114.44 ? 8   DG  E N2    1 
ATOM 812  N N3    . DG  C 3 8  ? -9.290  7.350   -30.920 1.00 117.77 ? 8   DG  E N3    1 
ATOM 813  C C4    . DG  C 3 8  ? -10.482 7.917   -30.643 1.00 119.27 ? 8   DG  E C4    1 
ATOM 814  P P     . DG  C 3 9  ? -14.361 3.088   -29.362 1.00 155.12 ? 9   DG  E P     1 
ATOM 815  O OP1   . DG  C 3 9  ? -15.212 1.886   -29.481 1.00 165.15 ? 9   DG  E OP1   1 
ATOM 816  O OP2   . DG  C 3 9  ? -14.589 4.032   -28.244 1.00 157.65 ? 9   DG  E OP2   1 
ATOM 817  O "O5'" . DG  C 3 9  ? -12.833 2.617   -29.329 1.00 144.01 ? 9   DG  E "O5'" 1 
ATOM 818  C "C5'" . DG  C 3 9  ? -11.997 2.995   -28.249 1.00 136.75 ? 9   DG  E "C5'" 1 
ATOM 819  C "C4'" . DG  C 3 9  ? -10.687 2.234   -28.289 1.00 120.22 ? 9   DG  E "C4'" 1 
ATOM 820  O "O4'" . DG  C 3 9  ? -9.642  3.122   -28.770 1.00 113.66 ? 9   DG  E "O4'" 1 
ATOM 821  C "C3'" . DG  C 3 9  ? -10.193 1.734   -26.940 1.00 116.55 ? 9   DG  E "C3'" 1 
ATOM 822  O "O3'" . DG  C 3 9  ? -9.380  0.563   -27.092 1.00 113.49 ? 9   DG  E "O3'" 1 
ATOM 823  C "C2'" . DG  C 3 9  ? -9.407  2.930   -26.425 1.00 116.42 ? 9   DG  E "C2'" 1 
ATOM 824  C "C1'" . DG  C 3 9  ? -8.785  3.489   -27.702 1.00 113.84 ? 9   DG  E "C1'" 1 
ATOM 825  N N9    . DG  C 3 9  ? -8.638  4.947   -27.683 1.00 106.23 ? 9   DG  E N9    1 
ATOM 826  C C8    . DG  C 3 9  ? -9.632  5.884   -27.834 1.00 112.00 ? 9   DG  E C8    1 
ATOM 827  N N7    . DG  C 3 9  ? -9.207  7.112   -27.750 1.00 109.90 ? 9   DG  E N7    1 
ATOM 828  C C5    . DG  C 3 9  ? -7.847  6.986   -27.524 1.00 111.63 ? 9   DG  E C5    1 
ATOM 829  C C6    . DG  C 3 9  ? -6.859  7.982   -27.356 1.00 104.32 ? 9   DG  E C6    1 
ATOM 830  O O6    . DG  C 3 9  ? -6.996  9.214   -27.371 1.00 103.35 ? 9   DG  E O6    1 
ATOM 831  N N1    . DG  C 3 9  ? -5.603  7.428   -27.156 1.00 102.17 ? 9   DG  E N1    1 
ATOM 832  C C2    . DG  C 3 9  ? -5.335  6.083   -27.125 1.00 98.78  ? 9   DG  E C2    1 
ATOM 833  N N2    . DG  C 3 9  ? -4.062  5.746   -26.914 1.00 107.33 ? 9   DG  E N2    1 
ATOM 834  N N3    . DG  C 3 9  ? -6.249  5.137   -27.280 1.00 110.78 ? 9   DG  E N3    1 
ATOM 835  C C4    . DG  C 3 9  ? -7.479  5.661   -27.479 1.00 93.34  ? 9   DG  E C4    1 
ATOM 836  P P     . DA  C 3 10 ? -8.632  -0.081  -25.823 1.00 121.86 ? 10  DA  E P     1 
ATOM 837  O OP1   . DA  C 3 10 ? -8.470  -1.528  -26.081 1.00 128.39 ? 10  DA  E OP1   1 
ATOM 838  O OP2   . DA  C 3 10 ? -9.343  0.357   -24.598 1.00 133.76 ? 10  DA  E OP2   1 
ATOM 839  O "O5'" . DA  C 3 10 ? -7.174  0.584   -25.864 1.00 117.66 ? 10  DA  E "O5'" 1 
ATOM 840  C "C5'" . DA  C 3 10 ? -6.614  1.124   -24.676 1.00 116.49 ? 10  DA  E "C5'" 1 
ATOM 841  C "C4'" . DA  C 3 10 ? -5.125  1.383   -24.822 1.00 117.98 ? 10  DA  E "C4'" 1 
ATOM 842  O "O4'" . DA  C 3 10 ? -4.911  2.778   -25.164 1.00 108.97 ? 10  DA  E "O4'" 1 
ATOM 843  C "C3'" . DA  C 3 10 ? -4.322  1.168   -23.551 1.00 125.68 ? 10  DA  E "C3'" 1 
ATOM 844  O "O3'" . DA  C 3 10 ? -2.958  0.849   -23.849 1.00 133.26 ? 10  DA  E "O3'" 1 
ATOM 845  C "C2'" . DA  C 3 10 ? -4.479  2.515   -22.839 1.00 123.11 ? 10  DA  E "C2'" 1 
ATOM 846  C "C1'" . DA  C 3 10 ? -4.572  3.519   -24.000 1.00 112.27 ? 10  DA  E "C1'" 1 
ATOM 847  N N9    . DA  C 3 10 ? -5.582  4.575   -23.812 1.00 117.74 ? 10  DA  E N9    1 
ATOM 848  C C8    . DA  C 3 10 ? -6.897  4.410   -23.460 1.00 111.12 ? 10  DA  E C8    1 
ATOM 849  N N7    . DA  C 3 10 ? -7.572  5.534   -23.377 1.00 107.40 ? 10  DA  E N7    1 
ATOM 850  C C5    . DA  C 3 10 ? -6.645  6.509   -23.703 1.00 101.94 ? 10  DA  E C5    1 
ATOM 851  C C6    . DA  C 3 10 ? -6.737  7.918   -23.799 1.00 108.09 ? 10  DA  E C6    1 
ATOM 852  N N6    . DA  C 3 10 ? -7.856  8.609   -23.562 1.00 110.59 ? 10  DA  E N6    1 
ATOM 853  N N1    . DA  C 3 10 ? -5.629  8.593   -24.145 1.00 104.73 ? 10  DA  E N1    1 
ATOM 854  C C2    . DA  C 3 10 ? -4.507  7.912   -24.389 1.00 104.91 ? 10  DA  E C2    1 
ATOM 855  N N3    . DA  C 3 10 ? -4.290  6.595   -24.330 1.00 101.56 ? 10  DA  E N3    1 
ATOM 856  C C4    . DA  C 3 10 ? -5.412  5.941   -23.977 1.00 106.21 ? 10  DA  E C4    1 
ATOM 857  P P     . DT  C 3 11 ? -1.901  0.598   -22.662 1.00 138.68 ? 11  DT  E P     1 
ATOM 858  O OP1   . DT  C 3 11 ? -0.796  -0.209  -23.220 1.00 151.37 ? 11  DT  E OP1   1 
ATOM 859  O OP2   . DT  C 3 11 ? -2.630  0.097   -21.472 1.00 137.23 ? 11  DT  E OP2   1 
ATOM 860  O "O5'" . DT  C 3 11 ? -1.327  2.063   -22.364 1.00 128.75 ? 11  DT  E "O5'" 1 
ATOM 861  C "C5'" . DT  C 3 11 ? -1.328  2.578   -21.043 1.00 125.08 ? 11  DT  E "C5'" 1 
ATOM 862  C "C4'" . DT  C 3 11 ? -0.916  4.042   -21.032 1.00 119.82 ? 11  DT  E "C4'" 1 
ATOM 863  O "O4'" . DT  C 3 11 ? -1.974  4.864   -21.598 1.00 117.28 ? 11  DT  E "O4'" 1 
ATOM 864  C "C3'" . DT  C 3 11 ? -0.696  4.642   -19.659 1.00 121.33 ? 11  DT  E "C3'" 1 
ATOM 865  O "O3'" . DT  C 3 11 ? 0.593   4.246   -19.056 1.00 121.93 ? 11  DT  E "O3'" 1 
ATOM 866  C "C2'" . DT  C 3 11 ? -0.829  6.136   -19.956 1.00 117.52 ? 11  DT  E "C2'" 1 
ATOM 867  C "C1'" . DT  C 3 11 ? -1.934  6.169   -21.012 1.00 111.51 ? 11  DT  E "C1'" 1 
ATOM 868  N N1    . DT  C 3 11 ? -3.297  6.508   -20.451 1.00 112.60 ? 11  DT  E N1    1 
ATOM 869  C C2    . DT  C 3 11 ? -3.982  7.614   -20.920 1.00 108.69 ? 11  DT  E C2    1 
ATOM 870  O O2    . DT  C 3 11 ? -3.552  8.349   -21.783 1.00 102.82 ? 11  DT  E O2    1 
ATOM 871  N N3    . DT  C 3 11 ? -5.204  7.826   -20.335 1.00 110.23 ? 11  DT  E N3    1 
ATOM 872  C C4    . DT  C 3 11 ? -5.797  7.067   -19.344 1.00 115.07 ? 11  DT  E C4    1 
ATOM 873  O O4    . DT  C 3 11 ? -6.900  7.338   -18.880 1.00 127.09 ? 11  DT  E O4    1 
ATOM 874  C C5    . DT  C 3 11 ? -5.026  5.932   -18.893 1.00 116.10 ? 11  DT  E C5    1 
ATOM 875  C C7    . DT  C 3 11 ? -5.559  5.032   -17.823 1.00 122.92 ? 11  DT  E C7    1 
ATOM 876  C C6    . DT  C 3 11 ? -3.829  5.711   -19.458 1.00 114.66 ? 11  DT  E C6    1 
ATOM 877  P P     . DA  C 3 12 ? 2.025   4.444   -19.771 1.00 124.87 ? 12  DA  E P     1 
ATOM 878  O OP1   . DA  C 3 12 ? 2.062   3.807   -21.098 1.00 136.78 ? 12  DA  E OP1   1 
ATOM 879  O OP2   . DA  C 3 12 ? 3.042   4.045   -18.785 1.00 133.14 ? 12  DA  E OP2   1 
ATOM 880  O "O5'" . DA  C 3 12 ? 2.183   6.016   -19.897 1.00 115.73 ? 12  DA  E "O5'" 1 
ATOM 881  C "C5'" . DA  C 3 12 ? 2.044   6.815   -18.746 1.00 115.24 ? 12  DA  E "C5'" 1 
ATOM 882  C "C4'" . DA  C 3 12 ? 2.104   8.285   -19.087 1.00 111.58 ? 12  DA  E "C4'" 1 
ATOM 883  O "O4'" . DA  C 3 12 ? 0.790   8.721   -19.539 1.00 108.73 ? 12  DA  E "O4'" 1 
ATOM 884  C "C3'" . DA  C 3 12 ? 2.492   9.184   -17.919 1.00 114.22 ? 12  DA  E "C3'" 1 
ATOM 885  O "O3'" . DA  C 3 12 ? 3.835   9.621   -18.051 1.00 125.21 ? 12  DA  E "O3'" 1 
ATOM 886  C "C2'" . DA  C 3 12 ? 1.498   10.346  -17.977 1.00 113.07 ? 12  DA  E "C2'" 1 
ATOM 887  C "C1'" . DA  C 3 12 ? 0.317   9.813   -18.777 1.00 109.24 ? 12  DA  E "C1'" 1 
ATOM 888  N N9    . DA  C 3 12 ? -0.785  9.357   -17.928 1.00 111.86 ? 12  DA  E N9    1 
ATOM 889  C C8    . DA  C 3 12 ? -0.733  8.332   -17.027 1.00 122.98 ? 12  DA  E C8    1 
ATOM 890  N N7    . DA  C 3 12 ? -1.854  8.131   -16.381 1.00 126.47 ? 12  DA  E N7    1 
ATOM 891  C C5    . DA  C 3 12 ? -2.711  9.095   -16.880 1.00 116.92 ? 12  DA  E C5    1 
ATOM 892  C C6    . DA  C 3 12 ? -4.061  9.407   -16.595 1.00 118.95 ? 12  DA  E C6    1 
ATOM 893  N N6    . DA  C 3 12 ? -4.803  8.748   -15.693 1.00 122.57 ? 12  DA  E N6    1 
ATOM 894  N N1    . DA  C 3 12 ? -4.621  10.428  -17.272 1.00 117.59 ? 12  DA  E N1    1 
ATOM 895  C C2    . DA  C 3 12 ? -3.883  11.088  -18.167 1.00 116.56 ? 12  DA  E C2    1 
ATOM 896  N N3    . DA  C 3 12 ? -2.607  10.890  -18.523 1.00 113.32 ? 12  DA  E N3    1 
ATOM 897  C C4    . DA  C 3 12 ? -2.072  9.869   -17.837 1.00 114.36 ? 12  DA  E C4    1 
ATOM 898  P P     . DA  C 3 13 ? 4.639   10.195  -16.784 1.00 123.28 ? 13  DA  E P     1 
ATOM 899  O OP1   . DA  C 3 13 ? 5.332   11.427  -17.208 1.00 126.06 ? 13  DA  E OP1   1 
ATOM 900  O OP2   . DA  C 3 13 ? 5.445   9.080   -16.248 1.00 126.07 ? 13  DA  E OP2   1 
ATOM 901  O "O5'" . DA  C 3 13 ? 3.486   10.589  -15.745 1.00 125.62 ? 13  DA  E "O5'" 1 
ATOM 902  C "C5'" . DA  C 3 13 ? 3.583   11.801  -14.990 1.00 134.71 ? 13  DA  E "C5'" 1 
ATOM 903  C "C4'" . DA  C 3 13 ? 2.837   12.947  -15.667 1.00 125.61 ? 13  DA  E "C4'" 1 
ATOM 904  O "O4'" . DA  C 3 13 ? 1.506   12.519  -16.036 1.00 124.71 ? 13  DA  E "O4'" 1 
ATOM 905  C "C3'" . DA  C 3 13 ? 2.627   14.165  -14.791 1.00 133.17 ? 13  DA  E "C3'" 1 
ATOM 906  O "O3'" . DA  C 3 13 ? 3.732   15.050  -14.887 1.00 147.60 ? 13  DA  E "O3'" 1 
ATOM 907  C "C2'" . DA  C 3 13 ? 1.335   14.781  -15.333 1.00 129.76 ? 13  DA  E "C2'" 1 
ATOM 908  C "C1'" . DA  C 3 13 ? 0.583   13.589  -15.927 1.00 123.94 ? 13  DA  E "C1'" 1 
ATOM 909  N N9    . DA  C 3 13 ? -0.553  13.131  -15.120 1.00 122.81 ? 13  DA  E N9    1 
ATOM 910  C C8    . DA  C 3 13 ? -0.503  12.369  -13.981 1.00 124.32 ? 13  DA  E C8    1 
ATOM 911  N N7    . DA  C 3 13 ? -1.682  12.096  -13.473 1.00 120.90 ? 13  DA  E N7    1 
ATOM 912  C C5    . DA  C 3 13 ? -2.567  12.714  -14.341 1.00 123.27 ? 13  DA  E C5    1 
ATOM 913  C C6    . DA  C 3 13 ? -3.973  12.802  -14.362 1.00 125.35 ? 13  DA  E C6    1 
ATOM 914  N N6    . DA  C 3 13 ? -4.765  12.235  -13.450 1.00 122.71 ? 13  DA  E N6    1 
ATOM 915  N N1    . DA  C 3 13 ? -4.538  13.491  -15.369 1.00 122.96 ? 13  DA  E N1    1 
ATOM 916  C C2    . DA  C 3 13 ? -3.753  14.056  -16.284 1.00 119.97 ? 13  DA  E C2    1 
ATOM 917  N N3    . DA  C 3 13 ? -2.425  14.047  -16.375 1.00 117.48 ? 13  DA  E N3    1 
ATOM 918  C C4    . DA  C 3 13 ? -1.887  13.352  -15.364 1.00 126.53 ? 13  DA  E C4    1 
ATOM 919  P P     . DT  C 3 14 ? 4.174   15.931  -13.618 1.00 158.51 ? 14  DT  E P     1 
ATOM 920  O OP1   . DT  C 3 14 ? 5.562   16.370  -13.847 1.00 149.92 ? 14  DT  E OP1   1 
ATOM 921  O OP2   . DT  C 3 14 ? 3.868   15.167  -12.390 1.00 171.93 ? 14  DT  E OP2   1 
ATOM 922  O "O5'" . DT  C 3 14 ? 3.210   17.206  -13.678 1.00 144.27 ? 14  DT  E "O5'" 1 
ATOM 923  C "C5'" . DT  C 3 14 ? 2.039   17.251  -12.876 1.00 142.63 ? 14  DT  E "C5'" 1 
ATOM 924  C "C4'" . DT  C 3 14 ? 1.044   18.247  -13.432 1.00 133.12 ? 14  DT  E "C4'" 1 
ATOM 925  O "O4'" . DT  C 3 14 ? -0.045  17.538  -14.090 1.00 124.36 ? 14  DT  E "O4'" 1 
ATOM 926  C "C3'" . DT  C 3 14 ? 0.352   19.116  -12.401 1.00 141.81 ? 14  DT  E "C3'" 1 
ATOM 927  O "O3'" . DT  C 3 14 ? 1.145   20.219  -12.014 1.00 144.65 ? 14  DT  E "O3'" 1 
ATOM 928  C "C2'" . DT  C 3 14 ? -0.891  19.525  -13.161 1.00 131.18 ? 14  DT  E "C2'" 1 
ATOM 929  C "C1'" . DT  C 3 14 ? -1.268  18.226  -13.854 1.00 126.44 ? 14  DT  E "C1'" 1 
ATOM 930  N N1    . DT  C 3 14 ? -2.170  17.352  -13.032 1.00 131.16 ? 14  DT  E N1    1 
ATOM 931  C C2    . DT  C 3 14 ? -3.534  17.391  -13.240 1.00 135.16 ? 14  DT  E C2    1 
ATOM 932  O O2    . DT  C 3 14 ? -4.065  18.099  -14.076 1.00 123.57 ? 14  DT  E O2    1 
ATOM 933  N N3    . DT  C 3 14 ? -4.262  16.557  -12.428 1.00 136.98 ? 14  DT  E N3    1 
ATOM 934  C C4    . DT  C 3 14 ? -3.774  15.711  -11.452 1.00 141.71 ? 14  DT  E C4    1 
ATOM 935  O O4    . DT  C 3 14 ? -4.503  15.002  -10.770 1.00 143.13 ? 14  DT  E O4    1 
ATOM 936  C C5    . DT  C 3 14 ? -2.350  15.726  -11.281 1.00 142.05 ? 14  DT  E C5    1 
ATOM 937  C C7    . DT  C 3 14 ? -1.723  14.854  -10.251 1.00 157.70 ? 14  DT  E C7    1 
ATOM 938  C C6    . DT  C 3 14 ? -1.619  16.531  -12.064 1.00 137.51 ? 14  DT  E C6    1 
ATOM 939  P P     . DT  C 3 15 ? 1.025   20.794  -10.519 1.00 139.75 ? 15  DT  E P     1 
ATOM 940  O OP1   . DT  C 3 15 ? 1.634   22.141  -10.518 1.00 135.83 ? 15  DT  E OP1   1 
ATOM 941  O OP2   . DT  C 3 15 ? 1.546   19.755  -9.603  1.00 145.55 ? 15  DT  E OP2   1 
ATOM 942  O "O5'" . DT  C 3 15 ? -0.558  20.920  -10.278 1.00 139.72 ? 15  DT  E "O5'" 1 
ATOM 943  C "C5'" . DT  C 3 15 ? -1.302  21.930  -10.948 1.00 140.86 ? 15  DT  E "C5'" 1 
ATOM 944  C "C4'" . DT  C 3 15 ? -2.801  21.752  -10.753 1.00 141.27 ? 15  DT  E "C4'" 1 
ATOM 945  O "O4'" . DT  C 3 15 ? -3.184  20.375  -11.012 1.00 141.51 ? 15  DT  E "O4'" 1 
ATOM 946  C "C3'" . DT  C 3 15 ? -3.312  22.007  -9.354  1.00 142.47 ? 15  DT  E "C3'" 1 
ATOM 947  O "O3'" . DT  C 3 15 ? -3.440  23.413  -9.086  1.00 159.71 ? 15  DT  E "O3'" 1 
ATOM 948  C "C2'" . DT  C 3 15 ? -4.650  21.280  -9.392  1.00 137.37 ? 15  DT  E "C2'" 1 
ATOM 949  C "C1'" . DT  C 3 15 ? -4.346  20.060  -10.257 1.00 138.74 ? 15  DT  E "C1'" 1 
ATOM 950  N N1    . DT  C 3 15 ? -4.094  18.824  -9.449  1.00 144.47 ? 15  DT  E N1    1 
ATOM 951  C C2    . DT  C 3 15 ? -5.017  17.802  -9.458  1.00 143.91 ? 15  DT  E C2    1 
ATOM 952  O O2    . DT  C 3 15 ? -6.036  17.828  -10.119 1.00 140.49 ? 15  DT  E O2    1 
ATOM 953  N N3    . DT  C 3 15 ? -4.688  16.726  -8.673  1.00 145.59 ? 15  DT  E N3    1 
ATOM 954  C C4    . DT  C 3 15 ? -3.561  16.579  -7.886  1.00 148.11 ? 15  DT  E C4    1 
ATOM 955  O O4    . DT  C 3 15 ? -3.359  15.574  -7.211  1.00 156.01 ? 15  DT  E O4    1 
ATOM 956  C C5    . DT  C 3 15 ? -2.643  17.691  -7.910  1.00 144.76 ? 15  DT  E C5    1 
ATOM 957  C C7    . DT  C 3 15 ? -1.385  17.651  -7.096  1.00 159.32 ? 15  DT  E C7    1 
ATOM 958  C C6    . DT  C 3 15 ? -2.952  18.749  -8.677  1.00 141.92 ? 15  DT  E C6    1 
ATOM 959  P P     . DG  C 3 16 ? -3.129  24.004  -7.620  1.00 155.97 ? 16  DG  E P     1 
ATOM 960  O OP1   . DG  C 3 16 ? -2.554  25.353  -7.803  1.00 162.14 ? 16  DG  E OP1   1 
ATOM 961  O OP2   . DG  C 3 16 ? -2.385  22.993  -6.832  1.00 150.73 ? 16  DG  E OP2   1 
ATOM 962  O "O5'" . DG  C 3 16 ? -4.575  24.148  -6.957  1.00 152.04 ? 16  DG  E "O5'" 1 
ATOM 963  C "C5'" . DG  C 3 16 ? -5.440  23.039  -6.965  1.00 151.32 ? 16  DG  E "C5'" 1 
ATOM 964  C "C4'" . DG  C 3 16 ? -6.489  23.127  -5.881  1.00 164.23 ? 16  DG  E "C4'" 1 
ATOM 965  O "O4'" . DG  C 3 16 ? -7.212  21.867  -5.837  1.00 164.47 ? 16  DG  E "O4'" 1 
ATOM 966  C "C3'" . DG  C 3 16 ? -5.937  23.340  -4.479  1.00 174.05 ? 16  DG  E "C3'" 1 
ATOM 967  O "O3'" . DG  C 3 16 ? -6.828  24.160  -3.662  1.00 192.89 ? 16  DG  E "O3'" 1 
ATOM 968  C "C2'" . DG  C 3 16 ? -5.750  21.914  -3.955  1.00 168.03 ? 16  DG  E "C2'" 1 
ATOM 969  C "C1'" . DG  C 3 16 ? -6.813  21.100  -4.713  1.00 164.64 ? 16  DG  E "C1'" 1 
ATOM 970  N N9    . DG  C 3 16 ? -6.363  19.775  -5.186  1.00 153.47 ? 16  DG  E N9    1 
ATOM 971  C C8    . DG  C 3 16 ? -5.075  19.282  -5.223  1.00 148.51 ? 16  DG  E C8    1 
ATOM 972  N N7    . DG  C 3 16 ? -4.993  18.066  -5.694  1.00 144.53 ? 16  DG  E N7    1 
ATOM 973  C C5    . DG  C 3 16 ? -6.301  17.725  -5.994  1.00 140.31 ? 16  DG  E C5    1 
ATOM 974  C C6    . DG  C 3 16 ? -6.829  16.526  -6.535  1.00 134.41 ? 16  DG  E C6    1 
ATOM 975  O O6    . DG  C 3 16 ? -6.220  15.499  -6.869  1.00 131.66 ? 16  DG  E O6    1 
ATOM 976  N N1    . DG  C 3 16 ? -8.211  16.590  -6.681  1.00 134.18 ? 16  DG  E N1    1 
ATOM 977  C C2    . DG  C 3 16 ? -8.986  17.671  -6.349  1.00 141.71 ? 16  DG  E C2    1 
ATOM 978  N N2    . DG  C 3 16 ? -10.301 17.545  -6.569  1.00 145.78 ? 16  DG  E N2    1 
ATOM 979  N N3    . DG  C 3 16 ? -8.509  18.802  -5.839  1.00 146.65 ? 16  DG  E N3    1 
ATOM 980  C C4    . DG  C 3 16 ? -7.160  18.760  -5.689  1.00 145.16 ? 16  DG  E C4    1 
ATOM 981  P P     . DT  C 3 17 ? -8.324  23.703  -3.273  1.00 223.43 ? 17  DT  E P     1 
ATOM 982  O OP1   . DT  C 3 17 ? -9.029  23.245  -4.488  1.00 207.62 ? 17  DT  E OP1   1 
ATOM 983  O OP2   . DT  C 3 17 ? -8.913  24.821  -2.502  1.00 204.97 ? 17  DT  E OP2   1 
ATOM 984  O "O5'" . DT  C 3 17 ? -8.118  22.481  -2.259  1.00 185.96 ? 17  DT  E "O5'" 1 
ATOM 985  C "C5'" . DT  C 3 17 ? -9.212  21.992  -1.473  1.00 193.43 ? 17  DT  E "C5'" 1 
ATOM 986  C "C4'" . DT  C 3 17 ? -10.359 21.528  -2.352  1.00 172.15 ? 17  DT  E "C4'" 1 
ATOM 987  O "O4'" . DT  C 3 17 ? -9.896  20.475  -3.238  1.00 160.09 ? 17  DT  E "O4'" 1 
ATOM 988  C "C3'" . DT  C 3 17 ? -11.534 20.913  -1.615  1.00 162.43 ? 17  DT  E "C3'" 1 
ATOM 989  O "O3'" . DT  C 3 17 ? -12.428 21.913  -1.127  1.00 164.70 ? 17  DT  E "O3'" 1 
ATOM 990  C "C2'" . DT  C 3 17 ? -12.162 20.049  -2.698  1.00 150.29 ? 17  DT  E "C2'" 1 
ATOM 991  C "C1'" . DT  C 3 17 ? -10.954 19.561  -3.496  1.00 149.49 ? 17  DT  E "C1'" 1 
ATOM 992  N N1    . DT  C 3 17 ? -10.504 18.168  -3.130  1.00 136.51 ? 17  DT  E N1    1 
ATOM 993  C C2    . DT  C 3 17 ? -11.198 17.078  -3.618  1.00 130.00 ? 17  DT  E C2    1 
ATOM 994  O O2    . DT  C 3 17 ? -12.169 17.176  -4.344  1.00 139.38 ? 17  DT  E O2    1 
ATOM 995  N N3    . DT  C 3 17 ? -10.704 15.858  -3.229  1.00 132.63 ? 17  DT  E N3    1 
ATOM 996  C C4    . DT  C 3 17 ? -9.612  15.622  -2.416  1.00 128.26 ? 17  DT  E C4    1 
ATOM 997  O O4    . DT  C 3 17 ? -9.245  14.487  -2.121  1.00 123.63 ? 17  DT  E O4    1 
ATOM 998  C C5    . DT  C 3 17 ? -8.933  16.803  -1.938  1.00 129.41 ? 17  DT  E C5    1 
ATOM 999  C C7    . DT  C 3 17 ? -7.741  16.671  -1.050  1.00 126.96 ? 17  DT  E C7    1 
ATOM 1000 C C6    . DT  C 3 17 ? -9.403  18.004  -2.310  1.00 136.36 ? 17  DT  E C6    1 
ATOM 1001 P P     . DT  C 3 18 ? -13.285 21.666  0.213   1.00 182.33 ? 18  DT  E P     1 
ATOM 1002 O OP1   . DT  C 3 18 ? -14.547 22.420  0.050   1.00 177.38 ? 18  DT  E OP1   1 
ATOM 1003 O OP2   . DT  C 3 18 ? -12.407 21.966  1.364   1.00 171.28 ? 18  DT  E OP2   1 
ATOM 1004 O "O5'" . DT  C 3 18 ? -13.604 20.091  0.206   1.00 153.34 ? 18  DT  E "O5'" 1 
ATOM 1005 C "C5'" . DT  C 3 18 ? -14.650 19.573  -0.620  1.00 142.72 ? 18  DT  E "C5'" 1 
ATOM 1006 C "C4'" . DT  C 3 18 ? -14.570 18.055  -0.741  1.00 133.20 ? 18  DT  E "C4'" 1 
ATOM 1007 O "O4'" . DT  C 3 18 ? -13.180 17.626  -0.640  1.00 133.98 ? 18  DT  E "O4'" 1 
ATOM 1008 C "C3'" . DT  C 3 18 ? -15.338 17.274  0.334   1.00 140.03 ? 18  DT  E "C3'" 1 
ATOM 1009 O "O3'" . DT  C 3 18 ? -16.169 16.284  -0.264  1.00 151.98 ? 18  DT  E "O3'" 1 
ATOM 1010 C "C2'" . DT  C 3 18 ? -14.240 16.660  1.205   1.00 149.78 ? 18  DT  E "C2'" 1 
ATOM 1011 C "C1'" . DT  C 3 18 ? -13.080 16.521  0.231   1.00 140.28 ? 18  DT  E "C1'" 1 
ATOM 1012 N N1    . DT  C 3 18 ? -11.707 16.531  0.881   1.00 139.78 ? 18  DT  E N1    1 
ATOM 1013 C C2    . DT  C 3 18 ? -10.848 15.465  0.678   1.00 139.42 ? 18  DT  E C2    1 
ATOM 1014 O O2    . DT  C 3 18 ? -11.132 14.494  -0.003  1.00 146.22 ? 18  DT  E O2    1 
ATOM 1015 N N3    . DT  C 3 18 ? -9.635  15.576  1.307   1.00 138.23 ? 18  DT  E N3    1 
ATOM 1016 C C4    . DT  C 3 18 ? -9.200  16.617  2.099   1.00 130.78 ? 18  DT  E C4    1 
ATOM 1017 O O4    . DT  C 3 18 ? -8.089  16.626  2.621   1.00 127.93 ? 18  DT  E O4    1 
ATOM 1018 C C5    . DT  C 3 18 ? -10.141 17.697  2.268   1.00 129.88 ? 18  DT  E C5    1 
ATOM 1019 C C7    . DT  C 3 18 ? -9.775  18.878  3.105   1.00 116.06 ? 18  DT  E C7    1 
ATOM 1020 C C6    . DT  C 3 18 ? -11.334 17.607  1.660   1.00 138.51 ? 18  DT  E C6    1 
ATOM 1021 P P     . DT  D 4 2  ? -26.553 -18.028 -52.482 1.00 113.86 ? 2   DT  L P     1 
ATOM 1022 O OP1   . DT  D 4 2  ? -25.192 -18.468 -52.118 1.00 104.21 ? 2   DT  L OP1   1 
ATOM 1023 O OP2   . DT  D 4 2  ? -27.529 -19.021 -52.970 1.00 106.80 ? 2   DT  L OP2   1 
ATOM 1024 O "O5'" . DT  D 4 2  ? -27.181 -17.255 -51.229 1.00 117.33 ? 2   DT  L "O5'" 1 
ATOM 1025 C "C5'" . DT  D 4 2  ? -28.029 -16.115 -51.415 1.00 122.13 ? 2   DT  L "C5'" 1 
ATOM 1026 C "C4'" . DT  D 4 2  ? -27.456 -15.156 -52.439 1.00 126.71 ? 2   DT  L "C4'" 1 
ATOM 1027 O "O4'" . DT  D 4 2  ? -28.047 -15.451 -53.738 1.00 130.20 ? 2   DT  L "O4'" 1 
ATOM 1028 C "C3'" . DT  D 4 2  ? -27.746 -13.676 -52.164 1.00 126.58 ? 2   DT  L "C3'" 1 
ATOM 1029 O "O3'" . DT  D 4 2  ? -26.615 -13.026 -51.580 1.00 120.74 ? 2   DT  L "O3'" 1 
ATOM 1030 C "C2'" . DT  D 4 2  ? -28.089 -13.128 -53.547 1.00 123.65 ? 2   DT  L "C2'" 1 
ATOM 1031 C "C1'" . DT  D 4 2  ? -28.766 -14.327 -54.200 1.00 130.52 ? 2   DT  L "C1'" 1 
ATOM 1032 N N1    . DT  D 4 2  ? -30.234 -14.511 -53.840 1.00 133.51 ? 2   DT  L N1    1 
ATOM 1033 C C2    . DT  D 4 2  ? -30.986 -15.451 -54.520 1.00 131.02 ? 2   DT  L C2    1 
ATOM 1034 O O2    . DT  D 4 2  ? -30.536 -16.151 -55.412 1.00 142.29 ? 2   DT  L O2    1 
ATOM 1035 N N3    . DT  D 4 2  ? -32.295 -15.541 -54.114 1.00 128.11 ? 2   DT  L N3    1 
ATOM 1036 C C4    . DT  D 4 2  ? -32.912 -14.802 -53.118 1.00 146.97 ? 2   DT  L C4    1 
ATOM 1037 O O4    . DT  D 4 2  ? -34.096 -14.954 -52.822 1.00 144.75 ? 2   DT  L O4    1 
ATOM 1038 C C5    . DT  D 4 2  ? -32.065 -13.841 -52.447 1.00 156.29 ? 2   DT  L C5    1 
ATOM 1039 C C7    . DT  D 4 2  ? -32.615 -12.979 -51.349 1.00 154.12 ? 2   DT  L C7    1 
ATOM 1040 C C6    . DT  D 4 2  ? -30.791 -13.743 -52.833 1.00 148.76 ? 2   DT  L C6    1 
ATOM 1041 P P     . DT  D 4 3  ? -26.627 -12.617 -50.023 1.00 134.11 ? 3   DT  L P     1 
ATOM 1042 O OP1   . DT  D 4 3  ? -25.323 -11.994 -49.691 1.00 134.52 ? 3   DT  L OP1   1 
ATOM 1043 O OP2   . DT  D 4 3  ? -27.098 -13.792 -49.258 1.00 134.23 ? 3   DT  L OP2   1 
ATOM 1044 O "O5'" . DT  D 4 3  ? -27.765 -11.499 -49.914 1.00 128.06 ? 3   DT  L "O5'" 1 
ATOM 1045 C "C5'" . DT  D 4 3  ? -27.747 -10.597 -48.817 1.00 130.19 ? 3   DT  L "C5'" 1 
ATOM 1046 C "C4'" . DT  D 4 3  ? -29.027 -9.786  -48.741 1.00 134.47 ? 3   DT  L "C4'" 1 
ATOM 1047 O "O4'" . DT  D 4 3  ? -30.159 -10.660 -48.465 1.00 141.42 ? 3   DT  L "O4'" 1 
ATOM 1048 C "C3'" . DT  D 4 3  ? -29.042 -8.725  -47.624 1.00 137.29 ? 3   DT  L "C3'" 1 
ATOM 1049 O "O3'" . DT  D 4 3  ? -29.216 -7.407  -48.155 1.00 143.50 ? 3   DT  L "O3'" 1 
ATOM 1050 C "C2'" . DT  D 4 3  ? -30.211 -9.142  -46.733 1.00 148.22 ? 3   DT  L "C2'" 1 
ATOM 1051 C "C1'" . DT  D 4 3  ? -31.076 -9.922  -47.694 1.00 144.91 ? 3   DT  L "C1'" 1 
ATOM 1052 N N1    . DT  D 4 3  ? -32.067 -10.822 -47.025 1.00 148.05 ? 3   DT  L N1    1 
ATOM 1053 C C2    . DT  D 4 3  ? -33.256 -10.275 -46.604 1.00 143.03 ? 3   DT  L C2    1 
ATOM 1054 O O2    . DT  D 4 3  ? -33.541 -9.101  -46.759 1.00 138.21 ? 3   DT  L O2    1 
ATOM 1055 N N3    . DT  D 4 3  ? -34.107 -11.150 -45.995 1.00 144.48 ? 3   DT  L N3    1 
ATOM 1056 C C4    . DT  D 4 3  ? -33.901 -12.495 -45.766 1.00 146.29 ? 3   DT  L C4    1 
ATOM 1057 O O4    . DT  D 4 3  ? -34.736 -13.199 -45.209 1.00 146.62 ? 3   DT  L O4    1 
ATOM 1058 C C5    . DT  D 4 3  ? -32.634 -13.015 -46.225 1.00 149.88 ? 3   DT  L C5    1 
ATOM 1059 C C7    . DT  D 4 3  ? -32.301 -14.465 -46.024 1.00 136.26 ? 3   DT  L C7    1 
ATOM 1060 C C6    . DT  D 4 3  ? -31.780 -12.165 -46.826 1.00 152.32 ? 3   DT  L C6    1 
ATOM 1061 P P     . DG  D 4 4  ? -29.283 -6.141  -47.162 1.00 175.69 ? 4   DG  L P     1 
ATOM 1062 O OP1   . DG  D 4 4  ? -28.827 -4.947  -47.912 1.00 157.90 ? 4   DG  L OP1   1 
ATOM 1063 O OP2   . DG  D 4 4  ? -28.594 -6.520  -45.908 1.00 158.66 ? 4   DG  L OP2   1 
ATOM 1064 O "O5'" . DG  D 4 4  ? -30.845 -5.994  -46.828 1.00 150.39 ? 4   DG  L "O5'" 1 
ATOM 1065 C "C5'" . DG  D 4 4  ? -31.265 -5.509  -45.545 1.00 141.96 ? 4   DG  L "C5'" 1 
ATOM 1066 C "C4'" . DG  D 4 4  ? -32.771 -5.302  -45.498 1.00 139.63 ? 4   DG  L "C4'" 1 
ATOM 1067 O "O4'" . DG  D 4 4  ? -33.442 -6.600  -45.477 1.00 141.62 ? 4   DG  L "O4'" 1 
ATOM 1068 C "C3'" . DG  D 4 4  ? -33.277 -4.549  -44.260 1.00 143.57 ? 4   DG  L "C3'" 1 
ATOM 1069 O "O3'" . DG  D 4 4  ? -34.239 -3.552  -44.616 1.00 144.64 ? 4   DG  L "O3'" 1 
ATOM 1070 C "C2'" . DG  D 4 4  ? -33.885 -5.649  -43.403 1.00 143.19 ? 4   DG  L "C2'" 1 
ATOM 1071 C "C1'" . DG  D 4 4  ? -34.419 -6.603  -44.456 1.00 142.22 ? 4   DG  L "C1'" 1 
ATOM 1072 N N9    . DG  D 4 4  ? -34.630 -7.973  -43.973 1.00 142.87 ? 4   DG  L N9    1 
ATOM 1073 C C8    . DG  D 4 4  ? -33.804 -8.696  -43.147 1.00 143.26 ? 4   DG  L C8    1 
ATOM 1074 N N7    . DG  D 4 4  ? -34.256 -9.885  -42.868 1.00 137.15 ? 4   DG  L N7    1 
ATOM 1075 C C5    . DG  D 4 4  ? -35.459 -9.959  -43.544 1.00 144.77 ? 4   DG  L C5    1 
ATOM 1076 C C6    . DG  D 4 4  ? -36.392 -11.015 -43.616 1.00 147.81 ? 4   DG  L C6    1 
ATOM 1077 O O6    . DG  D 4 4  ? -36.334 -12.127 -43.072 1.00 148.29 ? 4   DG  L O6    1 
ATOM 1078 N N1    . DG  D 4 4  ? -37.483 -10.686 -44.415 1.00 146.10 ? 4   DG  L N1    1 
ATOM 1079 C C2    . DG  D 4 4  ? -37.649 -9.484  -45.060 1.00 146.68 ? 4   DG  L C2    1 
ATOM 1080 N N2    . DG  D 4 4  ? -38.766 -9.353  -45.785 1.00 146.46 ? 4   DG  L N2    1 
ATOM 1081 N N3    . DG  D 4 4  ? -36.779 -8.484  -45.005 1.00 148.84 ? 4   DG  L N3    1 
ATOM 1082 C C4    . DG  D 4 4  ? -35.708 -8.793  -44.234 1.00 147.52 ? 4   DG  L C4    1 
ATOM 1083 P P     . DA  D 4 5  ? -34.864 -2.593  -43.485 1.00 134.90 ? 5   DA  L P     1 
ATOM 1084 O OP1   . DA  D 4 5  ? -35.149 -1.283  -44.110 1.00 126.70 ? 5   DA  L OP1   1 
ATOM 1085 O OP2   . DA  D 4 5  ? -33.976 -2.661  -42.301 1.00 135.31 ? 5   DA  L OP2   1 
ATOM 1086 O "O5'" . DA  D 4 5  ? -36.257 -3.290  -43.102 1.00 157.18 ? 5   DA  L "O5'" 1 
ATOM 1087 C "C5'" . DA  D 4 5  ? -36.810 -3.100  -41.798 1.00 164.47 ? 5   DA  L "C5'" 1 
ATOM 1088 C "C4'" . DA  D 4 5  ? -38.325 -3.264  -41.802 1.00 164.20 ? 5   DA  L "C4'" 1 
ATOM 1089 O "O4'" . DA  D 4 5  ? -38.692 -4.348  -42.699 1.00 170.32 ? 5   DA  L "O4'" 1 
ATOM 1090 C "C3'" . DA  D 4 5  ? -38.946 -3.587  -40.435 1.00 167.51 ? 5   DA  L "C3'" 1 
ATOM 1091 O "O3'" . DA  D 4 5  ? -39.708 -2.469  -39.957 1.00 155.82 ? 5   DA  L "O3'" 1 
ATOM 1092 C "C2'" . DA  D 4 5  ? -39.827 -4.813  -40.688 1.00 170.84 ? 5   DA  L "C2'" 1 
ATOM 1093 C "C1'" . DA  D 4 5  ? -39.275 -5.410  -41.977 1.00 170.27 ? 5   DA  L "C1'" 1 
ATOM 1094 N N9    . DA  D 4 5  ? -38.262 -6.438  -41.755 1.00 162.50 ? 5   DA  L N9    1 
ATOM 1095 C C8    . DA  D 4 5  ? -36.921 -6.342  -42.002 1.00 159.99 ? 5   DA  L C8    1 
ATOM 1096 N N7    . DA  D 4 5  ? -36.245 -7.420  -41.688 1.00 158.03 ? 5   DA  L N7    1 
ATOM 1097 C C5    . DA  D 4 5  ? -37.209 -8.287  -41.205 1.00 150.84 ? 5   DA  L C5    1 
ATOM 1098 C C6    . DA  D 4 5  ? -37.140 -9.602  -40.709 1.00 140.91 ? 5   DA  L C6    1 
ATOM 1099 N N6    . DA  D 4 5  ? -36.005 -10.295 -40.613 1.00 135.31 ? 5   DA  L N6    1 
ATOM 1100 N N1    . DA  D 4 5  ? -38.286 -10.177 -40.306 1.00 141.79 ? 5   DA  L N1    1 
ATOM 1101 C C2    . DA  D 4 5  ? -39.422 -9.481  -40.397 1.00 143.88 ? 5   DA  L C2    1 
ATOM 1102 N N3    . DA  D 4 5  ? -39.615 -8.243  -40.841 1.00 154.62 ? 5   DA  L N3    1 
ATOM 1103 C C4    . DA  D 4 5  ? -38.458 -7.696  -41.236 1.00 156.89 ? 5   DA  L C4    1 
ATOM 1104 P P     . DC  D 4 6  ? -40.134 -2.357  -38.410 1.00 167.20 ? 6   DC  L P     1 
ATOM 1105 O OP1   . DC  D 4 6  ? -40.829 -1.062  -38.246 1.00 186.56 ? 6   DC  L OP1   1 
ATOM 1106 O OP2   . DC  D 4 6  ? -38.948 -2.660  -37.579 1.00 170.63 ? 6   DC  L OP2   1 
ATOM 1107 O "O5'" . DC  D 4 6  ? -41.195 -3.540  -38.211 1.00 172.46 ? 6   DC  L "O5'" 1 
ATOM 1108 C "C5'" . DC  D 4 6  ? -42.433 -3.521  -38.911 1.00 178.72 ? 6   DC  L "C5'" 1 
ATOM 1109 C "C4'" . DC  D 4 6  ? -43.205 -4.819  -38.707 1.00 164.08 ? 6   DC  L "C4'" 1 
ATOM 1110 O "O4'" . DC  D 4 6  ? -42.376 -5.961  -39.027 1.00 161.72 ? 6   DC  L "O4'" 1 
ATOM 1111 C "C3'" . DC  D 4 6  ? -43.647 -5.096  -37.286 1.00 163.90 ? 6   DC  L "C3'" 1 
ATOM 1112 O "O3'" . DC  D 4 6  ? -44.831 -4.366  -36.964 1.00 167.02 ? 6   DC  L "O3'" 1 
ATOM 1113 C "C2'" . DC  D 4 6  ? -43.871 -6.612  -37.300 1.00 163.46 ? 6   DC  L "C2'" 1 
ATOM 1114 C "C1'" . DC  D 4 6  ? -42.950 -7.113  -38.421 1.00 161.44 ? 6   DC  L "C1'" 1 
ATOM 1115 N N1    . DC  D 4 6  ? -41.869 -8.039  -37.935 1.00 157.71 ? 6   DC  L N1    1 
ATOM 1116 C C2    . DC  D 4 6  ? -42.207 -9.347  -37.562 1.00 154.26 ? 6   DC  L C2    1 
ATOM 1117 O O2    . DC  D 4 6  ? -43.388 -9.711  -37.640 1.00 157.69 ? 6   DC  L O2    1 
ATOM 1118 N N3    . DC  D 4 6  ? -41.231 -10.180 -37.122 1.00 154.94 ? 6   DC  L N3    1 
ATOM 1119 C C4    . DC  D 4 6  ? -39.969 -9.753  -37.050 1.00 152.87 ? 6   DC  L C4    1 
ATOM 1120 N N4    . DC  D 4 6  ? -39.042 -10.613 -36.607 1.00 153.35 ? 6   DC  L N4    1 
ATOM 1121 C C5    . DC  D 4 6  ? -39.602 -8.425  -37.423 1.00 149.96 ? 6   DC  L C5    1 
ATOM 1122 C C6    . DC  D 4 6  ? -40.573 -7.610  -37.859 1.00 156.26 ? 6   DC  L C6    1 
ATOM 1123 P P     . DA  D 4 7  ? -45.569 -4.597  -35.555 1.00 189.08 ? 7   DA  L P     1 
ATOM 1124 O OP1   . DA  D 4 7  ? -46.559 -3.510  -35.388 1.00 209.72 ? 7   DA  L OP1   1 
ATOM 1125 O OP2   . DA  D 4 7  ? -44.531 -4.803  -34.519 1.00 170.23 ? 7   DA  L OP2   1 
ATOM 1126 O "O5'" . DA  D 4 7  ? -46.352 -5.974  -35.762 1.00 173.12 ? 7   DA  L "O5'" 1 
ATOM 1127 C "C5'" . DA  D 4 7  ? -46.713 -6.767  -34.645 1.00 167.92 ? 7   DA  L "C5'" 1 
ATOM 1128 C "C4'" . DA  D 4 7  ? -47.077 -8.168  -35.089 1.00 161.90 ? 7   DA  L "C4'" 1 
ATOM 1129 O "O4'" . DA  D 4 7  ? -45.928 -8.745  -35.757 1.00 155.11 ? 7   DA  L "O4'" 1 
ATOM 1130 C "C3'" . DA  D 4 7  ? -47.482 -9.115  -33.958 1.00 155.02 ? 7   DA  L "C3'" 1 
ATOM 1131 O "O3'" . DA  D 4 7  ? -48.855 -9.531  -34.113 1.00 162.67 ? 7   DA  L "O3'" 1 
ATOM 1132 C "C2'" . DA  D 4 7  ? -46.508 -10.291 -34.050 1.00 147.15 ? 7   DA  L "C2'" 1 
ATOM 1133 C "C1'" . DA  D 4 7  ? -45.497 -9.926  -35.130 1.00 146.12 ? 7   DA  L "C1'" 1 
ATOM 1134 N N9    . DA  D 4 7  ? -44.138 -9.718  -34.614 1.00 136.51 ? 7   DA  L N9    1 
ATOM 1135 C C8    . DA  D 4 7  ? -43.655 -8.609  -33.977 1.00 138.93 ? 7   DA  L C8    1 
ATOM 1136 N N7    . DA  D 4 7  ? -42.393 -8.706  -33.624 1.00 141.07 ? 7   DA  L N7    1 
ATOM 1137 C C5    . DA  D 4 7  ? -42.018 -9.967  -34.057 1.00 134.66 ? 7   DA  L C5    1 
ATOM 1138 C C6    . DA  D 4 7  ? -40.799 -10.676 -33.985 1.00 135.44 ? 7   DA  L C6    1 
ATOM 1139 N N6    . DA  D 4 7  ? -39.690 -10.189 -33.419 1.00 130.45 ? 7   DA  L N6    1 
ATOM 1140 N N1    . DA  D 4 7  ? -40.765 -11.912 -34.516 1.00 141.22 ? 7   DA  L N1    1 
ATOM 1141 C C2    . DA  D 4 7  ? -41.875 -12.406 -35.078 1.00 148.04 ? 7   DA  L C2    1 
ATOM 1142 N N3    . DA  D 4 7  ? -43.075 -11.840 -35.208 1.00 147.06 ? 7   DA  L N3    1 
ATOM 1143 C C4    . DA  D 4 7  ? -43.081 -10.608 -34.669 1.00 139.47 ? 7   DA  L C4    1 
ATOM 1144 P P     . DG  D 4 8  ? -49.444 -10.812 -33.328 1.00 161.64 ? 8   DG  L P     1 
ATOM 1145 O OP1   . DG  D 4 8  ? -49.398 -11.965 -34.255 1.00 172.64 ? 8   DG  L OP1   1 
ATOM 1146 O OP2   . DG  D 4 8  ? -50.751 -10.399 -32.768 1.00 184.07 ? 8   DG  L OP2   1 
ATOM 1147 O "O5'" . DG  D 4 8  ? -48.416 -11.065 -32.119 1.00 154.32 ? 8   DG  L "O5'" 1 
ATOM 1148 C "C5'" . DG  D 4 8  ? -48.386 -12.339 -31.442 1.00 173.06 ? 8   DG  L "C5'" 1 
ATOM 1149 C "C4'" . DG  D 4 8  ? -47.507 -13.342 -32.179 1.00 173.48 ? 8   DG  L "C4'" 1 
ATOM 1150 O "O4'" . DG  D 4 8  ? -46.297 -12.679 -32.622 1.00 148.42 ? 8   DG  L "O4'" 1 
ATOM 1151 C "C3'" . DG  D 4 8  ? -47.061 -14.537 -31.340 1.00 179.21 ? 8   DG  L "C3'" 1 
ATOM 1152 O "O3'" . DG  D 4 8  ? -47.830 -15.691 -31.658 1.00 190.83 ? 8   DG  L "O3'" 1 
ATOM 1153 C "C2'" . DG  D 4 8  ? -45.584 -14.715 -31.695 1.00 163.57 ? 8   DG  L "C2'" 1 
ATOM 1154 C "C1'" . DG  D 4 8  ? -45.148 -13.325 -32.126 1.00 143.81 ? 8   DG  L "C1'" 1 
ATOM 1155 N N9    . DG  D 4 8  ? -44.581 -12.492 -31.056 1.00 131.08 ? 8   DG  L N9    1 
ATOM 1156 C C8    . DG  D 4 8  ? -45.276 -11.694 -30.180 1.00 120.75 ? 8   DG  L C8    1 
ATOM 1157 N N7    . DG  D 4 8  ? -44.517 -11.044 -29.348 1.00 117.21 ? 8   DG  L N7    1 
ATOM 1158 C C5    . DG  D 4 8  ? -43.232 -11.419 -29.695 1.00 108.57 ? 8   DG  L C5    1 
ATOM 1159 C C6    . DG  D 4 8  ? -41.996 -11.029 -29.139 1.00 110.91 ? 8   DG  L C6    1 
ATOM 1160 O O6    . DG  D 4 8  ? -41.791 -10.250 -28.199 1.00 102.94 ? 8   DG  L O6    1 
ATOM 1161 N N1    . DG  D 4 8  ? -40.927 -11.643 -29.784 1.00 114.85 ? 8   DG  L N1    1 
ATOM 1162 C C2    . DG  D 4 8  ? -41.044 -12.520 -30.835 1.00 117.57 ? 8   DG  L C2    1 
ATOM 1163 N N2    . DG  D 4 8  ? -39.900 -13.005 -31.321 1.00 122.25 ? 8   DG  L N2    1 
ATOM 1164 N N3    . DG  D 4 8  ? -42.198 -12.895 -31.369 1.00 119.71 ? 8   DG  L N3    1 
ATOM 1165 C C4    . DG  D 4 8  ? -43.248 -12.307 -30.751 1.00 120.44 ? 8   DG  L C4    1 
ATOM 1166 P P     . DG  D 4 9  ? -48.349 -16.669 -30.493 1.00 212.25 ? 9   DG  L P     1 
ATOM 1167 O OP1   . DG  D 4 9  ? -49.165 -17.724 -31.133 1.00 232.96 ? 9   DG  L OP1   1 
ATOM 1168 O OP2   . DG  D 4 9  ? -48.938 -15.832 -29.424 1.00 216.14 ? 9   DG  L OP2   1 
ATOM 1169 O "O5'" . DG  D 4 9  ? -47.013 -17.329 -29.914 1.00 165.66 ? 9   DG  L "O5'" 1 
ATOM 1170 C "C5'" . DG  D 4 9  ? -46.244 -16.644 -28.932 1.00 144.33 ? 9   DG  L "C5'" 1 
ATOM 1171 C "C4'" . DG  D 4 9  ? -44.923 -17.343 -28.697 1.00 128.07 ? 9   DG  L "C4'" 1 
ATOM 1172 O "O4'" . DG  D 4 9  ? -43.836 -16.368 -28.743 1.00 118.50 ? 9   DG  L "O4'" 1 
ATOM 1173 C "C3'" . DG  D 4 9  ? -44.800 -18.031 -27.342 1.00 126.63 ? 9   DG  L "C3'" 1 
ATOM 1174 O "O3'" . DG  D 4 9  ? -44.042 -19.241 -27.474 1.00 127.24 ? 9   DG  L "O3'" 1 
ATOM 1175 C "C2'" . DG  D 4 9  ? -44.109 -16.956 -26.508 1.00 124.86 ? 9   DG  L "C2'" 1 
ATOM 1176 C "C1'" . DG  D 4 9  ? -43.124 -16.398 -27.518 1.00 120.89 ? 9   DG  L "C1'" 1 
ATOM 1177 N N9    . DG  D 4 9  ? -42.618 -15.053 -27.212 1.00 120.17 ? 9   DG  L N9    1 
ATOM 1178 C C8    . DG  D 4 9  ? -43.333 -13.973 -26.742 1.00 121.56 ? 9   DG  L C8    1 
ATOM 1179 N N7    . DG  D 4 9  ? -42.606 -12.906 -26.566 1.00 118.92 ? 9   DG  L N7    1 
ATOM 1180 C C5    . DG  D 4 9  ? -41.329 -13.298 -26.943 1.00 122.96 ? 9   DG  L C5    1 
ATOM 1181 C C6    . DG  D 4 9  ? -40.120 -12.563 -26.967 1.00 115.84 ? 9   DG  L C6    1 
ATOM 1182 O O6    . DG  D 4 9  ? -39.929 -11.381 -26.649 1.00 115.65 ? 9   DG  L O6    1 
ATOM 1183 N N1    . DG  D 4 9  ? -39.059 -13.339 -27.419 1.00 119.25 ? 9   DG  L N1    1 
ATOM 1184 C C2    . DG  D 4 9  ? -39.156 -14.654 -27.798 1.00 116.14 ? 9   DG  L C2    1 
ATOM 1185 N N2    . DG  D 4 9  ? -38.025 -15.233 -28.200 1.00 122.74 ? 9   DG  L N2    1 
ATOM 1186 N N3    . DG  D 4 9  ? -40.279 -15.354 -27.781 1.00 119.18 ? 9   DG  L N3    1 
ATOM 1187 C C4    . DG  D 4 9  ? -41.322 -14.614 -27.345 1.00 113.72 ? 9   DG  L C4    1 
ATOM 1188 P P     . DA  D 4 10 ? -43.223 -19.857 -26.238 1.00 132.29 ? 10  DA  L P     1 
ATOM 1189 O OP1   . DA  D 4 10 ? -42.782 -21.204 -26.650 1.00 129.56 ? 10  DA  L OP1   1 
ATOM 1190 O OP2   . DA  D 4 10 ? -44.020 -19.679 -25.000 1.00 128.23 ? 10  DA  L OP2   1 
ATOM 1191 O "O5'" . DA  D 4 10 ? -41.900 -18.965 -26.190 1.00 119.80 ? 10  DA  L "O5'" 1 
ATOM 1192 C "C5'" . DA  D 4 10 ? -41.343 -18.582 -24.948 1.00 113.26 ? 10  DA  L "C5'" 1 
ATOM 1193 C "C4'" . DA  D 4 10 ? -39.854 -18.340 -25.079 1.00 113.48 ? 10  DA  L "C4'" 1 
ATOM 1194 O "O4'" . DA  D 4 10 ? -39.624 -16.927 -25.354 1.00 112.60 ? 10  DA  L "O4'" 1 
ATOM 1195 C "C3'" . DA  D 4 10 ? -39.041 -18.658 -23.825 1.00 119.74 ? 10  DA  L "C3'" 1 
ATOM 1196 O "O3'" . DA  D 4 10 ? -37.770 -19.207 -24.158 1.00 137.42 ? 10  DA  L "O3'" 1 
ATOM 1197 C "C2'" . DA  D 4 10 ? -38.925 -17.302 -23.149 1.00 114.24 ? 10  DA  L "C2'" 1 
ATOM 1198 C "C1'" . DA  D 4 10 ? -38.818 -16.364 -24.338 1.00 116.44 ? 10  DA  L "C1'" 1 
ATOM 1199 N N9    . DA  D 4 10 ? -39.274 -15.005 -24.060 1.00 119.56 ? 10  DA  L N9    1 
ATOM 1200 C C8    . DA  D 4 10 ? -40.486 -14.620 -23.550 1.00 120.89 ? 10  DA  L C8    1 
ATOM 1201 N N7    . DA  D 4 10 ? -40.609 -13.321 -23.403 1.00 113.61 ? 10  DA  L N7    1 
ATOM 1202 C C5    . DA  D 4 10 ? -39.396 -12.822 -23.847 1.00 109.00 ? 10  DA  L C5    1 
ATOM 1203 C C6    . DA  D 4 10 ? -38.889 -11.513 -23.954 1.00 115.84 ? 10  DA  L C6    1 
ATOM 1204 N N6    . DA  D 4 10 ? -39.575 -10.423 -23.601 1.00 115.35 ? 10  DA  L N6    1 
ATOM 1205 N N1    . DA  D 4 10 ? -37.641 -11.367 -24.443 1.00 113.33 ? 10  DA  L N1    1 
ATOM 1206 C C2    . DA  D 4 10 ? -36.952 -12.459 -24.792 1.00 113.63 ? 10  DA  L C2    1 
ATOM 1207 N N3    . DA  D 4 10 ? -37.322 -13.734 -24.743 1.00 106.32 ? 10  DA  L N3    1 
ATOM 1208 C C4    . DA  D 4 10 ? -38.565 -13.848 -24.256 1.00 108.94 ? 10  DA  L C4    1 
ATOM 1209 P P     . DT  D 4 11 ? -36.763 -19.672 -22.994 1.00 143.10 ? 11  DT  L P     1 
ATOM 1210 O OP1   . DT  D 4 11 ? -35.816 -20.640 -23.589 1.00 141.97 ? 11  DT  L OP1   1 
ATOM 1211 O OP2   . DT  D 4 11 ? -37.576 -20.079 -21.824 1.00 145.85 ? 11  DT  L OP2   1 
ATOM 1212 O "O5'" . DT  D 4 11 ? -35.950 -18.335 -22.644 1.00 123.85 ? 11  DT  L "O5'" 1 
ATOM 1213 C "C5'" . DT  D 4 11 ? -35.911 -17.831 -21.303 1.00 115.55 ? 11  DT  L "C5'" 1 
ATOM 1214 C "C4'" . DT  D 4 11 ? -35.249 -16.461 -21.259 1.00 112.20 ? 11  DT  L "C4'" 1 
ATOM 1215 O "O4'" . DT  D 4 11 ? -36.119 -15.466 -21.862 1.00 118.31 ? 11  DT  L "O4'" 1 
ATOM 1216 C "C3'" . DT  D 4 11 ? -34.987 -15.910 -19.874 1.00 112.43 ? 11  DT  L "C3'" 1 
ATOM 1217 O "O3'" . DT  D 4 11 ? -33.822 -16.527 -19.265 1.00 119.35 ? 11  DT  L "O3'" 1 
ATOM 1218 C "C2'" . DT  D 4 11 ? -34.837 -14.412 -20.161 1.00 112.30 ? 11  DT  L "C2'" 1 
ATOM 1219 C "C1'" . DT  D 4 11 ? -35.840 -14.187 -21.295 1.00 110.67 ? 11  DT  L "C1'" 1 
ATOM 1220 N N1    . DT  D 4 11 ? -37.128 -13.554 -20.832 1.00 111.13 ? 11  DT  L N1    1 
ATOM 1221 C C2    . DT  D 4 11 ? -37.428 -12.255 -21.203 1.00 108.44 ? 11  DT  L C2    1 
ATOM 1222 O O2    . DT  D 4 11 ? -36.710 -11.576 -21.910 1.00 113.04 ? 11  DT  L O2    1 
ATOM 1223 N N3    . DT  D 4 11 ? -38.617 -11.777 -20.721 1.00 115.24 ? 11  DT  L N3    1 
ATOM 1224 C C4    . DT  D 4 11 ? -39.514 -12.444 -19.914 1.00 105.59 ? 11  DT  L C4    1 
ATOM 1225 O O4    . DT  D 4 11 ? -40.559 -11.928 -19.527 1.00 122.11 ? 11  DT  L O4    1 
ATOM 1226 C C5    . DT  D 4 11 ? -39.137 -13.792 -19.554 1.00 105.35 ? 11  DT  L C5    1 
ATOM 1227 C C7    . DT  D 4 11 ? -40.033 -14.613 -18.681 1.00 124.60 ? 11  DT  L C7    1 
ATOM 1228 C C6    . DT  D 4 11 ? -37.976 -14.277 -20.021 1.00 98.19  ? 11  DT  L C6    1 
ATOM 1229 P P     . DA  D 4 12 ? -32.324 -15.997 -19.525 1.00 118.01 ? 12  DA  L P     1 
ATOM 1230 O OP1   . DA  D 4 12 ? -32.110 -15.789 -20.974 1.00 141.13 ? 12  DA  L OP1   1 
ATOM 1231 O OP2   . DA  D 4 12 ? -31.431 -16.927 -18.800 1.00 130.50 ? 12  DA  L OP2   1 
ATOM 1232 O "O5'" . DA  D 4 12 ? -32.291 -14.568 -18.805 1.00 112.84 ? 12  DA  L "O5'" 1 
ATOM 1233 C "C5'" . DA  D 4 12 ? -31.073 -14.036 -18.320 1.00 118.12 ? 12  DA  L "C5'" 1 
ATOM 1234 C "C4'" . DA  D 4 12 ? -31.085 -12.527 -18.360 1.00 119.90 ? 12  DA  L "C4'" 1 
ATOM 1235 O "O4'" . DA  D 4 12 ? -32.392 -12.067 -18.796 1.00 120.01 ? 12  DA  L "O4'" 1 
ATOM 1236 C "C3'" . DA  D 4 12 ? -30.823 -11.857 -17.018 1.00 122.27 ? 12  DA  L "C3'" 1 
ATOM 1237 O "O3'" . DA  D 4 12 ? -29.403 -11.627 -16.840 1.00 129.78 ? 12  DA  L "O3'" 1 
ATOM 1238 C "C2'" . DA  D 4 12 ? -31.655 -10.580 -17.109 1.00 121.63 ? 12  DA  L "C2'" 1 
ATOM 1239 C "C1'" . DA  D 4 12 ? -32.828 -10.976 -18.006 1.00 114.72 ? 12  DA  L "C1'" 1 
ATOM 1240 N N9    . DA  D 4 12 ? -34.020 -11.395 -17.267 1.00 110.65 ? 12  DA  L N9    1 
ATOM 1241 C C8    . DA  D 4 12 ? -34.064 -12.293 -16.241 1.00 121.50 ? 12  DA  L C8    1 
ATOM 1242 N N7    . DA  D 4 12 ? -35.266 -12.494 -15.760 1.00 125.26 ? 12  DA  L N7    1 
ATOM 1243 C C5    . DA  D 4 12 ? -36.075 -11.672 -16.523 1.00 109.97 ? 12  DA  L C5    1 
ATOM 1244 C C6    . DA  D 4 12 ? -37.465 -11.431 -16.508 1.00 111.74 ? 12  DA  L C6    1 
ATOM 1245 N N6    . DA  D 4 12 ? -38.308 -12.021 -15.651 1.00 114.86 ? 12  DA  L N6    1 
ATOM 1246 N N1    . DA  D 4 12 ? -37.953 -10.551 -17.403 1.00 109.13 ? 12  DA  L N1    1 
ATOM 1247 C C2    . DA  D 4 12 ? -37.104 -9.961  -18.254 1.00 107.03 ? 12  DA  L C2    1 
ATOM 1248 N N3    . DA  D 4 12 ? -35.781 -10.108 -18.365 1.00 103.17 ? 12  DA  L N3    1 
ATOM 1249 C C4    . DA  D 4 12 ? -35.324 -10.985 -17.462 1.00 107.60 ? 12  DA  L C4    1 
ATOM 1250 P P     . DA  D 4 13 ? -28.822 -10.307 -16.123 1.00 128.08 ? 13  DA  L P     1 
ATOM 1251 O OP1   . DA  D 4 13 ? -28.921 -9.181  -17.071 1.00 127.94 ? 13  DA  L OP1   1 
ATOM 1252 O OP2   . DA  D 4 13 ? -27.488 -10.677 -15.603 1.00 131.90 ? 13  DA  L OP2   1 
ATOM 1253 O "O5'" . DA  D 4 13 ? -29.780 -10.064 -14.865 1.00 131.71 ? 13  DA  L "O5'" 1 
ATOM 1254 C "C5'" . DA  D 4 13 ? -29.722 -8.818  -14.150 1.00 135.46 ? 13  DA  L "C5'" 1 
ATOM 1255 C "C4'" . DA  D 4 13 ? -30.286 -7.686  -14.992 1.00 133.44 ? 13  DA  L "C4'" 1 
ATOM 1256 O "O4'" . DA  D 4 13 ? -31.522 -8.112  -15.613 1.00 129.47 ? 13  DA  L "O4'" 1 
ATOM 1257 C "C3'" . DA  D 4 13 ? -30.652 -6.429  -14.237 1.00 136.05 ? 13  DA  L "C3'" 1 
ATOM 1258 O "O3'" . DA  D 4 13 ? -29.512 -5.593  -14.055 1.00 141.89 ? 13  DA  L "O3'" 1 
ATOM 1259 C "C2'" . DA  D 4 13 ? -31.692 -5.798  -15.159 1.00 130.11 ? 13  DA  L "C2'" 1 
ATOM 1260 C "C1'" . DA  D 4 13 ? -32.376 -7.001  -15.800 1.00 127.43 ? 13  DA  L "C1'" 1 
ATOM 1261 N N9    . DA  D 4 13 ? -33.678 -7.302  -15.209 1.00 123.93 ? 13  DA  L N9    1 
ATOM 1262 C C8    . DA  D 4 13 ? -33.929 -7.754  -13.940 1.00 126.34 ? 13  DA  L C8    1 
ATOM 1263 N N7    . DA  D 4 13 ? -35.202 -7.926  -13.682 1.00 124.77 ? 13  DA  L N7    1 
ATOM 1264 C C5    . DA  D 4 13 ? -35.830 -7.559  -14.860 1.00 117.94 ? 13  DA  L C5    1 
ATOM 1265 C C6    . DA  D 4 13 ? -37.181 -7.516  -15.242 1.00 118.10 ? 13  DA  L C6    1 
ATOM 1266 N N6    . DA  D 4 13 ? -38.182 -7.854  -14.438 1.00 132.06 ? 13  DA  L N6    1 
ATOM 1267 N N1    . DA  D 4 13 ? -37.469 -7.100  -16.489 1.00 115.28 ? 13  DA  L N1    1 
ATOM 1268 C C2    . DA  D 4 13 ? -36.471 -6.755  -17.299 1.00 120.92 ? 13  DA  L C2    1 
ATOM 1269 N N3    . DA  D 4 13 ? -35.162 -6.751  -17.060 1.00 121.28 ? 13  DA  L N3    1 
ATOM 1270 C C4    . DA  D 4 13 ? -34.906 -7.168  -15.809 1.00 119.73 ? 13  DA  L C4    1 
ATOM 1271 P P     . DT  D 4 14 ? -29.167 -4.948  -12.625 1.00 160.29 ? 14  DT  L P     1 
ATOM 1272 O OP1   . DT  D 4 14 ? -27.760 -4.502  -12.713 1.00 151.52 ? 14  DT  L OP1   1 
ATOM 1273 O OP2   . DT  D 4 14 ? -29.548 -5.908  -11.569 1.00 173.85 ? 14  DT  L OP2   1 
ATOM 1274 O "O5'" . DT  D 4 14 ? -30.111 -3.653  -12.529 1.00 144.28 ? 14  DT  L "O5'" 1 
ATOM 1275 C "C5'" . DT  D 4 14 ? -31.525 -3.788  -12.391 1.00 139.68 ? 14  DT  L "C5'" 1 
ATOM 1276 C "C4'" . DT  D 4 14 ? -32.258 -2.725  -13.194 1.00 136.62 ? 14  DT  L "C4'" 1 
ATOM 1277 O "O4'" . DT  D 4 14 ? -33.299 -3.349  -13.999 1.00 133.38 ? 14  DT  L "O4'" 1 
ATOM 1278 C "C3'" . DT  D 4 14 ? -32.959 -1.671  -12.353 1.00 140.16 ? 14  DT  L "C3'" 1 
ATOM 1279 O "O3'" . DT  D 4 14 ? -32.122 -0.539  -12.172 1.00 141.47 ? 14  DT  L "O3'" 1 
ATOM 1280 C "C2'" . DT  D 4 14 ? -34.208 -1.359  -13.166 1.00 133.87 ? 14  DT  L "C2'" 1 
ATOM 1281 C "C1'" . DT  D 4 14 ? -34.537 -2.704  -13.793 1.00 135.33 ? 14  DT  L "C1'" 1 
ATOM 1282 N N1    . DT  D 4 14 ? -35.394 -3.603  -12.941 1.00 133.96 ? 14  DT  L N1    1 
ATOM 1283 C C2    . DT  D 4 14 ? -36.769 -3.593  -13.092 1.00 131.77 ? 14  DT  L C2    1 
ATOM 1284 O O2    . DT  D 4 14 ? -37.355 -2.870  -13.880 1.00 125.01 ? 14  DT  L O2    1 
ATOM 1285 N N3    . DT  D 4 14 ? -37.439 -4.464  -12.271 1.00 132.76 ? 14  DT  L N3    1 
ATOM 1286 C C4    . DT  D 4 14 ? -36.886 -5.326  -11.345 1.00 131.90 ? 14  DT  L C4    1 
ATOM 1287 O O4    . DT  D 4 14 ? -37.564 -6.072  -10.655 1.00 128.80 ? 14  DT  L O4    1 
ATOM 1288 C C5    . DT  D 4 14 ? -35.453 -5.290  -11.246 1.00 134.21 ? 14  DT  L C5    1 
ATOM 1289 C C7    . DT  D 4 14 ? -34.751 -6.181  -10.276 1.00 136.90 ? 14  DT  L C7    1 
ATOM 1290 C C6    . DT  D 4 14 ? -34.782 -4.448  -12.038 1.00 136.32 ? 14  DT  L C6    1 
ATOM 1291 P P     . DT  D 4 15 ? -31.867 0.031   -10.695 1.00 152.05 ? 15  DT  L P     1 
ATOM 1292 O OP1   . DT  D 4 15 ? -31.304 1.393   -10.829 1.00 158.80 ? 15  DT  L OP1   1 
ATOM 1293 O OP2   . DT  D 4 15 ? -31.119 -0.999  -9.940  1.00 148.05 ? 15  DT  L OP2   1 
ATOM 1294 O "O5'" . DT  D 4 15 ? -33.344 0.129   -10.087 1.00 164.69 ? 15  DT  L "O5'" 1 
ATOM 1295 C "C5'" . DT  D 4 15 ? -34.317 0.908   -10.759 1.00 161.93 ? 15  DT  L "C5'" 1 
ATOM 1296 C "C4'" . DT  D 4 15 ? -35.734 0.512   -10.376 1.00 151.53 ? 15  DT  L "C4'" 1 
ATOM 1297 O "O4'" . DT  D 4 15 ? -35.881 -0.931  -10.321 1.00 147.79 ? 15  DT  L "O4'" 1 
ATOM 1298 C "C3'" . DT  D 4 15 ? -36.179 0.972   -9.000  1.00 150.40 ? 15  DT  L "C3'" 1 
ATOM 1299 O "O3'" . DT  D 4 15 ? -36.764 2.285   -9.050  1.00 162.28 ? 15  DT  L "O3'" 1 
ATOM 1300 C "C2'" . DT  D 4 15 ? -37.188 -0.104  -8.574  1.00 145.00 ? 15  DT  L "C2'" 1 
ATOM 1301 C "C1'" . DT  D 4 15 ? -37.098 -1.173  -9.653  1.00 140.85 ? 15  DT  L "C1'" 1 
ATOM 1302 N N1    . DT  D 4 15 ? -37.156 -2.570  -9.083  1.00 140.94 ? 15  DT  L N1    1 
ATOM 1303 C C2    . DT  D 4 15 ? -38.332 -3.285  -9.196  1.00 132.87 ? 15  DT  L C2    1 
ATOM 1304 O O2    . DT  D 4 15 ? -39.315 -2.865  -9.776  1.00 129.27 ? 15  DT  L O2    1 
ATOM 1305 N N3    . DT  D 4 15 ? -38.309 -4.528  -8.622  1.00 129.81 ? 15  DT  L N3    1 
ATOM 1306 C C4    . DT  D 4 15 ? -37.263 -5.111  -7.941  1.00 128.15 ? 15  DT  L C4    1 
ATOM 1307 O O4    . DT  D 4 15 ? -37.341 -6.241  -7.463  1.00 121.68 ? 15  DT  L O4    1 
ATOM 1308 C C5    . DT  D 4 15 ? -36.069 -4.306  -7.835  1.00 140.66 ? 15  DT  L C5    1 
ATOM 1309 C C7    . DT  D 4 15 ? -34.872 -4.842  -7.116  1.00 154.57 ? 15  DT  L C7    1 
ATOM 1310 C C6    . DT  D 4 15 ? -36.073 -3.082  -8.395  1.00 140.44 ? 15  DT  L C6    1 
ATOM 1311 P P     . DG  D 4 16 ? -36.426 3.383   -7.920  1.00 153.09 ? 16  DG  L P     1 
ATOM 1312 O OP1   . DG  D 4 16 ? -36.327 4.689   -8.605  1.00 160.04 ? 16  DG  L OP1   1 
ATOM 1313 O OP2   . DG  D 4 16 ? -35.291 2.909   -7.096  1.00 163.67 ? 16  DG  L OP2   1 
ATOM 1314 O "O5'" . DG  D 4 16 ? -37.725 3.387   -6.984  1.00 168.44 ? 16  DG  L "O5'" 1 
ATOM 1315 C "C5'" . DG  D 4 16 ? -38.097 2.205   -6.309  1.00 169.24 ? 16  DG  L "C5'" 1 
ATOM 1316 C "C4'" . DG  D 4 16 ? -39.434 2.340   -5.614  1.00 174.95 ? 16  DG  L "C4'" 1 
ATOM 1317 O "O4'" . DG  D 4 16 ? -40.181 1.110   -5.793  1.00 179.99 ? 16  DG  L "O4'" 1 
ATOM 1318 C "C3'" . DG  D 4 16 ? -39.339 2.570   -4.112  1.00 184.35 ? 16  DG  L "C3'" 1 
ATOM 1319 O "O3'" . DG  D 4 16 ? -40.294 3.574   -3.668  1.00 193.93 ? 16  DG  L "O3'" 1 
ATOM 1320 C "C2'" . DG  D 4 16 ? -39.563 1.180   -3.493  1.00 178.62 ? 16  DG  L "C2'" 1 
ATOM 1321 C "C1'" . DG  D 4 16 ? -40.140 0.320   -4.622  1.00 167.33 ? 16  DG  L "C1'" 1 
ATOM 1322 N N9    . DG  D 4 16 ? -39.340 -0.882  -4.882  1.00 156.03 ? 16  DG  L N9    1 
ATOM 1323 C C8    . DG  D 4 16 ? -38.132 -0.939  -5.528  1.00 153.44 ? 16  DG  L C8    1 
ATOM 1324 N N7    . DG  D 4 16 ? -37.632 -2.141  -5.602  1.00 148.87 ? 16  DG  L N7    1 
ATOM 1325 C C5    . DG  D 4 16 ? -38.558 -2.936  -4.952  1.00 146.07 ? 16  DG  L C5    1 
ATOM 1326 C C6    . DG  D 4 16 ? -38.548 -4.329  -4.718  1.00 139.50 ? 16  DG  L C6    1 
ATOM 1327 O O6    . DG  D 4 16 ? -37.688 -5.154  -5.046  1.00 141.42 ? 16  DG  L O6    1 
ATOM 1328 N N1    . DG  D 4 16 ? -39.674 -4.745  -4.023  1.00 128.83 ? 16  DG  L N1    1 
ATOM 1329 C C2    . DG  D 4 16 ? -40.686 -3.919  -3.606  1.00 136.70 ? 16  DG  L C2    1 
ATOM 1330 N N2    . DG  D 4 16 ? -41.687 -4.510  -2.953  1.00 139.39 ? 16  DG  L N2    1 
ATOM 1331 N N3    . DG  D 4 16 ? -40.715 -2.605  -3.816  1.00 137.71 ? 16  DG  L N3    1 
ATOM 1332 C C4    . DG  D 4 16 ? -39.618 -2.182  -4.495  1.00 149.17 ? 16  DG  L C4    1 
ATOM 1333 P P     . DT  D 4 17 ? -41.862 3.260   -3.485  1.00 224.62 ? 17  DT  L P     1 
ATOM 1334 O OP1   . DT  D 4 17 ? -42.308 2.373   -4.582  1.00 212.68 ? 17  DT  L OP1   1 
ATOM 1335 O OP2   . DT  D 4 17 ? -42.516 4.576   -3.316  1.00 199.73 ? 17  DT  L OP2   1 
ATOM 1336 O "O5'" . DT  D 4 17 ? -41.956 2.529   -2.061  1.00 185.51 ? 17  DT  L "O5'" 1 
ATOM 1337 C "C5'" . DT  D 4 17 ? -42.649 1.292   -1.929  1.00 176.41 ? 17  DT  L "C5'" 1 
ATOM 1338 C "C4'" . DT  D 4 17 ? -44.131 1.517   -1.689  1.00 173.21 ? 17  DT  L "C4'" 1 
ATOM 1339 O "O4'" . DT  D 4 17 ? -44.897 0.624   -2.549  1.00 156.35 ? 17  DT  L "O4'" 1 
ATOM 1340 C "C3'" . DT  D 4 17 ? -44.598 1.244   -0.260  1.00 176.29 ? 17  DT  L "C3'" 1 
ATOM 1341 O "O3'" . DT  D 4 17 ? -44.654 2.452   0.498   1.00 187.05 ? 17  DT  L "O3'" 1 
ATOM 1342 C "C2'" . DT  D 4 17 ? -45.972 0.612   -0.453  1.00 168.40 ? 17  DT  L "C2'" 1 
ATOM 1343 C "C1'" . DT  D 4 17 ? -45.837 -0.110  -1.790  1.00 154.30 ? 17  DT  L "C1'" 1 
ATOM 1344 N N1    . DT  D 4 17 ? -45.349 -1.523  -1.674  1.00 148.70 ? 17  DT  L N1    1 
ATOM 1345 C C2    . DT  D 4 17 ? -46.155 -2.571  -2.077  1.00 151.74 ? 17  DT  L C2    1 
ATOM 1346 O O2    . DT  D 4 17 ? -47.274 -2.422  -2.535  1.00 161.85 ? 17  DT  L O2    1 
ATOM 1347 N N3    . DT  D 4 17 ? -45.595 -3.814  -1.922  1.00 140.15 ? 17  DT  L N3    1 
ATOM 1348 C C4    . DT  D 4 17 ? -44.344 -4.104  -1.416  1.00 128.96 ? 17  DT  L C4    1 
ATOM 1349 O O4    . DT  D 4 17 ? -43.924 -5.253  -1.315  1.00 123.55 ? 17  DT  L O4    1 
ATOM 1350 C C5    . DT  D 4 17 ? -43.563 -2.958  -1.022  1.00 137.10 ? 17  DT  L C5    1 
ATOM 1351 C C7    . DT  D 4 17 ? -42.196 -3.132  -0.461  1.00 125.16 ? 17  DT  L C7    1 
ATOM 1352 C C6    . DT  D 4 17 ? -44.094 -1.746  -1.167  1.00 146.10 ? 17  DT  L C6    1 
ATOM 1353 N N     . PRO E 5 2  ? -29.574 2.189   -48.894 1.00 142.03 ? 280 PRO A N     1 
ATOM 1354 C CA    . PRO E 5 2  ? -28.878 1.575   -47.762 1.00 144.43 ? 280 PRO A CA    1 
ATOM 1355 C C     . PRO E 5 2  ? -27.364 1.538   -47.927 1.00 135.19 ? 280 PRO A C     1 
ATOM 1356 O O     . PRO E 5 2  ? -26.656 1.336   -46.943 1.00 142.31 ? 280 PRO A O     1 
ATOM 1357 C CB    . PRO E 5 2  ? -29.431 0.155   -47.764 1.00 145.88 ? 280 PRO A CB    1 
ATOM 1358 C CG    . PRO E 5 2  ? -29.593 -0.133  -49.227 1.00 137.35 ? 280 PRO A CG    1 
ATOM 1359 C CD    . PRO E 5 2  ? -30.115 1.163   -49.806 1.00 139.60 ? 280 PRO A CD    1 
ATOM 1360 N N     . LYS E 5 3  ? -26.879 1.731   -49.150 1.00 143.51 ? 281 LYS A N     1 
ATOM 1361 C CA    . LYS E 5 3  ? -25.495 1.398   -49.473 1.00 139.69 ? 281 LYS A CA    1 
ATOM 1362 C C     . LYS E 5 3  ? -24.506 2.185   -48.624 1.00 140.23 ? 281 LYS A C     1 
ATOM 1363 O O     . LYS E 5 3  ? -24.683 3.378   -48.385 1.00 134.45 ? 281 LYS A O     1 
ATOM 1364 C CB    . LYS E 5 3  ? -25.202 1.644   -50.962 1.00 137.65 ? 281 LYS A CB    1 
ATOM 1365 C CG    . LYS E 5 3  ? -25.284 3.097   -51.425 1.00 137.17 ? 281 LYS A CG    1 
ATOM 1366 C CD    . LYS E 5 3  ? -24.650 3.259   -52.805 1.00 134.10 ? 281 LYS A CD    1 
ATOM 1367 C CE    . LYS E 5 3  ? -23.388 4.111   -52.747 1.00 119.54 ? 281 LYS A CE    1 
ATOM 1368 N NZ    . LYS E 5 3  ? -22.444 3.784   -53.842 1.00 94.94  ? 281 LYS A NZ    1 
ATOM 1369 N N     . VAL E 5 4  ? -23.459 1.500   -48.175 1.00 138.61 ? 282 VAL A N     1 
ATOM 1370 C CA    . VAL E 5 4  ? -22.373 2.131   -47.436 1.00 140.48 ? 282 VAL A CA    1 
ATOM 1371 C C     . VAL E 5 4  ? -22.904 2.814   -46.165 1.00 144.55 ? 282 VAL A C     1 
ATOM 1372 O O     . VAL E 5 4  ? -22.311 3.763   -45.657 1.00 150.08 ? 282 VAL A O     1 
ATOM 1373 C CB    . VAL E 5 4  ? -21.628 3.135   -48.340 1.00 138.50 ? 282 VAL A CB    1 
ATOM 1374 C CG1   . VAL E 5 4  ? -20.190 3.342   -47.865 1.00 142.80 ? 282 VAL A CG1   1 
ATOM 1375 C CG2   . VAL E 5 4  ? -21.639 2.641   -49.787 1.00 132.84 ? 282 VAL A CG2   1 
ATOM 1376 N N     . ALA E 5 5  ? -24.038 2.313   -45.675 1.00 141.30 ? 283 ALA A N     1 
ATOM 1377 C CA    . ALA E 5 5  ? -24.500 2.563   -44.313 1.00 142.79 ? 283 ALA A CA    1 
ATOM 1378 C C     . ALA E 5 5  ? -24.055 1.367   -43.475 1.00 148.89 ? 283 ALA A C     1 
ATOM 1379 O O     . ALA E 5 5  ? -24.522 1.165   -42.356 1.00 152.06 ? 283 ALA A O     1 
ATOM 1380 C CB    . ALA E 5 5  ? -26.033 2.748   -44.259 1.00 150.92 ? 283 ALA A CB    1 
ATOM 1381 N N     . THR E 5 6  ? -23.132 0.590   -44.045 1.00 143.96 ? 284 THR A N     1 
ATOM 1382 C CA    . THR E 5 6  ? -22.828 -0.771  -43.605 1.00 140.60 ? 284 THR A CA    1 
ATOM 1383 C C     . THR E 5 6  ? -21.356 -0.997  -43.282 1.00 136.54 ? 284 THR A C     1 
ATOM 1384 O O     . THR E 5 6  ? -21.004 -1.372  -42.169 1.00 136.84 ? 284 THR A O     1 
ATOM 1385 C CB    . THR E 5 6  ? -23.215 -1.797  -44.693 1.00 144.81 ? 284 THR A CB    1 
ATOM 1386 O OG1   . THR E 5 6  ? -24.640 -1.848  -44.836 1.00 162.53 ? 284 THR A OG1   1 
ATOM 1387 C CG2   . THR E 5 6  ? -22.680 -3.181  -44.352 1.00 145.18 ? 284 THR A CG2   1 
ATOM 1388 N N     . ASN E 5 7  ? -20.498 -0.783  -44.272 1.00 139.33 ? 285 ASN A N     1 
ATOM 1389 C CA    . ASN E 5 7  ? -19.081 -1.096  -44.134 1.00 139.76 ? 285 ASN A CA    1 
ATOM 1390 C C     . ASN E 5 7  ? -18.464 -0.220  -43.050 1.00 136.97 ? 285 ASN A C     1 
ATOM 1391 O O     . ASN E 5 7  ? -17.464 -0.586  -42.440 1.00 137.97 ? 285 ASN A O     1 
ATOM 1392 C CB    . ASN E 5 7  ? -18.361 -0.926  -45.476 1.00 140.50 ? 285 ASN A CB    1 
ATOM 1393 C CG    . ASN E 5 7  ? -19.159 -1.500  -46.642 1.00 149.96 ? 285 ASN A CG    1 
ATOM 1394 O OD1   . ASN E 5 7  ? -20.367 -1.701  -46.535 1.00 145.09 ? 285 ASN A OD1   1 
ATOM 1395 N ND2   . ASN E 5 7  ? -18.485 -1.776  -47.756 1.00 176.81 ? 285 ASN A ND2   1 
ATOM 1396 N N     . ILE E 5 8  ? -19.077 0.936   -42.811 1.00 137.76 ? 286 ILE A N     1 
ATOM 1397 C CA    . ILE E 5 8  ? -18.826 1.699   -41.594 1.00 136.95 ? 286 ILE A CA    1 
ATOM 1398 C C     . ILE E 5 8  ? -19.081 0.808   -40.383 1.00 137.97 ? 286 ILE A C     1 
ATOM 1399 O O     . ILE E 5 8  ? -18.256 0.720   -39.479 1.00 136.08 ? 286 ILE A O     1 
ATOM 1400 C CB    . ILE E 5 8  ? -19.743 2.946   -41.492 1.00 138.39 ? 286 ILE A CB    1 
ATOM 1401 C CG1   . ILE E 5 8  ? -21.215 2.518   -41.558 1.00 143.76 ? 286 ILE A CG1   1 
ATOM 1402 C CG2   . ILE E 5 8  ? -19.415 3.951   -42.576 1.00 127.41 ? 286 ILE A CG2   1 
ATOM 1403 C CD1   . ILE E 5 8  ? -22.167 3.569   -42.059 1.00 140.26 ? 286 ILE A CD1   1 
ATOM 1404 N N     . MET E 5 9  ? -20.229 0.137   -40.393 1.00 141.75 ? 287 MET A N     1 
ATOM 1405 C CA    . MET E 5 9  ? -20.663 -0.701  -39.287 1.00 139.44 ? 287 MET A CA    1 
ATOM 1406 C C     . MET E 5 9  ? -19.774 -1.929  -39.136 1.00 137.70 ? 287 MET A C     1 
ATOM 1407 O O     . MET E 5 9  ? -19.530 -2.408  -38.029 1.00 136.34 ? 287 MET A O     1 
ATOM 1408 C CB    . MET E 5 9  ? -22.105 -1.155  -39.496 1.00 141.67 ? 287 MET A CB    1 
ATOM 1409 C CG    . MET E 5 9  ? -23.084 -0.116  -40.030 1.00 147.42 ? 287 MET A CG    1 
ATOM 1410 S SD    . MET E 5 9  ? -23.515 1.155   -38.828 1.00 195.66 ? 287 MET A SD    1 
ATOM 1411 C CE    . MET E 5 9  ? -24.222 0.166   -37.506 1.00 163.27 ? 287 MET A CE    1 
ATOM 1412 N N     . ARG E 5 10 ? -19.294 -2.424  -40.272 1.00 135.12 ? 288 ARG A N     1 
ATOM 1413 C CA    . ARG E 5 10 ? -18.555 -3.678  -40.336 1.00 136.18 ? 288 ARG A CA    1 
ATOM 1414 C C     . ARG E 5 10 ? -17.068 -3.439  -40.117 1.00 133.58 ? 288 ARG A C     1 
ATOM 1415 O O     . ARG E 5 10 ? -16.384 -4.253  -39.497 1.00 134.90 ? 288 ARG A O     1 
ATOM 1416 C CB    . ARG E 5 10 ? -18.789 -4.361  -41.688 1.00 137.27 ? 288 ARG A CB    1 
ATOM 1417 C CG    . ARG E 5 10 ? -20.248 -4.354  -42.155 1.00 137.72 ? 288 ARG A CG    1 
ATOM 1418 C CD    . ARG E 5 10 ? -20.838 -5.746  -42.300 1.00 146.35 ? 288 ARG A CD    1 
ATOM 1419 N NE    . ARG E 5 10 ? -21.575 -5.893  -43.548 1.00 146.80 ? 288 ARG A NE    1 
ATOM 1420 C CZ    . ARG E 5 10 ? -21.011 -6.192  -44.714 1.00 149.47 ? 288 ARG A CZ    1 
ATOM 1421 N NH1   . ARG E 5 10 ? -19.701 -6.371  -44.800 1.00 154.36 ? 288 ARG A NH1   1 
ATOM 1422 N NH2   . ARG E 5 10 ? -21.758 -6.309  -45.800 1.00 145.18 ? 288 ARG A NH2   1 
ATOM 1423 N N     . ALA E 5 11 ? -16.575 -2.315  -40.632 1.00 131.41 ? 289 ALA A N     1 
ATOM 1424 C CA    . ALA E 5 11 ? -15.164 -1.975  -40.499 1.00 135.50 ? 289 ALA A CA    1 
ATOM 1425 C C     . ALA E 5 11 ? -14.782 -1.735  -39.043 1.00 140.47 ? 289 ALA A C     1 
ATOM 1426 O O     . ALA E 5 11 ? -13.666 -2.060  -38.635 1.00 139.52 ? 289 ALA A O     1 
ATOM 1427 C CB    . ALA E 5 11 ? -14.834 -0.740  -41.334 1.00 126.89 ? 289 ALA A CB    1 
ATOM 1428 N N     . TRP E 5 12 ? -15.695 -1.164  -38.260 1.00 141.47 ? 290 TRP A N     1 
ATOM 1429 C CA    . TRP E 5 12 ? -15.461 -1.036  -36.827 1.00 140.65 ? 290 TRP A CA    1 
ATOM 1430 C C     . TRP E 5 12 ? -15.706 -2.383  -36.143 1.00 136.78 ? 290 TRP A C     1 
ATOM 1431 O O     . TRP E 5 12 ? -15.146 -2.642  -35.083 1.00 134.26 ? 290 TRP A O     1 
ATOM 1432 C CB    . TRP E 5 12 ? -16.346 0.062   -36.191 1.00 138.17 ? 290 TRP A CB    1 
ATOM 1433 C CG    . TRP E 5 12 ? -17.802 -0.319  -35.942 1.00 136.77 ? 290 TRP A CG    1 
ATOM 1434 C CD1   . TRP E 5 12 ? -18.894 0.134   -36.625 1.00 135.62 ? 290 TRP A CD1   1 
ATOM 1435 C CD2   . TRP E 5 12 ? -18.310 -1.206  -34.933 1.00 137.98 ? 290 TRP A CD2   1 
ATOM 1436 N NE1   . TRP E 5 12 ? -20.042 -0.427  -36.119 1.00 138.40 ? 290 TRP A NE1   1 
ATOM 1437 C CE2   . TRP E 5 12 ? -19.709 -1.252  -35.081 1.00 140.27 ? 290 TRP A CE2   1 
ATOM 1438 C CE3   . TRP E 5 12 ? -17.720 -1.966  -33.924 1.00 137.86 ? 290 TRP A CE3   1 
ATOM 1439 C CZ2   . TRP E 5 12 ? -20.519 -2.028  -34.261 1.00 143.96 ? 290 TRP A CZ2   1 
ATOM 1440 C CZ3   . TRP E 5 12 ? -18.521 -2.739  -33.129 1.00 138.10 ? 290 TRP A CZ3   1 
ATOM 1441 C CH2   . TRP E 5 12 ? -19.905 -2.763  -33.291 1.00 142.75 ? 290 TRP A CH2   1 
ATOM 1442 N N     . LEU E 5 13 ? -16.471 -3.269  -36.787 1.00 137.85 ? 291 LEU A N     1 
ATOM 1443 C CA    . LEU E 5 13 ? -17.078 -4.425  -36.102 1.00 134.72 ? 291 LEU A CA    1 
ATOM 1444 C C     . LEU E 5 13 ? -16.027 -5.365  -35.535 1.00 133.11 ? 291 LEU A C     1 
ATOM 1445 O O     . LEU E 5 13 ? -16.328 -6.235  -34.721 1.00 133.29 ? 291 LEU A O     1 
ATOM 1446 C CB    . LEU E 5 13 ? -18.010 -5.200  -37.043 1.00 137.05 ? 291 LEU A CB    1 
ATOM 1447 C CG    . LEU E 5 13 ? -19.000 -6.195  -36.418 1.00 136.80 ? 291 LEU A CG    1 
ATOM 1448 C CD1   . LEU E 5 13 ? -19.495 -5.745  -35.048 1.00 130.57 ? 291 LEU A CD1   1 
ATOM 1449 C CD2   . LEU E 5 13 ? -20.184 -6.398  -37.357 1.00 143.65 ? 291 LEU A CD2   1 
ATOM 1450 N N     . PHE E 5 14 ? -14.796 -5.186  -35.983 1.00 132.72 ? 292 PHE A N     1 
ATOM 1451 C CA    . PHE E 5 14 ? -13.656 -5.887  -35.429 1.00 133.02 ? 292 PHE A CA    1 
ATOM 1452 C C     . PHE E 5 14 ? -13.507 -5.475  -33.955 1.00 135.29 ? 292 PHE A C     1 
ATOM 1453 O O     . PHE E 5 14 ? -12.937 -6.210  -33.148 1.00 137.75 ? 292 PHE A O     1 
ATOM 1454 C CB    . PHE E 5 14 ? -12.391 -5.572  -36.244 1.00 136.30 ? 292 PHE A CB    1 
ATOM 1455 C CG    . PHE E 5 14 ? -12.420 -6.097  -37.674 1.00 145.16 ? 292 PHE A CG    1 
ATOM 1456 C CD1   . PHE E 5 14 ? -13.534 -5.927  -38.490 1.00 145.11 ? 292 PHE A CD1   1 
ATOM 1457 C CD2   . PHE E 5 14 ? -11.312 -6.740  -38.207 1.00 155.71 ? 292 PHE A CD2   1 
ATOM 1458 C CE1   . PHE E 5 14 ? -13.549 -6.404  -39.789 1.00 141.24 ? 292 PHE A CE1   1 
ATOM 1459 C CE2   . PHE E 5 14 ? -11.325 -7.218  -39.512 1.00 153.31 ? 292 PHE A CE2   1 
ATOM 1460 C CZ    . PHE E 5 14 ? -12.443 -7.048  -40.300 1.00 147.49 ? 292 PHE A CZ    1 
ATOM 1461 N N     . GLN E 5 15 ? -14.039 -4.298  -33.614 1.00 132.88 ? 293 GLN A N     1 
ATOM 1462 C CA    . GLN E 5 15 ? -14.010 -3.783  -32.241 1.00 133.79 ? 293 GLN A CA    1 
ATOM 1463 C C     . GLN E 5 15 ? -14.945 -4.533  -31.276 1.00 135.24 ? 293 GLN A C     1 
ATOM 1464 O O     . GLN E 5 15 ? -14.519 -4.925  -30.190 1.00 136.58 ? 293 GLN A O     1 
ATOM 1465 C CB    . GLN E 5 15 ? -14.366 -2.293  -32.226 1.00 137.49 ? 293 GLN A CB    1 
ATOM 1466 C CG    . GLN E 5 15 ? -13.361 -1.387  -32.943 1.00 144.42 ? 293 GLN A CG    1 
ATOM 1467 C CD    . GLN E 5 15 ? -13.840 0.049   -33.063 1.00 158.40 ? 293 GLN A CD    1 
ATOM 1468 O OE1   . GLN E 5 15 ? -15.039 0.321   -33.006 1.00 154.31 ? 293 GLN A OE1   1 
ATOM 1469 N NE2   . GLN E 5 15 ? -12.902 0.977   -33.226 1.00 173.03 ? 293 GLN A NE2   1 
ATOM 1470 N N     . HIS E 5 16 ? -16.206 -4.731  -31.663 1.00 137.57 ? 294 HIS A N     1 
ATOM 1471 C CA    . HIS E 5 16 ? -17.171 -5.455  -30.827 1.00 136.34 ? 294 HIS A CA    1 
ATOM 1472 C C     . HIS E 5 16 ? -17.672 -6.675  -31.600 1.00 132.02 ? 294 HIS A C     1 
ATOM 1473 O O     . HIS E 5 16 ? -18.871 -6.947  -31.650 1.00 133.03 ? 294 HIS A O     1 
ATOM 1474 C CB    . HIS E 5 16 ? -18.351 -4.557  -30.402 1.00 138.21 ? 294 HIS A CB    1 
ATOM 1475 C CG    . HIS E 5 16 ? -17.955 -3.160  -30.022 1.00 154.10 ? 294 HIS A CG    1 
ATOM 1476 N ND1   . HIS E 5 16 ? -16.694 -2.837  -29.573 1.00 159.33 ? 294 HIS A ND1   1 
ATOM 1477 C CD2   . HIS E 5 16 ? -18.655 -1.999  -30.041 1.00 159.00 ? 294 HIS A CD2   1 
ATOM 1478 C CE1   . HIS E 5 16 ? -16.633 -1.538  -29.327 1.00 162.30 ? 294 HIS A CE1   1 
ATOM 1479 N NE2   . HIS E 5 16 ? -17.810 -1.008  -29.605 1.00 161.70 ? 294 HIS A NE2   1 
ATOM 1480 N N     . LEU E 5 17 ? -16.737 -7.394  -32.216 1.00 131.44 ? 295 LEU A N     1 
ATOM 1481 C CA    . LEU E 5 17 ? -17.039 -8.663  -32.867 1.00 131.99 ? 295 LEU A CA    1 
ATOM 1482 C C     . LEU E 5 17 ? -17.537 -9.640  -31.817 1.00 127.10 ? 295 LEU A C     1 
ATOM 1483 O O     . LEU E 5 17 ? -18.575 -10.284 -31.973 1.00 132.11 ? 295 LEU A O     1 
ATOM 1484 C CB    . LEU E 5 17 ? -15.791 -9.236  -33.547 1.00 138.65 ? 295 LEU A CB    1 
ATOM 1485 C CG    . LEU E 5 17 ? -15.933 -10.155 -34.768 1.00 136.23 ? 295 LEU A CG    1 
ATOM 1486 C CD1   . LEU E 5 17 ? -14.680 -11.014 -34.879 1.00 137.60 ? 295 LEU A CD1   1 
ATOM 1487 C CD2   . LEU E 5 17 ? -17.178 -11.032 -34.717 1.00 130.20 ? 295 LEU A CD2   1 
ATOM 1488 N N     . THR E 5 18 ? -16.760 -9.739  -30.745 1.00 124.48 ? 296 THR A N     1 
ATOM 1489 C CA    . THR E 5 18 ? -17.030 -10.666 -29.654 1.00 128.74 ? 296 THR A CA    1 
ATOM 1490 C C     . THR E 5 18 ? -18.286 -10.307 -28.878 1.00 124.46 ? 296 THR A C     1 
ATOM 1491 O O     . THR E 5 18 ? -19.032 -11.185 -28.446 1.00 122.85 ? 296 THR A O     1 
ATOM 1492 C CB    . THR E 5 18 ? -15.848 -10.700 -28.657 1.00 129.98 ? 296 THR A CB    1 
ATOM 1493 O OG1   . THR E 5 18 ? -15.723 -9.430  -28.010 1.00 121.53 ? 296 THR A OG1   1 
ATOM 1494 C CG2   . THR E 5 18 ? -14.543 -11.014 -29.365 1.00 143.89 ? 296 THR A CG2   1 
ATOM 1495 N N     . HIS E 5 19 ? -18.525 -9.008  -28.735 1.00 123.14 ? 297 HIS A N     1 
ATOM 1496 C CA    . HIS E 5 19 ? -19.474 -8.505  -27.751 1.00 123.61 ? 297 HIS A CA    1 
ATOM 1497 C C     . HIS E 5 19 ? -20.402 -7.477  -28.377 1.00 128.42 ? 297 HIS A C     1 
ATOM 1498 O O     . HIS E 5 19 ? -20.296 -6.281  -28.107 1.00 133.78 ? 297 HIS A O     1 
ATOM 1499 C CB    . HIS E 5 19 ? -18.717 -7.901  -26.560 1.00 113.45 ? 297 HIS A CB    1 
ATOM 1500 C CG    . HIS E 5 19 ? -19.549 -7.735  -25.323 1.00 125.47 ? 297 HIS A CG    1 
ATOM 1501 N ND1   . HIS E 5 19 ? -19.425 -6.639  -24.495 1.00 134.68 ? 297 HIS A ND1   1 
ATOM 1502 C CD2   . HIS E 5 19 ? -20.479 -8.532  -24.754 1.00 128.10 ? 297 HIS A CD2   1 
ATOM 1503 C CE1   . HIS E 5 19 ? -20.261 -6.760  -23.480 1.00 129.13 ? 297 HIS A CE1   1 
ATOM 1504 N NE2   . HIS E 5 19 ? -20.916 -7.901  -23.612 1.00 129.06 ? 297 HIS A NE2   1 
ATOM 1505 N N     . PRO E 5 20 ? -21.319 -7.942  -29.231 1.00 128.88 ? 298 PRO A N     1 
ATOM 1506 C CA    . PRO E 5 20 ? -22.449 -7.092  -29.607 1.00 135.37 ? 298 PRO A CA    1 
ATOM 1507 C C     . PRO E 5 20 ? -23.329 -6.796  -28.389 1.00 139.89 ? 298 PRO A C     1 
ATOM 1508 O O     . PRO E 5 20 ? -24.468 -7.254  -28.272 1.00 142.34 ? 298 PRO A O     1 
ATOM 1509 C CB    . PRO E 5 20 ? -23.181 -7.917  -30.673 1.00 136.72 ? 298 PRO A CB    1 
ATOM 1510 C CG    . PRO E 5 20 ? -22.475 -9.261  -30.728 1.00 130.46 ? 298 PRO A CG    1 
ATOM 1511 C CD    . PRO E 5 20 ? -21.128 -9.059  -30.167 1.00 127.08 ? 298 PRO A CD    1 
ATOM 1512 N N     . TYR E 5 21 ? -22.751 -6.028  -27.469 1.00 142.61 ? 299 TYR A N     1 
ATOM 1513 C CA    . TYR E 5 21 ? -23.472 -5.434  -26.356 1.00 148.93 ? 299 TYR A CA    1 
ATOM 1514 C C     . TYR E 5 21 ? -23.075 -3.958  -26.344 1.00 150.39 ? 299 TYR A C     1 
ATOM 1515 O O     . TYR E 5 21 ? -22.463 -3.471  -25.395 1.00 168.37 ? 299 TYR A O     1 
ATOM 1516 C CB    . TYR E 5 21 ? -23.105 -6.145  -25.040 1.00 137.64 ? 299 TYR A CB    1 
ATOM 1517 C CG    . TYR E 5 21 ? -24.174 -7.064  -24.484 1.00 135.75 ? 299 TYR A CG    1 
ATOM 1518 C CD1   . TYR E 5 21 ? -24.115 -8.440  -24.684 1.00 136.53 ? 299 TYR A CD1   1 
ATOM 1519 C CD2   . TYR E 5 21 ? -25.231 -6.557  -23.746 1.00 134.93 ? 299 TYR A CD2   1 
ATOM 1520 C CE1   . TYR E 5 21 ? -25.088 -9.280  -24.170 1.00 138.99 ? 299 TYR A CE1   1 
ATOM 1521 C CE2   . TYR E 5 21 ? -26.204 -7.386  -23.233 1.00 136.27 ? 299 TYR A CE2   1 
ATOM 1522 C CZ    . TYR E 5 21 ? -26.130 -8.747  -23.447 1.00 138.72 ? 299 TYR A CZ    1 
ATOM 1523 O OH    . TYR E 5 21 ? -27.106 -9.568  -22.930 1.00 134.16 ? 299 TYR A OH    1 
ATOM 1524 N N     . PRO E 5 22 ? -23.451 -3.236  -27.410 1.00 150.70 ? 300 PRO A N     1 
ATOM 1525 C CA    . PRO E 5 22 ? -23.166 -1.807  -27.538 1.00 150.24 ? 300 PRO A CA    1 
ATOM 1526 C C     . PRO E 5 22 ? -23.908 -1.006  -26.473 1.00 154.04 ? 300 PRO A C     1 
ATOM 1527 O O     . PRO E 5 22 ? -24.994 -1.410  -26.058 1.00 156.01 ? 300 PRO A O     1 
ATOM 1528 C CB    . PRO E 5 22 ? -23.650 -1.474  -28.955 1.00 139.81 ? 300 PRO A CB    1 
ATOM 1529 C CG    . PRO E 5 22 ? -24.635 -2.548  -29.287 1.00 139.34 ? 300 PRO A CG    1 
ATOM 1530 C CD    . PRO E 5 22 ? -24.104 -3.767  -28.616 1.00 137.32 ? 300 PRO A CD    1 
ATOM 1531 N N     . SER E 5 23 ? -23.330 0.099   -26.016 1.00 149.86 ? 301 SER A N     1 
ATOM 1532 C CA    . SER E 5 23 ? -23.996 0.966   -25.048 1.00 142.92 ? 301 SER A CA    1 
ATOM 1533 C C     . SER E 5 23 ? -25.233 1.610   -25.671 1.00 140.99 ? 301 SER A C     1 
ATOM 1534 O O     . SER E 5 23 ? -25.237 1.928   -26.856 1.00 140.22 ? 301 SER A O     1 
ATOM 1535 C CB    . SER E 5 23 ? -23.030 2.032   -24.530 1.00 138.44 ? 301 SER A CB    1 
ATOM 1536 O OG    . SER E 5 23 ? -23.656 3.297   -24.455 1.00 134.73 ? 301 SER A OG    1 
ATOM 1537 N N     . GLU E 5 24 ? -26.278 1.776   -24.864 1.00 141.21 ? 302 GLU A N     1 
ATOM 1538 C CA    . GLU E 5 24 ? -27.580 2.249   -25.330 1.00 141.92 ? 302 GLU A CA    1 
ATOM 1539 C C     . GLU E 5 24 ? -27.573 3.638   -25.966 1.00 144.79 ? 302 GLU A C     1 
ATOM 1540 O O     . GLU E 5 24 ? -28.414 3.931   -26.818 1.00 143.51 ? 302 GLU A O     1 
ATOM 1541 C CB    . GLU E 5 24 ? -28.562 2.239   -24.161 1.00 142.21 ? 302 GLU A CB    1 
ATOM 1542 C CG    . GLU E 5 24 ? -29.023 0.853   -23.788 1.00 142.90 ? 302 GLU A CG    1 
ATOM 1543 C CD    . GLU E 5 24 ? -30.378 0.539   -24.362 1.00 144.63 ? 302 GLU A CD    1 
ATOM 1544 O OE1   . GLU E 5 24 ? -31.323 1.321   -24.123 1.00 139.52 ? 302 GLU A OE1   1 
ATOM 1545 O OE2   . GLU E 5 24 ? -30.499 -0.486  -25.064 1.00 155.23 ? 302 GLU A OE2   1 
ATOM 1546 N N     . GLU E 5 25 ? -26.649 4.492   -25.535 1.00 148.05 ? 303 GLU A N     1 
ATOM 1547 C CA    . GLU E 5 25 ? -26.430 5.781   -26.184 1.00 146.93 ? 303 GLU A CA    1 
ATOM 1548 C C     . GLU E 5 25 ? -25.254 5.724   -27.156 1.00 142.73 ? 303 GLU A C     1 
ATOM 1549 O O     . GLU E 5 25 ? -25.033 6.656   -27.926 1.00 141.19 ? 303 GLU A O     1 
ATOM 1550 C CB    . GLU E 5 25 ? -26.197 6.872   -25.143 1.00 164.56 ? 303 GLU A CB    1 
ATOM 1551 C CG    . GLU E 5 25 ? -27.477 7.419   -24.548 1.00 180.76 ? 303 GLU A CG    1 
ATOM 1552 C CD    . GLU E 5 25 ? -27.241 8.631   -23.677 1.00 179.10 ? 303 GLU A CD    1 
ATOM 1553 O OE1   . GLU E 5 25 ? -26.071 8.903   -23.339 1.00 181.66 ? 303 GLU A OE1   1 
ATOM 1554 O OE2   . GLU E 5 25 ? -28.228 9.314   -23.334 1.00 170.33 ? 303 GLU A OE2   1 
ATOM 1555 N N     . GLN E 5 26 ? -24.487 4.640   -27.101 1.00 140.95 ? 304 GLN A N     1 
ATOM 1556 C CA    . GLN E 5 26 ? -23.437 4.400   -28.087 1.00 135.46 ? 304 GLN A CA    1 
ATOM 1557 C C     . GLN E 5 26 ? -24.066 3.906   -29.388 1.00 127.55 ? 304 GLN A C     1 
ATOM 1558 O O     . GLN E 5 26 ? -23.429 3.907   -30.434 1.00 122.49 ? 304 GLN A O     1 
ATOM 1559 C CB    . GLN E 5 26 ? -22.414 3.396   -27.553 1.00 142.85 ? 304 GLN A CB    1 
ATOM 1560 C CG    . GLN E 5 26 ? -21.051 3.458   -28.231 1.00 140.03 ? 304 GLN A CG    1 
ATOM 1561 C CD    . GLN E 5 26 ? -20.197 4.608   -27.724 1.00 138.91 ? 304 GLN A CD    1 
ATOM 1562 O OE1   . GLN E 5 26 ? -20.703 5.543   -27.105 1.00 144.77 ? 304 GLN A OE1   1 
ATOM 1563 N NE2   . GLN E 5 26 ? -18.891 4.537   -27.969 1.00 150.24 ? 304 GLN A NE2   1 
ATOM 1564 N N     . LYS E 5 27 ? -25.322 3.479   -29.307 1.00 129.30 ? 305 LYS A N     1 
ATOM 1565 C CA    . LYS E 5 27 ? -26.093 3.145   -30.493 1.00 126.65 ? 305 LYS A CA    1 
ATOM 1566 C C     . LYS E 5 27 ? -26.266 4.415   -31.319 1.00 130.01 ? 305 LYS A C     1 
ATOM 1567 O O     . LYS E 5 27 ? -26.304 4.364   -32.544 1.00 127.51 ? 305 LYS A O     1 
ATOM 1568 C CB    . LYS E 5 27 ? -27.447 2.531   -30.106 1.00 134.55 ? 305 LYS A CB    1 
ATOM 1569 C CG    . LYS E 5 27 ? -27.333 1.586   -28.927 1.00 144.12 ? 305 LYS A CG    1 
ATOM 1570 C CD    . LYS E 5 27 ? -28.552 0.740   -28.655 1.00 147.76 ? 305 LYS A CD    1 
ATOM 1571 C CE    . LYS E 5 27 ? -28.134 -0.418  -27.771 1.00 148.82 ? 305 LYS A CE    1 
ATOM 1572 N NZ    . LYS E 5 27 ? -29.150 -0.763  -26.762 1.00 151.59 ? 305 LYS A NZ    1 
ATOM 1573 N N     . LYS E 5 28 ? -26.317 5.554   -30.630 1.00 129.65 ? 306 LYS A N     1 
ATOM 1574 C CA    . LYS E 5 28 ? -26.540 6.854   -31.259 1.00 123.62 ? 306 LYS A CA    1 
ATOM 1575 C C     . LYS E 5 28 ? -25.356 7.312   -32.093 1.00 126.35 ? 306 LYS A C     1 
ATOM 1576 O O     . LYS E 5 28 ? -25.521 7.763   -33.223 1.00 129.86 ? 306 LYS A O     1 
ATOM 1577 C CB    . LYS E 5 28 ? -26.831 7.917   -30.201 1.00 130.11 ? 306 LYS A CB    1 
ATOM 1578 C CG    . LYS E 5 28 ? -27.772 7.475   -29.099 1.00 137.76 ? 306 LYS A CG    1 
ATOM 1579 C CD    . LYS E 5 28 ? -29.123 7.042   -29.634 1.00 140.47 ? 306 LYS A CD    1 
ATOM 1580 C CE    . LYS E 5 28 ? -29.938 6.321   -28.572 1.00 157.84 ? 306 LYS A CE    1 
ATOM 1581 N NZ    . LYS E 5 28 ? -31.398 6.334   -28.867 1.00 151.85 ? 306 LYS A NZ    1 
ATOM 1582 N N     . GLN E 5 29 ? -24.162 7.206   -31.526 1.00 125.03 ? 307 GLN A N     1 
ATOM 1583 C CA    . GLN E 5 29 ? -22.956 7.646   -32.209 1.00 126.64 ? 307 GLN A CA    1 
ATOM 1584 C C     . GLN E 5 29 ? -22.638 6.712   -33.376 1.00 128.00 ? 307 GLN A C     1 
ATOM 1585 O O     . GLN E 5 29 ? -21.884 7.071   -34.282 1.00 132.76 ? 307 GLN A O     1 
ATOM 1586 C CB    . GLN E 5 29 ? -21.792 7.737   -31.220 1.00 136.02 ? 307 GLN A CB    1 
ATOM 1587 C CG    . GLN E 5 29 ? -21.934 8.916   -30.244 1.00 148.08 ? 307 GLN A CG    1 
ATOM 1588 C CD    . GLN E 5 29 ? -20.637 9.272   -29.552 1.00 146.96 ? 307 GLN A CD    1 
ATOM 1589 O OE1   . GLN E 5 29 ? -19.605 8.651   -29.793 1.00 146.63 ? 307 GLN A OE1   1 
ATOM 1590 N NE2   . GLN E 5 29 ? -20.681 10.282  -28.690 1.00 135.07 ? 307 GLN A NE2   1 
ATOM 1591 N N     . LEU E 5 30 ? -23.215 5.513   -33.342 1.00 130.53 ? 308 LEU A N     1 
ATOM 1592 C CA    . LEU E 5 30 ? -23.230 4.622   -34.501 1.00 126.30 ? 308 LEU A CA    1 
ATOM 1593 C C     . LEU E 5 30 ? -24.528 4.779   -35.297 1.00 126.67 ? 308 LEU A C     1 
ATOM 1594 O O     . LEU E 5 30 ? -24.565 4.483   -36.490 1.00 136.56 ? 308 LEU A O     1 
ATOM 1595 C CB    . LEU E 5 30 ? -23.053 3.170   -34.061 1.00 131.69 ? 308 LEU A CB    1 
ATOM 1596 C CG    . LEU E 5 30 ? -21.831 2.907   -33.178 1.00 137.97 ? 308 LEU A CG    1 
ATOM 1597 C CD1   . LEU E 5 30 ? -21.661 1.413   -32.937 1.00 144.18 ? 308 LEU A CD1   1 
ATOM 1598 C CD2   . LEU E 5 30 ? -20.560 3.522   -33.770 1.00 139.45 ? 308 LEU A CD2   1 
ATOM 1599 N N     . ALA E 5 31 ? -25.591 5.241   -34.642 1.00 122.43 ? 309 ALA A N     1 
ATOM 1600 C CA    . ALA E 5 31 ? -26.830 5.557   -35.349 1.00 119.32 ? 309 ALA A CA    1 
ATOM 1601 C C     . ALA E 5 31 ? -26.625 6.796   -36.202 1.00 122.79 ? 309 ALA A C     1 
ATOM 1602 O O     . ALA E 5 31 ? -26.211 6.684   -37.347 1.00 127.12 ? 309 ALA A O     1 
ATOM 1603 C CB    . ALA E 5 31 ? -27.993 5.765   -34.374 1.00 112.83 ? 309 ALA A CB    1 
ATOM 1604 N N     . GLN E 5 32 ? -26.836 7.970   -35.612 1.00 124.89 ? 310 GLN A N     1 
ATOM 1605 C CA    . GLN E 5 32 ? -26.975 9.230   -36.348 1.00 124.89 ? 310 GLN A CA    1 
ATOM 1606 C C     . GLN E 5 32 ? -25.896 9.465   -37.404 1.00 129.08 ? 310 GLN A C     1 
ATOM 1607 O O     . GLN E 5 32 ? -26.171 10.038  -38.459 1.00 132.36 ? 310 GLN A O     1 
ATOM 1608 C CB    . GLN E 5 32 ? -26.941 10.393  -35.362 1.00 124.46 ? 310 GLN A CB    1 
ATOM 1609 C CG    . GLN E 5 32 ? -25.557 10.566  -34.769 1.00 125.33 ? 310 GLN A CG    1 
ATOM 1610 C CD    . GLN E 5 32 ? -25.546 11.195  -33.398 1.00 128.28 ? 310 GLN A CD    1 
ATOM 1611 O OE1   . GLN E 5 32 ? -26.568 11.262  -32.718 1.00 122.01 ? 310 GLN A OE1   1 
ATOM 1612 N NE2   . GLN E 5 32 ? -24.372 11.647  -32.976 1.00 137.29 ? 310 GLN A NE2   1 
ATOM 1613 N N     . ASP E 5 33 ? -24.676 9.015   -37.122 1.00 133.15 ? 311 ASP A N     1 
ATOM 1614 C CA    . ASP E 5 33 ? -23.566 9.150   -38.058 1.00 136.97 ? 311 ASP A CA    1 
ATOM 1615 C C     . ASP E 5 33 ? -23.893 8.387   -39.337 1.00 136.15 ? 311 ASP A C     1 
ATOM 1616 O O     . ASP E 5 33 ? -23.403 8.715   -40.420 1.00 137.33 ? 311 ASP A O     1 
ATOM 1617 C CB    . ASP E 5 33 ? -22.269 8.636   -37.428 1.00 143.46 ? 311 ASP A CB    1 
ATOM 1618 C CG    . ASP E 5 33 ? -21.801 9.497   -36.271 1.00 145.87 ? 311 ASP A CG    1 
ATOM 1619 O OD1   . ASP E 5 33 ? -22.655 10.113  -35.600 1.00 139.92 ? 311 ASP A OD1   1 
ATOM 1620 O OD2   . ASP E 5 33 ? -20.577 9.554   -36.032 1.00 152.02 ? 311 ASP A OD2   1 
ATOM 1621 N N     . THR E 5 34 ? -24.713 7.352   -39.182 1.00 134.73 ? 312 THR A N     1 
ATOM 1622 C CA    . THR E 5 34 ? -25.350 6.667   -40.297 1.00 129.53 ? 312 THR A CA    1 
ATOM 1623 C C     . THR E 5 34 ? -26.860 6.890   -40.214 1.00 128.19 ? 312 THR A C     1 
ATOM 1624 O O     . THR E 5 34 ? -27.549 7.004   -41.227 1.00 128.83 ? 312 THR A O     1 
ATOM 1625 C CB    . THR E 5 34 ? -25.046 5.173   -40.279 1.00 134.49 ? 312 THR A CB    1 
ATOM 1626 O OG1   . THR E 5 34 ? -23.673 4.970   -39.924 1.00 133.45 ? 312 THR A OG1   1 
ATOM 1627 C CG2   . THR E 5 34 ? -25.310 4.572   -41.634 1.00 154.03 ? 312 THR A CG2   1 
ATOM 1628 N N     . GLY E 5 35 ? -27.355 6.941   -38.983 1.00 126.11 ? 313 GLY A N     1 
ATOM 1629 C CA    . GLY E 5 35 ? -28.713 7.344   -38.674 1.00 119.98 ? 313 GLY A CA    1 
ATOM 1630 C C     . GLY E 5 35 ? -29.821 6.376   -39.018 1.00 121.90 ? 313 GLY A C     1 
ATOM 1631 O O     . GLY E 5 35 ? -29.648 5.160   -38.966 1.00 118.29 ? 313 GLY A O     1 
ATOM 1632 N N     . LEU E 5 36 ? -30.978 6.951   -39.337 1.00 129.99 ? 314 LEU A N     1 
ATOM 1633 C CA    . LEU E 5 36 ? -32.233 6.226   -39.535 1.00 127.63 ? 314 LEU A CA    1 
ATOM 1634 C C     . LEU E 5 36 ? -32.759 5.707   -38.200 1.00 123.46 ? 314 LEU A C     1 
ATOM 1635 O O     . LEU E 5 36 ? -32.104 5.867   -37.170 1.00 124.10 ? 314 LEU A O     1 
ATOM 1636 C CB    . LEU E 5 36 ? -32.064 5.082   -40.540 1.00 123.11 ? 314 LEU A CB    1 
ATOM 1637 C CG    . LEU E 5 36 ? -32.893 5.219   -41.820 1.00 133.14 ? 314 LEU A CG    1 
ATOM 1638 C CD1   . LEU E 5 36 ? -32.640 4.022   -42.738 1.00 143.43 ? 314 LEU A CD1   1 
ATOM 1639 C CD2   . LEU E 5 36 ? -34.380 5.397   -41.493 1.00 132.82 ? 314 LEU A CD2   1 
ATOM 1640 N N     . THR E 5 37 ? -33.935 5.086   -38.226 1.00 124.34 ? 315 THR A N     1 
ATOM 1641 C CA    . THR E 5 37 ? -34.659 4.772   -37.004 1.00 130.18 ? 315 THR A CA    1 
ATOM 1642 C C     . THR E 5 37 ? -33.805 3.888   -36.108 1.00 131.71 ? 315 THR A C     1 
ATOM 1643 O O     . THR E 5 37 ? -33.278 2.874   -36.553 1.00 129.14 ? 315 THR A O     1 
ATOM 1644 C CB    . THR E 5 37 ? -36.003 4.071   -37.319 1.00 133.86 ? 315 THR A CB    1 
ATOM 1645 O OG1   . THR E 5 37 ? -36.980 5.049   -37.700 1.00 139.49 ? 315 THR A OG1   1 
ATOM 1646 C CG2   . THR E 5 37 ? -36.515 3.286   -36.122 1.00 123.99 ? 315 THR A CG2   1 
ATOM 1647 N N     . ILE E 5 38 ? -33.710 4.265   -34.837 1.00 140.17 ? 316 ILE A N     1 
ATOM 1648 C CA    . ILE E 5 38 ? -32.824 3.604   -33.890 1.00 139.77 ? 316 ILE A CA    1 
ATOM 1649 C C     . ILE E 5 38 ? -33.236 2.146   -33.704 1.00 137.33 ? 316 ILE A C     1 
ATOM 1650 O O     . ILE E 5 38 ? -32.407 1.279   -33.421 1.00 145.03 ? 316 ILE A O     1 
ATOM 1651 C CB    . ILE E 5 38 ? -32.831 4.325   -32.525 1.00 137.82 ? 316 ILE A CB    1 
ATOM 1652 C CG1   . ILE E 5 38 ? -31.550 4.024   -31.752 1.00 139.24 ? 316 ILE A CG1   1 
ATOM 1653 C CG2   . ILE E 5 38 ? -34.046 3.931   -31.720 1.00 135.73 ? 316 ILE A CG2   1 
ATOM 1654 C CD1   . ILE E 5 38 ? -30.367 4.757   -32.295 1.00 129.92 ? 316 ILE A CD1   1 
ATOM 1655 N N     . LEU E 5 39 ? -34.532 1.892   -33.854 1.00 127.67 ? 317 LEU A N     1 
ATOM 1656 C CA    . LEU E 5 39 ? -35.085 0.541   -33.800 1.00 127.73 ? 317 LEU A CA    1 
ATOM 1657 C C     . LEU E 5 39 ? -34.619 -0.344  -34.959 1.00 138.89 ? 317 LEU A C     1 
ATOM 1658 O O     . LEU E 5 39 ? -34.449 -1.548  -34.791 1.00 146.57 ? 317 LEU A O     1 
ATOM 1659 C CB    . LEU E 5 39 ? -36.614 0.621   -33.782 1.00 124.96 ? 317 LEU A CB    1 
ATOM 1660 C CG    . LEU E 5 39 ? -37.425 -0.628  -34.142 1.00 133.82 ? 317 LEU A CG    1 
ATOM 1661 C CD1   . LEU E 5 39 ? -37.092 -1.798  -33.221 1.00 130.00 ? 317 LEU A CD1   1 
ATOM 1662 C CD2   . LEU E 5 39 ? -38.923 -0.304  -34.100 1.00 153.39 ? 317 LEU A CD2   1 
ATOM 1663 N N     . GLN E 5 40 ? -34.411 0.255   -36.128 1.00 136.92 ? 318 GLN A N     1 
ATOM 1664 C CA    . GLN E 5 40 ? -33.950 -0.482  -37.308 1.00 134.25 ? 318 GLN A CA    1 
ATOM 1665 C C     . GLN E 5 40 ? -32.483 -0.896  -37.197 1.00 136.97 ? 318 GLN A C     1 
ATOM 1666 O O     . GLN E 5 40 ? -32.033 -1.796  -37.903 1.00 140.48 ? 318 GLN A O     1 
ATOM 1667 C CB    . GLN E 5 40 ? -34.149 0.363   -38.571 1.00 129.92 ? 318 GLN A CB    1 
ATOM 1668 C CG    . GLN E 5 40 ? -35.598 0.749   -38.855 1.00 127.60 ? 318 GLN A CG    1 
ATOM 1669 C CD    . GLN E 5 40 ? -35.728 1.655   -40.061 1.00 120.30 ? 318 GLN A CD    1 
ATOM 1670 O OE1   . GLN E 5 40 ? -34.739 2.201   -40.544 1.00 117.76 ? 318 GLN A OE1   1 
ATOM 1671 N NE2   . GLN E 5 40 ? -36.949 1.821   -40.554 1.00 117.42 ? 318 GLN A NE2   1 
ATOM 1672 N N     . VAL E 5 41 ? -31.750 -0.234  -36.307 1.00 138.60 ? 319 VAL A N     1 
ATOM 1673 C CA    . VAL E 5 41 ? -30.298 -0.351  -36.260 1.00 147.83 ? 319 VAL A CA    1 
ATOM 1674 C C     . VAL E 5 41 ? -29.870 -1.480  -35.335 1.00 148.91 ? 319 VAL A C     1 
ATOM 1675 O O     . VAL E 5 41 ? -28.872 -2.154  -35.588 1.00 152.01 ? 319 VAL A O     1 
ATOM 1676 C CB    . VAL E 5 41 ? -29.638 0.964   -35.786 1.00 147.86 ? 319 VAL A CB    1 
ATOM 1677 C CG1   . VAL E 5 41 ? -28.227 1.084   -36.335 1.00 142.66 ? 319 VAL A CG1   1 
ATOM 1678 C CG2   . VAL E 5 41 ? -30.466 2.155   -36.210 1.00 140.99 ? 319 VAL A CG2   1 
ATOM 1679 N N     . ASN E 5 42 ? -30.613 -1.668  -34.248 1.00 147.07 ? 320 ASN A N     1 
ATOM 1680 C CA    . ASN E 5 42 ? -30.376 -2.813  -33.386 1.00 142.19 ? 320 ASN A CA    1 
ATOM 1681 C C     . ASN E 5 42 ? -30.644 -4.069  -34.198 1.00 135.41 ? 320 ASN A C     1 
ATOM 1682 O O     . ASN E 5 42 ? -29.894 -5.037  -34.131 1.00 134.06 ? 320 ASN A O     1 
ATOM 1683 C CB    . ASN E 5 42 ? -31.275 -2.791  -32.140 1.00 144.53 ? 320 ASN A CB    1 
ATOM 1684 C CG    . ASN E 5 42 ? -31.570 -1.388  -31.641 1.00 147.17 ? 320 ASN A CG    1 
ATOM 1685 O OD1   . ASN E 5 42 ? -30.734 -0.755  -31.001 1.00 153.74 ? 320 ASN A OD1   1 
ATOM 1686 N ND2   . ASN E 5 42 ? -32.783 -0.911  -31.907 1.00 136.79 ? 320 ASN A ND2   1 
ATOM 1687 N N     . ASN E 5 43 ? -31.693 -4.007  -35.014 1.00 135.68 ? 321 ASN A N     1 
ATOM 1688 C CA    . ASN E 5 43 ? -32.130 -5.146  -35.811 1.00 136.97 ? 321 ASN A CA    1 
ATOM 1689 C C     . ASN E 5 43 ? -31.091 -5.595  -36.832 1.00 140.11 ? 321 ASN A C     1 
ATOM 1690 O O     . ASN E 5 43 ? -30.925 -6.789  -37.072 1.00 146.42 ? 321 ASN A O     1 
ATOM 1691 C CB    . ASN E 5 43 ? -33.427 -4.801  -36.548 1.00 133.55 ? 321 ASN A CB    1 
ATOM 1692 C CG    . ASN E 5 43 ? -34.598 -4.587  -35.612 1.00 134.51 ? 321 ASN A CG    1 
ATOM 1693 O OD1   . ASN E 5 43 ? -34.934 -5.454  -34.809 1.00 146.64 ? 321 ASN A OD1   1 
ATOM 1694 N ND2   . ASN E 5 43 ? -35.232 -3.425  -35.717 1.00 147.71 ? 321 ASN A ND2   1 
ATOM 1695 N N     . TRP E 5 44 ? -30.398 -4.642  -37.444 1.00 142.61 ? 322 TRP A N     1 
ATOM 1696 C CA    . TRP E 5 44 ? -29.416 -4.986  -38.460 1.00 154.98 ? 322 TRP A CA    1 
ATOM 1697 C C     . TRP E 5 44 ? -28.194 -5.663  -37.853 1.00 152.54 ? 322 TRP A C     1 
ATOM 1698 O O     . TRP E 5 44 ? -27.539 -6.478  -38.500 1.00 167.89 ? 322 TRP A O     1 
ATOM 1699 C CB    . TRP E 5 44 ? -28.982 -3.754  -39.253 1.00 169.63 ? 322 TRP A CB    1 
ATOM 1700 C CG    . TRP E 5 44 ? -28.094 -4.159  -40.366 1.00 181.97 ? 322 TRP A CG    1 
ATOM 1701 C CD1   . TRP E 5 44 ? -28.456 -4.840  -41.486 1.00 185.44 ? 322 TRP A CD1   1 
ATOM 1702 C CD2   . TRP E 5 44 ? -26.686 -3.956  -40.455 1.00 175.64 ? 322 TRP A CD2   1 
ATOM 1703 N NE1   . TRP E 5 44 ? -27.360 -5.067  -42.278 1.00 186.31 ? 322 TRP A NE1   1 
ATOM 1704 C CE2   . TRP E 5 44 ? -26.259 -4.530  -41.668 1.00 179.22 ? 322 TRP A CE2   1 
ATOM 1705 C CE3   . TRP E 5 44 ? -25.745 -3.337  -39.633 1.00 168.16 ? 322 TRP A CE3   1 
ATOM 1706 C CZ2   . TRP E 5 44 ? -24.934 -4.504  -42.079 1.00 174.51 ? 322 TRP A CZ2   1 
ATOM 1707 C CZ3   . TRP E 5 44 ? -24.430 -3.312  -40.045 1.00 157.13 ? 322 TRP A CZ3   1 
ATOM 1708 C CH2   . TRP E 5 44 ? -24.035 -3.892  -41.254 1.00 159.71 ? 322 TRP A CH2   1 
ATOM 1709 N N     . PHE E 5 45 ? -27.897 -5.326  -36.605 1.00 140.27 ? 323 PHE A N     1 
ATOM 1710 C CA    . PHE E 5 45 ? -26.766 -5.919  -35.902 1.00 139.22 ? 323 PHE A CA    1 
ATOM 1711 C C     . PHE E 5 45 ? -27.133 -7.201  -35.179 1.00 140.71 ? 323 PHE A C     1 
ATOM 1712 O O     . PHE E 5 45 ? -26.296 -7.808  -34.518 1.00 141.05 ? 323 PHE A O     1 
ATOM 1713 C CB    . PHE E 5 45 ? -26.161 -4.915  -34.933 1.00 139.52 ? 323 PHE A CB    1 
ATOM 1714 C CG    . PHE E 5 45 ? -24.861 -4.390  -35.408 1.00 152.16 ? 323 PHE A CG    1 
ATOM 1715 C CD1   . PHE E 5 45 ? -23.671 -4.838  -34.874 1.00 157.57 ? 323 PHE A CD1   1 
ATOM 1716 C CD2   . PHE E 5 45 ? -24.830 -3.494  -36.450 1.00 154.15 ? 323 PHE A CD2   1 
ATOM 1717 C CE1   . PHE E 5 45 ? -22.473 -4.363  -35.354 1.00 152.16 ? 323 PHE A CE1   1 
ATOM 1718 C CE2   . PHE E 5 45 ? -23.646 -3.019  -36.929 1.00 149.51 ? 323 PHE A CE2   1 
ATOM 1719 C CZ    . PHE E 5 45 ? -22.461 -3.450  -36.391 1.00 145.07 ? 323 PHE A CZ    1 
ATOM 1720 N N     . ILE E 5 46 ? -28.387 -7.612  -35.323 1.00 141.64 ? 324 ILE A N     1 
ATOM 1721 C CA    . ILE E 5 46 ? -28.879 -8.850  -34.730 1.00 143.79 ? 324 ILE A CA    1 
ATOM 1722 C C     . ILE E 5 46 ? -29.601 -9.640  -35.814 1.00 147.04 ? 324 ILE A C     1 
ATOM 1723 O O     . ILE E 5 46 ? -30.444 -10.489 -35.535 1.00 153.07 ? 324 ILE A O     1 
ATOM 1724 C CB    . ILE E 5 46 ? -29.792 -8.578  -33.519 1.00 146.00 ? 324 ILE A CB    1 
ATOM 1725 C CG1   . ILE E 5 46 ? -31.073 -7.871  -33.945 1.00 146.96 ? 324 ILE A CG1   1 
ATOM 1726 C CG2   . ILE E 5 46 ? -29.050 -7.735  -32.500 1.00 144.69 ? 324 ILE A CG2   1 
ATOM 1727 C CD1   . ILE E 5 46 ? -31.802 -7.155  -32.805 1.00 151.22 ? 324 ILE A CD1   1 
ATOM 1728 N N     . ASN E 5 47 ? -29.248 -9.332  -37.061 1.00 146.57 ? 325 ASN A N     1 
ATOM 1729 C CA    . ASN E 5 47 ? -29.621 -10.138 -38.215 1.00 150.52 ? 325 ASN A CA    1 
ATOM 1730 C C     . ASN E 5 47 ? -28.374 -10.445 -39.048 1.00 147.29 ? 325 ASN A C     1 
ATOM 1731 O O     . ASN E 5 47 ? -28.446 -10.640 -40.260 1.00 152.54 ? 325 ASN A O     1 
ATOM 1732 C CB    . ASN E 5 47 ? -30.678 -9.413  -39.050 1.00 151.53 ? 325 ASN A CB    1 
ATOM 1733 C CG    . ASN E 5 47 ? -31.320 -10.308 -40.083 1.00 145.38 ? 325 ASN A CG    1 
ATOM 1734 O OD1   . ASN E 5 47 ? -31.096 -11.515 -40.102 1.00 149.86 ? 325 ASN A OD1   1 
ATOM 1735 N ND2   . ASN E 5 47 ? -32.133 -9.722  -40.945 1.00 146.90 ? 325 ASN A ND2   1 
ATOM 1736 N N     . ALA E 5 48 ? -27.229 -10.495 -38.372 1.00 147.92 ? 326 ALA A N     1 
ATOM 1737 C CA    . ALA E 5 48 ? -25.937 -10.672 -39.030 1.00 151.94 ? 326 ALA A CA    1 
ATOM 1738 C C     . ALA E 5 48 ? -24.955 -11.456 -38.158 1.00 155.58 ? 326 ALA A C     1 
ATOM 1739 O O     . ALA E 5 48 ? -23.842 -11.751 -38.589 1.00 170.20 ? 326 ALA A O     1 
ATOM 1740 C CB    . ALA E 5 48 ? -25.342 -9.312  -39.404 1.00 154.66 ? 326 ALA A CB    1 
ATOM 1741 N N     . ARG E 5 49 ? -25.358 -11.790 -36.934 1.00 149.90 ? 327 ARG A N     1 
ATOM 1742 C CA    . ARG E 5 49 ? -24.533 -12.646 -36.082 1.00 146.81 ? 327 ARG A CA    1 
ATOM 1743 C C     . ARG E 5 49 ? -24.392 -14.005 -36.749 1.00 148.09 ? 327 ARG A C     1 
ATOM 1744 O O     . ARG E 5 49 ? -23.386 -14.694 -36.584 1.00 149.68 ? 327 ARG A O     1 
ATOM 1745 C CB    . ARG E 5 49 ? -25.135 -12.824 -34.681 1.00 145.67 ? 327 ARG A CB    1 
ATOM 1746 C CG    . ARG E 5 49 ? -26.210 -11.830 -34.285 1.00 141.18 ? 327 ARG A CG    1 
ATOM 1747 C CD    . ARG E 5 49 ? -26.418 -11.802 -32.783 1.00 140.18 ? 327 ARG A CD    1 
ATOM 1748 N NE    . ARG E 5 49 ? -26.568 -10.438 -32.293 1.00 139.55 ? 327 ARG A NE    1 
ATOM 1749 C CZ    . ARG E 5 49 ? -25.628 -9.503  -32.375 1.00 140.41 ? 327 ARG A CZ    1 
ATOM 1750 N NH1   . ARG E 5 49 ? -24.460 -9.766  -32.947 1.00 136.62 ? 327 ARG A NH1   1 
ATOM 1751 N NH2   . ARG E 5 49 ? -25.866 -8.288  -31.908 1.00 144.32 ? 327 ARG A NH2   1 
ATOM 1752 N N     . ARG E 5 50 ? -25.416 -14.367 -37.514 1.00 151.33 ? 328 ARG A N     1 
ATOM 1753 C CA    . ARG E 5 50 ? -25.543 -15.695 -38.103 1.00 156.99 ? 328 ARG A CA    1 
ATOM 1754 C C     . ARG E 5 50 ? -25.168 -15.759 -39.584 1.00 159.05 ? 328 ARG A C     1 
ATOM 1755 O O     . ARG E 5 50 ? -24.991 -16.852 -40.120 1.00 163.51 ? 328 ARG A O     1 
ATOM 1756 C CB    . ARG E 5 50 ? -26.980 -16.196 -37.933 1.00 161.47 ? 328 ARG A CB    1 
ATOM 1757 C CG    . ARG E 5 50 ? -28.038 -15.203 -38.359 1.00 153.03 ? 328 ARG A CG    1 
ATOM 1758 C CD    . ARG E 5 50 ? -28.563 -14.394 -37.182 1.00 153.13 ? 328 ARG A CD    1 
ATOM 1759 N NE    . ARG E 5 50 ? -29.771 -13.648 -37.537 1.00 149.56 ? 328 ARG A NE    1 
ATOM 1760 C CZ    . ARG E 5 50 ? -31.013 -14.031 -37.248 1.00 151.15 ? 328 ARG A CZ    1 
ATOM 1761 N NH1   . ARG E 5 50 ? -31.242 -15.156 -36.581 1.00 134.36 ? 328 ARG A NH1   1 
ATOM 1762 N NH2   . ARG E 5 50 ? -32.035 -13.276 -37.628 1.00 173.22 ? 328 ARG A NH2   1 
ATOM 1763 N N     . ARG E 5 51 ? -25.045 -14.608 -40.246 1.00 161.94 ? 329 ARG A N     1 
ATOM 1764 C CA    . ARG E 5 51 ? -24.791 -14.602 -41.690 1.00 163.07 ? 329 ARG A CA    1 
ATOM 1765 C C     . ARG E 5 51 ? -23.483 -15.315 -41.965 1.00 165.16 ? 329 ARG A C     1 
ATOM 1766 O O     . ARG E 5 51 ? -23.342 -16.038 -42.953 1.00 162.60 ? 329 ARG A O     1 
ATOM 1767 C CB    . ARG E 5 51 ? -24.716 -13.174 -42.255 1.00 159.45 ? 329 ARG A CB    1 
ATOM 1768 C CG    . ARG E 5 51 ? -24.447 -13.109 -43.769 1.00 168.72 ? 329 ARG A CG    1 
ATOM 1769 C CD    . ARG E 5 51 ? -23.814 -11.787 -44.178 1.00 170.60 ? 329 ARG A CD    1 
ATOM 1770 N NE    . ARG E 5 51 ? -22.365 -11.898 -44.368 1.00 170.97 ? 329 ARG A NE    1 
ATOM 1771 C CZ    . ARG E 5 51 ? -21.763 -12.069 -45.543 1.00 164.88 ? 329 ARG A CZ    1 
ATOM 1772 N NH1   . ARG E 5 51 ? -22.467 -12.150 -46.664 1.00 165.89 ? 329 ARG A NH1   1 
ATOM 1773 N NH2   . ARG E 5 51 ? -20.441 -12.157 -45.598 1.00 159.79 ? 329 ARG A NH2   1 
ATOM 1774 N N     . ILE E 5 52 ? -22.541 -15.110 -41.055 1.00 169.76 ? 330 ILE A N     1 
ATOM 1775 C CA    . ILE E 5 52 ? -21.240 -15.747 -41.100 1.00 176.13 ? 330 ILE A CA    1 
ATOM 1776 C C     . ILE E 5 52 ? -20.794 -15.886 -39.650 1.00 169.83 ? 330 ILE A C     1 
ATOM 1777 O O     . ILE E 5 52 ? -21.608 -15.744 -38.742 1.00 164.47 ? 330 ILE A O     1 
ATOM 1778 C CB    . ILE E 5 52 ? -20.217 -14.946 -41.933 1.00 178.63 ? 330 ILE A CB    1 
ATOM 1779 C CG1   . ILE E 5 52 ? -20.009 -13.550 -41.342 1.00 175.27 ? 330 ILE A CG1   1 
ATOM 1780 C CG2   . ILE E 5 52 ? -20.679 -14.840 -43.387 1.00 178.31 ? 330 ILE A CG2   1 
ATOM 1781 C CD1   . ILE E 5 52 ? -18.566 -13.104 -41.353 1.00 172.18 ? 330 ILE A CD1   1 
ATOM 1782 N N     . VAL E 5 53 ? -19.515 -16.176 -39.430 1.00 171.05 ? 331 VAL A N     1 
ATOM 1783 C CA    . VAL E 5 53 ? -18.975 -16.494 -38.097 1.00 169.77 ? 331 VAL A CA    1 
ATOM 1784 C C     . VAL E 5 53 ? -19.669 -17.739 -37.510 1.00 170.31 ? 331 VAL A C     1 
ATOM 1785 O O     . VAL E 5 53 ? -18.994 -18.638 -37.011 1.00 172.80 ? 331 VAL A O     1 
ATOM 1786 C CB    . VAL E 5 53 ? -19.062 -15.274 -37.100 1.00 168.78 ? 331 VAL A CB    1 
ATOM 1787 C CG1   . VAL E 5 53 ? -19.243 -13.938 -37.848 1.00 175.64 ? 331 VAL A CG1   1 
ATOM 1788 C CG2   . VAL E 5 53 ? -20.127 -15.465 -36.001 1.00 163.02 ? 331 VAL A CG2   1 
ATOM 1789 N N     . GLN E 5 54 ? -20.998 -17.790 -37.581 1.00 165.49 ? 332 GLN A N     1 
ATOM 1790 C CA    . GLN E 5 54 ? -21.793 -18.973 -37.228 1.00 167.59 ? 332 GLN A CA    1 
ATOM 1791 C C     . GLN E 5 54 ? -21.413 -20.251 -37.996 1.00 182.03 ? 332 GLN A C     1 
ATOM 1792 O O     . GLN E 5 54 ? -21.323 -21.324 -37.402 1.00 188.24 ? 332 GLN A O     1 
ATOM 1793 C CB    . GLN E 5 54 ? -23.279 -18.670 -37.463 1.00 156.04 ? 332 GLN A CB    1 
ATOM 1794 C CG    . GLN E 5 54 ? -24.203 -18.910 -36.264 1.00 149.54 ? 332 GLN A CG    1 
ATOM 1795 C CD    . GLN E 5 54 ? -23.971 -17.928 -35.132 1.00 154.56 ? 332 GLN A CD    1 
ATOM 1796 O OE1   . GLN E 5 54 ? -22.853 -17.463 -34.918 1.00 162.84 ? 332 GLN A OE1   1 
ATOM 1797 N NE2   . GLN E 5 54 ? -25.032 -17.602 -34.402 1.00 149.28 ? 332 GLN A NE2   1 
ATOM 1798 N N     . PRO E 5 55 ? -21.236 -20.156 -39.325 1.00 179.97 ? 333 PRO A N     1 
ATOM 1799 C CA    . PRO E 5 55 ? -20.749 -21.318 -40.071 1.00 188.61 ? 333 PRO A CA    1 
ATOM 1800 C C     . PRO E 5 55 ? -19.228 -21.448 -39.988 1.00 195.99 ? 333 PRO A C     1 
ATOM 1801 O O     . PRO E 5 55 ? -18.679 -22.508 -40.296 1.00 206.89 ? 333 PRO A O     1 
ATOM 1802 C CB    . PRO E 5 55 ? -21.207 -21.023 -41.497 1.00 191.64 ? 333 PRO A CB    1 
ATOM 1803 C CG    . PRO E 5 55 ? -21.158 -19.531 -41.592 1.00 180.65 ? 333 PRO A CG    1 
ATOM 1804 C CD    . PRO E 5 55 ? -21.375 -18.979 -40.197 1.00 178.72 ? 333 PRO A CD    1 
ATOM 1805 N N     . MET E 5 56 ? -18.564 -20.376 -39.560 1.00 189.47 ? 334 MET A N     1 
ATOM 1806 C CA    . MET E 5 56 ? -17.105 -20.313 -39.547 1.00 185.22 ? 334 MET A CA    1 
ATOM 1807 C C     . MET E 5 56 ? -16.501 -21.215 -38.472 1.00 186.03 ? 334 MET A C     1 
ATOM 1808 O O     . MET E 5 56 ? -15.304 -21.513 -38.507 1.00 199.98 ? 334 MET A O     1 
ATOM 1809 C CB    . MET E 5 56 ? -16.642 -18.869 -39.343 1.00 177.36 ? 334 MET A CB    1 
ATOM 1810 C CG    . MET E 5 56 ? -17.147 -17.911 -40.415 1.00 181.48 ? 334 MET A CG    1 
ATOM 1811 S SD    . MET E 5 56 ? -16.446 -18.243 -42.040 1.00 217.75 ? 334 MET A SD    1 
ATOM 1812 C CE    . MET E 5 56 ? -14.774 -17.658 -41.792 1.00 179.56 ? 334 MET A CE    1 
ATOM 1813 N N     . ILE E 5 57 ? -17.322 -21.632 -37.511 1.00 175.43 ? 335 ILE A N     1 
ATOM 1814 C CA    . ILE E 5 57 ? -16.893 -22.608 -36.515 1.00 166.92 ? 335 ILE A CA    1 
ATOM 1815 C C     . ILE E 5 57 ? -16.492 -23.911 -37.199 1.00 196.06 ? 335 ILE A C     1 
ATOM 1816 O O     . ILE E 5 57 ? -17.347 -24.721 -37.563 1.00 224.99 ? 335 ILE A O     1 
ATOM 1817 C CB    . ILE E 5 57 ? -17.998 -22.913 -35.469 1.00 159.75 ? 335 ILE A CB    1 
ATOM 1818 C CG1   . ILE E 5 57 ? -18.347 -21.665 -34.644 1.00 155.81 ? 335 ILE A CG1   1 
ATOM 1819 C CG2   . ILE E 5 57 ? -17.553 -24.073 -34.562 1.00 157.02 ? 335 ILE A CG2   1 
ATOM 1820 C CD1   . ILE E 5 57 ? -19.641 -20.994 -35.029 1.00 162.39 ? 335 ILE A CD1   1 
ATOM 1821 N N     . PHE F 5 1  ? 5.454   19.757  -45.673 1.00 165.82 ? 279 PHE B N     1 
ATOM 1822 C CA    . PHE F 5 1  ? 4.729   19.444  -46.894 1.00 170.02 ? 279 PHE B CA    1 
ATOM 1823 C C     . PHE F 5 1  ? 5.484   20.133  -48.076 1.00 182.38 ? 279 PHE B C     1 
ATOM 1824 O O     . PHE F 5 1  ? 6.575   19.676  -48.407 1.00 187.56 ? 279 PHE B O     1 
ATOM 1825 C CB    . PHE F 5 1  ? 3.256   19.845  -46.711 1.00 171.90 ? 279 PHE B CB    1 
ATOM 1826 C CG    . PHE F 5 1  ? 2.296   19.184  -47.677 1.00 173.39 ? 279 PHE B CG    1 
ATOM 1827 C CD1   . PHE F 5 1  ? 2.731   18.243  -48.595 1.00 176.00 ? 279 PHE B CD1   1 
ATOM 1828 C CD2   . PHE F 5 1  ? 0.954   19.537  -47.680 1.00 159.75 ? 279 PHE B CD2   1 
ATOM 1829 C CE1   . PHE F 5 1  ? 1.845   17.659  -49.481 1.00 162.44 ? 279 PHE B CE1   1 
ATOM 1830 C CE2   . PHE F 5 1  ? 0.071   18.953  -48.566 1.00 152.62 ? 279 PHE B CE2   1 
ATOM 1831 C CZ    . PHE F 5 1  ? 0.518   18.015  -49.465 1.00 153.87 ? 279 PHE B CZ    1 
ATOM 1832 N N     . PRO F 5 2  ? 4.951   21.207  -48.714 1.00 186.39 ? 280 PRO B N     1 
ATOM 1833 C CA    . PRO F 5 2  ? 5.919   21.850  -49.617 1.00 174.01 ? 280 PRO B CA    1 
ATOM 1834 C C     . PRO F 5 2  ? 7.181   22.459  -49.000 1.00 165.60 ? 280 PRO B C     1 
ATOM 1835 O O     . PRO F 5 2  ? 7.157   22.981  -47.887 1.00 171.86 ? 280 PRO B O     1 
ATOM 1836 C CB    . PRO F 5 2  ? 5.096   22.982  -50.236 1.00 174.26 ? 280 PRO B CB    1 
ATOM 1837 C CG    . PRO F 5 2  ? 3.780   22.426  -50.358 1.00 177.49 ? 280 PRO B CG    1 
ATOM 1838 C CD    . PRO F 5 2  ? 3.578   21.548  -49.143 1.00 185.55 ? 280 PRO B CD    1 
ATOM 1839 N N     . LYS F 5 3  ? 8.279   22.382  -49.749 1.00 162.58 ? 281 LYS B N     1 
ATOM 1840 C CA    . LYS F 5 3  ? 9.506   23.112  -49.440 1.00 156.34 ? 281 LYS B CA    1 
ATOM 1841 C C     . LYS F 5 3  ? 10.078  22.744  -48.070 1.00 151.30 ? 281 LYS B C     1 
ATOM 1842 O O     . LYS F 5 3  ? 9.811   21.658  -47.557 1.00 154.19 ? 281 LYS B O     1 
ATOM 1843 C CB    . LYS F 5 3  ? 9.242   24.620  -49.542 1.00 158.65 ? 281 LYS B CB    1 
ATOM 1844 C CG    . LYS F 5 3  ? 9.154   25.115  -50.972 1.00 164.11 ? 281 LYS B CG    1 
ATOM 1845 C CD    . LYS F 5 3  ? 10.522  25.582  -51.457 1.00 166.30 ? 281 LYS B CD    1 
ATOM 1846 C CE    . LYS F 5 3  ? 10.435  26.302  -52.789 1.00 167.80 ? 281 LYS B CE    1 
ATOM 1847 N NZ    . LYS F 5 3  ? 11.718  26.940  -53.201 1.00 156.31 ? 281 LYS B NZ    1 
ATOM 1848 N N     . VAL F 5 4  ? 10.865  23.643  -47.487 1.00 148.78 ? 282 VAL B N     1 
ATOM 1849 C CA    . VAL F 5 4  ? 11.668  23.330  -46.319 1.00 149.34 ? 282 VAL B CA    1 
ATOM 1850 C C     . VAL F 5 4  ? 10.867  22.963  -45.070 1.00 150.77 ? 282 VAL B C     1 
ATOM 1851 O O     . VAL F 5 4  ? 11.420  22.343  -44.178 1.00 148.95 ? 282 VAL B O     1 
ATOM 1852 C CB    . VAL F 5 4  ? 12.606  24.507  -45.965 1.00 144.09 ? 282 VAL B CB    1 
ATOM 1853 C CG1   . VAL F 5 4  ? 13.715  24.642  -47.015 1.00 136.38 ? 282 VAL B CG1   1 
ATOM 1854 C CG2   . VAL F 5 4  ? 11.816  25.807  -45.811 1.00 125.95 ? 282 VAL B CG2   1 
ATOM 1855 N N     . ALA F 5 5  ? 9.586   23.318  -44.993 1.00 151.76 ? 283 ALA B N     1 
ATOM 1856 C CA    . ALA F 5 5  ? 8.810   23.055  -43.775 1.00 150.96 ? 283 ALA B CA    1 
ATOM 1857 C C     . ALA F 5 5  ? 8.871   21.577  -43.385 1.00 154.90 ? 283 ALA B C     1 
ATOM 1858 O O     . ALA F 5 5  ? 8.959   21.244  -42.204 1.00 162.02 ? 283 ALA B O     1 
ATOM 1859 C CB    . ALA F 5 5  ? 7.351   23.492  -43.966 1.00 151.07 ? 283 ALA B CB    1 
ATOM 1860 N N     . THR F 5 6  ? 8.825   20.703  -44.383 1.00 155.37 ? 284 THR B N     1 
ATOM 1861 C CA    . THR F 5 6  ? 9.103   19.283  -44.192 1.00 161.62 ? 284 THR B CA    1 
ATOM 1862 C C     . THR F 5 6  ? 10.567  19.036  -43.826 1.00 159.82 ? 284 THR B C     1 
ATOM 1863 O O     . THR F 5 6  ? 10.881  18.140  -43.046 1.00 163.52 ? 284 THR B O     1 
ATOM 1864 C CB    . THR F 5 6  ? 8.782   18.485  -45.472 1.00 170.15 ? 284 THR B CB    1 
ATOM 1865 O OG1   . THR F 5 6  ? 7.490   18.856  -45.965 1.00 168.51 ? 284 THR B OG1   1 
ATOM 1866 C CG2   . THR F 5 6  ? 8.814   16.991  -45.211 1.00 167.59 ? 284 THR B CG2   1 
ATOM 1867 N N     . ASN F 5 7  ? 11.449  19.841  -44.408 1.00 147.91 ? 285 ASN B N     1 
ATOM 1868 C CA    . ASN F 5 7  ? 12.894  19.690  -44.261 1.00 146.37 ? 285 ASN B CA    1 
ATOM 1869 C C     . ASN F 5 7  ? 13.469  20.412  -43.037 1.00 147.22 ? 285 ASN B C     1 
ATOM 1870 O O     . ASN F 5 7  ? 14.333  19.893  -42.335 1.00 143.23 ? 285 ASN B O     1 
ATOM 1871 C CB    . ASN F 5 7  ? 13.583  20.220  -45.523 1.00 144.90 ? 285 ASN B CB    1 
ATOM 1872 C CG    . ASN F 5 7  ? 12.905  19.762  -46.806 1.00 147.34 ? 285 ASN B CG    1 
ATOM 1873 O OD1   . ASN F 5 7  ? 11.776  19.276  -46.787 1.00 152.67 ? 285 ASN B OD1   1 
ATOM 1874 N ND2   . ASN F 5 7  ? 13.598  19.920  -47.930 1.00 145.93 ? 285 ASN B ND2   1 
ATOM 1875 N N     . ILE F 5 8  ? 12.949  21.604  -42.777 1.00 151.76 ? 286 ILE B N     1 
ATOM 1876 C CA    . ILE F 5 8  ? 13.544  22.555  -41.849 1.00 157.84 ? 286 ILE B CA    1 
ATOM 1877 C C     . ILE F 5 8  ? 13.545  21.957  -40.455 1.00 153.72 ? 286 ILE B C     1 
ATOM 1878 O O     . ILE F 5 8  ? 14.361  22.308  -39.606 1.00 146.23 ? 286 ILE B O     1 
ATOM 1879 C CB    . ILE F 5 8  ? 12.763  23.891  -41.875 1.00 157.98 ? 286 ILE B CB    1 
ATOM 1880 C CG1   . ILE F 5 8  ? 13.539  25.014  -41.181 1.00 162.37 ? 286 ILE B CG1   1 
ATOM 1881 C CG2   . ILE F 5 8  ? 11.378  23.707  -41.257 1.00 151.78 ? 286 ILE B CG2   1 
ATOM 1882 C CD1   . ILE F 5 8  ? 13.111  26.396  -41.643 1.00 157.81 ? 286 ILE B CD1   1 
ATOM 1883 N N     . MET F 5 9  ? 12.599  21.051  -40.242 1.00 154.83 ? 287 MET B N     1 
ATOM 1884 C CA    . MET F 5 9  ? 12.513  20.270  -39.022 1.00 153.40 ? 287 MET B CA    1 
ATOM 1885 C C     . MET F 5 9  ? 13.539  19.139  -38.967 1.00 149.29 ? 287 MET B C     1 
ATOM 1886 O O     . MET F 5 9  ? 14.249  18.991  -37.975 1.00 148.36 ? 287 MET B O     1 
ATOM 1887 C CB    . MET F 5 9  ? 11.104  19.681  -38.894 1.00 154.85 ? 287 MET B CB    1 
ATOM 1888 C CG    . MET F 5 9  ? 9.974   20.701  -38.920 1.00 167.66 ? 287 MET B CG    1 
ATOM 1889 S SD    . MET F 5 9  ? 10.252  22.089  -37.798 1.00 198.68 ? 287 MET B SD    1 
ATOM 1890 C CE    . MET F 5 9  ? 10.723  21.248  -36.282 1.00 159.02 ? 287 MET B CE    1 
ATOM 1891 N N     . ARG F 5 10 ? 13.633  18.357  -40.037 1.00 147.83 ? 288 ARG B N     1 
ATOM 1892 C CA    . ARG F 5 10 ? 14.467  17.157  -40.025 1.00 143.41 ? 288 ARG B CA    1 
ATOM 1893 C C     . ARG F 5 10 ? 15.942  17.492  -39.809 1.00 141.53 ? 288 ARG B C     1 
ATOM 1894 O O     . ARG F 5 10 ? 16.658  16.752  -39.144 1.00 136.23 ? 288 ARG B O     1 
ATOM 1895 C CB    . ARG F 5 10 ? 14.282  16.375  -41.326 1.00 144.01 ? 288 ARG B CB    1 
ATOM 1896 C CG    . ARG F 5 10 ? 12.860  15.922  -41.569 1.00 143.81 ? 288 ARG B CG    1 
ATOM 1897 C CD    . ARG F 5 10 ? 12.823  14.723  -42.477 1.00 155.03 ? 288 ARG B CD    1 
ATOM 1898 N NE    . ARG F 5 10 ? 11.496  14.483  -43.035 1.00 159.97 ? 288 ARG B NE    1 
ATOM 1899 C CZ    . ARG F 5 10 ? 11.072  13.302  -43.472 1.00 155.39 ? 288 ARG B CZ    1 
ATOM 1900 N NH1   . ARG F 5 10 ? 11.865  12.241  -43.403 1.00 146.89 ? 288 ARG B NH1   1 
ATOM 1901 N NH2   . ARG F 5 10 ? 9.850   13.177  -43.970 1.00 155.25 ? 288 ARG B NH2   1 
ATOM 1902 N N     . ALA F 5 11 ? 16.382  18.622  -40.352 1.00 145.13 ? 289 ALA B N     1 
ATOM 1903 C CA    . ALA F 5 11 ? 17.711  19.158  -40.064 1.00 145.79 ? 289 ALA B CA    1 
ATOM 1904 C C     . ALA F 5 11 ? 17.808  19.599  -38.611 1.00 146.16 ? 289 ALA B C     1 
ATOM 1905 O O     . ALA F 5 11 ? 18.873  19.553  -37.992 1.00 158.71 ? 289 ALA B O     1 
ATOM 1906 C CB    . ALA F 5 11 ? 18.014  20.335  -40.982 1.00 149.26 ? 289 ALA B CB    1 
ATOM 1907 N N     . TRP F 5 12 ? 16.667  20.020  -38.083 1.00 147.27 ? 290 TRP B N     1 
ATOM 1908 C CA    . TRP F 5 12 ? 16.573  20.687  -36.792 1.00 148.31 ? 290 TRP B CA    1 
ATOM 1909 C C     . TRP F 5 12 ? 16.322  19.712  -35.634 1.00 148.12 ? 290 TRP B C     1 
ATOM 1910 O O     . TRP F 5 12 ? 16.692  19.991  -34.492 1.00 150.90 ? 290 TRP B O     1 
ATOM 1911 C CB    . TRP F 5 12 ? 15.459  21.737  -36.886 1.00 148.73 ? 290 TRP B CB    1 
ATOM 1912 C CG    . TRP F 5 12 ? 14.987  22.316  -35.594 1.00 145.17 ? 290 TRP B CG    1 
ATOM 1913 C CD1   . TRP F 5 12 ? 15.328  23.528  -35.064 1.00 138.46 ? 290 TRP B CD1   1 
ATOM 1914 C CD2   . TRP F 5 12 ? 14.068  21.721  -34.676 1.00 146.85 ? 290 TRP B CD2   1 
ATOM 1915 N NE1   . TRP F 5 12 ? 14.682  23.718  -33.868 1.00 136.48 ? 290 TRP B NE1   1 
ATOM 1916 C CE2   . TRP F 5 12 ? 13.904  22.620  -33.608 1.00 144.31 ? 290 TRP B CE2   1 
ATOM 1917 C CE3   . TRP F 5 12 ? 13.373  20.511  -34.650 1.00 147.56 ? 290 TRP B CE3   1 
ATOM 1918 C CZ2   . TRP F 5 12 ? 13.077  22.343  -32.524 1.00 148.16 ? 290 TRP B CZ2   1 
ATOM 1919 C CZ3   . TRP F 5 12 ? 12.546  20.241  -33.573 1.00 151.36 ? 290 TRP B CZ3   1 
ATOM 1920 C CH2   . TRP F 5 12 ? 12.401  21.156  -32.531 1.00 146.33 ? 290 TRP B CH2   1 
ATOM 1921 N N     . LEU F 5 13 ? 15.702  18.571  -35.940 1.00 139.90 ? 291 LEU B N     1 
ATOM 1922 C CA    . LEU F 5 13 ? 15.234  17.626  -34.912 1.00 138.41 ? 291 LEU B CA    1 
ATOM 1923 C C     . LEU F 5 13 ? 16.066  16.363  -34.704 1.00 136.50 ? 291 LEU B C     1 
ATOM 1924 O O     . LEU F 5 13 ? 15.962  15.739  -33.653 1.00 134.76 ? 291 LEU B O     1 
ATOM 1925 C CB    . LEU F 5 13 ? 13.807  17.169  -35.230 1.00 137.30 ? 291 LEU B CB    1 
ATOM 1926 C CG    . LEU F 5 13 ? 13.642  16.370  -36.525 1.00 131.48 ? 291 LEU B CG    1 
ATOM 1927 C CD1   . LEU F 5 13 ? 13.781  14.853  -36.327 1.00 144.21 ? 291 LEU B CD1   1 
ATOM 1928 C CD2   . LEU F 5 13 ? 12.314  16.697  -37.185 1.00 124.74 ? 291 LEU B CD2   1 
ATOM 1929 N N     . PHE F 5 14 ? 16.868  15.963  -35.688 1.00 131.85 ? 292 PHE B N     1 
ATOM 1930 C CA    . PHE F 5 14 ? 17.529  14.656  -35.618 1.00 126.05 ? 292 PHE B CA    1 
ATOM 1931 C C     . PHE F 5 14 ? 18.409  14.609  -34.381 1.00 127.74 ? 292 PHE B C     1 
ATOM 1932 O O     . PHE F 5 14 ? 18.603  13.557  -33.771 1.00 133.91 ? 292 PHE B O     1 
ATOM 1933 C CB    . PHE F 5 14 ? 18.375  14.374  -36.869 1.00 129.05 ? 292 PHE B CB    1 
ATOM 1934 C CG    . PHE F 5 14 ? 17.577  14.061  -38.109 1.00 133.59 ? 292 PHE B CG    1 
ATOM 1935 C CD1   . PHE F 5 14 ? 16.304  13.518  -38.042 1.00 136.42 ? 292 PHE B CD1   1 
ATOM 1936 C CD2   . PHE F 5 14 ? 18.124  14.302  -39.357 1.00 138.71 ? 292 PHE B CD2   1 
ATOM 1937 C CE1   . PHE F 5 14 ? 15.594  13.240  -39.197 1.00 137.36 ? 292 PHE B CE1   1 
ATOM 1938 C CE2   . PHE F 5 14 ? 17.422  14.028  -40.496 1.00 135.65 ? 292 PHE B CE2   1 
ATOM 1939 C CZ    . PHE F 5 14 ? 16.156  13.493  -40.420 1.00 137.83 ? 292 PHE B CZ    1 
ATOM 1940 N N     . GLN F 5 15 ? 18.919  15.777  -34.016 1.00 130.94 ? 293 GLN B N     1 
ATOM 1941 C CA    . GLN F 5 15 ? 19.704  15.966  -32.803 1.00 141.92 ? 293 GLN B CA    1 
ATOM 1942 C C     . GLN F 5 15 ? 18.900  15.521  -31.592 1.00 140.59 ? 293 GLN B C     1 
ATOM 1943 O O     . GLN F 5 15 ? 19.460  15.105  -30.577 1.00 139.22 ? 293 GLN B O     1 
ATOM 1944 C CB    . GLN F 5 15 ? 20.127  17.440  -32.662 1.00 150.78 ? 293 GLN B CB    1 
ATOM 1945 C CG    . GLN F 5 15 ? 19.083  18.451  -33.174 1.00 144.78 ? 293 GLN B CG    1 
ATOM 1946 C CD    . GLN F 5 15 ? 19.494  19.903  -33.000 1.00 148.66 ? 293 GLN B CD    1 
ATOM 1947 O OE1   . GLN F 5 15 ? 18.735  20.711  -32.464 1.00 153.95 ? 293 GLN B OE1   1 
ATOM 1948 N NE2   . GLN F 5 15 ? 20.687  20.247  -33.475 1.00 150.71 ? 293 GLN B NE2   1 
ATOM 1949 N N     . HIS F 5 16 ? 17.578  15.605  -31.708 1.00 136.71 ? 294 HIS B N     1 
ATOM 1950 C CA    . HIS F 5 16 ? 16.693  15.136  -30.655 1.00 130.86 ? 294 HIS B CA    1 
ATOM 1951 C C     . HIS F 5 16 ? 16.559  13.609  -30.635 1.00 134.94 ? 294 HIS B C     1 
ATOM 1952 O O     . HIS F 5 16 ? 16.165  13.066  -29.622 1.00 137.42 ? 294 HIS B O     1 
ATOM 1953 C CB    . HIS F 5 16 ? 15.291  15.752  -30.800 1.00 133.80 ? 294 HIS B CB    1 
ATOM 1954 C CG    . HIS F 5 16 ? 15.291  17.225  -31.078 1.00 136.04 ? 294 HIS B CG    1 
ATOM 1955 N ND1   . HIS F 5 16 ? 16.423  18.003  -31.005 1.00 137.01 ? 294 HIS B ND1   1 
ATOM 1956 C CD2   . HIS F 5 16 ? 14.280  18.061  -31.431 1.00 140.23 ? 294 HIS B CD2   1 
ATOM 1957 C CE1   . HIS F 5 16 ? 16.116  19.256  -31.303 1.00 139.38 ? 294 HIS B CE1   1 
ATOM 1958 N NE2   . HIS F 5 16 ? 14.824  19.314  -31.563 1.00 140.21 ? 294 HIS B NE2   1 
ATOM 1959 N N     . LEU F 5 17 ? 16.950  12.902  -31.697 1.00 137.10 ? 295 LEU B N     1 
ATOM 1960 C CA    . LEU F 5 17 ? 16.382  11.563  -31.956 1.00 143.85 ? 295 LEU B CA    1 
ATOM 1961 C C     . LEU F 5 17 ? 16.459  10.613  -30.756 1.00 147.87 ? 295 LEU B C     1 
ATOM 1962 O O     . LEU F 5 17 ? 15.624  9.722   -30.625 1.00 151.11 ? 295 LEU B O     1 
ATOM 1963 C CB    . LEU F 5 17 ? 17.062  10.892  -33.161 1.00 141.08 ? 295 LEU B CB    1 
ATOM 1964 C CG    . LEU F 5 17 ? 18.390  10.132  -33.015 1.00 143.40 ? 295 LEU B CG    1 
ATOM 1965 C CD1   . LEU F 5 17 ? 19.478  11.010  -32.391 1.00 132.91 ? 295 LEU B CD1   1 
ATOM 1966 C CD2   . LEU F 5 17 ? 18.241  8.787   -32.259 1.00 156.16 ? 295 LEU B CD2   1 
ATOM 1967 N N     . THR F 5 18 ? 17.467  10.781  -29.903 1.00 145.15 ? 296 THR B N     1 
ATOM 1968 C CA    . THR F 5 18 ? 17.522  10.056  -28.633 1.00 144.65 ? 296 THR B CA    1 
ATOM 1969 C C     . THR F 5 18 ? 16.483  10.602  -27.647 1.00 139.23 ? 296 THR B C     1 
ATOM 1970 O O     . THR F 5 18 ? 15.922  9.854   -26.846 1.00 131.82 ? 296 THR B O     1 
ATOM 1971 C CB    . THR F 5 18 ? 18.924  10.136  -27.988 1.00 151.44 ? 296 THR B CB    1 
ATOM 1972 O OG1   . THR F 5 18 ? 19.198  11.483  -27.588 1.00 153.51 ? 296 THR B OG1   1 
ATOM 1973 C CG2   . THR F 5 18 ? 19.998  9.671   -28.962 1.00 143.26 ? 296 THR B CG2   1 
ATOM 1974 N N     . HIS F 5 19 ? 16.246  11.913  -27.714 1.00 138.45 ? 297 HIS B N     1 
ATOM 1975 C CA    . HIS F 5 19 ? 15.231  12.585  -26.900 1.00 136.22 ? 297 HIS B CA    1 
ATOM 1976 C C     . HIS F 5 19 ? 14.317  13.497  -27.747 1.00 135.61 ? 297 HIS B C     1 
ATOM 1977 O O     . HIS F 5 19 ? 14.434  14.722  -27.700 1.00 137.03 ? 297 HIS B O     1 
ATOM 1978 C CB    . HIS F 5 19 ? 15.944  13.374  -25.788 1.00 135.59 ? 297 HIS B CB    1 
ATOM 1979 C CG    . HIS F 5 19 ? 15.078  14.329  -25.028 1.00 139.40 ? 297 HIS B CG    1 
ATOM 1980 N ND1   . HIS F 5 19 ? 14.789  15.600  -25.487 1.00 137.49 ? 297 HIS B ND1   1 
ATOM 1981 C CD2   . HIS F 5 19 ? 14.482  14.231  -23.817 1.00 139.33 ? 297 HIS B CD2   1 
ATOM 1982 C CE1   . HIS F 5 19 ? 14.034  16.225  -24.607 1.00 137.79 ? 297 HIS B CE1   1 
ATOM 1983 N NE2   . HIS F 5 19 ? 13.835  15.417  -23.579 1.00 144.32 ? 297 HIS B NE2   1 
ATOM 1984 N N     . PRO F 5 20 ? 13.428  12.891  -28.564 1.00 136.19 ? 298 PRO B N     1 
ATOM 1985 C CA    . PRO F 5 20 ? 12.380  13.682  -29.211 1.00 140.52 ? 298 PRO B CA    1 
ATOM 1986 C C     . PRO F 5 20 ? 11.215  13.906  -28.253 1.00 141.93 ? 298 PRO B C     1 
ATOM 1987 O O     . PRO F 5 20 ? 10.110  13.392  -28.449 1.00 147.85 ? 298 PRO B O     1 
ATOM 1988 C CB    . PRO F 5 20 ? 11.983  12.819  -30.422 1.00 150.90 ? 298 PRO B CB    1 
ATOM 1989 C CG    . PRO F 5 20 ? 13.151  11.916  -30.626 1.00 145.59 ? 298 PRO B CG    1 
ATOM 1990 C CD    . PRO F 5 20 ? 13.547  11.586  -29.226 1.00 142.88 ? 298 PRO B CD    1 
ATOM 1991 N N     . TYR F 5 21 ? 11.481  14.694  -27.217 1.00 138.44 ? 299 TYR B N     1 
ATOM 1992 C CA    . TYR F 5 21 ? 10.501  14.987  -26.181 1.00 136.96 ? 299 TYR B CA    1 
ATOM 1993 C C     . TYR F 5 21 ? 10.430  16.505  -26.128 1.00 138.58 ? 299 TYR B C     1 
ATOM 1994 O O     . TYR F 5 21 ? 10.929  17.132  -25.196 1.00 141.83 ? 299 TYR B O     1 
ATOM 1995 C CB    . TYR F 5 21 ? 10.899  14.385  -24.823 1.00 136.16 ? 299 TYR B CB    1 
ATOM 1996 C CG    . TYR F 5 21 ? 11.158  12.885  -24.838 1.00 133.13 ? 299 TYR B CG    1 
ATOM 1997 C CD1   . TYR F 5 21 ? 10.335  12.006  -24.147 1.00 135.67 ? 299 TYR B CD1   1 
ATOM 1998 C CD2   . TYR F 5 21 ? 12.225  12.352  -25.542 1.00 132.23 ? 299 TYR B CD2   1 
ATOM 1999 C CE1   . TYR F 5 21 ? 10.571  10.644  -24.162 1.00 139.79 ? 299 TYR B CE1   1 
ATOM 2000 C CE2   . TYR F 5 21 ? 12.466  10.986  -25.563 1.00 132.75 ? 299 TYR B CE2   1 
ATOM 2001 C CZ    . TYR F 5 21 ? 11.639  10.138  -24.870 1.00 143.71 ? 299 TYR B CZ    1 
ATOM 2002 O OH    . TYR F 5 21 ? 11.873  8.780   -24.887 1.00 178.83 ? 299 TYR B OH    1 
ATOM 2003 N N     . PRO F 5 22 ? 9.804   17.099  -27.153 1.00 141.42 ? 300 PRO B N     1 
ATOM 2004 C CA    . PRO F 5 22 ? 9.804   18.542  -27.399 1.00 141.04 ? 300 PRO B CA    1 
ATOM 2005 C C     . PRO F 5 22 ? 9.143   19.317  -26.267 1.00 137.72 ? 300 PRO B C     1 
ATOM 2006 O O     . PRO F 5 22 ? 8.230   18.793  -25.632 1.00 152.34 ? 300 PRO B O     1 
ATOM 2007 C CB    . PRO F 5 22 ? 8.995   18.673  -28.693 1.00 133.76 ? 300 PRO B CB    1 
ATOM 2008 C CG    . PRO F 5 22 ? 8.089   17.490  -28.679 1.00 136.91 ? 300 PRO B CG    1 
ATOM 2009 C CD    . PRO F 5 22 ? 8.920   16.394  -28.102 1.00 139.36 ? 300 PRO B CD    1 
ATOM 2010 N N     . SER F 5 23 ? 9.609   20.530  -26.001 1.00 134.91 ? 301 SER B N     1 
ATOM 2011 C CA    . SER F 5 23 ? 8.835   21.460  -25.198 1.00 128.37 ? 301 SER B CA    1 
ATOM 2012 C C     . SER F 5 23 ? 7.521   21.675  -25.942 1.00 130.08 ? 301 SER B C     1 
ATOM 2013 O O     . SER F 5 23 ? 7.480   21.606  -27.168 1.00 131.15 ? 301 SER B O     1 
ATOM 2014 C CB    . SER F 5 23 ? 9.586   22.780  -24.994 1.00 118.99 ? 301 SER B CB    1 
ATOM 2015 O OG    . SER F 5 23 ? 8.932   23.615  -24.053 1.00 113.87 ? 301 SER B OG    1 
ATOM 2016 N N     . GLU F 5 24 ? 6.436   21.882  -25.207 1.00 130.83 ? 302 GLU B N     1 
ATOM 2017 C CA    . GLU F 5 24 ? 5.147   22.158  -25.846 1.00 129.09 ? 302 GLU B CA    1 
ATOM 2018 C C     . GLU F 5 24 ? 5.287   23.467  -26.614 1.00 119.55 ? 302 GLU B C     1 
ATOM 2019 O O     . GLU F 5 24 ? 4.656   23.668  -27.651 1.00 117.38 ? 302 GLU B O     1 
ATOM 2020 C CB    . GLU F 5 24 ? 3.995   22.232  -24.829 1.00 135.02 ? 302 GLU B CB    1 
ATOM 2021 C CG    . GLU F 5 24 ? 4.330   21.821  -23.390 1.00 125.74 ? 302 GLU B CG    1 
ATOM 2022 C CD    . GLU F 5 24 ? 4.832   20.397  -23.277 1.00 132.93 ? 302 GLU B CD    1 
ATOM 2023 O OE1   . GLU F 5 24 ? 4.166   19.582  -22.608 1.00 134.67 ? 302 GLU B OE1   1 
ATOM 2024 O OE2   . GLU F 5 24 ? 5.903   20.098  -23.847 1.00 150.20 ? 302 GLU B OE2   1 
ATOM 2025 N N     . GLU F 5 25 ? 6.137   24.347  -26.095 1.00 123.77 ? 303 GLU B N     1 
ATOM 2026 C CA    . GLU F 5 25 ? 6.527   25.567  -26.798 1.00 118.20 ? 303 GLU B CA    1 
ATOM 2027 C C     . GLU F 5 25 ? 7.376   25.262  -28.029 1.00 116.08 ? 303 GLU B C     1 
ATOM 2028 O O     . GLU F 5 25 ? 7.367   26.022  -28.982 1.00 115.90 ? 303 GLU B O     1 
ATOM 2029 C CB    . GLU F 5 25 ? 7.301   26.505  -25.862 1.00 116.47 ? 303 GLU B CB    1 
ATOM 2030 C CG    . GLU F 5 25 ? 8.821   26.400  -25.989 1.00 122.73 ? 303 GLU B CG    1 
ATOM 2031 C CD    . GLU F 5 25 ? 9.568   27.252  -24.976 1.00 118.21 ? 303 GLU B CD    1 
ATOM 2032 O OE1   . GLU F 5 25 ? 8.969   28.197  -24.423 1.00 111.18 ? 303 GLU B OE1   1 
ATOM 2033 O OE2   . GLU F 5 25 ? 10.763  26.978  -24.735 1.00 121.08 ? 303 GLU B OE2   1 
ATOM 2034 N N     . GLN F 5 26 ? 8.098   24.144  -28.010 1.00 119.56 ? 304 GLN B N     1 
ATOM 2035 C CA    . GLN F 5 26 ? 9.095   23.845  -29.043 1.00 118.39 ? 304 GLN B CA    1 
ATOM 2036 C C     . GLN F 5 26 ? 8.442   23.760  -30.409 1.00 114.06 ? 304 GLN B C     1 
ATOM 2037 O O     . GLN F 5 26 ? 9.038   24.128  -31.417 1.00 114.85 ? 304 GLN B O     1 
ATOM 2038 C CB    . GLN F 5 26 ? 9.822   22.531  -28.725 1.00 123.70 ? 304 GLN B CB    1 
ATOM 2039 C CG    . GLN F 5 26 ? 11.276  22.460  -29.202 1.00 128.05 ? 304 GLN B CG    1 
ATOM 2040 C CD    . GLN F 5 26 ? 12.133  21.514  -28.368 1.00 132.37 ? 304 GLN B CD    1 
ATOM 2041 O OE1   . GLN F 5 26 ? 11.827  21.234  -27.208 1.00 126.85 ? 304 GLN B OE1   1 
ATOM 2042 N NE2   . GLN F 5 26 ? 13.217  21.023  -28.957 1.00 138.61 ? 304 GLN B NE2   1 
ATOM 2043 N N     . LYS F 5 27 ? 7.200   23.293  -30.435 1.00 110.66 ? 305 LYS B N     1 
ATOM 2044 C CA    . LYS F 5 27 ? 6.399   23.400  -31.642 1.00 115.18 ? 305 LYS B CA    1 
ATOM 2045 C C     . LYS F 5 27 ? 6.012   24.851  -31.860 1.00 115.70 ? 305 LYS B C     1 
ATOM 2046 O O     . LYS F 5 27 ? 6.279   25.416  -32.910 1.00 118.99 ? 305 LYS B O     1 
ATOM 2047 C CB    . LYS F 5 27 ? 5.134   22.556  -31.551 1.00 116.88 ? 305 LYS B CB    1 
ATOM 2048 C CG    . LYS F 5 27 ? 5.254   21.266  -30.784 1.00 128.81 ? 305 LYS B CG    1 
ATOM 2049 C CD    . LYS F 5 27 ? 4.181   20.309  -31.238 1.00 137.03 ? 305 LYS B CD    1 
ATOM 2050 C CE    . LYS F 5 27 ? 3.586   19.576  -30.075 1.00 146.52 ? 305 LYS B CE    1 
ATOM 2051 N NZ    . LYS F 5 27 ? 2.457   18.737  -30.524 1.00 132.78 ? 305 LYS B NZ    1 
ATOM 2052 N N     . LYS F 5 28 ? 5.426   25.453  -30.825 1.00 114.99 ? 306 LYS B N     1 
ATOM 2053 C CA    . LYS F 5 28 ? 4.875   26.812  -30.887 1.00 120.85 ? 306 LYS B CA    1 
ATOM 2054 C C     . LYS F 5 28 ? 5.951   27.848  -31.169 1.00 125.32 ? 306 LYS B C     1 
ATOM 2055 O O     . LYS F 5 28 ? 5.703   28.863  -31.815 1.00 129.53 ? 306 LYS B O     1 
ATOM 2056 C CB    . LYS F 5 28 ? 4.160   27.146  -29.573 1.00 131.13 ? 306 LYS B CB    1 
ATOM 2057 C CG    . LYS F 5 28 ? 3.745   28.603  -29.408 1.00 148.43 ? 306 LYS B CG    1 
ATOM 2058 C CD    . LYS F 5 28 ? 3.346   28.905  -27.975 1.00 153.31 ? 306 LYS B CD    1 
ATOM 2059 C CE    . LYS F 5 28 ? 3.545   30.375  -27.660 1.00 141.21 ? 306 LYS B CE    1 
ATOM 2060 N NZ    . LYS F 5 28 ? 4.991   30.737  -27.615 1.00 139.06 ? 306 LYS B NZ    1 
ATOM 2061 N N     . GLN F 5 29 ? 7.147   27.578  -30.668 1.00 127.64 ? 307 GLN B N     1 
ATOM 2062 C CA    . GLN F 5 29 ? 8.286   28.462  -30.835 1.00 123.12 ? 307 GLN B CA    1 
ATOM 2063 C C     . GLN F 5 29 ? 8.659   28.493  -32.303 1.00 120.99 ? 307 GLN B C     1 
ATOM 2064 O O     . GLN F 5 29 ? 9.164   29.488  -32.822 1.00 127.73 ? 307 GLN B O     1 
ATOM 2065 C CB    . GLN F 5 29 ? 9.457   27.973  -29.985 1.00 120.89 ? 307 GLN B CB    1 
ATOM 2066 C CG    . GLN F 5 29 ? 10.658  28.876  -30.014 1.00 128.98 ? 307 GLN B CG    1 
ATOM 2067 C CD    . GLN F 5 29 ? 11.504  28.743  -28.777 1.00 133.51 ? 307 GLN B CD    1 
ATOM 2068 O OE1   . GLN F 5 29 ? 11.560  27.685  -28.150 1.00 140.71 ? 307 GLN B OE1   1 
ATOM 2069 N NE2   . GLN F 5 29 ? 12.165  29.820  -28.410 1.00 135.19 ? 307 GLN B NE2   1 
ATOM 2070 N N     . LEU F 5 30 ? 8.377   27.378  -32.964 1.00 115.76 ? 308 LEU B N     1 
ATOM 2071 C CA    . LEU F 5 30 ? 8.726   27.166  -34.355 1.00 119.15 ? 308 LEU B CA    1 
ATOM 2072 C C     . LEU F 5 30 ? 7.454   26.928  -35.163 1.00 120.13 ? 308 LEU B C     1 
ATOM 2073 O O     . LEU F 5 30 ? 7.502   26.764  -36.381 1.00 116.01 ? 308 LEU B O     1 
ATOM 2074 C CB    . LEU F 5 30 ? 9.690   25.991  -34.460 1.00 110.76 ? 308 LEU B CB    1 
ATOM 2075 C CG    . LEU F 5 30 ? 10.831  26.106  -33.446 1.00 108.88 ? 308 LEU B CG    1 
ATOM 2076 C CD1   . LEU F 5 30 ? 11.658  24.844  -33.418 1.00 119.54 ? 308 LEU B CD1   1 
ATOM 2077 C CD2   . LEU F 5 30 ? 11.694  27.336  -33.730 1.00 110.10 ? 308 LEU B CD2   1 
ATOM 2078 N N     . ALA F 5 31 ? 6.316   26.888  -34.474 1.00 126.77 ? 309 ALA B N     1 
ATOM 2079 C CA    . ALA F 5 31 ? 5.029   26.931  -35.146 1.00 125.83 ? 309 ALA B CA    1 
ATOM 2080 C C     . ALA F 5 31 ? 4.893   28.306  -35.770 1.00 127.52 ? 309 ALA B C     1 
ATOM 2081 O O     . ALA F 5 31 ? 4.278   28.454  -36.815 1.00 131.33 ? 309 ALA B O     1 
ATOM 2082 C CB    . ALA F 5 31 ? 3.879   26.650  -34.179 1.00 130.15 ? 309 ALA B CB    1 
ATOM 2083 N N     . GLN F 5 32 ? 5.483   29.304  -35.116 1.00 124.88 ? 310 GLN B N     1 
ATOM 2084 C CA    . GLN F 5 32 ? 5.534   30.668  -35.638 1.00 118.37 ? 310 GLN B CA    1 
ATOM 2085 C C     . GLN F 5 32 ? 6.701   30.860  -36.610 1.00 127.52 ? 310 GLN B C     1 
ATOM 2086 O O     . GLN F 5 32 ? 6.813   31.898  -37.261 1.00 131.98 ? 310 GLN B O     1 
ATOM 2087 C CB    . GLN F 5 32 ? 5.618   31.671  -34.486 1.00 112.21 ? 310 GLN B CB    1 
ATOM 2088 C CG    . GLN F 5 32 ? 4.254   32.011  -33.903 1.00 114.91 ? 310 GLN B CG    1 
ATOM 2089 C CD    . GLN F 5 32 ? 4.321   32.990  -32.751 1.00 120.32 ? 310 GLN B CD    1 
ATOM 2090 O OE1   . GLN F 5 32 ? 5.399   33.303  -32.249 1.00 125.59 ? 310 GLN B OE1   1 
ATOM 2091 N NE2   . GLN F 5 32 ? 3.163   33.480  -32.324 1.00 132.36 ? 310 GLN B NE2   1 
ATOM 2092 N N     . ASP F 5 33 ? 7.564   29.852  -36.701 1.00 127.35 ? 311 ASP B N     1 
ATOM 2093 C CA    . ASP F 5 33 ? 8.526   29.751  -37.790 1.00 127.70 ? 311 ASP B CA    1 
ATOM 2094 C C     . ASP F 5 33 ? 7.799   29.159  -39.001 1.00 124.99 ? 311 ASP B C     1 
ATOM 2095 O O     . ASP F 5 33 ? 8.404   28.927  -40.043 1.00 137.49 ? 311 ASP B O     1 
ATOM 2096 C CB    . ASP F 5 33 ? 9.735   28.898  -37.390 1.00 116.87 ? 311 ASP B CB    1 
ATOM 2097 C CG    . ASP F 5 33 ? 10.649  29.599  -36.402 1.00 113.36 ? 311 ASP B CG    1 
ATOM 2098 O OD1   . ASP F 5 33 ? 10.155  30.407  -35.588 1.00 121.55 ? 311 ASP B OD1   1 
ATOM 2099 O OD2   . ASP F 5 33 ? 11.869  29.334  -36.438 1.00 115.19 ? 311 ASP B OD2   1 
ATOM 2100 N N     . THR F 5 34 ? 6.510   28.860  -38.828 1.00 123.08 ? 312 THR B N     1 
ATOM 2101 C CA    . THR F 5 34 ? 5.607   28.596  -39.951 1.00 131.08 ? 312 THR B CA    1 
ATOM 2102 C C     . THR F 5 34 ? 4.208   29.208  -39.728 1.00 130.36 ? 312 THR B C     1 
ATOM 2103 O O     . THR F 5 34 ? 3.381   29.216  -40.638 1.00 140.06 ? 312 THR B O     1 
ATOM 2104 C CB    . THR F 5 34 ? 5.479   27.066  -40.223 1.00 133.82 ? 312 THR B CB    1 
ATOM 2105 O OG1   . THR F 5 34 ? 4.394   26.817  -41.127 1.00 130.34 ? 312 THR B OG1   1 
ATOM 2106 C CG2   . THR F 5 34 ? 5.254   26.282  -38.936 1.00 126.75 ? 312 THR B CG2   1 
ATOM 2107 N N     . GLY F 5 35 ? 3.949   29.713  -38.521 1.00 131.09 ? 313 GLY B N     1 
ATOM 2108 C CA    . GLY F 5 35 ? 2.655   30.292  -38.174 1.00 142.00 ? 313 GLY B CA    1 
ATOM 2109 C C     . GLY F 5 35 ? 1.605   29.209  -38.008 1.00 145.33 ? 313 GLY B C     1 
ATOM 2110 O O     . GLY F 5 35 ? 0.417   29.487  -37.855 1.00 154.18 ? 313 GLY B O     1 
ATOM 2111 N N     . LEU F 5 36 ? 2.071   27.966  -38.011 1.00 129.66 ? 314 LEU B N     1 
ATOM 2112 C CA    . LEU F 5 36 ? 1.220   26.797  -38.218 1.00 120.47 ? 314 LEU B CA    1 
ATOM 2113 C C     . LEU F 5 36 ? 0.494   26.352  -36.955 1.00 123.25 ? 314 LEU B C     1 
ATOM 2114 O O     . LEU F 5 36 ? 0.973   26.563  -35.844 1.00 136.94 ? 314 LEU B O     1 
ATOM 2115 C CB    . LEU F 5 36 ? 2.074   25.651  -38.778 1.00 117.76 ? 314 LEU B CB    1 
ATOM 2116 C CG    . LEU F 5 36 ? 1.433   24.415  -39.422 1.00 105.48 ? 314 LEU B CG    1 
ATOM 2117 C CD1   . LEU F 5 36 ? 0.218   24.766  -40.281 1.00 114.06 ? 314 LEU B CD1   1 
ATOM 2118 C CD2   . LEU F 5 36 ? 2.501   23.680  -40.251 1.00 122.79 ? 314 LEU B CD2   1 
ATOM 2119 N N     . THR F 5 37 ? -0.670  25.737  -37.132 1.00 122.22 ? 315 THR B N     1 
ATOM 2120 C CA    . THR F 5 37 ? -1.377  25.138  -36.010 1.00 117.85 ? 315 THR B CA    1 
ATOM 2121 C C     . THR F 5 37 ? -0.516  24.022  -35.433 1.00 115.81 ? 315 THR B C     1 
ATOM 2122 O O     . THR F 5 37 ? 0.121   23.268  -36.165 1.00 115.73 ? 315 THR B O     1 
ATOM 2123 C CB    . THR F 5 37 ? -2.759  24.587  -36.414 1.00 110.58 ? 315 THR B CB    1 
ATOM 2124 O OG1   . THR F 5 37 ? -3.417  24.068  -35.254 1.00 114.52 ? 315 THR B OG1   1 
ATOM 2125 C CG2   . THR F 5 37 ? -2.634  23.487  -37.465 1.00 102.73 ? 315 THR B CG2   1 
ATOM 2126 N N     . ILE F 5 38 ? -0.503  23.935  -34.111 1.00 111.54 ? 316 ILE B N     1 
ATOM 2127 C CA    . ILE F 5 38 ? 0.363   23.017  -33.384 1.00 108.65 ? 316 ILE B CA    1 
ATOM 2128 C C     . ILE F 5 38 ? -0.166  21.577  -33.428 1.00 110.70 ? 316 ILE B C     1 
ATOM 2129 O O     . ILE F 5 38 ? 0.524   20.639  -33.026 1.00 111.85 ? 316 ILE B O     1 
ATOM 2130 C CB    . ILE F 5 38 ? 0.517   23.498  -31.921 1.00 128.96 ? 316 ILE B CB    1 
ATOM 2131 C CG1   . ILE F 5 38 ? 1.795   22.956  -31.289 1.00 132.43 ? 316 ILE B CG1   1 
ATOM 2132 C CG2   . ILE F 5 38 ? -0.704  23.129  -31.092 1.00 129.83 ? 316 ILE B CG2   1 
ATOM 2133 C CD1   . ILE F 5 38 ? 2.227   23.759  -30.073 1.00 119.94 ? 316 ILE B CD1   1 
ATOM 2134 N N     . LEU F 5 39 ? -1.389  21.415  -33.927 1.00 107.87 ? 317 LEU B N     1 
ATOM 2135 C CA    . LEU F 5 39 ? -2.042  20.107  -34.025 1.00 112.20 ? 317 LEU B CA    1 
ATOM 2136 C C     . LEU F 5 39 ? -1.639  19.330  -35.274 1.00 115.20 ? 317 LEU B C     1 
ATOM 2137 O O     . LEU F 5 39 ? -1.383  18.129  -35.213 1.00 121.70 ? 317 LEU B O     1 
ATOM 2138 C CB    . LEU F 5 39 ? -3.570  20.289  -33.996 1.00 112.74 ? 317 LEU B CB    1 
ATOM 2139 C CG    . LEU F 5 39 ? -4.468  19.936  -35.195 1.00 106.79 ? 317 LEU B CG    1 
ATOM 2140 C CD1   . LEU F 5 39 ? -5.877  19.606  -34.713 1.00 112.52 ? 317 LEU B CD1   1 
ATOM 2141 C CD2   . LEU F 5 39 ? -4.525  21.063  -36.227 1.00 106.24 ? 317 LEU B CD2   1 
ATOM 2142 N N     . GLN F 5 40 ? -1.573  20.023  -36.404 1.00 105.42 ? 318 GLN B N     1 
ATOM 2143 C CA    . GLN F 5 40 ? -1.343  19.370  -37.686 1.00 108.38 ? 318 GLN B CA    1 
ATOM 2144 C C     . GLN F 5 40 ? 0.131   19.030  -37.851 1.00 111.74 ? 318 GLN B C     1 
ATOM 2145 O O     . GLN F 5 40 ? 0.514   18.296  -38.763 1.00 119.28 ? 318 GLN B O     1 
ATOM 2146 C CB    . GLN F 5 40 ? -1.830  20.258  -38.844 1.00 110.12 ? 318 GLN B CB    1 
ATOM 2147 C CG    . GLN F 5 40 ? -1.996  19.517  -40.156 1.00 111.97 ? 318 GLN B CG    1 
ATOM 2148 C CD    . GLN F 5 40 ? -2.771  18.239  -39.981 1.00 110.67 ? 318 GLN B CD    1 
ATOM 2149 O OE1   . GLN F 5 40 ? -2.192  17.174  -39.789 1.00 113.63 ? 318 GLN B OE1   1 
ATOM 2150 N NE2   . GLN F 5 40 ? -4.089  18.333  -40.035 1.00 111.94 ? 318 GLN B NE2   1 
ATOM 2151 N N     . VAL F 5 41 ? 0.954   19.568  -36.958 1.00 110.42 ? 319 VAL B N     1 
ATOM 2152 C CA    . VAL F 5 41 ? 2.378   19.265  -36.941 1.00 117.65 ? 319 VAL B CA    1 
ATOM 2153 C C     . VAL F 5 41 ? 2.572   17.820  -36.518 1.00 122.67 ? 319 VAL B C     1 
ATOM 2154 O O     . VAL F 5 41 ? 3.375   17.085  -37.089 1.00 128.61 ? 319 VAL B O     1 
ATOM 2155 C CB    . VAL F 5 41 ? 3.157   20.174  -35.955 1.00 113.58 ? 319 VAL B CB    1 
ATOM 2156 C CG1   . VAL F 5 41 ? 4.631   20.264  -36.342 1.00 121.53 ? 319 VAL B CG1   1 
ATOM 2157 C CG2   . VAL F 5 41 ? 2.529   21.559  -35.872 1.00 106.68 ? 319 VAL B CG2   1 
ATOM 2158 N N     . ASN F 5 42 ? 1.794   17.426  -35.517 1.00 123.07 ? 320 ASN B N     1 
ATOM 2159 C CA    . ASN F 5 42 ? 1.935   16.129  -34.871 1.00 127.67 ? 320 ASN B CA    1 
ATOM 2160 C C     . ASN F 5 42 ? 1.619   14.974  -35.804 1.00 128.59 ? 320 ASN B C     1 
ATOM 2161 O O     . ASN F 5 42 ? 2.152   13.883  -35.659 1.00 135.71 ? 320 ASN B O     1 
ATOM 2162 C CB    . ASN F 5 42 ? 1.031   16.068  -33.643 1.00 125.66 ? 320 ASN B CB    1 
ATOM 2163 C CG    . ASN F 5 42 ? 1.182   17.280  -32.748 1.00 121.30 ? 320 ASN B CG    1 
ATOM 2164 O OD1   . ASN F 5 42 ? 2.274   17.830  -32.613 1.00 115.90 ? 320 ASN B OD1   1 
ATOM 2165 N ND2   . ASN F 5 42 ? 0.085   17.703  -32.128 1.00 113.83 ? 320 ASN B ND2   1 
ATOM 2166 N N     . ASN F 5 43 ? 0.761   15.232  -36.781 1.00 124.26 ? 321 ASN B N     1 
ATOM 2167 C CA    . ASN F 5 43 ? 0.369   14.219  -37.747 1.00 129.69 ? 321 ASN B CA    1 
ATOM 2168 C C     . ASN F 5 43 ? 1.403   14.154  -38.875 1.00 129.15 ? 321 ASN B C     1 
ATOM 2169 O O     . ASN F 5 43 ? 1.193   13.505  -39.899 1.00 130.04 ? 321 ASN B O     1 
ATOM 2170 C CB    . ASN F 5 43 ? -1.038  14.518  -38.270 1.00 124.51 ? 321 ASN B CB    1 
ATOM 2171 C CG    . ASN F 5 43 ? -2.018  14.824  -37.147 1.00 124.79 ? 321 ASN B CG    1 
ATOM 2172 O OD1   . ASN F 5 43 ? -1.626  14.925  -35.984 1.00 126.18 ? 321 ASN B OD1   1 
ATOM 2173 N ND2   . ASN F 5 43 ? -3.291  14.980  -37.488 1.00 118.85 ? 321 ASN B ND2   1 
ATOM 2174 N N     . TRP F 5 44 ? 2.503   14.878  -38.678 1.00 131.53 ? 322 TRP B N     1 
ATOM 2175 C CA    . TRP F 5 44 ? 3.716   14.724  -39.469 1.00 135.75 ? 322 TRP B CA    1 
ATOM 2176 C C     . TRP F 5 44 ? 4.858   14.366  -38.518 1.00 141.52 ? 322 TRP B C     1 
ATOM 2177 O O     . TRP F 5 44 ? 5.654   13.471  -38.802 1.00 148.54 ? 322 TRP B O     1 
ATOM 2178 C CB    . TRP F 5 44 ? 4.033   16.002  -40.241 1.00 139.08 ? 322 TRP B CB    1 
ATOM 2179 C CG    . TRP F 5 44 ? 5.150   15.858  -41.233 1.00 144.93 ? 322 TRP B CG    1 
ATOM 2180 C CD1   . TRP F 5 44 ? 5.031   15.762  -42.589 1.00 149.98 ? 322 TRP B CD1   1 
ATOM 2181 C CD2   . TRP F 5 44 ? 6.552   15.794  -40.951 1.00 148.15 ? 322 TRP B CD2   1 
ATOM 2182 N NE1   . TRP F 5 44 ? 6.270   15.641  -43.167 1.00 156.54 ? 322 TRP B NE1   1 
ATOM 2183 C CE2   . TRP F 5 44 ? 7.220   15.658  -42.182 1.00 154.93 ? 322 TRP B CE2   1 
ATOM 2184 C CE3   . TRP F 5 44 ? 7.306   15.838  -39.777 1.00 147.46 ? 322 TRP B CE3   1 
ATOM 2185 C CZ2   . TRP F 5 44 ? 8.603   15.565  -42.273 1.00 157.48 ? 322 TRP B CZ2   1 
ATOM 2186 C CZ3   . TRP F 5 44 ? 8.684   15.744  -39.870 1.00 154.64 ? 322 TRP B CZ3   1 
ATOM 2187 C CH2   . TRP F 5 44 ? 9.316   15.610  -41.111 1.00 160.47 ? 322 TRP B CH2   1 
ATOM 2188 N N     . PHE F 5 45 ? 4.924   15.073  -37.391 1.00 138.29 ? 323 PHE B N     1 
ATOM 2189 C CA    . PHE F 5 45 ? 5.931   14.822  -36.361 1.00 141.11 ? 323 PHE B CA    1 
ATOM 2190 C C     . PHE F 5 45 ? 5.774   13.417  -35.780 1.00 144.46 ? 323 PHE B C     1 
ATOM 2191 O O     . PHE F 5 45 ? 6.755   12.681  -35.650 1.00 142.68 ? 323 PHE B O     1 
ATOM 2192 C CB    . PHE F 5 45 ? 5.822   15.877  -35.247 1.00 136.76 ? 323 PHE B CB    1 
ATOM 2193 C CG    . PHE F 5 45 ? 6.669   15.593  -34.027 1.00 142.29 ? 323 PHE B CG    1 
ATOM 2194 C CD1   . PHE F 5 45 ? 7.853   16.281  -33.805 1.00 145.28 ? 323 PHE B CD1   1 
ATOM 2195 C CD2   . PHE F 5 45 ? 6.264   14.660  -33.089 1.00 156.58 ? 323 PHE B CD2   1 
ATOM 2196 C CE1   . PHE F 5 45 ? 8.621   16.025  -32.676 1.00 156.36 ? 323 PHE B CE1   1 
ATOM 2197 C CE2   . PHE F 5 45 ? 7.025   14.397  -31.970 1.00 168.11 ? 323 PHE B CE2   1 
ATOM 2198 C CZ    . PHE F 5 45 ? 8.204   15.083  -31.761 1.00 163.67 ? 323 PHE B CZ    1 
ATOM 2199 N N     . ILE F 5 46 ? 4.539   13.051  -35.435 1.00 143.61 ? 324 ILE B N     1 
ATOM 2200 C CA    . ILE F 5 46 ? 4.264   11.768  -34.783 1.00 151.16 ? 324 ILE B CA    1 
ATOM 2201 C C     . ILE F 5 46 ? 3.942   10.672  -35.792 1.00 146.41 ? 324 ILE B C     1 
ATOM 2202 O O     . ILE F 5 46 ? 4.192   9.497   -35.539 1.00 148.15 ? 324 ILE B O     1 
ATOM 2203 C CB    . ILE F 5 46 ? 3.094   11.862  -33.769 1.00 154.61 ? 324 ILE B CB    1 
ATOM 2204 C CG1   . ILE F 5 46 ? 3.278   13.071  -32.843 1.00 144.00 ? 324 ILE B CG1   1 
ATOM 2205 C CG2   . ILE F 5 46 ? 2.997   10.569  -32.971 1.00 157.62 ? 324 ILE B CG2   1 
ATOM 2206 C CD1   . ILE F 5 46 ? 2.197   13.244  -31.774 1.00 145.40 ? 324 ILE B CD1   1 
ATOM 2207 N N     . ASN F 5 47 ? 3.390   11.058  -36.935 1.00 144.36 ? 325 ASN B N     1 
ATOM 2208 C CA    . ASN F 5 47 ? 3.152   10.107  -38.011 1.00 141.87 ? 325 ASN B CA    1 
ATOM 2209 C C     . ASN F 5 47 ? 4.487   9.558   -38.514 1.00 145.94 ? 325 ASN B C     1 
ATOM 2210 O O     . ASN F 5 47 ? 4.535   8.485   -39.115 1.00 146.84 ? 325 ASN B O     1 
ATOM 2211 C CB    . ASN F 5 47 ? 2.365   10.760  -39.148 1.00 145.83 ? 325 ASN B CB    1 
ATOM 2212 C CG    . ASN F 5 47 ? 0.866   10.802  -38.880 1.00 141.24 ? 325 ASN B CG    1 
ATOM 2213 O OD1   . ASN F 5 47 ? 0.414   10.580  -37.758 1.00 136.62 ? 325 ASN B OD1   1 
ATOM 2214 N ND2   . ASN F 5 47 ? 0.089   11.104  -39.915 1.00 148.59 ? 325 ASN B ND2   1 
ATOM 2215 N N     . ALA F 5 48 ? 5.560   10.310  -38.266 1.00 145.08 ? 326 ALA B N     1 
ATOM 2216 C CA    . ALA F 5 48 ? 6.923   9.888   -38.591 1.00 154.68 ? 326 ALA B CA    1 
ATOM 2217 C C     . ALA F 5 48 ? 7.804   9.702   -37.348 1.00 152.65 ? 326 ALA B C     1 
ATOM 2218 O O     . ALA F 5 48 ? 9.004   9.468   -37.476 1.00 181.73 ? 326 ALA B O     1 
ATOM 2219 C CB    . ALA F 5 48 ? 7.571   10.893  -39.538 1.00 172.53 ? 326 ALA B CB    1 
ATOM 2220 N N     . ARG F 5 49 ? 7.221   9.793   -36.154 1.00 151.76 ? 327 ARG B N     1 
ATOM 2221 C CA    . ARG F 5 49 ? 7.972   9.575   -34.909 1.00 153.72 ? 327 ARG B CA    1 
ATOM 2222 C C     . ARG F 5 49 ? 8.358   8.102   -34.840 1.00 152.10 ? 327 ARG B C     1 
ATOM 2223 O O     . ARG F 5 49 ? 7.957   7.384   -33.924 1.00 150.56 ? 327 ARG B O     1 
ATOM 2224 C CB    . ARG F 5 49 ? 7.127   9.978   -33.692 1.00 152.82 ? 327 ARG B CB    1 
ATOM 2225 C CG    . ARG F 5 49 ? 7.784   9.820   -32.316 1.00 152.67 ? 327 ARG B CG    1 
ATOM 2226 C CD    . ARG F 5 49 ? 6.743   9.686   -31.191 1.00 150.78 ? 327 ARG B CD    1 
ATOM 2227 N NE    . ARG F 5 49 ? 5.648   8.766   -31.501 1.00 149.52 ? 327 ARG B NE    1 
ATOM 2228 C CZ    . ARG F 5 49 ? 5.783   7.456   -31.691 1.00 136.47 ? 327 ARG B CZ    1 
ATOM 2229 N NH1   . ARG F 5 49 ? 6.974   6.880   -31.627 1.00 139.53 ? 327 ARG B NH1   1 
ATOM 2230 N NH2   . ARG F 5 49 ? 4.716   6.717   -31.962 1.00 129.09 ? 327 ARG B NH2   1 
ATOM 2231 N N     . ARG F 5 50 ? 9.124   7.645   -35.829 1.00 154.00 ? 328 ARG B N     1 
ATOM 2232 C CA    . ARG F 5 50 ? 9.219   6.214   -36.095 1.00 147.85 ? 328 ARG B CA    1 
ATOM 2233 C C     . ARG F 5 50 ? 10.424  5.765   -36.928 1.00 149.97 ? 328 ARG B C     1 
ATOM 2234 O O     . ARG F 5 50 ? 11.426  5.275   -36.407 1.00 152.65 ? 328 ARG B O     1 
ATOM 2235 C CB    . ARG F 5 50 ? 7.963   5.720   -36.845 1.00 141.83 ? 328 ARG B CB    1 
ATOM 2236 C CG    . ARG F 5 50 ? 6.623   6.361   -36.530 1.00 142.66 ? 328 ARG B CG    1 
ATOM 2237 C CD    . ARG F 5 50 ? 5.583   5.880   -37.540 1.00 137.41 ? 328 ARG B CD    1 
ATOM 2238 N NE    . ARG F 5 50 ? 4.228   5.848   -36.998 1.00 136.66 ? 328 ARG B NE    1 
ATOM 2239 C CZ    . ARG F 5 50 ? 3.843   5.065   -35.995 1.00 139.77 ? 328 ARG B CZ    1 
ATOM 2240 N NH1   . ARG F 5 50 ? 4.716   4.258   -35.402 1.00 136.44 ? 328 ARG B NH1   1 
ATOM 2241 N NH2   . ARG F 5 50 ? 2.589   5.098   -35.572 1.00 138.73 ? 328 ARG B NH2   1 
ATOM 2242 N N     . ARG F 5 51 ? 10.304  5.988   -38.233 1.00 147.60 ? 329 ARG B N     1 
ATOM 2243 C CA    . ARG F 5 51 ? 10.763  5.051   -39.256 1.00 145.99 ? 329 ARG B CA    1 
ATOM 2244 C C     . ARG F 5 51 ? 12.256  4.743   -39.307 1.00 151.13 ? 329 ARG B C     1 
ATOM 2245 O O     . ARG F 5 51 ? 12.641  3.683   -39.795 1.00 150.59 ? 329 ARG B O     1 
ATOM 2246 C CB    . ARG F 5 51 ? 10.326  5.576   -40.628 1.00 141.82 ? 329 ARG B CB    1 
ATOM 2247 C CG    . ARG F 5 51 ? 8.820   5.727   -40.791 1.00 133.91 ? 329 ARG B CG    1 
ATOM 2248 C CD    . ARG F 5 51 ? 8.473   6.899   -41.689 1.00 142.68 ? 329 ARG B CD    1 
ATOM 2249 N NE    . ARG F 5 51 ? 7.039   7.164   -41.696 1.00 140.73 ? 329 ARG B NE    1 
ATOM 2250 C CZ    . ARG F 5 51 ? 6.454   8.105   -42.427 1.00 132.68 ? 329 ARG B CZ    1 
ATOM 2251 N NH1   . ARG F 5 51 ? 7.172   8.883   -43.226 1.00 136.65 ? 329 ARG B NH1   1 
ATOM 2252 N NH2   . ARG F 5 51 ? 5.142   8.264   -42.359 1.00 131.20 ? 329 ARG B NH2   1 
ATOM 2253 N N     . ILE F 5 52 ? 13.095  5.661   -38.842 1.00 157.77 ? 330 ILE B N     1 
ATOM 2254 C CA    . ILE F 5 52 ? 14.541  5.494   -38.983 1.00 159.92 ? 330 ILE B CA    1 
ATOM 2255 C C     . ILE F 5 52 ? 15.214  4.899   -37.736 1.00 160.89 ? 330 ILE B C     1 
ATOM 2256 O O     . ILE F 5 52 ? 16.208  4.179   -37.859 1.00 168.40 ? 330 ILE B O     1 
ATOM 2257 C CB    . ILE F 5 52 ? 15.198  6.845   -39.353 1.00 157.74 ? 330 ILE B CB    1 
ATOM 2258 C CG1   . ILE F 5 52 ? 15.026  7.111   -40.852 1.00 156.20 ? 330 ILE B CG1   1 
ATOM 2259 C CG2   . ILE F 5 52 ? 16.683  6.855   -39.016 1.00 175.39 ? 330 ILE B CG2   1 
ATOM 2260 C CD1   . ILE F 5 52 ? 13.594  7.389   -41.275 1.00 149.05 ? 330 ILE B CD1   1 
ATOM 2261 N N     . VAL F 5 53 ? 14.681  5.191   -36.551 1.00 158.29 ? 331 VAL B N     1 
ATOM 2262 C CA    . VAL F 5 53 ? 15.212  4.633   -35.299 1.00 154.77 ? 331 VAL B CA    1 
ATOM 2263 C C     . VAL F 5 53 ? 14.385  3.447   -34.795 1.00 150.66 ? 331 VAL B C     1 
ATOM 2264 O O     . VAL F 5 53 ? 14.887  2.613   -34.042 1.00 149.52 ? 331 VAL B O     1 
ATOM 2265 C CB    . VAL F 5 53 ? 15.280  5.699   -34.188 1.00 145.84 ? 331 VAL B CB    1 
ATOM 2266 C CG1   . VAL F 5 53 ? 16.401  6.693   -34.467 1.00 149.73 ? 331 VAL B CG1   1 
ATOM 2267 C CG2   . VAL F 5 53 ? 13.940  6.404   -34.045 1.00 141.08 ? 331 VAL B CG2   1 
ATOM 2268 N N     . GLN F 5 54 ? 13.124  3.376   -35.215 1.00 148.26 ? 332 GLN B N     1 
ATOM 2269 C CA    . GLN F 5 54 ? 12.263  2.228   -34.930 1.00 149.97 ? 332 GLN B CA    1 
ATOM 2270 C C     . GLN F 5 54 ? 12.882  0.894   -35.377 1.00 152.64 ? 332 GLN B C     1 
ATOM 2271 O O     . GLN F 5 54 ? 12.799  -0.094  -34.646 1.00 154.68 ? 332 GLN B O     1 
ATOM 2272 C CB    . GLN F 5 54 ? 10.897  2.402   -35.600 1.00 144.74 ? 332 GLN B CB    1 
ATOM 2273 C CG    . GLN F 5 54 ? 9.917   3.260   -34.823 1.00 140.68 ? 332 GLN B CG    1 
ATOM 2274 C CD    . GLN F 5 54 ? 9.293   2.521   -33.659 1.00 137.71 ? 332 GLN B CD    1 
ATOM 2275 O OE1   . GLN F 5 54 ? 9.969   2.188   -32.687 1.00 137.75 ? 332 GLN B OE1   1 
ATOM 2276 N NE2   . GLN F 5 54 ? 7.995   2.256   -33.753 1.00 132.02 ? 332 GLN B NE2   1 
ATOM 2277 N N     . PRO F 5 55 ? 13.458  0.848   -36.593 1.00 153.55 ? 333 PRO B N     1 
ATOM 2278 C CA    . PRO F 5 55 ? 13.993  -0.423  -37.091 1.00 155.95 ? 333 PRO B CA    1 
ATOM 2279 C C     . PRO F 5 55 ? 15.056  -1.051  -36.178 1.00 152.04 ? 333 PRO B C     1 
ATOM 2280 O O     . PRO F 5 55 ? 15.113  -2.279  -36.093 1.00 153.76 ? 333 PRO B O     1 
ATOM 2281 C CB    . PRO F 5 55 ? 14.637  -0.007  -38.434 1.00 163.91 ? 333 PRO B CB    1 
ATOM 2282 C CG    . PRO F 5 55 ? 13.901  1.222   -38.840 1.00 165.57 ? 333 PRO B CG    1 
ATOM 2283 C CD    . PRO F 5 55 ? 13.642  1.941   -37.559 1.00 155.16 ? 333 PRO B CD    1 
ATOM 2284 N N     . MET F 5 56 ? 15.854  -0.236  -35.499 1.00 150.40 ? 334 MET B N     1 
ATOM 2285 C CA    . MET F 5 56 ? 16.979  -0.746  -34.713 1.00 159.62 ? 334 MET B CA    1 
ATOM 2286 C C     . MET F 5 56 ? 17.264  0.135   -33.484 1.00 165.95 ? 334 MET B C     1 
ATOM 2287 O O     . MET F 5 56 ? 18.307  0.785   -33.405 1.00 168.84 ? 334 MET B O     1 
ATOM 2288 C CB    . MET F 5 56 ? 18.237  -0.852  -35.593 1.00 155.68 ? 334 MET B CB    1 
ATOM 2289 C CG    . MET F 5 56 ? 17.979  -1.405  -36.984 1.00 155.77 ? 334 MET B CG    1 
ATOM 2290 S SD    . MET F 5 56 ? 19.439  -1.494  -38.037 1.00 171.59 ? 334 MET B SD    1 
ATOM 2291 C CE    . MET F 5 56 ? 18.637  -1.675  -39.628 1.00 158.06 ? 334 MET B CE    1 
ATOM 2292 N N     . ILE F 5 57 ? 16.331  0.158   -32.533 1.00 157.69 ? 335 ILE B N     1 
ATOM 2293 C CA    . ILE F 5 57 ? 16.522  0.910   -31.292 1.00 159.42 ? 335 ILE B CA    1 
ATOM 2294 C C     . ILE F 5 57 ? 17.673  0.346   -30.465 1.00 167.10 ? 335 ILE B C     1 
ATOM 2295 O O     . ILE F 5 57 ? 18.401  1.090   -29.806 1.00 175.41 ? 335 ILE B O     1 
ATOM 2296 C CB    . ILE F 5 57 ? 15.245  0.895   -30.399 1.00 164.68 ? 335 ILE B CB    1 
ATOM 2297 C CG1   . ILE F 5 57 ? 13.996  1.257   -31.214 1.00 162.74 ? 335 ILE B CG1   1 
ATOM 2298 C CG2   . ILE F 5 57 ? 15.417  1.820   -29.187 1.00 169.99 ? 335 ILE B CG2   1 
ATOM 2299 C CD1   . ILE F 5 57 ? 12.748  1.554   -30.376 1.00 163.30 ? 335 ILE B CD1   1 
ATOM 2300 N N     . ASP F 5 58 ? 17.845  -0.971  -30.531 1.00 168.20 ? 336 ASP B N     1 
ATOM 2301 C CA    . ASP F 5 58 ? 18.694  -1.696  -29.589 1.00 171.58 ? 336 ASP B CA    1 
ATOM 2302 C C     . ASP F 5 58 ? 19.842  -2.385  -30.316 1.00 165.29 ? 336 ASP B C     1 
ATOM 2303 O O     . ASP F 5 58 ? 20.357  -3.402  -29.857 1.00 175.94 ? 336 ASP B O     1 
ATOM 2304 C CB    . ASP F 5 58 ? 17.868  -2.726  -28.811 1.00 169.14 ? 336 ASP B CB    1 
ATOM 2305 C CG    . ASP F 5 58 ? 16.514  -2.189  -28.388 1.00 165.08 ? 336 ASP B CG    1 
ATOM 2306 O OD1   . ASP F 5 58 ? 16.434  -1.009  -27.986 1.00 169.61 ? 336 ASP B OD1   1 
ATOM 2307 O OD2   . ASP F 5 58 ? 15.525  -2.949  -28.460 1.00 160.86 ? 336 ASP B OD2   1 
ATOM 2308 N N     . LYS G 6 1  ? -28.595 -5.098  -15.823 1.00 146.92 ? 131 LYS G N     1 
ATOM 2309 C CA    . LYS G 6 1  ? -28.716 -4.443  -17.113 1.00 138.59 ? 131 LYS G CA    1 
ATOM 2310 C C     . LYS G 6 1  ? -27.309 -4.187  -17.672 1.00 145.78 ? 131 LYS G C     1 
ATOM 2311 O O     . LYS G 6 1  ? -26.415 -3.779  -16.931 1.00 159.40 ? 131 LYS G O     1 
ATOM 2312 C CB    . LYS G 6 1  ? -29.522 -3.146  -16.989 1.00 127.45 ? 131 LYS G CB    1 
ATOM 2313 C CG    . LYS G 6 1  ? -29.596 -2.551  -15.585 1.00 134.87 ? 131 LYS G CG    1 
ATOM 2314 C CD    . LYS G 6 1  ? -28.249 -2.103  -15.051 1.00 131.57 ? 131 LYS G CD    1 
ATOM 2315 C CE    . LYS G 6 1  ? -27.617 -1.058  -15.943 1.00 126.80 ? 131 LYS G CE    1 
ATOM 2316 N NZ    . LYS G 6 1  ? -26.431 -0.418  -15.308 1.00 121.57 ? 131 LYS G NZ    1 
ATOM 2317 N N     . PRO G 6 2  ? -27.092 -4.464  -18.971 1.00 135.86 ? 132 PRO G N     1 
ATOM 2318 C CA    . PRO G 6 2  ? -28.070 -4.984  -19.931 1.00 132.39 ? 132 PRO G CA    1 
ATOM 2319 C C     . PRO G 6 2  ? -28.410 -6.455  -19.667 1.00 133.95 ? 132 PRO G C     1 
ATOM 2320 O O     . PRO G 6 2  ? -28.160 -6.949  -18.570 1.00 128.52 ? 132 PRO G O     1 
ATOM 2321 C CB    . PRO G 6 2  ? -27.355 -4.805  -21.268 1.00 126.92 ? 132 PRO G CB    1 
ATOM 2322 C CG    . PRO G 6 2  ? -25.910 -5.019  -20.921 1.00 133.27 ? 132 PRO G CG    1 
ATOM 2323 C CD    . PRO G 6 2  ? -25.752 -4.351  -19.579 1.00 134.31 ? 132 PRO G CD    1 
ATOM 2324 N N     . ARG G 6 3  ? -28.958 -7.147  -20.659 1.00 138.64 ? 133 ARG G N     1 
ATOM 2325 C CA    . ARG G 6 3  ? -29.424 -8.520  -20.472 1.00 130.23 ? 133 ARG G CA    1 
ATOM 2326 C C     . ARG G 6 3  ? -28.327 -9.512  -20.060 1.00 134.91 ? 133 ARG G C     1 
ATOM 2327 O O     . ARG G 6 3  ? -28.603 -10.473 -19.347 1.00 136.05 ? 133 ARG G O     1 
ATOM 2328 C CB    . ARG G 6 3  ? -30.097 -9.005  -21.756 1.00 123.24 ? 133 ARG G CB    1 
ATOM 2329 C CG    . ARG G 6 3  ? -30.360 -10.492 -21.817 1.00 132.83 ? 133 ARG G CG    1 
ATOM 2330 C CD    . ARG G 6 3  ? -31.737 -10.765 -22.335 1.00 125.66 ? 133 ARG G CD    1 
ATOM 2331 N NE    . ARG G 6 3  ? -32.737 -10.480 -21.316 1.00 117.12 ? 133 ARG G NE    1 
ATOM 2332 C CZ    . ARG G 6 3  ? -34.009 -10.834 -21.420 1.00 113.73 ? 133 ARG G CZ    1 
ATOM 2333 N NH1   . ARG G 6 3  ? -34.424 -11.464 -22.511 1.00 108.72 ? 133 ARG G NH1   1 
ATOM 2334 N NH2   . ARG G 6 3  ? -34.875 -10.535 -20.461 1.00 110.82 ? 133 ARG G NH2   1 
ATOM 2335 N N     . THR G 6 4  ? -27.096 -9.279  -20.500 1.00 137.21 ? 134 THR G N     1 
ATOM 2336 C CA    . THR G 6 4  ? -25.970 -10.165 -20.184 1.00 142.69 ? 134 THR G CA    1 
ATOM 2337 C C     . THR G 6 4  ? -26.211 -11.617 -20.604 1.00 145.84 ? 134 THR G C     1 
ATOM 2338 O O     . THR G 6 4  ? -26.824 -12.388 -19.866 1.00 142.55 ? 134 THR G O     1 
ATOM 2339 C CB    . THR G 6 4  ? -25.637 -10.164 -18.668 1.00 140.81 ? 134 THR G CB    1 
ATOM 2340 O OG1   . THR G 6 4  ? -26.503 -11.072 -17.974 1.00 144.29 ? 134 THR G OG1   1 
ATOM 2341 C CG2   . THR G 6 4  ? -25.761 -8.764  -18.069 1.00 135.40 ? 134 THR G CG2   1 
ATOM 2342 N N     . ILE G 6 5  ? -25.709 -12.000 -21.775 1.00 145.98 ? 135 ILE G N     1 
ATOM 2343 C CA    . ILE G 6 5  ? -25.729 -13.401 -22.169 1.00 141.82 ? 135 ILE G CA    1 
ATOM 2344 C C     . ILE G 6 5  ? -24.903 -14.120 -21.097 1.00 143.48 ? 135 ILE G C     1 
ATOM 2345 O O     . ILE G 6 5  ? -23.817 -13.658 -20.736 1.00 146.00 ? 135 ILE G O     1 
ATOM 2346 C CB    . ILE G 6 5  ? -25.143 -13.597 -23.627 1.00 141.64 ? 135 ILE G CB    1 
ATOM 2347 C CG1   . ILE G 6 5  ? -26.003 -14.514 -24.529 1.00 144.73 ? 135 ILE G CG1   1 
ATOM 2348 C CG2   . ILE G 6 5  ? -23.681 -14.097 -23.590 1.00 145.16 ? 135 ILE G CG2   1 
ATOM 2349 C CD1   . ILE G 6 5  ? -27.515 -14.572 -24.246 1.00 142.52 ? 135 ILE G CD1   1 
ATOM 2350 N N     . TYR G 6 6  ? -25.413 -15.226 -20.560 1.00 150.52 ? 136 TYR G N     1 
ATOM 2351 C CA    . TYR G 6 6  ? -24.643 -15.995 -19.589 1.00 154.83 ? 136 TYR G CA    1 
ATOM 2352 C C     . TYR G 6 6  ? -23.453 -16.669 -20.284 1.00 151.49 ? 136 TYR G C     1 
ATOM 2353 O O     . TYR G 6 6  ? -22.330 -16.524 -19.802 1.00 156.78 ? 136 TYR G O     1 
ATOM 2354 C CB    . TYR G 6 6  ? -25.531 -17.004 -18.854 1.00 150.88 ? 136 TYR G CB    1 
ATOM 2355 C CG    . TYR G 6 6  ? -26.491 -16.348 -17.894 1.00 149.87 ? 136 TYR G CG    1 
ATOM 2356 C CD1   . TYR G 6 6  ? -26.031 -15.649 -16.789 1.00 145.20 ? 136 TYR G CD1   1 
ATOM 2357 C CD2   . TYR G 6 6  ? -27.858 -16.421 -18.099 1.00 148.28 ? 136 TYR G CD2   1 
ATOM 2358 C CE1   . TYR G 6 6  ? -26.912 -15.043 -15.913 1.00 146.75 ? 136 TYR G CE1   1 
ATOM 2359 C CE2   . TYR G 6 6  ? -28.737 -15.825 -17.232 1.00 145.39 ? 136 TYR G CE2   1 
ATOM 2360 C CZ    . TYR G 6 6  ? -28.262 -15.134 -16.141 1.00 143.14 ? 136 TYR G CZ    1 
ATOM 2361 O OH    . TYR G 6 6  ? -29.143 -14.532 -15.272 1.00 134.30 ? 136 TYR G OH    1 
ATOM 2362 N N     . SER G 6 7  ? -23.642 -17.399 -21.389 1.00 142.61 ? 137 SER G N     1 
ATOM 2363 C CA    . SER G 6 7  ? -24.881 -18.086 -21.773 1.00 139.03 ? 137 SER G CA    1 
ATOM 2364 C C     . SER G 6 7  ? -24.529 -19.292 -22.639 1.00 135.06 ? 137 SER G C     1 
ATOM 2365 O O     . SER G 6 7  ? -25.369 -19.830 -23.361 1.00 132.68 ? 137 SER G O     1 
ATOM 2366 C CB    . SER G 6 7  ? -25.844 -17.164 -22.518 1.00 143.18 ? 137 SER G CB    1 
ATOM 2367 O OG    . SER G 6 7  ? -27.011 -16.935 -21.748 1.00 142.56 ? 137 SER G OG    1 
ATOM 2368 N N     . SER G 6 8  ? -23.274 -19.711 -22.550 1.00 126.51 ? 138 SER G N     1 
ATOM 2369 C CA    . SER G 6 8  ? -22.790 -20.892 -23.237 1.00 125.69 ? 138 SER G CA    1 
ATOM 2370 C C     . SER G 6 8  ? -23.334 -22.136 -22.531 1.00 125.47 ? 138 SER G C     1 
ATOM 2371 O O     . SER G 6 8  ? -24.503 -22.452 -22.705 1.00 125.62 ? 138 SER G O     1 
ATOM 2372 C CB    . SER G 6 8  ? -21.269 -20.863 -23.272 1.00 124.82 ? 138 SER G CB    1 
ATOM 2373 O OG    . SER G 6 8  ? -20.831 -19.552 -22.970 1.00 122.43 ? 138 SER G OG    1 
ATOM 2374 N N     . TYR G 6 9  ? -22.504 -22.819 -21.738 1.00 126.12 ? 139 TYR G N     1 
ATOM 2375 C CA    . TYR G 6 9  ? -22.933 -23.932 -20.877 1.00 129.41 ? 139 TYR G CA    1 
ATOM 2376 C C     . TYR G 6 9  ? -21.900 -24.236 -19.781 1.00 130.55 ? 139 TYR G C     1 
ATOM 2377 O O     . TYR G 6 9  ? -21.015 -25.048 -20.046 1.00 130.97 ? 139 TYR G O     1 
ATOM 2378 C CB    . TYR G 6 9  ? -23.173 -25.206 -21.712 1.00 128.57 ? 139 TYR G CB    1 
ATOM 2379 C CG    . TYR G 6 9  ? -24.446 -25.167 -22.536 1.00 125.50 ? 139 TYR G CG    1 
ATOM 2380 C CD1   . TYR G 6 9  ? -24.406 -25.165 -23.928 1.00 131.56 ? 139 TYR G CD1   1 
ATOM 2381 C CD2   . TYR G 6 9  ? -25.687 -25.081 -21.921 1.00 123.93 ? 139 TYR G CD2   1 
ATOM 2382 C CE1   . TYR G 6 9  ? -25.575 -25.104 -24.678 1.00 138.66 ? 139 TYR G CE1   1 
ATOM 2383 C CE2   . TYR G 6 9  ? -26.853 -25.018 -22.663 1.00 136.67 ? 139 TYR G CE2   1 
ATOM 2384 C CZ    . TYR G 6 9  ? -26.793 -25.029 -24.037 1.00 141.18 ? 139 TYR G CZ    1 
ATOM 2385 O OH    . TYR G 6 9  ? -27.961 -24.968 -24.765 1.00 155.59 ? 139 TYR G OH    1 
ATOM 2386 N N     . GLN G 6 10 ? -21.927 -23.642 -18.572 1.00 143.05 ? 140 GLN G N     1 
ATOM 2387 C CA    . GLN G 6 10 ? -22.770 -22.531 -18.054 1.00 129.34 ? 140 GLN G CA    1 
ATOM 2388 C C     . GLN G 6 10 ? -24.137 -22.924 -17.462 1.00 129.40 ? 140 GLN G C     1 
ATOM 2389 O O     . GLN G 6 10 ? -24.279 -23.017 -16.241 1.00 130.09 ? 140 GLN G O     1 
ATOM 2390 C CB    . GLN G 6 10 ? -23.007 -21.444 -19.108 1.00 131.15 ? 140 GLN G CB    1 
ATOM 2391 C CG    . GLN G 6 10 ? -21.745 -20.791 -19.659 1.00 132.72 ? 140 GLN G CG    1 
ATOM 2392 C CD    . GLN G 6 10 ? -21.265 -19.637 -18.803 1.00 137.66 ? 140 GLN G CD    1 
ATOM 2393 O OE1   . GLN G 6 10 ? -21.302 -19.702 -17.575 1.00 137.53 ? 140 GLN G OE1   1 
ATOM 2394 N NE2   . GLN G 6 10 ? -20.809 -18.569 -19.451 1.00 139.93 ? 140 GLN G NE2   1 
ATOM 2395 N N     . LEU G 6 11 ? -25.134 -23.144 -18.314 1.00 128.56 ? 141 LEU G N     1 
ATOM 2396 C CA    . LEU G 6 11 ? -26.540 -23.066 -17.905 1.00 127.98 ? 141 LEU G CA    1 
ATOM 2397 C C     . LEU G 6 11 ? -27.073 -24.236 -17.091 1.00 123.61 ? 141 LEU G C     1 
ATOM 2398 O O     . LEU G 6 11 ? -27.180 -24.157 -15.868 1.00 127.14 ? 141 LEU G O     1 
ATOM 2399 C CB    . LEU G 6 11 ? -27.434 -22.931 -19.139 1.00 128.71 ? 141 LEU G CB    1 
ATOM 2400 C CG    . LEU G 6 11 ? -27.464 -21.603 -19.891 1.00 124.54 ? 141 LEU G CG    1 
ATOM 2401 C CD1   . LEU G 6 11 ? -26.101 -21.303 -20.461 1.00 124.30 ? 141 LEU G CD1   1 
ATOM 2402 C CD2   . LEU G 6 11 ? -28.521 -21.634 -20.993 1.00 128.91 ? 141 LEU G CD2   1 
ATOM 2403 N N     . ALA G 6 12 ? -27.400 -25.320 -17.787 1.00 122.09 ? 142 ALA G N     1 
ATOM 2404 C CA    . ALA G 6 12 ? -28.290 -26.340 -17.248 1.00 119.26 ? 142 ALA G CA    1 
ATOM 2405 C C     . ALA G 6 12 ? -27.584 -27.249 -16.247 1.00 123.39 ? 142 ALA G C     1 
ATOM 2406 O O     . ALA G 6 12 ? -28.124 -28.276 -15.841 1.00 115.98 ? 142 ALA G O     1 
ATOM 2407 C CB    . ALA G 6 12 ? -28.919 -27.156 -18.395 1.00 104.12 ? 142 ALA G CB    1 
ATOM 2408 N N     . ALA G 6 13 ? -26.372 -26.860 -15.860 1.00 117.30 ? 143 ALA G N     1 
ATOM 2409 C CA    . ALA G 6 13 ? -25.811 -27.304 -14.598 1.00 118.97 ? 143 ALA G CA    1 
ATOM 2410 C C     . ALA G 6 13 ? -26.780 -26.830 -13.506 1.00 118.74 ? 143 ALA G C     1 
ATOM 2411 O O     . ALA G 6 13 ? -26.884 -27.437 -12.440 1.00 117.72 ? 143 ALA G O     1 
ATOM 2412 C CB    . ALA G 6 13 ? -24.390 -26.735 -14.383 1.00 112.53 ? 143 ALA G CB    1 
ATOM 2413 N N     . LEU G 6 14 ? -27.490 -25.740 -13.799 1.00 118.45 ? 144 LEU G N     1 
ATOM 2414 C CA    . LEU G 6 14 ? -28.556 -25.212 -12.946 1.00 118.95 ? 144 LEU G CA    1 
ATOM 2415 C C     . LEU G 6 14 ? -29.887 -25.962 -13.025 1.00 114.27 ? 144 LEU G C     1 
ATOM 2416 O O     . LEU G 6 14 ? -30.531 -26.186 -12.003 1.00 120.39 ? 144 LEU G O     1 
ATOM 2417 C CB    . LEU G 6 14 ? -28.824 -23.753 -13.310 1.00 114.16 ? 144 LEU G CB    1 
ATOM 2418 C CG    . LEU G 6 14 ? -29.841 -23.033 -12.423 1.00 129.34 ? 144 LEU G CG    1 
ATOM 2419 C CD1   . LEU G 6 14 ? -29.123 -22.220 -11.347 1.00 139.25 ? 144 LEU G CD1   1 
ATOM 2420 C CD2   . LEU G 6 14 ? -30.790 -22.178 -13.263 1.00 140.39 ? 144 LEU G CD2   1 
ATOM 2421 N N     . GLN G 6 15 ? -30.306 -26.332 -14.232 1.00 121.38 ? 145 GLN G N     1 
ATOM 2422 C CA    . GLN G 6 15 ? -31.697 -26.739 -14.458 1.00 125.72 ? 145 GLN G CA    1 
ATOM 2423 C C     . GLN G 6 15 ? -32.057 -27.967 -13.627 1.00 117.28 ? 145 GLN G C     1 
ATOM 2424 O O     . GLN G 6 15 ? -33.212 -28.144 -13.255 1.00 115.86 ? 145 GLN G O     1 
ATOM 2425 C CB    . GLN G 6 15 ? -31.953 -26.993 -15.952 1.00 130.98 ? 145 GLN G CB    1 
ATOM 2426 C CG    . GLN G 6 15 ? -31.729 -25.750 -16.829 1.00 132.74 ? 145 GLN G CG    1 
ATOM 2427 C CD    . GLN G 6 15 ? -32.821 -25.511 -17.847 1.00 153.79 ? 145 GLN G CD    1 
ATOM 2428 O OE1   . GLN G 6 15 ? -33.207 -24.369 -18.096 1.00 161.76 ? 145 GLN G OE1   1 
ATOM 2429 N NE2   . GLN G 6 15 ? -33.313 -26.580 -18.457 1.00 171.42 ? 145 GLN G NE2   1 
ATOM 2430 N N     . ARG G 6 16 ? -31.062 -28.797 -13.329 1.00 114.96 ? 146 ARG G N     1 
ATOM 2431 C CA    . ARG G 6 16 ? -31.207 -29.862 -12.339 1.00 114.41 ? 146 ARG G CA    1 
ATOM 2432 C C     . ARG G 6 16 ? -30.921 -29.329 -10.940 1.00 115.39 ? 146 ARG G C     1 
ATOM 2433 O O     . ARG G 6 16 ? -31.449 -29.834 -9.956  1.00 114.86 ? 146 ARG G O     1 
ATOM 2434 C CB    . ARG G 6 16 ? -30.255 -31.015 -12.635 1.00 114.24 ? 146 ARG G CB    1 
ATOM 2435 C CG    . ARG G 6 16 ? -28.826 -30.680 -12.274 1.00 115.83 ? 146 ARG G CG    1 
ATOM 2436 C CD    . ARG G 6 16 ? -27.844 -31.676 -12.821 1.00 120.40 ? 146 ARG G CD    1 
ATOM 2437 N NE    . ARG G 6 16 ? -26.826 -31.015 -13.633 1.00 118.92 ? 146 ARG G NE    1 
ATOM 2438 C CZ    . ARG G 6 16 ? -25.534 -31.329 -13.629 1.00 111.64 ? 146 ARG G CZ    1 
ATOM 2439 N NH1   . ARG G 6 16 ? -25.075 -32.302 -12.855 1.00 119.80 ? 146 ARG G NH1   1 
ATOM 2440 N NH2   . ARG G 6 16 ? -24.693 -30.663 -14.404 1.00 107.40 ? 146 ARG G NH2   1 
ATOM 2441 N N     . ARG G 6 17 ? -30.055 -28.324 -10.852 1.00 116.28 ? 147 ARG G N     1 
ATOM 2442 C CA    . ARG G 6 17 ? -29.710 -27.745 -9.559  1.00 113.70 ? 147 ARG G CA    1 
ATOM 2443 C C     . ARG G 6 17 ? -30.952 -27.132 -8.943  1.00 116.15 ? 147 ARG G C     1 
ATOM 2444 O O     . ARG G 6 17 ? -31.150 -27.183 -7.734  1.00 122.60 ? 147 ARG G O     1 
ATOM 2445 C CB    . ARG G 6 17 ? -28.619 -26.693 -9.704  1.00 109.16 ? 147 ARG G CB    1 
ATOM 2446 C CG    . ARG G 6 17 ? -27.957 -26.310 -8.409  1.00 107.00 ? 147 ARG G CG    1 
ATOM 2447 C CD    . ARG G 6 17 ? -26.491 -26.594 -8.487  1.00 116.73 ? 147 ARG G CD    1 
ATOM 2448 N NE    . ARG G 6 17 ? -25.797 -26.185 -7.279  1.00 136.40 ? 147 ARG G NE    1 
ATOM 2449 C CZ    . ARG G 6 17 ? -24.485 -26.273 -7.119  1.00 145.42 ? 147 ARG G CZ    1 
ATOM 2450 N NH1   . ARG G 6 17 ? -23.729 -26.759 -8.094  1.00 144.28 ? 147 ARG G NH1   1 
ATOM 2451 N NH2   . ARG G 6 17 ? -23.935 -25.876 -5.985  1.00 144.32 ? 147 ARG G NH2   1 
ATOM 2452 N N     . PHE G 6 18 ? -31.798 -26.577 -9.803  1.00 116.49 ? 148 PHE G N     1 
ATOM 2453 C CA    . PHE G 6 18 ? -33.120 -26.110 -9.413  1.00 119.47 ? 148 PHE G CA    1 
ATOM 2454 C C     . PHE G 6 18 ? -33.939 -27.318 -8.956  1.00 119.84 ? 148 PHE G C     1 
ATOM 2455 O O     . PHE G 6 18 ? -34.619 -27.268 -7.929  1.00 124.77 ? 148 PHE G O     1 
ATOM 2456 C CB    . PHE G 6 18 ? -33.781 -25.377 -10.593 1.00 121.50 ? 148 PHE G CB    1 
ATOM 2457 C CG    . PHE G 6 18 ? -35.221 -25.001 -10.372 1.00 126.68 ? 148 PHE G CG    1 
ATOM 2458 C CD1   . PHE G 6 18 ? -35.747 -24.873 -9.099  1.00 134.84 ? 148 PHE G CD1   1 
ATOM 2459 C CD2   . PHE G 6 18 ? -36.049 -24.767 -11.455 1.00 128.96 ? 148 PHE G CD2   1 
ATOM 2460 C CE1   . PHE G 6 18 ? -37.070 -24.532 -8.911  1.00 138.70 ? 148 PHE G CE1   1 
ATOM 2461 C CE2   . PHE G 6 18 ? -37.376 -24.422 -11.269 1.00 139.63 ? 148 PHE G CE2   1 
ATOM 2462 C CZ    . PHE G 6 18 ? -37.880 -24.306 -9.996  1.00 142.59 ? 148 PHE G CZ    1 
ATOM 2463 N N     . GLN G 6 19 ? -33.842 -28.417 -9.697  1.00 118.54 ? 149 GLN G N     1 
ATOM 2464 C CA    . GLN G 6 19 ? -34.487 -29.665 -9.294  1.00 115.78 ? 149 GLN G CA    1 
ATOM 2465 C C     . GLN G 6 19 ? -33.865 -30.229 -8.011  1.00 119.45 ? 149 GLN G C     1 
ATOM 2466 O O     . GLN G 6 19 ? -34.544 -30.896 -7.232  1.00 140.70 ? 149 GLN G O     1 
ATOM 2467 C CB    . GLN G 6 19 ? -34.404 -30.705 -10.417 1.00 120.63 ? 149 GLN G CB    1 
ATOM 2468 C CG    . GLN G 6 19 ? -35.062 -30.292 -11.723 1.00 118.44 ? 149 GLN G CG    1 
ATOM 2469 C CD    . GLN G 6 19 ? -34.708 -31.203 -12.881 1.00 105.11 ? 149 GLN G CD    1 
ATOM 2470 O OE1   . GLN G 6 19 ? -34.153 -30.758 -13.885 1.00 107.65 ? 149 GLN G OE1   1 
ATOM 2471 N NE2   . GLN G 6 19 ? -35.048 -32.481 -12.756 1.00 104.77 ? 149 GLN G NE2   1 
ATOM 2472 N N     . LYS G 6 20 ? -32.577 -29.965 -7.798  1.00 120.11 ? 150 LYS G N     1 
ATOM 2473 C CA    . LYS G 6 20 ? -31.890 -30.362 -6.564  1.00 123.71 ? 150 LYS G CA    1 
ATOM 2474 C C     . LYS G 6 20 ? -32.182 -29.403 -5.421  1.00 127.31 ? 150 LYS G C     1 
ATOM 2475 O O     . LYS G 6 20 ? -32.467 -29.812 -4.296  1.00 126.35 ? 150 LYS G O     1 
ATOM 2476 C CB    . LYS G 6 20 ? -30.374 -30.398 -6.774  1.00 121.29 ? 150 LYS G CB    1 
ATOM 2477 C CG    . LYS G 6 20 ? -29.832 -31.577 -7.541  1.00 130.11 ? 150 LYS G CG    1 
ATOM 2478 C CD    . LYS G 6 20 ? -28.331 -31.429 -7.723  1.00 124.17 ? 150 LYS G CD    1 
ATOM 2479 C CE    . LYS G 6 20 ? -27.787 -32.338 -8.810  1.00 135.23 ? 150 LYS G CE    1 
ATOM 2480 N NZ    . LYS G 6 20 ? -26.388 -31.968 -9.151  1.00 146.21 ? 150 LYS G NZ    1 
ATOM 2481 N N     . ALA G 6 21 ? -32.114 -28.116 -5.738  1.00 125.25 ? 151 ALA G N     1 
ATOM 2482 C CA    . ALA G 6 21 ? -32.034 -27.070 -4.731  1.00 128.15 ? 151 ALA G CA    1 
ATOM 2483 C C     . ALA G 6 21 ? -32.577 -25.762 -5.282  1.00 133.26 ? 151 ALA G C     1 
ATOM 2484 O O     . ALA G 6 21 ? -32.009 -25.187 -6.206  1.00 133.17 ? 151 ALA G O     1 
ATOM 2485 C CB    . ALA G 6 21 ? -30.588 -26.893 -4.273  1.00 126.27 ? 151 ALA G CB    1 
ATOM 2486 N N     . GLN G 6 22 ? -33.681 -25.301 -4.707  1.00 138.70 ? 152 GLN G N     1 
ATOM 2487 C CA    . GLN G 6 22 ? -34.239 -23.998 -5.041  1.00 145.41 ? 152 GLN G CA    1 
ATOM 2488 C C     . GLN G 6 22 ? -33.676 -22.952 -4.086  1.00 157.12 ? 152 GLN G C     1 
ATOM 2489 O O     . GLN G 6 22 ? -34.206 -21.847 -3.979  1.00 170.42 ? 152 GLN G O     1 
ATOM 2490 C CB    . GLN G 6 22 ? -35.767 -24.028 -4.978  1.00 144.31 ? 152 GLN G CB    1 
ATOM 2491 C CG    . GLN G 6 22 ? -36.395 -25.240 -5.655  1.00 134.21 ? 152 GLN G CG    1 
ATOM 2492 C CD    . GLN G 6 22 ? -36.624 -26.394 -4.699  1.00 130.40 ? 152 GLN G CD    1 
ATOM 2493 O OE1   . GLN G 6 22 ? -35.901 -26.554 -3.716  1.00 137.39 ? 152 GLN G OE1   1 
ATOM 2494 N NE2   . GLN G 6 22 ? -37.635 -27.206 -4.984  1.00 124.53 ? 152 GLN G NE2   1 
ATOM 2495 N N     . TYR G 6 23 ? -32.605 -23.320 -3.383  1.00 149.68 ? 153 TYR G N     1 
ATOM 2496 C CA    . TYR G 6 23 ? -31.960 -22.436 -2.419  1.00 149.52 ? 153 TYR G CA    1 
ATOM 2497 C C     . TYR G 6 23 ? -30.440 -22.592 -2.415  1.00 138.03 ? 153 TYR G C     1 
ATOM 2498 O O     . TYR G 6 23 ? -29.922 -23.709 -2.493  1.00 139.20 ? 153 TYR G O     1 
ATOM 2499 C CB    . TYR G 6 23 ? -32.491 -22.712 -1.009  1.00 160.70 ? 153 TYR G CB    1 
ATOM 2500 C CG    . TYR G 6 23 ? -33.933 -22.315 -0.795  1.00 168.07 ? 153 TYR G CG    1 
ATOM 2501 C CD1   . TYR G 6 23 ? -34.962 -23.228 -0.984  1.00 165.24 ? 153 TYR G CD1   1 
ATOM 2502 C CD2   . TYR G 6 23 ? -34.263 -21.029 -0.394  1.00 173.24 ? 153 TYR G CD2   1 
ATOM 2503 C CE1   . TYR G 6 23 ? -36.279 -22.869 -0.787  1.00 169.03 ? 153 TYR G CE1   1 
ATOM 2504 C CE2   . TYR G 6 23 ? -35.582 -20.659 -0.193  1.00 173.44 ? 153 TYR G CE2   1 
ATOM 2505 C CZ    . TYR G 6 23 ? -36.586 -21.585 -0.390  1.00 173.86 ? 153 TYR G CZ    1 
ATOM 2506 O OH    . TYR G 6 23 ? -37.904 -21.236 -0.196  1.00 172.39 ? 153 TYR G OH    1 
ATOM 2507 N N     . LEU G 6 24 ? -29.738 -21.465 -2.327  1.00 134.97 ? 154 LEU G N     1 
ATOM 2508 C CA    . LEU G 6 24 ? -28.321 -21.452 -1.972  1.00 128.18 ? 154 LEU G CA    1 
ATOM 2509 C C     . LEU G 6 24 ? -27.942 -20.073 -1.426  1.00 118.16 ? 154 LEU G C     1 
ATOM 2510 O O     . LEU G 6 24 ? -28.646 -19.093 -1.656  1.00 115.43 ? 154 LEU G O     1 
ATOM 2511 C CB    . LEU G 6 24 ? -27.431 -21.816 -3.170  1.00 128.45 ? 154 LEU G CB    1 
ATOM 2512 C CG    . LEU G 6 24 ? -25.932 -21.913 -2.842  1.00 120.30 ? 154 LEU G CG    1 
ATOM 2513 C CD1   . LEU G 6 24 ? -25.653 -23.030 -1.820  1.00 114.69 ? 154 LEU G CD1   1 
ATOM 2514 C CD2   . LEU G 6 24 ? -25.075 -22.076 -4.090  1.00 120.07 ? 154 LEU G CD2   1 
ATOM 2515 N N     . ALA G 6 25 ? -26.838 -20.017 -0.683  1.00 118.76 ? 155 ALA G N     1 
ATOM 2516 C CA    . ALA G 6 25 ? -26.268 -18.758 -0.189  1.00 120.15 ? 155 ALA G CA    1 
ATOM 2517 C C     . ALA G 6 25 ? -24.926 -18.459 -0.874  1.00 117.11 ? 155 ALA G C     1 
ATOM 2518 O O     . ALA G 6 25 ? -24.671 -18.939 -1.979  1.00 115.65 ? 155 ALA G O     1 
ATOM 2519 C CB    . ALA G 6 25 ? -26.095 -18.812 1.331   1.00 135.02 ? 155 ALA G CB    1 
ATOM 2520 N N     . LEU G 6 26 ? -24.080 -17.670 -0.216  1.00 119.00 ? 156 LEU G N     1 
ATOM 2521 C CA    . LEU G 6 26 ? -22.740 -17.352 -0.714  1.00 120.75 ? 156 LEU G CA    1 
ATOM 2522 C C     . LEU G 6 26 ? -21.747 -18.502 -0.930  1.00 124.10 ? 156 LEU G C     1 
ATOM 2523 O O     . LEU G 6 26 ? -21.098 -18.562 -1.973  1.00 126.23 ? 156 LEU G O     1 
ATOM 2524 C CB    . LEU G 6 26 ? -22.075 -16.366 0.248   1.00 127.47 ? 156 LEU G CB    1 
ATOM 2525 C CG    . LEU G 6 26 ? -20.586 -16.117 -0.010  1.00 135.78 ? 156 LEU G CG    1 
ATOM 2526 C CD1   . LEU G 6 26 ? -20.365 -15.500 -1.373  1.00 147.12 ? 156 LEU G CD1   1 
ATOM 2527 C CD2   . LEU G 6 26 ? -20.016 -15.229 1.049   1.00 161.04 ? 156 LEU G CD2   1 
ATOM 2528 N N     . PRO G 6 27 ? -21.588 -19.397 0.068   1.00 127.43 ? 157 PRO G N     1 
ATOM 2529 C CA    . PRO G 6 27 ? -20.330 -20.164 0.144   1.00 134.36 ? 157 PRO G CA    1 
ATOM 2530 C C     . PRO G 6 27 ? -20.000 -21.004 -1.094  1.00 127.75 ? 157 PRO G C     1 
ATOM 2531 O O     . PRO G 6 27 ? -18.818 -21.168 -1.405  1.00 134.83 ? 157 PRO G O     1 
ATOM 2532 C CB    . PRO G 6 27 ? -20.552 -21.084 1.354   1.00 130.69 ? 157 PRO G CB    1 
ATOM 2533 C CG    . PRO G 6 27 ? -22.008 -21.087 1.620   1.00 120.26 ? 157 PRO G CG    1 
ATOM 2534 C CD    . PRO G 6 27 ? -22.583 -19.824 1.059   1.00 121.72 ? 157 PRO G CD    1 
ATOM 2535 N N     . GLU G 6 28 ? -21.006 -21.528 -1.776  1.00 126.94 ? 158 GLU G N     1 
ATOM 2536 C CA    . GLU G 6 28 ? -20.773 -22.289 -2.997  1.00 131.80 ? 158 GLU G CA    1 
ATOM 2537 C C     . GLU G 6 28 ? -20.200 -21.432 -4.131  1.00 135.16 ? 158 GLU G C     1 
ATOM 2538 O O     . GLU G 6 28 ? -19.460 -21.936 -4.977  1.00 139.30 ? 158 GLU G O     1 
ATOM 2539 C CB    . GLU G 6 28 ? -22.074 -22.934 -3.473  1.00 129.19 ? 158 GLU G CB    1 
ATOM 2540 C CG    . GLU G 6 28 ? -21.980 -24.422 -3.811  1.00 124.53 ? 158 GLU G CG    1 
ATOM 2541 C CD    . GLU G 6 28 ? -20.921 -24.743 -4.845  1.00 127.06 ? 158 GLU G CD    1 
ATOM 2542 O OE1   . GLU G 6 28 ? -21.290 -25.050 -5.995  1.00 142.98 ? 158 GLU G OE1   1 
ATOM 2543 O OE2   . GLU G 6 28 ? -19.723 -24.710 -4.502  1.00 132.09 ? 158 GLU G OE2   1 
ATOM 2544 N N     . ARG G 6 29 ? -20.487 -20.131 -4.109  1.00 133.29 ? 159 ARG G N     1 
ATOM 2545 C CA    . ARG G 6 29 ? -20.463 -19.297 -5.321  1.00 132.51 ? 159 ARG G CA    1 
ATOM 2546 C C     . ARG G 6 29 ? -19.100 -19.247 -6.030  1.00 133.64 ? 159 ARG G C     1 
ATOM 2547 O O     . ARG G 6 29 ? -19.033 -18.937 -7.220  1.00 134.72 ? 159 ARG G O     1 
ATOM 2548 C CB    . ARG G 6 29 ? -20.928 -17.877 -4.983  1.00 129.81 ? 159 ARG G CB    1 
ATOM 2549 C CG    . ARG G 6 29 ? -22.400 -17.803 -4.573  1.00 128.59 ? 159 ARG G CG    1 
ATOM 2550 C CD    . ARG G 6 29 ? -23.354 -18.174 -5.691  1.00 126.71 ? 159 ARG G CD    1 
ATOM 2551 N NE    . ARG G 6 29 ? -24.734 -17.837 -5.351  1.00 120.59 ? 159 ARG G NE    1 
ATOM 2552 C CZ    . ARG G 6 29 ? -25.280 -16.641 -5.545  1.00 127.08 ? 159 ARG G CZ    1 
ATOM 2553 N NH1   . ARG G 6 29 ? -24.568 -15.653 -6.073  1.00 129.73 ? 159 ARG G NH1   1 
ATOM 2554 N NH2   . ARG G 6 29 ? -26.543 -16.435 -5.203  1.00 132.26 ? 159 ARG G NH2   1 
ATOM 2555 N N     . ALA G 6 30 ? -18.027 -19.543 -5.304  1.00 133.90 ? 160 ALA G N     1 
ATOM 2556 C CA    . ALA G 6 30 ? -16.690 -19.632 -5.890  1.00 132.08 ? 160 ALA G CA    1 
ATOM 2557 C C     . ALA G 6 30 ? -16.593 -20.688 -7.002  1.00 125.95 ? 160 ALA G C     1 
ATOM 2558 O O     . ALA G 6 30 ? -16.648 -20.355 -8.182  1.00 127.55 ? 160 ALA G O     1 
ATOM 2559 C CB    . ALA G 6 30 ? -15.680 -19.933 -4.802  1.00 142.60 ? 160 ALA G CB    1 
ATOM 2560 N N     . GLU G 6 31 ? -16.451 -21.956 -6.628  1.00 125.89 ? 161 GLU G N     1 
ATOM 2561 C CA    . GLU G 6 31 ? -16.365 -23.040 -7.607  1.00 129.76 ? 161 GLU G CA    1 
ATOM 2562 C C     . GLU G 6 31 ? -17.640 -23.103 -8.443  1.00 128.77 ? 161 GLU G C     1 
ATOM 2563 O O     . GLU G 6 31 ? -17.640 -23.561 -9.584  1.00 121.78 ? 161 GLU G O     1 
ATOM 2564 C CB    . GLU G 6 31 ? -16.122 -24.380 -6.907  1.00 136.63 ? 161 GLU G CB    1 
ATOM 2565 C CG    . GLU G 6 31 ? -14.687 -24.889 -6.981  1.00 135.27 ? 161 GLU G CG    1 
ATOM 2566 C CD    . GLU G 6 31 ? -13.680 -23.941 -6.349  1.00 147.24 ? 161 GLU G CD    1 
ATOM 2567 O OE1   . GLU G 6 31 ? -12.475 -24.268 -6.354  1.00 183.72 ? 161 GLU G OE1   1 
ATOM 2568 O OE2   . GLU G 6 31 ? -14.088 -22.874 -5.845  1.00 138.33 ? 161 GLU G OE2   1 
ATOM 2569 N N     . LEU G 6 32 ? -18.726 -22.638 -7.838  1.00 123.61 ? 162 LEU G N     1 
ATOM 2570 C CA    . LEU G 6 32 ? -20.024 -22.519 -8.489  1.00 125.95 ? 162 LEU G CA    1 
ATOM 2571 C C     . LEU G 6 32 ? -19.991 -21.577 -9.701  1.00 127.09 ? 162 LEU G C     1 
ATOM 2572 O O     . LEU G 6 32 ? -20.797 -21.727 -10.619 1.00 127.87 ? 162 LEU G O     1 
ATOM 2573 C CB    . LEU G 6 32 ? -21.041 -22.028 -7.450  1.00 129.82 ? 162 LEU G CB    1 
ATOM 2574 C CG    . LEU G 6 32 ? -22.466 -21.572 -7.781  1.00 133.63 ? 162 LEU G CG    1 
ATOM 2575 C CD1   . LEU G 6 32 ? -22.498 -20.175 -8.432  1.00 135.53 ? 162 LEU G CD1   1 
ATOM 2576 C CD2   . LEU G 6 32 ? -23.192 -22.635 -8.613  1.00 138.75 ? 162 LEU G CD2   1 
ATOM 2577 N N     . ALA G 6 33 ? -19.058 -20.622 -9.706  1.00 125.09 ? 163 ALA G N     1 
ATOM 2578 C CA    . ALA G 6 33 ? -19.031 -19.568 -10.726 1.00 123.05 ? 163 ALA G CA    1 
ATOM 2579 C C     . ALA G 6 33 ? -17.614 -19.037 -11.042 1.00 127.41 ? 163 ALA G C     1 
ATOM 2580 O O     . ALA G 6 33 ? -17.356 -18.658 -12.176 1.00 132.44 ? 163 ALA G O     1 
ATOM 2581 C CB    . ALA G 6 33 ? -19.956 -18.400 -10.304 1.00 122.85 ? 163 ALA G CB    1 
ATOM 2582 N N     . ALA G 6 34 ? -16.711 -18.990 -10.060 1.00 128.77 ? 164 ALA G N     1 
ATOM 2583 C CA    . ALA G 6 34 ? -15.337 -18.489 -10.280 1.00 137.12 ? 164 ALA G CA    1 
ATOM 2584 C C     . ALA G 6 34 ? -14.520 -19.370 -11.237 1.00 138.87 ? 164 ALA G C     1 
ATOM 2585 O O     . ALA G 6 34 ? -13.598 -18.890 -11.898 1.00 138.71 ? 164 ALA G O     1 
ATOM 2586 C CB    . ALA G 6 34 ? -14.593 -18.342 -8.939  1.00 136.19 ? 164 ALA G CB    1 
ATOM 2587 N N     . GLN G 6 35 ? -14.858 -20.653 -11.297 1.00 134.78 ? 165 GLN G N     1 
ATOM 2588 C CA    . GLN G 6 35 ? -14.308 -21.574 -12.292 1.00 138.32 ? 165 GLN G CA    1 
ATOM 2589 C C     . GLN G 6 35 ? -15.070 -21.390 -13.607 1.00 135.04 ? 165 GLN G C     1 
ATOM 2590 O O     . GLN G 6 35 ? -14.765 -22.021 -14.619 1.00 141.29 ? 165 GLN G O     1 
ATOM 2591 C CB    . GLN G 6 35 ? -14.401 -23.017 -11.777 1.00 141.23 ? 165 GLN G CB    1 
ATOM 2592 C CG    . GLN G 6 35 ? -13.776 -24.102 -12.658 1.00 135.22 ? 165 GLN G CG    1 
ATOM 2593 C CD    . GLN G 6 35 ? -12.287 -24.240 -12.440 1.00 138.19 ? 165 GLN G CD    1 
ATOM 2594 O OE1   . GLN G 6 35 ? -11.548 -23.258 -12.488 1.00 143.98 ? 165 GLN G OE1   1 
ATOM 2595 N NE2   . GLN G 6 35 ? -11.837 -25.465 -12.197 1.00 143.62 ? 165 GLN G NE2   1 
ATOM 2596 N N     . LEU G 6 36 ? -16.067 -20.509 -13.576 1.00 130.19 ? 166 LEU G N     1 
ATOM 2597 C CA    . LEU G 6 36 ? -16.969 -20.298 -14.698 1.00 130.55 ? 166 LEU G CA    1 
ATOM 2598 C C     . LEU G 6 36 ? -16.908 -18.832 -15.126 1.00 138.06 ? 166 LEU G C     1 
ATOM 2599 O O     . LEU G 6 36 ? -17.264 -18.483 -16.251 1.00 141.31 ? 166 LEU G O     1 
ATOM 2600 C CB    . LEU G 6 36 ? -18.400 -20.701 -14.327 1.00 124.27 ? 166 LEU G CB    1 
ATOM 2601 C CG    . LEU G 6 36 ? -18.607 -22.124 -13.784 1.00 123.59 ? 166 LEU G CG    1 
ATOM 2602 C CD1   . LEU G 6 36 ? -17.953 -22.355 -12.424 1.00 124.25 ? 166 LEU G CD1   1 
ATOM 2603 C CD2   . LEU G 6 36 ? -20.089 -22.478 -13.699 1.00 128.30 ? 166 LEU G CD2   1 
ATOM 2604 N N     . GLY G 6 37 ? -16.461 -17.981 -14.205 1.00 140.19 ? 167 GLY G N     1 
ATOM 2605 C CA    . GLY G 6 37 ? -16.079 -16.620 -14.527 1.00 144.73 ? 167 GLY G CA    1 
ATOM 2606 C C     . GLY G 6 37 ? -17.002 -15.461 -14.194 1.00 146.34 ? 167 GLY G C     1 
ATOM 2607 O O     . GLY G 6 37 ? -16.556 -14.316 -14.179 1.00 154.52 ? 167 GLY G O     1 
ATOM 2608 N N     . LEU G 6 38 ? -18.273 -15.738 -13.925 1.00 141.78 ? 168 LEU G N     1 
ATOM 2609 C CA    . LEU G 6 38 ? -19.277 -14.677 -13.854 1.00 143.32 ? 168 LEU G CA    1 
ATOM 2610 C C     . LEU G 6 38 ? -19.494 -14.151 -12.428 1.00 139.67 ? 168 LEU G C     1 
ATOM 2611 O O     . LEU G 6 38 ? -19.107 -14.790 -11.451 1.00 142.30 ? 168 LEU G O     1 
ATOM 2612 C CB    . LEU G 6 38 ? -20.610 -15.157 -14.453 1.00 149.51 ? 168 LEU G CB    1 
ATOM 2613 C CG    . LEU G 6 38 ? -20.779 -16.587 -14.989 1.00 154.12 ? 168 LEU G CG    1 
ATOM 2614 C CD1   . LEU G 6 38 ? -22.231 -16.844 -15.385 1.00 152.14 ? 168 LEU G CD1   1 
ATOM 2615 C CD2   . LEU G 6 38 ? -19.884 -16.846 -16.189 1.00 148.41 ? 168 LEU G CD2   1 
ATOM 2616 N N     . THR G 6 39 ? -20.118 -12.977 -12.329 1.00 140.59 ? 169 THR G N     1 
ATOM 2617 C CA    . THR G 6 39 ? -20.235 -12.239 -11.066 1.00 137.33 ? 169 THR G CA    1 
ATOM 2618 C C     . THR G 6 39 ? -21.343 -12.762 -10.142 1.00 133.99 ? 169 THR G C     1 
ATOM 2619 O O     . THR G 6 39 ? -22.115 -13.645 -10.514 1.00 131.95 ? 169 THR G O     1 
ATOM 2620 C CB    . THR G 6 39 ? -20.480 -10.728 -11.317 1.00 140.47 ? 169 THR G CB    1 
ATOM 2621 O OG1   . THR G 6 39 ? -20.423 -10.018 -10.073 1.00 135.28 ? 169 THR G OG1   1 
ATOM 2622 C CG2   . THR G 6 39 ? -21.832 -10.475 -11.980 1.00 130.93 ? 169 THR G CG2   1 
ATOM 2623 N N     . GLN G 6 40 ? -21.388 -12.215 -8.928  1.00 130.52 ? 170 GLN G N     1 
ATOM 2624 C CA    . GLN G 6 40 ? -22.329 -12.644 -7.893  1.00 127.13 ? 170 GLN G CA    1 
ATOM 2625 C C     . GLN G 6 40 ? -23.794 -12.438 -8.277  1.00 126.09 ? 170 GLN G C     1 
ATOM 2626 O O     . GLN G 6 40 ? -24.576 -13.387 -8.333  1.00 131.28 ? 170 GLN G O     1 
ATOM 2627 C CB    . GLN G 6 40 ? -22.076 -11.868 -6.596  1.00 127.15 ? 170 GLN G CB    1 
ATOM 2628 C CG    . GLN G 6 40 ? -20.626 -11.734 -6.152  1.00 132.08 ? 170 GLN G CG    1 
ATOM 2629 C CD    . GLN G 6 40 ? -20.496 -10.913 -4.879  1.00 157.30 ? 170 GLN G CD    1 
ATOM 2630 O OE1   . GLN G 6 40 ? -21.488 -10.409 -4.353  1.00 158.06 ? 170 GLN G OE1   1 
ATOM 2631 N NE2   . GLN G 6 40 ? -19.274 -10.775 -4.379  1.00 167.18 ? 170 GLN G NE2   1 
ATOM 2632 N N     . THR G 6 41 ? -24.139 -11.187 -8.578  1.00 125.57 ? 171 THR G N     1 
ATOM 2633 C CA    . THR G 6 41 ? -25.529 -10.747 -8.719  1.00 128.82 ? 171 THR G CA    1 
ATOM 2634 C C     . THR G 6 41 ? -26.096 -11.179 -10.062 1.00 132.11 ? 171 THR G C     1 
ATOM 2635 O O     . THR G 6 41 ? -27.277 -10.983 -10.347 1.00 133.92 ? 171 THR G O     1 
ATOM 2636 C CB    . THR G 6 41 ? -25.659 -9.209  -8.573  1.00 139.84 ? 171 THR G CB    1 
ATOM 2637 O OG1   . THR G 6 41 ? -24.768 -8.548  -9.479  1.00 152.25 ? 171 THR G OG1   1 
ATOM 2638 C CG2   . THR G 6 41 ? -25.322 -8.777  -7.159  1.00 141.27 ? 171 THR G CG2   1 
ATOM 2639 N N     . GLN G 6 42 ? -25.238 -11.779 -10.877 1.00 133.46 ? 172 GLN G N     1 
ATOM 2640 C CA    . GLN G 6 42 ? -25.616 -12.297 -12.184 1.00 130.77 ? 172 GLN G CA    1 
ATOM 2641 C C     . GLN G 6 42 ? -26.689 -13.379 -12.061 1.00 125.06 ? 172 GLN G C     1 
ATOM 2642 O O     . GLN G 6 42 ? -27.484 -13.571 -12.979 1.00 122.70 ? 172 GLN G O     1 
ATOM 2643 C CB    . GLN G 6 42 ? -24.369 -12.855 -12.885 1.00 130.64 ? 172 GLN G CB    1 
ATOM 2644 C CG    . GLN G 6 42 ? -24.592 -13.400 -14.290 1.00 134.05 ? 172 GLN G CG    1 
ATOM 2645 C CD    . GLN G 6 42 ? -23.331 -13.412 -15.159 1.00 142.93 ? 172 GLN G CD    1 
ATOM 2646 O OE1   . GLN G 6 42 ? -23.276 -14.104 -16.177 1.00 147.96 ? 172 GLN G OE1   1 
ATOM 2647 N NE2   . GLN G 6 42 ? -22.325 -12.641 -14.766 1.00 144.09 ? 172 GLN G NE2   1 
ATOM 2648 N N     . VAL G 6 43 ? -26.713 -14.066 -10.918 1.00 125.57 ? 173 VAL G N     1 
ATOM 2649 C CA    . VAL G 6 43 ? -27.480 -15.305 -10.771 1.00 130.76 ? 173 VAL G CA    1 
ATOM 2650 C C     . VAL G 6 43 ? -28.172 -15.470 -9.402  1.00 136.37 ? 173 VAL G C     1 
ATOM 2651 O O     . VAL G 6 43 ? -28.867 -16.461 -9.192  1.00 140.51 ? 173 VAL G O     1 
ATOM 2652 C CB    . VAL G 6 43 ? -26.572 -16.548 -11.010 1.00 145.68 ? 173 VAL G CB    1 
ATOM 2653 C CG1   . VAL G 6 43 ? -27.338 -17.661 -11.709 1.00 153.07 ? 173 VAL G CG1   1 
ATOM 2654 C CG2   . VAL G 6 43 ? -25.345 -16.188 -11.839 1.00 151.94 ? 173 VAL G CG2   1 
ATOM 2655 N N     . LYS G 6 44 ? -28.005 -14.517 -8.482  1.00 136.49 ? 174 LYS G N     1 
ATOM 2656 C CA    . LYS G 6 44 ? -28.807 -14.513 -7.250  1.00 135.10 ? 174 LYS G CA    1 
ATOM 2657 C C     . LYS G 6 44 ? -30.261 -14.397 -7.699  1.00 137.75 ? 174 LYS G C     1 
ATOM 2658 O O     . LYS G 6 44 ? -31.184 -14.931 -7.082  1.00 140.41 ? 174 LYS G O     1 
ATOM 2659 C CB    . LYS G 6 44 ? -28.429 -13.353 -6.311  1.00 132.02 ? 174 LYS G CB    1 
ATOM 2660 C CG    . LYS G 6 44 ? -26.937 -13.089 -6.159  1.00 131.23 ? 174 LYS G CG    1 
ATOM 2661 C CD    . LYS G 6 44 ? -26.664 -11.792 -5.415  1.00 135.01 ? 174 LYS G CD    1 
ATOM 2662 C CE    . LYS G 6 44 ? -25.172 -11.576 -5.257  1.00 131.88 ? 174 LYS G CE    1 
ATOM 2663 N NZ    . LYS G 6 44 ? -24.847 -10.413 -4.399  1.00 127.44 ? 174 LYS G NZ    1 
ATOM 2664 N N     . ILE G 6 45 ? -30.415 -13.679 -8.803  1.00 137.48 ? 175 ILE G N     1 
ATOM 2665 C CA    . ILE G 6 45 ? -31.648 -13.575 -9.583  1.00 136.60 ? 175 ILE G CA    1 
ATOM 2666 C C     . ILE G 6 45 ? -32.221 -14.870 -10.183 1.00 137.40 ? 175 ILE G C     1 
ATOM 2667 O O     . ILE G 6 45 ? -33.436 -15.043 -10.235 1.00 142.10 ? 175 ILE G O     1 
ATOM 2668 C CB    . ILE G 6 45 ? -31.397 -12.605 -10.778 1.00 132.56 ? 175 ILE G CB    1 
ATOM 2669 C CG1   . ILE G 6 45 ? -32.386 -12.830 -11.924 1.00 141.14 ? 175 ILE G CG1   1 
ATOM 2670 C CG2   . ILE G 6 45 ? -30.003 -12.831 -11.348 1.00 127.85 ? 175 ILE G CG2   1 
ATOM 2671 C CD1   . ILE G 6 45 ? -32.313 -11.791 -13.027 1.00 131.04 ? 175 ILE G CD1   1 
ATOM 2672 N N     . TRP G 6 46 ? -31.358 -15.773 -10.634 1.00 134.54 ? 176 TRP G N     1 
ATOM 2673 C CA    . TRP G 6 46 ? -31.772 -16.771 -11.626 1.00 137.76 ? 176 TRP G CA    1 
ATOM 2674 C C     . TRP G 6 46 ? -32.754 -17.838 -11.147 1.00 139.03 ? 176 TRP G C     1 
ATOM 2675 O O     . TRP G 6 46 ? -33.478 -18.416 -11.958 1.00 139.33 ? 176 TRP G O     1 
ATOM 2676 C CB    . TRP G 6 46 ? -30.542 -17.466 -12.208 1.00 141.00 ? 176 TRP G CB    1 
ATOM 2677 C CG    . TRP G 6 46 ? -30.769 -17.994 -13.606 1.00 152.17 ? 176 TRP G CG    1 
ATOM 2678 C CD1   . TRP G 6 46 ? -31.843 -17.742 -14.418 1.00 149.93 ? 176 TRP G CD1   1 
ATOM 2679 C CD2   . TRP G 6 46 ? -29.906 -18.857 -14.351 1.00 153.78 ? 176 TRP G CD2   1 
ATOM 2680 N NE1   . TRP G 6 46 ? -31.701 -18.394 -15.614 1.00 152.07 ? 176 TRP G NE1   1 
ATOM 2681 C CE2   . TRP G 6 46 ? -30.520 -19.087 -15.598 1.00 158.14 ? 176 TRP G CE2   1 
ATOM 2682 C CE3   . TRP G 6 46 ? -28.675 -19.460 -14.084 1.00 140.36 ? 176 TRP G CE3   1 
ATOM 2683 C CZ2   . TRP G 6 46 ? -29.947 -19.889 -16.572 1.00 155.12 ? 176 TRP G CZ2   1 
ATOM 2684 C CZ3   . TRP G 6 46 ? -28.109 -20.257 -15.052 1.00 138.92 ? 176 TRP G CZ3   1 
ATOM 2685 C CH2   . TRP G 6 46 ? -28.741 -20.466 -16.280 1.00 145.05 ? 176 TRP G CH2   1 
ATOM 2686 N N     . PHE G 6 47 ? -32.776 -18.129 -9.854  1.00 140.94 ? 177 PHE G N     1 
ATOM 2687 C CA    . PHE G 6 47 ? -33.870 -18.924 -9.315  1.00 141.45 ? 177 PHE G CA    1 
ATOM 2688 C C     . PHE G 6 47 ? -35.124 -18.078 -9.465  1.00 138.49 ? 177 PHE G C     1 
ATOM 2689 O O     . PHE G 6 47 ? -36.142 -18.519 -9.993  1.00 139.98 ? 177 PHE G O     1 
ATOM 2690 C CB    . PHE G 6 47 ? -33.657 -19.289 -7.845  1.00 150.77 ? 177 PHE G CB    1 
ATOM 2691 C CG    . PHE G 6 47 ? -32.532 -20.254 -7.596  1.00 163.00 ? 177 PHE G CG    1 
ATOM 2692 C CD1   . PHE G 6 47 ? -32.741 -21.364 -6.796  1.00 160.85 ? 177 PHE G CD1   1 
ATOM 2693 C CD2   . PHE G 6 47 ? -31.271 -20.059 -8.140  1.00 159.19 ? 177 PHE G CD2   1 
ATOM 2694 C CE1   . PHE G 6 47 ? -31.735 -22.251 -6.548  1.00 145.40 ? 177 PHE G CE1   1 
ATOM 2695 C CE2   . PHE G 6 47 ? -30.253 -20.960 -7.890  1.00 154.50 ? 177 PHE G CE2   1 
ATOM 2696 C CZ    . PHE G 6 47 ? -30.490 -22.057 -7.093  1.00 146.63 ? 177 PHE G CZ    1 
ATOM 2697 N N     . GLN G 6 48 ? -34.995 -16.823 -9.045  1.00 136.75 ? 178 GLN G N     1 
ATOM 2698 C CA    . GLN G 6 48 ? -36.099 -15.868 -9.013  1.00 136.31 ? 178 GLN G CA    1 
ATOM 2699 C C     . GLN G 6 48 ? -36.631 -15.638 -10.425 1.00 134.81 ? 178 GLN G C     1 
ATOM 2700 O O     . GLN G 6 48 ? -37.798 -15.298 -10.613 1.00 137.74 ? 178 GLN G O     1 
ATOM 2701 C CB    . GLN G 6 48 ? -35.645 -14.548 -8.368  1.00 132.40 ? 178 GLN G CB    1 
ATOM 2702 C CG    . GLN G 6 48 ? -34.563 -14.719 -7.299  1.00 143.42 ? 178 GLN G CG    1 
ATOM 2703 C CD    . GLN G 6 48 ? -34.364 -13.497 -6.411  1.00 161.28 ? 178 GLN G CD    1 
ATOM 2704 O OE1   . GLN G 6 48 ? -35.274 -12.689 -6.223  1.00 173.12 ? 178 GLN G OE1   1 
ATOM 2705 N NE2   . GLN G 6 48 ? -33.162 -13.365 -5.853  1.00 155.20 ? 178 GLN G NE2   1 
ATOM 2706 N N     . ASN G 6 49 ? -35.763 -15.828 -11.414 1.00 137.86 ? 179 ASN G N     1 
ATOM 2707 C CA    . ASN G 6 49 ? -36.178 -15.884 -12.811 1.00 136.33 ? 179 ASN G CA    1 
ATOM 2708 C C     . ASN G 6 49 ? -37.052 -17.093 -13.115 1.00 140.63 ? 179 ASN G C     1 
ATOM 2709 O O     . ASN G 6 49 ? -37.857 -17.058 -14.045 1.00 151.91 ? 179 ASN G O     1 
ATOM 2710 C CB    . ASN G 6 49 ? -34.954 -15.917 -13.727 1.00 134.92 ? 179 ASN G CB    1 
ATOM 2711 C CG    . ASN G 6 49 ? -34.263 -14.582 -13.824 1.00 136.06 ? 179 ASN G CG    1 
ATOM 2712 O OD1   . ASN G 6 49 ? -34.788 -13.570 -13.364 1.00 137.01 ? 179 ASN G OD1   1 
ATOM 2713 N ND2   . ASN G 6 49 ? -33.083 -14.567 -14.440 1.00 129.95 ? 179 ASN G ND2   1 
ATOM 2714 N N     . ARG G 6 50 ? -36.866 -18.163 -12.345 1.00 138.56 ? 180 ARG G N     1 
ATOM 2715 C CA    . ARG G 6 50 ? -37.522 -19.439 -12.615 1.00 140.91 ? 180 ARG G CA    1 
ATOM 2716 C C     . ARG G 6 50 ? -38.451 -19.937 -11.501 1.00 139.18 ? 180 ARG G C     1 
ATOM 2717 O O     . ARG G 6 50 ? -38.866 -21.094 -11.530 1.00 137.87 ? 180 ARG G O     1 
ATOM 2718 C CB    . ARG G 6 50 ? -36.471 -20.505 -12.904 1.00 139.97 ? 180 ARG G CB    1 
ATOM 2719 C CG    . ARG G 6 50 ? -36.887 -21.465 -13.990 1.00 150.48 ? 180 ARG G CG    1 
ATOM 2720 C CD    . ARG G 6 50 ? -35.741 -22.348 -14.372 1.00 155.54 ? 180 ARG G CD    1 
ATOM 2721 N NE    . ARG G 6 50 ? -36.106 -23.296 -15.411 1.00 154.36 ? 180 ARG G NE    1 
ATOM 2722 C CZ    . ARG G 6 50 ? -35.312 -24.276 -15.813 1.00 146.44 ? 180 ARG G CZ    1 
ATOM 2723 N NH1   . ARG G 6 50 ? -34.122 -24.428 -15.252 1.00 142.47 ? 180 ARG G NH1   1 
ATOM 2724 N NH2   . ARG G 6 50 ? -35.709 -25.103 -16.768 1.00 146.49 ? 180 ARG G NH2   1 
ATOM 2725 N N     . ARG G 6 51 ? -38.789 -19.091 -10.530 1.00 128.74 ? 181 ARG G N     1 
ATOM 2726 C CA    . ARG G 6 51 ? -39.855 -19.443 -9.585  1.00 122.83 ? 181 ARG G CA    1 
ATOM 2727 C C     . ARG G 6 51 ? -41.189 -19.197 -10.281 1.00 120.90 ? 181 ARG G C     1 
ATOM 2728 O O     . ARG G 6 51 ? -42.250 -19.385 -9.700  1.00 118.89 ? 181 ARG G O     1 
ATOM 2729 C CB    . ARG G 6 51 ? -39.766 -18.663 -8.272  1.00 129.68 ? 181 ARG G CB    1 
ATOM 2730 C CG    . ARG G 6 51 ? -38.851 -19.304 -7.219  1.00 136.60 ? 181 ARG G CG    1 
ATOM 2731 C CD    . ARG G 6 51 ? -37.418 -18.864 -7.443  1.00 130.86 ? 181 ARG G CD    1 
ATOM 2732 N NE    . ARG G 6 51 ? -36.578 -18.707 -6.256  1.00 126.89 ? 181 ARG G NE    1 
ATOM 2733 C CZ    . ARG G 6 51 ? -36.870 -17.947 -5.206  1.00 127.05 ? 181 ARG G CZ    1 
ATOM 2734 N NH1   . ARG G 6 51 ? -38.003 -17.265 -5.141  1.00 138.89 ? 181 ARG G NH1   1 
ATOM 2735 N NH2   . ARG G 6 51 ? -36.014 -17.878 -4.200  1.00 121.50 ? 181 ARG G NH2   1 
ATOM 2736 N N     . SER G 6 52 ? -41.105 -18.683 -11.503 1.00 133.07 ? 182 SER G N     1 
ATOM 2737 C CA    . SER G 6 52 ? -42.077 -18.959 -12.562 1.00 140.61 ? 182 SER G CA    1 
ATOM 2738 C C     . SER G 6 52 ? -41.212 -18.976 -13.818 1.00 138.63 ? 182 SER G C     1 
ATOM 2739 O O     . SER G 6 52 ? -40.174 -18.325 -13.819 1.00 139.42 ? 182 SER G O     1 
ATOM 2740 C CB    . SER G 6 52 ? -43.202 -17.929 -12.621 1.00 139.33 ? 182 SER G CB    1 
ATOM 2741 O OG    . SER G 6 52 ? -44.356 -18.423 -11.962 1.00 135.31 ? 182 SER G OG    1 
ATOM 2742 N N     . LYS G 6 53 ? -41.595 -19.659 -14.895 1.00 137.27 ? 183 LYS G N     1 
ATOM 2743 C CA    . LYS G 6 53 ? -42.974 -19.943 -15.294 1.00 136.62 ? 183 LYS G CA    1 
ATOM 2744 C C     . LYS G 6 53 ? -43.790 -20.881 -14.397 1.00 131.56 ? 183 LYS G C     1 
ATOM 2745 O O     . LYS G 6 53 ? -43.243 -21.700 -13.658 1.00 131.92 ? 183 LYS G O     1 
ATOM 2746 C CB    . LYS G 6 53 ? -42.969 -20.505 -16.726 1.00 151.39 ? 183 LYS G CB    1 
ATOM 2747 C CG    . LYS G 6 53 ? -41.869 -21.526 -17.042 1.00 145.74 ? 183 LYS G CG    1 
ATOM 2748 C CD    . LYS G 6 53 ? -40.659 -20.897 -17.724 1.00 146.79 ? 183 LYS G CD    1 
ATOM 2749 C CE    . LYS G 6 53 ? -39.561 -21.913 -17.969 1.00 140.53 ? 183 LYS G CE    1 
ATOM 2750 N NZ    . LYS G 6 53 ? -38.353 -21.292 -18.576 1.00 131.27 ? 183 LYS G NZ    1 
ATOM 2751 N N     . PHE G 6 54 ? -45.111 -20.714 -14.487 1.00 125.46 ? 184 PHE G N     1 
ATOM 2752 C CA    . PHE G 6 54 ? -46.127 -21.411 -13.683 1.00 124.02 ? 184 PHE G CA    1 
ATOM 2753 C C     . PHE G 6 54 ? -45.794 -21.366 -12.187 1.00 126.52 ? 184 PHE G C     1 
ATOM 2754 O O     . PHE G 6 54 ? -45.928 -20.311 -11.571 1.00 127.45 ? 184 PHE G O     1 
ATOM 2755 C CB    . PHE G 6 54 ? -46.363 -22.862 -14.169 1.00 130.99 ? 184 PHE G CB    1 
ATOM 2756 C CG    . PHE G 6 54 ? -45.147 -23.568 -14.714 1.00 135.54 ? 184 PHE G CG    1 
ATOM 2757 C CD1   . PHE G 6 54 ? -44.390 -24.405 -13.910 1.00 148.58 ? 184 PHE G CD1   1 
ATOM 2758 C CD2   . PHE G 6 54 ? -44.788 -23.430 -16.044 1.00 139.96 ? 184 PHE G CD2   1 
ATOM 2759 C CE1   . PHE G 6 54 ? -43.286 -25.059 -14.408 1.00 168.23 ? 184 PHE G CE1   1 
ATOM 2760 C CE2   . PHE G 6 54 ? -43.683 -24.091 -16.547 1.00 152.51 ? 184 PHE G CE2   1 
ATOM 2761 C CZ    . PHE G 6 54 ? -42.932 -24.904 -15.726 1.00 159.57 ? 184 PHE G CZ    1 
ATOM 2762 N N     . LYS G 6 55 ? -45.381 -22.487 -11.600 1.00 129.18 ? 185 LYS G N     1 
ATOM 2763 C CA    . LYS G 6 55 ? -45.073 -22.546 -10.172 1.00 125.30 ? 185 LYS G CA    1 
ATOM 2764 C C     . LYS G 6 55 ? -46.278 -22.116 -9.332  1.00 119.98 ? 185 LYS G C     1 
ATOM 2765 O O     . LYS G 6 55 ? -46.146 -21.440 -8.314  1.00 124.29 ? 185 LYS G O     1 
ATOM 2766 C CB    . LYS G 6 55 ? -43.849 -21.683 -9.870  1.00 122.13 ? 185 LYS G CB    1 
ATOM 2767 C CG    . LYS G 6 55 ? -42.540 -22.419 -10.045 1.00 120.10 ? 185 LYS G CG    1 
ATOM 2768 C CD    . LYS G 6 55 ? -42.023 -22.923 -8.720  1.00 124.07 ? 185 LYS G CD    1 
ATOM 2769 C CE    . LYS G 6 55 ? -41.136 -24.122 -8.919  1.00 121.72 ? 185 LYS G CE    1 
ATOM 2770 N NZ    . LYS G 6 55 ? -40.135 -24.244 -7.829  1.00 108.56 ? 185 LYS G NZ    1 
ATOM 2771 N N     . LYS G 6 56 ? -47.456 -22.537 -9.780  1.00 122.83 ? 186 LYS G N     1 
ATOM 2772 C CA    . LYS G 6 56 ? -48.707 -22.269 -9.083  1.00 126.79 ? 186 LYS G CA    1 
ATOM 2773 C C     . LYS G 6 56 ? -48.711 -22.911 -7.701  1.00 132.00 ? 186 LYS G C     1 
ATOM 2774 O O     . LYS G 6 56 ? -47.981 -23.871 -7.448  1.00 138.28 ? 186 LYS G O     1 
ATOM 2775 C CB    . LYS G 6 56 ? -49.893 -22.788 -9.902  1.00 133.05 ? 186 LYS G CB    1 
ATOM 2776 C CG    . LYS G 6 56 ? -49.897 -22.356 -11.371 1.00 127.48 ? 186 LYS G CG    1 
ATOM 2777 C CD    . LYS G 6 56 ? -49.386 -23.457 -12.302 1.00 134.81 ? 186 LYS G CD    1 
ATOM 2778 C CE    . LYS G 6 56 ? -49.475 -23.057 -13.767 1.00 118.41 ? 186 LYS G CE    1 
ATOM 2779 N NZ    . LYS G 6 56 ? -50.878 -22.822 -14.189 1.00 107.93 ? 186 LYS G NZ    1 
ATOM 2780 N N     . LYS H 6 1  ? 3.774   16.034  -16.962 1.00 155.58 ? 131 LYS I N     1 
ATOM 2781 C CA    . LYS H 6 1  ? 4.768   17.041  -17.305 1.00 142.42 ? 131 LYS I CA    1 
ATOM 2782 C C     . LYS H 6 1  ? 6.183   16.488  -17.148 1.00 148.96 ? 131 LYS I C     1 
ATOM 2783 O O     . LYS H 6 1  ? 6.851   16.769  -16.154 1.00 154.64 ? 131 LYS I O     1 
ATOM 2784 C CB    . LYS H 6 1  ? 4.583   18.289  -16.441 1.00 160.92 ? 131 LYS I CB    1 
ATOM 2785 N N     . PRO H 6 2  ? 6.655   15.711  -18.139 1.00 148.94 ? 132 PRO I N     1 
ATOM 2786 C CA    . PRO H 6 2  ? 5.938   15.217  -19.315 1.00 137.06 ? 132 PRO I CA    1 
ATOM 2787 C C     . PRO H 6 2  ? 5.906   13.691  -19.425 1.00 127.55 ? 132 PRO I C     1 
ATOM 2788 O O     . PRO H 6 2  ? 6.712   13.011  -18.795 1.00 130.85 ? 132 PRO I O     1 
ATOM 2789 C CB    . PRO H 6 2  ? 6.742   15.823  -20.469 1.00 133.98 ? 132 PRO I CB    1 
ATOM 2790 C CG    . PRO H 6 2  ? 8.116   16.226  -19.840 1.00 129.83 ? 132 PRO I CG    1 
ATOM 2791 C CD    . PRO H 6 2  ? 8.094   15.724  -18.423 1.00 141.12 ? 132 PRO I CD    1 
ATOM 2792 N N     . ARG H 6 3  ? 5.017   13.183  -20.274 1.00 126.53 ? 133 ARG I N     1 
ATOM 2793 C CA    . ARG H 6 3  ? 4.712   11.749  -20.365 1.00 125.05 ? 133 ARG I CA    1 
ATOM 2794 C C     . ARG H 6 3  ? 5.930   10.821  -20.453 1.00 127.93 ? 133 ARG I C     1 
ATOM 2795 O O     . ARG H 6 3  ? 6.167   10.019  -19.553 1.00 131.37 ? 133 ARG I O     1 
ATOM 2796 C CB    . ARG H 6 3  ? 3.816   11.497  -21.582 1.00 120.09 ? 133 ARG I CB    1 
ATOM 2797 C CG    . ARG H 6 3  ? 2.446   10.981  -21.233 1.00 121.25 ? 133 ARG I CG    1 
ATOM 2798 C CD    . ARG H 6 3  ? 1.964   9.925   -22.181 1.00 109.37 ? 133 ARG I CD    1 
ATOM 2799 N NE    . ARG H 6 3  ? 0.633   9.474   -21.802 1.00 107.51 ? 133 ARG I NE    1 
ATOM 2800 C CZ    . ARG H 6 3  ? -0.490  9.842   -22.405 1.00 99.88  ? 133 ARG I CZ    1 
ATOM 2801 N NH1   . ARG H 6 3  ? -0.472  10.661  -23.448 1.00 95.78  ? 133 ARG I NH1   1 
ATOM 2802 N NH2   . ARG H 6 3  ? -1.644  9.374   -21.961 1.00 101.67 ? 133 ARG I NH2   1 
ATOM 2803 N N     . THR H 6 4  ? 6.678   10.924  -21.549 1.00 137.78 ? 134 THR I N     1 
ATOM 2804 C CA    . THR H 6 4  ? 7.915   10.163  -21.760 1.00 152.09 ? 134 THR I CA    1 
ATOM 2805 C C     . THR H 6 4  ? 7.699   8.665   -21.991 1.00 148.72 ? 134 THR I C     1 
ATOM 2806 O O     . THR H 6 4  ? 6.823   8.048   -21.392 1.00 142.63 ? 134 THR I O     1 
ATOM 2807 C CB    . THR H 6 4  ? 8.886   10.314  -20.561 1.00 151.29 ? 134 THR I CB    1 
ATOM 2808 O OG1   . THR H 6 4  ? 8.744   11.614  -19.978 1.00 129.91 ? 134 THR I OG1   1 
ATOM 2809 C CG2   . THR H 6 4  ? 10.338  10.108  -20.997 1.00 159.00 ? 134 THR I CG2   1 
ATOM 2810 N N     . ILE H 6 5  ? 8.520   8.104   -22.876 1.00 149.98 ? 135 ILE I N     1 
ATOM 2811 C CA    . ILE H 6 5  ? 8.690   6.661   -23.011 1.00 149.85 ? 135 ILE I CA    1 
ATOM 2812 C C     . ILE H 6 5  ? 10.184  6.424   -23.203 1.00 149.84 ? 135 ILE I C     1 
ATOM 2813 O O     . ILE H 6 5  ? 10.930  7.359   -23.490 1.00 150.76 ? 135 ILE I O     1 
ATOM 2814 C CB    . ILE H 6 5  ? 7.910   6.043   -24.202 1.00 150.82 ? 135 ILE I CB    1 
ATOM 2815 C CG1   . ILE H 6 5  ? 6.622   6.818   -24.526 1.00 140.74 ? 135 ILE I CG1   1 
ATOM 2816 C CG2   . ILE H 6 5  ? 7.591   4.579   -23.914 1.00 147.05 ? 135 ILE I CG2   1 
ATOM 2817 C CD1   . ILE H 6 5  ? 5.446   6.568   -23.578 1.00 133.60 ? 135 ILE I CD1   1 
ATOM 2818 N N     . TYR H 6 6  ? 10.623  5.181   -23.040 1.00 151.46 ? 136 TYR I N     1 
ATOM 2819 C CA    . TYR H 6 6  ? 12.050  4.875   -23.065 1.00 151.60 ? 136 TYR I CA    1 
ATOM 2820 C C     . TYR H 6 6  ? 12.572  4.699   -24.512 1.00 155.28 ? 136 TYR I C     1 
ATOM 2821 O O     . TYR H 6 6  ? 13.543  5.367   -24.872 1.00 163.88 ? 136 TYR I O     1 
ATOM 2822 C CB    . TYR H 6 6  ? 12.381  3.624   -22.218 1.00 150.61 ? 136 TYR I CB    1 
ATOM 2823 C CG    . TYR H 6 6  ? 11.547  3.369   -20.957 1.00 147.49 ? 136 TYR I CG    1 
ATOM 2824 C CD1   . TYR H 6 6  ? 10.686  4.323   -20.421 1.00 151.41 ? 136 TYR I CD1   1 
ATOM 2825 C CD2   . TYR H 6 6  ? 11.644  2.153   -20.298 1.00 141.54 ? 136 TYR I CD2   1 
ATOM 2826 C CE1   . TYR H 6 6  ? 9.937   4.056   -19.285 1.00 149.08 ? 136 TYR I CE1   1 
ATOM 2827 C CE2   . TYR H 6 6  ? 10.898  1.880   -19.163 1.00 145.89 ? 136 TYR I CE2   1 
ATOM 2828 C CZ    . TYR H 6 6  ? 10.049  2.833   -18.664 1.00 151.49 ? 136 TYR I CZ    1 
ATOM 2829 O OH    . TYR H 6 6  ? 9.311   2.569   -17.532 1.00 153.59 ? 136 TYR I OH    1 
ATOM 2830 N N     . SER H 6 7  ? 11.972  3.845   -25.354 1.00 151.93 ? 137 SER I N     1 
ATOM 2831 C CA    . SER H 6 7  ? 10.878  2.926   -25.019 1.00 149.22 ? 137 SER I CA    1 
ATOM 2832 C C     . SER H 6 7  ? 11.343  1.467   -24.981 1.00 150.75 ? 137 SER I C     1 
ATOM 2833 O O     . SER H 6 7  ? 10.517  0.557   -25.009 1.00 145.61 ? 137 SER I O     1 
ATOM 2834 C CB    . SER H 6 7  ? 9.725   3.076   -26.021 1.00 149.48 ? 137 SER I CB    1 
ATOM 2835 O OG    . SER H 6 7  ? 8.644   2.216   -25.693 1.00 150.47 ? 137 SER I OG    1 
ATOM 2836 N N     . SER H 6 8  ? 12.656  1.245   -24.936 1.00 153.38 ? 138 SER I N     1 
ATOM 2837 C CA    . SER H 6 8  ? 13.201  -0.102  -24.742 1.00 147.48 ? 138 SER I CA    1 
ATOM 2838 C C     . SER H 6 8  ? 12.656  -0.622  -23.419 1.00 134.38 ? 138 SER I C     1 
ATOM 2839 O O     . SER H 6 8  ? 12.510  0.159   -22.489 1.00 137.08 ? 138 SER I O     1 
ATOM 2840 C CB    . SER H 6 8  ? 14.730  -0.085  -24.741 1.00 144.51 ? 138 SER I CB    1 
ATOM 2841 O OG    . SER H 6 8  ? 15.233  0.691   -23.667 1.00 146.99 ? 138 SER I OG    1 
ATOM 2842 N N     . TYR H 6 9  ? 12.352  -1.918  -23.330 1.00 134.89 ? 139 TYR I N     1 
ATOM 2843 C CA    . TYR H 6 9  ? 11.495  -2.426  -22.256 1.00 133.70 ? 139 TYR I CA    1 
ATOM 2844 C C     . TYR H 6 9  ? 12.204  -3.456  -21.365 1.00 135.89 ? 139 TYR I C     1 
ATOM 2845 O O     . TYR H 6 9  ? 12.690  -4.443  -21.915 1.00 133.98 ? 139 TYR I O     1 
ATOM 2846 C CB    . TYR H 6 9  ? 10.219  -3.094  -22.828 1.00 130.95 ? 139 TYR I CB    1 
ATOM 2847 C CG    . TYR H 6 9  ? 9.649   -2.552  -24.144 1.00 140.13 ? 139 TYR I CG    1 
ATOM 2848 C CD1   . TYR H 6 9  ? 10.427  -2.467  -25.294 1.00 146.64 ? 139 TYR I CD1   1 
ATOM 2849 C CD2   . TYR H 6 9  ? 8.308   -2.183  -24.245 1.00 141.01 ? 139 TYR I CD2   1 
ATOM 2850 C CE1   . TYR H 6 9  ? 9.906   -1.988  -26.487 1.00 157.07 ? 139 TYR I CE1   1 
ATOM 2851 C CE2   . TYR H 6 9  ? 7.779   -1.707  -25.443 1.00 144.39 ? 139 TYR I CE2   1 
ATOM 2852 C CZ    . TYR H 6 9  ? 8.585   -1.615  -26.556 1.00 153.72 ? 139 TYR I CZ    1 
ATOM 2853 O OH    . TYR H 6 9  ? 8.080   -1.148  -27.750 1.00 159.92 ? 139 TYR I OH    1 
ATOM 2854 N N     . GLN H 6 10 ? 12.310  -3.307  -20.032 1.00 135.14 ? 140 GLN I N     1 
ATOM 2855 C CA    . GLN H 6 10 ? 12.043  -2.135  -19.162 1.00 130.36 ? 140 GLN I CA    1 
ATOM 2856 C C     . GLN H 6 10 ? 10.573  -1.784  -18.849 1.00 126.80 ? 140 GLN I C     1 
ATOM 2857 O O     . GLN H 6 10 ? 10.213  -1.703  -17.675 1.00 120.79 ? 140 GLN I O     1 
ATOM 2858 C CB    . GLN H 6 10 ? 12.722  -0.882  -19.704 1.00 129.86 ? 140 GLN I CB    1 
ATOM 2859 C CG    . GLN H 6 10 ? 14.136  -1.060  -20.267 1.00 137.08 ? 140 GLN I CG    1 
ATOM 2860 C CD    . GLN H 6 10 ? 15.183  -1.350  -19.205 1.00 141.68 ? 140 GLN I CD    1 
ATOM 2861 O OE1   . GLN H 6 10 ? 16.188  -0.646  -19.107 1.00 155.64 ? 140 GLN I OE1   1 
ATOM 2862 N NE2   . GLN H 6 10 ? 14.962  -2.394  -18.420 1.00 141.51 ? 140 GLN I NE2   1 
ATOM 2863 N N     . LEU H 6 11 ? 9.735   -1.558  -19.856 1.00 127.60 ? 141 LEU I N     1 
ATOM 2864 C CA    . LEU H 6 11 ? 8.362   -1.145  -19.633 1.00 125.18 ? 141 LEU I CA    1 
ATOM 2865 C C     . LEU H 6 11 ? 7.650   -2.307  -18.971 1.00 121.40 ? 141 LEU I C     1 
ATOM 2866 O O     . LEU H 6 11 ? 7.510   -2.327  -17.763 1.00 117.59 ? 141 LEU I O     1 
ATOM 2867 C CB    . LEU H 6 11 ? 7.681   -0.738  -20.944 1.00 123.08 ? 141 LEU I CB    1 
ATOM 2868 C CG    . LEU H 6 11 ? 8.162   0.558   -21.611 1.00 132.06 ? 141 LEU I CG    1 
ATOM 2869 C CD1   . LEU H 6 11 ? 9.597   0.453   -22.078 1.00 137.10 ? 141 LEU I CD1   1 
ATOM 2870 C CD2   . LEU H 6 11 ? 7.280   0.926   -22.791 1.00 134.65 ? 141 LEU I CD2   1 
ATOM 2871 N N     . ALA H 6 12 ? 7.292   -3.320  -19.752 1.00 123.03 ? 142 ALA I N     1 
ATOM 2872 C CA    . ALA H 6 12 ? 6.615   -4.499  -19.214 1.00 118.32 ? 142 ALA I CA    1 
ATOM 2873 C C     . ALA H 6 12 ? 7.544   -5.286  -18.275 1.00 118.18 ? 142 ALA I C     1 
ATOM 2874 O O     . ALA H 6 12 ? 7.096   -6.177  -17.559 1.00 119.32 ? 142 ALA I O     1 
ATOM 2875 C CB    . ALA H 6 12 ? 6.101   -5.387  -20.351 1.00 106.06 ? 142 ALA I CB    1 
ATOM 2876 N N     . ALA H 6 13 ? 8.834   -4.949  -18.277 1.00 120.14 ? 143 ALA I N     1 
ATOM 2877 C CA    . ALA H 6 13 ? 9.773   -5.475  -17.284 1.00 120.07 ? 143 ALA I CA    1 
ATOM 2878 C C     . ALA H 6 13 ? 9.377   -4.986  -15.886 1.00 118.68 ? 143 ALA I C     1 
ATOM 2879 O O     . ALA H 6 13 ? 9.814   -5.539  -14.879 1.00 115.67 ? 143 ALA I O     1 
ATOM 2880 C CB    . ALA H 6 13 ? 11.214  -5.063  -17.614 1.00 127.24 ? 143 ALA I CB    1 
ATOM 2881 N N     . LEU H 6 14 ? 8.540   -3.951  -15.841 1.00 118.39 ? 144 LEU I N     1 
ATOM 2882 C CA    . LEU H 6 14 ? 8.020   -3.400  -14.589 1.00 119.80 ? 144 LEU I CA    1 
ATOM 2883 C C     . LEU H 6 14 ? 7.285   -4.450  -13.778 1.00 116.66 ? 144 LEU I C     1 
ATOM 2884 O O     . LEU H 6 14 ? 7.127   -4.295  -12.578 1.00 113.77 ? 144 LEU I O     1 
ATOM 2885 C CB    . LEU H 6 14 ? 7.044   -2.245  -14.864 1.00 125.69 ? 144 LEU I CB    1 
ATOM 2886 C CG    . LEU H 6 14 ? 5.693   -2.759  -15.411 1.00 122.88 ? 144 LEU I CG    1 
ATOM 2887 C CD1   . LEU H 6 14 ? 4.648   -2.858  -14.312 1.00 123.16 ? 144 LEU I CD1   1 
ATOM 2888 C CD2   . LEU H 6 14 ? 5.102   -1.972  -16.558 1.00 129.22 ? 144 LEU I CD2   1 
ATOM 2889 N N     . GLN H 6 15 ? 6.784   -5.478  -14.455 1.00 116.86 ? 145 GLN I N     1 
ATOM 2890 C CA    . GLN H 6 15 ? 5.887   -6.452  -13.847 1.00 115.49 ? 145 GLN I CA    1 
ATOM 2891 C C     . GLN H 6 15 ? 6.566   -7.194  -12.703 1.00 114.94 ? 145 GLN I C     1 
ATOM 2892 O O     . GLN H 6 15 ? 5.902   -7.635  -11.765 1.00 116.56 ? 145 GLN I O     1 
ATOM 2893 C CB    . GLN H 6 15 ? 5.359   -7.419  -14.912 1.00 112.39 ? 145 GLN I CB    1 
ATOM 2894 C CG    . GLN H 6 15 ? 4.190   -6.836  -15.722 1.00 116.96 ? 145 GLN I CG    1 
ATOM 2895 C CD    . GLN H 6 15 ? 4.239   -7.152  -17.210 1.00 117.61 ? 145 GLN I CD    1 
ATOM 2896 O OE1   . GLN H 6 15 ? 4.859   -8.128  -17.637 1.00 131.88 ? 145 GLN I OE1   1 
ATOM 2897 N NE2   . GLN H 6 15 ? 3.576   -6.318  -18.008 1.00 111.52 ? 145 GLN I NE2   1 
ATOM 2898 N N     . ARG H 6 16 ? 7.886   -7.321  -12.774 1.00 117.44 ? 146 ARG I N     1 
ATOM 2899 C CA    . ARG H 6 16 ? 8.670   -7.696  -11.604 1.00 129.44 ? 146 ARG I CA    1 
ATOM 2900 C C     . ARG H 6 16 ? 8.499   -6.585  -10.571 1.00 120.06 ? 146 ARG I C     1 
ATOM 2901 O O     . ARG H 6 16 ? 8.645   -5.423  -10.909 1.00 126.40 ? 146 ARG I O     1 
ATOM 2902 C CB    . ARG H 6 16 ? 10.133  -7.892  -11.994 1.00 134.49 ? 146 ARG I CB    1 
ATOM 2903 C CG    . ARG H 6 16 ? 10.339  -9.093  -12.918 1.00 141.82 ? 146 ARG I CG    1 
ATOM 2904 C CD    . ARG H 6 16 ? 11.422  -8.836  -13.957 1.00 128.59 ? 146 ARG I CD    1 
ATOM 2905 N NE    . ARG H 6 16 ? 11.122  -9.425  -15.257 1.00 114.72 ? 146 ARG I NE    1 
ATOM 2906 C CZ    . ARG H 6 16 ? 10.090  -9.069  -16.017 1.00 102.47 ? 146 ARG I CZ    1 
ATOM 2907 N NH1   . ARG H 6 16 ? 9.238   -8.142  -15.605 1.00 106.55 ? 146 ARG I NH1   1 
ATOM 2908 N NH2   . ARG H 6 16 ? 9.896   -9.650  -17.190 1.00 103.10 ? 146 ARG I NH2   1 
ATOM 2909 N N     . ARG H 6 17 ? 8.226   -6.951  -9.319  1.00 128.55 ? 147 ARG I N     1 
ATOM 2910 C CA    . ARG H 6 17 ? 7.845   -6.006  -8.253  1.00 129.37 ? 147 ARG I CA    1 
ATOM 2911 C C     . ARG H 6 17 ? 6.381   -5.533  -8.372  1.00 135.06 ? 147 ARG I C     1 
ATOM 2912 O O     . ARG H 6 17 ? 5.701   -5.386  -7.360  1.00 137.06 ? 147 ARG I O     1 
ATOM 2913 C CB    . ARG H 6 17 ? 8.766   -4.775  -8.229  1.00 128.82 ? 147 ARG I CB    1 
ATOM 2914 C CG    . ARG H 6 17 ? 10.239  -5.050  -8.495  1.00 131.18 ? 147 ARG I CG    1 
ATOM 2915 C CD    . ARG H 6 17 ? 11.122  -4.009  -7.843  1.00 138.86 ? 147 ARG I CD    1 
ATOM 2916 N NE    . ARG H 6 17 ? 12.507  -4.157  -8.271  1.00 142.42 ? 147 ARG I NE    1 
ATOM 2917 C CZ    . ARG H 6 17 ? 13.532  -3.546  -7.690  1.00 141.30 ? 147 ARG I CZ    1 
ATOM 2918 N NH1   . ARG H 6 17 ? 13.323  -2.751  -6.657  1.00 139.68 ? 147 ARG I NH1   1 
ATOM 2919 N NH2   . ARG H 6 17 ? 14.766  -3.732  -8.135  1.00 139.99 ? 147 ARG I NH2   1 
ATOM 2920 N N     . PHE H 6 18 ? 5.905   -5.284  -9.593  1.00 131.11 ? 148 PHE I N     1 
ATOM 2921 C CA    . PHE H 6 18 ? 4.576   -4.680  -9.810  1.00 131.44 ? 148 PHE I CA    1 
ATOM 2922 C C     . PHE H 6 18 ? 3.388   -5.593  -9.544  1.00 127.92 ? 148 PHE I C     1 
ATOM 2923 O O     . PHE H 6 18 ? 2.465   -5.224  -8.824  1.00 123.42 ? 148 PHE I O     1 
ATOM 2924 C CB    . PHE H 6 18 ? 4.450   -4.174  -11.259 1.00 130.79 ? 148 PHE I CB    1 
ATOM 2925 C CG    . PHE H 6 18 ? 3.028   -4.195  -11.808 1.00 124.42 ? 148 PHE I CG    1 
ATOM 2926 C CD1   . PHE H 6 18 ? 2.034   -3.405  -11.254 1.00 128.56 ? 148 PHE I CD1   1 
ATOM 2927 C CD2   . PHE H 6 18 ? 2.696   -4.993  -12.899 1.00 139.88 ? 148 PHE I CD2   1 
ATOM 2928 C CE1   . PHE H 6 18 ? 0.739   -3.428  -11.763 1.00 144.70 ? 148 PHE I CE1   1 
ATOM 2929 C CE2   . PHE H 6 18 ? 1.406   -5.011  -13.409 1.00 151.59 ? 148 PHE I CE2   1 
ATOM 2930 C CZ    . PHE H 6 18 ? 0.431   -4.228  -12.839 1.00 158.02 ? 148 PHE I CZ    1 
ATOM 2931 N N     . GLN H 6 19 ? 3.426   -6.788  -10.123 1.00 129.51 ? 149 GLN I N     1 
ATOM 2932 C CA    . GLN H 6 19 ? 2.215   -7.573  -10.364 1.00 125.80 ? 149 GLN I CA    1 
ATOM 2933 C C     . GLN H 6 19 ? 1.494   -7.962  -9.082  1.00 123.87 ? 149 GLN I C     1 
ATOM 2934 O O     . GLN H 6 19 ? 0.289   -8.209  -9.091  1.00 123.85 ? 149 GLN I O     1 
ATOM 2935 C CB    . GLN H 6 19 ? 2.560   -8.834  -11.168 1.00 125.83 ? 149 GLN I CB    1 
ATOM 2936 C CG    . GLN H 6 19 ? 1.348   -9.560  -11.750 1.00 124.77 ? 149 GLN I CG    1 
ATOM 2937 C CD    . GLN H 6 19 ? 1.723   -10.707 -12.676 1.00 137.99 ? 149 GLN I CD    1 
ATOM 2938 O OE1   . GLN H 6 19 ? 2.898   -11.034 -12.832 1.00 150.42 ? 149 GLN I OE1   1 
ATOM 2939 N NE2   . GLN H 6 19 ? 0.720   -11.318 -13.301 1.00 149.21 ? 149 GLN I NE2   1 
ATOM 2940 N N     . LYS H 6 20 ? 2.236   -7.999  -7.984  1.00 127.49 ? 150 LYS I N     1 
ATOM 2941 C CA    . LYS H 6 20 ? 1.691   -8.397  -6.695  1.00 123.13 ? 150 LYS I CA    1 
ATOM 2942 C C     . LYS H 6 20 ? 0.931   -7.233  -6.063  1.00 122.85 ? 150 LYS I C     1 
ATOM 2943 O O     . LYS H 6 20 ? 0.023   -6.682  -6.686  1.00 119.05 ? 150 LYS I O     1 
ATOM 2944 C CB    . LYS H 6 20 ? 2.819   -8.894  -5.791  1.00 121.59 ? 150 LYS I CB    1 
ATOM 2945 C CG    . LYS H 6 20 ? 3.633   -10.039 -6.396  1.00 121.88 ? 150 LYS I CG    1 
ATOM 2946 C CD    . LYS H 6 20 ? 2.761   -11.232 -6.763  1.00 128.95 ? 150 LYS I CD    1 
ATOM 2947 C CE    . LYS H 6 20 ? 2.181   -11.897 -5.525  1.00 136.18 ? 150 LYS I CE    1 
ATOM 2948 N NZ    . LYS H 6 20 ? 1.018   -12.751 -5.854  1.00 149.18 ? 150 LYS I NZ    1 
ATOM 2949 N N     . ALA H 6 21 ? 1.278   -6.860  -4.834  1.00 120.49 ? 151 ALA I N     1 
ATOM 2950 C CA    . ALA H 6 21 ? 0.577   -5.773  -4.158  1.00 128.65 ? 151 ALA I CA    1 
ATOM 2951 C C     . ALA H 6 21 ? 0.766   -4.455  -4.919  1.00 131.87 ? 151 ALA I C     1 
ATOM 2952 O O     . ALA H 6 21 ? 1.871   -4.137  -5.353  1.00 133.58 ? 151 ALA I O     1 
ATOM 2953 C CB    . ALA H 6 21 ? 1.067   -5.645  -2.717  1.00 133.28 ? 151 ALA I CB    1 
ATOM 2954 N N     . GLN H 6 22 ? -0.319  -3.703  -5.096  1.00 130.49 ? 152 GLN I N     1 
ATOM 2955 C CA    . GLN H 6 22 ? -0.252  -2.414  -5.775  1.00 127.99 ? 152 GLN I CA    1 
ATOM 2956 C C     . GLN H 6 22 ? 0.468   -1.408  -4.885  1.00 131.75 ? 152 GLN I C     1 
ATOM 2957 O O     . GLN H 6 22 ? 1.235   -0.577  -5.366  1.00 134.73 ? 152 GLN I O     1 
ATOM 2958 C CB    . GLN H 6 22 ? -1.651  -1.911  -6.142  1.00 125.46 ? 152 GLN I CB    1 
ATOM 2959 C CG    . GLN H 6 22 ? -2.602  -2.990  -6.644  1.00 115.68 ? 152 GLN I CG    1 
ATOM 2960 C CD    . GLN H 6 22 ? -3.435  -3.599  -5.533  1.00 112.26 ? 152 GLN I CD    1 
ATOM 2961 O OE1   . GLN H 6 22 ? -2.970  -3.737  -4.404  1.00 118.15 ? 152 GLN I OE1   1 
ATOM 2962 N NE2   . GLN H 6 22 ? -4.675  -3.959  -5.846  1.00 117.54 ? 152 GLN I NE2   1 
ATOM 2963 N N     . TYR H 6 23 ? 0.226   -1.498  -3.581  1.00 130.52 ? 153 TYR I N     1 
ATOM 2964 C CA    . TYR H 6 23 ? 1.013   -0.749  -2.614  1.00 133.01 ? 153 TYR I CA    1 
ATOM 2965 C C     . TYR H 6 23 ? 2.431   -1.291  -2.695  1.00 131.76 ? 153 TYR I C     1 
ATOM 2966 O O     . TYR H 6 23 ? 2.620   -2.491  -2.895  1.00 130.47 ? 153 TYR I O     1 
ATOM 2967 C CB    . TYR H 6 23 ? 0.474   -0.897  -1.190  1.00 134.73 ? 153 TYR I CB    1 
ATOM 2968 C CG    . TYR H 6 23 ? -1.008  -0.642  -0.991  1.00 140.77 ? 153 TYR I CG    1 
ATOM 2969 C CD1   . TYR H 6 23 ? -1.622  -0.980  0.210   1.00 143.80 ? 153 TYR I CD1   1 
ATOM 2970 C CD2   . TYR H 6 23 ? -1.791  -0.068  -1.983  1.00 142.39 ? 153 TYR I CD2   1 
ATOM 2971 C CE1   . TYR H 6 23 ? -2.968  -0.759  0.417   1.00 133.42 ? 153 TYR I CE1   1 
ATOM 2972 C CE2   . TYR H 6 23 ? -3.149  0.157   -1.782  1.00 144.63 ? 153 TYR I CE2   1 
ATOM 2973 C CZ    . TYR H 6 23 ? -3.726  -0.190  -0.578  1.00 137.43 ? 153 TYR I CZ    1 
ATOM 2974 O OH    . TYR H 6 23 ? -5.068  0.028   -0.364  1.00 124.21 ? 153 TYR I OH    1 
ATOM 2975 N N     . LEU H 6 24 ? 3.423   -0.422  -2.549  1.00 127.45 ? 154 LEU I N     1 
ATOM 2976 C CA    . LEU H 6 24 ? 4.812   -0.847  -2.639  1.00 132.65 ? 154 LEU I CA    1 
ATOM 2977 C C     . LEU H 6 24 ? 5.601   -0.211  -1.502  1.00 135.22 ? 154 LEU I C     1 
ATOM 2978 O O     . LEU H 6 24 ? 5.047   0.083   -0.445  1.00 142.85 ? 154 LEU I O     1 
ATOM 2979 C CB    . LEU H 6 24 ? 5.384   -0.486  -4.013  1.00 141.53 ? 154 LEU I CB    1 
ATOM 2980 C CG    . LEU H 6 24 ? 6.266   -1.522  -4.722  1.00 146.99 ? 154 LEU I CG    1 
ATOM 2981 C CD1   . LEU H 6 24 ? 6.727   -0.988  -6.065  1.00 148.89 ? 154 LEU I CD1   1 
ATOM 2982 C CD2   . LEU H 6 24 ? 7.464   -1.933  -3.898  1.00 143.12 ? 154 LEU I CD2   1 
ATOM 2983 N N     . ALA H 6 25 ? 6.889   0.019   -1.724  1.00 131.82 ? 155 ALA I N     1 
ATOM 2984 C CA    . ALA H 6 25 ? 7.790   0.430   -0.664  1.00 135.70 ? 155 ALA I CA    1 
ATOM 2985 C C     . ALA H 6 25 ? 9.142   0.808   -1.251  1.00 134.26 ? 155 ALA I C     1 
ATOM 2986 O O     . ALA H 6 25 ? 9.494   0.382   -2.349  1.00 130.94 ? 155 ALA I O     1 
ATOM 2987 C CB    . ALA H 6 25 ? 7.945   -0.681  0.357   1.00 140.40 ? 155 ALA I CB    1 
ATOM 2988 N N     . LEU H 6 26 ? 9.885   1.628   -0.524  1.00 129.93 ? 156 LEU I N     1 
ATOM 2989 C CA    . LEU H 6 26 ? 11.201  2.078   -0.962  1.00 129.11 ? 156 LEU I CA    1 
ATOM 2990 C C     . LEU H 6 26 ? 12.220  0.959   -1.223  1.00 132.13 ? 156 LEU I C     1 
ATOM 2991 O O     . LEU H 6 26 ? 12.921  1.023   -2.214  1.00 129.18 ? 156 LEU I O     1 
ATOM 2992 C CB    . LEU H 6 26 ? 11.774  3.084   0.020   1.00 125.00 ? 156 LEU I CB    1 
ATOM 2993 C CG    . LEU H 6 26 ? 11.248  4.499   -0.233  1.00 133.48 ? 156 LEU I CG    1 
ATOM 2994 C CD1   . LEU H 6 26 ? 11.618  4.997   -1.632  1.00 142.49 ? 156 LEU I CD1   1 
ATOM 2995 C CD2   . LEU H 6 26 ? 9.737   4.550   -0.054  1.00 125.35 ? 156 LEU I CD2   1 
ATOM 2996 N N     . PRO H 6 27 ? 12.284  -0.085  -0.375  1.00 141.02 ? 157 PRO I N     1 
ATOM 2997 C CA    . PRO H 6 27 ? 13.391  -1.044  -0.514  1.00 147.43 ? 157 PRO I CA    1 
ATOM 2998 C C     . PRO H 6 27 ? 13.424  -1.629  -1.920  1.00 142.83 ? 157 PRO I C     1 
ATOM 2999 O O     . PRO H 6 27 ? 14.488  -1.991  -2.421  1.00 140.08 ? 157 PRO I O     1 
ATOM 3000 C CB    . PRO H 6 27 ? 13.063  -2.126  0.525   1.00 140.14 ? 157 PRO I CB    1 
ATOM 3001 C CG    . PRO H 6 27 ? 12.138  -1.473  1.494   1.00 132.28 ? 157 PRO I CG    1 
ATOM 3002 C CD    . PRO H 6 27 ? 11.358  -0.472  0.705   1.00 139.59 ? 157 PRO I CD    1 
ATOM 3003 N N     . GLU H 6 28 ? 12.253  -1.724  -2.538  1.00 138.80 ? 158 GLU I N     1 
ATOM 3004 C CA    . GLU H 6 28 ? 12.157  -1.960  -3.969  1.00 136.33 ? 158 GLU I CA    1 
ATOM 3005 C C     . GLU H 6 28 ? 12.507  -0.684  -4.761  1.00 130.23 ? 158 GLU I C     1 
ATOM 3006 O O     . GLU H 6 28 ? 13.260  -0.738  -5.730  1.00 127.83 ? 158 GLU I O     1 
ATOM 3007 C CB    . GLU H 6 28 ? 10.754  -2.441  -4.333  1.00 137.37 ? 158 GLU I CB    1 
ATOM 3008 C CG    . GLU H 6 28 ? 10.294  -3.702  -3.603  1.00 139.64 ? 158 GLU I CG    1 
ATOM 3009 C CD    . GLU H 6 28 ? 9.748   -3.425  -2.210  1.00 151.98 ? 158 GLU I CD    1 
ATOM 3010 O OE1   . GLU H 6 28 ? 10.389  -2.667  -1.454  1.00 146.15 ? 158 GLU I OE1   1 
ATOM 3011 O OE2   . GLU H 6 28 ? 8.675   -3.964  -1.870  1.00 177.63 ? 158 GLU I OE2   1 
ATOM 3012 N N     . ARG H 6 29 ? 11.968  0.457   -4.332  1.00 127.13 ? 159 ARG I N     1 
ATOM 3013 C CA    . ARG H 6 29 ? 12.240  1.754   -4.963  1.00 128.61 ? 159 ARG I CA    1 
ATOM 3014 C C     . ARG H 6 29 ? 13.641  2.271   -4.611  1.00 130.20 ? 159 ARG I C     1 
ATOM 3015 O O     . ARG H 6 29 ? 14.147  3.202   -5.234  1.00 136.20 ? 159 ARG I O     1 
ATOM 3016 C CB    . ARG H 6 29 ? 11.188  2.776   -4.520  1.00 128.59 ? 159 ARG I CB    1 
ATOM 3017 C CG    . ARG H 6 29 ? 10.520  3.560   -5.629  1.00 127.08 ? 159 ARG I CG    1 
ATOM 3018 C CD    . ARG H 6 29 ? 9.327   4.324   -5.096  1.00 121.64 ? 159 ARG I CD    1 
ATOM 3019 N NE    . ARG H 6 29 ? 8.551   4.921   -6.177  1.00 117.46 ? 159 ARG I NE    1 
ATOM 3020 C CZ    . ARG H 6 29 ? 7.337   5.443   -6.039  1.00 118.61 ? 159 ARG I CZ    1 
ATOM 3021 N NH1   . ARG H 6 29 ? 6.729   5.457   -4.858  1.00 116.43 ? 159 ARG I NH1   1 
ATOM 3022 N NH2   . ARG H 6 29 ? 6.728   5.950   -7.100  1.00 116.52 ? 159 ARG I NH2   1 
ATOM 3023 N N     . ALA H 6 30 ? 14.256  1.631   -3.616  1.00 130.63 ? 160 ALA I N     1 
ATOM 3024 C CA    . ALA H 6 30 ? 15.489  2.095   -2.975  1.00 131.11 ? 160 ALA I CA    1 
ATOM 3025 C C     . ALA H 6 30 ? 16.642  2.192   -3.958  1.00 134.29 ? 160 ALA I C     1 
ATOM 3026 O O     . ALA H 6 30 ? 17.532  3.030   -3.810  1.00 130.57 ? 160 ALA I O     1 
ATOM 3027 C CB    . ALA H 6 30 ? 15.857  1.154   -1.822  1.00 129.30 ? 160 ALA I CB    1 
ATOM 3028 N N     . GLU H 6 31 ? 16.631  1.311   -4.949  1.00 133.79 ? 161 GLU I N     1 
ATOM 3029 C CA    . GLU H 6 31 ? 17.532  1.414   -6.084  1.00 131.86 ? 161 GLU I CA    1 
ATOM 3030 C C     . GLU H 6 31 ? 16.799  2.101   -7.235  1.00 126.95 ? 161 GLU I C     1 
ATOM 3031 O O     . GLU H 6 31 ? 17.365  2.931   -7.943  1.00 128.67 ? 161 GLU I O     1 
ATOM 3032 C CB    . GLU H 6 31 ? 18.019  0.026   -6.504  1.00 126.60 ? 161 GLU I CB    1 
ATOM 3033 C CG    . GLU H 6 31 ? 18.927  0.011   -7.716  1.00 131.68 ? 161 GLU I CG    1 
ATOM 3034 C CD    . GLU H 6 31 ? 20.168  0.852   -7.529  1.00 140.20 ? 161 GLU I CD    1 
ATOM 3035 O OE1   . GLU H 6 31 ? 20.492  1.636   -8.443  1.00 152.83 ? 161 GLU I OE1   1 
ATOM 3036 O OE2   . GLU H 6 31 ? 20.823  0.724   -6.474  1.00 143.00 ? 161 GLU I OE2   1 
ATOM 3037 N N     . LEU H 6 32 ? 15.505  1.800   -7.343  1.00 124.60 ? 162 LEU I N     1 
ATOM 3038 C CA    . LEU H 6 32 ? 14.762  1.901   -8.602  1.00 121.58 ? 162 LEU I CA    1 
ATOM 3039 C C     . LEU H 6 32 ? 14.630  3.288   -9.221  1.00 126.20 ? 162 LEU I C     1 
ATOM 3040 O O     . LEU H 6 32 ? 14.565  3.408   -10.443 1.00 128.09 ? 162 LEU I O     1 
ATOM 3041 C CB    . LEU H 6 32 ? 13.353  1.340   -8.403  1.00 124.18 ? 162 LEU I CB    1 
ATOM 3042 C CG    . LEU H 6 32 ? 12.864  0.311   -9.427  1.00 125.16 ? 162 LEU I CG    1 
ATOM 3043 C CD1   . LEU H 6 32 ? 11.380  0.026   -9.230  1.00 126.84 ? 162 LEU I CD1   1 
ATOM 3044 C CD2   . LEU H 6 32 ? 13.116  0.762   -10.847 1.00 117.20 ? 162 LEU I CD2   1 
ATOM 3045 N N     . ALA H 6 33 ? 14.559  4.328   -8.399  1.00 128.60 ? 163 ALA I N     1 
ATOM 3046 C CA    . ALA H 6 33 ? 14.331  5.670   -8.931  1.00 134.13 ? 163 ALA I CA    1 
ATOM 3047 C C     . ALA H 6 33 ? 15.503  6.084   -9.816  1.00 132.89 ? 163 ALA I C     1 
ATOM 3048 O O     . ALA H 6 33 ? 15.355  6.202   -11.029 1.00 132.21 ? 163 ALA I O     1 
ATOM 3049 C CB    . ALA H 6 33 ? 14.128  6.666   -7.810  1.00 141.91 ? 163 ALA I CB    1 
ATOM 3050 N N     . ALA H 6 34 ? 16.677  6.248   -9.214  1.00 127.86 ? 164 ALA I N     1 
ATOM 3051 C CA    . ALA H 6 34 ? 17.878  6.596   -9.963  1.00 129.64 ? 164 ALA I CA    1 
ATOM 3052 C C     . ALA H 6 34 ? 18.231  5.480   -10.950 1.00 139.07 ? 164 ALA I C     1 
ATOM 3053 O O     . ALA H 6 34 ? 18.927  5.709   -11.939 1.00 152.47 ? 164 ALA I O     1 
ATOM 3054 C CB    . ALA H 6 34 ? 19.039  6.867   -9.012  1.00 136.77 ? 164 ALA I CB    1 
ATOM 3055 N N     . GLN H 6 35 ? 17.743  4.274   -10.670 1.00 133.49 ? 165 GLN I N     1 
ATOM 3056 C CA    . GLN H 6 35 ? 17.933  3.117   -11.541 1.00 126.98 ? 165 GLN I CA    1 
ATOM 3057 C C     . GLN H 6 35 ? 17.189  3.285   -12.865 1.00 119.15 ? 165 GLN I C     1 
ATOM 3058 O O     . GLN H 6 35 ? 16.240  4.062   -12.960 1.00 118.93 ? 165 GLN I O     1 
ATOM 3059 C CB    . GLN H 6 35 ? 17.450  1.841   -10.842 1.00 126.73 ? 165 GLN I CB    1 
ATOM 3060 C CG    . GLN H 6 35 ? 17.847  0.532   -11.517 1.00 130.05 ? 165 GLN I CG    1 
ATOM 3061 C CD    . GLN H 6 35 ? 17.263  -0.688  -10.820 1.00 132.30 ? 165 GLN I CD    1 
ATOM 3062 O OE1   . GLN H 6 35 ? 16.096  -0.695  -10.433 1.00 120.44 ? 165 GLN I OE1   1 
ATOM 3063 N NE2   . GLN H 6 35 ? 18.076  -1.727  -10.657 1.00 153.10 ? 165 GLN I NE2   1 
ATOM 3064 N N     . LEU H 6 36 ? 17.656  2.568   -13.885 1.00 118.42 ? 166 LEU I N     1 
ATOM 3065 C CA    . LEU H 6 36 ? 16.984  2.479   -15.182 1.00 117.64 ? 166 LEU I CA    1 
ATOM 3066 C C     . LEU H 6 36 ? 17.132  3.784   -15.973 1.00 120.64 ? 166 LEU I C     1 
ATOM 3067 O O     . LEU H 6 36 ? 17.873  3.843   -16.955 1.00 113.23 ? 166 LEU I O     1 
ATOM 3068 C CB    . LEU H 6 36 ? 15.495  2.133   -15.012 1.00 111.93 ? 166 LEU I CB    1 
ATOM 3069 C CG    . LEU H 6 36 ? 15.050  1.111   -13.956 1.00 111.13 ? 166 LEU I CG    1 
ATOM 3070 C CD1   . LEU H 6 36 ? 13.509  1.034   -13.925 1.00 105.39 ? 166 LEU I CD1   1 
ATOM 3071 C CD2   . LEU H 6 36 ? 15.689  -0.275  -14.148 1.00 109.28 ? 166 LEU I CD2   1 
ATOM 3072 N N     . GLY H 6 37 ? 16.437  4.826   -15.529 1.00 120.34 ? 167 GLY I N     1 
ATOM 3073 C CA    . GLY H 6 37 ? 16.403  6.097   -16.231 1.00 122.30 ? 167 GLY I CA    1 
ATOM 3074 C C     . GLY H 6 37 ? 15.136  6.868   -15.899 1.00 121.92 ? 167 GLY I C     1 
ATOM 3075 O O     . GLY H 6 37 ? 14.634  7.634   -16.721 1.00 133.52 ? 167 GLY I O     1 
ATOM 3076 N N     . LEU H 6 38 ? 14.632  6.675   -14.681 1.00 120.23 ? 168 LEU I N     1 
ATOM 3077 C CA    . LEU H 6 38 ? 13.345  7.226   -14.264 1.00 122.44 ? 168 LEU I CA    1 
ATOM 3078 C C     . LEU H 6 38 ? 13.458  7.785   -12.843 1.00 125.13 ? 168 LEU I C     1 
ATOM 3079 O O     . LEU H 6 38 ? 14.525  8.244   -12.445 1.00 123.55 ? 168 LEU I O     1 
ATOM 3080 C CB    . LEU H 6 38 ? 12.255  6.152   -14.361 1.00 123.00 ? 168 LEU I CB    1 
ATOM 3081 C CG    . LEU H 6 38 ? 11.958  5.659   -15.778 1.00 123.73 ? 168 LEU I CG    1 
ATOM 3082 C CD1   . LEU H 6 38 ? 10.974  4.490   -15.748 1.00 131.81 ? 168 LEU I CD1   1 
ATOM 3083 C CD2   . LEU H 6 38 ? 11.441  6.807   -16.647 1.00 136.04 ? 168 LEU I CD2   1 
ATOM 3084 N N     . THR H 6 39 ? 12.361  7.765   -12.089 1.00 124.08 ? 169 THR I N     1 
ATOM 3085 C CA    . THR H 6 39 ? 12.331  8.287   -10.720 1.00 122.13 ? 169 THR I CA    1 
ATOM 3086 C C     . THR H 6 39 ? 11.143  7.657   -9.994  1.00 124.36 ? 169 THR I C     1 
ATOM 3087 O O     . THR H 6 39 ? 10.381  6.912   -10.599 1.00 126.80 ? 169 THR I O     1 
ATOM 3088 C CB    . THR H 6 39 ? 12.196  9.835   -10.648 1.00 124.71 ? 169 THR I CB    1 
ATOM 3089 O OG1   . THR H 6 39 ? 10.861  10.179  -10.263 1.00 127.45 ? 169 THR I OG1   1 
ATOM 3090 C CG2   . THR H 6 39 ? 12.522  10.526  -11.976 1.00 115.51 ? 169 THR I CG2   1 
ATOM 3091 N N     . GLN H 6 40 ? 10.998  7.938   -8.702  1.00 118.33 ? 170 GLN I N     1 
ATOM 3092 C CA    . GLN H 6 40 ? 9.823   7.513   -7.944  1.00 116.27 ? 170 GLN I CA    1 
ATOM 3093 C C     . GLN H 6 40 ? 8.531   8.119   -8.504  1.00 118.65 ? 170 GLN I C     1 
ATOM 3094 O O     . GLN H 6 40 ? 7.457   7.520   -8.416  1.00 117.54 ? 170 GLN I O     1 
ATOM 3095 C CB    . GLN H 6 40 ? 9.982   7.899   -6.468  1.00 109.48 ? 170 GLN I CB    1 
ATOM 3096 C CG    . GLN H 6 40 ? 10.282  9.384   -6.206  1.00 106.45 ? 170 GLN I CG    1 
ATOM 3097 C CD    . GLN H 6 40 ? 11.767  9.726   -6.235  1.00 117.46 ? 170 GLN I CD    1 
ATOM 3098 O OE1   . GLN H 6 40 ? 12.580  8.951   -6.732  1.00 126.56 ? 170 GLN I OE1   1 
ATOM 3099 N NE2   . GLN H 6 40 ? 12.124  10.895  -5.708  1.00 121.77 ? 170 GLN I NE2   1 
ATOM 3100 N N     . THR H 6 41 ? 8.653   9.298   -9.102  1.00 120.44 ? 171 THR I N     1 
ATOM 3101 C CA    . THR H 6 41 ? 7.501   10.058  -9.585  1.00 123.23 ? 171 THR I CA    1 
ATOM 3102 C C     . THR H 6 41 ? 7.018   9.593   -10.961 1.00 131.68 ? 171 THR I C     1 
ATOM 3103 O O     . THR H 6 41 ? 6.005   10.075  -11.461 1.00 131.06 ? 171 THR I O     1 
ATOM 3104 C CB    . THR H 6 41 ? 7.821   11.570  -9.656  1.00 122.92 ? 171 THR I CB    1 
ATOM 3105 O OG1   . THR H 6 41 ? 9.028   11.781  -10.400 1.00 143.62 ? 171 THR I OG1   1 
ATOM 3106 C CG2   . THR H 6 41 ? 7.985   12.161  -8.251  1.00 140.52 ? 171 THR I CG2   1 
ATOM 3107 N N     . GLN H 6 42 ? 7.754   8.673   -11.579 1.00 130.60 ? 172 GLN I N     1 
ATOM 3108 C CA    . GLN H 6 42 ? 7.394   8.130   -12.892 1.00 126.80 ? 172 GLN I CA    1 
ATOM 3109 C C     . GLN H 6 42 ? 6.491   6.898   -12.795 1.00 130.40 ? 172 GLN I C     1 
ATOM 3110 O O     . GLN H 6 42 ? 6.129   6.315   -13.816 1.00 145.60 ? 172 GLN I O     1 
ATOM 3111 C CB    . GLN H 6 42 ? 8.664   7.767   -13.674 1.00 122.98 ? 172 GLN I CB    1 
ATOM 3112 C CG    . GLN H 6 42 ? 9.690   8.882   -13.776 1.00 125.22 ? 172 GLN I CG    1 
ATOM 3113 C CD    . GLN H 6 42 ? 9.275   9.991   -14.725 1.00 126.02 ? 172 GLN I CD    1 
ATOM 3114 O OE1   . GLN H 6 42 ? 8.089   10.247  -14.928 1.00 132.19 ? 172 GLN I OE1   1 
ATOM 3115 N NE2   . GLN H 6 42 ? 10.259  10.649  -15.321 1.00 109.34 ? 172 GLN I NE2   1 
ATOM 3116 N N     . VAL H 6 43 ? 6.127   6.513   -11.572 1.00 125.98 ? 173 VAL I N     1 
ATOM 3117 C CA    . VAL H 6 43 ? 5.738   5.132   -11.282 1.00 125.69 ? 173 VAL I CA    1 
ATOM 3118 C C     . VAL H 6 43 ? 4.439   4.995   -10.481 1.00 127.73 ? 173 VAL I C     1 
ATOM 3119 O O     . VAL H 6 43 ? 3.526   4.296   -10.914 1.00 126.17 ? 173 VAL I O     1 
ATOM 3120 C CB    . VAL H 6 43 ? 6.862   4.420   -10.507 1.00 125.75 ? 173 VAL I CB    1 
ATOM 3121 C CG1   . VAL H 6 43 ? 6.709   2.898   -10.585 1.00 127.91 ? 173 VAL I CG1   1 
ATOM 3122 C CG2   . VAL H 6 43 ? 8.227   4.873   -11.015 1.00 122.33 ? 173 VAL I CG2   1 
ATOM 3123 N N     . LYS H 6 44 ? 4.350   5.637   -9.319  1.00 131.40 ? 174 LYS I N     1 
ATOM 3124 C CA    . LYS H 6 44 ? 3.111   5.601   -8.545  1.00 137.28 ? 174 LYS I CA    1 
ATOM 3125 C C     . LYS H 6 44 ? 2.023   6.316   -9.331  1.00 137.89 ? 174 LYS I C     1 
ATOM 3126 O O     . LYS H 6 44 ? 0.831   6.147   -9.068  1.00 139.71 ? 174 LYS I O     1 
ATOM 3127 C CB    . LYS H 6 44 ? 3.297   6.224   -7.165  1.00 132.32 ? 174 LYS I CB    1 
ATOM 3128 C CG    . LYS H 6 44 ? 2.108   6.020   -6.255  1.00 150.66 ? 174 LYS I CG    1 
ATOM 3129 C CD    . LYS H 6 44 ? 2.467   6.236   -4.808  1.00 161.33 ? 174 LYS I CD    1 
ATOM 3130 C CE    . LYS H 6 44 ? 1.491   5.501   -3.937  1.00 140.46 ? 174 LYS I CE    1 
ATOM 3131 N NZ    . LYS H 6 44 ? 1.734   5.759   -2.507  1.00 121.81 ? 174 LYS I NZ    1 
ATOM 3132 N N     . ILE H 6 45 ? 2.458   7.123   -10.294 1.00 133.87 ? 175 ILE I N     1 
ATOM 3133 C CA    . ILE H 6 45 ? 1.571   7.674   -11.309 1.00 135.65 ? 175 ILE I CA    1 
ATOM 3134 C C     . ILE H 6 45 ? 0.874   6.535   -12.041 1.00 142.23 ? 175 ILE I C     1 
ATOM 3135 O O     . ILE H 6 45 ? -0.288  6.648   -12.416 1.00 150.44 ? 175 ILE I O     1 
ATOM 3136 C CB    . ILE H 6 45 ? 2.351   8.531   -12.340 1.00 135.82 ? 175 ILE I CB    1 
ATOM 3137 C CG1   . ILE H 6 45 ? 3.356   7.670   -13.128 1.00 132.15 ? 175 ILE I CG1   1 
ATOM 3138 C CG2   . ILE H 6 45 ? 3.089   9.660   -11.640 1.00 130.47 ? 175 ILE I CG2   1 
ATOM 3139 C CD1   . ILE H 6 45 ? 2.863   7.127   -14.491 1.00 126.41 ? 175 ILE I CD1   1 
ATOM 3140 N N     . TRP H 6 46 ? 1.596   5.430   -12.206 1.00 139.11 ? 176 TRP I N     1 
ATOM 3141 C CA    . TRP H 6 46 ? 1.126   4.259   -12.941 1.00 138.87 ? 176 TRP I CA    1 
ATOM 3142 C C     . TRP H 6 46 ? 0.303   3.333   -12.070 1.00 134.46 ? 176 TRP I C     1 
ATOM 3143 O O     . TRP H 6 46 ? -0.649  2.701   -12.530 1.00 140.53 ? 176 TRP I O     1 
ATOM 3144 C CB    . TRP H 6 46 ? 2.316   3.477   -13.483 1.00 132.13 ? 176 TRP I CB    1 
ATOM 3145 C CG    . TRP H 6 46 ? 2.172   2.958   -14.871 1.00 130.48 ? 176 TRP I CG    1 
ATOM 3146 C CD1   . TRP H 6 46 ? 1.081   3.056   -15.690 1.00 128.85 ? 176 TRP I CD1   1 
ATOM 3147 C CD2   . TRP H 6 46 ? 3.163   2.252   -15.607 1.00 124.03 ? 176 TRP I CD2   1 
ATOM 3148 N NE1   . TRP H 6 46 ? 1.339   2.453   -16.894 1.00 128.19 ? 176 TRP I NE1   1 
ATOM 3149 C CE2   . TRP H 6 46 ? 2.610   1.947   -16.866 1.00 129.72 ? 176 TRP I CE2   1 
ATOM 3150 C CE3   . TRP H 6 46 ? 4.467   1.845   -15.324 1.00 123.96 ? 176 TRP I CE3   1 
ATOM 3151 C CZ2   . TRP H 6 46 ? 3.316   1.262   -17.840 1.00 140.63 ? 176 TRP I CZ2   1 
ATOM 3152 C CZ3   . TRP H 6 46 ? 5.162   1.171   -16.288 1.00 142.08 ? 176 TRP I CZ3   1 
ATOM 3153 C CH2   . TRP H 6 46 ? 4.589   0.887   -17.536 1.00 135.77 ? 176 TRP I CH2   1 
ATOM 3154 N N     . PHE H 6 47 ? 0.721   3.240   -10.813 1.00 133.57 ? 177 PHE I N     1 
ATOM 3155 C CA    . PHE H 6 47 ? 0.076   2.392   -9.826  1.00 140.27 ? 177 PHE I CA    1 
ATOM 3156 C C     . PHE H 6 47 ? -1.429  2.635   -9.822  1.00 140.90 ? 177 PHE I C     1 
ATOM 3157 O O     . PHE H 6 47 ? -2.191  1.825   -10.349 1.00 138.67 ? 177 PHE I O     1 
ATOM 3158 C CB    . PHE H 6 47 ? 0.658   2.666   -8.439  1.00 138.23 ? 177 PHE I CB    1 
ATOM 3159 C CG    . PHE H 6 47 ? 1.974   1.987   -8.174  1.00 135.78 ? 177 PHE I CG    1 
ATOM 3160 C CD1   . PHE H 6 47 ? 2.821   1.621   -9.207  1.00 131.67 ? 177 PHE I CD1   1 
ATOM 3161 C CD2   . PHE H 6 47 ? 2.361   1.717   -6.875  1.00 142.20 ? 177 PHE I CD2   1 
ATOM 3162 C CE1   . PHE H 6 47 ? 4.031   0.995   -8.939  1.00 143.47 ? 177 PHE I CE1   1 
ATOM 3163 C CE2   . PHE H 6 47 ? 3.558   1.095   -6.606  1.00 146.61 ? 177 PHE I CE2   1 
ATOM 3164 C CZ    . PHE H 6 47 ? 4.394   0.734   -7.636  1.00 148.82 ? 177 PHE I CZ    1 
ATOM 3165 N N     . GLN H 6 48 ? -1.844  3.778   -9.281  1.00 143.80 ? 178 GLN I N     1 
ATOM 3166 C CA    . GLN H 6 48 ? -3.260  4.112   -9.198  1.00 142.45 ? 178 GLN I CA    1 
ATOM 3167 C C     . GLN H 6 48 ? -3.873  4.175   -10.590 1.00 142.48 ? 178 GLN I C     1 
ATOM 3168 O O     . GLN H 6 48 ? -5.061  3.921   -10.760 1.00 146.98 ? 178 GLN I O     1 
ATOM 3169 C CB    . GLN H 6 48 ? -3.475  5.443   -8.474  1.00 136.91 ? 178 GLN I CB    1 
ATOM 3170 C CG    . GLN H 6 48 ? -3.003  5.463   -7.035  1.00 135.96 ? 178 GLN I CG    1 
ATOM 3171 C CD    . GLN H 6 48 ? -1.535  5.795   -6.904  1.00 143.43 ? 178 GLN I CD    1 
ATOM 3172 O OE1   . GLN H 6 48 ? -0.689  4.905   -6.883  1.00 146.41 ? 178 GLN I OE1   1 
ATOM 3173 N NE2   . GLN H 6 48 ? -1.222  7.082   -6.817  1.00 154.44 ? 178 GLN I NE2   1 
ATOM 3174 N N     . ASN H 6 49 ? -3.056  4.505   -11.586 1.00 148.86 ? 179 ASN I N     1 
ATOM 3175 C CA    . ASN H 6 49 ? -3.521  4.528   -12.966 1.00 157.06 ? 179 ASN I CA    1 
ATOM 3176 C C     . ASN H 6 49 ? -4.010  3.161   -13.422 1.00 150.42 ? 179 ASN I C     1 
ATOM 3177 O O     . ASN H 6 49 ? -4.942  3.065   -14.221 1.00 149.59 ? 179 ASN I O     1 
ATOM 3178 C CB    . ASN H 6 49 ? -2.406  4.994   -13.897 1.00 156.66 ? 179 ASN I CB    1 
ATOM 3179 C CG    . ASN H 6 49 ? -2.496  6.462   -14.234 1.00 151.54 ? 179 ASN I CG    1 
ATOM 3180 O OD1   . ASN H 6 49 ? -3.585  7.017   -14.368 1.00 150.42 ? 179 ASN I OD1   1 
ATOM 3181 N ND2   . ASN H 6 49 ? -1.340  7.101   -14.398 1.00 147.93 ? 179 ASN I ND2   1 
ATOM 3182 N N     . ARG H 6 50 ? -3.374  2.108   -12.916 1.00 142.68 ? 180 ARG I N     1 
ATOM 3183 C CA    . ARG H 6 50 ? -3.777  0.750   -13.247 1.00 140.31 ? 180 ARG I CA    1 
ATOM 3184 C C     . ARG H 6 50 ? -4.563  0.127   -12.096 1.00 134.37 ? 180 ARG I C     1 
ATOM 3185 O O     . ARG H 6 50 ? -5.239  -0.881  -12.286 1.00 125.82 ? 180 ARG I O     1 
ATOM 3186 C CB    . ARG H 6 50 ? -2.563  -0.106  -13.600 1.00 151.32 ? 180 ARG I CB    1 
ATOM 3187 C CG    . ARG H 6 50 ? -2.933  -1.491  -14.107 1.00 153.93 ? 180 ARG I CG    1 
ATOM 3188 C CD    . ARG H 6 50 ? -1.790  -2.156  -14.862 1.00 156.89 ? 180 ARG I CD    1 
ATOM 3189 N NE    . ARG H 6 50 ? -1.668  -1.684  -16.236 1.00 156.70 ? 180 ARG I NE    1 
ATOM 3190 C CZ    . ARG H 6 50 ? -2.565  -1.914  -17.191 1.00 139.68 ? 180 ARG I CZ    1 
ATOM 3191 N NH1   . ARG H 6 50 ? -3.672  -2.597  -16.929 1.00 141.64 ? 180 ARG I NH1   1 
ATOM 3192 N NH2   . ARG H 6 50 ? -2.359  -1.446  -18.414 1.00 133.95 ? 180 ARG I NH2   1 
ATOM 3193 N N     . ARG H 6 51 ? -4.475  0.711   -10.901 1.00 137.86 ? 181 ARG I N     1 
ATOM 3194 C CA    . ARG H 6 51 ? -5.427  0.355   -9.855  1.00 132.46 ? 181 ARG I CA    1 
ATOM 3195 C C     . ARG H 6 51 ? -6.803  0.787   -10.348 1.00 130.21 ? 181 ARG I C     1 
ATOM 3196 O O     . ARG H 6 51 ? -7.785  0.058   -10.217 1.00 122.83 ? 181 ARG I O     1 
ATOM 3197 C CB    . ARG H 6 51 ? -5.131  1.042   -8.511  1.00 134.18 ? 181 ARG I CB    1 
ATOM 3198 C CG    . ARG H 6 51 ? -3.788  0.769   -7.841  1.00 135.20 ? 181 ARG I CG    1 
ATOM 3199 C CD    . ARG H 6 51 ? -3.622  1.636   -6.595  1.00 134.67 ? 181 ARG I CD    1 
ATOM 3200 N NE    . ARG H 6 51 ? -2.218  1.921   -6.318  1.00 138.73 ? 181 ARG I NE    1 
ATOM 3201 C CZ    . ARG H 6 51 ? -1.791  2.694   -5.327  1.00 146.14 ? 181 ARG I CZ    1 
ATOM 3202 N NH1   . ARG H 6 51 ? -0.493  2.898   -5.158  1.00 147.58 ? 181 ARG I NH1   1 
ATOM 3203 N NH2   . ARG H 6 51 ? -2.655  3.272   -4.508  1.00 152.83 ? 181 ARG I NH2   1 
ATOM 3204 N N     . SER H 6 52 ? -6.840  1.970   -10.961 1.00 127.54 ? 182 SER I N     1 
ATOM 3205 C CA    . SER H 6 52 ? -8.091  2.652   -11.289 1.00 126.65 ? 182 SER I CA    1 
ATOM 3206 C C     . SER H 6 52 ? -8.746  2.122   -12.557 1.00 130.35 ? 182 SER I C     1 
ATOM 3207 O O     . SER H 6 52 ? -9.916  2.405   -12.808 1.00 131.84 ? 182 SER I O     1 
ATOM 3208 C CB    . SER H 6 52 ? -7.849  4.158   -11.439 1.00 132.48 ? 182 SER I CB    1 
ATOM 3209 O OG    . SER H 6 52 ? -6.834  4.420   -12.391 1.00 141.42 ? 182 SER I OG    1 
ATOM 3210 N N     . LYS H 6 53 ? -8.003  1.364   -13.360 1.00 130.08 ? 183 LYS I N     1 
ATOM 3211 C CA    . LYS H 6 53 ? -8.597  0.750   -14.543 1.00 124.83 ? 183 LYS I CA    1 
ATOM 3212 C C     . LYS H 6 53 ? -9.697  -0.179  -14.072 1.00 121.55 ? 183 LYS I C     1 
ATOM 3213 O O     . LYS H 6 53 ? -10.749 -0.296  -14.695 1.00 115.46 ? 183 LYS I O     1 
ATOM 3214 C CB    . LYS H 6 53 ? -7.559  -0.021  -15.356 1.00 124.56 ? 183 LYS I CB    1 
ATOM 3215 C CG    . LYS H 6 53 ? -8.157  -0.906  -16.441 1.00 126.37 ? 183 LYS I CG    1 
ATOM 3216 C CD    . LYS H 6 53 ? -7.075  -1.514  -17.308 1.00 131.08 ? 183 LYS I CD    1 
ATOM 3217 C CE    . LYS H 6 53 ? -6.549  -0.497  -18.294 1.00 133.91 ? 183 LYS I CE    1 
ATOM 3218 N NZ    . LYS H 6 53 ? -5.069  -0.466  -18.325 1.00 146.24 ? 183 LYS I NZ    1 
ATOM 3219 N N     . PHE H 6 54 ? -9.433  -0.829  -12.944 1.00 127.14 ? 184 PHE I N     1 
ATOM 3220 C CA    . PHE H 6 54 ? -10.437 -1.607  -12.232 1.00 128.62 ? 184 PHE I CA    1 
ATOM 3221 C C     . PHE H 6 54 ? -9.867  -2.157  -10.914 1.00 119.21 ? 184 PHE I C     1 
ATOM 3222 O O     . PHE H 6 54 ? -8.712  -2.585  -10.900 1.00 117.77 ? 184 PHE I O     1 
ATOM 3223 C CB    . PHE H 6 54 ? -10.983 -2.757  -13.096 1.00 133.51 ? 184 PHE I CB    1 
ATOM 3224 C CG    . PHE H 6 54 ? -10.015 -3.304  -14.116 1.00 137.01 ? 184 PHE I CG    1 
ATOM 3225 C CD1   . PHE H 6 54 ? -8.659  -3.423  -13.851 1.00 140.69 ? 184 PHE I CD1   1 
ATOM 3226 C CD2   . PHE H 6 54 ? -10.490 -3.746  -15.340 1.00 132.29 ? 184 PHE I CD2   1 
ATOM 3227 C CE1   . PHE H 6 54 ? -7.798  -3.934  -14.799 1.00 144.71 ? 184 PHE I CE1   1 
ATOM 3228 C CE2   . PHE H 6 54 ? -9.633  -4.261  -16.285 1.00 132.85 ? 184 PHE I CE2   1 
ATOM 3229 C CZ    . PHE H 6 54 ? -8.285  -4.356  -16.011 1.00 142.68 ? 184 PHE I CZ    1 
ATOM 3230 N N     . LYS H 6 55 ? -10.624 -2.167  -9.808  1.00 111.99 ? 185 LYS I N     1 
ATOM 3231 C CA    . LYS H 6 55 ? -12.008 -1.680  -9.680  1.00 117.67 ? 185 LYS I CA    1 
ATOM 3232 C C     . LYS H 6 55 ? -12.935 -2.287  -10.733 1.00 126.59 ? 185 LYS I C     1 
ATOM 3233 O O     . LYS H 6 55 ? -13.246 -3.475  -10.679 1.00 127.02 ? 185 LYS I O     1 
ATOM 3234 C CB    . LYS H 6 55 ? -12.065 -0.145  -9.733  1.00 115.39 ? 185 LYS I CB    1 
ATOM 3235 C CG    . LYS H 6 55 ? -11.576 0.546   -8.460  1.00 114.29 ? 185 LYS I CG    1 
ATOM 3236 C CD    . LYS H 6 55 ? -10.061 0.583   -8.406  1.00 120.77 ? 185 LYS I CD    1 
ATOM 3237 C CE    . LYS H 6 55 ? -9.536  1.154   -7.102  1.00 126.87 ? 185 LYS I CE    1 
ATOM 3238 N NZ    . LYS H 6 55 ? -8.059  1.313   -7.142  1.00 143.37 ? 185 LYS I NZ    1 
ATOM 3239 N N     . LYS H 6 56 ? -13.385 -1.471  -11.681 1.00 126.54 ? 186 LYS I N     1 
ATOM 3240 C CA    . LYS H 6 56 ? -14.134 -1.975  -12.824 1.00 133.69 ? 186 LYS I CA    1 
ATOM 3241 C C     . LYS H 6 56 ? -14.075 -0.985  -13.979 1.00 139.48 ? 186 LYS I C     1 
ATOM 3242 O O     . LYS H 6 56 ? -13.602 -1.317  -15.063 1.00 136.04 ? 186 LYS I O     1 
ATOM 3243 C CB    . LYS H 6 56 ? -15.579 -2.246  -12.437 1.00 132.10 ? 186 LYS I CB    1 
ATOM 3244 C CG    . LYS H 6 56 ? -16.177 -3.446  -13.130 1.00 132.31 ? 186 LYS I CG    1 
ATOM 3245 C CD    . LYS H 6 56 ? -17.685 -3.438  -13.036 1.00 115.86 ? 186 LYS I CD    1 
ATOM 3246 C CE    . LYS H 6 56 ? -18.155 -3.385  -11.598 1.00 107.97 ? 186 LYS I CE    1 
ATOM 3247 N NZ    . LYS H 6 56 ? -19.633 -3.357  -11.504 1.00 110.74 ? 186 LYS I NZ    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  DC  1  21  21  DC  DC  M . n 
A 1 2  DA  2  22  22  DA  DA  M . n 
A 1 3  DA  3  23  23  DA  DA  M . n 
A 1 4  DT  4  24  24  DT  DT  M . n 
A 1 5  DT  5  25  25  DT  DT  M . n 
A 1 6  DA  6  26  26  DA  DA  M . n 
A 1 7  DT  7  27  27  DT  DT  M . n 
A 1 8  DC  8  28  28  DC  DC  M . n 
A 1 9  DC  9  29  29  DC  DC  M . n 
A 1 10 DT  10 30  30  DT  DT  M . n 
A 1 11 DG  11 31  31  DG  DG  M . n 
A 1 12 DT  12 32  32  DT  DT  M . n 
A 1 13 DC  13 33  33  DC  DC  M . n 
A 1 14 DA  14 34  34  DA  DA  M . n 
A 1 15 DA  15 35  35  DA  DA  M . n 
B 2 1  DA  1  20  20  DA  DA  D . n 
B 2 2  DC  2  21  21  DC  DC  D . n 
B 2 3  DA  3  22  22  DA  DA  D . n 
B 2 4  DA  4  23  23  DA  DA  D . n 
B 2 5  DT  5  24  24  DT  DT  D . n 
B 2 6  DT  6  25  25  DT  DT  D . n 
B 2 7  DA  7  26  26  DA  DA  D . n 
B 2 8  DT  8  27  27  DT  DT  D . n 
B 2 9  DC  9  28  28  DC  DC  D . n 
B 2 10 DC  10 29  29  DC  DC  D . n 
B 2 11 DT  11 30  30  DT  DT  D . n 
B 2 12 DG  12 31  31  DG  DG  D . n 
B 2 13 DT  13 32  32  DT  DT  D . n 
B 2 14 DC  14 33  33  DC  DC  D . n 
B 2 15 DA  15 34  34  DA  DA  D . n 
B 2 16 DA  16 35  35  DA  DA  D . n 
B 2 17 DC  17 36  36  DC  DC  D . n 
C 3 1  DG  1  1   1   DG  DG  E . n 
C 3 2  DT  2  2   2   DT  DT  E . n 
C 3 3  DT  3  3   3   DT  DT  E . n 
C 3 4  DG  4  4   4   DG  DG  E . n 
C 3 5  DA  5  5   5   DA  DA  E . n 
C 3 6  DC  6  6   6   DC  DC  E . n 
C 3 7  DA  7  7   7   DA  DA  E . n 
C 3 8  DG  8  8   8   DG  DG  E . n 
C 3 9  DG  9  9   9   DG  DG  E . n 
C 3 10 DA  10 10  10  DA  DA  E . n 
C 3 11 DT  11 11  11  DT  DT  E . n 
C 3 12 DA  12 12  12  DA  DA  E . n 
C 3 13 DA  13 13  13  DA  DA  E . n 
C 3 14 DT  14 14  14  DT  DT  E . n 
C 3 15 DT  15 15  15  DT  DT  E . n 
C 3 16 DG  16 16  16  DG  DG  E . n 
C 3 17 DT  17 17  17  DT  DT  E . n 
C 3 18 DT  18 18  18  DT  DT  E . n 
D 4 1  DG  1  1   ?   ?   ?   L . n 
D 4 2  DT  2  2   2   DT  DT  L . n 
D 4 3  DT  3  3   3   DT  DT  L . n 
D 4 4  DG  4  4   4   DG  DG  L . n 
D 4 5  DA  5  5   5   DA  DA  L . n 
D 4 6  DC  6  6   6   DC  DC  L . n 
D 4 7  DA  7  7   7   DA  DA  L . n 
D 4 8  DG  8  8   8   DG  DG  L . n 
D 4 9  DG  9  9   9   DG  DG  L . n 
D 4 10 DA  10 10  10  DA  DA  L . n 
D 4 11 DT  11 11  11  DT  DT  L . n 
D 4 12 DA  12 12  12  DA  DA  L . n 
D 4 13 DA  13 13  13  DA  DA  L . n 
D 4 14 DT  14 14  14  DT  DT  L . n 
D 4 15 DT  15 15  15  DT  DT  L . n 
D 4 16 DG  16 16  16  DG  DG  L . n 
D 4 17 DT  17 17  17  DT  DT  L . n 
E 5 1  PHE 1  279 ?   ?   ?   A . n 
E 5 2  PRO 2  280 280 PRO PRO A . n 
E 5 3  LYS 3  281 281 LYS LYS A . n 
E 5 4  VAL 4  282 282 VAL VAL A . n 
E 5 5  ALA 5  283 283 ALA ALA A . n 
E 5 6  THR 6  284 284 THR THR A . n 
E 5 7  ASN 7  285 285 ASN ASN A . n 
E 5 8  ILE 8  286 286 ILE ILE A . n 
E 5 9  MET 9  287 287 MET MET A . n 
E 5 10 ARG 10 288 288 ARG ARG A . n 
E 5 11 ALA 11 289 289 ALA ALA A . n 
E 5 12 TRP 12 290 290 TRP TRP A . n 
E 5 13 LEU 13 291 291 LEU LEU A . n 
E 5 14 PHE 14 292 292 PHE PHE A . n 
E 5 15 GLN 15 293 293 GLN GLN A . n 
E 5 16 HIS 16 294 294 HIS HIS A . n 
E 5 17 LEU 17 295 295 LEU LEU A . n 
E 5 18 THR 18 296 296 THR THR A . n 
E 5 19 HIS 19 297 297 HIS HIS A . n 
E 5 20 PRO 20 298 298 PRO PRO A . n 
E 5 21 TYR 21 299 299 TYR TYR A . n 
E 5 22 PRO 22 300 300 PRO PRO A . n 
E 5 23 SER 23 301 301 SER SER A . n 
E 5 24 GLU 24 302 302 GLU GLU A . n 
E 5 25 GLU 25 303 303 GLU GLU A . n 
E 5 26 GLN 26 304 304 GLN GLN A . n 
E 5 27 LYS 27 305 305 LYS LYS A . n 
E 5 28 LYS 28 306 306 LYS LYS A . n 
E 5 29 GLN 29 307 307 GLN GLN A . n 
E 5 30 LEU 30 308 308 LEU LEU A . n 
E 5 31 ALA 31 309 309 ALA ALA A . n 
E 5 32 GLN 32 310 310 GLN GLN A . n 
E 5 33 ASP 33 311 311 ASP ASP A . n 
E 5 34 THR 34 312 312 THR THR A . n 
E 5 35 GLY 35 313 313 GLY GLY A . n 
E 5 36 LEU 36 314 314 LEU LEU A . n 
E 5 37 THR 37 315 315 THR THR A . n 
E 5 38 ILE 38 316 316 ILE ILE A . n 
E 5 39 LEU 39 317 317 LEU LEU A . n 
E 5 40 GLN 40 318 318 GLN GLN A . n 
E 5 41 VAL 41 319 319 VAL VAL A . n 
E 5 42 ASN 42 320 320 ASN ASN A . n 
E 5 43 ASN 43 321 321 ASN ASN A . n 
E 5 44 TRP 44 322 322 TRP TRP A . n 
E 5 45 PHE 45 323 323 PHE PHE A . n 
E 5 46 ILE 46 324 324 ILE ILE A . n 
E 5 47 ASN 47 325 325 ASN ASN A . n 
E 5 48 ALA 48 326 326 ALA ALA A . n 
E 5 49 ARG 49 327 327 ARG ARG A . n 
E 5 50 ARG 50 328 328 ARG ARG A . n 
E 5 51 ARG 51 329 329 ARG ARG A . n 
E 5 52 ILE 52 330 330 ILE ILE A . n 
E 5 53 VAL 53 331 331 VAL VAL A . n 
E 5 54 GLN 54 332 332 GLN GLN A . n 
E 5 55 PRO 55 333 333 PRO PRO A . n 
E 5 56 MET 56 334 334 MET MET A . n 
E 5 57 ILE 57 335 335 ILE ILE A . n 
E 5 58 ASP 58 336 ?   ?   ?   A . n 
F 5 1  PHE 1  279 279 PHE PHE B . n 
F 5 2  PRO 2  280 280 PRO PRO B . n 
F 5 3  LYS 3  281 281 LYS LYS B . n 
F 5 4  VAL 4  282 282 VAL VAL B . n 
F 5 5  ALA 5  283 283 ALA ALA B . n 
F 5 6  THR 6  284 284 THR THR B . n 
F 5 7  ASN 7  285 285 ASN ASN B . n 
F 5 8  ILE 8  286 286 ILE ILE B . n 
F 5 9  MET 9  287 287 MET MET B . n 
F 5 10 ARG 10 288 288 ARG ARG B . n 
F 5 11 ALA 11 289 289 ALA ALA B . n 
F 5 12 TRP 12 290 290 TRP TRP B . n 
F 5 13 LEU 13 291 291 LEU LEU B . n 
F 5 14 PHE 14 292 292 PHE PHE B . n 
F 5 15 GLN 15 293 293 GLN GLN B . n 
F 5 16 HIS 16 294 294 HIS HIS B . n 
F 5 17 LEU 17 295 295 LEU LEU B . n 
F 5 18 THR 18 296 296 THR THR B . n 
F 5 19 HIS 19 297 297 HIS HIS B . n 
F 5 20 PRO 20 298 298 PRO PRO B . n 
F 5 21 TYR 21 299 299 TYR TYR B . n 
F 5 22 PRO 22 300 300 PRO PRO B . n 
F 5 23 SER 23 301 301 SER SER B . n 
F 5 24 GLU 24 302 302 GLU GLU B . n 
F 5 25 GLU 25 303 303 GLU GLU B . n 
F 5 26 GLN 26 304 304 GLN GLN B . n 
F 5 27 LYS 27 305 305 LYS LYS B . n 
F 5 28 LYS 28 306 306 LYS LYS B . n 
F 5 29 GLN 29 307 307 GLN GLN B . n 
F 5 30 LEU 30 308 308 LEU LEU B . n 
F 5 31 ALA 31 309 309 ALA ALA B . n 
F 5 32 GLN 32 310 310 GLN GLN B . n 
F 5 33 ASP 33 311 311 ASP ASP B . n 
F 5 34 THR 34 312 312 THR THR B . n 
F 5 35 GLY 35 313 313 GLY GLY B . n 
F 5 36 LEU 36 314 314 LEU LEU B . n 
F 5 37 THR 37 315 315 THR THR B . n 
F 5 38 ILE 38 316 316 ILE ILE B . n 
F 5 39 LEU 39 317 317 LEU LEU B . n 
F 5 40 GLN 40 318 318 GLN GLN B . n 
F 5 41 VAL 41 319 319 VAL VAL B . n 
F 5 42 ASN 42 320 320 ASN ASN B . n 
F 5 43 ASN 43 321 321 ASN ASN B . n 
F 5 44 TRP 44 322 322 TRP TRP B . n 
F 5 45 PHE 45 323 323 PHE PHE B . n 
F 5 46 ILE 46 324 324 ILE ILE B . n 
F 5 47 ASN 47 325 325 ASN ASN B . n 
F 5 48 ALA 48 326 326 ALA ALA B . n 
F 5 49 ARG 49 327 327 ARG ARG B . n 
F 5 50 ARG 50 328 328 ARG ARG B . n 
F 5 51 ARG 51 329 329 ARG ARG B . n 
F 5 52 ILE 52 330 330 ILE ILE B . n 
F 5 53 VAL 53 331 331 VAL VAL B . n 
F 5 54 GLN 54 332 332 GLN GLN B . n 
F 5 55 PRO 55 333 333 PRO PRO B . n 
F 5 56 MET 56 334 334 MET MET B . n 
F 5 57 ILE 57 335 335 ILE ILE B . n 
F 5 58 ASP 58 336 336 ASP ASP B . n 
G 6 1  LYS 1  131 131 LYS LYS G . n 
G 6 2  PRO 2  132 132 PRO PRO G . n 
G 6 3  ARG 3  133 133 ARG ARG G . n 
G 6 4  THR 4  134 134 THR THR G . n 
G 6 5  ILE 5  135 135 ILE ILE G . n 
G 6 6  TYR 6  136 136 TYR TYR G . n 
G 6 7  SER 7  137 137 SER SER G . n 
G 6 8  SER 8  138 138 SER SER G . n 
G 6 9  TYR 9  139 139 TYR TYR G . n 
G 6 10 GLN 10 140 140 GLN GLN G . n 
G 6 11 LEU 11 141 141 LEU LEU G . n 
G 6 12 ALA 12 142 142 ALA ALA G . n 
G 6 13 ALA 13 143 143 ALA ALA G . n 
G 6 14 LEU 14 144 144 LEU LEU G . n 
G 6 15 GLN 15 145 145 GLN GLN G . n 
G 6 16 ARG 16 146 146 ARG ARG G . n 
G 6 17 ARG 17 147 147 ARG ARG G . n 
G 6 18 PHE 18 148 148 PHE PHE G . n 
G 6 19 GLN 19 149 149 GLN GLN G . n 
G 6 20 LYS 20 150 150 LYS LYS G . n 
G 6 21 ALA 21 151 151 ALA ALA G . n 
G 6 22 GLN 22 152 152 GLN GLN G . n 
G 6 23 TYR 23 153 153 TYR TYR G . n 
G 6 24 LEU 24 154 154 LEU LEU G . n 
G 6 25 ALA 25 155 155 ALA ALA G . n 
G 6 26 LEU 26 156 156 LEU LEU G . n 
G 6 27 PRO 27 157 157 PRO PRO G . n 
G 6 28 GLU 28 158 158 GLU GLU G . n 
G 6 29 ARG 29 159 159 ARG ARG G . n 
G 6 30 ALA 30 160 160 ALA ALA G . n 
G 6 31 GLU 31 161 161 GLU GLU G . n 
G 6 32 LEU 32 162 162 LEU LEU G . n 
G 6 33 ALA 33 163 163 ALA ALA G . n 
G 6 34 ALA 34 164 164 ALA ALA G . n 
G 6 35 GLN 35 165 165 GLN GLN G . n 
G 6 36 LEU 36 166 166 LEU LEU G . n 
G 6 37 GLY 37 167 167 GLY GLY G . n 
G 6 38 LEU 38 168 168 LEU LEU G . n 
G 6 39 THR 39 169 169 THR THR G . n 
G 6 40 GLN 40 170 170 GLN GLN G . n 
G 6 41 THR 41 171 171 THR THR G . n 
G 6 42 GLN 42 172 172 GLN GLN G . n 
G 6 43 VAL 43 173 173 VAL VAL G . n 
G 6 44 LYS 44 174 174 LYS LYS G . n 
G 6 45 ILE 45 175 175 ILE ILE G . n 
G 6 46 TRP 46 176 176 TRP TRP G . n 
G 6 47 PHE 47 177 177 PHE PHE G . n 
G 6 48 GLN 48 178 178 GLN GLN G . n 
G 6 49 ASN 49 179 179 ASN ASN G . n 
G 6 50 ARG 50 180 180 ARG ARG G . n 
G 6 51 ARG 51 181 181 ARG ARG G . n 
G 6 52 SER 52 182 182 SER SER G . n 
G 6 53 LYS 53 183 183 LYS LYS G . n 
G 6 54 PHE 54 184 184 PHE PHE G . n 
G 6 55 LYS 55 185 185 LYS LYS G . n 
G 6 56 LYS 56 186 186 LYS LYS G . n 
H 6 1  LYS 1  131 131 LYS ALA I . n 
H 6 2  PRO 2  132 132 PRO PRO I . n 
H 6 3  ARG 3  133 133 ARG ARG I . n 
H 6 4  THR 4  134 134 THR THR I . n 
H 6 5  ILE 5  135 135 ILE ILE I . n 
H 6 6  TYR 6  136 136 TYR TYR I . n 
H 6 7  SER 7  137 137 SER SER I . n 
H 6 8  SER 8  138 138 SER SER I . n 
H 6 9  TYR 9  139 139 TYR TYR I . n 
H 6 10 GLN 10 140 140 GLN GLN I . n 
H 6 11 LEU 11 141 141 LEU LEU I . n 
H 6 12 ALA 12 142 142 ALA ALA I . n 
H 6 13 ALA 13 143 143 ALA ALA I . n 
H 6 14 LEU 14 144 144 LEU LEU I . n 
H 6 15 GLN 15 145 145 GLN GLN I . n 
H 6 16 ARG 16 146 146 ARG ARG I . n 
H 6 17 ARG 17 147 147 ARG ARG I . n 
H 6 18 PHE 18 148 148 PHE PHE I . n 
H 6 19 GLN 19 149 149 GLN GLN I . n 
H 6 20 LYS 20 150 150 LYS LYS I . n 
H 6 21 ALA 21 151 151 ALA ALA I . n 
H 6 22 GLN 22 152 152 GLN GLN I . n 
H 6 23 TYR 23 153 153 TYR TYR I . n 
H 6 24 LEU 24 154 154 LEU LEU I . n 
H 6 25 ALA 25 155 155 ALA ALA I . n 
H 6 26 LEU 26 156 156 LEU LEU I . n 
H 6 27 PRO 27 157 157 PRO PRO I . n 
H 6 28 GLU 28 158 158 GLU GLU I . n 
H 6 29 ARG 29 159 159 ARG ARG I . n 
H 6 30 ALA 30 160 160 ALA ALA I . n 
H 6 31 GLU 31 161 161 GLU GLU I . n 
H 6 32 LEU 32 162 162 LEU LEU I . n 
H 6 33 ALA 33 163 163 ALA ALA I . n 
H 6 34 ALA 34 164 164 ALA ALA I . n 
H 6 35 GLN 35 165 165 GLN GLN I . n 
H 6 36 LEU 36 166 166 LEU LEU I . n 
H 6 37 GLY 37 167 167 GLY GLY I . n 
H 6 38 LEU 38 168 168 LEU LEU I . n 
H 6 39 THR 39 169 169 THR THR I . n 
H 6 40 GLN 40 170 170 GLN GLN I . n 
H 6 41 THR 41 171 171 THR THR I . n 
H 6 42 GLN 42 172 172 GLN GLN I . n 
H 6 43 VAL 43 173 173 VAL VAL I . n 
H 6 44 LYS 44 174 174 LYS LYS I . n 
H 6 45 ILE 45 175 175 ILE ILE I . n 
H 6 46 TRP 46 176 176 TRP TRP I . n 
H 6 47 PHE 47 177 177 PHE PHE I . n 
H 6 48 GLN 48 178 178 GLN GLN I . n 
H 6 49 ASN 49 179 179 ASN ASN I . n 
H 6 50 ARG 50 180 180 ARG ARG I . n 
H 6 51 ARG 51 181 181 ARG ARG I . n 
H 6 52 SER 52 182 182 SER SER I . n 
H 6 53 LYS 53 183 183 LYS LYS I . n 
H 6 54 PHE 54 184 184 PHE PHE I . n 
H 6 55 LYS 55 185 185 LYS LYS I . n 
H 6 56 LYS 56 186 186 LYS LYS I . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA Tetrameric 4 
2 software_defined_assembly PISA Tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,G 
2 1 B,C,F,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3570  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  14060 ? 
2 'ABSA (A^2)' 4260  ? 
2 MORE         -15   ? 
2 'SSA (A^2)'  14450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-04 
2 'Structure model' 1 1 2015-11-18 
3 'Structure model' 1 2 2015-12-02 
4 'Structure model' 1 3 2019-04-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Data collection'     
4 4 'Structure model' 'Source and taxonomy' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen              
2 4 'Structure model' pdbx_seq_map_depositor_info 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_host_org_cell_line'          
2 4 'Structure model' '_entity_src_gen.pdbx_host_org_variant'            
3 4 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 'phenix.refine: 1.9_1692' 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? .                         2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .                         3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15                      4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .                         5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O     A ALA 309 ? ? N   A GLY 313 ? ? 2.01 
2 1 O     I LEU 156 ? ? N   I ALA 160 ? ? 2.03 
3 1 "O3'" L DA  13  ? ? N   G LYS 131 ? ? 2.05 
4 1 O     B ALA 309 ? ? N   B GLY 313 ? ? 2.15 
5 1 O     B LYS 305 ? ? N   B ALA 309 ? ? 2.15 
6 1 O2    E DT  11  ? ? NH2 I ARG 133 ? ? 2.17 
7 1 NH2   I ARG 159 ? ? O   I GLN 170 ? ? 2.17 
8 1 OE2   A GLU 302 ? ? NZ  A LYS 305 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" M DA 26 ? ? "C1'" M DA 26 ? ? N9 M DA 26 ? ? 110.12 108.30 1.82 0.30 N 
2  1 "O4'" M DT 27 ? ? "C1'" M DT 27 ? ? N1 M DT 27 ? ? 111.00 108.30 2.70 0.30 N 
3  1 "O4'" M DC 29 ? ? "C1'" M DC 29 ? ? N1 M DC 29 ? ? 110.37 108.30 2.07 0.30 N 
4  1 "O4'" D DA 23 ? ? "C1'" D DA 23 ? ? N9 D DA 23 ? ? 110.28 108.30 1.98 0.30 N 
5  1 "O4'" D DT 24 ? ? "C1'" D DT 24 ? ? N1 D DT 24 ? ? 110.96 108.30 2.66 0.30 N 
6  1 "O4'" D DT 25 ? ? "C1'" D DT 25 ? ? N1 D DT 25 ? ? 110.72 108.30 2.42 0.30 N 
7  1 "O4'" D DT 27 ? ? "C1'" D DT 27 ? ? N1 D DT 27 ? ? 110.36 108.30 2.06 0.30 N 
8  1 "O4'" D DC 29 ? ? "C1'" D DC 29 ? ? N1 D DC 29 ? ? 110.66 108.30 2.36 0.30 N 
9  1 "O4'" D DC 33 ? ? "C1'" D DC 33 ? ? N1 D DC 33 ? ? 112.40 108.30 4.10 0.30 N 
10 1 "O4'" E DG 1  ? ? "C1'" E DG 1  ? ? N9 E DG 1  ? ? 110.74 108.30 2.44 0.30 N 
11 1 "O4'" E DT 3  ? ? "C1'" E DT 3  ? ? N1 E DT 3  ? ? 110.56 108.30 2.26 0.30 N 
12 1 "O4'" E DC 6  ? ? "C1'" E DC 6  ? ? N1 E DC 6  ? ? 110.91 108.30 2.61 0.30 N 
13 1 "O4'" L DT 3  ? ? "C1'" L DT 3  ? ? N1 L DT 3  ? ? 111.17 108.30 2.87 0.30 N 
14 1 "O4'" L DC 6  ? ? "C1'" L DC 6  ? ? N1 L DC 6  ? ? 110.26 108.30 1.96 0.30 N 
15 1 "O4'" L DT 15 ? ? "C1'" L DT 15 ? ? N1 L DT 15 ? ? 111.78 108.30 3.48 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 284 ? ? -125.34 -59.38  
2  1 PRO A 298 ? ? -64.24  67.77   
3  1 ALA A 309 ? ? -70.29  -87.32  
4  1 LEU A 314 ? ? 71.01   176.62  
5  1 ALA A 326 ? ? -147.62 -3.86   
6  1 VAL A 331 ? ? 60.20   -46.80  
7  1 LYS B 281 ? ? 59.73   -156.34 
8  1 THR B 312 ? ? -140.53 -8.81   
9  1 ARG B 327 ? ? -68.25  60.29   
10 1 ARG B 328 ? ? -161.48 -77.83  
11 1 PRO G 132 ? ? -72.05  -160.77 
12 1 THR G 134 ? ? 56.30   96.66   
13 1 SER G 137 ? ? -152.36 19.00   
14 1 SER G 138 ? ? -73.59  -103.18 
15 1 TYR G 139 ? ? -162.34 89.80   
16 1 GLN G 140 ? ? 86.52   -80.76  
17 1 LEU G 141 ? ? -75.59  -79.59  
18 1 ALA G 155 ? ? -111.67 -155.88 
19 1 ALA G 160 ? ? -59.22  -80.46  
20 1 ALA G 163 ? ? -150.10 -33.32  
21 1 VAL G 173 ? ? -141.50 -1.14   
22 1 PHE G 184 ? ? 48.93   -107.85 
23 1 THR I 134 ? ? 70.24   143.03  
24 1 GLN I 140 ? ? 76.46   -56.63  
25 1 LEU I 141 ? ? -66.76  -77.39  
26 1 ARG I 147 ? ? 76.67   -39.49  
27 1 LYS I 150 ? ? -79.84  -125.59 
28 1 LEU I 154 ? ? -135.20 -151.13 
29 1 LEU I 166 ? ? 72.96   -71.56  
30 1 LEU I 168 ? ? -137.63 -150.39 
31 1 VAL I 173 ? ? -132.14 -55.20  
32 1 PHE I 177 ? ? -49.74  -73.28  
33 1 PHE I 184 ? ? -175.88 139.93  
34 1 LYS I 185 ? ? 52.55   -110.40 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ARG B 328 ? ? ARG B 329 ? ? -140.67 
2 1 ARG G 181 ? ? SER G 182 ? ? 148.82  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 I LYS 131 ? CG ? H LYS 1 CG 
2 1 Y 1 I LYS 131 ? CD ? H LYS 1 CD 
3 1 Y 1 I LYS 131 ? CE ? H LYS 1 CE 
4 1 Y 1 I LYS 131 ? NZ ? H LYS 1 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 L DG  1   ? D DG  1  
2 1 Y 1 A PHE 279 ? E PHE 1  
3 1 Y 1 A ASP 336 ? E ASP 58 
# 
_ndb_struct_conf_na.entry_id   4XRS 
_ndb_struct_conf_na.feature    'double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 2  1_555 D DT 15 1_555 1.064  -3.271 -0.528 -63.530 0.705   134.965  1 M_DA22:DT15_L M 22 ? L 15 ? ?  ? 
1 A DT 4  1_555 D DA 13 1_555 -0.719 -0.115 0.855  60.599  9.980   -138.411 2 M_DT24:DA13_L M 24 ? L 13 ? ?  ? 
1 A DT 7  1_555 D DA 10 1_555 0.363  -0.542 -0.439 6.795   -52.408 -5.846   3 M_DT27:DA10_L M 27 ? L 10 ? 20 1 
1 A DC 8  1_555 D DG 9  1_555 -0.479 0.822  -1.692 24.196  -57.986 -34.459  4 M_DC28:DG9_L  M 28 ? L 9  ? ?  ? 
1 A DT 10 1_555 D DC 6  1_555 -0.511 2.175  -0.919 -8.172  -23.735 -88.581  5 M_DT30:DC6_L  M 30 ? L 6  ? ?  ? 
1 B DA 3  1_555 C DG 16 1_555 1.015  0.488  -1.971 -0.184  -17.194 -12.105  6 D_DA22:DG16_E D 22 ? E 16 ? 8  1 
1 B DC 9  1_555 C DG 9  1_555 0.350  -0.688 0.790  9.571   -37.473 -16.182  7 D_DC28:DG9_E  D 28 ? E 9  ? 19 1 
1 B DT 11 1_555 C DC 6  1_555 -1.037 1.900  -0.014 26.487  -14.458 -81.132  8 D_DT30:DC6_E  D 30 ? E 6  ? ?  ? 
1 B DA 16 1_555 C DG 1  1_555 -3.294 1.311  -1.148 -14.651 -2.565  -24.121  9 D_DA35:DG1_E  D 35 ? E 1  ? ?  ? 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 7 1_555 D DA 10 1_555 A DC 8  1_555 D DG 9 1_555 -0.807 -0.637 2.743 4.084 1.632  24.867 -1.845 2.815  2.533 3.751  -9.390 
25.247 1 MM_DT27DC28:DG9DA10_LL M 27 ? L 10 ? M 28 ? L 9 ? 
1 B DC 9 1_555 C DG 9  1_555 B DT 11 1_555 C DC 6 1_555 0.397  -3.007 6.566 5.030 -7.701 86.787 -1.838 -0.064 6.773 -5.591 -3.652 
87.177 2 DD_DC28DT30:DC6DG9_EE  D 28 ? E 9  ? D 30 ? E 6 ? 
# 
_pdbx_reflns_twin.domain_id                    1 
_pdbx_reflns_twin.crystal_id                   1 
_pdbx_reflns_twin.diffrn_id                    1 
_pdbx_reflns_twin.fraction                     0.080 
_pdbx_reflns_twin.operator                     k,h,-l 
_pdbx_reflns_twin.type                         ? 
_pdbx_reflns_twin.mean_F_square_over_mean_F2   ? 
_pdbx_reflns_twin.mean_I2_over_mean_I_square   ? 
#