data_4XUJ
# 
_entry.id   4XUJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4XUJ         
WWPDB D_1000206273 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4XUJ 
_pdbx_database_status.recvd_initial_deposition_date   2015-01-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Adhireksan, Z.' 1 
'Davey, C.A.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
;Contrasting Cytotoxicity and Reactivity of RuII-Arene Complexes of Morpholine vs Thiomorpholine Substituted 3-Hydroxy-2-pyridone Ligands
;
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hanif, M.'       1  
primary 'Meier, S.M.'     2  
primary 'Adhireksan, Z.'  3  
primary 'Henke, H.'       4  
primary 'Martic, S.'      5  
primary 'Labib, M.'       6  
primary 'Kandioller, W.'  7  
primary 'Jakupec, M.A.'   8  
primary 'Kraatz, H.B.'    9  
primary 'Davey, C.A.'     10 
primary 'Keppler, B.K.'   11 
primary 'Hartinger, C.G.' 12 
# 
_cell.entry_id           4XUJ 
_cell.length_a           106.426 
_cell.length_b           109.754 
_cell.length_c           181.277 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4XUJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2'                                                 15303.930 2 ? ? 'UNP residues 2-136' ? 
2  polymer     man 'Histone H4'                                                   11263.231 2 ? ? 'UNP residues 2-103' ? 
3  polymer     man 'Histone H2A'                                                  13907.163 2 ? ? 'UNP residues 2-126' ? 
4  polymer     man 'Histone H2B 1.1'                                              13848.097 2 ? ? 'UNP residues 2-126' ? 
5  polymer     syn 'DNA (145-MER)'                                                44749.664 1 ? ? ?                    ? 
6  polymer     syn 'DNA (145-MER)'                                                44740.648 1 ? ? ?                    ? 
7  non-polymer syn 'SULFATE ION'                                                  96.063    3 ? ? ?                    ? 
8  non-polymer syn '[(1,2,3,4,5,6-eta)-1-methyl-4-(propan-2-yl)benzene]ruthenium' 235.288   3 ? ? ?                    ? 
9  non-polymer syn 'MAGNESIUM ION'                                                24.305    1 ? ? ?                    ? 
10 water       nat water                                                          18.015    1 ? ? ?                    ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 LYS n 
3 127 SER n 
3 128 LYS n 
4 1   PRO n 
4 2   GLU n 
4 3   PRO n 
4 4   ALA n 
4 5   LYS n 
4 6   SER n 
4 7   ALA n 
4 8   PRO n 
4 9   ALA n 
4 10  PRO n 
4 11  LYS n 
4 12  LYS n 
4 13  GLY n 
4 14  SER n 
4 15  LYS n 
4 16  LYS n 
4 17  ALA n 
4 18  VAL n 
4 19  THR n 
4 20  LYS n 
4 21  THR n 
4 22  GLN n 
4 23  LYS n 
4 24  LYS n 
4 25  ASP n 
4 26  GLY n 
4 27  LYS n 
4 28  LYS n 
4 29  ARG n 
4 30  ARG n 
4 31  LYS n 
4 32  THR n 
4 33  ARG n 
4 34  LYS n 
4 35  GLU n 
4 36  SER n 
4 37  TYR n 
4 38  ALA n 
4 39  ILE n 
4 40  TYR n 
4 41  VAL n 
4 42  TYR n 
4 43  LYS n 
4 44  VAL n 
4 45  LEU n 
4 46  LYS n 
4 47  GLN n 
4 48  VAL n 
4 49  HIS n 
4 50  PRO n 
4 51  ASP n 
4 52  THR n 
4 53  GLY n 
4 54  ILE n 
4 55  SER n 
4 56  SER n 
4 57  LYS n 
4 58  ALA n 
4 59  MET n 
4 60  SER n 
4 61  ILE n 
4 62  MET n 
4 63  ASN n 
4 64  SER n 
4 65  PHE n 
4 66  VAL n 
4 67  ASN n 
4 68  ASP n 
4 69  VAL n 
4 70  PHE n 
4 71  GLU n 
4 72  ARG n 
4 73  ILE n 
4 74  ALA n 
4 75  GLY n 
4 76  GLU n 
4 77  ALA n 
4 78  SER n 
4 79  ARG n 
4 80  LEU n 
4 81  ALA n 
4 82  HIS n 
4 83  TYR n 
4 84  ASN n 
4 85  LYS n 
4 86  ARG n 
4 87  SER n 
4 88  THR n 
4 89  ILE n 
4 90  THR n 
4 91  SER n 
4 92  ARG n 
4 93  GLU n 
4 94  ILE n 
4 95  GLN n 
4 96  THR n 
4 97  ALA n 
4 98  VAL n 
4 99  ARG n 
4 100 LEU n 
4 101 LEU n 
4 102 LEU n 
4 103 PRO n 
4 104 GLY n 
4 105 GLU n 
4 106 LEU n 
4 107 ALA n 
4 108 LYS n 
4 109 HIS n 
4 110 ALA n 
4 111 VAL n 
4 112 SER n 
4 113 GLU n 
4 114 GLY n 
4 115 THR n 
4 116 LYS n 
4 117 ALA n 
4 118 VAL n 
4 119 THR n 
4 120 LYS n 
4 121 TYR n 
4 122 THR n 
4 123 SER n 
4 124 ALA n 
4 125 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 128 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 125 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 145 'synthetic construct' ? 32630 ? 
6 1 sample 1 145 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA    P84233 ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
2 UNP H4_XENLA     P62799 ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
4 UNP H2B11_XENLA  P02281 ? 4 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
2 
5 PDB 4XUJ         4XUJ   ? 5 ? 1 
6 PDB 4XUJ         4XUJ   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4XUJ A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 4XUJ B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 4XUJ C 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
4  4 4XUJ D 1 ? 125 ? P02281 2   ? 126 ? -2  122 
5  1 4XUJ E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 4XUJ F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 4XUJ G 1 ? 128 ? Q6AZJ8 2   ? 130 ? 1   128 
8  4 4XUJ H 1 ? 125 ? P02281 2   ? 126 ? -2  122 
9  5 4XUJ I 1 ? 145 ? 4XUJ   -72 ? 72  ? -72 72  
10 6 4XUJ J 1 ? 145 ? 4XUJ   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4XUJ ALA A 102 ? UNP P84233 GLY 103 variant 102 1 
4 4XUJ THR D 32  ? UNP P02281 SER 33  variant 29  2 
5 4XUJ ALA E 102 ? UNP P84233 GLY 103 variant 102 3 
8 4XUJ THR H 32  ? UNP P02281 SER 33  variant 29  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4A6 non-polymer         . '[(1,2,3,4,5,6-eta)-1-methyl-4-(propan-2-yl)benzene]ruthenium' ? 'C10 H14 Ru'      235.288 
ALA 'L-peptide linking' y ALANINE                                                        ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                       ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                     ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                       ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                           ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                            ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                           ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                   ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                      ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                        ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                      ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                          ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                     ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                        ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                         ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                     ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                  ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                        ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                         ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                                  ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                      ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                                                       ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                         ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4XUJ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.63 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.21 
_exptl_crystal.description                 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS.' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '40mM MnCl2, 30mM KCl, 20mM K-Cacodylate' 
_exptl_crystal_grow.pdbx_pH_range   6.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-08-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Bartels Monochromator' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.50 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.50 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4XUJ 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             93.890 
_reflns.d_resolution_high            3.180 
_reflns.number_obs                   35645 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.2 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.5 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.498 
_reflns_shell.d_res_high                  3.18 
_reflns_shell.d_res_low                   3.36 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         3.4 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             5.2 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        89.2 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4XUJ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     33808 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             93.89 
_refine.ls_d_res_high                            3.18 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.265 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.263 
_refine.ls_R_factor_R_free                       0.299 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1783 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.911 
_refine.correlation_coeff_Fo_to_Fc_free          0.898 
_refine.B_iso_mean                               105.18 
_refine.aniso_B[1][1]                            1.53000 
_refine.aniso_B[2][2]                            -4.63000 
_refine.aniso_B[3][3]                            3.11000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS, SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' 
_refine.pdbx_starting_model                      3REH 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.514 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             29.555 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         49 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               12075 
_refine_hist.d_res_high                       3.18 
_refine_hist.d_res_low                        93.89 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.006  0.021  ? 12889 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.346  2.547  ? 18710 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       4.612  5.000  ? 757   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       33.190 21.255 ? 271   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       16.883 15.000 ? 1183  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.061 15.000 ? 86    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.132  0.200  ? 2122  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 7675  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.424  1.500  ? 3797  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.790  2.000  ? 6110  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.791  3.000  ? 9092  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 1.417  4.500  ? 12528 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3.18 
_refine_ls_shell.d_res_low                        3.27 
_refine_ls_shell.number_reflns_R_work             2043 
_refine_ls_shell.R_factor_R_work                  0.3510 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.3390 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             108 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4XUJ 
_struct.title                        
;Nucleosome core particle containing adducts from treatment with a thiomorpholine-substituted [(eta-6-p-cymene)Ru(3-hydroxy-2-pyridone)Cl] compound
;
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4XUJ 
_struct_keywords.text            'nucleosome, ruthenium agent, DNA-BINDIG PROTEIN-DNA complex, DNA-BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA-BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 7  ? 
O N N 7  ? 
P N N 8  ? 
Q N N 8  ? 
R N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 120 ? GLY A 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 ALA C 45  ? ASN C 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE C 79  ? ASN C 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 AB4 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 37  ? HIS D 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 55  ? TYR D 83  ? SER D 52  TYR D 80  1 ? 29 
HELX_P HELX_P17 AB8 THR D 90  ? LEU D 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO D 103 ? SER D 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 AC1 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 63  ? LYS E 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 AD1 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 AD4 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 TYR H 37  ? HIS H 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P33 AD6 SER H 55  ? ASN H 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P34 AD7 THR H 90  ? LEU H 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P35 AD8 PRO H 103 ? SER H 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E ASP 77  OD1 ? ? ? 1_555 M MG  .   MG ? ? E ASP 77  E MG  1001 1_555 ? ? ? ? ? ? ?               2.293 ? 
metalc2   metalc ? ? H HIS 109 NE2 ? ? ? 1_555 P 4A6 .   RU ? ? H HIS 106 H 4A6 202  1_555 ? ? ? ? ? ? ?               2.177 ? 
metalc3   metalc ? ? P 4A6 .   RU  ? ? ? 1_555 R HOH .   O  ? ? H 4A6 202 H HOH 301  1_555 ? ? ? ? ? ? ?               2.303 ? 
metalc4   metalc ? ? D VAL 48  O   ? ? ? 1_555 M MG  .   MG ? ? D VAL 45  E MG  1001 3_555 ? ? ? ? ? ? ?               2.040 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT  145 N3 ? ? I DA  -72 J DT  72   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog2   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA  144 N1 ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA  144 N6 ? ? I DT  -71 J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG  143 O6 ? ? I DC  -70 J DG  70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog5   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J DT  142 N3 ? ? I DA  -69 J DT  69   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog6   hydrog ? ? I DA  5   N1  ? ? ? 1_555 J DT  141 N3 ? ? I DA  -68 J DT  68   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog7   hydrog ? ? I DT  6   N3  ? ? ? 1_555 J DA  140 N1 ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DT  6   O4  ? ? ? 1_555 J DA  140 N6 ? ? I DT  -67 J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  7   N1  ? ? ? 1_555 J DT  139 N3 ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J DT  139 O4 ? ? I DA  -66 J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J DA  138 N1 ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J DA  138 N6 ? ? I DT  -65 J DA  65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DC  9   N3  ? ? ? 1_555 J DG  137 N1 ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DC  9   N4  ? ? ? 1_555 J DG  137 O6 ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J DG  137 N2 ? ? I DC  -64 J DG  64   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DC  10  N3  ? ? ? 1_555 J DG  136 N1 ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DC  10  N4  ? ? ? 1_555 J DG  136 O6 ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J DG  136 N2 ? ? I DC  -63 J DG  63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J DT  135 N3 ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J DT  135 O4 ? ? I DA  -62 J DT  62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  13  N3  ? ? ? 1_555 J DG  133 N1 ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  13  N4  ? ? ? 1_555 J DG  133 O6 ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J DG  133 N2 ? ? I DC  -60 J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DT  14  N3  ? ? ? 1_555 J DA  132 N1 ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DT  14  O4  ? ? ? 1_555 J DA  132 N6 ? ? I DT  -59 J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J DC  131 N3 ? ? I DG  -58 J DC  58   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog27  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG  130 O6 ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog28  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG  130 N1 ? ? I DC  -57 J DG  57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog29  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J DT  129 N3 ? ? I DA  -56 J DT  56   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog30  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC  128 N3 ? ? I DG  -55 J DC  55   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog31  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J DA  126 N1 ? ? I DT  -53 J DA  53   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog32  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DG  124 O6 ? ? I DA  -52 J DG  51   1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog33  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT  125 N3 ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT  125 O4 ? ? I DA  -52 J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG  124 N1 ? ? I DC  -51 J DG  51   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog36  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J DA  123 N1 ? ? I DT  -50 J DA  50   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog37  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DG  121 N1 ? ? I DA  -49 J DG  48   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog38  hydrog ? ? I DA  24  N6  ? ? ? 1_555 J DG  121 O6 ? ? I DA  -49 J DG  48   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog39  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J DT  122 N3 ? ? I DA  -49 J DT  49   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog40  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J DG  120 O6 ? ? I DC  -48 J DG  47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog41  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J DG  121 N2 ? ? I DC  -48 J DG  48   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog42  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J DG  120 N1 ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DG  120 O6 ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG  120 N2 ? ? I DC  -47 J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J DT  119 N3 ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J DT  119 O4 ? ? I DA  -46 J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J DT  118 N3 ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J DT  118 O4 ? ? I DA  -45 J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J DT  117 N3 ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J DT  117 O4 ? ? I DA  -44 J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J DC  115 O2 ? ? I DG  -42 J DC  42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog52  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J DA  114 N1 ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J DA  114 N6 ? ? I DT  -41 J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J DC  113 O2 ? ? I DG  -40 J DC  40   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog55  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J DA  112 N1 ? ? I DT  -39 J DA  39   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog56  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J DT  111 N3 ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J DT  111 O4 ? ? I DA  -38 J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J DA  109 N6 ? ? I DT  -37 J DA  36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog59  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J DA  110 N1 ? ? I DT  -37 J DA  37   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog60  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  108 N6 ? ? I DT  -36 J DA  35   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog61  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J DA  109 N1 ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J DA  109 N6 ? ? I DT  -36 J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DC  107 N3 ? ? I DT  -35 J DC  34   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog64  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DC  107 N4 ? ? I DT  -35 J DC  34   1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog65  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J DA  108 N1 ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DT  38  O4  ? ? ? 1_555 J DA  108 N6 ? ? I DT  -35 J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  106 N4 ? ? I DG  -34 J DC  33   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog68  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC  107 N3 ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC  107 O2 ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC  107 N4 ? ? I DG  -34 J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J DC  106 N3 ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J DC  106 O2 ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J DC  106 N4 ? ? I DG  -33 J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J DT  105 N3 ? ? I DA  -32 J DT  32   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog75  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J DT  104 N3 ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J DT  104 O4 ? ? I DA  -31 J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT  103 N3 ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT  103 O4 ? ? I DA  -30 J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DC  44  N3  ? ? ? 1_555 J DG  102 N1 ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DC  44  N4  ? ? ? 1_555 J DG  102 O6 ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J DG  102 N2 ? ? I DC  -29 J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA  101 N1 ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA  101 N6 ? ? I DT  -28 J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J DC  100 N3 ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J DC  100 O2 ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J DC  100 N4 ? ? I DG  -27 J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG  99  N1 ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG  99  O6 ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG  99  N2 ? ? I DC  -26 J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J DA  98  N1 ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J DA  98  N6 ? ? I DT  -25 J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG  97  N1 ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG  97  O6 ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG  97  N2 ? ? I DC  -24 J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  50  N3  ? ? ? 1_555 J DG  96  N1 ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DC  50  N4  ? ? ? 1_555 J DG  96  O6 ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  50  O2  ? ? ? 1_555 J DG  96  N2 ? ? I DC  -23 J DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DA  51  N1  ? ? ? 1_555 J DT  95  N3 ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DA  51  N6  ? ? ? 1_555 J DT  95  O4 ? ? I DA  -22 J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J DA  94  N1 ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J DA  94  N6 ? ? I DT  -21 J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J DG  93  N1 ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J DG  93  O6 ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J DG  93  N2 ? ? I DC  -20 J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J DT  92  N3 ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J DT  92  O4 ? ? I DA  -19 J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J DT  91  N3 ? ? I DA  -18 J DT  18   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog108 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  89  O4 ? ? I DA  -17 J DT  16   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog109 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J DT  90  N3 ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J DT  90  O4 ? ? I DA  -17 J DT  17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J DT  89  N3 ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J DT  89  O4 ? ? I DA  -16 J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J DC  88  N3 ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J DC  88  O2 ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J DC  88  N4 ? ? I DG  -15 J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J DC  87  N3 ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J DC  87  O2 ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J DC  87  N4 ? ? I DG  -14 J DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J DG  86  N2 ? ? I DC  -13 J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog120 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT  85  N3 ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT  85  O4 ? ? I DA  -12 J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J DA  84  N1 ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J DA  84  N6 ? ? I DT  -11 J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J DC  83  N3 ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J DC  83  O2 ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J DC  83  N4 ? ? I DG  -10 J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J DA  82  N1 ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J DA  82  N6 ? ? I DT  -9  J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J DA  81  N1 ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J DA  81  N6 ? ? I DT  -8  J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J DT  79  N3 ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J DT  79  O4 ? ? I DA  -6  J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC  78  N3 ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC  78  O2 ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC  78  N4 ? ? I DG  -5  J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J DG  77  N1 ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J DG  77  O6 ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J DG  77  N2 ? ? I DC  -4  J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J DA  76  N1 ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J DA  76  N6 ? ? I DT  -3  J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J DC  75  N3 ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J DC  75  O2 ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J DC  75  N4 ? ? I DG  -2  J DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J DT  74  N3 ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J DT  74  O4 ? ? I DA  -1  J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT  73  N3 ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT  73  O4 ? ? I DA  0   J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J DA  72  N1 ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J DA  72  N6 ? ? I DT  1   J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG  71  N1 ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG  71  O6 ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG  71  N2 ? ? I DC  2   J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J DT  70  N3 ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J DT  70  O4 ? ? I DA  3   J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J DC  69  N3 ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J DC  69  O2 ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J DC  69  N4 ? ? I DG  4   J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J DG  68  N1 ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J DG  68  O6 ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J DG  68  N2 ? ? I DC  5   J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA  67  N1 ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA  67  N6 ? ? I DT  6   J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J DC  66  N3 ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J DC  66  O2 ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J DC  66  N4 ? ? I DG  7   J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J DT  65  N3 ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J DT  65  O4 ? ? I DA  8   J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J DT  64  N3 ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J DT  64  O4 ? ? I DA  9   J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J DG  63  N1 ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J DG  63  O6 ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J DG  63  N2 ? ? I DC  10  J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J DT  62  N3 ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J DT  62  O4 ? ? I DA  11  J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J DA  61  N1 ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J DA  61  N6 ? ? I DT  12  J DA  -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC  60  N3 ? ? I DG  13  J DC  -13  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog178 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J DG  59  N1 ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J DG  59  O6 ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J DG  59  N2 ? ? I DC  14  J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J DG  58  N1 ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J DG  58  O6 ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J DG  58  N2 ? ? I DC  15  J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA  57  N1 ? ? I DT  16  J DA  -16  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog185 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J DA  56  N1 ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DT  90  O4  ? ? ? 1_555 J DA  56  N6 ? ? I DT  17  J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J DA  55  N1 ? ? I DT  18  J DA  -18  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog188 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J DA  54  N1 ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J DA  54  N6 ? ? I DT  19  J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DA  94  N1  ? ? ? 1_555 J DT  52  N3 ? ? I DA  21  J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DA  94  N6  ? ? ? 1_555 J DT  52  O4 ? ? I DA  21  J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J DA  51  N1 ? ? I DT  22  J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DT  95  O4  ? ? ? 1_555 J DA  51  N6 ? ? I DT  22  J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DG  96  N1  ? ? ? 1_555 J DC  50  N3 ? ? I DG  23  J DC  -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog195 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC  49  N3 ? ? I DG  24  J DC  -24  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog196 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DC  47  N3 ? ? I DA  25  J DC  -26  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog197 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J DT  48  N3 ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J DT  48  O4 ? ? I DA  25  J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J DC  47  N3 ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J DC  47  O2 ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J DC  47  N4 ? ? I DG  26  J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J DG  46  N2 ? ? I DC  27  J DG  -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog203 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J DT  45  N3 ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DA  101 N6  ? ? ? 1_555 J DT  45  O4 ? ? I DA  28  J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DC  44  O2 ? ? I DG  29  J DC  -29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog206 hydrog ? ? I DG  102 N2  ? ? ? 1_555 J DT  45  O2 ? ? I DG  29  J DT  -28  1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog207 hydrog ? ? I DT  103 N3  ? ? ? 1_555 J DA  43  N1 ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DT  103 O4  ? ? ? 1_555 J DA  43  N6 ? ? I DT  30  J DA  -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J DA  42  N1 ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J DA  42  N6 ? ? I DT  31  J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA  41  N1 ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA  41  N6 ? ? I DT  32  J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J DG  40  N2 ? ? I DC  33  J DG  -33  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog214 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J DG  39  N1 ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J DG  39  O6 ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J DG  39  N2 ? ? I DC  34  J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J DT  38  N3 ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J DT  38  O4 ? ? I DA  35  J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT  36  O4 ? ? I DA  36  J DT  -37  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog220 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J DT  37  N3 ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J DT  37  O4 ? ? I DA  36  J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT  36  N3 ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT  36  O4 ? ? I DA  37  J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J DA  35  N1 ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J DA  35  N6 ? ? I DT  38  J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J DT  34  N3 ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J DT  34  O4 ? ? I DA  39  J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J DG  33  N1 ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J DG  33  O6 ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J DG  33  N2 ? ? I DC  40  J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J DT  32  N3 ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J DT  32  O4 ? ? I DA  41  J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG  31  N1 ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG  31  O6 ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG  31  N2 ? ? I DC  42  J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J DA  29  N1 ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J DA  29  N6 ? ? I DT  44  J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA  28  N1 ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA  28  N6 ? ? I DT  45  J DA  -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC  25  N4 ? ? I DG  47  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog241 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J DA  24  N6 ? ? I DG  48  J DA  -49  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog242 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J DC  25  O2 ? ? I DG  48  J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog243 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J DT  23  N3 ? ? I DA  50  J DT  -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog244 hydrog ? ? I DT  125 N3  ? ? ? 1_555 J DA  21  N1 ? ? I DT  52  J DA  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  125 O4  ? ? ? 1_555 J DA  21  N6 ? ? I DT  52  J DA  -52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J DA  19  N1 ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J DA  19  N6 ? ? I DT  54  J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J DG  18  N1 ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J DG  18  O6 ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J DG  18  N2 ? ? I DC  55  J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J DA  17  N1 ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J DA  17  N6 ? ? I DT  56  J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC  16  N3 ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC  16  O2 ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC  16  N4 ? ? I DG  57  J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J DG  15  N2 ? ? I DC  58  J DG  -58  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog257 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J DT  14  N3 ? ? I DA  59  J DT  -59  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog258 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J DC  13  N3 ? ? I DG  60  J DC  -60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog259 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J DC  12  N3 ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J DC  12  O2 ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J DC  12  N4 ? ? I DG  61  J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J DA  11  N1 ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J DA  11  N6 ? ? I DT  62  J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC  10  N3 ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC  10  O2 ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC  10  N4 ? ? I DG  63  J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC  9   N3 ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC  9   O2 ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC  9   N4 ? ? I DG  64  J DC  -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J DT  8   N3 ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J DT  8   O4 ? ? I DA  65  J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J DA  7   N1 ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J DA  7   N6 ? ? I DT  66  J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J DT  6   N3 ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J DT  6   O4 ? ? I DA  67  J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA  5   N1 ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA  5   N6 ? ? I DT  68  J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J DA  4   N1 ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J DA  4   N6 ? ? I DT  69  J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J DC  3   N3 ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J DC  3   O2 ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J DC  3   N4 ? ? I DG  70  J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J DT  2   N3 ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J DT  2   O4 ? ? I DA  71  J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J DA  1   N1 ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J DA  1   N6 ? ? I DT  72  J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
AA1 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
AA2 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA2 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA3 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA3 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 88  ? ILE D 89  ? THR D 85  ILE D 86  
AA5 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
AA5 2 GLY D 53  ? ILE D 54  ? GLY D 50  ILE D 51  
AA6 1 THR C 101 ? ILE C 102 ? THR C 101 ILE C 102 
AA6 2 LEU F 97  ? TYR F 98  ? LEU F 97  TYR F 98  
AA7 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA7 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA8 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA8 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA9 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA9 2 THR H 88  ? ILE H 89  ? THR H 85  ILE H 86  
AB1 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AB1 2 GLY H 53  ? ILE H 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
AA2 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA3 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 89  ? O ILE D 86  
AA5 1 2 N ILE C 78  ? N ILE C 78  O GLY D 53  ? O GLY D 50  
AA6 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
AA7 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA8 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA9 1 2 N ARG G 42  ? N ARG G 42  O ILE H 89  ? O ILE H 86  
AB1 1 2 N ILE G 78  ? N ILE G 78  O GLY H 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software C SO4 1101 ? 6 'binding site for residue SO4 C 1101' 
AC2 Software D 4A6 201  ? 1 'binding site for residue 4A6 D 201'  
AC3 Software E MG  1001 ? 2 'binding site for residue MG E 1001'  
AC4 Software G SO4 201  ? 6 'binding site for residue SO4 G 201'  
AC5 Software H SO4 201  ? 4 'binding site for residue SO4 H 201'  
AC6 Software H 4A6 202  ? 3 'binding site for residue 4A6 H 202'  
AC7 Software H 4A6 203  ? 2 'binding site for residue 4A6 H 203'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLY C 44  ? GLY C 44  . ? 1_555 ? 
2  AC1 6 ALA C 45  ? ALA C 45  . ? 1_555 ? 
3  AC1 6 GLY C 46  ? GLY C 46  . ? 1_555 ? 
4  AC1 6 ALA C 47  ? ALA C 47  . ? 1_555 ? 
5  AC1 6 THR D 90  ? THR D 87  . ? 1_555 ? 
6  AC1 6 SER D 91  ? SER D 88  . ? 1_555 ? 
7  AC2 1 HIS D 82  ? HIS D 79  . ? 1_555 ? 
8  AC3 2 VAL D 48  ? VAL D 45  . ? 3_545 ? 
9  AC3 2 ASP E 77  ? ASP E 77  . ? 1_555 ? 
10 AC4 6 GLY G 44  ? GLY G 44  . ? 1_555 ? 
11 AC4 6 ALA G 45  ? ALA G 45  . ? 1_555 ? 
12 AC4 6 GLY G 46  ? GLY G 46  . ? 1_555 ? 
13 AC4 6 ALA G 47  ? ALA G 47  . ? 1_555 ? 
14 AC4 6 THR H 90  ? THR H 87  . ? 1_555 ? 
15 AC4 6 SER H 91  ? SER H 88  . ? 1_555 ? 
16 AC5 4 HIS H 49  ? HIS H 46  . ? 1_555 ? 
17 AC5 4 PRO H 50  ? PRO H 47  . ? 1_555 ? 
18 AC5 4 ASP H 51  ? ASP H 48  . ? 1_555 ? 
19 AC5 4 THR H 52  ? THR H 49  . ? 1_555 ? 
20 AC6 3 GLU H 105 ? GLU H 102 . ? 1_555 ? 
21 AC6 3 HIS H 109 ? HIS H 106 . ? 1_555 ? 
22 AC6 3 HOH R .   ? HOH H 301 . ? 1_555 ? 
23 AC7 2 TYR C 39  ? TYR C 39  . ? 1_555 ? 
24 AC7 2 HIS H 82  ? HIS H 79  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4XUJ 
_atom_sites.fract_transf_matrix[1][1]   0.009396 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009111 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005516 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
RU 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A 1  38  ? -60.605 -29.663 80.927 1.00 109.96 ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A 1  38  ? -59.514 -28.891 80.322 1.00 109.81 ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A 1  38  ? -58.314 -29.760 79.915 1.00 109.54 ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A 1  38  ? -57.954 -30.708 80.625 1.00 109.47 ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A 1  38  ? -59.125 -27.885 81.422 1.00 109.92 ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A 1  38  ? -59.837 -28.351 82.700 1.00 110.10 ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A 1  38  ? -60.560 -29.640 82.400 1.00 109.97 ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A 1  39  ? -57.707 -29.419 78.778 1.00 109.21 ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A 1  39  ? -56.654 -30.235 78.163 1.00 108.71 ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A 1  39  ? -55.556 -29.373 77.540 1.00 107.92 ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A 1  39  ? -55.838 -28.423 76.796 1.00 107.86 ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A 1  39  ? -57.258 -31.169 77.105 1.00 109.03 ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A 1  39  ? -56.265 -32.089 76.466 1.00 109.77 ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A 1  39  ? -55.731 -31.856 75.216 1.00 110.41 ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A 1  39  ? -55.711 -33.245 76.903 1.00 110.51 ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A 1  39  ? -54.893 -32.830 74.910 1.00 110.79 ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A 1  39  ? -54.862 -33.686 75.916 1.00 110.96 ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A 1  40  ? -54.307 -29.725 77.839 1.00 106.82 ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A 1  40  ? -53.151 -28.955 77.386 1.00 105.62 ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A 1  40  ? -51.969 -29.855 77.006 1.00 104.75 ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A 1  40  ? -51.583 -30.756 77.767 1.00 104.76 ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A 1  40  ? -52.732 -27.956 78.468 1.00 105.58 ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A 1  40  ? -51.831 -26.837 77.983 1.00 105.45 ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A 1  40  ? -51.509 -25.901 79.130 1.00 105.42 ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A 1  40  ? -50.751 -24.722 78.715 1.00 104.98 ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A 1  40  ? -51.288 -23.597 78.246 1.00 104.84 ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A 1  40  ? -52.603 -23.471 78.103 1.00 104.67 ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A 1  40  ? -50.500 -22.588 77.912 1.00 104.76 ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A 1  41  ? -51.406 -29.603 75.825 1.00 103.40 ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A 1  41  ? -50.202 -30.292 75.378 1.00 102.00 ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A 1  41  ? -48.964 -29.612 75.954 1.00 101.12 ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A 1  41  ? -48.971 -28.405 76.213 1.00 100.95 ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A 1  41  ? -50.131 -30.336 73.846 1.00 102.02 ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A 1  41  ? -51.072 -31.337 73.210 1.00 101.71 ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A 1  41  ? -52.170 -30.914 72.462 1.00 101.50 ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A 1  41  ? -50.864 -32.707 73.357 1.00 101.87 ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A 1  41  ? -53.042 -31.833 71.874 1.00 101.62 ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A 1  41  ? -51.730 -33.636 72.777 1.00 102.15 ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A 1  41  ? -52.817 -33.192 72.037 1.00 101.86 ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A 1  41  ? -53.670 -34.109 71.464 1.00 101.48 ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A 1  42  ? -47.911 -30.400 76.155 1.00 99.97  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A 1  42  ? -46.642 -29.918 76.700 1.00 98.89  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A 1  42  ? -45.872 -29.087 75.675 1.00 98.09  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A 1  42  ? -45.985 -29.331 74.470 1.00 98.08  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A 1  42  ? -45.779 -31.106 77.116 1.00 98.95  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A 1  42  ? -46.529 -32.173 77.860 1.00 99.17  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A 1  42  ? -46.191 -32.193 79.320 1.00 99.92  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A 1  42  ? -45.249 -33.267 79.599 1.00 100.65 ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A 1  42  ? -45.134 -33.871 80.776 1.00 101.34 ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A 1  42  ? -45.908 -33.508 81.794 1.00 101.54 ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A 1  42  ? -44.247 -34.847 80.931 1.00 101.51 ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A 1  43  ? -45.074 -28.109 76.142 1.00 97.23  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  43  ? -44.214 -27.396 75.205 1.00 96.51  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  43  ? -43.283 -28.363 74.475 1.00 95.78  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A 1  43  ? -42.680 -29.242 75.102 1.00 95.54  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  43  ? -43.417 -26.452 76.108 1.00 96.55  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  43  ? -44.279 -26.252 77.291 1.00 96.77  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  43  ? -44.955 -27.569 77.509 1.00 97.19  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A 1  44  ? -43.198 -28.206 73.155 1.00 95.05  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A 1  44  ? -42.353 -29.054 72.317 1.00 93.92  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A 1  44  ? -43.099 -30.204 71.664 1.00 93.11  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A 1  44  ? -42.598 -30.808 70.715 1.00 93.07  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A 1  45  ? -44.291 -30.510 72.176 1.00 92.29  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A 1  45  ? -45.116 -31.585 71.626 1.00 91.36  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A 1  45  ? -45.760 -31.146 70.314 1.00 90.86  ? 45   THR A C     1 
ATOM   66    O  O     . THR A 1  45  ? -45.729 -31.890 69.330 1.00 90.78  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A 1  45  ? -46.176 -32.077 72.637 1.00 91.28  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A 1  45  ? -45.515 -32.602 73.792 1.00 90.97  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1  45  ? -47.037 -33.176 72.038 1.00 91.11  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A 1  46  ? -46.325 -29.938 70.302 1.00 90.15  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A 1  46  ? -46.881 -29.363 69.074 1.00 89.58  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A 1  46  ? -45.746 -29.041 68.096 1.00 89.14  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A 1  46  ? -45.855 -29.319 66.900 1.00 89.02  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A 1  46  ? -47.753 -28.097 69.332 1.00 89.54  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1  46  ? -48.558 -27.727 68.091 1.00 89.34  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1  46  ? -48.688 -28.317 70.501 1.00 89.68  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A 1  47  ? -44.658 -28.470 68.610 1.00 88.60  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A 1  47  ? -43.477 -28.205 67.797 1.00 88.21  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A 1  47  ? -43.138 -29.443 66.972 1.00 88.10  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A 1  47  ? -43.104 -29.380 65.743 1.00 88.46  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A 1  47  ? -42.301 -27.794 68.665 1.00 88.09  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A 1  48  ? -42.926 -30.573 67.646 1.00 87.63  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A 1  48  ? -42.645 -31.837 66.970 1.00 87.02  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A 1  48  ? -43.715 -32.186 65.950 1.00 86.75  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A 1  48  ? -43.403 -32.623 64.839 1.00 86.78  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A 1  48  ? -42.508 -32.963 67.985 1.00 86.90  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A 1  48  ? -41.096 -33.338 68.419 1.00 87.04  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A 1  48  ? -40.115 -32.179 68.312 1.00 87.21  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A 1  48  ? -41.147 -33.862 69.834 1.00 88.00  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A 1  49  ? -44.972 -31.977 66.335 1.00 86.27  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A 1  49  ? -46.111 -32.251 65.466 1.00 85.87  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A 1  49  ? -46.044 -31.365 64.219 1.00 85.36  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A 1  49  ? -46.355 -31.814 63.115 1.00 85.25  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A 1  49  ? -47.426 -32.070 66.244 1.00 86.01  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A 1  49  ? -48.706 -32.254 65.434 1.00 86.39  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A 1  49  ? -49.888 -32.709 66.289 1.00 87.04  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A 1  49  ? -50.305 -31.738 67.299 1.00 87.98  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A 1  49  ? -50.333 -31.974 68.611 1.00 88.45  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A 1  49  ? -49.975 -33.160 69.099 1.00 88.06  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A 1  49  ? -50.732 -31.021 69.442 1.00 88.75  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A 1  50  ? -45.610 -30.121 64.402 1.00 84.75  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  50  ? -45.430 -29.197 63.288 1.00 84.36  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  50  ? -44.237 -29.586 62.421 1.00 84.07  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A 1  50  ? -44.357 -29.622 61.194 1.00 84.29  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  50  ? -45.300 -27.756 63.779 1.00 84.30  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  50  ? -46.626 -27.126 64.161 1.00 84.85  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  50  ? -46.487 -25.756 64.810 1.00 85.52  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  50  ? -45.397 -25.149 64.747 1.00 85.52  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  50  ? -47.486 -25.280 65.389 1.00 86.15  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A 1  51  ? -43.097 -29.884 63.048 1.00 83.51  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A 1  51  ? -41.932 -30.373 62.307 1.00 82.91  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A 1  51  ? -42.364 -31.501 61.371 1.00 82.67  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A 1  51  ? -42.142 -31.428 60.165 1.00 82.66  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A 1  51  ? -40.786 -30.864 63.231 1.00 82.86  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A 1  51  ? -40.186 -29.695 64.016 1.00 82.65  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A 1  51  ? -39.697 -31.544 62.408 1.00 82.53  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A 1  51  ? -39.118 -30.088 65.027 1.00 81.97  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A 1  52  ? -43.015 -32.517 61.932 1.00 82.30  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A 1  52  ? -43.463 -33.672 61.164 1.00 82.02  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A 1  52  ? -44.421 -33.294 60.046 1.00 81.68  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A 1  52  ? -44.390 -33.898 58.970 1.00 81.74  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A 1  52  ? -44.104 -34.708 62.077 1.00 82.10  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A 1  52  ? -43.118 -35.356 63.009 1.00 83.06  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A 1  52  ? -43.536 -36.766 63.398 1.00 85.36  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A 1  52  ? -42.464 -37.443 64.127 1.00 86.47  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A 1  52  ? -42.239 -37.321 65.436 1.00 86.96  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A 1  52  ? -43.013 -36.556 66.203 1.00 86.33  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A 1  52  ? -41.226 -37.975 65.983 1.00 87.77  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A 1  53  ? -45.254 -32.289 60.305 1.00 81.20  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A 1  53  ? -46.258 -31.837 59.348 1.00 80.82  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A 1  53  ? -45.627 -31.117 58.169 1.00 80.31  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A 1  53  ? -45.812 -31.517 57.018 1.00 80.38  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A 1  53  ? -47.283 -30.924 60.028 1.00 81.13  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A 1  53  ? -48.390 -30.427 59.116 1.00 81.53  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A 1  53  ? -49.167 -29.314 59.774 1.00 83.24  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A 1  53  ? -50.120 -28.710 58.845 1.00 85.10  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A 1  53  ? -50.797 -27.583 59.071 1.00 85.80  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A 1  53  ? -50.633 -26.909 60.205 1.00 86.30  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A 1  53  ? -51.643 -27.127 58.155 1.00 85.86  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A 1  54  ? -44.876 -30.061 58.458 1.00 79.62  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A 1  54  ? -44.342 -29.209 57.402 1.00 79.07  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A 1  54  ? -43.230 -29.854 56.582 1.00 78.60  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A 1  54  ? -42.928 -29.398 55.479 1.00 78.59  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A 1  54  ? -43.944 -27.844 57.959 1.00 79.08  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A 1  54  ? -45.153 -27.054 58.400 1.00 79.37  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A 1  54  ? -45.330 -26.691 59.735 1.00 79.44  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A 1  54  ? -46.146 -26.702 57.483 1.00 80.02  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A 1  54  ? -46.454 -25.976 60.143 1.00 79.50  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A 1  54  ? -47.273 -25.989 57.880 1.00 80.21  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A 1  54  ? -47.418 -25.631 59.209 1.00 79.84  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A 1  54  ? -48.529 -24.925 59.595 1.00 79.73  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A 1  55  ? -42.646 -30.925 57.108 1.00 78.01  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A 1  55  ? -41.674 -31.703 56.354 1.00 77.44  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A 1  55  ? -42.358 -32.694 55.416 1.00 77.48  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A 1  55  ? -41.748 -33.162 54.453 1.00 77.43  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A 1  55  ? -40.674 -32.385 57.287 1.00 77.21  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A 1  55  ? -39.742 -31.385 57.946 1.00 76.06  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A 1  55  ? -38.651 -32.016 58.766 1.00 74.76  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A 1  55  ? -38.431 -33.221 58.715 1.00 74.92  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A 1  55  ? -37.949 -31.195 59.529 1.00 74.13  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A 1  56  ? -43.626 -32.997 55.694 1.00 77.43  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A 1  56  ? -44.444 -33.800 54.789 1.00 77.56  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A 1  56  ? -44.950 -32.996 53.607 1.00 77.38  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A 1  56  ? -45.033 -33.517 52.497 1.00 77.39  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A 1  56  ? -45.636 -34.410 55.513 1.00 77.69  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A 1  56  ? -45.442 -35.852 55.911 1.00 78.97  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A 1  56  ? -46.621 -36.336 56.734 1.00 80.93  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A 1  56  ? -46.178 -37.355 57.773 1.00 82.12  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A 1  56  ? -46.937 -37.164 59.046 1.00 82.95  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A 1  57  ? -45.299 -31.734 53.850 1.00 77.19  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A 1  57  ? -45.866 -30.882 52.812 1.00 77.07  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A 1  57  ? -44.788 -30.145 52.042 1.00 76.93  ? 57   SER A C     1 
ATOM   173   O  O     . SER A 1  57  ? -43.620 -30.168 52.423 1.00 76.91  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A 1  57  ? -46.845 -29.879 53.414 1.00 77.17  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A 1  57  ? -46.151 -28.878 54.129 1.00 77.49  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A 1  58  ? -45.198 -29.483 50.962 1.00 76.96  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A 1  58  ? -44.288 -28.730 50.098 1.00 76.95  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A 1  58  ? -44.810 -27.318 49.815 1.00 77.17  ? 58   THR A C     1 
ATOM   179   O  O     . THR A 1  58  ? -44.134 -26.515 49.170 1.00 77.04  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A 1  58  ? -44.034 -29.461 48.761 1.00 76.73  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A 1  58  ? -45.277 -29.669 48.089 1.00 76.49  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A 1  58  ? -43.378 -30.803 48.991 1.00 76.36  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A 1  59  ? -46.010 -27.020 50.302 1.00 77.58  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A 1  59  ? -46.604 -25.703 50.095 1.00 78.14  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A 1  59  ? -45.773 -24.637 50.776 1.00 78.13  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A 1  59  ? -45.254 -24.850 51.870 1.00 77.89  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A 1  59  ? -48.082 -25.634 50.546 1.00 78.33  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A 1  59  ? -48.540 -26.629 51.625 1.00 79.59  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A 1  59  ? -48.056 -26.284 53.032 1.00 81.19  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A 1  59  ? -48.888 -25.844 53.858 1.00 81.69  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A 1  59  ? -46.852 -26.463 53.319 1.00 81.72  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A 1  60  ? -45.634 -23.498 50.105 1.00 78.48  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A 1  60  ? -44.861 -22.386 50.639 1.00 78.87  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A 1  60  ? -45.476 -21.884 51.946 1.00 79.07  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A 1  60  ? -46.676 -22.060 52.182 1.00 79.25  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A 1  60  ? -44.710 -21.270 49.599 1.00 78.88  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A 1  60  ? -43.879 -21.597 48.345 1.00 79.25  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A 1  60  ? -43.736 -20.383 47.433 1.00 79.59  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A 1  60  ? -42.494 -22.166 48.679 1.00 79.20  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A 1  61  ? -44.649 -21.284 52.798 1.00 79.15  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A 1  61  ? -45.047 -21.006 54.173 1.00 79.34  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A 1  61  ? -45.083 -19.526 54.532 1.00 79.86  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A 1  61  ? -45.360 -19.155 55.681 1.00 80.00  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A 1  61  ? -44.171 -21.794 55.144 1.00 79.02  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A 1  61  ? -44.346 -23.304 55.012 1.00 78.52  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A 1  61  ? -43.282 -24.054 55.785 1.00 78.36  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A 1  61  ? -45.729 -23.703 55.467 1.00 78.30  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A 1  62  ? -44.803 -18.680 53.550 1.00 80.25  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A 1  62  ? -45.081 -17.259 53.691 1.00 80.75  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A 1  62  ? -46.344 -16.949 52.884 1.00 81.09  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A 1  62  ? -46.577 -17.540 51.820 1.00 81.23  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A 1  62  ? -43.878 -16.375 53.256 1.00 80.70  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A 1  62  ? -42.687 -16.603 54.193 1.00 80.44  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A 1  62  ? -44.261 -14.894 53.249 1.00 80.85  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A 1  62  ? -41.459 -15.787 53.857 1.00 80.15  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A 1  63  ? -47.171 -16.049 53.401 1.00 81.33  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A 1  63  ? -48.355 -15.632 52.671 1.00 81.72  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A 1  63  ? -47.926 -14.793 51.478 1.00 81.91  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A 1  63  ? -47.111 -13.882 51.621 1.00 81.93  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A 1  63  ? -49.313 -14.875 53.586 1.00 81.71  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A 1  63  ? -49.904 -15.741 54.677 1.00 81.94  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A 1  63  ? -51.211 -16.396 54.254 1.00 82.52  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A 1  63  ? -52.351 -15.491 54.405 1.00 84.17  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A 1  63  ? -52.756 -14.949 55.560 1.00 85.51  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A 1  63  ? -52.110 -15.187 56.701 1.00 85.86  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A 1  63  ? -53.812 -14.142 55.578 1.00 85.93  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A 1  64  ? -48.461 -15.133 50.304 1.00 82.28  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A 1  64  ? -48.057 -14.533 49.025 1.00 82.71  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A 1  64  ? -47.970 -13.008 49.045 1.00 82.84  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A 1  64  ? -46.903 -12.441 48.808 1.00 82.87  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A 1  64  ? -48.994 -14.974 47.892 1.00 82.76  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A 1  64  ? -48.802 -16.398 47.413 1.00 83.44  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A 1  64  ? -49.367 -16.570 46.010 1.00 84.33  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A 1  64  ? -49.154 -17.993 45.493 1.00 85.48  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A 1  64  ? -49.391 -18.110 44.014 1.00 85.27  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A 1  65  ? -49.094 -12.356 49.330 1.00 83.05  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A 1  65  ? -49.184 -10.896 49.268 1.00 83.39  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A 1  65  ? -48.091 -10.164 50.070 1.00 83.59  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A 1  65  ? -47.310 -9.413  49.473 1.00 83.60  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A 1  65  ? -50.594 -10.412 49.659 1.00 83.47  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A 1  65  ? -50.911 -8.911  49.679 1.00 83.18  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A 1  65  ? -51.315 -8.399  48.303 1.00 82.59  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A 1  65  ? -52.015 -8.652  50.681 1.00 83.38  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A 1  66  ? -48.021 -10.382 51.408 1.00 83.68  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A 1  66  ? -47.033 -9.656  52.221 1.00 83.87  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A 1  66  ? -45.605 -9.863  51.744 1.00 84.03  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A 1  66  ? -44.760 -8.979  51.924 1.00 84.03  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A 1  66  ? -47.208 -10.255 53.624 1.00 83.87  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A 1  66  ? -47.974 -11.493 53.436 1.00 83.72  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A 1  66  ? -48.842 -11.269 52.247 1.00 83.54  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A 1  67  ? -45.353 -11.030 51.152 1.00 84.15  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A 1  67  ? -44.080 -11.324 50.518 1.00 84.26  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A 1  67  ? -43.906 -10.459 49.270 1.00 84.57  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A 1  67  ? -42.929 -9.721  49.152 1.00 84.54  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A 1  67  ? -43.991 -12.810 50.160 1.00 84.07  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A 1  67  ? -42.696 -13.197 49.517 1.00 83.53  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A 1  67  ? -41.587 -13.497 50.294 1.00 82.78  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A 1  67  ? -42.582 -13.252 48.134 1.00 82.95  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A 1  67  ? -40.385 -13.842 49.703 1.00 82.72  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A 1  67  ? -41.385 -13.597 47.537 1.00 82.48  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A 1  67  ? -40.284 -13.890 48.321 1.00 82.42  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A 1  68  ? -44.869 -10.545 48.354 1.00 84.94  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A 1  68  ? -44.808 -9.831  47.081 1.00 85.30  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A 1  68  ? -44.491 -8.346  47.260 1.00 85.23  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A 1  68  ? -43.715 -7.788  46.488 1.00 85.40  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A 1  68  ? -46.109 -10.015 46.294 1.00 85.43  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A 1  68  ? -45.986 -9.672  44.815 1.00 86.74  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A 1  68  ? -47.336 -9.529  44.124 1.00 88.77  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A 1  68  ? -48.155 -8.681  44.497 1.00 89.76  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A 1  68  ? -47.569 -10.352 43.100 1.00 88.80  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A 1  69  ? -45.081 -7.718  48.278 1.00 85.13  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A 1  69  ? -44.815 -6.304  48.582 1.00 84.96  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A 1  69  ? -43.353 -6.072  48.974 1.00 84.75  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A 1  69  ? -42.737 -5.085  48.555 1.00 84.66  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A 1  69  ? -45.724 -5.794  49.704 1.00 85.02  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A 1  69  ? -47.201 -5.724  49.371 1.00 85.24  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A 1  69  ? -47.952 -4.963  50.457 1.00 85.70  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A 1  69  ? -47.702 -5.500  51.796 1.00 85.74  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A 1  69  ? -48.598 -6.155  52.532 1.00 85.80  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A 1  69  ? -49.832 -6.362  52.080 1.00 85.32  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A 1  69  ? -48.254 -6.598  53.735 1.00 85.73  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A 1  70  ? -42.814 -6.984  49.784 1.00 84.40  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A 1  70  ? -41.417 -6.937  50.197 1.00 84.00  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A 1  70  ? -40.512 -7.020  48.974 1.00 84.02  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A 1  70  ? -39.572 -6.239  48.840 1.00 84.27  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A 1  70  ? -41.110 -8.071  51.173 1.00 83.76  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1  70  ? -39.707 -8.139  51.764 1.00 83.12  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1  70  ? -39.393 -6.879  52.540 1.00 82.91  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1  70  ? -39.596 -9.351  52.655 1.00 82.85  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A 1  71  ? -40.815 -7.963  48.084 1.00 83.77  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A 1  71  ? -40.126 -8.098  46.807 1.00 83.58  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A 1  71  ? -40.117 -6.768  46.055 1.00 83.66  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A 1  71  ? -39.050 -6.278  45.669 1.00 83.68  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A 1  71  ? -40.784 -9.195  45.948 1.00 83.56  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A 1  71  ? -40.187 -9.241  44.544 1.00 83.45  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A 1  71  ? -40.642 -10.535 46.629 1.00 83.50  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A 1  72  ? -41.302 -6.184  45.876 1.00 83.68  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A 1  72  ? -41.457 -4.920  45.153 1.00 83.72  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A 1  72  ? -40.762 -3.766  45.855 1.00 83.89  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A 1  72  ? -40.102 -2.954  45.207 1.00 83.92  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A 1  72  ? -42.930 -4.591  44.938 1.00 83.57  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A 1  72  ? -43.559 -5.368  43.808 1.00 83.64  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A 1  72  ? -45.074 -5.364  43.910 1.00 83.79  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A 1  72  ? -45.665 -6.479  43.175 1.00 83.72  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A 1  72  ? -45.830 -6.506  41.856 1.00 84.09  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A 1  72  ? -45.448 -5.482  41.106 1.00 84.13  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A 1  72  ? -46.377 -7.564  41.281 1.00 84.51  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A 1  73  ? -40.907 -3.708  47.178 1.00 84.09  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A 1  73  ? -40.280 -2.667  47.986 1.00 84.33  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A 1  73  ? -38.758 -2.698  47.842 1.00 84.38  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A 1  73  ? -38.106 -1.653  47.759 1.00 84.29  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A 1  73  ? -40.685 -2.820  49.451 1.00 84.38  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A 1  73  ? -40.240 -1.677  50.341 1.00 85.01  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A 1  73  ? -40.184 -2.081  51.790 1.00 85.56  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A 1  73  ? -41.222 -1.976  52.476 1.00 85.60  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A 1  73  ? -39.096 -2.504  52.237 1.00 85.99  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A 1  74  ? -38.205 -3.905  47.801 1.00 84.67  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A 1  74  ? -36.768 -4.088  47.645 1.00 85.04  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A 1  74  ? -36.306 -3.673  46.247 1.00 85.45  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A 1  74  ? -35.266 -3.026  46.112 1.00 85.64  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A 1  74  ? -36.330 -5.534  47.996 1.00 84.84  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1  74  ? -36.436 -5.754  49.508 1.00 84.48  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1  74  ? -34.903 -5.789  47.552 1.00 84.82  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1  74  ? -36.554 -7.195  49.929 1.00 83.90  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A 1  75  ? -37.095 -4.017  45.228 1.00 85.84  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A 1  75  ? -36.770 -3.705  43.831 1.00 86.27  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A 1  75  ? -36.839 -2.214  43.501 1.00 86.69  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A 1  75  ? -36.166 -1.747  42.577 1.00 86.61  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A 1  75  ? -37.670 -4.488  42.894 1.00 86.21  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A 1  76  ? -37.652 -1.481  44.263 1.00 87.38  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A 1  76  ? -37.866 -0.042  44.063 1.00 88.11  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A 1  76  ? -36.584 0.777   44.276 1.00 88.36  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A 1  76  ? -36.394 1.826   43.651 1.00 88.35  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A 1  76  ? -39.006 0.453   44.970 1.00 88.18  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1  76  ? -39.513 1.874   44.692 1.00 89.44  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1  76  ? -40.144 2.046   43.309 1.00 91.47  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1  76  ? -40.475 1.071   42.628 1.00 92.34  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1  76  ? -40.313 3.299   42.893 1.00 92.12  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A 1  77  ? -35.711 0.286   45.153 1.00 88.76  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A 1  77  ? -34.386 0.867   45.340 1.00 89.12  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A 1  77  ? -33.496 0.637   44.128 1.00 89.18  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A 1  77  ? -32.519 1.352   43.926 1.00 89.36  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A 1  77  ? -33.709 0.282   46.581 1.00 89.24  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A 1  77  ? -34.156 0.952   47.867 1.00 90.06  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A 1  77  ? -33.936 0.350   48.942 1.00 91.04  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A 1  77  ? -34.716 2.074   47.812 1.00 90.52  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A 1  78  ? -33.825 -0.358  43.319 1.00 89.32  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A 1  78  ? -32.986 -0.667  42.177 1.00 89.75  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A 1  78  ? -33.529 -0.040  40.898 1.00 90.18  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A 1  78  ? -32.770 0.526   40.105 1.00 90.25  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A 1  78  ? -32.750 -2.177  42.071 1.00 89.64  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A 1  78  ? -32.095 -2.760  43.298 1.00 89.23  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A 1  78  ? -32.799 -3.612  44.141 1.00 88.59  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A 1  78  ? -30.783 -2.422  43.632 1.00 88.65  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A 1  78  ? -32.204 -4.134  45.285 1.00 88.24  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A 1  78  ? -30.182 -2.941  44.774 1.00 88.27  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A 1  78  ? -30.894 -3.797  45.601 1.00 88.14  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A 1  79  ? -34.840 -0.127  40.707 1.00 90.71  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A 1  79  ? -35.497 0.595   39.623 1.00 91.27  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A 1  79  ? -36.922 0.978   40.004 1.00 91.61  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A 1  79  ? -37.637 0.210   40.656 1.00 91.78  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A 1  79  ? -35.478 -0.206  38.315 1.00 91.30  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A 1  79  ? -35.754 0.637   37.080 1.00 91.62  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A 1  79  ? -35.613 -0.157  35.793 1.00 92.21  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A 1  79  ? -35.617 0.771   34.578 1.00 92.68  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A 1  79  ? -35.516 0.033   33.286 1.00 92.69  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A 1  80  ? -37.317 2.181   39.598 1.00 91.98  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A 1  80  ? -38.674 2.679   39.816 1.00 92.11  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A 1  80  ? -39.606 2.198   38.707 1.00 92.14  ? 80   THR A C     1 
ATOM   370   O  O     . THR A 1  80  ? -39.164 1.899   37.590 1.00 92.06  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A 1  80  ? -38.716 4.225   39.876 1.00 92.11  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A 1  80  ? -38.215 4.770   38.648 1.00 92.07  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A 1  80  ? -37.884 4.749   41.043 1.00 92.23  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A 1  81  ? -40.895 2.129   39.035 1.00 92.22  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A 1  81  ? -41.951 1.732   38.094 1.00 92.21  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A 1  81  ? -41.651 0.389   37.413 1.00 91.79  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A 1  81  ? -41.727 0.260   36.184 1.00 91.78  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A 1  81  ? -42.219 2.851   37.069 1.00 92.43  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A 1  81  ? -43.622 2.779   36.458 1.00 93.29  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A 1  81  ? -44.535 2.153   37.058 1.00 93.45  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A 1  81  ? -43.806 3.366   35.367 1.00 94.34  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A 1  82  ? -41.286 -0.598  38.227 1.00 91.23  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A 1  82  ? -41.084 -1.952  37.734 1.00 90.64  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A 1  82  ? -42.395 -2.719  37.760 1.00 90.24  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A 1  82  ? -43.349 -2.321  38.433 1.00 90.22  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A 1  82  ? -40.012 -2.691  38.543 1.00 90.56  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A 1  82  ? -38.552 -2.405  38.177 1.00 90.49  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A 1  82  ? -37.601 -3.027  39.186 1.00 90.07  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A 1  82  ? -38.234 -2.899  36.778 1.00 90.45  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A 1  83  ? -42.440 -3.799  36.988 1.00 89.63  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A 1  83  ? -43.543 -4.742  37.021 1.00 88.93  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A 1  83  ? -42.933 -6.120  37.242 1.00 88.23  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A 1  83  ? -41.783 -6.358  36.875 1.00 88.12  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A 1  83  ? -44.353 -4.706  35.718 1.00 89.16  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A 1  83  ? -44.885 -3.329  35.309 1.00 89.62  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A 1  83  ? -45.953 -3.440  34.225 1.00 90.24  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A 1  83  ? -47.303 -3.161  34.721 1.00 91.33  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A 1  83  ? -48.424 -3.623  34.167 1.00 91.97  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A 1  83  ? -48.365 -4.409  33.097 1.00 92.59  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A 1  83  ? -49.608 -3.315  34.689 1.00 91.56  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A 1  84  ? -43.692 -7.019  37.857 1.00 87.35  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A 1  84  ? -43.196 -8.357  38.170 1.00 86.38  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A 1  84  ? -44.052 -9.430  37.531 1.00 85.63  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A 1  84  ? -45.268 -9.432  37.705 1.00 85.67  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A 1  84  ? -43.162 -8.580  39.686 1.00 86.36  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A 1  84  ? -41.870 -8.173  40.331 1.00 86.47  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A 1  84  ? -41.772 -6.974  41.028 1.00 86.56  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A 1  84  ? -40.745 -8.989  40.241 1.00 86.40  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A 1  84  ? -40.573 -6.595  41.626 1.00 86.44  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A 1  84  ? -39.546 -8.619  40.834 1.00 86.09  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A 1  84  ? -39.458 -7.420  41.525 1.00 86.25  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A 1  85  ? -43.422 -10.340 36.796 1.00 84.71  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A 1  85  ? -44.128 -11.509 36.297 1.00 83.93  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A 1  85  ? -44.603 -12.336 37.487 1.00 83.87  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A 1  85  ? -43.858 -12.531 38.442 1.00 83.92  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A 1  85  ? -43.246 -12.340 35.369 1.00 83.65  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A 1  85  ? -43.190 -11.819 33.944 1.00 82.49  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A 1  85  ? -42.743 -12.863 32.939 1.00 81.17  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A 1  85  ? -42.187 -13.899 33.296 1.00 80.64  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A 1  85  ? -42.982 -12.585 31.668 1.00 81.08  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A 1  86  ? -45.857 -12.784 37.436 1.00 83.72  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A 1  86  ? -46.460 -13.587 38.500 1.00 83.35  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A 1  86  ? -45.592 -14.783 38.865 1.00 83.08  ? 86   SER A C     1 
ATOM   424   O  O     . SER A 1  86  ? -45.387 -15.061 40.050 1.00 83.23  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A 1  86  ? -47.853 -14.065 38.088 1.00 83.47  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A 1  86  ? -48.186 -15.285 38.731 1.00 83.65  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A 1  87  ? -45.096 -15.481 37.841 1.00 82.56  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A 1  87  ? -44.181 -16.609 38.018 1.00 82.00  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A 1  87  ? -42.826 -16.179 38.578 1.00 81.78  ? 87   SER A C     1 
ATOM   430   O  O     . SER A 1  87  ? -42.144 -16.968 39.232 1.00 81.73  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A 1  87  ? -43.969 -17.333 36.692 1.00 81.93  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A 1  87  ? -43.172 -16.559 35.817 1.00 81.40  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A 1  88  ? -42.439 -14.933 38.312 1.00 81.53  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A 1  88  ? -41.166 -14.397 38.790 1.00 81.26  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A 1  88  ? -41.161 -14.199 40.298 1.00 80.98  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A 1  88  ? -40.184 -14.547 40.957 1.00 81.27  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A 1  88  ? -40.814 -13.097 38.079 1.00 81.28  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A 1  89  ? -42.240 -13.648 40.844 1.00 80.50  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A 1  89  ? -42.369 -13.523 42.293 1.00 80.22  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A 1  89  ? -42.346 -14.923 42.910 1.00 80.07  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A 1  89  ? -41.702 -15.140 43.939 1.00 79.98  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A 1  89  ? -43.647 -12.752 42.697 1.00 80.27  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A 1  89  ? -43.827 -12.737 44.213 1.00 80.24  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A 1  89  ? -43.593 -11.330 42.166 1.00 80.32  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A 1  90  ? -43.026 -15.866 42.253 1.00 79.85  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A 1  90  ? -43.036 -17.271 42.665 1.00 79.61  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A 1  90  ? -41.635 -17.864 42.694 1.00 79.13  ? 90   MET A C     1 
ATOM   448   O  O     . MET A 1  90  ? -41.238 -18.467 43.691 1.00 79.36  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A 1  90  ? -43.945 -18.113 41.764 1.00 79.80  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A 1  90  ? -45.425 -17.839 41.935 1.00 81.42  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A 1  90  ? -45.917 -17.659 43.669 1.00 86.06  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A 1  90  ? -45.722 -19.337 44.287 1.00 85.98  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A 1  91  ? -40.886 -17.689 41.607 1.00 78.44  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A 1  91  ? -39.501 -18.139 41.564 1.00 77.72  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A 1  91  ? -38.745 -17.580 42.764 1.00 77.21  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A 1  91  ? -38.090 -18.327 43.488 1.00 77.28  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A 1  91  ? -38.835 -17.734 40.262 1.00 77.70  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A 1  92  ? -38.871 -16.276 42.994 1.00 76.50  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A 1  92  ? -38.206 -15.637 44.122 1.00 75.84  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A 1  92  ? -38.664 -16.174 45.465 1.00 75.57  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A 1  92  ? -37.846 -16.313 46.376 1.00 75.74  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A 1  92  ? -38.368 -14.121 44.082 1.00 75.72  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A 1  92  ? -37.193 -13.383 43.445 1.00 75.63  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A 1  92  ? -37.558 -11.943 43.127 1.00 76.06  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A 1  92  ? -35.969 -13.444 44.335 1.00 74.96  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A 1  93  ? -39.956 -16.485 45.596 1.00 74.96  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A 1  93  ? -40.447 -17.047 46.852 1.00 74.16  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A 1  93  ? -39.866 -18.435 47.067 1.00 73.62  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A 1  93  ? -39.209 -18.675 48.080 1.00 73.56  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A 1  93  ? -41.979 -17.037 46.974 1.00 74.02  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A 1  93  ? -42.411 -16.898 48.436 1.00 74.11  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A 1  93  ? -43.870 -17.192 48.694 1.00 74.36  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A 1  93  ? -44.753 -16.697 47.995 1.00 76.07  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A 1  93  ? -44.135 -17.983 49.724 1.00 73.40  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A 1  94  ? -40.077 -19.325 46.099 1.00 72.94  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A 1  94  ? -39.541 -20.681 46.158 1.00 72.57  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A 1  94  ? -38.106 -20.693 46.660 1.00 72.11  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A 1  94  ? -37.738 -21.525 47.494 1.00 72.07  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A 1  94  ? -39.603 -21.347 44.783 1.00 72.61  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A 1  94  ? -40.980 -21.855 44.395 1.00 73.46  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A 1  94  ? -41.450 -23.025 45.253 1.00 74.61  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A 1  94  ? -42.680 -23.165 45.437 1.00 74.95  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A 1  94  ? -40.596 -23.801 45.742 1.00 74.71  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A 1  95  ? -37.316 -19.746 46.158 1.00 71.50  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A 1  95  ? -35.886 -19.678 46.425 1.00 70.87  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A 1  95  ? -35.589 -19.168 47.824 1.00 70.37  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A 1  95  ? -34.764 -19.743 48.527 1.00 70.27  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A 1  95  ? -35.193 -18.815 45.379 1.00 70.89  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A 1  96  ? -36.264 -18.089 48.215 1.00 69.97  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A 1  96  ? -36.117 -17.500 49.548 1.00 69.58  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A 1  96  ? -36.479 -18.498 50.643 1.00 69.34  ? 96   SER A C     1 
ATOM   492   O  O     . SER A 1  96  ? -35.728 -18.698 51.600 1.00 69.08  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A 1  96  ? -36.986 -16.249 49.676 1.00 69.46  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A 1  96  ? -36.543 -15.236 48.792 1.00 69.28  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A 1  97  ? -37.634 -19.130 50.485 1.00 69.22  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A 1  97  ? -38.083 -20.126 51.441 1.00 69.06  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A 1  97  ? -37.099 -21.300 51.518 1.00 68.66  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A 1  97  ? -36.593 -21.602 52.598 1.00 68.79  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A 1  97  ? -39.515 -20.567 51.130 1.00 69.21  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A 1  97  ? -40.551 -19.461 51.326 1.00 69.64  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A 1  97  ? -41.934 -20.011 51.634 1.00 71.62  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1  97  ? -42.059 -21.254 51.766 1.00 71.94  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1  97  ? -42.895 -19.210 51.752 1.00 71.89  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A 1  98  ? -36.799 -21.927 50.378 1.00 68.07  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A 1  98  ? -35.779 -22.981 50.316 1.00 67.39  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A 1  98  ? -34.512 -22.575 51.073 1.00 66.90  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A 1  98  ? -34.085 -23.270 51.994 1.00 66.83  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A 1  98  ? -35.448 -23.322 48.873 1.00 67.37  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A 1  99  ? -33.938 -21.440 50.685 1.00 66.18  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A 1  99  ? -32.783 -20.875 51.353 1.00 65.70  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A 1  99  ? -32.972 -20.844 52.861 1.00 65.41  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A 1  99  ? -32.151 -21.394 53.591 1.00 65.81  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A 1  99  ? -32.497 -19.461 50.822 1.00 65.91  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A 1  99  ? -31.511 -18.640 51.639 1.00 65.74  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1  99  ? -30.160 -18.994 51.709 1.00 65.63  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1  99  ? -31.930 -17.507 52.329 1.00 65.66  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1  99  ? -29.254 -18.243 52.448 1.00 65.67  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1  99  ? -31.033 -16.750 53.077 1.00 66.53  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1  99  ? -29.695 -17.123 53.129 1.00 66.42  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1  99  ? -28.807 -16.371 53.864 1.00 67.07  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A 1  100 ? -34.045 -20.208 53.327 1.00 64.74  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A 1  100 ? -34.232 -19.998 54.764 1.00 64.01  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A 1  100 ? -34.385 -21.315 55.517 1.00 63.81  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A 1  100 ? -33.830 -21.474 56.601 1.00 63.89  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A 1  100 ? -35.415 -19.064 55.048 1.00 63.80  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A 1  100 ? -35.243 -17.563 54.783 1.00 63.26  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1  100 ? -36.587 -16.887 54.689 1.00 63.00  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1  100 ? -34.396 -16.879 55.842 1.00 63.06  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A 1  101 ? -35.117 -22.260 54.923 1.00 63.33  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A 1  101 ? -35.361 -23.570 55.524 1.00 62.73  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A 1  101 ? -34.054 -24.330 55.646 1.00 62.61  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A 1  101 ? -33.792 -24.961 56.659 1.00 62.56  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A 1  101 ? -36.390 -24.387 54.708 1.00 62.70  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1  101 ? -36.409 -25.839 55.143 1.00 62.69  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1  101 ? -37.777 -23.792 54.851 1.00 62.51  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A 1  102 ? -33.232 -24.251 54.607 1.00 62.72  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A 1  102 ? -31.901 -24.843 54.629 1.00 62.73  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A 1  102 ? -31.008 -24.157 55.657 1.00 62.65  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A 1  102 ? -30.215 -24.824 56.315 1.00 62.65  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A 1  102 ? -31.269 -24.797 53.242 1.00 62.86  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A 1  103 ? -31.152 -22.838 55.799 1.00 62.69  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A 1  103 ? -30.407 -22.072 56.809 1.00 62.84  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A 1  103 ? -30.784 -22.463 58.239 1.00 63.19  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A 1  103 ? -29.922 -22.530 59.119 1.00 63.51  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A 1  103 ? -30.559 -20.553 56.612 1.00 62.54  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A 1  103 ? -29.821 -19.639 57.606 1.00 61.46  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1  103 ? -28.327 -19.782 57.478 1.00 60.60  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1  103 ? -30.219 -18.193 57.431 1.00 60.73  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A 1  104 ? -32.064 -22.729 58.470 1.00 63.44  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A 1  104 ? -32.500 -23.159 59.791 1.00 63.65  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A 1  104 ? -31.894 -24.495 60.185 1.00 64.22  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A 1  104 ? -31.516 -24.677 61.340 1.00 64.34  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A 1  104 ? -34.023 -23.166 59.907 1.00 63.29  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A 1  104 ? -34.600 -21.808 60.130 1.00 61.95  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1  104 ? -35.364 -21.198 59.155 1.00 61.15  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1  104 ? -34.351 -21.124 61.309 1.00 60.55  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1  104 ? -35.882 -19.935 59.360 1.00 60.78  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1  104 ? -34.863 -19.867 61.519 1.00 59.79  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1  104 ? -35.630 -19.269 60.544 1.00 60.16  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A 1  105 ? -31.780 -25.407 59.221 1.00 64.66  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A 1  105 ? -31.139 -26.690 59.450 1.00 65.40  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A 1  105 ? -29.745 -26.484 60.046 1.00 65.80  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A 1  105 ? -29.429 -27.029 61.106 1.00 65.89  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A 1  105 ? -31.053 -27.487 58.149 1.00 65.43  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A 1  105 ? -32.391 -28.013 57.645 1.00 66.60  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A 1  105 ? -32.330 -28.611 56.236 1.00 67.73  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1  105 ? -31.218 -28.926 55.760 1.00 68.41  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1  105 ? -33.402 -28.773 55.605 1.00 67.60  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A 1  106 ? -28.929 -25.675 59.374 1.00 66.20  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A 1  106 ? -27.556 -25.426 59.802 1.00 66.64  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A 1  106 ? -27.534 -24.655 61.110 1.00 66.93  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A 1  106 ? -26.710 -24.928 61.991 1.00 67.11  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A 1  106 ? -26.790 -24.661 58.725 1.00 66.65  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1  106 ? -26.844 -25.346 57.373 1.00 67.04  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1  106 ? -27.104 -26.570 57.326 1.00 68.14  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1  106 ? -26.628 -24.662 56.353 1.00 67.28  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A 1  107 ? -28.454 -23.702 61.233 1.00 67.11  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A 1  107 ? -28.617 -22.944 62.465 1.00 67.42  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A 1  107 ? -28.903 -23.893 63.630 1.00 67.57  ? 107  THR A C     1 
ATOM   580   O  O     . THR A 1  107 ? -28.306 -23.771 64.705 1.00 67.63  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A 1  107 ? -29.732 -21.890 62.326 1.00 67.35  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A 1  107 ? -29.323 -20.886 61.387 1.00 67.25  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A 1  107 ? -30.005 -21.225 63.650 1.00 67.60  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A 1  108 ? -29.801 -24.850 63.388 1.00 67.71  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A 1  108 ? -30.184 -25.854 64.382 1.00 67.50  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A 1  108 ? -29.062 -26.808 64.738 1.00 67.29  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A 1  108 ? -28.973 -27.232 65.878 1.00 67.61  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A 1  108 ? -31.409 -26.653 63.929 1.00 67.57  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  108 ? -32.135 -27.310 65.086 1.00 67.65  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  108 ? -32.475 -26.656 66.066 1.00 68.34  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  108 ? -32.384 -28.606 64.973 1.00 68.15  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  109 ? -28.215 -27.152 63.771 1.00 66.99  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A 1  109 ? -27.050 -27.988 64.048 1.00 66.79  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A 1  109 ? -26.063 -27.235 64.921 1.00 66.74  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A 1  109 ? -25.332 -27.844 65.705 1.00 66.55  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A 1  109 ? -26.360 -28.420 62.758 1.00 66.82  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  109 ? -27.133 -29.318 61.801 1.00 66.50  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  109 ? -26.576 -29.131 60.420 1.00 67.21  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  109 ? -27.057 -30.767 62.217 1.00 66.18  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A 1  110 ? -26.059 -25.911 64.770 1.00 66.80  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A 1  110 ? -25.213 -25.013 65.564 1.00 67.14  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A 1  110 ? -25.667 -24.855 67.015 1.00 66.81  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A 1  110 ? -24.842 -24.877 67.936 1.00 66.56  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A 1  110 ? -25.151 -23.637 64.910 1.00 67.29  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A 1  110 ? -24.276 -23.638 63.366 1.00 68.44  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A 1  111 ? -26.974 -24.669 67.195 1.00 66.57  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A 1  111 ? -27.595 -24.621 68.511 1.00 66.38  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A 1  111 ? -27.338 -25.918 69.268 1.00 66.33  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A 1  111 ? -26.937 -25.889 70.432 1.00 66.52  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A 1  111 ? -29.085 -24.358 68.384 1.00 66.34  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A 1  112 ? -27.547 -27.049 68.598 1.00 66.11  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A 1  112 ? -27.264 -28.362 69.178 1.00 66.16  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A 1  112 ? -25.774 -28.514 69.531 1.00 66.54  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A 1  112 ? -25.418 -29.129 70.543 1.00 66.55  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A 1  112 ? -27.747 -29.501 68.249 1.00 65.76  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1  112 ? -29.268 -29.502 68.192 1.00 65.54  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1  112 ? -27.280 -30.856 68.747 1.00 65.53  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1  112 ? -29.839 -30.244 67.018 1.00 65.96  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A 1  113 ? -24.909 -27.934 68.705 1.00 66.85  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A 1  113 ? -23.476 -28.024 68.929 1.00 67.09  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A 1  113 ? -23.094 -27.389 70.261 1.00 67.67  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A 1  113 ? -22.265 -27.931 71.005 1.00 67.73  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A 1  113 ? -22.718 -27.364 67.784 1.00 66.75  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A 1  113 ? -21.233 -27.474 67.903 1.00 65.51  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1  113 ? -20.552 -28.637 67.626 1.00 64.69  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1  113 ? -20.297 -26.563 68.259 1.00 64.57  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1  113 ? -19.259 -28.440 67.809 1.00 64.72  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1  113 ? -19.078 -27.189 68.192 1.00 64.34  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A 1  114 ? -23.713 -26.245 70.553 1.00 68.20  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A 1  114 ? -23.484 -25.521 71.800 1.00 68.83  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A 1  114 ? -24.261 -26.154 72.958 1.00 69.35  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A 1  114 ? -24.365 -25.574 74.046 1.00 69.53  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A 1  114 ? -23.858 -24.051 71.637 1.00 68.81  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A 1  115 ? -24.803 -27.346 72.706 1.00 69.79  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A 1  115 ? -25.495 -28.155 73.715 1.00 70.04  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A 1  115 ? -26.824 -27.523 74.142 1.00 70.11  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A 1  115 ? -27.246 -27.636 75.296 1.00 70.29  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A 1  115 ? -24.566 -28.468 74.904 1.00 70.06  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A 1  115 ? -23.291 -29.218 74.501 1.00 70.69  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A 1  115 ? -22.505 -29.771 75.695 1.00 72.41  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A 1  115 ? -21.794 -31.088 75.322 1.00 73.48  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1  115 ? -20.790 -31.577 76.327 1.00 73.14  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A 1  116 ? -27.472 -26.858 73.187 1.00 70.11  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A 1  116 ? -28.789 -26.253 73.387 1.00 70.10  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A 1  116 ? -29.826 -26.953 72.511 1.00 69.97  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A 1  116 ? -29.510 -27.934 71.835 1.00 70.05  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A 1  116 ? -28.748 -24.754 73.068 1.00 70.12  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A 1  116 ? -28.048 -23.908 74.121 1.00 70.72  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A 1  116 ? -28.146 -22.418 73.818 1.00 71.47  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A 1  116 ? -27.102 -21.987 72.894 1.00 73.02  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1  116 ? -27.278 -21.779 71.591 1.00 73.80  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1  116 ? -28.471 -21.941 71.034 1.00 74.51  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1  116 ? -26.256 -21.395 70.841 1.00 73.95  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A 1  117 ? -31.063 -26.465 72.552 1.00 69.78  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A 1  117 ? -32.110 -26.890 71.629 1.00 69.87  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A 1  117 ? -32.921 -25.677 71.186 1.00 70.09  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A 1  117 ? -33.966 -25.805 70.552 1.00 70.30  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A 1  117 ? -33.055 -27.932 72.240 1.00 69.69  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1  117 ? -32.335 -29.254 72.466 1.00 69.93  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1  117 ? -33.669 -27.411 73.522 1.00 69.91  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A 1  118 ? -32.427 -24.496 71.524 1.00 70.25  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A 1  118 ? -33.083 -23.262 71.145 1.00 70.49  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A 1  118 ? -32.204 -22.511 70.155 1.00 70.59  ? 118  THR A C     1 
ATOM   664   O  O     . THR A 1  118 ? -31.138 -22.005 70.519 1.00 70.78  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A 1  118 ? -33.354 -22.367 72.374 1.00 70.58  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A 1  118 ? -33.751 -23.178 73.490 1.00 70.91  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1  118 ? -34.440 -21.332 72.065 1.00 70.38  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A 1  119 ? -32.649 -22.443 68.903 1.00 70.55  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A 1  119 ? -31.940 -21.671 67.887 1.00 70.41  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A 1  119 ? -31.943 -20.179 68.267 1.00 70.50  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A 1  119 ? -33.004 -19.587 68.478 1.00 70.44  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A 1  119 ? -32.516 -21.894 66.454 1.00 70.32  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1  119 ? -33.911 -21.285 66.312 1.00 70.36  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1  119 ? -32.538 -23.372 66.095 1.00 69.65  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1  119 ? -34.186 -20.678 64.949 1.00 70.04  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A 1  120 ? -30.749 -19.598 68.379 1.00 70.42  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A 1  120 ? -30.580 -18.189 68.748 1.00 70.28  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A 1  120 ? -29.921 -17.398 67.614 1.00 70.13  ? 120  MET A C     1 
ATOM   679   O  O     . MET A 1  120 ? -29.397 -17.999 66.675 1.00 70.06  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A 1  120 ? -29.748 -18.085 70.019 1.00 70.34  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A 1  120 ? -30.390 -18.736 71.216 1.00 70.92  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A 1  120 ? -29.399 -18.504 72.695 1.00 72.15  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A 1  120 ? -30.321 -19.512 73.852 1.00 72.53  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A 1  121 ? -29.960 -16.049 67.677 1.00 69.99  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A 1  121 ? -29.333 -15.262 66.619 1.00 69.99  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A 1  121 ? -27.868 -15.614 66.387 1.00 70.02  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A 1  121 ? -27.410 -15.561 65.247 1.00 70.47  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A 1  121 ? -29.464 -13.825 67.126 1.00 69.82  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  121 ? -30.703 -13.843 67.898 1.00 69.79  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  121 ? -30.745 -15.188 68.580 1.00 70.05  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A 1  122 ? -27.139 -15.983 67.436 1.00 69.72  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A 1  122 ? -25.738 -16.351 67.254 1.00 69.44  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A 1  122 ? -25.566 -17.617 66.409 1.00 69.16  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A 1  122 ? -24.565 -17.760 65.711 1.00 69.19  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A 1  122 ? -24.988 -16.447 68.593 1.00 69.67  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A 1  122 ? -25.403 -17.565 69.532 1.00 69.21  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A 1  122 ? -24.687 -17.393 70.853 1.00 69.44  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A 1  122 ? -25.562 -17.845 72.004 1.00 70.73  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1  122 ? -25.261 -17.101 73.257 1.00 71.54  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A 1  123 ? -26.550 -18.512 66.468 1.00 68.70  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A 1  123 ? -26.553 -19.733 65.667 1.00 68.48  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A 1  123 ? -26.703 -19.440 64.180 1.00 68.02  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A 1  123 ? -25.954 -19.964 63.360 1.00 67.88  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A 1  123 ? -27.668 -20.671 66.125 1.00 68.70  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A 1  123 ? -27.484 -21.140 67.546 1.00 69.39  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1  123 ? -26.369 -21.602 67.878 1.00 69.45  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1  123 ? -28.460 -21.052 68.326 1.00 70.27  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A 1  124 ? -27.687 -18.611 63.846 1.00 67.77  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A 1  124 ? -27.861 -18.094 62.493 1.00 67.41  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A 1  124 ? -26.573 -17.416 62.029 1.00 67.31  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A 1  124 ? -26.122 -17.635 60.906 1.00 67.45  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A 1  124 ? -29.053 -17.103 62.410 1.00 67.24  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1  124 ? -30.377 -17.867 62.460 1.00 67.08  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1  124 ? -28.980 -16.266 61.147 1.00 67.34  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1  124 ? -31.611 -17.058 62.086 1.00 66.67  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A 1  125 ? -25.979 -16.617 62.912 1.00 67.13  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A 1  125 ? -24.754 -15.882 62.607 1.00 66.99  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A 1  125 ? -23.559 -16.798 62.371 1.00 66.67  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A 1  125 ? -22.761 -16.553 61.476 1.00 66.59  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A 1  125 ? -24.440 -14.897 63.727 1.00 67.12  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A 1  125 ? -25.347 -13.684 63.749 1.00 67.61  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A 1  125 ? -25.399 -13.018 65.110 1.00 68.10  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1  125 ? -24.528 -13.229 65.958 1.00 68.25  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1  125 ? -26.430 -12.206 65.328 1.00 68.68  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A 1  126 ? -23.444 -17.844 63.182 1.00 66.55  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A 1  126 ? -22.377 -18.826 63.035 1.00 66.29  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A 1  126 ? -22.559 -19.627 61.757 1.00 66.33  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A 1  126 ? -21.611 -19.808 60.994 1.00 66.41  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A 1  126 ? -22.324 -19.766 64.240 1.00 66.00  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A 1  126 ? -21.242 -20.841 64.189 1.00 65.45  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A 1  126 ? -19.846 -20.253 64.405 1.00 65.14  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A 1  126 ? -21.534 -21.921 65.195 1.00 64.63  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A 1  127 ? -23.775 -20.107 61.525 1.00 66.39  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A 1  127 ? -24.080 -20.780 60.275 1.00 66.74  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A 1  127 ? -23.660 -19.907 59.091 1.00 67.02  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A 1  127 ? -22.914 -20.354 58.225 1.00 67.25  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A 1  127 ? -25.553 -21.138 60.196 1.00 66.59  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A 1  128 ? -24.098 -18.651 59.082 1.00 67.29  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A 1  128 ? -23.834 -17.763 57.956 1.00 67.51  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A 1  128 ? -22.357 -17.486 57.720 1.00 68.03  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A 1  128 ? -21.906 -17.527 56.581 1.00 68.34  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A 1  128 ? -24.646 -16.479 58.066 1.00 67.22  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A 1  128 ? -26.098 -16.713 57.703 1.00 66.80  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A 1  128 ? -26.929 -15.455 57.741 1.00 66.94  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A 1  128 ? -26.723 -14.603 56.574 1.00 66.73  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A 1  128 ? -26.306 -13.341 56.633 1.00 66.75  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A 1  128 ? -26.054 -12.775 57.804 1.00 67.07  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A 1  128 ? -26.149 -12.639 55.521 1.00 66.86  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A 1  129 ? -21.607 -17.221 58.787 1.00 68.67  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A 1  129 ? -20.169 -16.922 58.673 1.00 69.15  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A 1  129 ? -19.392 -18.095 58.075 1.00 69.53  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A 1  129 ? -18.579 -17.903 57.173 1.00 69.51  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A 1  129 ? -19.586 -16.447 60.022 1.00 68.89  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A 1  129 ? -18.123 -16.787 60.301 1.00 68.72  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A 1  129 ? -17.113 -16.010 59.439 1.00 68.86  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A 1  129 ? -15.740 -16.499 59.623 1.00 68.52  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A 1  129 ? -15.261 -17.650 59.141 1.00 67.75  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A 1  129 ? -16.030 -18.468 58.433 1.00 67.65  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A 1  129 ? -14.005 -17.995 59.378 1.00 67.03  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A 1  130 ? -19.673 -19.303 58.557 1.00 70.20  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A 1  130 ? -19.017 -20.511 58.049 1.00 70.90  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A 1  130 ? -19.381 -20.797 56.591 1.00 71.44  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A 1  130 ? -18.545 -21.271 55.822 1.00 71.71  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A 1  130 ? -19.305 -21.729 58.945 1.00 70.74  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A 1  130 ? -18.589 -21.554 60.279 1.00 70.81  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A 1  130 ? -18.844 -23.022 58.292 1.00 70.34  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A 1  130 ? -19.224 -22.326 61.399 1.00 71.53  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A 1  131 ? -20.619 -20.495 56.216 1.00 72.02  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A 1  131 ? -21.063 -20.635 54.838 1.00 72.72  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A 1  131 ? -20.271 -19.708 53.919 1.00 73.44  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A 1  131 ? -20.067 -20.004 52.747 1.00 73.35  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A 1  131 ? -22.554 -20.313 54.735 1.00 72.70  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A 1  131 ? -23.477 -21.366 55.313 1.00 72.39  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A 1  131 ? -24.871 -20.809 55.451 1.00 72.46  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A 1  131 ? -25.889 -21.850 55.361 1.00 73.16  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A 1  131 ? -27.041 -21.720 54.707 1.00 73.58  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A 1  131 ? -27.325 -20.593 54.071 1.00 73.80  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A 1  131 ? -27.909 -22.724 54.673 1.00 74.29  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A 1  132 ? -19.818 -18.589 54.465 1.00 74.45  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A 1  132 ? -19.103 -17.598 53.683 1.00 75.93  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A 1  132 ? -19.878 -16.302 53.538 1.00 77.06  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A 1  132 ? -19.290 -15.259 53.238 1.00 77.28  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A 1  133 ? -21.192 -16.360 53.768 1.00 78.07  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A 1  133 ? -22.097 -15.207 53.586 1.00 79.11  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A 1  133 ? -21.693 -13.925 54.344 1.00 80.07  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A 1  133 ? -21.945 -12.813 53.866 1.00 80.18  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A 1  133 ? -23.546 -15.598 53.906 1.00 78.84  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A 1  133 ? -24.106 -16.669 52.972 1.00 78.74  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A 1  133 ? -25.475 -17.198 53.382 1.00 78.14  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A 1  133 ? -26.211 -16.487 54.097 1.00 78.31  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A 1  133 ? -25.819 -18.328 52.973 1.00 77.33  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A 1  134 ? -21.068 -14.081 55.512 1.00 81.10  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A 1  134 ? -20.525 -12.936 56.252 1.00 82.04  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A 1  134 ? -19.063 -12.661 55.863 1.00 82.01  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A 1  134 ? -18.126 -13.253 56.418 1.00 82.01  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A 1  134 ? -20.667 -13.127 57.773 1.00 82.45  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A 1  134 ? -22.086 -13.467 58.244 1.00 84.36  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A 1  134 ? -22.416 -12.864 59.617 1.00 87.43  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A 1  134 ? -22.548 -11.401 59.561 1.00 90.02  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A 1  134 ? -23.230 -10.660 60.436 1.00 91.03  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A 1  134 ? -23.874 -11.227 61.450 1.00 91.74  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A 1  134 ? -23.278 -9.341  60.292 1.00 91.18  ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B 2  21  ? -54.031 1.191   60.525 1.00 110.86 ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B 2  21  ? -53.208 0.124   61.178 1.00 110.91 ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B 2  21  ? -51.915 -0.134  60.377 1.00 110.80 ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B 2  21  ? -51.542 -1.288  60.111 1.00 110.85 ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B 2  21  ? -54.016 -1.201  61.389 1.00 110.99 ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B 2  21  ? -53.454 -1.997  62.573 1.00 110.94 ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B 2  21  ? -55.513 -0.917  61.595 1.00 110.96 ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B 2  22  ? -51.244 0.960   60.005 1.00 110.49 ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B 2  22  ? -49.977 0.936   59.246 1.00 110.11 ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B 2  22  ? -48.903 -0.012  59.814 1.00 109.63 ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B 2  22  ? -48.598 0.026   61.013 1.00 109.75 ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B 2  22  ? -49.412 2.364   59.091 1.00 110.23 ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B 2  22  ? -49.842 3.507   60.037 1.00 110.57 ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B 2  22  ? -49.396 3.295   61.488 1.00 110.82 ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B 2  22  ? -49.343 4.858   59.522 1.00 110.68 ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B 2  23  ? -48.345 -0.859  58.947 1.00 108.76 ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B 2  23  ? -47.313 -1.824  59.346 1.00 107.82 ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B 2  23  ? -46.230 -1.986  58.269 1.00 107.06 ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B 2  23  ? -46.543 -2.090  57.080 1.00 107.07 ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B 2  23  ? -47.951 -3.180  59.703 1.00 107.85 ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B 2  23  ? -46.948 -4.293  60.035 1.00 107.89 ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B 2  23  ? -47.618 -5.604  60.487 1.00 107.90 ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B 2  23  ? -48.334 -6.388  59.460 1.00 108.10 ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B 2  23  ? -48.167 -6.340  58.132 1.00 107.71 ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B 2  23  ? -47.280 -5.533  57.560 1.00 107.47 ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B 2  23  ? -48.905 -7.125  57.358 1.00 107.12 ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B 2  24  ? -44.967 -1.996  58.703 1.00 105.91 ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B 2  24  ? -43.805 -2.254  57.840 1.00 104.72 ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B 2  24  ? -44.003 -3.457  56.926 1.00 103.68 ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B 2  24  ? -44.611 -4.450  57.328 1.00 103.65 ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B 2  24  ? -42.559 -2.492  58.699 1.00 104.94 ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B 2  24  ? -41.534 -1.382  58.576 1.00 105.26 ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B 2  24  ? -41.104 -1.084  57.437 1.00 105.92 ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B 2  24  ? -41.142 -0.825  59.624 1.00 105.44 ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B 2  25  ? -43.478 -3.370  55.705 1.00 102.30 ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B 2  25  ? -43.616 -4.454  54.733 1.00 100.94 ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B 2  25  ? -42.866 -5.719  55.126 1.00 99.95  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B 2  25  ? -43.397 -6.822  54.987 1.00 99.80  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B 2  25  ? -43.194 -3.999  53.337 1.00 101.01 ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B 2  25  ? -44.309 -3.297  52.589 1.00 100.89 ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B 2  25  ? -45.405 -3.838  52.427 1.00 100.82 ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B 2  25  ? -44.030 -2.089  52.116 1.00 100.78 ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B 2  26  ? -41.637 -5.549  55.614 1.00 98.73  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B 2  26  ? -40.806 -6.666  56.087 1.00 97.54  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B 2  26  ? -41.466 -7.378  57.274 1.00 96.72  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B 2  26  ? -41.353 -8.597  57.426 1.00 96.69  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B 2  26  ? -39.332 -6.219  56.412 1.00 97.52  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B 2  26  ? -38.502 -7.364  56.997 1.00 97.21  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B 2  26  ? -39.292 -5.024  57.356 1.00 97.60  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B 2  26  ? -38.037 -8.371  55.980 1.00 97.20  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B 2  27  ? -42.177 -6.609  58.092 1.00 95.56  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B 2  27  ? -42.924 -7.162  59.211 1.00 94.45  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B 2  27  ? -44.074 -8.028  58.716 1.00 93.66  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B 2  27  ? -44.696 -8.750  59.496 1.00 93.76  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B 2  27  ? -43.437 -6.042  60.113 1.00 94.46  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B 2  27  ? -42.348 -5.363  60.924 1.00 94.26  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B 2  27  ? -41.750 -6.270  61.979 1.00 94.16  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B 2  27  ? -42.446 -7.093  62.577 1.00 94.38  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B 2  27  ? -40.455 -6.119  62.220 1.00 93.99  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B 2  28  ? -44.340 -7.956  57.412 1.00 92.60  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B 2  28  ? -45.337 -8.801  56.762 1.00 91.39  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B 2  28  ? -44.910 -10.255 56.747 1.00 90.51  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B 2  28  ? -45.730 -11.153 56.529 1.00 90.47  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B 2  29  ? -43.615 -10.477 56.966 1.00 89.54  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B 2  29  ? -43.075 -11.814 57.163 1.00 88.40  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B 2  29  ? -43.267 -12.116 58.640 1.00 87.66  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B 2  29  ? -42.373 -11.906 59.466 1.00 87.64  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B 2  29  ? -41.585 -11.924 56.736 1.00 88.36  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B 2  29  ? -41.355 -11.319 55.342 1.00 87.94  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B 2  29  ? -41.106 -13.376 56.787 1.00 88.60  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B 2  29  ? -42.125 -11.982 54.207 1.00 87.23  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B 2  30  ? -44.465 -12.598 58.947 1.00 86.62  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B 2  30  ? -44.954 -12.752 60.311 1.00 85.72  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B 2  30  ? -44.218 -13.827 61.104 1.00 84.89  ? 30   THR B C     1 
ATOM   877   O  O     . THR B 2  30  ? -43.544 -14.682 60.533 1.00 84.88  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B 2  30  ? -46.450 -13.099 60.291 1.00 85.85  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B 2  30  ? -46.641 -14.343 59.601 1.00 86.11  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B 2  30  ? -47.245 -12.003 59.587 1.00 85.87  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B 2  31  ? -44.364 -13.772 62.424 1.00 83.85  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B 2  31  ? -43.812 -14.780 63.319 1.00 83.03  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B 2  31  ? -44.297 -16.208 62.994 1.00 82.48  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B 2  31  ? -43.483 -17.133 62.966 1.00 82.45  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B 2  31  ? -44.085 -14.404 64.785 1.00 82.98  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B 2  31  ? -43.783 -15.508 65.790 1.00 82.96  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B 2  31  ? -43.743 -14.990 67.211 1.00 82.69  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B 2  31  ? -43.703 -16.138 68.203 1.00 82.44  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B 2  31  ? -43.589 -15.656 69.607 1.00 82.56  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B 2  32  ? -45.613 -16.396 62.741 1.00 81.96  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B 2  32  ? -46.076 -17.753 62.421 1.00 81.43  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B 2  32  ? -45.496 -18.289 61.124 1.00 80.76  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B 2  32  ? -45.301 -19.493 60.999 1.00 80.75  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B 2  32  ? -47.594 -17.588 62.278 1.00 81.54  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B 2  32  ? -47.920 -16.364 63.048 1.00 81.82  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B 2  32  ? -46.747 -15.457 62.843 1.00 81.95  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B 2  33  ? -45.235 -17.397 60.172 1.00 80.11  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B 2  33  ? -44.609 -17.768 58.907 1.00 79.43  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B 2  33  ? -43.166 -18.209 59.131 1.00 78.91  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B 2  33  ? -42.788 -19.316 58.739 1.00 78.95  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B 2  33  ? -44.675 -16.614 57.923 1.00 79.49  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B 2  34  ? -42.377 -17.350 59.779 1.00 78.09  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B 2  34  ? -40.985 -17.654 60.119 1.00 77.33  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B 2  34  ? -40.875 -18.933 60.952 1.00 77.15  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B 2  34  ? -39.905 -19.685 60.820 1.00 77.24  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B 2  34  ? -40.294 -16.468 60.839 1.00 77.13  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B 2  34  ? -40.270 -15.239 59.924 1.00 76.85  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B 2  34  ? -38.880 -16.838 61.258 1.00 76.59  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B 2  34  ? -39.688 -13.980 60.549 1.00 76.39  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B 2  35  ? -41.877 -19.187 61.790 1.00 76.75  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B 2  35  ? -41.893 -20.391 62.616 1.00 76.44  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B 2  35  ? -42.119 -21.656 61.786 1.00 75.74  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B 2  35  ? -41.533 -22.701 62.071 1.00 75.58  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B 2  35  ? -42.944 -20.274 63.719 1.00 76.76  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B 2  35  ? -42.861 -21.363 64.779 1.00 78.11  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B 2  35  ? -44.009 -21.246 65.746 1.00 80.81  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B 2  35  ? -43.776 -20.221 66.762 1.00 82.56  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B 2  35  ? -43.521 -20.487 68.041 1.00 83.95  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B 2  35  ? -43.462 -21.744 68.474 1.00 84.76  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B 2  35  ? -43.331 -19.492 68.894 1.00 84.50  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B 2  36  ? -42.964 -21.552 60.762 1.00 74.98  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B 2  36  ? -43.248 -22.684 59.881 1.00 74.13  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B 2  36  ? -42.021 -23.057 59.060 1.00 73.53  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B 2  36  ? -41.744 -24.236 58.853 1.00 73.40  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B 2  36  ? -44.449 -22.392 58.982 1.00 74.06  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B 2  36  ? -45.780 -22.422 59.722 1.00 74.22  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B 2  36  ? -46.958 -22.203 58.788 1.00 74.61  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B 2  36  ? -46.836 -20.961 58.027 1.00 74.87  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B 2  36  ? -47.555 -19.863 58.236 1.00 74.49  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B 2  36  ? -48.480 -19.819 59.188 1.00 74.34  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B 2  36  ? -47.350 -18.802 57.475 1.00 74.82  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B 2  37  ? -41.284 -22.045 58.613 1.00 72.92  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B 2  37  ? -40.012 -22.257 57.932 1.00 72.43  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B 2  37  ? -39.030 -22.966 58.854 1.00 72.18  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B 2  37  ? -38.453 -23.990 58.490 1.00 72.07  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B 2  37  ? -39.433 -20.928 57.452 1.00 72.32  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B 2  37  ? -40.184 -20.218 56.324 1.00 72.23  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B 2  37  ? -39.609 -18.829 56.140 1.00 72.30  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B 2  37  ? -40.137 -21.003 55.010 1.00 71.78  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B 2  38  ? -38.868 -22.426 60.058 1.00 71.91  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B 2  38  ? -38.076 -23.063 61.100 1.00 71.71  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B 2  38  ? -38.504 -24.510 61.327 1.00 71.65  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B 2  38  ? -37.666 -25.382 61.547 1.00 71.56  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B 2  38  ? -38.193 -22.282 62.377 1.00 71.69  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B 2  39  ? -39.813 -24.752 61.259 1.00 71.76  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B 2  39  ? -40.382 -26.085 61.465 1.00 71.72  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B 2  39  ? -39.977 -27.068 60.376 1.00 71.79  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B 2  39  ? -39.454 -28.141 60.682 1.00 71.87  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B 2  39  ? -41.903 -26.019 61.587 1.00 71.55  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B 2  39  ? -42.386 -25.480 62.913 1.00 71.62  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B 2  39  ? -42.044 -26.409 64.073 1.00 71.61  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B 2  39  ? -42.539 -25.879 65.340 1.00 71.87  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B 2  39  ? -41.859 -25.045 66.118 1.00 72.31  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B 2  39  ? -40.647 -24.652 65.767 1.00 72.67  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B 2  39  ? -42.384 -24.602 67.251 1.00 73.13  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B 2  40  ? -40.215 -26.695 59.116 1.00 71.68  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B 2  40  ? -39.778 -27.480 57.966 1.00 71.62  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B 2  40  ? -38.277 -27.736 58.070 1.00 71.78  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B 2  40  ? -37.780 -28.796 57.680 1.00 71.86  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B 2  40  ? -40.118 -26.738 56.677 1.00 71.66  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B 2  40  ? -39.831 -27.499 55.391 1.00 71.83  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B 2  40  ? -40.581 -26.889 54.219 1.00 72.15  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B 2  40  ? -41.922 -27.450 54.068 1.00 72.39  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B 2  40  ? -42.928 -26.843 53.443 1.00 72.72  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B 2  40  ? -42.764 -25.642 52.914 1.00 73.15  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B 2  40  ? -44.108 -27.436 53.352 1.00 73.12  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B 2  41  ? -37.567 -26.760 58.631 1.00 71.89  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B 2  41  ? -36.144 -26.889 58.907 1.00 71.86  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B 2  41  ? -35.849 -27.776 60.096 1.00 71.87  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B 2  41  ? -34.692 -27.976 60.440 1.00 72.06  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B 2  42  ? -36.890 -28.303 60.730 1.00 71.99  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B 2  42  ? -36.727 -29.223 61.853 1.00 72.52  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B 2  42  ? -36.321 -28.584 63.168 1.00 72.81  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B 2  42  ? -35.752 -29.256 64.035 1.00 72.67  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B 2  43  ? -36.617 -27.289 63.306 1.00 73.19  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B 2  43  ? -36.343 -26.519 64.522 1.00 73.58  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B 2  43  ? -37.459 -26.730 65.538 1.00 73.84  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B 2  43  ? -38.636 -26.550 65.224 1.00 73.87  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B 2  43  ? -36.221 -25.008 64.220 1.00 73.59  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B 2  43  ? -36.174 -24.200 65.504 1.00 73.84  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B 2  43  ? -34.991 -24.721 63.368 1.00 73.88  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B 2  44  ? -37.081 -27.100 66.757 1.00 74.22  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B 2  44  ? -38.046 -27.420 67.802 1.00 74.49  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B 2  44  ? -38.319 -26.232 68.713 1.00 74.72  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B 2  44  ? -39.475 -25.949 69.038 1.00 75.13  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B 2  44  ? -37.567 -28.622 68.618 1.00 74.47  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B 2  44  ? -38.322 -28.842 69.912 1.00 74.69  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B 2  44  ? -37.975 -30.175 70.533 1.00 74.82  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B 2  44  ? -38.679 -30.351 71.858 1.00 74.83  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B 2  44  ? -38.967 -31.786 72.075 1.00 75.75  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B 2  45  ? -37.260 -25.539 69.123 1.00 74.83  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B 2  45  ? -37.394 -24.420 70.050 1.00 74.99  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B 2  45  ? -36.766 -23.146 69.486 1.00 74.89  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B 2  45  ? -35.618 -23.157 69.050 1.00 75.03  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B 2  45  ? -36.779 -24.788 71.399 1.00 75.08  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B 2  45  ? -37.359 -24.025 72.565 1.00 75.82  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B 2  45  ? -36.818 -24.530 73.890 1.00 76.52  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B 2  45  ? -37.433 -23.815 75.005 1.00 77.86  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B 2  45  ? -37.030 -22.628 75.461 1.00 78.89  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B 2  45  ? -36.001 -22.004 74.905 1.00 78.99  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B 2  45  ? -37.660 -22.056 76.481 1.00 79.36  ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B 2  46  ? -37.522 -22.052 69.494 1.00 74.77  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B 2  46  ? -37.092 -20.813 68.834 1.00 74.75  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B 2  46  ? -36.972 -19.636 69.810 1.00 74.95  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B 2  46  ? -37.959 -19.233 70.418 1.00 75.10  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B 2  46  ? -38.057 -20.413 67.670 1.00 74.59  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B 2  46  ? -38.181 -21.537 66.641 1.00 74.00  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B 2  46  ? -37.597 -19.128 66.990 1.00 74.26  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B 2  46  ? -39.329 -21.357 65.686 1.00 73.19  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B 2  47  ? -35.767 -19.082 69.941 1.00 75.04  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B 2  47  ? -35.560 -17.856 70.708 1.00 75.15  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B 2  47  ? -36.365 -16.736 70.099 1.00 75.31  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B 2  47  ? -36.458 -16.628 68.884 1.00 75.47  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B 2  47  ? -34.088 -17.449 70.711 1.00 75.30  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B 2  47  ? -33.951 -16.041 70.860 1.00 75.27  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B 2  48  ? -36.925 -15.887 70.950 1.00 75.54  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B 2  48  ? -37.771 -14.789 70.499 1.00 75.72  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B 2  48  ? -37.062 -13.835 69.560 1.00 75.96  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B 2  48  ? -37.701 -13.221 68.704 1.00 76.16  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B 2  49  ? -35.741 -13.718 69.705 1.00 75.97  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B 2  49  ? -34.969 -12.743 68.933 1.00 75.98  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B 2  49  ? -34.741 -13.159 67.483 1.00 75.93  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B 2  49  ? -34.336 -12.331 66.650 1.00 76.00  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B 2  49  ? -33.636 -12.446 69.614 1.00 76.01  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B 2  49  ? -33.701 -11.688 70.938 1.00 76.19  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B 2  49  ? -32.405 -11.918 71.703 1.00 77.24  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B 2  49  ? -33.964 -10.197 70.726 1.00 75.72  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B 2  50  ? -35.016 -14.434 67.201 1.00 75.62  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B 2  50  ? -34.838 -15.033 65.876 1.00 75.37  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B 2  50  ? -35.621 -14.330 64.772 1.00 75.19  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B 2  50  ? -35.080 -14.093 63.691 1.00 75.33  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B 2  50  ? -35.190 -16.544 65.902 1.00 75.47  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B 2  50  ? -34.046 -17.354 66.529 1.00 75.65  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B 2  50  ? -35.573 -17.071 64.515 1.00 75.22  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B 2  50  ? -32.716 -17.261 65.798 1.00 75.86  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B 2  51  ? -36.876 -13.984 65.057 1.00 74.83  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B 2  51  ? -37.786 -13.438 64.048 1.00 74.63  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B 2  51  ? -37.285 -12.130 63.439 1.00 74.56  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B 2  51  ? -37.423 -11.913 62.237 1.00 74.45  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B 2  51  ? -39.216 -13.326 64.603 1.00 74.65  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B 2  51  ? -39.657 -14.590 65.322 1.00 74.62  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B 2  51  ? -40.089 -15.710 64.612 1.00 74.54  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B 2  51  ? -39.608 -14.676 66.714 1.00 74.59  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B 2  51  ? -40.469 -16.878 65.273 1.00 74.31  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B 2  51  ? -39.985 -15.837 67.384 1.00 74.17  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B 2  51  ? -40.415 -16.930 66.659 1.00 74.27  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B 2  51  ? -40.787 -18.077 67.317 1.00 74.61  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B 2  52  ? -36.677 -11.275 64.255 1.00 74.65  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B 2  52  ? -36.012 -10.072 63.732 1.00 74.68  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B 2  52  ? -34.707 -10.384 63.005 1.00 74.33  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B 2  52  ? -34.452 -9.804  61.949 1.00 74.51  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B 2  52  ? -35.768 -9.019  64.822 1.00 74.91  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B 2  52  ? -36.976 -8.132  65.119 1.00 75.47  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B 2  52  ? -37.501 -7.416  63.886 1.00 76.32  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B 2  52  ? -36.805 -6.514  63.375 1.00 77.03  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B 2  52  ? -38.614 -7.758  63.429 1.00 76.39  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B 2  53  ? -33.887 -11.279 63.567 1.00 73.67  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B 2  53  ? -32.661 -11.723 62.887 1.00 73.03  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B 2  53  ? -32.979 -12.322 61.512 1.00 72.53  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B 2  53  ? -32.353 -11.956 60.512 1.00 72.62  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B 2  53  ? -31.861 -12.713 63.742 1.00 72.94  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B 2  53  ? -30.456 -13.034 63.208 1.00 72.76  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B 2  53  ? -29.438 -11.915 63.428 1.00 73.33  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B 2  53  ? -29.519 -11.200 64.448 1.00 74.17  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B 2  53  ? -28.531 -11.756 62.585 1.00 73.43  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B 2  54  ? -33.968 -13.211 61.469 1.00 71.70  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B 2  54  ? -34.372 -13.864 60.232 1.00 71.10  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B 2  54  ? -34.844 -12.859 59.175 1.00 71.23  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B 2  54  ? -34.394 -12.911 58.025 1.00 71.21  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B 2  54  ? -35.421 -14.948 60.501 1.00 70.82  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B 2  54  ? -34.891 -15.867 61.458 1.00 70.20  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B 2  54  ? -35.748 -15.712 59.242 1.00 70.54  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B 2  55  ? -35.720 -11.934 59.571 1.00 71.22  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B 2  55  ? -36.199 -10.877 58.669 1.00 71.00  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B 2  55  ? -35.039 -10.107 58.045 1.00 70.88  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B 2  55  ? -35.068 -9.796  56.854 1.00 70.88  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B 2  55  ? -37.155 -9.922  59.388 1.00 70.95  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B 2  55  ? -38.570 -10.448 59.494 1.00 71.02  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B 2  55  ? -39.510 -9.474  60.192 1.00 71.20  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B 2  55  ? -40.661 -10.189 60.743 1.00 71.66  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B 2  55  ? -40.870 -10.434 62.039 1.00 71.99  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B 2  55  ? -40.027 -9.999  62.974 1.00 71.51  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B 2  55  ? -41.946 -11.114 62.406 1.00 72.37  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B 2  56  ? -34.021 -9.818  58.854 1.00 70.71  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B 2  56  ? -32.809 -9.165  58.373 1.00 70.62  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B 2  56  ? -32.121 -10.013 57.319 1.00 70.60  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B 2  56  ? -31.701 -9.498  56.276 1.00 70.64  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B 2  57  ? -32.027 -11.316 57.592 1.00 70.29  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B 2  57  ? -31.385 -12.267 56.688 1.00 70.00  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B 2  57  ? -32.120 -12.308 55.348 1.00 69.91  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B 2  57  ? -31.496 -12.240 54.283 1.00 69.86  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B 2  57  ? -31.298 -13.686 57.321 1.00 69.97  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B 2  57  ? -30.984 -14.754 56.269 1.00 70.18  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B 2  57  ? -30.260 -13.714 58.429 1.00 69.65  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B 2  58  ? -33.447 -12.397 55.412 1.00 69.73  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B 2  58  ? -34.263 -12.471 54.208 1.00 69.60  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B 2  58  ? -34.083 -11.232 53.340 1.00 69.88  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B 2  58  ? -34.094 -11.328 52.106 1.00 70.22  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B 2  58  ? -35.733 -12.671 54.559 1.00 69.32  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B 2  58  ? -36.702 -12.697 53.381 1.00 68.93  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B 2  58  ? -36.414 -13.857 52.446 1.00 68.81  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B 2  58  ? -38.126 -12.751 53.879 1.00 69.05  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B 2  59  ? -33.907 -10.080 53.993 1.00 69.83  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B 2  59  ? -33.675 -8.809  53.308 1.00 69.64  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B 2  59  ? -32.384 -8.854  52.505 1.00 69.30  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B 2  59  ? -32.355 -8.408  51.358 1.00 69.39  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B 2  59  ? -33.643 -7.651  54.312 1.00 69.94  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B 2  59  ? -33.488 -6.242  53.704 1.00 70.54  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B 2  59  ? -33.929 -5.168  54.705 1.00 71.06  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B 2  59  ? -33.932 -3.769  54.102 1.00 71.19  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B 2  59  ? -32.689 -3.018  54.408 1.00 71.45  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B 2  60  ? -31.327 -9.403  53.106 1.00 68.81  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B 2  60  ? -30.030 -9.511  52.435 1.00 68.32  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B 2  60  ? -30.125 -10.470 51.258 1.00 68.12  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B 2  60  ? -29.563 -10.204 50.193 1.00 68.01  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B 2  60  ? -28.902 -9.950  53.394 1.00 68.16  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B 2  60  ? -27.637 -10.255 52.627 1.00 68.01  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B 2  60  ? -28.621 -8.868  54.414 1.00 68.67  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B 2  61  ? -30.847 -11.575 51.446 1.00 67.88  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B 2  61  ? -31.013 -12.541 50.372 1.00 67.71  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B 2  61  ? -31.665 -11.864 49.174 1.00 67.89  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B 2  61  ? -31.134 -11.902 48.062 1.00 67.96  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B 2  61  ? -31.831 -13.757 50.813 1.00 67.43  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B 2  61  ? -32.001 -14.790 49.729 1.00 67.09  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B 2  61  ? -31.014 -15.732 49.486 1.00 67.24  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B 2  61  ? -33.141 -14.811 48.939 1.00 66.90  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B 2  61  ? -31.165 -16.684 48.481 1.00 66.89  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B 2  61  ? -33.295 -15.757 47.928 1.00 66.34  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B 2  61  ? -32.309 -16.690 47.701 1.00 66.45  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B 2  62  ? -32.799 -11.218 49.419 1.00 67.98  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B 2  62  ? -33.595 -10.658 48.341 1.00 68.11  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B 2  62  ? -32.894 -9.512  47.619 1.00 68.50  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B 2  62  ? -32.796 -9.537  46.394 1.00 68.69  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B 2  62  ? -34.996 -10.286 48.829 1.00 67.91  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B 2  62  ? -35.870 -11.513 49.120 1.00 67.53  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B 2  62  ? -37.057 -11.140 49.951 1.00 67.61  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B 2  62  ? -36.331 -12.186 47.845 1.00 67.28  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B 2  63  ? -32.386 -8.530  48.366 1.00 68.81  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B 2  63  ? -31.576 -7.453  47.783 1.00 69.10  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B 2  63  ? -30.583 -8.014  46.772 1.00 69.37  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B 2  63  ? -30.610 -7.644  45.597 1.00 69.30  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B 2  63  ? -30.817 -6.693  48.866 1.00 69.02  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B 2  63  ? -31.659 -5.734  49.673 1.00 69.70  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B 2  63  ? -30.926 -5.184  50.884 1.00 70.24  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B 2  63  ? -30.218 -5.966  51.563 1.00 70.56  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B 2  63  ? -31.062 -3.969  51.160 1.00 70.12  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B 2  64  ? -29.734 -8.930  47.247 1.00 69.71  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B 2  64  ? -28.720 -9.605  46.437 1.00 69.95  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B 2  64  ? -29.273 -10.276 45.174 1.00 70.12  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B 2  64  ? -28.721 -10.103 44.081 1.00 70.19  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B 2  64  ? -27.941 -10.615 47.291 1.00 69.87  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B 2  64  ? -26.853 -9.961  48.135 1.00 70.13  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B 2  64  ? -26.234 -8.981  47.725 1.00 71.41  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B 2  64  ? -26.606 -10.515 49.314 1.00 70.08  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B 2  65  ? -30.364 -11.026 45.325 1.00 70.17  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B 2  65  ? -30.982 -11.714 44.195 1.00 70.26  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B 2  65  ? -31.728 -10.735 43.273 1.00 70.47  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B 2  65  ? -31.569 -10.790 42.049 1.00 70.58  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B 2  65  ? -31.910 -12.860 44.656 1.00 70.16  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B 2  65  ? -32.439 -13.618 43.467 1.00 70.17  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B 2  65  ? -31.166 -13.815 45.567 1.00 70.13  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B 2  66  ? -32.517 -9.835  43.862 1.00 70.61  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B 2  66  ? -33.307 -8.857  43.102 1.00 70.71  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B 2  66  ? -32.421 -7.892  42.312 1.00 70.82  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B 2  66  ? -32.642 -7.685  41.116 1.00 70.66  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B 2  66  ? -34.311 -8.095  44.010 1.00 70.67  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B 2  66  ? -35.473 -9.017  44.392 1.00 70.71  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B 2  66  ? -34.852 -6.852  43.312 1.00 70.89  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B 2  66  ? -36.378 -8.488  45.499 1.00 70.41  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B 2  67  ? -31.426 -7.315  42.987 1.00 71.04  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B 2  67  ? -30.415 -6.453  42.360 1.00 71.35  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B 2  67  ? -29.929 -7.019  41.017 1.00 71.52  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B 2  67  ? -29.976 -6.332  39.996 1.00 71.12  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B 2  67  ? -29.253 -6.236  43.344 1.00 71.36  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B 2  67  ? -27.913 -5.796  42.767 1.00 71.85  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B 2  67  ? -26.789 -5.947  43.816 1.00 73.20  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B 2  67  ? -26.851 -4.922  44.868 1.00 74.17  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B 2  67  ? -27.073 -5.150  46.167 1.00 73.89  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B 2  67  ? -27.250 -6.384  46.636 1.00 73.03  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B 2  67  ? -27.108 -4.125  47.010 1.00 73.63  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B 2  68  ? -29.497 -8.281  41.035 1.00 72.06  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B 2  68  ? -29.016 -8.979  39.842 1.00 72.52  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B 2  68  ? -30.121 -9.215  38.809 1.00 72.95  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B 2  68  ? -29.908 -8.997  37.617 1.00 72.99  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B 2  68  ? -28.315 -10.290 40.225 1.00 72.35  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B 2  68  ? -26.844 -10.088 40.609 1.00 72.54  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B 2  68  ? -26.490 -9.041  41.194 1.00 73.29  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B 2  68  ? -26.027 -10.989 40.332 1.00 71.95  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B 2  69  ? -31.295 -9.649  39.270 1.00 73.57  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B 2  69  ? -32.464 -9.851  38.400 1.00 74.11  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B 2  69  ? -32.863 -8.571  37.661 1.00 74.55  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B 2  69  ? -32.985 -8.565  36.438 1.00 74.52  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B 2  69  ? -33.645 -10.394 39.204 1.00 73.93  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B 2  70  ? -33.061 -7.495  38.420 1.00 75.20  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B 2  70  ? -33.373 -6.175  37.871 1.00 75.82  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B 2  70  ? -32.295 -5.713  36.889 1.00 76.42  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B 2  70  ? -32.605 -5.058  35.890 1.00 76.61  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B 2  70  ? -33.550 -5.130  39.001 1.00 75.76  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B 2  70  ? -33.615 -3.701  38.446 1.00 75.35  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B 2  70  ? -34.788 -5.456  39.824 1.00 75.85  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B 2  71  ? -31.040 -6.061  37.177 1.00 76.96  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B 2  71  ? -29.921 -5.739  36.299 1.00 77.59  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B 2  71  ? -30.086 -6.454  34.960 1.00 78.00  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B 2  71  ? -29.733 -5.913  33.917 1.00 78.07  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B 2  71  ? -28.574 -6.089  36.961 1.00 77.75  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B 2  71  ? -28.477 -5.408  38.219 1.00 78.42  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B 2  71  ? -27.396 -5.676  36.088 1.00 77.68  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B 2  72  ? -30.644 -7.663  34.995 1.00 78.69  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B 2  72  ? -31.026 -8.372  33.770 1.00 79.25  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B 2  72  ? -32.200 -7.697  33.067 1.00 79.69  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B 2  72  ? -32.240 -7.650  31.840 1.00 79.78  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B 2  72  ? -31.362 -9.841  34.053 1.00 79.14  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B 2  72  ? -30.154 -10.704 34.315 1.00 78.87  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B 2  72  ? -30.103 -11.549 35.420 1.00 78.71  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B 2  72  ? -29.058 -10.672 33.458 1.00 78.65  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B 2  72  ? -28.985 -12.344 35.662 1.00 78.74  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B 2  72  ? -27.942 -11.458 33.688 1.00 78.81  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B 2  72  ? -27.907 -12.290 34.791 1.00 78.90  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B 2  72  ? -26.791 -13.066 35.014 1.00 79.17  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B 2  73  ? -33.149 -7.185  33.848 1.00 80.28  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B 2  73  ? -34.320 -6.509  33.298 1.00 80.93  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B 2  73  ? -33.898 -5.259  32.532 1.00 81.57  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B 2  73  ? -34.315 -5.061  31.391 1.00 81.76  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B 2  73  ? -35.351 -6.156  34.396 1.00 80.77  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B 2  73  ? -35.618 -7.318  35.188 1.00 81.10  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B 2  73  ? -36.655 -5.683  33.787 1.00 80.47  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B 2  74  ? -33.052 -4.439  33.152 1.00 82.35  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B 2  74  ? -32.580 -3.193  32.538 1.00 83.19  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B 2  74  ? -31.785 -3.422  31.258 1.00 83.25  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B 2  74  ? -31.909 -2.652  30.302 1.00 83.40  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B 2  74  ? -31.754 -2.363  33.528 1.00 83.44  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B 2  74  ? -32.600 -1.534  34.480 1.00 85.07  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B 2  74  ? -31.780 -0.564  35.309 1.00 87.29  ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B 2  74  ? -31.789 0.649   34.985 1.00 88.20  ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B 2  74  ? -31.122 -1.016  36.277 1.00 88.00  ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B 2  75  ? -30.978 -4.480  31.241 1.00 83.32  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B 2  75  ? -30.205 -4.826  30.050 1.00 83.41  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B 2  75  ? -31.107 -5.192  28.871 1.00 83.52  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B 2  75  ? -30.792 -4.890  27.723 1.00 83.55  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B 2  75  ? -29.235 -5.967  30.338 1.00 83.32  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B 2  75  ? -28.272 -6.216  29.226 1.00 83.27  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B 2  75  ? -27.046 -5.595  29.154 1.00 83.56  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B 2  75  ? -28.367 -6.989  28.119 1.00 83.52  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B 2  75  ? -26.416 -5.990  28.063 1.00 83.68  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B 2  75  ? -27.198 -6.834  27.415 1.00 83.75  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B 2  76  ? -32.228 -5.845  29.172 1.00 83.67  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B 2  76  ? -33.228 -6.206  28.175 1.00 83.65  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B 2  76  ? -34.119 -5.019  27.811 1.00 83.66  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B 2  76  ? -34.960 -5.125  26.915 1.00 83.70  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B 2  76  ? -34.072 -7.362  28.684 1.00 83.74  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B 2  77  ? -33.923 -3.897  28.506 1.00 83.62  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B 2  77  ? -34.739 -2.694  28.337 1.00 83.61  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B 2  77  ? -36.217 -3.008  28.568 1.00 83.48  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B 2  77  ? -37.064 -2.759  27.707 1.00 83.43  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B 2  77  ? -34.516 -2.067  26.956 1.00 83.63  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B 2  77  ? -33.141 -1.457  26.759 1.00 84.19  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B 2  77  ? -32.901 -1.131  25.294 1.00 84.93  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B 2  77  ? -31.477 -0.662  25.044 1.00 84.87  ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B 2  77  ? -31.100 -0.826  23.611 1.00 85.13  ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B 2  78  ? -36.507 -3.569  29.737 1.00 83.32  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B 2  78  ? -37.858 -3.976  30.096 1.00 83.25  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B 2  78  ? -38.278 -3.333  31.416 1.00 83.19  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B 2  78  ? -37.436 -2.876  32.187 1.00 83.18  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B 2  78  ? -37.945 -5.502  30.191 1.00 83.36  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B 2  78  ? -37.693 -6.242  28.880 1.00 83.59  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B 2  78  ? -38.191 -7.688  28.944 1.00 84.23  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B 2  78  ? -37.133 -8.644  29.278 1.00 84.70  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B 2  78  ? -36.784 -8.999  30.514 1.00 84.49  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B 2  78  ? -37.399 -8.485  31.572 1.00 84.36  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B 2  78  ? -35.812 -9.880  30.692 1.00 84.43  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B 2  79  ? -39.584 -3.282  31.659 1.00 83.22  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B 2  79  ? -40.130 -2.721  32.898 1.00 83.28  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B 2  79  ? -40.667 -3.841  33.791 1.00 83.04  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B 2  79  ? -40.985 -3.622  34.962 1.00 82.96  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B 2  79  ? -41.247 -1.712  32.593 1.00 83.47  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B 2  79  ? -40.805 -0.442  31.877 1.00 83.95  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B 2  79  ? -41.951 0.559   31.828 1.00 85.54  ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B 2  79  ? -41.454 1.977   31.531 1.00 86.60  ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B 2  79  ? -42.565 2.984   31.497 1.00 86.53  ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B 2  80  ? -40.760 -5.039  33.217 1.00 82.70  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B 2  80  ? -41.276 -6.213  33.904 1.00 82.24  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B 2  80  ? -40.149 -7.202  34.168 1.00 81.92  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B 2  80  ? -39.539 -7.720  33.227 1.00 81.86  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B 2  80  ? -42.355 -6.917  33.067 1.00 82.22  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B 2  80  ? -43.157 -5.937  32.399 1.00 82.41  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B 2  80  ? -43.238 -7.781  33.950 1.00 82.21  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B 2  81  ? -39.876 -7.452  35.449 1.00 81.45  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B 2  81  ? -38.897 -8.456  35.850 1.00 80.98  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B 2  81  ? -39.505 -9.825  35.579 1.00 80.56  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B 2  81  ? -40.506 -10.194 36.195 1.00 80.60  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B 2  81  ? -38.500 -8.337  37.346 1.00 80.99  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B 2  81  ? -37.576 -9.479  37.745 1.00 81.38  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B 2  81  ? -37.823 -7.000  37.632 1.00 80.81  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B 2  82  ? -38.899 -10.559 34.648 1.00 79.95  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B 2  82  ? -39.408 -11.859 34.217 1.00 79.47  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B 2  82  ? -38.755 -12.996 34.995 1.00 78.94  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B 2  82  ? -37.654 -12.840 35.511 1.00 78.85  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B 2  82  ? -39.180 -12.077 32.711 1.00 79.60  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B 2  82  ? -37.776 -12.034 32.425 1.00 80.25  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B 2  82  ? -39.882 -10.995 31.901 1.00 79.71  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B 2  83  ? -39.437 -14.138 35.069 1.00 78.41  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B 2  83  ? -38.951 -15.303 35.821 1.00 77.76  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B 2  83  ? -37.523 -15.703 35.445 1.00 77.25  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B 2  83  ? -36.763 -16.164 36.300 1.00 77.09  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B 2  83  ? -39.900 -16.484 35.652 1.00 77.80  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B 2  84  ? -37.169 -15.517 34.173 1.00 76.51  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B 2  84  ? -35.816 -15.790 33.705 1.00 75.87  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B 2  84  ? -34.817 -14.810 34.290 1.00 75.40  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B 2  84  ? -33.715 -15.206 34.643 1.00 75.42  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B 2  84  ? -35.735 -15.801 32.179 1.00 75.96  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B 2  84  ? -36.517 -16.929 31.531 1.00 76.23  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B 2  84  ? -36.250 -18.528 32.323 1.00 77.25  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B 2  84  ? -34.623 -18.944 31.723 1.00 76.62  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B 2  85  ? -35.202 -13.541 34.403 1.00 74.93  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B 2  85  ? -34.380 -12.546 35.105 1.00 74.61  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B 2  85  ? -34.046 -13.023 36.515 1.00 74.35  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B 2  85  ? -32.930 -12.828 36.996 1.00 74.43  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B 2  85  ? -35.100 -11.199 35.207 1.00 74.57  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B 2  85  ? -35.230 -10.502 33.881 1.00 74.39  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B 2  85  ? -34.341 -10.676 33.019 1.00 74.05  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B 2  85  ? -36.226 -9.768  33.713 1.00 74.36  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B 2  86  ? -35.032 -13.637 37.166 1.00 73.90  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B 2  86  ? -34.890 -14.144 38.520 1.00 73.29  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B 2  86  ? -34.066 -15.421 38.494 1.00 72.91  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B 2  86  ? -33.060 -15.508 39.191 1.00 73.11  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B 2  86  ? -36.272 -14.375 39.197 1.00 73.39  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B 2  86  ? -36.120 -15.116 40.514 1.00 73.11  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B 2  86  ? -36.990 -13.044 39.418 1.00 73.25  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B 2  87  ? -34.483 -16.391 37.680 1.00 72.32  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B 2  87  ? -33.781 -17.676 37.567 1.00 71.86  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B 2  87  ? -32.286 -17.502 37.263 1.00 71.59  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B 2  87  ? -31.444 -18.113 37.921 1.00 71.47  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B 2  87  ? -34.465 -18.624 36.542 1.00 71.78  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B 2  87  ? -33.490 -19.668 36.009 1.00 71.92  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B 2  87  ? -35.664 -19.303 37.169 1.00 71.53  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B 2  88  ? -31.965 -16.659 36.287 1.00 71.37  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B 2  88  ? -30.575 -16.374 35.951 1.00 71.43  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B 2  88  ? -29.813 -15.762 37.117 1.00 71.15  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B 2  88  ? -28.682 -16.173 37.391 1.00 71.35  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B 2  88  ? -30.467 -15.467 34.722 1.00 71.65  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B 2  88  ? -30.950 -16.106 33.438 1.00 72.79  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B 2  88  ? -31.536 -15.337 32.432 1.00 73.65  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B 2  88  ? -30.834 -17.481 33.230 1.00 73.70  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B 2  88  ? -31.989 -15.920 31.253 1.00 73.77  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B 2  88  ? -31.280 -18.069 32.059 1.00 74.01  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B 2  88  ? -31.852 -17.284 31.075 1.00 73.80  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B 2  88  ? -32.286 -17.876 29.912 1.00 74.41  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B 2  89  ? -30.431 -14.789 37.793 1.00 70.64  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B 2  89  ? -29.844 -14.156 38.976 1.00 70.06  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B 2  89  ? -29.548 -15.222 40.007 1.00 69.87  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B 2  89  ? -28.441 -15.300 40.527 1.00 69.94  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B 2  89  ? -30.776 -13.114 39.550 1.00 70.00  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B 2  90  ? -30.545 -16.059 40.272 1.00 69.68  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B 2  90  ? -30.397 -17.192 41.168 1.00 69.45  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B 2  90  ? -29.229 -18.099 40.777 1.00 69.65  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B 2  90  ? -28.428 -18.466 41.631 1.00 69.68  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B 2  90  ? -31.701 -17.985 41.241 1.00 69.18  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B 2  90  ? -32.874 -17.351 41.990 1.00 68.54  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B 2  90  ? -34.137 -18.109 41.670 1.00 68.11  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B 2  90  ? -32.645 -17.303 43.501 1.00 67.99  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B 2  91  ? -29.120 -18.447 39.495 1.00 69.95  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B 2  91  ? -28.001 -19.275 39.031 1.00 70.24  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B 2  91  ? -26.648 -18.607 39.292 1.00 70.53  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B 2  91  ? -25.692 -19.263 39.703 1.00 70.67  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B 2  91  ? -28.137 -19.648 37.550 1.00 70.03  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B 2  91  ? -26.941 -20.431 37.020 1.00 70.05  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B 2  91  ? -27.341 -21.535 36.064 1.00 70.83  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B 2  91  ? -27.153 -21.120 34.611 1.00 71.56  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B 2  91  ? -27.209 -22.309 33.709 1.00 71.77  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B 2  92  ? -26.577 -17.301 39.069 1.00 70.73  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B 2  92  ? -25.311 -16.605 39.197 1.00 71.03  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B 2  92  ? -24.924 -16.306 40.650 1.00 71.26  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B 2  92  ? -23.741 -16.114 40.943 1.00 71.56  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B 2  92  ? -25.283 -15.351 38.319 1.00 71.16  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B 2  92  ? -25.872 -14.087 38.926 1.00 71.18  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B 2  92  ? -25.307 -12.887 38.204 1.00 71.74  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B 2  92  ? -23.872 -13.051 37.993 1.00 72.72  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B 2  92  ? -22.929 -12.631 38.830 1.00 73.51  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B 2  92  ? -23.256 -11.987 39.945 1.00 74.20  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B 2  92  ? -21.651 -12.846 38.542 1.00 73.66  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B 2  93  ? -25.906 -16.269 41.551 1.00 71.17  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B 2  93  ? -25.615 -16.192 42.982 1.00 71.12  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B 2  93  ? -25.242 -17.582 43.494 1.00 70.99  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B 2  93  ? -24.869 -17.747 44.654 1.00 71.12  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B 2  93  ? -26.807 -15.644 43.777 1.00 71.10  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B 2  93  ? -27.275 -14.250 43.380 1.00 72.27  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B 2  93  ? -26.220 -13.157 43.575 1.00 74.11  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B 2  93  ? -25.659 -12.988 44.660 1.00 75.44  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B 2  93  ? -25.966 -12.396 42.521 1.00 74.48  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B 2  94  ? -25.352 -18.577 42.619 1.00 70.82  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B 2  94  ? -25.086 -19.962 42.983 1.00 70.78  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B 2  94  ? -26.254 -20.651 43.668 1.00 70.63  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B 2  94  ? -26.069 -21.663 44.344 1.00 70.78  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B 2  95  ? -27.453 -20.102 43.492 1.00 70.45  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B 2  95  ? -28.672 -20.669 44.060 1.00 70.22  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B 2  95  ? -29.587 -21.196 42.949 1.00 69.94  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B 2  95  ? -30.756 -20.830 42.904 1.00 69.76  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B 2  95  ? -29.445 -19.615 44.866 1.00 70.28  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B 2  95  ? -28.652 -18.726 45.829 1.00 71.10  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B 2  95  ? -28.380 -19.362 47.199 1.00 73.27  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B 2  95  ? -29.396 -20.332 47.618 1.00 74.90  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B 2  95  ? -29.291 -21.118 48.692 1.00 75.83  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B 2  95  ? -28.216 -21.053 49.479 1.00 75.50  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B 2  95  ? -30.266 -21.971 48.987 1.00 76.45  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B 2  96  ? -29.060 -22.043 42.061 1.00 69.83  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B 2  96  ? -29.823 -22.600 40.926 1.00 69.60  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B 2  96  ? -31.185 -23.131 41.350 1.00 69.85  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B 2  96  ? -31.299 -23.815 42.373 1.00 70.34  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B 2  96  ? -29.071 -23.757 40.253 1.00 69.35  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B 2  96  ? -27.764 -23.323 39.869 1.00 69.29  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B 2  96  ? -29.813 -24.246 39.025 1.00 69.27  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B 2  97  ? -32.207 -22.824 40.553 1.00 69.79  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B 2  97  ? -33.581 -23.216 40.847 1.00 69.64  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B 2  97  ? -34.222 -23.859 39.618 1.00 69.78  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B 2  97  ? -34.100 -23.341 38.515 1.00 69.95  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B 2  97  ? -34.373 -21.986 41.290 1.00 69.41  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B 2  97  ? -35.876 -22.081 41.552 1.00 69.55  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B 2  97  ? -36.163 -22.466 42.987 1.00 69.69  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B 2  97  ? -36.536 -20.751 41.236 1.00 69.82  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B 2  98  ? -34.895 -24.990 39.806 1.00 70.02  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B 2  98  ? -35.639 -25.636 38.724 1.00 70.21  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B 2  98  ? -37.136 -25.408 38.870 1.00 71.18  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B 2  98  ? -37.652 -25.315 39.987 1.00 71.21  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B 2  98  ? -35.396 -27.140 38.699 1.00 69.66  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B 2  98  ? -33.990 -27.580 38.381 1.00 68.37  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B 2  98  ? -33.016 -26.675 37.948 1.00 67.76  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B 2  98  ? -33.640 -28.916 38.486 1.00 66.61  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B 2  98  ? -31.725 -27.097 37.652 1.00 66.40  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B 2  98  ? -32.365 -29.344 38.191 1.00 66.00  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B 2  98  ? -31.416 -28.434 37.774 1.00 66.02  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B 2  98  ? -30.157 -28.881 37.495 1.00 65.92  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B 2  99  ? -37.829 -25.327 37.733 1.00 72.17  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B 2  99  ? -39.290 -25.260 37.710 1.00 73.26  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B 2  99  ? -39.906 -23.962 37.224 1.00 74.06  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B 2  99  ? -41.112 -23.763 37.366 1.00 74.22  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B 2  100 ? -39.090 -23.078 36.655 1.00 74.85  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B 2  100 ? -39.579 -21.799 36.140 1.00 75.71  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B 2  100 ? -38.923 -21.433 34.806 1.00 76.48  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B 2  100 ? -38.832 -20.259 34.442 1.00 76.73  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B 2  100 ? -39.372 -20.682 37.173 1.00 75.55  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B 2  100 ? -40.157 -20.872 38.442 1.00 75.37  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B 2  100 ? -39.565 -21.432 39.560 1.00 75.16  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B 2  100 ? -41.493 -20.493 38.517 1.00 75.36  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B 2  100 ? -40.287 -21.611 40.732 1.00 74.74  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B 2  100 ? -42.218 -20.670 39.685 1.00 74.78  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B 2  100 ? -41.611 -21.229 40.793 1.00 74.58  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B 2  101 ? -38.473 -22.447 34.075 1.00 77.29  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B 2  101 ? -37.805 -22.232 32.797 1.00 78.23  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B 2  101 ? -36.296 -22.294 32.932 1.00 78.87  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B 2  101 ? -35.771 -22.470 34.038 1.00 79.16  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B 2  102 ? -35.603 -22.160 31.804 1.00 79.26  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B 2  102 ? -34.142 -22.158 31.780 1.00 79.56  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B 2  102 ? -33.554 -23.547 31.881 1.00 79.78  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B 2  102 ? -32.336 -23.705 31.934 1.00 80.04  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B 2  102 ? -34.274 -24.544 31.911 1.00 79.91  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C 3  14  ? 0.717   5.842   12.626 1.00 98.94  ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C 3  14  ? -0.378  4.992   13.186 1.00 98.97  ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C 3  14  ? -0.460  5.093   14.711 1.00 98.95  ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C 3  14  ? 0.542   4.916   15.418 1.00 99.02  ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C 3  14  ? -0.198  3.540   12.758 1.00 99.00  ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C 3  15  ? -1.661  5.381   15.209 1.00 98.71  ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C 3  15  ? -1.900  5.471   16.649 1.00 98.27  ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C 3  15  ? -2.656  4.250   17.181 1.00 97.74  ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C 3  15  ? -3.744  3.912   16.689 1.00 97.74  ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C 3  15  ? -2.621  6.779   17.002 1.00 98.37  ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C 3  15  ? -1.709  7.996   16.908 1.00 98.92  ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C 3  15  ? -2.380  9.271   17.396 1.00 99.91  ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C 3  15  ? -1.452  10.468  17.202 1.00 99.92  ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C 3  15  ? -2.053  11.746  17.672 1.00 100.22 ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C 3  16  ? -2.058  3.592   18.177 1.00 96.82  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C 3  16  ? -2.643  2.410   18.817 1.00 95.89  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C 3  16  ? -4.011  2.734   19.414 1.00 95.14  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C 3  16  ? -4.277  3.878   19.792 1.00 95.03  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C 3  16  ? -1.735  1.838   19.938 1.00 95.98  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C 3  16  ? -1.686  2.754   21.038 1.00 95.91  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C 3  16  ? -0.314  1.564   19.430 1.00 96.03  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C 3  17  ? -4.870  1.723   19.497 1.00 94.16  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C 3  17  ? -6.220  1.906   20.014 1.00 93.29  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C 3  17  ? -6.270  2.131   21.519 1.00 92.88  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C 3  17  ? -7.234  2.703   22.032 1.00 92.80  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C 3  17  ? -7.095  0.720   19.651 1.00 93.24  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C 3  17  ? -7.749  0.839   18.308 1.00 92.73  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C 3  17  ? -8.887  -0.137  18.205 1.00 91.46  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C 3  17  ? -8.439  -1.515  18.362 1.00 90.54  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C 3  17  ? -9.253  -2.541  18.569 1.00 89.82  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C 3  17  ? -10.565 -2.343  18.650 1.00 89.46  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C 3  17  ? -8.751  -3.760  18.699 1.00 89.46  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C 3  18  ? -5.245  1.660   22.223 1.00 92.33  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C 3  18  ? -5.121  1.914   23.649 1.00 91.73  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C 3  18  ? -5.104  3.426   23.863 1.00 91.50  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C 3  18  ? -6.042  3.985   24.428 1.00 91.35  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C 3  18  ? -3.860  1.248   24.208 1.00 91.72  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C 3  18  ? -3.968  -0.165  24.172 1.00 91.22  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C 3  19  ? -4.055  4.075   23.361 1.00 91.27  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C 3  19  ? -3.906  5.535   23.397 1.00 91.02  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C 3  19  ? -5.128  6.297   22.863 1.00 90.77  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C 3  19  ? -5.493  7.347   23.395 1.00 90.71  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C 3  19  ? -2.640  5.953   22.642 1.00 91.05  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C 3  19  ? -2.570  5.323   21.370 1.00 91.29  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C 3  20  ? -5.750  5.768   21.812 1.00 90.61  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C 3  20  ? -7.017  6.303   21.317 1.00 90.54  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C 3  20  ? -8.039  6.410   22.449 1.00 89.94  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C 3  20  ? -8.669  7.456   22.629 1.00 89.96  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C 3  20  ? -7.593  5.412   20.211 1.00 90.95  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C 3  20  ? -7.014  5.595   18.820 1.00 92.37  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C 3  20  ? -8.091  5.277   17.781 1.00 95.45  ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C 3  20  ? -7.538  4.780   16.522 1.00 98.69  ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C 3  20  ? -7.047  5.547   15.546 1.00 100.73 ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C 3  20  ? -7.020  6.876   15.662 1.00 101.15 ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C 3  20  ? -6.573  4.976   14.444 1.00 101.59 ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C 3  21  ? -8.187  5.321   23.206 1.00 89.19  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C 3  21  ? -9.127  5.244   24.325 1.00 88.45  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C 3  21  ? -8.520  5.772   25.625 1.00 87.90  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C 3  21  ? -9.220  5.943   26.630 1.00 87.77  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C 3  21  ? -9.606  3.816   24.505 1.00 88.46  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C 3  22  ? -7.214  6.027   25.592 1.00 87.30  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C 3  22  ? -6.484  6.570   26.735 1.00 86.51  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C 3  22  ? -6.237  5.547   27.823 1.00 85.84  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C 3  22  ? -6.548  5.795   28.986 1.00 85.93  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C 3  23  ? -5.680  4.399   27.439 1.00 85.14  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C 3  23  ? -5.420  3.297   28.365 1.00 84.45  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C 3  23  ? -4.013  2.733   28.193 1.00 84.20  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C 3  23  ? -3.484  2.703   27.084 1.00 84.19  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C 3  23  ? -6.448  2.179   28.177 1.00 84.25  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C 3  23  ? -7.943  2.512   28.224 1.00 83.97  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C 3  23  ? -8.760  1.320   27.768 1.00 84.13  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C 3  23  ? -8.388  2.955   29.605 1.00 83.96  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C 3  24  ? -3.411  2.301   29.299 1.00 83.83  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C 3  24  ? -2.098  1.657   29.280 1.00 83.49  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C 3  24  ? -2.251  0.196   28.886 1.00 83.33  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C 3  24  ? -1.327  -0.403  28.329 1.00 83.30  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C 3  24  ? -1.440  1.730   30.656 1.00 83.48  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C 3  24  ? -1.370  3.113   31.262 1.00 83.43  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C 3  24  ? -0.230  3.938   30.711 1.00 83.77  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C 3  24  ? 0.912   3.477   30.626 1.00 83.56  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C 3  24  ? -0.530  5.175   30.345 1.00 84.24  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C 3  25  ? -3.421  -0.364  29.198 1.00 83.04  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C 3  25  ? -3.755  -1.755  28.905 1.00 82.74  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C 3  25  ? -4.065  -1.975  27.427 1.00 82.62  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C 3  25  ? -4.646  -1.100  26.779 1.00 82.73  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C 3  25  ? -4.923  -2.208  29.778 1.00 82.66  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C 3  25  ? -4.496  -2.942  31.017 1.00 82.97  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C 3  25  ? -3.559  -2.390  31.886 1.00 82.86  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C 3  25  ? -5.035  -4.192  31.320 1.00 82.93  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C 3  25  ? -3.163  -3.072  33.028 1.00 82.62  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C 3  25  ? -4.647  -4.877  32.462 1.00 82.06  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C 3  25  ? -3.708  -4.320  33.313 1.00 82.20  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C 3  26  ? -3.681  -3.147  26.886 1.00 82.40  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C 3  26  ? -3.773  -3.354  25.445 1.00 82.16  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C 3  26  ? -5.196  -3.594  24.969 1.00 81.82  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C 3  26  ? -5.773  -4.629  25.277 1.00 81.64  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C 3  26  ? -2.913  -4.600  25.218 1.00 82.17  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C 3  26  ? -2.993  -5.354  26.489 1.00 82.33  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C 3  26  ? -3.234  -4.364  27.592 1.00 82.44  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C 3  27  ? -5.752  -2.639  24.227 1.00 81.84  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C 3  27  ? -7.086  -2.805  23.634 1.00 81.88  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C 3  27  ? -7.029  -3.832  22.500 1.00 82.20  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C 3  27  ? -7.945  -4.646  22.336 1.00 82.06  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C 3  27  ? -7.670  -1.468  23.127 1.00 81.64  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C 3  27  ? -8.977  -1.696  22.402 1.00 81.24  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C 3  27  ? -7.883  -0.514  24.280 1.00 81.54  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C 3  28  ? -5.940  -3.792  21.735 1.00 82.49  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C 3  28  ? -5.698  -4.767  20.686 1.00 82.83  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C 3  28  ? -5.824  -6.170  21.231 1.00 83.13  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C 3  28  ? -6.654  -6.949  20.764 1.00 83.07  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C 3  29  ? -5.015  -6.472  22.244 1.00 83.59  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C 3  29  ? -4.965  -7.810  22.836 1.00 84.01  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C 3  29  ? -6.294  -8.256  23.423 1.00 84.40  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C 3  29  ? -6.716  -9.388  23.201 1.00 84.57  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C 3  29  ? -3.858  -7.908  23.885 1.00 83.90  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C 3  29  ? -3.617  -9.315  24.378 1.00 83.64  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C 3  29  ? -2.153  -9.647  24.329 1.00 83.68  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C 3  29  ? -1.413  -9.049  25.434 1.00 83.75  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C 3  29  ? -0.091  -9.098  25.555 1.00 84.09  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C 3  29  ? 0.646   -9.711  24.635 1.00 84.45  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C 3  29  ? 0.497   -8.534  26.598 1.00 84.31  ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C 3  30  ? -6.950  -7.369  24.165 1.00 84.96  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C 3  30  ? -8.258  -7.681  24.734 1.00 85.59  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C 3  30  ? -9.255  -7.991  23.614 1.00 86.19  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C 3  30  ? -10.056 -8.919  23.738 1.00 86.24  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C 3  30  ? -8.787  -6.557  25.665 1.00 85.49  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C 3  30  ? -10.180 -6.887  26.169 1.00 85.35  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C 3  30  ? -7.855  -6.361  26.845 1.00 85.37  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C 3  31  ? -9.184  -7.241  22.516 1.00 86.94  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C 3  31  ? -10.034 -7.526  21.366 1.00 87.65  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C 3  31  ? -9.764  -8.929  20.868 1.00 87.95  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C 3  31  ? -10.692 -9.715  20.691 1.00 88.08  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C 3  31  ? -9.811  -6.540  20.220 1.00 87.82  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C 3  31  ? -11.029 -6.317  19.380 1.00 88.35  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C 3  31  ? -12.035 -7.252  19.265 1.00 89.12  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C 3  31  ? -11.410 -5.264  18.621 1.00 89.10  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C 3  31  ? -12.986 -6.781  18.478 1.00 89.36  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C 3  31  ? -12.630 -5.577  18.071 1.00 89.42  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C 3  32  ? -8.486  -9.233  20.663 1.00 88.38  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C 3  32  ? -8.074  -10.513 20.112 1.00 88.97  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C 3  32  ? -8.451  -11.688 20.994 1.00 89.22  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C 3  32  ? -8.856  -12.736 20.482 1.00 89.49  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C 3  32  ? -6.572  -10.544 19.866 1.00 89.12  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C 3  32  ? -6.170  -11.686 18.966 1.00 90.01  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C 3  32  ? -4.687  -11.743 18.769 1.00 91.43  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C 3  32  ? -4.038  -12.531 19.809 1.00 92.25  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C 3  32  ? -3.328  -12.026 20.812 1.00 92.88  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C 3  32  ? -3.168  -10.711 20.939 1.00 92.91  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C 3  32  ? -2.774  -12.847 21.690 1.00 93.37  ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C 3  33  ? -8.310  -11.522 22.310 1.00 89.39  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C 3  33  ? -8.610  -12.603 23.250 1.00 89.51  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C 3  33  ? -10.109 -12.862 23.381 1.00 89.80  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C 3  33  ? -10.521 -13.990 23.653 1.00 89.94  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C 3  33  ? -7.954  -12.365 24.615 1.00 89.33  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C 3  33  ? -6.422  -12.474 24.670 1.00 89.14  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C 3  33  ? -5.924  -12.499 26.106 1.00 88.76  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C 3  33  ? -5.906  -13.699 23.914 1.00 89.08  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C 3  34  ? -10.913 -11.823 23.162 1.00 90.12  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C 3  34  ? -12.371 -11.950 23.136 1.00 90.47  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C 3  34  ? -12.873 -12.782 21.954 1.00 90.92  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C 3  34  ? -13.968 -13.341 22.011 1.00 90.96  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C 3  34  ? -13.038 -10.568 23.120 1.00 90.41  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C 3  34  ? -13.130 -9.762  24.422 1.00 90.11  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C 3  34  ? -13.665 -8.374  24.143 1.00 89.55  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C 3  34  ? -13.989 -10.457 25.470 1.00 89.97  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C 3  35  ? -12.076 -12.852 20.887 1.00 91.50  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C 3  35  ? -12.423 -13.630 19.695 1.00 92.05  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C 3  35  ? -12.171 -15.114 19.914 1.00 92.53  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C 3  35  ? -13.110 -15.913 19.907 1.00 92.61  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C 3  35  ? -11.628 -13.159 18.477 1.00 91.99  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C 3  35  ? -11.781 -11.695 18.154 1.00 92.12  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C 3  35  ? -11.445 -11.429 16.699 1.00 92.08  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C 3  35  ? -11.651 -10.029 16.332 1.00 92.26  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C 3  35  ? -12.840 -9.444  16.187 1.00 92.36  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C 3  35  ? -13.967 -10.122 16.389 1.00 91.98  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C 3  35  ? -12.902 -8.167  15.837 1.00 92.58  ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C 3  36  ? -10.901 -15.471 20.114 1.00 93.09  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C 3  36  ? -10.497 -16.865 20.304 1.00 93.77  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C 3  36  ? -11.235 -17.488 21.485 1.00 93.87  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C 3  36  ? -11.419 -18.707 21.540 1.00 93.96  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C 3  36  ? -8.975  -16.970 20.506 1.00 93.98  ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C 3  36  ? -8.519  -17.297 21.942 1.00 95.25  ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C 3  36  ? -7.047  -16.971 22.187 1.00 97.32  ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C 3  36  ? -6.107  -17.946 21.480 1.00 98.12  ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C 3  36  ? -4.687  -17.499 21.606 1.00 98.89  ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C 3  37  ? -11.663 -16.634 22.414 1.00 94.02  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C 3  37  ? -12.300 -17.058 23.653 1.00 94.20  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C 3  37  ? -13.681 -17.650 23.473 1.00 94.34  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C 3  37  ? -14.242 -18.214 24.415 1.00 94.61  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C 3  38  ? -14.230 -17.524 22.267 1.00 94.31  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C 3  38  ? -15.531 -18.101 21.937 1.00 94.45  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C 3  38  ? -16.625 -17.722 22.933 1.00 94.25  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C 3  38  ? -17.232 -18.587 23.566 1.00 94.36  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C 3  38  ? -15.424 -19.628 21.786 1.00 94.55  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C 3  38  ? -14.793 -20.043 20.465 1.00 95.36  ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C 3  38  ? -13.958 -20.951 20.418 1.00 96.13  ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C 3  38  ? -15.189 -19.375 19.380 1.00 95.46  ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C 3  39  ? -16.859 -16.422 23.078 1.00 93.93  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C 3  39  ? -17.906 -15.941 23.968 1.00 93.73  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C 3  39  ? -19.172 -15.620 23.186 1.00 93.49  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C 3  39  ? -20.280 -15.842 23.672 1.00 93.47  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C 3  39  ? -17.436 -14.725 24.779 1.00 93.84  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C 3  39  ? -16.158 -14.949 25.566 1.00 94.20  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C 3  39  ? -14.955 -14.380 25.146 1.00 94.88  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C 3  39  ? -16.148 -15.728 26.723 1.00 94.44  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C 3  39  ? -13.772 -14.578 25.854 1.00 94.88  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C 3  39  ? -14.969 -15.937 27.438 1.00 94.96  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C 3  39  ? -13.785 -15.357 26.995 1.00 95.17  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C 3  39  ? -12.612 -15.549 27.690 1.00 95.87  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C 3  40  ? -18.995 -15.104 21.971 1.00 93.29  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C 3  40  ? -20.104 -14.769 21.079 1.00 93.10  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C 3  40  ? -19.662 -14.925 19.635 1.00 93.00  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C 3  40  ? -18.494 -15.206 19.369 1.00 93.09  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C 3  40  ? -20.574 -13.348 21.333 1.00 93.05  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C 3  41  ? -20.595 -14.752 18.704 1.00 92.92  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C 3  41  ? -20.264 -14.747 17.279 1.00 92.81  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C 3  41  ? -19.418 -13.521 16.944 1.00 92.41  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C 3  41  ? -18.409 -13.626 16.247 1.00 92.50  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C 3  41  ? -21.534 -14.759 16.422 1.00 93.01  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C 3  41  ? -22.458 -15.952 16.671 1.00 94.28  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C 3  41  ? -21.802 -17.283 16.342 1.00 95.76  ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C 3  41  ? -21.441 -17.487 15.161 1.00 96.35  ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C 3  41  ? -21.655 -18.122 17.264 1.00 96.02  ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C 3  42  ? -19.826 -12.368 17.474 1.00 91.83  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C 3  42  ? -19.216 -11.083 17.141 1.00 91.14  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C 3  42  ? -18.751 -10.322 18.377 1.00 90.51  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C 3  42  ? -19.358 -10.418 19.443 1.00 90.41  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C 3  42  ? -20.216 -10.213 16.379 1.00 91.36  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C 3  42  ? -21.017 -10.937 15.315 1.00 91.71  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C 3  42  ? -21.766 -9.960  14.437 1.00 92.35  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C 3  42  ? -21.685 -10.379 13.043 1.00 93.24  ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C 3  42  ? -22.013 -9.623  12.002 1.00 93.71  ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C 3  42  ? -22.469 -8.385  12.180 1.00 93.55  ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C 3  42  ? -21.891 -10.117 10.776 1.00 94.27  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C 3  43  ? -17.675 -9.557  18.221 1.00 89.73  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C 3  43  ? -17.179 -8.693  19.289 1.00 89.00  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C 3  43  ? -17.210 -7.233  18.848 1.00 88.49  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C 3  43  ? -16.463 -6.825  17.955 1.00 88.47  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C 3  43  ? -15.746 -9.067  19.734 1.00 89.00  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C 3  43  ? -15.270 -8.134  20.834 1.00 88.87  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C 3  43  ? -15.690 -10.506 20.215 1.00 89.10  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C 3  44  ? -18.078 -6.457  19.490 1.00 87.86  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C 3  44  ? -18.206 -5.027  19.229 1.00 86.97  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C 3  44  ? -16.921 -4.253  19.462 1.00 86.42  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C 3  44  ? -16.011 -4.723  20.152 1.00 86.35  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C 3  45  ? -16.864 -3.057  18.882 1.00 85.75  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C 3  45  ? -15.668 -2.218  18.889 1.00 84.94  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C 3  45  ? -15.368 -1.619  20.257 1.00 84.31  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C 3  45  ? -14.204 -1.440  20.618 1.00 84.36  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C 3  45  ? -15.803 -1.114  17.849 1.00 85.13  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C 3  46  ? -16.419 -1.297  21.003 1.00 83.49  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C 3  46  ? -16.276 -0.755  22.352 1.00 82.54  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C 3  46  ? -16.105 -1.819  23.424 1.00 81.74  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C 3  46  ? -15.651 -1.526  24.533 1.00 81.67  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C 3  47  ? -16.472 -3.056  23.098 1.00 80.88  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C 3  47  ? -16.346 -4.163  24.038 1.00 79.97  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C 3  47  ? -14.946 -4.259  24.639 1.00 79.27  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C 3  47  ? -14.814 -4.209  25.859 1.00 79.37  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C 3  47  ? -16.757 -5.478  23.395 1.00 80.04  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C 3  48  ? -13.894 -4.370  23.796 1.00 78.50  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C 3  48  ? -12.580 -4.518  24.405 1.00 77.92  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C 3  48  ? -12.089 -3.239  25.069 1.00 77.34  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C 3  48  ? -11.361 -3.312  26.053 1.00 77.25  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C 3  48  ? -11.682 -4.900  23.225 1.00 77.80  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C 3  48  ? -12.328 -4.323  22.064 1.00 78.01  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C 3  48  ? -13.806 -4.386  22.326 1.00 78.49  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C 3  49  ? -12.491 -2.086  24.544 1.00 76.70  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C 3  49  ? -12.113 -0.808  25.141 1.00 76.25  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C 3  49  ? -12.630 -0.718  26.581 1.00 75.85  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C 3  49  ? -11.864 -0.435  27.506 1.00 75.73  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C 3  49  ? -12.596 0.394   24.286 1.00 76.28  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C 3  49  ? -12.574 1.684   25.083 1.00 76.32  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C 3  49  ? -11.725 0.542   23.061 1.00 76.47  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C 3  50  ? -13.925 -0.983  26.753 1.00 75.40  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C 3  50  ? -14.574 -0.987  28.061 1.00 74.77  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C 3  50  ? -13.916 -2.025  28.956 1.00 74.56  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C 3  50  ? -13.553 -1.734  30.095 1.00 74.64  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C 3  50  ? -16.049 -1.328  27.897 1.00 74.56  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C 3  50  ? -16.957 -0.874  29.013 1.00 74.24  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C 3  50  ? -18.120 -0.172  28.728 1.00 74.43  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C 3  50  ? -16.675 -1.161  30.345 1.00 74.03  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C 3  50  ? -18.977 0.243   29.730 1.00 74.38  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C 3  50  ? -17.529 -0.747  31.361 1.00 74.12  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C 3  50  ? -18.680 -0.046  31.040 1.00 74.04  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C 3  50  ? -19.543 0.373   32.018 1.00 73.76  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C 3  51  ? -13.759 -3.235  28.426 1.00 74.15  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C 3  51  ? -13.153 -4.325  29.173 1.00 73.66  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C 3  51  ? -11.726 -3.981  29.597 1.00 73.52  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C 3  51  ? -11.372 -4.141  30.761 1.00 73.57  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C 3  51  ? -13.211 -5.637  28.381 1.00 73.39  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C 3  51  ? -12.692 -6.916  29.052 1.00 72.91  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C 3  51  ? -13.151 -7.064  30.508 1.00 72.16  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C 3  51  ? -13.091 -8.129  28.239 1.00 72.15  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C 3  52  ? -10.921 -3.486  28.661 1.00 73.37  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C 3  52  ? -9.557  -3.063  28.979 1.00 73.17  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C 3  52  ? -9.558  -1.978  30.050 1.00 72.90  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C 3  52  ? -8.692  -1.973  30.924 1.00 73.10  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C 3  52  ? -8.822  -2.578  27.730 1.00 73.18  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C 3  53  ? -10.539 -1.078  29.982 1.00 72.36  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C 3  53  ? -10.643 0.038   30.919 1.00 71.98  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C 3  53  ? -10.941 -0.444  32.333 1.00 71.72  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C 3  53  ? -10.405 0.090   33.311 1.00 71.77  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C 3  53  ? -11.706 1.017   30.463 1.00 72.01  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C 3  54  ? -11.808 -1.449  32.432 1.00 71.25  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C 3  54  ? -12.131 -2.053  33.715 1.00 70.64  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C 3  54  ? -10.898 -2.810  34.195 1.00 70.47  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C 3  54  ? -10.435 -2.600  35.315 1.00 70.31  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C 3  54  ? -13.400 -2.957  33.640 1.00 70.48  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C 3  54  ? -13.607 -3.726  34.932 1.00 70.03  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C 3  54  ? -14.630 -2.119  33.343 1.00 70.17  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C 3  55  ? -10.343 -3.650  33.326 1.00 70.36  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C 3  55  ? -9.193  -4.458  33.693 1.00 70.41  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C 3  55  ? -8.087  -3.568  34.223 1.00 70.68  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C 3  55  ? -7.557  -3.839  35.297 1.00 70.96  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C 3  55  ? -8.717  -5.330  32.532 1.00 70.29  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C 3  55  ? -9.599  -6.553  32.226 1.00 70.10  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C 3  55  ? -9.317  -7.112  30.835 1.00 69.61  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C 3  55  ? -9.459  -7.643  33.280 1.00 69.16  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C 3  56  ? -7.786  -2.488  33.499 1.00 70.74  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C 3  56  ? -6.811  -1.481  33.938 1.00 70.75  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C 3  56  ? -7.191  -0.859  35.286 1.00 70.54  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C 3  56  ? -6.337  -0.679  36.161 1.00 70.35  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C 3  56  ? -6.644  -0.387  32.875 1.00 70.91  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C 3  56  ? -5.586  0.683   33.202 1.00 71.69  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C 3  56  ? -5.402  1.703   32.081 1.00 72.04  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C 3  56  ? -4.876  1.328   31.010 1.00 71.96  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C 3  56  ? -5.776  2.880   32.276 1.00 71.77  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C 3  57  ? -8.472  -0.539  35.450 1.00 70.43  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C 3  57  ? -8.936  0.079   36.688 1.00 70.30  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C 3  57  ? -8.669  -0.814  37.899 1.00 70.24  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C 3  57  ? -8.002  -0.386  38.846 1.00 70.45  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C 3  57  ? -10.417 0.480   36.608 1.00 70.17  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C 3  57  ? -11.059 0.646   37.964 1.00 70.09  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C 3  57  ? -10.596 1.601   38.866 1.00 70.57  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C 3  57  ? -12.117 -0.164  38.352 1.00 70.10  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C 3  57  ? -11.174 1.742   40.124 1.00 71.15  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C 3  57  ? -12.709 -0.025  39.600 1.00 70.67  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C 3  57  ? -12.233 0.928   40.485 1.00 70.73  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C 3  57  ? -12.817 1.069   41.724 1.00 70.15  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C 3  58  ? -9.176  -2.050  37.848 1.00 69.84  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C 3  58  ? -9.055  -3.007  38.950 1.00 69.20  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C 3  58  ? -7.610  -3.252  39.367 1.00 68.94  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C 3  58  ? -7.314  -3.273  40.559 1.00 68.99  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C 3  58  ? -9.750  -4.330  38.611 1.00 69.12  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C 3  58  ? -11.287 -4.328  38.598 1.00 69.31  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C 3  58  ? -11.835 -5.577  37.920 1.00 68.73  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C 3  58  ? -11.892 -4.174  39.996 1.00 68.69  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C 3  59  ? -6.712  -3.417  38.396 1.00 68.54  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C 3  59  ? -5.293  -3.623  38.706 1.00 68.13  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C 3  59  ? -4.632  -2.387  39.302 1.00 68.03  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C 3  59  ? -3.698  -2.502  40.093 1.00 67.96  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C 3  59  ? -4.469  -4.172  37.508 1.00 68.09  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C 3  59  ? -3.267  -3.407  37.346 1.00 67.67  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C 3  59  ? -5.250  -4.108  36.242 1.00 67.82  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C 3  60  ? -5.121  -1.212  38.921 1.00 67.91  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C 3  60  ? -4.629  0.035   39.487 1.00 67.80  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C 3  60  ? -5.064  0.118   40.930 1.00 67.70  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C 3  60  ? -4.293  0.546   41.789 1.00 67.88  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C 3  60  ? -5.160  1.223   38.706 1.00 67.92  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C 3  61  ? -6.302  -0.312  41.176 1.00 67.58  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C 3  61  ? -6.940  -0.261  42.490 1.00 67.43  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C 3  61  ? -6.205  -1.127  43.509 1.00 67.07  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C 3  61  ? -5.990  -0.699  44.639 1.00 66.84  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C 3  61  ? -8.410  -0.680  42.373 1.00 67.38  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C 3  61  ? -9.235  -0.462  43.626 1.00 68.85  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C 3  61  ? -9.480  1.016   43.945 1.00 71.57  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C 3  61  ? -9.784  1.798   43.006 1.00 71.51  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C 3  61  ? -9.380  1.394   45.143 1.00 72.54  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C 3  62  ? -5.809  -2.329  43.088 1.00 66.90  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C 3  62  ? -5.088  -3.274  43.946 1.00 66.77  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C 3  62  ? -3.627  -2.882  44.180 1.00 66.69  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C 3  62  ? -3.108  -3.036  45.286 1.00 66.84  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C 3  62  ? -5.185  -4.735  43.422 1.00 66.74  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C 3  62  ? -4.319  -5.675  44.268 1.00 66.56  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C 3  62  ? -4.780  -4.821  41.965 1.00 66.94  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C 3  62  ? -4.445  -7.134  43.895 1.00 67.24  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C 3  63  ? -2.970  -2.372  43.146 1.00 66.57  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C 3  63  ? -1.575  -1.969  43.265 1.00 66.49  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C 3  63  ? -1.419  -0.737  44.154 1.00 66.59  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C 3  63  ? -0.397  -0.569  44.815 1.00 66.64  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C 3  63  ? -0.956  -1.720  41.888 1.00 66.36  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C 3  63  ? -0.707  -2.922  40.979 1.00 65.77  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C 3  63  ? -0.496  -2.464  39.544 1.00 65.18  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C 3  63  ? 0.477   -3.731  41.477 1.00 65.68  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C 3  64  ? -2.430  0.124   44.169 1.00 66.69  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C 3  64  ? -2.413  1.283   45.055 1.00 67.14  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C 3  64  ? -2.402  0.802   46.510 1.00 67.19  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C 3  64  ? -1.637  1.304   47.344 1.00 67.16  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C 3  64  ? -3.609  2.209   44.768 1.00 67.15  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C 3  64  ? -3.759  3.416   45.712 1.00 67.84  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C 3  64  ? -2.634  4.451   45.597 1.00 68.68  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C 3  64  ? -2.447  5.239   46.553 1.00 69.50  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C 3  64  ? -1.937  4.491   44.563 1.00 69.02  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C 3  65  ? -3.239  -0.197  46.784 1.00 67.29  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C 3  65  ? -3.394  -0.768  48.117 1.00 67.11  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C 3  65  ? -2.200  -1.627  48.507 1.00 67.30  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C 3  65  ? -1.669  -1.475  49.610 1.00 67.55  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C 3  65  ? -4.697  -1.571  48.216 1.00 66.85  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C 3  65  ? -6.009  -0.779  48.195 1.00 66.13  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C 3  65  ? -7.174  -1.723  48.212 1.00 65.86  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C 3  65  ? -6.118  0.193   49.360 1.00 65.50  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C 3  66  ? -1.783  -2.515  47.602 1.00 67.27  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C 3  66  ? -0.614  -3.373  47.813 1.00 67.25  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C 3  66  ? 0.630   -2.542  48.109 1.00 67.32  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C 3  66  ? 1.388   -2.834  49.037 1.00 67.19  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C 3  66  ? -0.389  -4.258  46.601 1.00 67.19  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C 3  67  ? 0.818   -1.494  47.314 1.00 67.53  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C 3  67  ? 1.907   -0.559  47.503 1.00 67.97  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C 3  67  ? 1.951   -0.027  48.917 1.00 68.32  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C 3  67  ? 3.021   0.068   49.512 1.00 68.48  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C 3  68  ? 0.787   0.313   49.461 1.00 68.66  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C 3  68  ? 0.706   0.802   50.835 1.00 69.01  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C 3  68  ? 1.188   -0.222  51.855 1.00 69.07  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C 3  68  ? 2.035   0.089   52.690 1.00 68.94  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C 3  68  ? -0.709  1.273   51.164 1.00 69.06  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C 3  68  ? -1.124  2.467   50.338 1.00 69.66  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C 3  68  ? -0.284  3.235   49.861 1.00 69.89  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C 3  68  ? -2.429  2.636   50.164 1.00 70.79  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C 3  69  ? 0.664   -1.442  51.765 1.00 69.32  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C 3  69  ? 1.079   -2.532  52.642 1.00 69.72  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C 3  69  ? 2.592   -2.772  52.551 1.00 70.09  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C 3  69  ? 3.231   -3.129  53.547 1.00 70.17  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C 3  69  ? 0.309   -3.801  52.318 1.00 69.66  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C 3  70  ? 3.155   -2.562  51.362 1.00 70.36  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C 3  70  ? 4.597   -2.624  51.176 1.00 70.64  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C 3  70  ? 5.319   -1.469  51.882 1.00 70.98  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C 3  70  ? 6.388   -1.672  52.444 1.00 70.87  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C 3  70  ? 4.942   -2.667  49.698 1.00 70.55  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C 3  71  ? 4.735   -0.269  51.858 1.00 71.61  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C 3  71  ? 5.313   0.884   52.559 1.00 72.27  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C 3  71  ? 5.176   0.733   54.071 1.00 72.53  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C 3  71  ? 6.140   0.944   54.804 1.00 72.72  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C 3  71  ? 4.703   2.219   52.091 1.00 72.43  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C 3  71  ? 5.099   3.427   52.971 1.00 73.50  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C 3  71  ? 4.737   4.793   52.385 1.00 75.99  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C 3  71  ? 5.457   5.094   51.140 1.00 78.64  ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C 3  71  ? 5.778   6.318   50.710 1.00 79.19  ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C 3  71  ? 5.472   7.395   51.427 1.00 79.05  ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C 3  71  ? 6.420   6.463   49.555 1.00 79.15  ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C 3  72  ? 3.985   0.367   54.536 1.00 72.87  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C 3  72  ? 3.760   0.140   55.961 1.00 73.38  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C 3  72  ? 4.797   -0.830  56.518 1.00 73.87  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C 3  72  ? 5.300   -0.641  57.628 1.00 73.94  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C 3  72  ? 2.358   -0.416  56.213 1.00 73.34  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C 3  72  ? 1.258   0.520   55.755 1.00 73.48  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C 3  72  ? 1.451   1.757   55.779 1.00 73.75  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C 3  72  ? 0.182   0.007   55.380 1.00 73.61  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C 3  73  ? 5.109   -1.859  55.727 1.00 74.44  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C 3  73  ? 6.094   -2.890  56.068 1.00 74.93  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C 3  73  ? 7.552   -2.470  55.905 1.00 74.99  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C 3  73  ? 8.462   -3.277  56.127 1.00 75.17  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C 3  73  ? 5.870   -4.120  55.197 1.00 75.21  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C 3  73  ? 5.045   -5.181  55.880 1.00 76.09  ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C 3  73  ? 5.480   -6.334  55.988 1.00 76.67  ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C 3  73  ? 3.840   -4.813  56.332 1.00 76.17  ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C 3  74  ? 7.768   -1.222  55.497 1.00 75.00  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C 3  74  ? 9.106   -0.685  55.242 1.00 74.97  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C 3  74  ? 9.883   -1.461  54.166 1.00 74.56  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C 3  74  ? 11.088  -1.665  54.282 1.00 74.61  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C 3  74  ? 9.884   -0.530  56.558 1.00 75.23  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C 3  74  ? 9.497   0.758   57.303 1.00 76.61  ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C 3  74  ? 9.679   0.696   58.820 1.00 77.90  ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C 3  74  ? 9.335   2.064   59.424 1.00 78.87  ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C 3  74  ? 9.183   2.062   60.909 1.00 79.73  ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C 3  75  ? 9.162   -1.868  53.117 1.00 74.12  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C 3  75  ? 9.719   -2.556  51.950 1.00 73.60  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C 3  75  ? 9.500   -1.722  50.694 1.00 73.41  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C 3  75  ? 8.601   -0.881  50.645 1.00 73.54  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C 3  75  ? 9.051   -3.919  51.746 1.00 73.56  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C 3  75  ? 9.072   -4.849  52.945 1.00 73.73  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C 3  75  ? 10.364  -5.647  53.042 1.00 73.83  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C 3  75  ? 10.434  -6.427  54.359 1.00 74.16  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C 3  75  ? 10.373  -5.560  55.580 1.00 72.99  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C 3  76  ? 10.315  -1.973  49.675 1.00 73.05  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C 3  76  ? 10.248  -1.244  48.406 1.00 72.51  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C 3  76  ? 9.557   -2.079  47.331 1.00 71.98  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C 3  76  ? 8.995   -1.540  46.376 1.00 71.91  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C 3  76  ? 11.671  -0.775  47.955 1.00 72.60  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C 3  76  ? 11.948  0.511   48.522 1.00 72.93  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C 3  76  ? 11.808  -0.686  46.433 1.00 72.35  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C 3  77  ? 9.586   -3.395  47.503 1.00 71.22  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C 3  77  ? 9.018   -4.290  46.516 1.00 70.71  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C 3  77  ? 7.745   -4.952  47.022 1.00 70.10  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C 3  77  ? 7.726   -5.517  48.117 1.00 70.39  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C 3  77  ? 10.036  -5.354  46.137 1.00 70.89  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C 3  77  ? 9.634   -6.163  44.927 1.00 71.96  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C 3  77  ? 10.660  -7.210  44.580 1.00 73.69  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C 3  77  ? 11.926  -6.612  44.179 1.00 75.47  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C 3  77  ? 13.038  -6.643  44.907 1.00 76.52  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C 3  77  ? 13.059  -7.254  46.089 1.00 76.39  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C 3  77  ? 14.137  -6.066  44.443 1.00 77.80  ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C 3  78  ? 6.686   -4.883  46.221 1.00 69.03  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C 3  78  ? 5.442   -5.580  46.532 1.00 67.94  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C 3  78  ? 5.662   -7.068  46.311 1.00 67.40  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C 3  78  ? 6.056   -7.492  45.226 1.00 67.44  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C 3  78  ? 4.258   -5.074  45.665 1.00 67.90  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C 3  78  ? 3.838   -3.669  46.102 1.00 67.54  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C 3  78  ? 3.071   -6.029  45.738 1.00 67.38  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C 3  78  ? 3.465   -2.765  44.955 1.00 66.93  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C 3  79  ? 5.434   -7.845  47.363 1.00 66.65  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C 3  79  ? 5.471   -9.303  47.297 1.00 65.92  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C 3  79  ? 4.028   -9.823  47.467 1.00 65.60  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C 3  79  ? 3.119   -9.018  47.695 1.00 65.72  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C 3  79  ? 6.444   -9.880  48.353 1.00 65.81  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C 3  79  ? 6.044   -9.436  49.765 1.00 65.54  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C 3  79  ? 7.876   -9.471  48.026 1.00 65.72  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C 3  79  ? 6.956   -9.930  50.871 1.00 65.64  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C 3  80  ? 3.798   -11.151 47.336 1.00 65.10  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C 3  80  ? 2.427   -11.658 47.496 1.00 64.73  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C 3  80  ? 1.749   -11.366 48.851 1.00 64.36  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C 3  80  ? 0.528   -11.236 48.893 1.00 64.18  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C 3  80  ? 2.588   -13.164 47.283 1.00 64.69  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C 3  80  ? 3.759   -13.287 46.407 1.00 64.60  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C 3  80  ? 4.699   -12.204 46.831 1.00 65.11  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C 3  81  ? 2.520   -11.265 49.934 1.00 64.04  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C 3  81  ? 1.966   -10.862 51.232 1.00 63.79  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C 3  81  ? 1.250   -9.516  51.117 1.00 63.67  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C 3  81  ? 0.115   -9.366  51.575 1.00 63.62  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C 3  81  ? 3.053   -10.794 52.308 1.00 63.66  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C 3  81  ? 2.673   -9.958  53.532 1.00 63.76  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C 3  81  ? 2.470   -10.767 54.813 1.00 63.79  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C 3  81  ? 1.173   -11.434 54.867 1.00 64.45  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C 3  81  ? 0.516   -11.727 55.989 1.00 64.68  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C 3  81  ? 1.018   -11.409 57.175 1.00 64.78  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C 3  81  ? -0.656  -12.340 55.925 1.00 64.46  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C 3  82  ? 1.912   -8.549  50.487 1.00 63.58  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C 3  82  ? 1.339   -7.213  50.304 1.00 63.48  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C 3  82  ? 0.075   -7.222  49.434 1.00 63.34  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C 3  82  ? -0.844  -6.426  49.672 1.00 63.43  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C 3  82  ? 2.373   -6.225  49.750 1.00 63.40  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C 3  82  ? 3.658   -6.200  50.516 1.00 63.56  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C 3  82  ? 4.890   -6.238  49.899 1.00 63.83  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C 3  82  ? 3.905   -6.161  51.848 1.00 63.65  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C 3  82  ? 5.841   -6.214  50.817 1.00 63.81  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C 3  82  ? 5.270   -6.172  52.008 1.00 63.69  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C 3  83  ? 0.037   -8.112  48.436 1.00 62.84  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C 3  83  ? -1.165  -8.319  47.624 1.00 62.45  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C 3  83  ? -2.301  -8.868  48.474 1.00 62.31  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C 3  83  ? -3.434  -8.383  48.418 1.00 62.09  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C 3  83  ? -0.897  -9.296  46.484 1.00 62.29  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C 3  83  ? -0.190  -8.835  45.215 1.00 62.22  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C 3  83  ? -0.408  -9.892  44.159 1.00 61.76  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C 3  83  ? -0.685  -7.477  44.716 1.00 61.96  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C 3  84  ? -1.976  -9.891  49.256 1.00 62.16  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C 3  84  ? -2.932  -10.515 50.139 1.00 62.04  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C 3  84  ? -3.411  -9.499  51.157 1.00 62.01  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C 3  84  ? -4.612  -9.356  51.361 1.00 62.22  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C 3  84  ? -2.322  -11.754 50.803 1.00 62.04  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C 3  84  ? -3.096  -12.319 51.982 1.00 61.83  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C 3  84  ? -4.378  -13.048 51.606 1.00 62.00  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C 3  84  ? -4.921  -12.908 50.507 1.00 61.00  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C 3  84  ? -4.880  -13.828 52.547 1.00 63.46  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C 3  85  ? -2.482  -8.767  51.763 1.00 61.88  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C 3  85  ? -2.855  -7.730  52.724 1.00 62.03  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C 3  85  ? -3.753  -6.651  52.116 1.00 62.16  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C 3  85  ? -4.657  -6.145  52.784 1.00 62.12  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C 3  85  ? -1.619  -7.100  53.370 1.00 61.99  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C 3  85  ? -0.892  -7.935  54.429 1.00 61.67  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C 3  85  ? 0.395   -7.242  54.840 1.00 61.60  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C 3  85  ? -1.775  -8.218  55.639 1.00 60.64  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C 3  86  ? -3.502  -6.320  50.848 1.00 62.37  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C 3  86  ? -4.283  -5.321  50.113 1.00 62.54  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C 3  86  ? -5.724  -5.766  49.875 1.00 62.81  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C 3  86  ? -6.668  -5.029  50.173 1.00 62.74  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C 3  86  ? -3.620  -5.019  48.800 1.00 62.53  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C 3  87  ? -5.878  -6.974  49.332 1.00 63.17  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C 3  87  ? -7.192  -7.550  49.045 1.00 63.29  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C 3  87  ? -7.995  -7.768  50.326 1.00 63.57  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C 3  87  ? -9.136  -7.313  50.430 1.00 63.64  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C 3  87  ? -7.082  -8.884  48.260 1.00 63.04  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C 3  87  ? -8.442  -9.490  48.050 1.00 62.94  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C 3  87  ? -6.428  -8.661  46.923 1.00 63.04  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C 3  88  ? -7.384  -8.439  51.301 1.00 63.90  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C 3  88  ? -8.106  -8.885  52.488 1.00 64.26  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C 3  88  ? -8.566  -7.737  53.352 1.00 64.78  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C 3  88  ? -9.662  -7.778  53.907 1.00 64.98  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C 3  88  ? -7.290  -9.891  53.304 1.00 64.06  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C 3  88  ? -7.045  -11.217 52.594 1.00 63.50  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C 3  88  ? -8.281  -11.691 51.857 1.00 62.91  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C 3  88  ? -7.958  -12.495 50.683 1.00 63.12  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C 3  88  ? -8.804  -12.733 49.680 1.00 63.63  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C 3  88  ? -10.027 -12.217 49.692 1.00 63.28  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C 3  88  ? -8.428  -13.487 48.653 1.00 63.80  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C 3  89  ? -7.745  -6.697  53.441 1.00 65.37  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C 3  89  ? -8.116  -5.518  54.215 1.00 65.99  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C 3  89  ? -9.128  -4.604  53.517 1.00 66.53  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C 3  89  ? -9.592  -3.615  54.095 1.00 66.71  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C 3  89  ? -6.869  -4.760  54.669 1.00 65.81  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C 3  89  ? -6.250  -5.368  55.919 1.00 65.65  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C 3  89  ? -6.966  -5.831  56.807 1.00 65.29  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C 3  89  ? -4.921  -5.369  55.995 1.00 65.46  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C 3  90  ? -9.481  -4.958  52.284 1.00 67.14  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C 3  90  ? -10.433 -4.188  51.502 1.00 67.69  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C 3  90  ? -11.707 -4.986  51.289 1.00 67.86  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C 3  90  ? -11.689 -6.027  50.621 1.00 68.13  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C 3  90  ? -9.834  -3.809  50.153 1.00 67.82  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C 3  90  ? -10.678 -2.796  49.415 1.00 69.00  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C 3  90  ? -10.551 -1.586  49.705 1.00 69.63  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C 3  90  ? -11.471 -3.212  48.543 1.00 70.86  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C 3  91  ? -12.808 -4.483  51.849 1.00 67.83  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C 3  91  ? -14.118 -5.143  51.784 1.00 67.54  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C 3  91  ? -14.492 -5.611  50.387 1.00 66.94  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C 3  91  ? -14.779 -6.787  50.179 1.00 66.70  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C 3  91  ? -15.216 -4.207  52.298 1.00 67.92  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C 3  91  ? -15.768 -4.529  53.683 1.00 68.46  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C 3  91  ? -17.122 -3.883  53.911 1.00 69.27  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C 3  91  ? -17.931 -3.833  52.958 1.00 69.43  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C 3  91  ? -17.378 -3.419  55.040 1.00 70.33  ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C 3  92  ? -14.477 -4.678  49.440 1.00 66.57  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C 3  92  ? -14.979 -4.929  48.093 1.00 66.27  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C 3  92  ? -14.054 -5.788  47.247 1.00 65.91  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C 3  92  ? -14.523 -6.604  46.452 1.00 65.72  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C 3  92  ? -15.334 -3.621  47.394 1.00 66.33  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C 3  92  ? -16.622 -3.012  47.938 1.00 66.65  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C 3  92  ? -17.060 -1.763  47.205 1.00 67.31  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C 3  92  ? -16.336 -1.302  46.295 1.00 66.83  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C 3  92  ? -18.139 -1.237  47.551 1.00 68.32  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C 3  93  ? -12.748 -5.608  47.428 1.00 65.58  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C 3  93  ? -11.766 -6.498  46.815 1.00 65.33  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C 3  93  ? -11.841 -7.912  47.395 1.00 65.34  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C 3  93  ? -11.834 -8.893  46.647 1.00 65.38  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C 3  93  ? -10.356 -5.936  46.950 1.00 65.11  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C 3  93  ? -9.949  -4.846  45.962 1.00 64.70  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C 3  93  ? -8.506  -4.457  46.205 1.00 64.61  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C 3  93  ? -10.135 -5.303  44.522 1.00 64.34  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C 3  94  ? -11.933 -8.006  48.722 1.00 65.27  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C 3  94  ? -12.039 -9.293  49.413 1.00 65.32  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C 3  94  ? -13.208 -10.162 48.919 1.00 65.44  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C 3  94  ? -13.049 -11.360 48.705 1.00 65.16  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C 3  94  ? -12.109 -9.084  50.930 1.00 65.10  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C 3  94  ? -12.231 -10.387 51.697 1.00 64.89  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C 3  94  ? -11.376 -11.264 51.605 1.00 64.39  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C 3  94  ? -13.302 -10.516 52.463 1.00 65.03  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C 3  95  ? -14.372 -9.541  48.742 1.00 65.85  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C 3  95  ? -15.560 -10.203 48.198 1.00 66.23  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C 3  95  ? -15.328 -10.671 46.755 1.00 66.26  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C 3  95  ? -15.720 -11.783 46.377 1.00 66.26  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C 3  95  ? -16.757 -9.247  48.257 1.00 66.30  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C 3  95  ? -18.044 -9.790  47.653 1.00 67.15  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C 3  95  ? -19.194 -8.839  47.933 1.00 69.17  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C 3  95  ? -20.513 -9.592  48.055 1.00 70.54  ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C 3  95  ? -21.330 -9.056  49.189 1.00 71.05  ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C 3  96  ? -14.693 -9.814  45.958 1.00 66.08  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C 3  96  ? -14.390 -10.132 44.574 1.00 65.86  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C 3  96  ? -13.505 -11.359 44.518 1.00 65.73  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C 3  96  ? -13.804 -12.318 43.810 1.00 65.79  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C 3  96  ? -13.700 -8.951  43.896 1.00 65.88  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C 3  96  ? -13.392 -9.101  42.411 1.00 65.49  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C 3  96  ? -14.674 -9.153  41.600 1.00 65.10  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C 3  96  ? -12.526 -7.945  41.984 1.00 65.35  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C 3  97  ? -12.423 -11.321 45.287 1.00 65.55  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C 3  97  ? -11.535 -12.463 45.428 1.00 65.47  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C 3  97  ? -11.897 -13.262 46.688 1.00 65.46  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C 3  97  ? -11.028 -13.636 47.487 1.00 65.38  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C 3  97  ? -10.073 -11.998 45.445 1.00 65.40  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C 3  97  ? -9.606  -11.139 44.263 1.00 65.14  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C 3  97  ? -8.202  -10.581 44.478 1.00 64.60  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C 3  97  ? -9.668  -11.921 42.964 1.00 65.37  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C 3  98  ? -13.197 -13.506 46.854 1.00 65.34  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C 3  98  ? -13.724 -14.282 47.974 1.00 65.12  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C 3  98  ? -13.356 -15.749 47.896 1.00 65.00  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C 3  98  ? -13.072 -16.382 48.912 1.00 64.94  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C 3  99  ? -13.352 -16.287 46.682 1.00 64.90  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C 3  99  ? -13.020 -17.686 46.468 1.00 64.95  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C 3  99  ? -11.663 -17.872 45.779 1.00 64.24  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C 3  99  ? -11.417 -18.889 45.132 1.00 64.43  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C 3  99  ? -14.137 -18.372 45.685 1.00 65.36  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C 3  99  ? -15.307 -18.795 46.537 1.00 67.64  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C 3  99  ? -16.544 -18.985 45.684 1.00 72.58  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C 3  99  ? -17.431 -20.017 46.225 1.00 76.44  ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C 3  99  ? -18.746 -20.095 45.997 1.00 78.41  ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C 3  99  ? -19.367 -19.190 45.234 1.00 78.34  ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C 3  99  ? -19.445 -21.086 46.548 1.00 79.43  ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C 3  100 ? -10.779 -16.894 45.947 1.00 63.36  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C 3  100 ? -9.461  -16.913 45.330 1.00 62.44  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C 3  100 ? -8.391  -16.981 46.397 1.00 61.80  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C 3  100 ? -8.418  -16.215 47.366 1.00 61.58  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C 3  100 ? -9.228  -15.639 44.491 1.00 62.63  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C 3  100 ? -7.758  -15.470 44.155 1.00 62.50  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C 3  100 ? -10.072 -15.664 43.222 1.00 63.22  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C 3  101 ? -7.448  -17.897 46.208 1.00 61.23  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C 3  101 ? -6.301  -18.041 47.103 1.00 60.60  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C 3  101 ? -5.054  -17.442 46.469 1.00 60.39  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C 3  101 ? -4.701  -17.768 45.333 1.00 60.31  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C 3  101 ? -6.045  -19.520 47.477 1.00 60.55  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C 3  101 ? -7.201  -20.049 48.132 1.00 59.96  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C 3  101 ? -4.834  -19.658 48.399 1.00 59.93  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C 3  102 ? -4.403  -16.557 47.217 1.00 60.07  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C 3  102 ? -3.167  -15.928 46.778 1.00 59.61  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C 3  102 ? -2.001  -16.719 47.344 1.00 59.79  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C 3  102 ? -1.712  -16.651 48.541 1.00 59.81  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C 3  102 ? -3.107  -14.439 47.206 1.00 59.28  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C 3  102 ? -4.223  -13.656 46.510 1.00 58.25  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C 3  102 ? -1.729  -13.839 46.920 1.00 58.91  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C 3  102 ? -4.462  -12.293 47.065 1.00 57.74  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C 3  103 ? -1.351  -17.494 46.484 1.00 60.08  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C 3  103 ? -0.161  -18.236 46.886 1.00 60.50  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C 3  103 ? 0.774   -17.337 47.690 1.00 60.84  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C 3  103 ? 0.932   -16.149 47.386 1.00 60.84  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C 3  103 ? 0.555   -18.795 45.678 1.00 60.31  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C 3  104 ? 1.360   -17.910 48.735 1.00 61.27  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C 3  104 ? 2.328   -17.217 49.585 1.00 61.75  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C 3  104 ? 1.875   -15.865 50.172 1.00 62.22  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C 3  104 ? 2.697   -14.970 50.407 1.00 62.25  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C 3  104 ? 3.685   -17.123 48.877 1.00 61.48  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C 3  104 ? 4.507   -18.381 49.054 1.00 61.29  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C 3  104 ? 4.664   -18.762 50.525 1.00 61.43  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C 3  104 ? 5.379   -18.096 51.273 1.00 61.06  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C 3  104 ? 3.985   -19.829 50.947 1.00 61.22  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C 3  105 ? 0.574   -15.749 50.443 1.00 62.68  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C 3  105 ? -0.013  -14.505 50.946 1.00 63.26  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C 3  105 ? -0.280  -14.451 52.442 1.00 63.66  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C 3  105 ? -0.359  -13.361 53.024 1.00 63.59  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C 3  106 ? -0.424  -15.623 53.064 1.00 63.89  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C 3  106 ? -0.678  -15.715 54.501 1.00 63.92  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C 3  106 ? -2.098  -15.334 54.878 1.00 64.03  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C 3  106 ? -2.992  -15.317 54.030 1.00 63.71  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C 3  107 ? -2.291  -15.033 56.164 1.00 64.34  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C 3  107 ? -3.594  -14.643 56.724 1.00 64.39  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C 3  107 ? -3.495  -13.270 57.406 1.00 64.88  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C 3  107 ? -2.396  -12.831 57.770 1.00 65.03  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C 3  107 ? -4.105  -15.695 57.742 1.00 64.19  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C 3  107 ? -4.191  -17.072 57.099 1.00 63.70  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C 3  107 ? -3.218  -15.750 58.971 1.00 63.59  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C 3  108 ? -4.622  -12.580 57.571 1.00 65.24  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C 3  108 ? -4.614  -11.364 58.385 1.00 65.81  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C 3  108 ? -4.424  -11.762 59.848 1.00 66.53  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C 3  108 ? -5.042  -12.727 60.299 1.00 66.68  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C 3  108 ? -5.919  -10.577 58.238 1.00 65.51  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C 3  108 ? -6.238  -9.859  56.928 1.00 64.88  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C 3  108 ? -7.620  -9.213  56.983 1.00 63.39  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C 3  108 ? -5.173  -8.825  56.614 1.00 64.81  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C 3  109 ? -3.548  -11.050 60.586 1.00 67.13  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C 3  109 ? -3.528  -11.214 62.028 1.00 67.77  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C 3  109 ? -4.937  -11.095 62.605 1.00 68.51  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C 3  109 ? -5.612  -10.083 62.413 1.00 68.63  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C 3  109 ? -2.666  -10.042 62.496 1.00 67.61  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C 3  109 ? -1.718  -9.838  61.412 1.00 67.44  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C 3  109 ? -2.408  -10.241 60.125 1.00 67.21  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C 3  110 ? -5.383  -12.150 63.271 1.00 69.35  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C 3  110 ? -6.650  -12.128 63.960 1.00 70.34  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C 3  110 ? -6.650  -13.219 64.998 1.00 71.04  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C 3  110 ? -6.470  -14.392 64.676 1.00 71.07  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C 3  110 ? -7.823  -12.312 62.993 1.00 70.48  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C 3  110 ? -9.124  -11.724 63.528 1.00 70.98  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C 3  110 ? -9.164  -11.137 64.612 1.00 71.94  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C 3  110 ? -10.195 -11.876 62.762 1.00 71.25  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C 3  111 ? -6.816  -12.799 66.249 1.00 72.01  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C 3  111 ? -6.998  -13.681 67.393 1.00 72.75  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C 3  111 ? -8.354  -13.342 68.015 1.00 73.54  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C 3  111 ? -8.642  -12.174 68.283 1.00 73.65  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C 3  111 ? -5.875  -13.468 68.428 1.00 72.52  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C 3  111 ? -4.522  -13.857 67.822 1.00 72.07  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C 3  111 ? -6.171  -14.237 69.725 1.00 72.65  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C 3  111 ? -3.314  -13.367 68.600 1.00 71.53  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C 3  112 ? -9.191  -14.355 68.219 1.00 74.43  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C 3  112 ? -10.476 -14.159 68.882 1.00 75.35  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C 3  112 ? -10.259 -13.710 70.317 1.00 76.21  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C 3  112 ? -9.358  -14.208 70.992 1.00 76.35  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C 3  112 ? -11.286 -15.450 68.870 1.00 75.22  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C 3  112 ? -11.505 -16.018 67.491 1.00 75.40  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C 3  112 ? -12.409 -15.155 66.650 1.00 76.14  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C 3  112 ? -13.585 -14.972 66.970 1.00 76.91  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C 3  112 ? -11.866 -14.615 65.564 1.00 76.11  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C 3  113 ? -11.092 -12.773 70.770 1.00 77.40  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C 3  113 ? -10.998 -12.178 72.115 1.00 78.51  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C 3  113 ? -10.907 -13.180 73.259 1.00 79.40  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C 3  113 ? -10.072 -13.033 74.149 1.00 79.54  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C 3  113 ? -12.178 -11.245 72.369 1.00 78.30  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C 3  113 ? -12.093 -10.106 71.543 1.00 78.70  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C 3  114 ? -11.759 -14.200 73.225 1.00 80.62  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C 3  114 ? -11.864 -15.164 74.320 1.00 81.74  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C 3  114 ? -10.541 -15.884 74.598 1.00 82.60  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C 3  114 ? -10.379 -16.493 75.656 1.00 82.86  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C 3  114 ? -13.006 -16.198 74.078 1.00 81.73  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C 3  114 ? -14.300 -15.495 73.640 1.00 81.72  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C 3  114 ? -12.592 -17.249 73.053 1.00 81.76  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C 3  115 ? -9.603  -15.793 73.653 1.00 83.63  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C 3  115 ? -8.328  -16.518 73.727 1.00 84.58  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C 3  115 ? -7.222  -15.712 74.403 1.00 85.43  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C 3  115 ? -6.201  -16.270 74.808 1.00 85.38  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C 3  115 ? -7.866  -16.958 72.329 1.00 84.45  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C 3  115 ? -8.844  -17.645 71.369 1.00 83.71  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C 3  115 ? -8.176  -17.825 70.025 1.00 83.38  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C 3  115 ? -9.330  -18.977 71.903 1.00 82.92  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C 3  116 ? -7.429  -14.402 74.509 1.00 86.65  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C 3  116 ? -6.486  -13.505 75.177 1.00 87.92  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C 3  116 ? -6.529  -13.704 76.694 1.00 89.08  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C 3  116 ? -7.579  -14.047 77.242 1.00 89.13  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C 3  116 ? -6.787  -12.048 74.815 1.00 87.74  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C 3  116 ? -6.800  -11.699 73.324 1.00 87.59  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C 3  116 ? -7.484  -10.363 73.096 1.00 87.40  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C 3  116 ? -5.388  -11.707 72.738 1.00 87.52  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C 3  117 ? -5.392  -13.484 77.381 1.00 90.28  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C 3  117 ? -5.288  -13.869 78.788 1.00 91.23  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C 3  117 ? -5.869  -12.840 79.760 1.00 92.22  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C 3  117 ? -6.304  -11.764 79.333 1.00 92.17  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C 3  117 ? -3.773  -14.033 79.000 1.00 91.27  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C 3  117 ? -3.101  -13.566 77.695 1.00 90.93  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C 3  117 ? -4.150  -12.847 76.911 1.00 90.45  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C 3  118 ? -5.848  -13.185 81.053 1.00 93.47  ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C 3  118 ? -6.489  -12.421 82.143 1.00 94.69  ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C 3  118 ? -8.015  -12.406 81.992 1.00 95.42  ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C 3  118 ? -8.638  -13.461 81.795 1.00 95.65  ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C 3  118 ? -5.951  -10.984 82.254 1.00 94.72  ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C 3  118 ? -4.457  -10.850 82.517 1.00 95.24  ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C 3  118 ? -4.026  -9.385  82.425 1.00 95.75  ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C 3  118 ? -4.099  -8.859  80.989 1.00 95.86  ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C 3  118 ? -4.091  -7.369  80.939 1.00 95.81  ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C 3  119 ? -8.608  -11.214 82.089 1.00 96.14  ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C 3  119 ? -10.056 -11.044 81.917 1.00 96.67  ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C 3  119 ? -10.429 -9.697  81.278 1.00 96.78  ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C 3  119 ? -9.759  -8.681  81.492 1.00 97.03  ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C 3  119 ? -10.800 -11.256 83.249 1.00 96.78  ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C 3  119 ? -10.647 -10.138 84.288 1.00 97.27  ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C 3  119 ? -9.548  -10.406 85.311 1.00 97.55  ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C 3  119 ? -9.672  -9.422  86.477 1.00 97.76  ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C 3  119 ? -8.600  -9.582  87.497 1.00 97.68  ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D 4  31  ? 10.093  -22.056 19.921 1.00 106.02 ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D 4  31  ? 10.350  -21.607 21.325 1.00 106.13 ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D 4  31  ? 9.205   -20.693 21.792 1.00 105.78 ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D 4  31  ? 9.404   -19.498 22.056 1.00 105.75 ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D 4  31  ? 11.727  -20.928 21.430 1.00 106.30 ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D 4  31  ? 12.916  -21.870 21.158 1.00 107.03 ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D 4  31  ? 13.353  -21.879 19.682 1.00 107.76 ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D 4  31  ? 13.583  -23.309 19.145 1.00 108.38 ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D 4  31  ? 14.541  -24.158 19.933 1.00 108.27 ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D 4  32  ? 8.019   -21.299 21.920 1.00 105.27 ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D 4  32  ? 6.716   -20.602 21.904 1.00 104.72 ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D 4  32  ? 6.576   -19.393 22.841 1.00 104.18 ? 29   THR D C     1 
ATOM   2286  O  O     . THR D 4  32  ? 7.126   -19.373 23.950 1.00 104.17 ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D 4  32  ? 5.516   -21.601 22.078 1.00 104.86 ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D 4  32  ? 4.494   -21.311 21.114 1.00 104.69 ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D 4  32  ? 4.922   -21.565 23.502 1.00 104.97 ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D 4  33  ? 5.826   -18.395 22.375 1.00 103.38 ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D 4  33  ? 5.700   -17.127 23.090 1.00 102.59 ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D 4  33  ? 4.542   -17.123 24.091 1.00 101.75 ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D 4  33  ? 3.391   -17.404 23.733 1.00 101.83 ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D 4  33  ? 5.613   -15.942 22.112 1.00 102.76 ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D 4  33  ? 4.368   -15.892 21.228 1.00 103.29 ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D 4  33  ? 4.231   -14.528 20.553 1.00 104.77 ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D 4  33  ? 4.487   -13.412 21.471 1.00 105.65 ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D 4  33  ? 4.367   -12.122 21.156 1.00 106.33 ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D 4  33  ? 3.987   -11.748 19.936 1.00 106.63 ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D 4  33  ? 4.627   -11.194 22.069 1.00 106.73 ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D 4  34  ? 4.865   -16.818 25.347 1.00 100.46 ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D 4  34  ? 3.866   -16.782 26.418 1.00 99.16  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D 4  34  ? 3.443   -15.358 26.775 1.00 98.10  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D 4  34  ? 4.242   -14.569 27.282 1.00 97.97  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D 4  34  ? 4.343   -17.555 27.656 1.00 99.20  ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D 4  34  ? 5.788   -17.313 28.047 1.00 99.46  ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D 4  34  ? 6.288   -18.380 29.013 1.00 100.25 ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D 4  34  ? 7.812   -18.345 29.117 1.00 100.70 ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D 4  34  ? 8.362   -19.436 29.966 1.00 100.69 ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D 4  35  ? 2.175   -15.049 26.505 1.00 96.72  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D 4  35  ? 1.615   -13.713 26.710 1.00 95.29  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D 4  35  ? 1.165   -13.452 28.141 1.00 94.19  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D 4  35  ? 0.560   -14.319 28.779 1.00 94.17  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D 4  35  ? 0.423   -13.497 25.787 1.00 95.35  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D 4  35  ? 0.786   -13.174 24.361 1.00 95.51  ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D 4  35  ? -0.415  -12.730 23.564 1.00 95.91  ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D 4  35  ? -1.543  -13.156 23.903 1.00 95.87  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D 4  35  ? -0.237  -11.952 22.602 1.00 96.09  ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D 4  36  ? 1.450   -12.245 28.627 1.00 92.65  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D 4  36  ? 0.999   -11.803 29.946 1.00 91.10  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D 4  36  ? 0.814   -10.288 30.010 1.00 90.03  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D 4  36  ? 1.299   -9.553  29.156 1.00 89.91  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D 4  36  ? 1.946   -12.296 31.054 1.00 91.12  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D 4  36  ? 3.072   -11.456 31.213 1.00 90.69  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D 4  37  ? 0.110   -9.835  31.039 1.00 88.72  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D 4  37  ? -0.188  -8.423  31.229 1.00 87.43  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D 4  37  ? 0.896   -7.691  32.024 1.00 86.74  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D 4  37  ? 0.702   -6.542  32.437 1.00 86.53  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D 4  37  ? -1.531  -8.287  31.937 1.00 87.36  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D 4  37  ? -2.700  -8.807  31.138 1.00 87.03  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D 4  37  ? -3.081  -10.144 31.210 1.00 86.84  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D 4  37  ? -3.432  -7.957  30.316 1.00 87.19  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D 4  37  ? -4.156  -10.623 30.478 1.00 86.96  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D 4  37  ? -4.509  -8.425  29.581 1.00 87.43  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D 4  37  ? -4.865  -9.757  29.667 1.00 87.24  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D 4  37  ? -5.935  -10.218 28.940 1.00 87.64  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D 4  38  ? 2.039   -8.356  32.204 1.00 85.82  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D 4  38  ? 3.119   -7.893  33.086 1.00 84.82  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D 4  38  ? 3.684   -6.520  32.753 1.00 84.13  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D 4  38  ? 3.993   -5.747  33.657 1.00 84.08  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D 4  38  ? 4.240   -8.921  33.145 1.00 84.87  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D 4  39  ? 3.827   -6.212  31.468 1.00 83.32  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D 4  39  ? 4.344   -4.900  31.078 1.00 82.50  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D 4  39  ? 3.324   -3.800  31.385 1.00 81.91  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D 4  39  ? 3.694   -2.676  31.730 1.00 81.77  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D 4  39  ? 4.830   -4.846  29.592 1.00 82.50  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D 4  39  ? 3.720   -5.233  28.615 1.00 82.29  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D 4  39  ? 6.054   -5.740  29.389 1.00 82.55  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D 4  39  ? 3.888   -4.629  27.232 1.00 81.91  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D 4  40  ? 2.045   -4.157  31.292 1.00 81.15  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D 4  40  ? 0.950   -3.219  31.483 1.00 80.53  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D 4  40  ? 0.680   -2.967  32.958 1.00 80.06  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D 4  40  ? 0.462   -1.824  33.372 1.00 79.85  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D 4  40  ? -0.307  -3.748  30.808 1.00 80.54  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D 4  40  ? -0.106  -4.110  29.359 1.00 80.92  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D 4  40  ? 0.098   -5.430  28.977 1.00 80.90  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D 4  40  ? -0.124  -3.131  28.368 1.00 81.60  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D 4  40  ? 0.278   -5.767  27.651 1.00 81.24  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D 4  40  ? 0.053   -3.459  27.033 1.00 81.78  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D 4  40  ? 0.257   -4.781  26.683 1.00 81.78  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D 4  40  ? 0.437   -5.122  25.361 1.00 82.85  ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D 4  41  ? 0.682   -4.047  33.738 1.00 79.51  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D 4  41  ? 0.534   -3.979  35.192 1.00 78.83  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D 4  41  ? 1.612   -3.057  35.744 1.00 78.55  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D 4  41  ? 1.310   -2.113  36.476 1.00 78.64  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D 4  41  ? 0.650   -5.382  35.847 1.00 78.71  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D 4  41  ? 0.743   -5.272  37.351 1.00 78.60  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D 4  41  ? -0.520  -6.260  35.456 1.00 78.48  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D 4  42  ? 2.859   -3.334  35.361 1.00 78.06  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D 4  42  ? 4.019   -2.563  35.785 1.00 77.66  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D 4  42  ? 3.867   -1.101  35.410 1.00 77.12  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D 4  42  ? 4.138   -0.228  36.223 1.00 77.02  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D 4  42  ? 5.294   -3.139  35.165 1.00 77.96  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D 4  42  ? 6.580   -2.538  35.688 1.00 79.02  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D 4  42  ? 7.188   -3.043  36.842 1.00 80.24  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D 4  42  ? 7.197   -1.476  35.024 1.00 80.14  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D 4  42  ? 8.371   -2.499  37.333 1.00 81.53  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D 4  42  ? 8.384   -0.921  35.501 1.00 81.79  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D 4  42  ? 8.968   -1.439  36.656 1.00 82.55  ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D 4  42  ? 10.144  -0.895  37.140 1.00 83.42  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D 4  43  ? 3.429   -0.837  34.180 1.00 76.64  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D 4  43  ? 3.182   0.531   33.730 1.00 76.17  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D 4  43  ? 2.321   1.255   34.754 1.00 75.76  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D 4  43  ? 2.679   2.331   35.240 1.00 75.70  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D 4  43  ? 2.481   0.543   32.369 1.00 76.17  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D 4  43  ? 3.405   0.544   31.173 1.00 76.56  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D 4  43  ? 2.616   0.491   29.873 1.00 77.11  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D 4  43  ? 3.544   0.407   28.670 1.00 77.55  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D 4  43  ? 2.821   -0.017  27.436 1.00 77.98  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D 4  44  ? 1.196   0.625   35.085 1.00 75.28  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D 4  44  ? 0.190   1.184   35.976 1.00 74.70  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D 4  44  ? 0.701   1.227   37.414 1.00 74.50  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D 4  44  ? 0.275   2.061   38.215 1.00 74.31  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D 4  44  ? -1.120  0.380   35.890 1.00 74.67  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D 4  44  ? -2.188  1.007   36.755 1.00 74.55  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D 4  44  ? -1.608  0.300   34.444 1.00 74.39  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D 4  45  ? 1.628   0.331   37.729 1.00 74.33  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D 4  45  ? 2.277   0.331   39.031 1.00 74.24  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D 4  45  ? 3.118   1.594   39.238 1.00 74.28  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D 4  45  ? 3.127   2.168   40.328 1.00 74.62  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D 4  45  ? 3.133   -0.924  39.200 1.00 74.00  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D 4  45  ? 3.976   -0.989  40.467 1.00 74.01  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D 4  45  ? 3.099   -0.987  41.715 1.00 73.96  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D 4  45  ? 4.861   -2.207  40.423 1.00 74.47  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D 4  46  ? 3.810   2.024   38.187 1.00 74.13  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D 4  46  ? 4.654   3.209   38.251 1.00 73.88  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D 4  46  ? 3.826   4.480   38.289 1.00 73.82  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D 4  46  ? 4.269   5.488   38.828 1.00 73.77  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D 4  46  ? 5.629   3.239   37.075 1.00 73.96  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D 4  46  ? 6.707   2.168   37.149 1.00 74.17  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D 4  46  ? 7.571   2.376   38.371 1.00 74.99  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D 4  46  ? 8.120   1.074   38.888 1.00 75.48  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D 4  46  ? 8.746   1.276   40.218 1.00 76.16  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D 4  47  ? 2.626   4.424   37.715 1.00 73.92  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D 4  47  ? 1.677   5.539   37.769 1.00 74.06  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D 4  47  ? 1.249   5.845   39.207 1.00 74.45  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D 4  47  ? 1.223   7.015   39.622 1.00 74.29  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D 4  47  ? 0.437   5.241   36.921 1.00 73.89  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D 4  47  ? 0.654   5.280   35.418 1.00 73.40  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D 4  47  ? -0.641  5.498   34.647 1.00 73.29  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D 4  47  ? -1.652  4.836   34.896 1.00 73.20  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D 4  47  ? -0.613  6.433   33.704 1.00 72.96  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D 4  48  ? 0.925   4.780   39.952 1.00 74.87  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D 4  48  ? 0.436   4.879   41.336 1.00 75.11  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D 4  48  ? 1.562   5.024   42.355 1.00 75.39  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D 4  48  ? 1.493   5.887   43.239 1.00 75.52  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D 4  48  ? -0.485  3.686   41.740 1.00 75.06  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D 4  48  ? -1.840  3.786   41.049 1.00 75.15  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D 4  48  ? 0.172   2.346   41.463 1.00 74.71  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D 4  49  ? 2.582   4.178   42.235 1.00 75.66  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D 4  49  ? 3.759   4.260   43.093 1.00 76.19  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D 4  49  ? 5.030   4.161   42.251 1.00 76.41  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D 4  49  ? 5.487   3.054   41.942 1.00 76.66  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D 4  49  ? 3.727   3.178   44.176 1.00 76.26  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D 4  49  ? 2.510   3.225   45.043 1.00 76.67  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D 4  49  ? 2.160   4.340   45.773 1.00 76.96  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D 4  49  ? 1.555   2.296   45.291 1.00 77.15  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D 4  49  ? 1.041   4.098   46.432 1.00 77.70  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D 4  49  ? 0.655   2.864   46.160 1.00 77.56  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D 4  50  ? 5.609   5.322   41.876 1.00 76.49  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D 4  50  ? 6.735   5.353   40.940 1.00 76.50  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D 4  50  ? 8.043   4.900   41.573 1.00 76.49  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D 4  50  ? 9.015   4.654   40.865 1.00 76.47  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D 4  50  ? 6.823   6.832   40.526 1.00 76.55  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D 4  50  ? 5.675   7.534   41.208 1.00 76.51  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D 4  50  ? 5.272   6.671   42.356 1.00 76.55  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D 4  51  ? 8.059   4.784   42.895 1.00 76.61  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D 4  51  ? 9.255   4.355   43.605 1.00 76.89  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D 4  51  ? 9.175   2.906   44.090 1.00 76.70  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D 4  51  ? 10.023  2.458   44.871 1.00 76.75  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D 4  51  ? 9.526   5.301   44.774 1.00 77.16  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D 4  51  ? 9.969   6.683   44.318 1.00 78.11  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D 4  51  ? 10.390  6.832   43.146 1.00 79.05  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D 4  51  ? 9.902   7.623   45.141 1.00 79.30  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D 4  52  ? 8.177   2.175   43.597 1.00 76.38  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D 4  52  ? 7.850   0.851   44.109 1.00 76.01  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D 4  52  ? 7.924   -0.221  43.022 1.00 75.87  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D 4  52  ? 7.327   -0.080  41.953 1.00 75.76  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D 4  52  ? 6.440   0.853   44.738 1.00 76.02  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D 4  52  ? 6.248   2.061   45.481 1.00 75.80  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D 4  52  ? 6.248   -0.335  45.664 1.00 76.14  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D 4  53  ? 8.661   -1.291  43.310 1.00 75.72  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D 4  53  ? 8.772   -2.439  42.407 1.00 75.36  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D 4  53  ? 7.893   -3.605  42.826 1.00 75.06  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D 4  53  ? 7.172   -3.517  43.819 1.00 75.01  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D 4  54  ? 7.968   -4.702  42.074 1.00 74.80  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D 4  54  ? 7.096   -5.863  42.291 1.00 74.62  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D 4  54  ? 7.803   -7.201  42.023 1.00 74.71  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D 4  54  ? 8.318   -7.430  40.924 1.00 74.92  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D 4  54  ? 5.807   -5.751  41.442 1.00 74.45  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D 4  54  ? 4.837   -6.892  41.767 1.00 74.21  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D 4  54  ? 6.150   -5.682  39.959 1.00 74.24  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D 4  54  ? 3.435   -6.702  41.206 1.00 74.15  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D 4  55  ? 7.814   -8.081  43.027 1.00 74.49  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D 4  55  ? 8.448   -9.394  42.911 1.00 74.30  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D 4  55  ? 7.820   -10.153 41.764 1.00 74.11  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D 4  55  ? 6.620   -10.036 41.538 1.00 74.19  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D 4  55  ? 8.284   -10.193 44.205 1.00 74.47  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D 4  55  ? 7.031   -10.860 44.254 1.00 74.72  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D 4  56  ? 8.616   -10.936 41.046 1.00 73.91  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D 4  56  ? 8.097   -11.662 39.892 1.00 73.92  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D 4  56  ? 6.943   -12.586 40.279 1.00 73.84  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D 4  56  ? 6.141   -12.980 39.417 1.00 74.05  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D 4  56  ? 9.204   -12.441 39.184 1.00 73.94  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D 4  56  ? 9.798   -13.379 40.063 1.00 74.41  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D 4  57  ? 6.858   -12.917 41.571 1.00 73.45  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D 4  57  ? 5.750   -13.718 42.100 1.00 73.13  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D 4  57  ? 4.466   -12.897 42.283 1.00 72.53  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D 4  57  ? 3.374   -13.347 41.917 1.00 72.34  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D 4  57  ? 6.146   -14.397 43.408 1.00 73.33  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D 4  57  ? 7.097   -15.568 43.243 1.00 74.55  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D 4  57  ? 7.556   -16.065 44.608 1.00 76.96  ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D 4  57  ? 8.504   -17.258 44.510 1.00 77.82  ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D 4  57  ? 9.139   -17.543 45.837 1.00 78.47  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D 4  58  ? 4.599   -11.699 42.847 1.00 71.82  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D 4  58  ? 3.464   -10.798 42.965 1.00 71.25  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D 4  58  ? 2.931   -10.501 41.574 1.00 71.06  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D 4  58  ? 1.726   -10.517 41.360 1.00 71.36  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D 4  58  ? 3.849   -9.528  43.682 1.00 71.12  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D 4  59  ? 3.833   -10.268 40.625 1.00 70.67  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D 4  59  ? 3.458   -10.079 39.232 1.00 70.29  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D 4  59  ? 2.748   -11.321 38.700 1.00 70.16  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D 4  59  ? 1.727   -11.207 38.020 1.00 70.19  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D 4  59  ? 4.694   -9.759  38.387 1.00 70.52  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D 4  59  ? 4.411   -9.385  36.930 1.00 70.47  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D 4  59  ? 3.354   -7.937  36.757 1.00 71.20  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D 4  59  ? 4.504   -6.596  37.031 1.00 69.72  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D 4  60  ? 3.278   -12.500 39.029 1.00 69.84  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D 4  60  ? 2.686   -13.767 38.597 1.00 69.68  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D 4  60  ? 1.217   -13.891 39.035 1.00 69.49  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D 4  60  ? 0.372   -14.405 38.291 1.00 69.37  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D 4  60  ? 3.514   -14.943 39.122 1.00 69.57  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D 4  60  ? 3.012   -16.182 38.643 1.00 70.30  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D 4  61  ? 0.937   -13.409 40.246 1.00 69.29  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D 4  61  ? -0.421  -13.332 40.787 1.00 68.96  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D 4  61  ? -1.226  -12.225 40.100 1.00 68.89  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D 4  61  ? -2.327  -12.477 39.601 1.00 68.90  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D 4  61  ? -0.398  -13.121 42.315 1.00 68.85  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D 4  61  ? 0.267   -14.320 42.983 1.00 68.60  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D 4  61  ? -1.809  -12.924 42.860 1.00 68.33  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D 4  61  ? 0.994   -13.992 44.236 1.00 69.04  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D 4  62  ? -0.664  -11.015 40.071 1.00 68.66  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D 4  62  ? -1.265  -9.875  39.374 1.00 68.52  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D 4  62  ? -1.666  -10.214 37.951 1.00 68.44  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D 4  62  ? -2.585  -9.607  37.395 1.00 68.31  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D 4  62  ? -0.303  -8.690  39.340 1.00 68.50  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D 4  62  ? -0.259  -7.877  40.620 1.00 68.41  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D 4  62  ? -1.890  -7.389  41.178 1.00 67.76  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D 4  62  ? -2.431  -6.384  39.804 1.00 67.21  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D 4  63  ? -0.964  -11.178 37.366 1.00 68.31  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D 4  63  ? -1.280  -11.618 36.029 1.00 68.42  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D 4  63  ? -2.469  -12.562 36.002 1.00 68.50  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D 4  63  ? -3.278  -12.510 35.073 1.00 68.49  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D 4  63  ? -0.072  -12.268 35.363 1.00 68.54  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D 4  63  ? -0.323  -12.571 33.905 1.00 68.52  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D 4  63  ? -1.001  -11.812 33.212 1.00 68.52  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D 4  63  ? 0.196   -13.694 33.437 1.00 68.62  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D 4  64  ? -2.561  -13.427 37.014 1.00 68.55  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D 4  64  ? -3.677  -14.363 37.145 1.00 68.68  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D 4  64  ? -4.962  -13.610 37.426 1.00 68.65  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D 4  64  ? -6.035  -13.981 36.944 1.00 68.77  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D 4  64  ? -3.423  -15.353 38.275 1.00 68.61  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D 4  64  ? -2.422  -16.280 37.912 1.00 69.66  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D 4  65  ? -4.833  -12.547 38.213 1.00 68.53  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D 4  65  ? -5.951  -11.702 38.598 1.00 68.42  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D 4  65  ? -6.626  -11.076 37.385 1.00 68.59  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D 4  65  ? -7.854  -11.074 37.286 1.00 68.70  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D 4  65  ? -5.464  -10.634 39.582 1.00 68.27  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D 4  65  ? -6.427  -9.506  39.800 1.00 67.56  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D 4  65  ? -7.739  -9.746  40.182 1.00 67.34  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D 4  65  ? -6.002  -8.194  39.659 1.00 66.94  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D 4  65  ? -8.615  -8.694  40.389 1.00 67.26  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D 4  65  ? -6.864  -7.143  39.871 1.00 66.66  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D 4  65  ? -8.174  -7.390  40.236 1.00 66.97  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D 4  66  ? -5.820  -10.557 36.462 1.00 68.69  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D 4  66  ? -6.347  -9.970  35.232 1.00 68.62  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D 4  66  ? -6.917  -11.060 34.319 1.00 68.82  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D 4  66  ? -7.982  -10.876 33.733 1.00 68.82  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D 4  66  ? -5.296  -9.106  34.504 1.00 68.48  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D 4  66  ? -5.872  -8.527  33.229 1.00 68.16  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D 4  66  ? -4.807  -7.984  35.417 1.00 68.19  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D 4  67  ? -6.225  -12.193 34.223 1.00 69.00  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D 4  67  ? -6.745  -13.342 33.494 1.00 69.43  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D 4  67  ? -8.075  -13.821 34.063 1.00 69.52  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D 4  67  ? -9.033  -14.044 33.311 1.00 69.57  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D 4  67  ? -5.732  -14.479 33.484 1.00 69.61  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D 4  67  ? -4.576  -14.218 32.538 1.00 71.07  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D 4  67  ? -4.775  -13.903 31.360 1.00 72.02  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D 4  67  ? -3.351  -14.355 33.048 1.00 72.73  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D 4  68  ? -8.128  -13.961 35.389 1.00 69.58  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D 4  68  ? -9.336  -14.405 36.081 1.00 69.57  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D 4  68  ? -10.494 -13.447 35.809 1.00 69.65  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D 4  68  ? -11.520 -13.857 35.269 1.00 69.81  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D 4  68  ? -9.088  -14.573 37.590 1.00 69.49  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D 4  68  ? -10.322 -15.084 38.353 1.00 69.15  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D 4  68  ? -11.202 -15.718 37.739 1.00 69.80  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D 4  68  ? -10.414 -14.859 39.577 1.00 67.88  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D 4  69  ? -10.316 -12.175 36.155 1.00 69.66  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D 4  69  ? -11.365 -11.174 35.967 1.00 69.79  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D 4  69  ? -11.794 -11.021 34.500 1.00 70.13  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D 4  69  ? -12.952 -10.694 34.231 1.00 70.01  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D 4  69  ? -10.972 -9.819  36.586 1.00 69.65  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D 4  69  ? -11.794 -8.693  36.001 1.00 69.80  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D 4  69  ? -11.155 -9.863  38.088 1.00 69.50  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D 4  70  ? -10.871 -11.265 33.563 1.00 70.62  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D 4  70  ? -11.210 -11.286 32.136 1.00 71.04  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D 4  70  ? -12.228 -12.379 31.838 1.00 71.48  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D 4  70  ? -13.288 -12.097 31.275 1.00 71.56  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D 4  70  ? -9.977  -11.479 31.247 1.00 70.99  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D 4  70  ? -10.289 -11.510 29.761 1.00 71.08  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D 4  70  ? -9.914  -10.456 28.936 1.00 70.87  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D 4  70  ? -10.954 -12.596 29.186 1.00 71.12  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D 4  70  ? -10.200 -10.484 27.575 1.00 70.42  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D 4  70  ? -11.244 -12.626 27.827 1.00 70.43  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D 4  70  ? -10.866 -11.572 27.024 1.00 70.32  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D 4  71  ? -11.902 -13.619 32.209 1.00 71.88  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D 4  71  ? -12.790 -14.754 31.957 1.00 72.48  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D 4  71  ? -14.161 -14.517 32.557 1.00 72.42  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D 4  71  ? -15.169 -14.873 31.958 1.00 72.68  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D 4  71  ? -12.217 -16.047 32.532 1.00 72.78  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D 4  71  ? -11.026 -16.625 31.774 1.00 74.58  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D 4  71  ? -10.035 -17.354 32.693 1.00 76.59  ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D 4  71  ? -10.440 -17.830 33.786 1.00 76.65  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D 4  71  ? -8.841  -17.442 32.317 1.00 77.45  ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D 4  72  ? -14.191 -13.903 33.736 1.00 72.42  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D 4  72  ? -15.430 -13.722 34.485 1.00 72.55  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D 4  72  ? -16.380 -12.702 33.858 1.00 72.82  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D 4  72  ? -17.589 -12.945 33.788 1.00 72.90  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D 4  72  ? -15.134 -13.309 35.925 1.00 72.52  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D 4  72  ? -14.578 -14.389 36.826 1.00 71.76  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D 4  72  ? -14.969 -14.053 38.251 1.00 70.56  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D 4  72  ? -13.847 -14.123 39.172 1.00 69.32  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D 4  72  ? -13.828 -13.546 40.367 1.00 69.20  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D 4  72  ? -14.865 -12.846 40.795 1.00 68.56  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D 4  72  ? -12.760 -13.664 41.138 1.00 70.62  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D 4  73  ? -15.834 -11.559 33.433 1.00 73.04  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D 4  73  ? -16.621 -10.507 32.776 1.00 73.08  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D 4  73  ? -17.021 -10.951 31.377 1.00 73.43  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D 4  73  ? -18.187 -10.826 30.994 1.00 73.57  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D 4  73  ? -15.873 -9.157  32.728 1.00 72.93  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D 4  73  ? -15.916 -8.492  34.108 1.00 72.74  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D 4  73  ? -16.484 -8.238  31.673 1.00 72.37  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D 4  73  ? -14.902 -7.384  34.313 1.00 72.49  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D 4  74  ? -16.054 -11.486 30.632 1.00 73.67  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D 4  74  ? -16.323 -12.074 29.328 1.00 73.96  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D 4  74  ? -17.424 -13.121 29.443 1.00 74.27  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D 4  74  ? -18.354 -13.136 28.645 1.00 74.49  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D 4  74  ? -15.067 -12.677 28.751 1.00 73.87  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D 4  75  ? -17.329 -13.971 30.462 1.00 74.60  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D 4  75  ? -18.330 -15.002 30.709 1.00 75.21  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D 4  75  ? -19.736 -14.452 30.840 1.00 75.67  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D 4  75  ? -20.643 -14.886 30.133 1.00 75.52  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D 4  76  ? -19.914 -13.492 31.747 1.00 76.29  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D 4  76  ? -21.220 -12.882 31.981 1.00 76.90  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D 4  76  ? -21.735 -12.234 30.716 1.00 77.10  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D 4  76  ? -22.895 -12.423 30.359 1.00 77.19  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D 4  76  ? -21.164 -11.857 33.114 1.00 77.08  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D 4  76  ? -21.107 -12.468 34.510 1.00 78.63  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D 4  76  ? -22.379 -13.222 34.892 1.00 80.26  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D 4  76  ? -23.432 -13.020 34.235 1.00 80.47  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D 4  76  ? -22.320 -14.017 35.860 1.00 80.83  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D 4  77  ? -20.860 -11.483 30.040 1.00 77.34  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D 4  77  ? -21.162 -10.891 28.739 1.00 77.41  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D 4  77  ? -21.622 -11.977 27.776 1.00 77.61  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D 4  77  ? -22.618 -11.811 27.071 1.00 77.70  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D 4  77  ? -19.949 -10.178 28.190 1.00 77.24  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D 4  78  ? -20.901 -13.097 27.782 1.00 77.84  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D 4  78  ? -21.212 -14.252 26.950 1.00 78.10  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D 4  78  ? -22.626 -14.769 27.220 1.00 78.41  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D 4  78  ? -23.425 -14.910 26.289 1.00 78.56  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D 4  78  ? -20.169 -15.354 27.170 1.00 77.97  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D 4  78  ? -20.266 -16.373 26.197 1.00 77.96  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D 4  79  ? -22.930 -15.034 28.489 1.00 78.80  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D 4  79  ? -24.255 -15.504 28.901 1.00 79.41  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D 4  79  ? -25.332 -14.466 28.616 1.00 80.16  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D 4  79  ? -26.419 -14.793 28.129 1.00 80.17  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D 4  79  ? -24.258 -15.841 30.390 1.00 79.22  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D 4  79  ? -24.272 -17.318 30.691 1.00 78.66  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D 4  79  ? -23.777 -17.612 32.096 1.00 77.54  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D 4  79  ? -22.324 -17.759 32.123 1.00 76.85  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D 4  79  ? -21.506 -17.056 32.897 1.00 76.63  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D 4  79  ? -21.992 -16.155 33.739 1.00 76.59  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D 4  79  ? -20.197 -17.265 32.837 1.00 76.66  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D 4  80  ? -24.995 -13.215 28.924 1.00 81.02  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D 4  80  ? -25.876 -12.061 28.794 1.00 81.76  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D 4  80  ? -26.449 -11.945 27.391 1.00 82.47  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D 4  80  ? -27.653 -11.750 27.220 1.00 82.50  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D 4  80  ? -25.086 -10.800 29.143 1.00 81.56  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D 4  80  ? -25.770 -9.519  29.601 1.00 81.34  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D 4  80  ? -26.853 -9.792  30.618 1.00 81.17  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D 4  80  ? -24.711 -8.617  30.182 1.00 81.14  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D 4  81  ? -25.567 -12.075 26.400 1.00 83.46  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D 4  81  ? -25.933 -12.026 24.990 1.00 84.37  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D 4  81  ? -26.847 -13.188 24.614 1.00 85.05  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D 4  81  ? -27.891 -12.977 23.996 1.00 84.97  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D 4  81  ? -24.680 -12.014 24.120 1.00 84.38  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D 4  82  ? -26.460 -14.404 25.002 1.00 86.06  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D 4  82  ? -27.280 -15.595 24.753 1.00 87.22  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D 4  82  ? -28.720 -15.392 25.204 1.00 87.57  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D 4  82  ? -29.653 -15.646 24.443 1.00 87.69  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D 4  82  ? -26.691 -16.838 25.431 1.00 87.46  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D 4  82  ? -26.119 -17.838 24.471 1.00 88.78  ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D 4  82  ? -26.903 -18.738 23.780 1.00 89.51  ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D 4  82  ? -24.841 -18.082 24.092 1.00 89.71  ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D 4  82  ? -26.133 -19.491 23.014 1.00 89.98  ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D 4  82  ? -24.878 -19.113 23.183 1.00 90.11  ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D 4  83  ? -28.883 -14.910 26.434 1.00 88.13  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D 4  83  ? -30.200 -14.707 27.036 1.00 88.65  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D 4  83  ? -31.032 -13.655 26.303 1.00 88.83  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D 4  83  ? -32.242 -13.552 26.523 1.00 88.91  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D 4  83  ? -30.068 -14.306 28.509 1.00 88.79  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D 4  83  ? -29.340 -15.294 29.410 1.00 89.60  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D 4  83  ? -28.713 -14.855 30.581 1.00 89.94  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D 4  83  ? -29.275 -16.658 29.102 1.00 90.11  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D 4  83  ? -28.053 -15.739 31.425 1.00 89.86  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D 4  83  ? -28.606 -17.551 29.939 1.00 90.37  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D 4  83  ? -28.003 -17.082 31.101 1.00 90.41  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D 4  83  ? -27.346 -17.957 31.939 1.00 90.98  ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D 4  84  ? -30.381 -12.876 25.442 1.00 88.96  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D 4  84  ? -31.058 -11.822 24.695 1.00 89.18  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D 4  84  ? -31.053 -12.050 23.182 1.00 89.37  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D 4  84  ? -31.274 -11.113 22.405 1.00 89.53  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D 4  84  ? -30.455 -10.454 25.035 1.00 89.11  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D 4  84  ? -30.885 -9.951  26.395 1.00 88.87  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D 4  84  ? -32.051 -9.620  26.611 1.00 88.61  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D 4  84  ? -29.940 -9.881  27.321 1.00 88.91  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D 4  85  ? -30.811 -13.295 22.772 1.00 89.46  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D 4  85  ? -30.723 -13.655 21.350 1.00 89.55  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D 4  85  ? -29.884 -12.619 20.590 1.00 89.26  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D 4  85  ? -30.314 -12.049 19.589 1.00 89.18  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D 4  85  ? -32.124 -13.824 20.743 1.00 89.70  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D 4  85  ? -32.974 -14.882 21.446 1.00 90.75  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D 4  85  ? -34.426 -14.419 21.622 1.00 92.43  ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D 4  85  ? -35.114 -15.117 22.810 1.00 92.68  ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D 4  85  ? -35.439 -16.549 22.530 1.00 93.01  ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D 4  86  ? -28.686 -12.372 21.114 1.00 89.09  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D 4  86  ? -27.738 -11.429 20.535 1.00 88.93  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D 4  86  ? -26.431 -12.147 20.222 1.00 88.61  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D 4  86  ? -25.873 -12.842 21.074 1.00 88.57  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D 4  86  ? -27.472 -10.264 21.497 1.00 89.06  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D 4  86  ? -28.673 -9.374  21.796 1.00 89.54  ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D 4  86  ? -29.003 -8.470  20.620 1.00 90.65  ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D 4  86  ? -30.212 -7.676  20.837 1.00 91.33  ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D 4  86  ? -31.452 -8.106  20.613 1.00 91.46  ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D 4  86  ? -31.675 -9.340  20.174 1.00 91.50  ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D 4  86  ? -32.477 -7.299  20.838 1.00 91.76  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D 4  87  ? -25.946 -11.976 18.998 1.00 88.20  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D 4  87  ? -24.734 -12.651 18.554 1.00 87.89  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D 4  87  ? -23.505 -11.755 18.706 1.00 87.54  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D 4  87  ? -22.425 -12.069 18.196 1.00 87.53  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D 4  87  ? -24.893 -13.118 17.104 1.00 88.00  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D 4  87  ? -25.358 -12.063 16.277 1.00 88.48  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D 4  88  ? -23.674 -10.644 19.418 1.00 87.01  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D 4  88  ? -22.606 -9.662  19.576 1.00 86.54  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D 4  88  ? -22.490 -9.181  21.021 1.00 86.04  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D 4  88  ? -23.495 -8.890  21.680 1.00 86.18  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D 4  88  ? -22.819 -8.436  18.653 1.00 86.68  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D 4  88  ? -23.341 -8.861  17.385 1.00 86.77  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D 4  88  ? -21.510 -7.668  18.445 1.00 86.67  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D 4  89  ? -21.256 -9.109  21.508 1.00 85.22  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D 4  89  ? -20.976 -8.488  22.791 1.00 84.32  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D 4  89  ? -20.490 -7.077  22.506 1.00 83.95  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D 4  89  ? -19.373 -6.886  22.027 1.00 84.06  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D 4  89  ? -19.902 -9.257  23.600 1.00 84.18  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D 4  89  ? -20.405 -10.646 23.988 1.00 83.63  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D 4  89  ? -19.519 -8.482  24.849 1.00 83.94  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D 4  89  ? -19.314 -11.569 24.446 1.00 82.45  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D 4  90  ? -21.347 -6.096  22.766 1.00 83.32  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D 4  90  ? -20.952 -4.694  22.714 1.00 82.75  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D 4  90  ? -20.510 -4.276  24.111 1.00 82.26  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D 4  90  ? -20.760 -4.995  25.075 1.00 82.39  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D 4  90  ? -22.112 -3.788  22.252 1.00 82.82  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D 4  90  ? -23.249 -3.990  23.102 1.00 82.81  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4  90  ? -22.502 -4.087  20.809 1.00 83.14  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D 4  91  ? -19.860 -3.120  24.222 1.00 81.62  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D 4  91  ? -19.450 -2.573  25.518 1.00 80.99  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D 4  91  ? -20.605 -2.484  26.512 1.00 80.54  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D 4  91  ? -20.381 -2.398  27.719 1.00 80.55  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D 4  91  ? -18.833 -1.190  25.344 1.00 80.99  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D 4  91  ? -19.839 -0.212  25.152 1.00 81.16  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D 4  92  ? -21.830 -2.490  25.993 1.00 79.97  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D 4  92  ? -23.033 -2.528  26.814 1.00 79.66  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D 4  92  ? -23.145 -3.844  27.596 1.00 79.16  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D 4  92  ? -23.512 -3.841  28.773 1.00 79.14  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D 4  92  ? -24.271 -2.302  25.945 1.00 79.90  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D 4  92  ? -25.571 -2.306  26.717 1.00 81.18  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D 4  92  ? -26.669 -1.571  25.983 1.00 83.73  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D 4  92  ? -27.806 -1.355  26.873 1.00 86.21  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D 4  92  ? -28.863 -2.161  26.953 1.00 87.79  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D 4  92  ? -28.949 -3.237  26.177 1.00 88.46  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D 4  92  ? -29.846 -1.883  27.805 1.00 88.36  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D 4  93  ? -22.829 -4.958  26.935 1.00 78.57  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D 4  93  ? -22.774 -6.269  27.585 1.00 77.98  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D 4  93  ? -21.643 -6.348  28.603 1.00 77.44  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D 4  93  ? -21.807 -6.947  29.664 1.00 77.52  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D 4  93  ? -22.613 -7.385  26.556 1.00 78.02  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D 4  93  ? -23.918 -7.909  25.988 1.00 78.67  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D 4  93  ? -24.648 -6.897  25.120 1.00 79.63  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D 4  93  ? -25.886 -7.016  24.998 1.00 80.75  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D 4  93  ? -23.995 -5.988  24.561 1.00 79.35  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D 4  94  ? -20.502 -5.746  28.274 1.00 76.65  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D 4  94  ? -19.383 -5.634  29.206 1.00 76.07  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D 4  94  ? -19.812 -4.838  30.443 1.00 76.00  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D 4  94  ? -19.375 -5.120  31.561 1.00 75.85  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D 4  94  ? -18.137 -4.978  28.537 1.00 75.92  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D 4  94  ? -17.684 -5.765  27.293 1.00 75.23  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D 4  94  ? -16.983 -4.804  29.540 1.00 75.82  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D 4  94  ? -17.110 -7.151  27.565 1.00 73.89  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D 4  95  ? -20.688 -3.858  30.226 1.00 76.03  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D 4  95  ? -21.215 -3.011  31.299 1.00 75.92  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D 4  95  ? -22.161 -3.736  32.265 1.00 75.76  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D 4  95  ? -21.962 -3.674  33.481 1.00 75.88  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D 4  95  ? -21.887 -1.758  30.732 1.00 75.87  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D 4  95  ? -22.565 -0.910  31.785 1.00 76.03  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D 4  95  ? -22.919 0.461   31.285 1.00 76.14  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D 4  95  ? -24.085 0.747   31.030 1.00 76.38  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D 4  95  ? -21.917 1.323   31.137 1.00 76.05  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D 4  96  ? -23.185 -4.412  31.747 1.00 75.29  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D 4  96  ? -24.047 -5.181  32.634 1.00 75.09  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D 4  96  ? -23.232 -6.301  33.279 1.00 74.90  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D 4  96  ? -23.434 -6.631  34.445 1.00 74.92  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D 4  96  ? -25.314 -5.703  31.932 1.00 75.12  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D 4  96  ? -26.090 -4.589  31.479 1.00 75.46  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4  96  ? -26.181 -6.509  32.889 1.00 75.08  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D 4  97  ? -22.278 -6.845  32.531 1.00 74.71  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D 4  97  ? -21.382 -7.870  33.058 1.00 74.48  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D 4  97  ? -20.598 -7.368  34.260 1.00 74.31  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D 4  97  ? -20.365 -8.119  35.201 1.00 74.32  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D 4  97  ? -20.436 -8.360  31.981 1.00 74.52  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D 4  98  ? -20.197 -6.100  34.218 1.00 74.21  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D 4  98  ? -19.434 -5.479  35.308 1.00 74.36  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D 4  98  ? -20.300 -5.176  36.538 1.00 74.25  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D 4  98  ? -19.865 -5.370  37.671 1.00 74.10  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D 4  98  ? -18.682 -4.199  34.824 1.00 74.48  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D 4  98  ? -18.399 -3.237  35.979 1.00 74.60  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D 4  98  ? -17.386 -4.576  34.114 1.00 74.56  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D 4  99  ? -21.523 -4.705  36.303 1.00 74.29  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D 4  99  ? -22.468 -4.414  37.377 1.00 74.24  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D 4  99  ? -22.971 -5.677  38.056 1.00 73.96  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D 4  99  ? -23.372 -5.639  39.221 1.00 74.07  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D 4  99  ? -23.647 -3.598  36.852 1.00 74.36  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D 4  99  ? -23.373 -2.109  36.812 1.00 76.06  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D 4  99  ? -24.493 -1.345  36.130 1.00 78.67  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D 4  99  ? -24.173 0.078   36.008 1.00 80.49  ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D 4  99  ? -24.527 0.846   34.977 1.00 81.56  ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D 4  99  ? -25.208 0.335   33.955 1.00 82.34  ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D 4  99  ? -24.189 2.130   34.961 1.00 81.88  ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D 4  100 ? -22.958 -6.789  37.324 1.00 73.58  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D 4  100 ? -23.357 -8.073  37.877 1.00 73.20  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D 4  100 ? -22.237 -8.673  38.688 1.00 72.98  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D 4  100 ? -22.489 -9.303  39.715 1.00 73.12  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D 4  100 ? -23.735 -9.058  36.779 1.00 73.15  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D 4  100 ? -25.102 -8.957  36.113 1.00 73.47  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D 4  100 ? -25.131 -9.970  34.983 1.00 73.93  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D 4  100 ? -26.261 -9.177  37.093 1.00 72.99  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D 4  101 ? -21.005 -8.474  38.226 1.00 72.63  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D 4  101 ? -19.866 -9.171  38.788 1.00 72.47  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D 4  101 ? -19.253 -8.465  39.983 1.00 72.46  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D 4  101 ? -19.047 -9.082  41.020 1.00 72.63  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D 4  101 ? -18.799 -9.413  37.729 1.00 72.51  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D 4  101 ? -17.850 -10.564 38.070 1.00 72.95  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D 4  101 ? -18.307 -11.845 37.356 1.00 72.95  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D 4  101 ? -16.406 -10.219 37.717 1.00 72.79  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D 4  102 ? -18.965 -7.177  39.840 1.00 72.52  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D 4  102 ? -18.236 -6.439  40.867 1.00 72.51  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D 4  102 ? -19.153 -5.865  41.951 1.00 72.90  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D 4  102 ? -20.269 -5.433  41.657 1.00 72.78  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D 4  102 ? -17.399 -5.316  40.246 1.00 72.42  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D 4  102 ? -16.584 -5.507  38.963 1.00 71.82  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D 4  102 ? -15.696 -4.305  38.766 1.00 71.57  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D 4  102 ? -15.745 -6.759  38.995 1.00 72.05  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D 4  103 ? -18.680 -5.863  43.215 1.00 73.32  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D 4  103 ? -19.420 -5.325  44.355 1.00 73.60  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D 4  103 ? -19.498 -3.800  44.411 1.00 74.01  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D 4  103 ? -18.505 -3.109  44.156 1.00 73.80  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D 4  103 ? -18.620 -5.837  45.554 1.00 73.55  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D 4  103 ? -17.257 -6.013  45.040 1.00 73.31  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D 4  103 ? -17.450 -6.544  43.658 1.00 73.37  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D 4  104 ? -20.693 -3.312  44.749 1.00 74.58  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D 4  104 ? -20.966 -1.911  45.076 1.00 75.19  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D 4  104 ? -20.129 -0.845  44.404 1.00 75.68  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D 4  104 ? -20.336 -0.536  43.230 1.00 75.97  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D 4  105 ? -19.183 -0.287  45.156 1.00 76.03  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D 4  105 ? -18.391 0.860   44.705 1.00 76.42  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D 4  105 ? -17.345 0.506   43.643 1.00 76.35  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D 4  105 ? -16.967 1.361   42.848 1.00 76.43  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D 4  105 ? -17.736 1.565   45.902 1.00 76.54  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D 4  105 ? -17.468 3.053   45.703 1.00 77.76  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D 4  105 ? -18.725 3.931   45.800 1.00 79.99  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D 4  105 ? -19.774 3.465   46.310 1.00 80.42  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D 4  105 ? -18.655 5.106   45.364 1.00 80.99  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D 4  106 ? -16.873 -0.739  43.626 1.00 76.37  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D 4  106 ? -15.972 -1.175  42.558 1.00 76.41  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D 4  106 ? -16.699 -1.151  41.221 1.00 76.85  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D 4  106 ? -16.144 -0.712  40.219 1.00 76.96  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D 4  106 ? -15.389 -2.572  42.816 1.00 76.08  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D 4  106 ? -14.096 -2.756  43.622 1.00 75.03  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D 4  106 ? -13.661 -4.200  43.544 1.00 73.91  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D 4  106 ? -12.970 -1.859  43.153 1.00 73.75  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D 4  107 ? -17.944 -1.614  41.217 1.00 77.30  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D 4  107 ? -18.748 -1.630  40.011 1.00 77.88  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D 4  107 ? -18.935 -0.213  39.494 1.00 78.52  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D 4  107 ? -18.721 0.057   38.311 1.00 78.71  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D 4  107 ? -20.077 -2.273  40.287 1.00 77.85  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D 4  108 ? -19.300 0.684   40.408 1.00 79.32  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D 4  108 ? -19.598 2.087   40.112 1.00 80.10  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D 4  108 ? -18.439 2.804   39.419 1.00 80.32  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D 4  108 ? -18.646 3.538   38.456 1.00 80.43  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D 4  108 ? -19.969 2.811   41.411 1.00 80.25  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D 4  108 ? -20.621 4.176   41.233 1.00 81.66  ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D 4  108 ? -20.604 4.986   42.542 1.00 83.92  ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D 4  108 ? -21.715 4.556   43.514 1.00 84.74  ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D 4  108 ? -21.646 5.289   44.815 1.00 84.89  ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D 4  109 ? -17.227 2.580   39.916 1.00 80.78  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D 4  109 ? -16.029 3.208   39.375 1.00 81.36  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D 4  109 ? -15.561 2.573   38.067 1.00 81.61  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D 4  109 ? -15.104 3.279   37.168 1.00 81.66  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D 4  109 ? -14.896 3.159   40.398 1.00 81.50  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D 4  109 ? -14.913 4.289   41.379 1.00 81.87  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D 4  109 ? -15.498 4.187   42.621 1.00 82.55  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D 4  109 ? -14.405 5.541   41.304 1.00 82.24  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D 4  109 ? -15.356 5.330   43.269 1.00 82.64  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D 4  109 ? -14.695 6.167   42.492 1.00 82.61  ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D 4  110 ? -15.659 1.246   37.976 1.00 81.97  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D 4  110 ? -15.261 0.511   36.773 1.00 82.26  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D 4  110 ? -16.088 0.979   35.591 1.00 82.59  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D 4  110 ? -15.543 1.330   34.542 1.00 82.42  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D 4  110 ? -15.421 -0.991  36.973 1.00 82.03  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D 4  111 ? -17.404 0.999   35.785 1.00 83.10  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D 4  111 ? -18.328 1.472   34.770 1.00 83.74  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D 4  111 ? -17.902 2.847   34.263 1.00 84.34  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D 4  111 ? -17.707 3.027   33.062 1.00 84.49  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D 4  111 ? -19.782 1.481   35.282 1.00 83.64  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D 4  111 ? -20.693 2.260   34.342 1.00 83.55  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D 4  111 ? -20.286 0.056   35.447 1.00 83.74  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D 4  112 ? -17.723 3.796   35.179 1.00 85.08  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D 4  112 ? -17.310 5.156   34.821 1.00 85.81  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D 4  112 ? -16.087 5.177   33.909 1.00 86.32  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D 4  112 ? -16.094 5.850   32.879 1.00 86.49  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D 4  112 ? -17.048 5.990   36.071 1.00 85.65  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D 4  112 ? -18.259 6.217   36.759 1.00 86.06  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D 4  113 ? -15.055 4.425   34.294 1.00 86.82  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D 4  113 ? -13.819 4.300   33.521 1.00 87.29  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D 4  113 ? -14.052 3.631   32.168 1.00 87.43  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D 4  113 ? -13.431 3.994   31.172 1.00 87.34  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D 4  113 ? -12.790 3.500   34.316 1.00 87.45  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D 4  113 ? -12.214 4.238   35.511 1.00 88.23  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D 4  113 ? -10.965 5.009   35.159 1.00 89.35  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D 4  113 ? -10.841 6.175   35.600 1.00 89.63  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D 4  113 ? -10.112 4.447   34.432 1.00 89.97  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D 4  114 ? -14.944 2.646   32.147 1.00 87.68  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D 4  114 ? -15.326 1.981   30.912 1.00 88.01  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D 4  114 ? -16.065 2.936   29.999 1.00 88.24  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D 4  114 ? -15.691 3.096   28.836 1.00 88.39  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D 4  115 ? -17.106 3.573   30.536 1.00 88.32  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D 4  115 ? -17.851 4.618   29.835 1.00 88.57  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D 4  115 ? -16.900 5.692   29.308 1.00 88.55  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D 4  115 ? -16.931 6.038   28.130 1.00 88.41  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D 4  115 ? -18.930 5.265   30.754 1.00 88.67  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D 4  115 ? -19.925 4.293   31.100 1.00 89.06  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D 4  115 ? -19.618 6.444   30.061 1.00 88.90  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D 4  116 ? -16.046 6.190   30.193 1.00 88.86  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D 4  116 ? -15.061 7.216   29.861 1.00 89.20  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D 4  116 ? -14.141 6.804   28.709 1.00 89.31  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D 4  116 ? -13.925 7.587   27.787 1.00 89.27  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D 4  116 ? -14.237 7.577   31.105 1.00 89.22  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D 4  116 ? -13.325 8.777   30.948 1.00 89.19  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D 4  116 ? -12.523 9.010   32.214 1.00 89.24  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D 4  116 ? -11.247 9.782   31.921 1.00 89.64  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D 4  116 ? -10.374 9.104   30.913 1.00 89.27  ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D 4  117 ? -13.616 5.582   28.765 1.00 89.56  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D 4  117 ? -12.680 5.098   27.754 1.00 89.94  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D 4  117 ? -13.348 4.844   26.407 1.00 90.31  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D 4  117 ? -12.760 5.122   25.365 1.00 90.26  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D 4  117 ? -11.972 3.854   28.234 1.00 90.00  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D 4  118 ? -14.564 4.302   26.433 1.00 90.88  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D 4  118 ? -15.347 4.077   25.210 1.00 91.44  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D 4  118 ? -15.726 5.415   24.563 1.00 91.93  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D 4  118 ? -15.556 5.595   23.356 1.00 92.11  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D 4  118 ? -16.603 3.195   25.480 1.00 91.38  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D 4  118 ? -17.521 3.138   24.263 1.00 91.25  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D 4  118 ? -16.187 1.793   25.883 1.00 91.09  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D 4  119 ? -16.223 6.345   25.376 1.00 92.42  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D 4  119 ? -16.520 7.708   24.937 1.00 92.89  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D 4  119 ? -15.296 8.399   24.312 1.00 93.35  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D 4  119 ? -15.394 8.947   23.218 1.00 93.32  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D 4  119 ? -17.100 8.539   26.102 1.00 92.80  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D 4  119 ? -18.374 8.002   26.470 1.00 92.90  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D 4  119 ? -17.278 9.982   25.716 1.00 92.69  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D 4  120 ? -14.153 8.356   24.997 1.00 94.10  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D 4  120 ? -12.901 8.918   24.463 1.00 94.90  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D 4  120 ? -12.365 8.135   23.261 1.00 95.58  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D 4  120 ? -11.471 8.604   22.554 1.00 95.64  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D 4  120 ? -11.827 9.056   25.561 1.00 94.85  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D 4  120 ? -10.374 8.982   25.066 1.00 94.52  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D 4  120 ? -9.450  9.961   25.784 1.00 94.90  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D 4  120 ? -8.045  9.967   25.158 1.00 94.80  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D 4  120 ? -7.208  11.141  25.565 1.00 94.05  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D 4  121 ? -12.914 6.947   23.031 1.00 96.54  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D 4  121 ? -12.539 6.154   21.867 1.00 97.50  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D 4  121 ? -13.408 6.481   20.656 1.00 98.28  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D 4  121 ? -12.888 6.667   19.555 1.00 98.42  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D 4  121 ? -12.612 4.664   22.180 1.00 97.39  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D 4  121 ? -12.273 3.794   21.004 1.00 97.28  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D 4  121 ? -10.954 3.433   20.743 1.00 97.56  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D 4  121 ? -13.270 3.333   20.148 1.00 97.25  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D 4  121 ? -10.634 2.629   19.657 1.00 97.88  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D 4  121 ? -12.964 2.535   19.062 1.00 97.73  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D 4  121 ? -11.645 2.185   18.822 1.00 98.03  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D 4  121 ? -11.350 1.392   17.741 1.00 98.60  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D 4  122 ? -14.725 6.538   20.866 1.00 99.25  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D 4  122 ? -15.689 6.829   19.805 1.00 100.19 ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D 4  122 ? -15.264 8.049   18.992 1.00 101.06 ? 119  THR D C     1 
ATOM   2994  O  O     . THR D 4  122 ? -15.229 7.988   17.763 1.00 101.44 ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D 4  122 ? -17.119 7.049   20.363 1.00 100.04 ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D 4  122 ? -17.490 5.948   21.196 1.00 99.99  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D 4  122 ? -18.132 7.160   19.237 1.00 100.20 ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D 4  123 ? -14.916 9.135   19.684 1.00 102.04 ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D 4  123 ? -14.612 10.420  19.044 1.00 102.98 ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D 4  123 ? -13.208 10.520  18.422 1.00 103.73 ? 120  SER D C     1 
ATOM   3001  O  O     . SER D 4  123 ? -12.979 11.346  17.532 1.00 103.87 ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D 4  123 ? -14.836 11.573  20.032 1.00 102.88 ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D 4  123 ? -13.790 11.647  20.986 1.00 102.93 ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D 4  124 ? -12.281 9.681   18.877 1.00 104.61 ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D 4  124 ? -10.874 9.814   18.489 1.00 105.53 ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D 4  124 ? -10.448 9.032   17.231 1.00 106.22 ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D 4  124 ? -9.459  8.288   17.261 1.00 106.39 ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D 4  124 ? -9.962  9.486   19.676 1.00 105.47 ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D 4  125 ? -11.191 9.205   16.135 1.00 106.96 ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D 4  125 ? -10.759 8.715   14.811 1.00 107.69 ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D 4  125 ? -11.283 9.589   13.657 1.00 107.88 ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D 4  125 ? -10.516 10.302  13.002 1.00 107.96 ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D 4  125 ? -11.109 7.228   14.594 1.00 107.83 ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D 4  125 ? -10.396 6.603   13.384 1.00 108.45 ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D 4  125 ? -10.309 5.081   13.462 1.00 109.59 ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D 4  125 ? -9.316  4.552   12.423 1.00 110.32 ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D 4  125 ? -9.241  3.060   12.366 1.00 110.74 ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D 4  125 ? -12.477 9.607   13.343 1.00 108.10 ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E 1  38  ? 13.626  -23.364 88.209 1.00 100.45 ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E 1  38  ? 13.504  -23.580 86.762 1.00 100.46 ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E 1  38  ? 12.275  -22.876 86.172 1.00 100.32 ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E 1  38  ? 11.138  -23.183 86.552 1.00 100.31 ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E 1  38  ? 13.375  -25.106 86.639 1.00 100.48 ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E 1  38  ? 13.971  -25.650 87.905 1.00 100.52 ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E 1  38  ? 13.674  -24.629 88.964 1.00 100.46 ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E 1  39  ? 12.515  -21.948 85.246 1.00 100.05 ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E 1  39  ? 11.464  -21.091 84.684 1.00 99.81  ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E 1  39  ? 10.564  -21.784 83.644 1.00 99.29  ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E 1  39  ? 11.044  -22.525 82.776 1.00 99.30  ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E 1  39  ? 12.094  -19.822 84.094 1.00 100.15 ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E 1  39  ? 11.105  -18.877 83.483 1.00 100.95 ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E 1  39  ? 10.857  -18.835 82.128 1.00 101.64 ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E 1  39  ? 10.307  -17.936 84.043 1.00 101.51 ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E 1  39  ? 9.946   -17.910 81.879 1.00 102.08 ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E 1  39  ? 9.596   -17.350 83.024 1.00 101.97 ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E 1  40  ? 9.259   -21.519 83.746 1.00 98.53  ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E 1  40  ? 8.245   -22.071 82.838 1.00 97.66  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E 1  40  ? 7.178   -21.049 82.455 1.00 96.90  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E 1  40  ? 6.807   -20.186 83.262 1.00 96.88  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E 1  40  ? 7.554   -23.282 83.464 1.00 97.70  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E 1  40  ? 7.990   -24.604 82.897 1.00 98.22  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E 1  40  ? 7.046   -25.699 83.337 1.00 99.55  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E 1  40  ? 7.486   -27.017 82.885 1.00 100.73 ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E 1  40  ? 6.755   -27.842 82.141 1.00 101.36 ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E 1  40  ? 5.530   -27.496 81.763 1.00 101.36 ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E 1  40  ? 7.243   -29.025 81.787 1.00 101.81 ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E 1  41  ? 6.687   -21.158 81.220 1.00 95.81  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E 1  41  ? 5.547   -20.369 80.770 1.00 94.54  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E 1  41  ? 4.238   -21.073 81.095 1.00 93.71  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E 1  41  ? 4.151   -22.299 81.061 1.00 93.52  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E 1  41  ? 5.637   -20.080 79.276 1.00 94.46  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E 1  41  ? 6.629   -18.998 78.937 1.00 94.35  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E 1  41  ? 7.880   -19.317 78.420 1.00 94.55  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E 1  41  ? 6.320   -17.653 79.138 1.00 94.19  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E 1  41  ? 8.803   -18.326 78.107 1.00 94.82  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E 1  41  ? 7.236   -16.651 78.830 1.00 94.29  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E 1  41  ? 8.475   -16.997 78.314 1.00 94.61  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E 1  41  ? 9.389   -16.019 78.007 1.00 94.85  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E 1  42  ? 3.226   -20.280 81.421 1.00 92.69  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E 1  42  ? 1.900   -20.799 81.707 1.00 91.79  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E 1  42  ? 1.293   -21.391 80.444 1.00 90.80  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E 1  42  ? 1.536   -20.874 79.352 1.00 90.91  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E 1  42  ? 1.010   -19.683 82.246 1.00 91.92  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E 1  42  ? 1.404   -19.227 83.638 1.00 93.04  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E 1  42  ? 0.653   -17.984 84.057 1.00 95.03  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E 1  42  ? -0.792  -18.196 84.050 1.00 96.85  ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E 1  42  ? -1.660  -17.496 84.776 1.00 97.84  ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E 1  42  ? -1.237  -16.531 85.588 1.00 98.08  ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E 1  42  ? -2.957  -17.769 84.699 1.00 98.37  ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E 1  43  ? 0.518   -22.486 80.579 1.00 89.71  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E 1  43  ? -0.145  -23.039 79.406 1.00 88.80  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E 1  43  ? -0.981  -21.978 78.687 1.00 87.90  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E 1  43  ? -1.809  -21.307 79.314 1.00 87.80  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E 1  43  ? -1.035  -24.148 79.985 1.00 88.77  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E 1  43  ? -1.022  -23.957 81.453 1.00 88.96  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E 1  43  ? 0.265   -23.303 81.776 1.00 89.65  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E 1  44  ? -0.726  -21.816 77.388 1.00 86.84  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E 1  44  ? -1.467  -20.880 76.551 1.00 85.37  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E 1  44  ? -0.693  -19.640 76.142 1.00 84.39  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E 1  44  ? -1.133  -18.893 75.267 1.00 84.57  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E 1  45  ? 0.460   -19.418 76.767 1.00 83.20  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E 1  45  ? 1.254   -18.211 76.526 1.00 81.83  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E 1  45  ? 2.209   -18.366 75.341 1.00 80.96  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E 1  45  ? 2.377   -17.436 74.560 1.00 80.73  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E 1  45  ? 1.985   -17.761 77.811 1.00 81.81  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E 1  45  ? 1.029   -17.195 78.716 1.00 81.54  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E 1  45  ? 3.048   -16.726 77.522 1.00 81.67  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E 1  46  ? 2.822   -19.538 75.203 1.00 80.05  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E 1  46  ? 3.612   -19.835 74.007 1.00 79.18  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E 1  46  ? 2.671   -19.993 72.813 1.00 78.63  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E 1  46  ? 3.021   -19.628 71.693 1.00 78.58  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E 1  46  ? 4.490   -21.107 74.154 1.00 79.08  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E 1  46  ? 5.348   -21.315 72.911 1.00 78.85  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E 1  46  ? 5.383   -21.011 75.372 1.00 79.01  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E 1  47  ? 1.477   -20.525 73.067 1.00 77.89  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E 1  47  ? 0.481   -20.749 72.022 1.00 77.17  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E 1  47  ? 0.132   -19.456 71.296 1.00 76.72  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E 1  47  ? 0.209   -19.396 70.071 1.00 76.91  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E 1  47  ? -0.765  -21.396 72.596 1.00 77.15  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E 1  48  ? -0.232  -18.425 72.057 1.00 76.05  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E 1  48  ? -0.527  -17.101 71.501 1.00 75.30  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E 1  48  ? 0.717   -16.441 70.930 1.00 74.99  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E 1  48  ? 0.617   -15.596 70.050 1.00 74.95  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E 1  48  ? -1.136  -16.191 72.561 1.00 75.17  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E 1  48  ? -2.590  -16.440 72.931 1.00 75.08  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E 1  48  ? -2.848  -15.980 74.355 1.00 75.23  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E 1  48  ? -3.506  -15.734 71.945 1.00 75.24  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E 1  49  ? 1.885   -16.816 71.442 1.00 74.62  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E 1  49  ? 3.139   -16.381 70.854 1.00 74.32  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E 1  49  ? 3.201   -16.962 69.445 1.00 73.90  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E 1  49  ? 3.430   -16.238 68.477 1.00 73.90  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E 1  49  ? 4.328   -16.858 71.691 1.00 74.46  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E 1  49  ? 5.624   -16.091 71.444 1.00 75.44  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E 1  49  ? 6.890   -16.990 71.528 1.00 77.40  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E 1  49  ? 7.260   -17.501 72.862 1.00 78.44  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E 1  49  ? 7.065   -16.888 74.036 1.00 79.44  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E 1  49  ? 6.494   -15.685 74.114 1.00 79.66  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E 1  49  ? 7.455   -17.494 75.153 1.00 79.68  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E 1  50  ? 2.960   -18.267 69.341 1.00 73.41  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E 1  50  ? 2.983   -18.970 68.063 1.00 72.96  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E 1  50  ? 1.983   -18.379 67.067 1.00 72.55  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E 1  50  ? 2.320   -18.173 65.901 1.00 72.48  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E 1  50  ? 2.740   -20.469 68.260 1.00 72.96  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E 1  50  ? 3.929   -21.225 68.836 1.00 73.64  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E 1  50  ? 3.651   -22.708 69.065 1.00 75.27  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E 1  50  ? 4.308   -23.305 69.946 1.00 75.95  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E 1  50  ? 2.785   -23.284 68.370 1.00 75.93  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E 1  51  ? 0.764   -18.095 67.527 1.00 72.02  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E 1  51  ? -0.264  -17.509 66.658 1.00 71.49  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E 1  51  ? 0.190   -16.156 66.099 1.00 71.40  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E 1  51  ? 0.045   -15.901 64.901 1.00 71.65  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E 1  51  ? -1.633  -17.346 67.364 1.00 71.33  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E 1  51  ? -2.137  -18.678 67.906 1.00 70.63  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E 1  51  ? -2.668  -16.764 66.405 1.00 71.21  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E 1  51  ? -3.353  -18.547 68.785 1.00 69.64  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E 1  52  ? 0.743   -15.299 66.960 1.00 70.96  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E 1  52  ? 1.273   -14.002 66.530 1.00 70.54  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E 1  52  ? 2.329   -14.187 65.454 1.00 70.17  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E 1  52  ? 2.388   -13.411 64.503 1.00 70.22  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E 1  52  ? 1.874   -13.226 67.706 1.00 70.59  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E 1  52  ? 0.853   -12.700 68.693 1.00 71.02  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E 1  52  ? 1.501   -12.008 69.896 1.00 71.86  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E 1  52  ? 0.733   -12.221 71.134 1.00 72.96  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E 1  52  ? -0.522  -11.807 71.348 1.00 72.96  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E 1  52  ? -1.200  -11.152 70.409 1.00 73.61  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E 1  52  ? -1.112  -12.058 72.509 1.00 71.89  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E 1  53  ? 3.144   -15.229 65.613 1.00 69.73  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E 1  53  ? 4.261   -15.510 64.720 1.00 69.36  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E 1  53  ? 3.798   -16.000 63.358 1.00 69.02  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E 1  53  ? 4.272   -15.516 62.330 1.00 69.08  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E 1  53  ? 5.210   -16.534 65.359 1.00 69.43  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E 1  53  ? 6.314   -17.059 64.446 1.00 69.96  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E 1  53  ? 7.200   -18.042 65.188 1.00 71.93  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E 1  53  ? 8.055   -18.815 64.285 1.00 74.10  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E 1  53  ? 8.750   -19.896 64.644 1.00 75.04  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E 1  53  ? 8.701   -20.349 65.894 1.00 75.38  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E 1  53  ? 9.495   -20.533 63.747 1.00 75.47  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E 1  54  ? 2.876   -16.959 63.354 1.00 68.58  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E 1  54  ? 2.504   -17.645 62.119 1.00 68.04  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E 1  54  ? 1.537   -16.849 61.263 1.00 67.93  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E 1  54  ? 1.520   -17.008 60.039 1.00 67.91  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E 1  54  ? 1.989   -19.060 62.402 1.00 67.88  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E 1  54  ? 3.084   -19.967 62.898 1.00 67.39  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E 1  54  ? 3.029   -20.541 64.164 1.00 66.69  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E 1  54  ? 4.201   -20.221 62.109 1.00 67.57  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E 1  54  ? 4.051   -21.359 64.619 1.00 66.80  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E 1  54  ? 5.232   -21.030 62.555 1.00 67.42  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E 1  54  ? 5.152   -21.595 63.805 1.00 67.11  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E 1  54  ? 6.182   -22.401 64.224 1.00 67.52  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E 1  55  ? 0.745   -15.991 61.903 1.00 67.71  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E 1  55  ? -0.156  -15.103 61.176 1.00 67.76  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E 1  55  ? 0.641   -13.967 60.522 1.00 68.16  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E 1  55  ? 0.202   -13.355 59.544 1.00 68.30  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E 1  55  ? -1.269  -14.576 62.089 1.00 67.59  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E 1  55  ? -2.306  -15.633 62.485 1.00 66.60  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E 1  55  ? -3.508  -15.065 63.236 1.00 65.56  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E 1  55  ? -3.410  -14.066 63.950 1.00 65.21  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E 1  55  ? -4.647  -15.717 63.085 1.00 64.90  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E 1  56  ? 1.831   -13.723 61.063 1.00 68.56  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E 1  56  ? 2.792   -12.765 60.527 1.00 68.79  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E 1  56  ? 3.449   -13.313 59.258 1.00 68.54  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E 1  56  ? 3.451   -12.657 58.221 1.00 68.41  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E 1  56  ? 3.858   -12.500 61.591 1.00 68.95  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E 1  56  ? 4.451   -11.115 61.617 1.00 70.26  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E 1  56  ? 4.942   -10.833 63.030 1.00 73.10  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E 1  56  ? 6.064   -9.800  63.077 1.00 75.06  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E 1  56  ? 6.411   -9.462  64.502 1.00 76.68  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E 1  57  ? 3.988   -14.526 59.349 1.00 68.49  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E 1  57  ? 4.762   -15.129 58.261 1.00 68.73  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E 1  57  ? 3.891   -15.760 57.182 1.00 68.85  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E 1  57  ? 2.696   -15.999 57.404 1.00 69.28  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E 1  57  ? 5.701   -16.190 58.820 1.00 68.75  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E 1  57  ? 4.954   -17.222 59.432 1.00 68.55  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E 1  58  ? 4.494   -16.046 56.025 1.00 68.62  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E 1  58  ? 3.758   -16.632 54.898 1.00 68.49  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E 1  58  ? 4.303   -17.991 54.443 1.00 68.49  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E 1  58  ? 3.661   -18.682 53.645 1.00 68.49  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E 1  58  ? 3.703   -15.688 53.673 1.00 68.36  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E 1  58  ? 5.003   -15.575 53.106 1.00 68.21  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E 1  58  ? 3.213   -14.304 54.051 1.00 68.37  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E 1  59  ? 5.478   -18.362 54.951 1.00 68.39  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E 1  59  ? 6.137   -19.624 54.590 1.00 68.23  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E 1  59  ? 5.223   -20.811 54.807 1.00 68.04  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E 1  59  ? 4.397   -20.780 55.714 1.00 68.19  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E 1  59  ? 7.439   -19.806 55.375 1.00 68.24  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E 1  59  ? 7.545   -19.001 56.679 1.00 69.21  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E 1  59  ? 7.123   -19.770 57.933 1.00 70.04  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E 1  59  ? 6.888   -20.992 57.861 1.00 70.76  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E 1  59  ? 7.042   -19.146 59.011 1.00 70.24  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E 1  60  ? 5.346   -21.840 53.964 1.00 67.96  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E 1  60  ? 4.554   -23.076 54.133 1.00 67.75  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E 1  60  ? 4.932   -23.782 55.434 1.00 67.74  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E 1  60  ? 6.087   -23.713 55.874 1.00 67.98  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E 1  60  ? 4.696   -24.025 52.936 1.00 67.42  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E 1  60  ? 4.043   -23.616 51.613 1.00 67.16  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E 1  60  ? 4.306   -24.644 50.534 1.00 67.01  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E 1  60  ? 2.547   -23.393 51.754 1.00 67.07  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E 1  61  ? 3.962   -24.454 56.046 1.00 67.46  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E 1  61  ? 4.139   -24.997 57.398 1.00 67.28  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E 1  61  ? 4.311   -26.527 57.462 1.00 67.19  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E 1  61  ? 4.800   -27.068 58.460 1.00 66.96  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E 1  61  ? 2.994   -24.521 58.295 1.00 67.22  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E 1  61  ? 2.713   -23.014 58.229 1.00 67.01  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E 1  61  ? 1.332   -22.708 58.762 1.00 66.84  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E 1  61  ? 3.769   -22.204 58.974 1.00 67.13  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E 1  62  ? 3.910   -27.212 56.393 1.00 67.03  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E 1  62  ? 4.140   -28.641 56.251 1.00 66.96  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E 1  62  ? 5.490   -28.806 55.567 1.00 67.18  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E 1  62  ? 5.791   -28.076 54.629 1.00 67.15  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E 1  62  ? 3.020   -29.309 55.419 1.00 66.73  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E 1  62  ? 1.673   -29.143 56.118 1.00 66.66  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E 1  62  ? 3.294   -30.785 55.209 1.00 66.57  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E 1  62  ? 0.479   -29.454 55.245 1.00 66.50  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E 1  63  ? 6.303   -29.746 56.049 1.00 67.50  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E 1  63  ? 7.612   -30.030 55.459 1.00 67.85  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E 1  63  ? 7.456   -30.485 54.005 1.00 67.84  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E 1  63  ? 6.588   -31.298 53.702 1.00 67.80  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E 1  63  ? 8.356   -31.092 56.275 1.00 68.06  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E 1  63  ? 8.796   -30.686 57.692 1.00 69.12  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E 1  63  ? 10.035  -29.782 57.708 1.00 71.31  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E 1  63  ? 9.729   -28.439 58.214 1.00 73.70  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E 1  63  ? 9.789   -27.309 57.505 1.00 74.84  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E 1  63  ? 10.156  -27.323 56.226 1.00 75.33  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E 1  63  ? 9.483   -26.150 58.087 1.00 75.13  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E 1  64  ? 8.299   -29.955 53.118 1.00 68.02  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E 1  64  ? 8.150   -30.144 51.666 1.00 68.16  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E 1  64  ? 8.096   -31.593 51.250 1.00 67.84  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E 1  64  ? 7.105   -32.025 50.670 1.00 67.95  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E 1  64  ? 9.274   -29.453 50.881 1.00 68.50  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E 1  64  ? 9.006   -28.002 50.532 1.00 69.66  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E 1  64  ? 10.186  -27.402 49.772 1.00 71.69  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E 1  64  ? 10.332  -25.902 50.064 1.00 72.97  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E 1  64  ? 9.030   -25.156 49.982 1.00 73.37  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E 1  65  ? 9.166   -32.330 51.541 1.00 67.50  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E 1  65  ? 9.306   -33.703 51.070 1.00 67.17  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E 1  65  ? 8.199   -34.611 51.592 1.00 66.89  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E 1  65  ? 7.602   -35.344 50.810 1.00 66.89  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E 1  65  ? 10.697  -34.269 51.389 1.00 67.19  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E 1  65  ? 10.967  -35.746 51.080 1.00 67.05  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E 1  65  ? 10.961  -36.017 49.583 1.00 66.67  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E 1  65  ? 12.287  -36.160 51.702 1.00 67.00  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E 1  66  ? 7.912   -34.565 52.905 1.00 66.70  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E 1  66  ? 6.816   -35.405 53.372 1.00 66.76  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E 1  66  ? 5.534   -35.156 52.586 1.00 66.66  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E 1  66  ? 4.875   -36.117 52.178 1.00 66.57  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E 1  66  ? 6.655   -34.988 54.837 1.00 66.78  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E 1  66  ? 8.006   -34.568 55.236 1.00 66.69  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E 1  66  ? 8.594   -33.898 54.027 1.00 66.64  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E 1  67  ? 5.205   -33.883 52.357 1.00 66.66  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E 1  67  ? 4.018   -33.531 51.576 1.00 66.65  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E 1  67  ? 4.135   -34.009 50.134 1.00 66.84  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E 1  67  ? 3.128   -34.335 49.503 1.00 66.96  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E 1  67  ? 3.732   -32.029 51.597 1.00 66.41  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E 1  67  ? 2.493   -31.650 50.837 1.00 65.80  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E 1  67  ? 1.259   -31.638 51.464 1.00 65.09  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E 1  67  ? 2.556   -31.331 49.486 1.00 66.04  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E 1  67  ? 0.105   -31.306 50.766 1.00 64.89  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E 1  67  ? 1.404   -30.999 48.779 1.00 65.91  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E 1  67  ? 0.177   -30.988 49.423 1.00 65.34  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E 1  68  ? 5.362   -34.045 49.619 1.00 66.88  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E 1  68  ? 5.593   -34.517 48.269 1.00 66.88  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E 1  68  ? 5.277   -36.003 48.172 1.00 66.50  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E 1  68  ? 4.698   -36.453 47.187 1.00 66.77  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E 1  68  ? 7.020   -34.225 47.816 1.00 66.94  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E 1  68  ? 7.134   -34.128 46.307 1.00 68.98  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E 1  68  ? 8.515   -33.721 45.842 1.00 71.70  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E 1  68  ? 9.525   -34.176 46.386 1.00 73.41  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E 1  68  ? 8.569   -32.867 44.818 1.00 71.90  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E 1  69  ? 5.625   -36.756 49.208 1.00 66.01  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E 1  69  ? 5.407   -38.194 49.198 1.00 65.59  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E 1  69  ? 3.933   -38.572 49.156 1.00 65.32  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E 1  69  ? 3.533   -39.417 48.358 1.00 65.49  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E 1  69  ? 6.105   -38.857 50.382 1.00 65.61  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E 1  69  ? 7.407   -39.512 49.999 1.00 65.76  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E 1  69  ? 8.003   -40.307 51.145 1.00 66.31  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E 1  69  ? 9.037   -39.568 51.869 1.00 66.72  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E 1  69  ? 8.903   -39.086 53.100 1.00 67.15  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E 1  69  ? 7.768   -39.248 53.780 1.00 67.04  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E 1  69  ? 9.914   -38.436 53.652 1.00 67.20  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E 1  70  ? 3.135   -37.933 50.007 1.00 64.96  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E 1  70  ? 1.696   -38.206 50.111 1.00 64.60  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E 1  70  ? 0.946   -37.883 48.820 1.00 64.48  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E 1  70  ? 0.060   -38.629 48.404 1.00 64.23  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E 1  70  ? 1.108   -37.422 51.287 1.00 64.54  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E 1  70  ? -0.402  -37.289 51.478 1.00 64.30  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E 1  70  ? -1.076  -38.625 51.747 1.00 63.76  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E 1  70  ? -0.655  -36.313 52.609 1.00 64.12  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E 1  71  ? 1.310   -36.758 48.205 1.00 64.50  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E 1  71  ? 0.812   -36.362 46.892 1.00 64.39  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E 1  71  ? 1.047   -37.499 45.908 1.00 64.50  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E 1  71  ? 0.140   -37.891 45.172 1.00 64.21  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E 1  71  ? 1.499   -35.050 46.413 1.00 64.27  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E 1  71  ? 1.310   -34.820 44.916 1.00 64.16  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E 1  71  ? 0.960   -33.877 47.187 1.00 64.06  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E 1  72  ? 2.263   -38.039 45.945 1.00 64.80  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E 1  72  ? 2.703   -39.095 45.039 1.00 65.33  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E 1  72  ? 2.048   -40.439 45.314 1.00 65.19  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E 1  72  ? 1.717   -41.174 44.383 1.00 65.15  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E 1  72  ? 4.222   -39.224 45.088 1.00 65.50  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E 1  72  ? 4.904   -37.992 44.570 1.00 66.64  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E 1  72  ? 6.393   -38.148 44.516 1.00 68.83  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E 1  72  ? 7.008   -36.924 44.022 1.00 70.76  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E 1  72  ? 6.978   -36.524 42.751 1.00 72.41  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E 1  72  ? 6.354   -37.243 41.815 1.00 71.68  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E 1  72  ? 7.574   -35.388 42.413 1.00 74.18  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E 1  73  ? 1.873   -40.749 46.593 1.00 65.08  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E 1  73  ? 1.203   -41.961 47.013 1.00 65.16  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E 1  73  ? -0.271  -41.940 46.598 1.00 65.39  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E 1  73  ? -0.783  -42.947 46.106 1.00 65.65  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E 1  73  ? 1.359   -42.139 48.524 1.00 65.08  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E 1  73  ? 0.681   -43.365 49.115 1.00 65.01  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E 1  73  ? 0.551   -43.288 50.636 1.00 65.31  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E 1  73  ? 1.568   -43.064 51.326 1.00 64.75  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E 1  73  ? -0.577  -43.456 51.145 1.00 66.10  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E 1  74  ? -0.946  -40.803 46.780 1.00 65.56  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E 1  74  ? -2.372  -40.706 46.448 1.00 65.77  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E 1  74  ? -2.561  -40.760 44.947 1.00 66.22  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E 1  74  ? -3.428  -41.480 44.465 1.00 66.37  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E 1  74  ? -3.055  -39.422 47.003 1.00 65.66  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E 1  74  ? -3.139  -39.461 48.530 1.00 65.17  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E 1  74  ? -4.463  -39.249 46.406 1.00 65.36  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E 1  74  ? -3.689  -38.198 49.149 1.00 64.23  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E 1  75  ? -1.745  -39.994 44.222 1.00 66.85  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E 1  75  ? -1.812  -39.925 42.762 1.00 67.35  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E 1  75  ? -1.558  -41.285 42.148 1.00 67.79  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E 1  75  ? -2.223  -41.664 41.192 1.00 67.86  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E 1  75  ? -0.819  -38.913 42.223 1.00 67.27  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E 1  76  ? -0.598  -42.013 42.714 1.00 68.51  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E 1  76  ? -0.282  -43.370 42.286 1.00 69.31  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E 1  76  ? -1.498  -44.275 42.383 1.00 69.87  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E 1  76  ? -1.778  -45.046 41.470 1.00 69.98  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E 1  76  ? 0.840   -43.941 43.139 1.00 69.26  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E 1  76  ? 1.670   -44.988 42.446 1.00 69.57  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E 1  76  ? 2.889   -45.369 43.254 1.00 70.45  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E 1  76  ? 2.816   -45.537 44.477 1.00 70.82  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E 1  76  ? 4.023   -45.509 42.577 1.00 70.62  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E 1  77  ? -2.222  -44.169 43.491 1.00 70.81  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E 1  77  ? -3.436  -44.946 43.689 1.00 71.74  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E 1  77  ? -4.484  -44.644 42.617 1.00 72.64  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E 1  77  ? -5.292  -45.503 42.291 1.00 72.84  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E 1  77  ? -3.995  -44.735 45.103 1.00 71.63  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E 1  77  ? -3.188  -45.467 46.180 1.00 71.16  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E 1  77  ? -2.670  -46.574 45.912 1.00 70.99  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E 1  77  ? -3.080  -44.944 47.309 1.00 70.06  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E 1  78  ? -4.459  -43.437 42.059 1.00 73.89  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E 1  78  ? -5.314  -43.117 40.917 1.00 75.27  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E 1  78  ? -4.736  -43.642 39.615 1.00 75.91  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E 1  78  ? -5.461  -44.220 38.811 1.00 76.13  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E 1  78  ? -5.598  -41.616 40.809 1.00 75.34  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E 1  78  ? -6.624  -41.127 41.786 1.00 76.93  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E 1  78  ? -6.290  -40.174 42.751 1.00 78.29  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E 1  78  ? -7.927  -41.630 41.761 1.00 78.18  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E 1  78  ? -7.245  -39.718 43.675 1.00 78.85  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E 1  78  ? -8.888  -41.188 42.684 1.00 78.90  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E 1  78  ? -8.545  -40.225 43.640 1.00 78.91  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E 1  79  ? -3.437  -43.435 39.412 1.00 76.84  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E 1  79  ? -2.769  -43.869 38.191 1.00 77.70  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E 1  79  ? -1.260  -43.994 38.356 1.00 78.19  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E 1  79  ? -0.606  -43.144 38.964 1.00 78.34  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E 1  79  ? -3.092  -42.922 37.036 1.00 77.82  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E 1  79  ? -3.165  -43.610 35.679 1.00 78.75  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E 1  79  ? -1.842  -43.575 34.928 1.00 79.56  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E 1  79  ? -1.915  -44.436 33.684 1.00 80.24  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E 1  79  ? -0.577  -44.957 33.308 1.00 81.04  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E 1  80  ? -0.722  -45.058 37.774 1.00 78.79  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E 1  80  ? 0.701   -45.385 37.848 1.00 79.31  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E 1  80  ? 1.580   -44.578 36.880 1.00 79.46  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E 1  80  ? 1.091   -44.022 35.892 1.00 79.32  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E 1  80  ? 0.898   -46.868 37.529 1.00 79.45  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E 1  80  ? 0.339   -47.147 36.233 1.00 79.72  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E 1  80  ? 0.209   -47.737 38.585 1.00 79.48  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E 1  81  ? 2.880   -44.538 37.177 1.00 79.80  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E 1  81  ? 3.901   -43.919 36.315 1.00 80.15  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E 1  81  ? 3.638   -42.438 36.043 1.00 79.96  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E 1  81  ? 3.956   -41.922 34.965 1.00 80.07  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E 1  81  ? 4.040   -44.680 34.986 1.00 80.52  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E 1  81  ? 4.222   -46.175 35.179 1.00 81.76  ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E 1  81  ? 3.275   -46.932 34.856 1.00 82.92  ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E 1  81  ? 5.307   -46.589 35.653 1.00 83.04  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E 1  82  ? 3.048   -41.759 37.019 1.00 79.66  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E 1  82  ? 2.797   -40.334 36.896 1.00 79.13  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E 1  82  ? 4.020   -39.557 37.347 1.00 78.81  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E 1  82  ? 4.779   -40.013 38.202 1.00 78.77  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E 1  82  ? 1.556   -39.924 37.694 1.00 79.09  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E 1  82  ? 0.197   -40.212 37.045 1.00 78.91  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E 1  82  ? -0.953  -39.895 37.992 1.00 78.47  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E 1  82  ? 0.042   -39.434 35.744 1.00 79.10  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E 1  83  ? 4.214   -38.393 36.744 1.00 78.40  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E 1  83  ? 5.301   -37.504 37.115 1.00 77.92  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E 1  83  ? 4.739   -36.166 37.553 1.00 77.25  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E 1  83  ? 3.611   -35.814 37.204 1.00 77.31  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E 1  83  ? 6.269   -37.339 35.950 1.00 78.19  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E 1  83  ? 7.233   -38.491 35.840 1.00 79.12  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E 1  83  ? 7.835   -38.598 34.459 1.00 80.78  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E 1  83  ? 9.168   -39.177 34.551 1.00 82.03  ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E 1  83  ? 10.289  -38.465 34.562 1.00 82.70  ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E 1  83  ? 10.241  -37.141 34.462 1.00 82.81  ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E 1  83  ? 11.458  -39.081 34.666 1.00 83.41  ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E 1  84  ? 5.518   -35.428 38.332 1.00 76.34  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E 1  84  ? 5.037   -34.174 38.883 1.00 75.46  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E 1  84  ? 6.005   -33.034 38.671 1.00 74.70  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E 1  84  ? 7.105   -33.037 39.225 1.00 74.74  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E 1  84  ? 4.748   -34.321 40.377 1.00 75.44  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E 1  84  ? 3.385   -34.854 40.680 1.00 75.46  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E 1  84  ? 3.174   -36.223 40.813 1.00 75.72  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E 1  84  ? 2.307   -33.988 40.843 1.00 75.42  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E 1  84  ? 1.904   -36.724 41.103 1.00 75.55  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E 1  84  ? 1.036   -34.478 41.134 1.00 75.20  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E 1  84  ? 0.836   -35.848 41.263 1.00 75.32  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E 1  85  ? 5.589   -32.061 37.869 1.00 73.66  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E 1  85  ? 6.287   -30.796 37.813 1.00 72.90  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E 1  85  ? 6.398   -30.297 39.250 1.00 72.43  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E 1  85  ? 5.441   -30.395 40.012 1.00 72.34  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E 1  85  ? 5.522   -29.798 36.951 1.00 72.88  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E 1  85  ? 5.470   -30.155 35.481 1.00 72.54  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E 1  85  ? 4.910   -29.037 34.632 1.00 73.15  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E 1  85  ? 4.452   -28.014 35.146 1.00 73.64  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E 1  85  ? 4.933   -29.227 33.320 1.00 73.35  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E 1  86  ? 7.568   -29.795 39.631 1.00 71.96  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E 1  86  ? 7.797   -29.397 41.019 1.00 71.49  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E 1  86  ? 6.791   -28.352 41.455 1.00 71.15  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E 1  86  ? 6.350   -28.360 42.604 1.00 71.19  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E 1  86  ? 9.227   -28.903 41.240 1.00 71.44  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E 1  86  ? 9.659   -28.118 40.147 1.00 71.63  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E 1  87  ? 6.413   -27.476 40.526 1.00 70.71  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E 1  87  ? 5.450   -26.419 40.811 1.00 70.38  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E 1  87  ? 4.016   -26.945 40.864 1.00 70.04  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E 1  87  ? 3.123   -26.239 41.331 1.00 69.88  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E 1  87  ? 5.570   -25.278 39.806 1.00 70.38  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E 1  87  ? 5.353   -25.751 38.488 1.00 71.21  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E 1  88  ? 3.797   -28.174 40.395 1.00 69.77  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E 1  88  ? 2.504   -28.834 40.572 1.00 69.59  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E 1  88  ? 2.331   -29.195 42.041 1.00 69.57  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E 1  88  ? 1.379   -28.752 42.677 1.00 69.90  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E 1  88  ? 2.383   -30.056 39.701 1.00 69.41  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E 1  89  ? 3.262   -29.975 42.586 1.00 69.34  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E 1  89  ? 3.300   -30.233 44.028 1.00 69.17  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E 1  89  ? 3.190   -28.913 44.813 1.00 69.11  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E 1  89  ? 2.368   -28.806 45.725 1.00 69.33  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E 1  89  ? 4.585   -30.996 44.464 1.00 69.12  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E 1  89  ? 4.490   -31.425 45.920 1.00 68.96  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E 1  89  ? 4.819   -32.207 43.592 1.00 69.33  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E 1  90  ? 4.006   -27.919 44.448 1.00 68.78  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E 1  90  ? 3.992   -26.603 45.107 1.00 68.38  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E 1  90  ? 2.639   -25.914 45.013 1.00 67.59  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E 1  90  ? 2.244   -25.220 45.945 1.00 67.81  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E 1  90  ? 5.081   -25.674 44.558 1.00 68.73  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E 1  90  ? 6.494   -26.088 44.893 1.00 70.45  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E 1  90  ? 6.663   -26.542 46.627 1.00 75.69  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E 1  90  ? 6.545   -24.928 47.419 1.00 75.11  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E 1  91  ? 1.941   -26.095 43.890 1.00 66.52  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E 1  91  ? 0.570   -25.595 43.751 1.00 65.45  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E 1  91  ? -0.322  -26.300 44.760 1.00 64.68  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E 1  91  ? -1.064  -25.654 45.497 1.00 64.64  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E 1  91  ? 0.046   -25.811 42.339 1.00 65.27  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E 1  92  ? -0.209  -27.627 44.800 1.00 63.65  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E 1  92  ? -1.027  -28.471 45.661 1.00 62.65  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E 1  92  ? -0.802  -28.234 47.150 1.00 62.30  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E 1  92  ? -1.695  -28.487 47.954 1.00 62.41  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E 1  92  ? -0.815  -29.957 45.328 1.00 62.54  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E 1  92  ? -1.534  -30.579 44.122 1.00 61.57  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E 1  92  ? -1.106  -32.011 43.934 1.00 60.92  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E 1  92  ? -3.036  -30.526 44.265 1.00 60.74  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E 1  93  ? 0.380   -27.757 47.527 1.00 61.77  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E 1  93  ? 0.648   -27.517 48.938 1.00 61.22  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E 1  93  ? 0.120   -26.168 49.377 1.00 61.04  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E 1  93  ? -0.530  -26.068 50.415 1.00 61.16  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E 1  93  ? 2.130   -27.668 49.286 1.00 61.18  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E 1  93  ? 2.332   -28.095 50.732 1.00 60.55  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E 1  93  ? 3.756   -27.980 51.200 1.00 60.54  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E 1  93  ? 4.693   -28.044 50.412 1.00 61.87  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E 1  93  ? 3.930   -27.803 52.498 1.00 61.07  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E 1  94  ? 0.399   -25.138 48.581 1.00 60.75  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E 1  94  ? -0.145  -23.806 48.809 1.00 60.50  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E 1  94  ? -1.653  -23.877 48.887 1.00 60.29  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E 1  94  ? -2.266  -23.195 49.693 1.00 60.51  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E 1  94  ? 0.242   -22.869 47.672 1.00 60.54  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E 1  94  ? 1.688   -22.466 47.665 1.00 61.21  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E 1  94  ? 1.999   -21.324 48.602 1.00 63.05  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E 1  94  ? 1.072   -20.725 49.196 1.00 64.02  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E 1  94  ? 3.199   -21.021 48.739 1.00 64.09  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E 1  95  ? -2.240  -24.708 48.033 1.00 60.10  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E 1  95  ? -3.678  -24.897 47.973 1.00 59.74  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E 1  95  ? -4.187  -25.507 49.267 1.00 59.58  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E 1  95  ? -5.099  -24.966 49.885 1.00 59.85  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E 1  95  ? -4.042  -25.785 46.785 1.00 59.58  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E 1  96  ? -3.576  -26.622 49.666 1.00 59.33  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E 1  96  ? -4.014  -27.420 50.810 1.00 59.03  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E 1  96  ? -3.845  -26.682 52.129 1.00 58.83  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E 1  96  ? -4.775  -26.638 52.941 1.00 58.72  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E 1  96  ? -3.248  -28.743 50.860 1.00 59.00  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E 1  96  ? -3.525  -29.535 49.721 1.00 59.35  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E 1  97  ? -2.657  -26.110 52.336 1.00 58.48  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E 1  97  ? -2.373  -25.341 53.540 1.00 58.26  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E 1  97  ? -3.383  -24.216 53.690 1.00 57.88  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E 1  97  ? -3.976  -24.062 54.745 1.00 58.13  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E 1  97  ? -0.935  -24.820 53.553 1.00 58.34  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E 1  97  ? 0.112   -25.903 53.829 1.00 59.93  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E 1  97  ? 1.412   -25.356 54.444 1.00 63.15  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E 1  97  ? 1.440   -24.171 54.859 1.00 64.32  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E 1  97  ? 2.419   -26.107 54.516 1.00 63.97  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E 1  98  ? -3.613  -23.468 52.617 1.00 57.63  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E 1  98  ? -4.646  -22.435 52.586 1.00 57.33  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E 1  98  ? -5.973  -22.994 53.042 1.00 57.25  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E 1  98  ? -6.635  -22.402 53.888 1.00 57.29  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E 1  98  ? -4.786  -21.865 51.195 1.00 57.33  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E 1  99  ? -6.346  -24.140 52.472 1.00 57.32  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E 1  99  ? -7.597  -24.816 52.799 1.00 57.21  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E 1  99  ? -7.655  -25.226 54.262 1.00 57.23  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E 1  99  ? -8.671  -24.995 54.928 1.00 57.53  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E 1  99  ? -7.825  -26.041 51.909 1.00 56.99  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E 1  99  ? -8.918  -26.961 52.427 1.00 56.98  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E 1  99  ? -10.256 -26.562 52.402 1.00 56.97  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E 1  99  ? -8.612  -28.226 52.955 1.00 56.59  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E 1  99  ? -11.262 -27.396 52.881 1.00 57.06  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E 1  99  ? -9.606  -29.067 53.431 1.00 55.97  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E 1  99  ? -10.933 -28.644 53.394 1.00 56.77  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E 1  99  ? -11.942 -29.452 53.866 1.00 56.05  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E 1  100 ? -6.575  -25.833 54.751 1.00 56.99  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E 1  100 ? -6.529  -26.303 56.133 1.00 56.95  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E 1  100 ? -6.556  -25.163 57.140 1.00 57.09  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E 1  100 ? -7.233  -25.268 58.168 1.00 57.30  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E 1  100 ? -5.323  -27.213 56.383 1.00 56.76  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E 1  100 ? -5.388  -28.634 55.802 1.00 56.44  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E 1  100 ? -4.071  -29.320 56.010 1.00 55.45  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E 1  100 ? -6.517  -29.471 56.397 1.00 55.57  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E 1  101 ? -5.841  -24.075 56.833 1.00 56.94  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E 1  101 ? -5.781  -22.905 57.715 1.00 56.57  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E 1  101 ? -7.168  -22.284 57.821 1.00 56.78  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E 1  101 ? -7.687  -22.096 58.912 1.00 56.81  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E 1  101 ? -4.695  -21.875 57.272 1.00 56.22  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E 1  101 ? -4.861  -20.557 57.994 1.00 55.72  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E 1  101 ? -3.302  -22.428 57.532 1.00 55.60  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E 1  102 ? -7.775  -22.012 56.676 1.00 57.26  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E 1  102 ? -9.114  -21.459 56.625 1.00 57.73  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E 1  102 ? -10.077 -22.334 57.423 1.00 58.27  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E 1  102 ? -10.947 -21.817 58.133 1.00 58.54  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E 1  102 ? -9.565  -21.346 55.190 1.00 57.63  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E 1  103 ? -9.906  -23.656 57.312 1.00 58.64  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E 1  103 ? -10.761 -24.614 58.017 1.00 58.64  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E 1  103 ? -10.566 -24.523 59.527 1.00 59.01  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E 1  103 ? -11.519 -24.706 60.288 1.00 59.40  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E 1  103 ? -10.532 -26.050 57.528 1.00 58.16  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E 1  103 ? -11.354 -27.124 58.251 1.00 57.62  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E 1  103 ? -12.834 -26.907 58.025 1.00 57.40  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E 1  103 ? -10.962 -28.528 57.835 1.00 57.61  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E 1  104 ? -9.338  -24.233 59.955 1.00 59.09  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E 1  104 ? -9.045  -24.123 61.378 1.00 59.11  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E 1  104 ? -9.691  -22.902 61.997 1.00 59.36  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E 1  104 ? -10.101 -22.935 63.153 1.00 59.53  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E 1  104 ? -7.543  -24.136 61.645 1.00 58.99  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E 1  104 ? -6.964  -25.512 61.720 1.00 58.52  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E 1  104 ? -5.937  -25.893 60.877 1.00 58.10  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E 1  104 ? -7.456  -26.435 62.628 1.00 57.92  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E 1  104 ? -5.409  -27.173 60.945 1.00 58.11  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E 1  104 ? -6.928  -27.714 62.698 1.00 58.03  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E 1  104 ? -5.905  -28.085 61.855 1.00 57.64  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E 1  105 ? -9.788  -21.827 61.228 1.00 59.52  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E 1  105 ? -10.500 -20.656 61.685 1.00 59.86  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E 1  105 ? -11.947 -21.060 61.896 1.00 59.87  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E 1  105 ? -12.489 -20.872 62.981 1.00 60.26  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E 1  105 ? -10.383 -19.519 60.681 1.00 60.00  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E 1  105 ? -8.958  -19.014 60.499 1.00 61.66  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E 1  105 ? -8.725  -18.317 59.162 1.00 63.52  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E 1  105 ? -9.684  -17.736 58.592 1.00 63.47  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E 1  105 ? -7.565  -18.350 58.689 1.00 64.11  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E 1  106 ? -12.561 -21.656 60.877 1.00 59.82  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E 1  106 ? -13.961 -22.069 60.967 1.00 59.56  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E 1  106 ? -14.155 -22.968 62.174 1.00 59.15  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E 1  106 ? -15.071 -22.763 62.973 1.00 59.07  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E 1  106 ? -14.404 -22.770 59.683 1.00 59.65  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E 1  106 ? -14.530 -21.815 58.510 1.00 60.64  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E 1  106 ? -14.350 -20.591 58.712 1.00 61.77  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E 1  106 ? -14.817 -22.284 57.383 1.00 61.57  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E 1  107 ? -13.253 -23.940 62.297 1.00 58.71  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E 1  107 ? -13.202 -24.887 63.401 1.00 58.27  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E 1  107 ? -13.116 -24.145 64.732 1.00 58.43  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E 1  107 ? -13.854 -24.452 65.670 1.00 58.44  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E 1  107 ? -11.981 -25.824 63.232 1.00 58.11  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E 1  107 ? -12.086 -26.521 61.988 1.00 57.05  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E 1  107 ? -11.880 -26.824 64.357 1.00 57.42  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E 1  108 ? -12.221 -23.163 64.793 1.00 58.47  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E 1  108 ? -11.954 -22.407 66.014 1.00 58.65  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E 1  108 ? -13.154 -21.582 66.448 1.00 58.84  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E 1  108 ? -13.376 -21.401 67.638 1.00 58.85  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E 1  108 ? -10.729 -21.508 65.820 1.00 58.60  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E 1  108 ? -10.098 -21.083 67.126 1.00 58.21  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E 1  108 ? -9.703  -21.913 67.947 1.00 57.43  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E 1  108 ? -9.974  -19.778 67.314 1.00 57.94  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E 1  109 ? -13.914 -21.089 65.470 1.00 59.21  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E 1  109 ? -15.166 -20.374 65.707 1.00 59.44  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E 1  109 ? -16.230 -21.301 66.272 1.00 59.80  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E 1  109 ? -17.000 -20.907 67.148 1.00 59.87  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E 1  109 ? -15.683 -19.748 64.410 1.00 59.30  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E 1  109 ? -15.047 -18.465 63.875 1.00 58.74  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E 1  109 ? -15.721 -18.095 62.596 1.00 57.54  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E 1  109 ? -15.163 -17.314 64.855 1.00 58.54  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E 1  110 ? -16.265 -22.528 65.755 1.00 60.23  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E 1  110 ? -17.200 -23.551 66.211 1.00 60.57  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E 1  110 ? -16.979 -23.945 67.660 1.00 60.82  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E 1  110 ? -17.943 -24.130 68.397 1.00 60.87  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E 1  110 ? -17.128 -24.783 65.315 1.00 60.54  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E 1  110 ? -17.820 -24.496 63.695 1.00 60.01  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E 1  111 ? -15.715 -24.077 68.052 1.00 61.32  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E 1  111 ? -15.352 -24.365 69.439 1.00 61.93  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E 1  111 ? -15.875 -23.262 70.364 1.00 62.35  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E 1  111 ? -16.592 -23.532 71.333 1.00 62.54  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E 1  111 ? -13.841 -24.520 69.577 1.00 61.63  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E 1  112 ? -15.536 -22.021 70.033 1.00 62.72  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E 1  112 ? -15.913 -20.859 70.821 1.00 63.06  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E 1  112 ? -17.420 -20.748 70.957 1.00 63.55  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E 1  112 ? -17.921 -20.261 71.962 1.00 63.70  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E 1  112 ? -15.320 -19.582 70.210 1.00 62.88  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E 1  112 ? -13.801 -19.598 70.378 1.00 62.52  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E 1  112 ? -15.905 -18.342 70.857 1.00 62.96  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E 1  112 ? -13.068 -18.709 69.416 1.00 62.50  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E 1  113 ? -18.135 -21.217 69.942 1.00 64.43  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E 1  113 ? -19.596 -21.282 69.977 1.00 65.14  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E 1  113 ? -20.063 -22.213 71.099 1.00 65.72  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E 1  113 ? -21.007 -21.892 71.833 1.00 66.00  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E 1  113 ? -20.136 -21.765 68.635 1.00 64.83  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E 1  113 ? -21.618 -21.662 68.510 1.00 64.76  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E 1  113 ? -22.260 -20.465 68.284 1.00 65.16  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E 1  113 ? -22.586 -22.606 68.563 1.00 65.24  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E 1  113 ? -23.563 -20.674 68.207 1.00 65.28  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E 1  113 ? -23.787 -21.966 68.370 1.00 65.34  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E 1  114 ? -19.382 -23.354 71.229 1.00 66.13  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E 1  114 ? -19.669 -24.336 72.271 1.00 66.44  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E 1  114 ? -19.067 -23.886 73.601 1.00 66.70  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E 1  114 ? -18.904 -24.682 74.533 1.00 66.71  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E 1  114 ? -19.132 -25.698 71.866 1.00 66.38  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E 1  115 ? -18.737 -22.599 73.669 1.00 66.96  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E 1  115 ? -18.151 -21.984 74.855 1.00 67.29  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E 1  115 ? -16.873 -22.695 75.311 1.00 66.99  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E 1  115 ? -16.603 -22.822 76.499 1.00 67.17  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E 1  115 ? -19.197 -21.870 75.969 1.00 67.63  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E 1  115 ? -20.296 -20.860 75.646 1.00 69.19  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E 1  115 ? -21.387 -20.828 76.707 1.00 72.36  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E 1  115 ? -22.213 -19.542 76.589 1.00 74.12  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E 1  115 ? -23.304 -19.473 77.615 1.00 76.10  ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E 1  116 ? -16.097 -23.156 74.336 1.00 66.61  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E 1  116 ? -14.804 -23.773 74.583 1.00 66.16  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E 1  116 ? -13.688 -22.931 73.953 1.00 65.82  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E 1  116 ? -13.949 -21.930 73.278 1.00 65.58  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E 1  116 ? -14.775 -25.196 74.015 1.00 66.17  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E 1  116 ? -15.776 -26.146 74.634 1.00 66.67  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E 1  116 ? -15.664 -27.553 74.043 1.00 67.87  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E 1  116 ? -16.494 -27.748 72.849 1.00 68.54  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E 1  116 ? -16.041 -27.751 71.596 1.00 68.36  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E 1  116 ? -14.753 -27.572 71.338 1.00 67.98  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E 1  116 ? -16.884 -27.940 70.594 1.00 68.45  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E 1  117 ? -12.445 -23.336 74.201 1.00 65.46  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E 1  117 ? -11.280 -22.773 73.521 1.00 64.97  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E 1  117 ? -10.432 -23.889 72.900 1.00 64.80  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E 1  117 ? -9.438  -23.615 72.224 1.00 64.64  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E 1  117 ? -10.422 -21.899 74.456 1.00 64.82  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E 1  117 ? -11.243 -20.740 75.000 1.00 64.74  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E 1  117 ? -9.832  -22.724 75.585 1.00 64.71  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E 1  118 ? -10.845 -25.138 73.133 1.00 64.47  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E 1  118 ? -10.165 -26.317 72.596 1.00 64.30  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E 1  118 ? -10.925 -26.890 71.405 1.00 64.17  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E 1  118 ? -12.039 -27.390 71.568 1.00 64.32  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E 1  118 ? -10.038 -27.433 73.663 1.00 64.29  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E 1  118 ? -9.620  -26.871 74.911 1.00 64.27  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E 1  118 ? -9.041  -28.503 73.225 1.00 64.04  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E 1  119 ? -10.325 -26.828 70.217 1.00 63.87  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E 1  119 ? -10.964 -27.382 69.021 1.00 63.75  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E 1  119 ? -11.007 -28.897 69.115 1.00 63.75  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E 1  119 ? -10.074 -29.512 69.626 1.00 63.86  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E 1  119 ? -10.296 -26.925 67.699 1.00 63.66  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E 1  119 ? -8.803  -27.253 67.678 1.00 64.08  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E 1  119 ? -10.492 -25.440 67.493 1.00 63.89  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E 1  119 ? -8.167  -27.220 66.289 1.00 63.97  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E 1  120 ? -12.109 -29.488 68.659 1.00 63.78  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E 1  120 ? -12.307 -30.941 68.720 1.00 63.68  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E 1  120 ? -12.804 -31.448 67.362 1.00 63.40  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E 1  120 ? -13.233 -30.647 66.532 1.00 63.12  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E 1  120 ? -13.284 -31.315 69.845 1.00 63.74  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E 1  120 ? -13.078 -30.533 71.145 1.00 64.70  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E 1  120 ? -13.745 -31.260 72.660 1.00 66.37  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E 1  120 ? -15.517 -31.257 72.350 1.00 65.38  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E 1  121 ? -12.723 -32.772 67.114 1.00 63.27  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E 1  121 ? -13.223 -33.278 65.845 1.00 63.18  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E 1  121 ? -14.669 -32.890 65.537 1.00 63.19  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E 1  121 ? -14.990 -32.674 64.369 1.00 63.63  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E 1  121 ? -13.058 -34.788 65.991 1.00 63.11  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E 1  121 ? -11.822 -34.908 66.784 1.00 62.99  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E 1  121 ? -11.965 -33.818 67.827 1.00 63.40  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E 1  122 ? -15.525 -32.778 66.550 1.00 62.90  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E 1  122 ? -16.883 -32.281 66.318 1.00 62.67  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E 1  122 ? -16.923 -30.860 65.733 1.00 62.58  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E 1  122 ? -17.796 -30.555 64.930 1.00 62.49  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E 1  122 ? -17.758 -32.403 67.574 1.00 62.80  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E 1  122 ? -17.329 -31.601 68.789 1.00 62.69  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E 1  122 ? -17.969 -32.165 70.051 1.00 63.99  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E 1  122 ? -19.484 -31.975 70.079 1.00 64.93  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E 1  122 ? -20.089 -32.604 71.293 1.00 66.01  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E 1  123 ? -15.972 -30.011 66.124 1.00 62.52  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E 1  123 ? -15.869 -28.652 65.598 1.00 62.51  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E 1  123 ? -15.462 -28.647 64.140 1.00 62.40  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E 1  123 ? -16.018 -27.893 63.339 1.00 62.60  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E 1  123 ? -14.860 -27.840 66.392 1.00 62.63  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E 1  123 ? -15.279 -27.641 67.814 1.00 63.66  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E 1  123 ? -16.370 -27.073 68.033 1.00 64.14  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E 1  123 ? -14.517 -28.058 68.712 1.00 65.33  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E 1  124 ? -14.476 -29.470 63.796 1.00 62.14  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E 1  124 ? -14.124 -29.650 62.398 1.00 61.77  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E 1  124 ? -15.374 -30.134 61.689 1.00 61.96  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E 1  124 ? -15.846 -29.497 60.756 1.00 62.06  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E 1  124 ? -12.975 -30.647 62.187 1.00 61.42  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E 1  124 ? -11.718 -30.169 62.912 1.00 60.88  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E 1  124 ? -12.693 -30.803 60.709 1.00 61.23  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E 1  124 ? -10.443 -30.882 62.514 1.00 60.10  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E 1  125 ? -15.933 -31.234 62.175 1.00 62.20  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E 1  125 ? -17.109 -31.824 61.559 1.00 62.58  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E 1  125 ? -18.259 -30.824 61.378 1.00 62.52  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E 1  125 ? -18.884 -30.799 60.329 1.00 62.56  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E 1  125 ? -17.551 -33.077 62.319 1.00 62.70  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E 1  125 ? -16.590 -34.256 62.176 1.00 63.51  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E 1  125 ? -16.591 -35.190 63.397 1.00 66.06  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E 1  125 ? -17.502 -35.158 64.240 1.00 66.61  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E 1  125 ? -15.554 -36.026 63.497 1.00 66.66  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E 1  126 ? -18.523 -29.983 62.372 1.00 62.80  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E 1  126 ? -19.630 -29.024 62.261 1.00 63.06  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E 1  126 ? -19.348 -27.983 61.191 1.00 63.33  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E 1  126 ? -20.251 -27.603 60.440 1.00 63.28  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E 1  126 ? -19.935 -28.329 63.596 1.00 62.95  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E 1  126 ? -21.071 -27.305 63.501 1.00 62.69  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E 1  126 ? -22.414 -27.993 63.475 1.00 63.11  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E 1  126 ? -21.022 -26.299 64.620 1.00 62.80  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E 1  127 ? -18.092 -27.531 61.146 1.00 63.73  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E 1  127 ? -17.612 -26.586 60.141 1.00 64.23  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E 1  127 ? -17.796 -27.136 58.728 1.00 64.77  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E 1  127 ? -18.331 -26.449 57.858 1.00 65.13  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E 1  127 ? -16.156 -26.249 60.389 1.00 63.96  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E 1  128 ? -17.379 -28.382 58.515 1.00 65.20  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E 1  128 ? -17.441 -29.000 57.202 1.00 65.41  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E 1  128 ? -18.861 -29.287 56.746 1.00 66.11  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E 1  128 ? -19.142 -29.205 55.552 1.00 66.35  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E 1  128 ? -16.589 -30.261 57.151 1.00 65.21  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E 1  128 ? -15.129 -30.000 57.423 1.00 64.60  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E 1  128 ? -14.210 -30.778 56.495 1.00 64.21  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E 1  128 ? -14.414 -32.221 56.554 1.00 63.85  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E 1  128 ? -14.774 -32.972 55.517 1.00 64.23  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E 1  128 ? -14.972 -32.432 54.318 1.00 63.72  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E 1  128 ? -14.930 -34.276 55.679 1.00 65.35  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E 1  129 ? -19.752 -29.630 57.676 1.00 66.91  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E 1  129 ? -21.146 -29.881 57.310 1.00 67.89  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E 1  129 ? -21.809 -28.601 56.825 1.00 68.20  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E 1  129 ? -22.449 -28.588 55.771 1.00 68.29  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E 1  129 ? -21.950 -30.485 58.457 1.00 67.99  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E 1  129 ? -23.445 -30.665 58.134 1.00 69.74  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E 1  129 ? -24.088 -31.633 59.111 1.00 73.64  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E 1  129 ? -25.425 -32.080 58.713 1.00 76.64  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E 1  129 ? -26.165 -32.950 59.410 1.00 78.92  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E 1  129 ? -25.711 -33.473 60.553 1.00 79.32  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E 1  129 ? -27.371 -33.302 58.968 1.00 79.76  ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E 1  130 ? -21.649 -27.526 57.589 1.00 68.63  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E 1  130 ? -22.251 -26.252 57.218 1.00 69.12  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E 1  130 ? -21.695 -25.768 55.885 1.00 69.50  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E 1  130 ? -22.472 -25.404 54.994 1.00 69.69  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E 1  130 ? -22.118 -25.196 58.333 1.00 69.10  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E 1  130 ? -23.128 -25.497 59.441 1.00 69.05  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E 1  130 ? -22.372 -23.794 57.795 1.00 69.13  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E 1  130 ? -22.824 -24.807 60.729 1.00 69.47  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E 1  131 ? -20.366 -25.806 55.746 1.00 69.86  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E 1  131 ? -19.665 -25.451 54.500 1.00 70.17  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E 1  131 ? -20.232 -26.132 53.251 1.00 71.02  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E 1  131 ? -19.963 -25.702 52.135 1.00 71.08  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E 1  131 ? -18.184 -25.808 54.602 1.00 69.84  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E 1  131 ? -17.301 -24.796 55.288 1.00 68.58  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E 1  131 ? -15.906 -25.366 55.432 1.00 66.51  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E 1  131 ? -14.904 -24.337 55.683 1.00 66.72  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E 1  131 ? -13.642 -24.388 55.251 1.00 67.29  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E 1  131 ? -13.217 -25.414 54.527 1.00 67.53  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E 1  131 ? -12.799 -23.402 55.526 1.00 67.06  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E 1  132 ? -21.002 -27.197 53.437 1.00 72.06  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E 1  132 ? -21.523 -27.955 52.312 1.00 73.52  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E 1  132 ? -20.491 -28.926 51.767 1.00 74.63  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E 1  132 ? -20.653 -29.464 50.669 1.00 74.77  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E 1  133 ? -19.421 -29.147 52.528 1.00 75.59  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E 1  133 ? -18.481 -30.218 52.216 1.00 76.78  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E 1  133 ? -19.107 -31.558 52.621 1.00 77.84  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E 1  133 ? -18.583 -32.636 52.312 1.00 78.01  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E 1  133 ? -17.122 -29.967 52.876 1.00 76.56  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E 1  133 ? -16.338 -28.853 52.188 1.00 76.20  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E 1  133 ? -15.091 -28.421 52.938 1.00 75.67  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E 1  133 ? -14.330 -29.290 53.401 1.00 75.56  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E 1  133 ? -14.862 -27.200 53.045 1.00 75.47  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E 1  134 ? -20.244 -31.464 53.311 1.00 79.07  ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E 1  134 ? -21.174 -32.586 53.487 1.00 80.19  ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E 1  134 ? -22.648 -32.154 53.397 1.00 80.14  ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E 1  134 ? -23.094 -31.247 54.104 1.00 80.04  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E 1  134 ? -20.904 -33.328 54.795 1.00 80.54  ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E 1  134 ? -19.767 -34.350 54.699 1.00 82.42  ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E 1  134 ? -19.406 -34.878 56.074 1.00 84.82  ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E 1  134 ? -19.176 -33.766 56.989 1.00 86.72  ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E 1  134 ? -19.216 -33.853 58.313 1.00 87.79  ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E 1  134 ? -19.478 -35.007 58.916 1.00 88.29  ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E 1  134 ? -18.994 -32.773 59.038 1.00 88.62  ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F 2  16  ? 14.221  -48.956 33.796 1.00 115.21 ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F 2  16  ? 14.270  -48.612 35.251 1.00 115.16 ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F 2  16  ? 14.599  -49.825 36.121 1.00 115.02 ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F 2  16  ? 14.061  -50.920 35.910 1.00 115.06 ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F 2  16  ? 12.950  -47.971 35.711 1.00 115.27 ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F 2  16  ? 11.702  -48.830 35.487 1.00 115.45 ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F 2  16  ? 10.512  -48.303 36.267 1.00 115.84 ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F 2  16  ? 9.383   -49.323 36.284 1.00 115.99 ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F 2  16  ? 8.333   -48.982 37.287 1.00 115.84 ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F 2  17  ? 15.489  -49.622 37.091 1.00 114.71 ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F 2  17  ? 15.807  -50.666 38.069 1.00 114.33 ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F 2  17  ? 15.435  -50.272 39.498 1.00 113.57 ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F 2  17  ? 16.198  -49.599 40.202 1.00 113.46 ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F 2  17  ? 17.266  -51.139 37.961 1.00 114.60 ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F 2  17  ? 17.449  -52.313 36.997 1.00 115.63 ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F 2  17  ? 18.874  -52.848 37.006 1.00 117.46 ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F 2  17  ? 19.038  -53.980 36.092 1.00 118.99 ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F 2  17  ? 20.189  -54.615 35.872 1.00 119.84 ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F 2  17  ? 21.300  -54.234 36.498 1.00 119.74 ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F 2  17  ? 20.232  -55.636 35.021 1.00 120.28 ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F 2  18  ? 14.230  -50.688 39.885 1.00 112.66 ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F 2  18  ? 13.692  -50.553 41.246 1.00 111.73 ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F 2  18  ? 13.250  -49.145 41.650 1.00 110.68 ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F 2  18  ? 14.032  -48.187 41.625 1.00 110.61 ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F 2  18  ? 14.613  -51.208 42.291 1.00 112.02 ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F 2  18  ? 14.779  -52.686 42.095 1.00 112.70 ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F 2  18  ? 13.992  -53.616 42.742 1.00 113.50 ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F 2  18  ? 15.627  -53.392 41.309 1.00 113.07 ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F 2  18  ? 14.351  -54.831 42.367 1.00 113.64 ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F 2  18  ? 15.343  -54.723 41.500 1.00 113.56 ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F 2  19  ? 11.967  -49.052 42.002 1.00 109.20 ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F 2  19  ? 11.312  -47.819 42.428 1.00 107.58 ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F 2  19  ? 10.583  -48.145 43.731 1.00 105.87 ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F 2  19  ? 9.662   -48.966 43.739 1.00 105.71 ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F 2  19  ? 10.325  -47.351 41.345 1.00 107.94 ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F 2  19  ? 10.065  -45.842 41.297 1.00 109.18 ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F 2  19  ? 8.776   -45.440 42.012 1.00 111.17 ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F 2  19  ? 8.705   -43.991 42.232 1.00 112.86 ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F 2  19  ? 7.698   -43.360 42.840 1.00 113.70 ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F 2  19  ? 6.650   -44.041 43.294 1.00 113.82 ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F 2  19  ? 7.736   -42.039 42.993 1.00 113.79 ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F 2  20  ? 11.011  -47.512 44.824 1.00 103.66 ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F 2  20  ? 10.537  -47.840 46.179 1.00 101.41 ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F 2  20  ? 9.020   -47.685 46.380 1.00 99.49  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F 2  20  ? 8.394   -46.772 45.829 1.00 99.38  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F 2  20  ? 11.322  -47.030 47.226 1.00 101.71 ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F 2  20  ? 10.779  -47.071 48.665 1.00 102.14 ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F 2  20  ? 10.929  -48.436 49.341 1.00 102.59 ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F 2  20  ? 10.242  -48.425 50.706 1.00 103.18 ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F 2  20  ? 10.386  -49.710 51.454 1.00 103.52 ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F 2  21  ? 8.459   -48.600 47.173 1.00 96.79  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F 2  21  ? 7.038   -48.652 47.505 1.00 94.07  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F 2  21  ? 6.654   -47.482 48.409 1.00 92.18  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F 2  21  ? 7.343   -47.208 49.393 1.00 92.05  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F 2  21  ? 6.706   -49.997 48.213 1.00 94.20  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F 2  21  ? 5.313   -49.986 48.817 1.00 94.26  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F 2  21  ? 6.852   -51.165 47.249 1.00 94.09  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F 2  22  ? 5.559   -46.799 48.064 1.00 89.71  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F 2  22  ? 5.022   -45.696 48.867 1.00 87.17  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F 2  22  ? 3.868   -46.183 49.723 1.00 85.52  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F 2  22  ? 2.897   -46.733 49.200 1.00 85.21  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F 2  22  ? 4.533   -44.555 47.972 1.00 87.17  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F 2  22  ? 5.527   -43.743 47.142 1.00 87.01  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F 2  22  ? 4.795   -42.962 46.065 1.00 86.98  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F 2  22  ? 6.348   -42.808 48.022 1.00 87.19  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F 2  23  ? 3.980   -45.983 51.036 1.00 83.57  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F 2  23  ? 2.907   -46.339 51.977 1.00 81.76  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F 2  23  ? 2.953   -45.570 53.290 1.00 80.74  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F 2  23  ? 4.028   -45.355 53.856 1.00 80.61  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F 2  23  ? 2.889   -47.841 52.271 1.00 81.51  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F 2  23  ? 4.241   -48.429 52.559 1.00 80.62  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F 2  23  ? 4.164   -49.935 52.632 1.00 79.00  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F 2  23  ? 3.898   -50.394 53.990 1.00 76.77  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F 2  23  ? 4.840   -50.677 54.883 1.00 75.29  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F 2  23  ? 6.128   -50.550 54.581 1.00 73.63  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F 2  23  ? 4.487   -51.091 56.089 1.00 75.18  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F 2  24  ? 1.767   -45.168 53.754 1.00 79.31  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F 2  24  ? 1.572   -44.504 55.048 1.00 77.93  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F 2  24  ? 2.211   -43.117 55.130 1.00 77.11  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F 2  24  ? 2.573   -42.646 56.209 1.00 76.94  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F 2  24  ? 2.069   -45.389 56.199 1.00 77.86  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F 2  24  ? 1.398   -45.060 57.513 1.00 77.46  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F 2  24  ? 0.151   -45.112 57.565 1.00 77.77  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F 2  24  ? 2.114   -44.749 58.489 1.00 76.23  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F 2  25  ? 2.327   -42.451 53.991 1.00 76.02  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F 2  25  ? 2.960   -41.147 53.959 1.00 74.95  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F 2  25  ? 2.155   -40.056 54.633 1.00 74.14  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F 2  25  ? 2.711   -39.017 54.988 1.00 74.09  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F 2  25  ? 3.316   -40.765 52.534 1.00 75.06  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F 2  25  ? 4.463   -41.570 52.012 1.00 75.33  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F 2  25  ? 5.620   -41.316 52.353 1.00 75.38  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F 2  25  ? 4.156   -42.569 51.198 1.00 76.01  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F 2  26  ? 0.858   -40.299 54.817 1.00 73.09  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F 2  26  ? -0.006  -39.388 55.570 1.00 72.17  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F 2  26  ? 0.570   -39.050 56.960 1.00 71.74  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F 2  26  ? 0.348   -37.952 57.474 1.00 71.81  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F 2  26  ? -1.476  -39.915 55.666 1.00 72.09  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F 2  26  ? -2.394  -38.915 56.380 1.00 71.21  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F 2  26  ? -1.544  -41.277 56.333 1.00 72.34  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F 2  26  ? -2.924  -37.811 55.484 1.00 69.81  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F 2  27  ? 1.333   -39.973 57.546 1.00 70.84  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F 2  27  ? 1.952   -39.729 58.847 1.00 70.09  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F 2  27  ? 3.152   -38.793 58.756 1.00 69.68  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F 2  27  ? 3.776   -38.474 59.770 1.00 69.89  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F 2  27  ? 2.329   -41.040 59.546 1.00 70.01  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F 2  27  ? 1.138   -41.897 59.966 1.00 70.13  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F 2  27  ? 0.127   -41.156 60.846 1.00 70.33  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F 2  27  ? 0.497   -40.403 61.751 1.00 70.18  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F 2  27  ? -1.157  -41.379 60.583 1.00 69.97  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F 2  28  ? 3.467   -38.351 57.541 1.00 69.06  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F 2  28  ? 4.482   -37.322 57.323 1.00 68.36  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F 2  28  ? 3.947   -35.961 57.724 1.00 67.79  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F 2  28  ? 4.710   -35.053 58.052 1.00 67.80  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F 2  29  ? 2.621   -35.833 57.688 1.00 67.18  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F 2  29  ? 1.919   -34.644 58.155 1.00 66.37  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F 2  29  ? 1.934   -34.685 59.680 1.00 66.19  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F 2  29  ? 0.974   -35.121 60.331 1.00 66.05  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F 2  29  ? 0.480   -34.594 57.599 1.00 66.14  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F 2  29  ? 0.459   -34.923 56.098 1.00 65.30  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F 2  29  ? -0.187  -33.247 57.903 1.00 66.31  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F 2  29  ? 1.517   -34.218 55.252 1.00 64.28  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F 2  30  ? 3.057   -34.241 60.233 1.00 65.87  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F 2  30  ? 3.368   -34.433 61.644 1.00 65.54  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F 2  30  ? 2.439   -33.639 62.553 1.00 65.31  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F 2  30  ? 1.750   -32.724 62.107 1.00 65.21  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F 2  30  ? 4.840   -34.057 61.962 1.00 65.44  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F 2  30  ? 5.039   -32.654 61.757 1.00 65.51  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F 2  30  ? 5.808   -34.831 61.088 1.00 65.29  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F 2  31  ? 2.427   -34.019 63.826 1.00 65.03  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F 2  31  ? 1.764   -33.263 64.874 1.00 64.80  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F 2  31  ? 2.252   -31.798 64.940 1.00 64.54  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F 2  31  ? 1.434   -30.889 65.058 1.00 64.61  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F 2  31  ? 1.953   -33.985 66.209 1.00 64.85  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F 2  31  ? 1.310   -33.333 67.412 1.00 65.61  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F 2  31  ? 1.706   -34.071 68.682 1.00 67.12  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F 2  31  ? 1.067   -33.456 69.917 1.00 67.95  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F 2  31  ? 1.611   -34.083 71.161 1.00 68.65  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F 2  32  ? 3.578   -31.556 64.859 1.00 64.32  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F 2  32  ? 3.991   -30.153 64.836 1.00 64.19  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F 2  32  ? 3.484   -29.374 63.621 1.00 63.97  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F 2  32  ? 3.081   -28.221 63.766 1.00 64.12  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F 2  32  ? 5.521   -30.239 64.811 1.00 64.15  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F 2  32  ? 5.825   -31.507 65.471 1.00 64.11  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F 2  32  ? 4.738   -32.446 65.048 1.00 64.29  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F 2  33  ? 3.503   -29.991 62.444 1.00 63.51  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F 2  33  ? 3.077   -29.306 61.241 1.00 63.20  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F 2  33  ? 1.604   -28.932 61.353 1.00 63.22  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F 2  33  ? 1.233   -27.791 61.103 1.00 63.35  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F 2  33  ? 3.330   -30.162 60.027 1.00 63.23  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F 2  34  ? 0.774   -29.889 61.758 1.00 63.20  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F 2  34  ? -0.651  -29.648 61.921 1.00 63.12  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F 2  34  ? -0.859  -28.525 62.913 1.00 63.54  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F 2  34  ? -1.626  -27.610 62.646 1.00 63.83  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F 2  34  ? -1.397  -30.904 62.388 1.00 62.89  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F 2  34  ? -1.440  -31.932 61.263 1.00 62.86  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F 2  34  ? -2.818  -30.562 62.795 1.00 62.84  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F 2  34  ? -1.672  -33.343 61.739 1.00 63.69  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F 2  35  ? -0.158  -28.580 64.043 1.00 64.02  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F 2  35  ? -0.257  -27.533 65.063 1.00 64.54  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F 2  35  ? -0.042  -26.123 64.501 1.00 64.19  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F 2  35  ? -0.868  -25.234 64.727 1.00 64.15  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F 2  35  ? 0.726   -27.780 66.206 1.00 64.94  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F 2  35  ? 0.553   -26.791 67.363 1.00 67.04  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F 2  35  ? 1.679   -26.871 68.375 1.00 70.54  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F 2  35  ? 2.165   -28.240 68.544 1.00 73.26  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F 2  35  ? 1.474   -29.230 69.105 1.00 74.14  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F 2  35  ? 0.238   -29.023 69.555 1.00 74.41  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F 2  35  ? 2.025   -30.435 69.199 1.00 74.37  ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F 2  36  ? 1.067   -25.931 63.784 1.00 63.81  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F 2  36  ? 1.380   -24.654 63.138 1.00 63.55  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F 2  36  ? 0.207   -24.160 62.290 1.00 63.27  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F 2  36  ? -0.224  -23.012 62.424 1.00 63.38  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F 2  36  ? 2.647   -24.766 62.282 1.00 63.55  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F 2  36  ? 3.915   -24.978 63.086 1.00 64.35  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F 2  36  ? 5.165   -24.812 62.250 1.00 65.30  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F 2  36  ? 5.437   -25.959 61.386 1.00 67.05  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F 2  36  ? 6.180   -27.012 61.727 1.00 67.72  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F 2  36  ? 6.729   -27.093 62.936 1.00 68.26  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F 2  36  ? 6.370   -27.995 60.855 1.00 67.43  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F 2  37  ? -0.313  -25.036 61.432 1.00 62.67  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F 2  37  ? -1.471  -24.718 60.606 1.00 62.14  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F 2  37  ? -2.622  -24.187 61.452 1.00 61.86  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F 2  37  ? -3.234  -23.180 61.114 1.00 61.66  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F 2  37  ? -1.917  -25.948 59.811 1.00 62.16  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F 2  37  ? -0.957  -26.524 58.767 1.00 61.93  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F 2  37  ? -1.373  -27.932 58.385 1.00 60.73  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F 2  37  ? -0.867  -25.618 57.541 1.00 61.70  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F 2  38  ? -2.894  -24.864 62.563 1.00 61.83  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F 2  38  ? -3.953  -24.460 63.486 1.00 61.83  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F 2  38  ? -3.662  -23.099 64.127 1.00 61.80  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F 2  38  ? -4.575  -22.303 64.352 1.00 61.48  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F 2  38  ? -4.164  -25.528 64.540 1.00 61.71  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F 2  39  ? -2.380  -22.844 64.392 1.00 61.91  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F 2  39  ? -1.907  -21.558 64.912 1.00 61.94  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F 2  39  ? -2.069  -20.425 63.898 1.00 62.01  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F 2  39  ? -2.466  -19.312 64.258 1.00 62.00  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F 2  39  ? -0.447  -21.669 65.330 1.00 61.76  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F 2  39  ? -0.213  -22.652 66.443 1.00 62.09  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F 2  39  ? -0.446  -22.018 67.802 1.00 62.41  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F 2  39  ? 0.060   -22.872 68.862 1.00 61.86  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F 2  39  ? -0.697  -23.681 69.587 1.00 62.88  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F 2  39  ? -2.008  -23.734 69.389 1.00 62.68  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F 2  39  ? -0.139  -24.431 70.522 1.00 64.98  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F 2  40  ? -1.755  -20.708 62.634 1.00 61.88  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F 2  40  ? -2.023  -19.760 61.573 1.00 61.85  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F 2  40  ? -3.523  -19.545 61.466 1.00 62.12  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F 2  40  ? -3.971  -18.444 61.144 1.00 62.32  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F 2  40  ? -1.455  -20.248 60.249 1.00 61.86  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F 2  40  ? -1.645  -19.266 59.095 1.00 61.34  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F 2  40  ? -0.610  -19.464 58.016 1.00 59.78  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F 2  40  ? 0.689   -18.932 58.403 1.00 58.68  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F 2  40  ? 1.814   -19.198 57.754 1.00 59.70  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F 2  40  ? 1.796   -19.989 56.687 1.00 60.32  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F 2  40  ? 2.958   -18.678 58.168 1.00 60.11  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F 2  41  ? -4.289  -20.597 61.754 1.00 62.23  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F 2  41  ? -5.745  -20.505 61.821 1.00 62.40  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F 2  41  ? -6.216  -19.715 63.031 1.00 62.63  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F 2  41  ? -7.373  -19.292 63.092 1.00 62.69  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F 2  42  ? -5.317  -19.512 63.993 1.00 62.66  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F 2  42  ? -5.640  -18.772 65.211 1.00 63.03  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F 2  42  ? -6.200  -19.647 66.318 1.00 63.28  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F 2  42  ? -7.035  -19.202 67.110 1.00 63.23  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F 2  43  ? -5.724  -20.890 66.368 1.00 63.59  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F 2  43  ? -6.200  -21.892 67.317 1.00 63.73  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F 2  43  ? -5.259  -21.965 68.509 1.00 63.95  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F 2  43  ? -4.051  -22.157 68.351 1.00 63.77  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F 2  43  ? -6.343  -23.288 66.649 1.00 63.66  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F 2  43  ? -6.620  -24.358 67.682 1.00 63.50  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F 2  43  ? -7.445  -23.271 65.594 1.00 63.47  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F 2  44  ? -5.833  -21.815 69.700 1.00 64.33  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F 2  44  ? -5.068  -21.774 70.944 1.00 64.69  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F 2  44  ? -4.879  -23.155 71.578 1.00 64.73  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F 2  44  ? -3.797  -23.471 72.072 1.00 64.83  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F 2  44  ? -5.742  -20.824 71.931 1.00 64.70  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F 2  44  ? -4.837  -20.312 73.028 1.00 65.80  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F 2  44  ? -5.647  -19.557 74.067 1.00 67.91  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F 2  44  ? -4.878  -19.389 75.370 1.00 68.86  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F 2  44  ? -5.812  -19.330 76.538 1.00 69.82  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F 2  45  ? -5.926  -23.974 71.553 1.00 64.84  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F 2  45  ? -5.895  -25.283 72.199 1.00 64.96  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F 2  45  ? -6.360  -26.371 71.247 1.00 64.66  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F 2  45  ? -7.373  -26.221 70.569 1.00 64.56  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F 2  45  ? -6.755  -25.269 73.463 1.00 65.30  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F 2  45  ? -6.333  -26.276 74.521 1.00 66.43  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F 2  45  ? -6.797  -25.866 75.921 1.00 67.40  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F 2  45  ? -6.298  -26.803 76.923 1.00 68.91  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F 2  45  ? -6.892  -27.949 77.254 1.00 70.06  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F 2  45  ? -8.034  -28.318 76.680 1.00 70.46  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F 2  45  ? -6.338  -28.731 78.173 1.00 70.60  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F 2  46  ? -5.607  -27.466 71.203 1.00 64.58  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F 2  46  ? -5.852  -28.559 70.257 1.00 64.35  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F 2  46  ? -6.003  -29.921 70.955 1.00 64.43  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F 2  46  ? -5.025  -30.489 71.471 1.00 64.32  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F 2  46  ? -4.731  -28.653 69.181 1.00 64.26  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F 2  46  ? -4.509  -27.304 68.494 1.00 63.82  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F 2  46  ? -5.062  -29.726 68.150 1.00 64.07  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F 2  46  ? -3.207  -27.203 67.720 1.00 63.20  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F 2  47  ? -7.234  -30.430 70.949 1.00 64.30  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F 2  47  ? -7.554  -31.772 71.422 1.00 64.45  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F 2  47  ? -6.746  -32.843 70.683 1.00 64.33  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F 2  47  ? -6.565  -32.779 69.470 1.00 64.32  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F 2  47  ? -9.059  -32.020 71.279 1.00 64.56  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F 2  47  ? -9.350  -33.386 71.044 1.00 65.51  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F 2  48  ? -6.271  -33.834 71.425 1.00 64.38  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F 2  48  ? -5.321  -34.807 70.891 1.00 64.67  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F 2  48  ? -5.828  -35.625 69.723 1.00 64.71  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F 2  48  ? -5.045  -36.245 69.000 1.00 64.78  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F 2  49  ? -7.140  -35.624 69.539 1.00 64.60  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F 2  49  ? -7.747  -36.377 68.463 1.00 64.70  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F 2  49  ? -7.749  -35.620 67.123 1.00 64.69  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F 2  49  ? -8.024  -36.213 66.071 1.00 64.79  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F 2  49  ? -9.165  -36.773 68.852 1.00 64.77  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F 2  49  ? -9.343  -37.940 69.815 1.00 64.80  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F 2  49  ? -10.814 -38.011 70.204 1.00 65.50  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F 2  49  ? -8.869  -39.254 69.200 1.00 64.55  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F 2  50  ? -7.433  -34.324 67.172 1.00 64.32  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F 2  50  ? -7.475  -33.449 65.996 1.00 63.93  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F 2  50  ? -6.544  -33.918 64.877 1.00 63.85  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F 2  50  ? -6.949  -33.963 63.713 1.00 63.49  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F 2  50  ? -7.176  -31.955 66.378 1.00 63.98  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F 2  50  ? -8.382  -31.296 67.074 1.00 63.62  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F 2  50  ? -6.714  -31.120 65.167 1.00 63.83  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F 2  50  ? -9.597  -31.046 66.193 1.00 62.28  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F 2  51  ? -5.313  -34.282 65.238 1.00 63.96  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F 2  51  ? -4.257  -34.536 64.249 1.00 64.12  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F 2  51  ? -4.605  -35.680 63.314 1.00 64.60  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F 2  51  ? -4.330  -35.599 62.119 1.00 64.81  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F 2  51  ? -2.895  -34.763 64.909 1.00 63.85  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F 2  51  ? -2.601  -33.803 66.031 1.00 63.46  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F 2  51  ? -2.870  -34.154 67.350 1.00 64.32  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F 2  51  ? -2.066  -32.543 65.781 1.00 63.09  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F 2  51  ? -2.615  -33.279 68.398 1.00 65.01  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F 2  51  ? -1.811  -31.651 66.817 1.00 63.69  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F 2  51  ? -2.085  -32.028 68.127 1.00 65.00  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F 2  51  ? -1.837  -31.163 69.178 1.00 65.64  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F 2  52  ? -5.219  -36.733 63.856 1.00 64.98  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F 2  52  ? -5.743  -37.809 63.025 1.00 65.23  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F 2  52  ? -6.903  -37.322 62.168 1.00 64.75  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F 2  52  ? -6.960  -37.620 60.974 1.00 64.96  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F 2  52  ? -6.159  -39.025 63.860 1.00 65.68  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F 2  52  ? -5.082  -40.116 63.963 1.00 67.70  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F 2  52  ? -4.367  -40.386 62.635 1.00 70.63  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F 2  52  ? -5.043  -40.450 61.576 1.00 71.86  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F 2  52  ? -3.122  -40.531 62.651 1.00 71.78  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F 2  53  ? -7.808  -36.565 62.777 1.00 64.10  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F 2  53  ? -8.962  -36.028 62.074 1.00 63.62  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F 2  53  ? -8.545  -35.067 60.960 1.00 63.14  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F 2  53  ? -9.138  -35.098 59.879 1.00 63.31  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F 2  53  ? -9.918  -35.344 63.053 1.00 63.80  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F 2  53  ? -11.232 -34.862 62.456 1.00 64.54  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F 2  53  ? -12.298 -35.949 62.365 1.00 66.64  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F 2  53  ? -12.127 -37.038 62.958 1.00 66.88  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F 2  53  ? -13.326 -35.706 61.695 1.00 68.34  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F 2  54  ? -7.535  -34.227 61.210 1.00 62.22  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F 2  54  ? -7.046  -33.291 60.183 1.00 61.40  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F 2  54  ? -6.422  -34.064 59.029 1.00 60.85  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F 2  54  ? -6.721  -33.804 57.860 1.00 60.73  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F 2  54  ? -6.025  -32.262 60.735 1.00 61.39  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F 2  54  ? -6.628  -31.494 61.776 1.00 62.15  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F 2  54  ? -5.586  -31.295 59.659 1.00 61.14  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F 2  55  ? -5.564  -35.023 59.366 1.00 60.14  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F 2  55  ? -4.978  -35.901 58.369 1.00 59.41  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F 2  55  ? -6.075  -36.515 57.496 1.00 58.90  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F 2  55  ? -6.007  -36.455 56.275 1.00 58.94  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F 2  55  ? -4.121  -36.973 59.035 1.00 59.39  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F 2  55  ? -2.787  -36.454 59.530 1.00 59.67  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F 2  55  ? -1.915  -37.579 60.073 1.00 61.30  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F 2  55  ? -0.883  -37.076 60.983 1.00 61.97  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F 2  55  ? -0.923  -37.184 62.311 1.00 62.54  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F 2  55  ? -1.941  -37.789 62.921 1.00 62.01  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F 2  55  ? 0.068   -36.683 63.034 1.00 63.14  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F 2  56  ? -7.100  -37.072 58.126 1.00 58.33  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F 2  56  ? -8.227  -37.610 57.389 1.00 57.74  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F 2  56  ? -8.786  -36.621 56.387 1.00 57.24  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F 2  56  ? -8.951  -36.952 55.209 1.00 57.26  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F 2  57  ? -9.054  -35.405 56.868 1.00 56.74  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F 2  57  ? -9.655  -34.324 56.079 1.00 56.17  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F 2  57  ? -8.741  -33.877 54.938 1.00 55.84  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F 2  57  ? -9.204  -33.677 53.818 1.00 55.87  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F 2  57  ? -10.076 -33.129 56.986 1.00 56.20  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F 2  57  ? -10.331 -31.866 56.181 1.00 56.41  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F 2  57  ? -11.321 -33.481 57.808 1.00 56.36  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F 2  58  ? -7.448  -33.746 55.216 1.00 55.52  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F 2  58  ? -6.466  -33.461 54.177 1.00 55.44  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F 2  58  ? -6.446  -34.546 53.097 1.00 55.92  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F 2  58  ? -6.321  -34.240 51.906 1.00 56.43  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F 2  58  ? -5.070  -33.290 54.783 1.00 55.25  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F 2  58  ? -3.876  -33.001 53.861 1.00 54.45  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F 2  58  ? -4.085  -31.715 53.069 1.00 53.64  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F 2  58  ? -2.564  -32.957 54.657 1.00 53.03  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F 2  59  ? -6.577  -35.809 53.505 1.00 56.15  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F 2  59  ? -6.565  -36.912 52.553 1.00 56.28  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F 2  59  ? -7.703  -36.777 51.555 1.00 56.36  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F 2  59  ? -7.482  -36.917 50.356 1.00 56.30  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F 2  59  ? -6.614  -38.261 53.259 1.00 56.44  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F 2  59  ? -6.286  -39.432 52.337 1.00 57.47  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F 2  59  ? -5.978  -40.708 53.108 1.00 58.75  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F 2  59  ? -6.504  -41.927 52.365 1.00 59.85  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F 2  59  ? -7.998  -41.909 52.252 1.00 60.68  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F 2  60  ? -8.905  -36.483 52.050 1.00 56.52  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F 2  60  ? -10.064 -36.253 51.187 1.00 56.69  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F 2  60  ? -9.806  -35.085 50.254 1.00 56.77  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F 2  60  ? -10.116 -35.160 49.064 1.00 57.07  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F 2  60  ? -11.361 -35.972 51.983 1.00 56.67  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F 2  60  ? -12.525 -35.667 51.030 1.00 56.62  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F 2  60  ? -11.713 -37.152 52.881 1.00 57.03  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F 2  61  ? -9.237  -34.014 50.796 1.00 56.76  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F 2  61  ? -8.982  -32.821 50.012 1.00 57.08  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F 2  61  ? -8.080  -33.157 48.830 1.00 57.75  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F 2  61  ? -8.472  -32.961 47.672 1.00 57.91  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F 2  61  ? -8.384  -31.701 50.877 1.00 56.80  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F 2  61  ? -8.151  -30.420 50.133 1.00 55.63  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F 2  61  ? -9.147  -29.470 50.042 1.00 54.77  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F 2  61  ? -6.927  -30.167 49.516 1.00 55.47  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F 2  61  ? -8.934  -28.283 49.343 1.00 55.26  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F 2  61  ? -6.700  -28.979 48.814 1.00 54.76  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F 2  61  ? -7.702  -28.040 48.729 1.00 54.96  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F 2  62  ? -6.892  -33.684 49.117 1.00 58.26  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F 2  62  ? -5.942  -34.001 48.057 1.00 59.10  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F 2  62  ? -6.530  -34.946 47.005 1.00 59.71  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F 2  62  ? -6.456  -34.658 45.812 1.00 60.07  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F 2  62  ? -4.630  -34.540 48.631 1.00 59.02  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F 2  62  ? -3.674  -33.481 49.187 1.00 59.20  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F 2  62  ? -2.618  -34.136 50.059 1.00 58.87  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F 2  62  ? -3.032  -32.630 48.078 1.00 59.07  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F 2  63  ? -7.136  -36.048 47.458 1.00 60.23  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F 2  63  ? -7.762  -37.046 46.587 1.00 60.43  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F 2  63  ? -8.652  -36.423 45.524 1.00 60.52  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F 2  63  ? -8.652  -36.858 44.370 1.00 60.29  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F 2  63  ? -8.590  -38.028 47.415 1.00 60.59  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F 2  63  ? -7.790  -39.151 48.054 1.00 61.53  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F 2  63  ? -8.592  -39.986 49.059 1.00 62.37  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F 2  63  ? -9.678  -39.541 49.505 1.00 62.12  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F 2  63  ? -8.114  -41.090 49.414 1.00 62.26  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F 2  64  ? -9.410  -35.406 45.919 1.00 60.83  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F 2  64  ? -10.349 -34.773 45.003 1.00 61.53  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F 2  64  ? -9.662  -33.867 43.994 1.00 61.63  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F 2  64  ? -9.990  -33.886 42.805 1.00 61.60  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F 2  64  ? -11.449 -34.031 45.768 1.00 61.59  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F 2  64  ? -12.384 -34.973 46.503 1.00 62.15  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F 2  64  ? -12.199 -36.189 46.488 1.00 63.92  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F 2  64  ? -13.390 -34.416 47.157 1.00 62.97  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F 2  65  ? -8.703  -33.085 44.472 1.00 61.82  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F 2  65  ? -7.970  -32.180 43.610 1.00 62.07  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F 2  65  ? -7.095  -32.989 42.648 1.00 62.31  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F 2  65  ? -7.096  -32.726 41.450 1.00 62.55  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F 2  65  ? -7.163  -31.155 44.425 1.00 62.05  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F 2  65  ? -6.567  -30.101 43.519 1.00 61.94  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F 2  65  ? -8.067  -30.483 45.457 1.00 62.27  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F 2  66  ? -6.393  -33.995 43.166 1.00 62.52  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F 2  66  ? -5.575  -34.896 42.338 1.00 62.69  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F 2  66  ? -6.385  -35.687 41.281 1.00 63.43  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F 2  66  ? -6.001  -35.700 40.106 1.00 63.51  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F 2  66  ? -4.717  -35.837 43.205 1.00 62.28  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F 2  66  ? -3.642  -35.033 43.928 1.00 61.62  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F 2  66  ? -4.075  -36.916 42.360 1.00 61.74  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F 2  66  ? -3.377  -35.490 45.341 1.00 60.48  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F 2  67  ? -7.489  -36.333 41.683 1.00 63.93  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F 2  67  ? -8.351  -37.050 40.727 1.00 64.29  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F 2  67  ? -8.647  -36.147 39.539 1.00 64.59  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F 2  67  ? -8.465  -36.551 38.388 1.00 64.84  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F 2  67  ? -9.656  -37.528 41.369 1.00 64.26  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F 2  67  ? -10.601 -38.274 40.410 1.00 65.17  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F 2  67  ? -11.965 -38.669 41.049 1.00 67.73  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F 2  67  ? -11.839 -39.599 42.186 1.00 69.81  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F 2  67  ? -12.060 -39.293 43.474 1.00 70.03  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F 2  67  ? -12.451 -38.073 43.841 1.00 69.45  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F 2  67  ? -11.902 -40.225 44.408 1.00 69.52  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F 2  68  ? -9.073  -34.917 39.830 1.00 64.89  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F 2  68  ? -9.370  -33.926 38.797 1.00 65.02  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F 2  68  ? -8.126  -33.498 38.029 1.00 65.03  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F 2  68  ? -8.162  -33.405 36.809 1.00 65.03  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F 2  68  ? -10.088 -32.716 39.395 1.00 65.12  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F 2  68  ? -11.566 -32.978 39.658 1.00 65.33  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F 2  68  ? -11.985 -34.157 39.690 1.00 65.53  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F 2  68  ? -12.310 -31.989 39.838 1.00 65.36  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F 2  69  ? -7.030  -33.258 38.741 1.00 65.18  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F 2  69  ? -5.765  -32.909 38.103 1.00 65.49  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F 2  69  ? -5.319  -34.014 37.165 1.00 65.77  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F 2  69  ? -5.049  -33.754 35.998 1.00 65.97  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F 2  69  ? -4.689  -32.627 39.136 1.00 65.52  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F 2  70  ? -5.262  -35.247 37.670 1.00 66.16  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F 2  70  ? -4.815  -36.395 36.871 1.00 66.43  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F 2  70  ? -5.673  -36.550 35.626 1.00 66.87  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F 2  70  ? -5.152  -36.813 34.545 1.00 66.74  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F 2  70  ? -4.803  -37.722 37.676 1.00 66.26  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F 2  70  ? -4.437  -38.886 36.776 1.00 66.09  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F 2  70  ? -3.823  -37.646 38.826 1.00 65.91  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F 2  71  ? -6.983  -36.371 35.793 1.00 67.60  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F 2  71  ? -7.935  -36.428 34.685 1.00 68.50  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F 2  71  ? -7.559  -35.460 33.559 1.00 69.52  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F 2  71  ? -7.531  -35.841 32.382 1.00 69.68  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F 2  71  ? -9.348  -36.161 35.178 1.00 68.26  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F 2  71  ? -9.633  -37.072 36.243 1.00 67.95  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F 2  71  ? -10.367 -36.360 34.062 1.00 67.78  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F 2  72  ? -7.257  -34.217 33.928 1.00 70.57  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F 2  72  ? -6.687  -33.256 32.992 1.00 71.70  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F 2  72  ? -5.385  -33.771 32.353 1.00 72.54  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F 2  72  ? -5.191  -33.619 31.141 1.00 72.83  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F 2  72  ? -6.452  -31.899 33.674 1.00 71.66  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F 2  72  ? -7.706  -31.070 33.895 1.00 71.55  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F 2  72  ? -7.997  -30.528 35.142 1.00 71.71  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F 2  72  ? -8.594  -30.825 32.855 1.00 71.65  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F 2  72  ? -9.142  -29.769 35.345 1.00 71.55  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F 2  72  ? -9.731  -30.070 33.046 1.00 71.54  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F 2  72  ? -10.001 -29.546 34.289 1.00 71.73  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F 2  72  ? -11.140 -28.796 34.463 1.00 72.60  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F 2  73  ? -4.511  -34.380 33.163 1.00 73.35  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F 2  73  ? -3.238  -34.929 32.677 1.00 74.07  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F 2  73  ? -3.482  -35.993 31.616 1.00 74.67  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F 2  73  ? -2.904  -35.924 30.535 1.00 74.77  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F 2  73  ? -2.379  -35.528 33.821 1.00 74.01  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F 2  73  ? -2.007  -34.496 34.740 1.00 74.10  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F 2  73  ? -1.114  -36.175 33.279 1.00 73.86  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F 2  74  ? -4.348  -36.956 31.931 1.00 75.49  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F 2  74  ? -4.670  -38.068 31.025 1.00 76.43  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F 2  74  ? -5.389  -37.649 29.750 1.00 76.55  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F 2  74  ? -5.207  -38.270 28.701 1.00 76.46  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F 2  74  ? -5.508  -39.123 31.740 1.00 76.64  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F 2  74  ? -4.686  -40.166 32.462 1.00 78.64  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F 2  74  ? -5.495  -40.968 33.471 1.00 81.60  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F 2  74  ? -6.678  -40.631 33.732 1.00 82.75  ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F 2  74  ? -4.937  -41.945 34.014 1.00 82.62  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F 2  75  ? -6.216  -36.612 29.845 1.00 76.84  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F 2  75  ? -6.911  -36.104 28.674 1.00 77.11  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F 2  75  ? -5.937  -35.429 27.722 1.00 77.26  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F 2  75  ? -6.169  -35.380 26.517 1.00 77.36  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F 2  75  ? -8.007  -35.128 29.065 1.00 77.12  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F 2  75  ? -8.765  -34.595 27.893 1.00 77.32  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F 2  75  ? -9.863  -35.237 27.366 1.00 77.84  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F 2  75  ? -8.564  -33.499 27.126 1.00 77.60  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F 2  75  ? -10.320 -34.547 26.336 1.00 78.18  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F 2  75  ? -9.548  -33.488 26.169 1.00 78.27  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F 2  76  ? -4.852  -34.903 28.275 1.00 77.44  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F 2  76  ? -3.808  -34.285 27.476 1.00 77.62  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F 2  76  ? -2.786  -35.331 27.043 1.00 77.78  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F 2  76  ? -1.776  -34.996 26.417 1.00 78.04  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F 2  76  ? -3.136  -33.171 28.263 1.00 77.77  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F 2  77  ? -3.057  -36.593 27.385 1.00 77.77  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F 2  77  ? -2.180  -37.736 27.078 1.00 77.70  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F 2  77  ? -0.737  -37.558 27.564 1.00 77.44  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F 2  77  ? 0.211   -38.012 26.917 1.00 77.53  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F 2  77  ? -2.223  -38.074 25.582 1.00 77.74  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F 2  77  ? -3.452  -38.858 25.172 1.00 78.48  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F 2  77  ? -3.724  -38.713 23.689 1.00 79.91  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F 2  77  ? -4.857  -39.624 23.245 1.00 80.66  ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F 2  77  ? -5.164  -39.442 21.798 1.00 81.28  ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F 2  78  ? -0.586  -36.898 28.708 1.00 77.03  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F 2  78  ? 0.724   -36.669 29.299 1.00 76.67  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F 2  78  ? 0.985   -37.695 30.400 1.00 76.32  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F 2  78  ? 0.051   -38.348 30.875 1.00 76.23  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F 2  78  ? 0.822   -35.239 29.848 1.00 76.72  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F 2  78  ? 0.954   -34.156 28.782 1.00 76.90  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F 2  78  ? 1.248   -32.787 29.396 1.00 77.82  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F 2  78  ? 0.029   -32.019 29.653 1.00 79.24  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F 2  78  ? -0.662  -32.032 30.793 1.00 79.54  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F 2  78  ? -0.269  -32.775 31.821 1.00 79.45  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F 2  78  ? -1.759  -31.295 30.901 1.00 79.90  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F 2  79  ? 2.255   -37.851 30.775 1.00 75.88  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F 2  79  ? 2.646   -38.663 31.934 1.00 75.52  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F 2  79  ? 3.056   -37.774 33.108 1.00 74.82  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F 2  79  ? 3.302   -38.262 34.215 1.00 74.58  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F 2  79  ? 3.784   -39.625 31.580 1.00 75.69  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F 2  79  ? 3.350   -40.806 30.732 1.00 77.12  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F 2  79  ? 4.371   -41.941 30.783 1.00 79.70  ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F 2  79  ? 3.972   -43.079 29.830 1.00 81.08  ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F 2  79  ? 5.067   -44.076 29.613 1.00 81.48  ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F 2  80  ? 3.122   -36.469 32.848 1.00 74.10  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F 2  80  ? 3.486   -35.482 33.856 1.00 73.29  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F 2  80  ? 2.278   -34.630 34.232 1.00 72.77  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F 2  80  ? 1.592   -34.084 33.366 1.00 72.58  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F 2  80  ? 4.665   -34.590 33.390 1.00 73.15  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F 2  80  ? 5.765   -35.422 33.017 1.00 73.25  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F 2  80  ? 5.132   -33.676 34.503 1.00 73.09  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F 2  81  ? 2.025   -34.553 35.536 1.00 72.16  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F 2  81  ? 1.006   -33.685 36.100 1.00 71.64  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F 2  81  ? 1.565   -32.262 36.175 1.00 71.27  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F 2  81  ? 2.447   -31.977 36.981 1.00 71.18  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F 2  81  ? 0.560   -34.184 37.493 1.00 71.63  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F 2  81  ? -0.546  -33.299 38.056 1.00 72.00  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F 2  81  ? 0.078   -35.624 37.410 1.00 71.22  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F 2  82  ? 1.051   -31.385 35.315 1.00 70.91  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F 2  82  ? 1.571   -30.029 35.168 1.00 70.64  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F 2  82  ? 0.998   -29.124 36.240 1.00 70.48  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F 2  82  ? -0.038  -29.439 36.823 1.00 70.49  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F 2  82  ? 1.248   -29.431 33.766 1.00 70.74  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F 2  82  ? -0.169  -29.387 33.563 1.00 70.67  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F 2  82  ? 1.875   -30.261 32.656 1.00 70.76  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F 2  83  ? 1.674   -28.005 36.501 1.00 70.27  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F 2  83  ? 1.159   -26.996 37.423 1.00 70.09  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F 2  83  ? -0.212  -26.510 36.957 1.00 70.10  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F 2  83  ? -1.096  -26.272 37.772 1.00 70.15  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F 2  83  ? 2.123   -25.839 37.545 1.00 70.01  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F 2  84  ? -0.389  -26.395 35.642 1.00 70.12  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F 2  84  ? -1.667  -25.973 35.065 1.00 70.06  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F 2  84  ? -2.773  -27.012 35.220 1.00 69.42  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F 2  84  ? -3.950  -26.666 35.195 1.00 69.63  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F 2  84  ? -1.504  -25.563 33.598 1.00 70.36  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F 2  84  ? -0.703  -24.275 33.411 1.00 72.07  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F 2  84  ? -1.344  -22.872 34.370 1.00 75.80  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F 2  84  ? -2.938  -22.630 33.590 1.00 74.83  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F 2  85  ? -2.395  -28.276 35.383 1.00 68.60  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F 2  85  ? -3.362  -29.333 35.655 1.00 67.87  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F 2  85  ? -4.042  -29.098 36.993 1.00 67.31  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F 2  85  ? -5.263  -29.180 37.101 1.00 67.00  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F 2  85  ? -2.679  -30.703 35.657 1.00 67.95  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F 2  85  ? -2.489  -31.262 34.266 1.00 67.77  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F 2  85  ? -3.259  -30.885 33.357 1.00 67.99  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F 2  85  ? -1.573  -32.088 34.085 1.00 67.52  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F 2  86  ? -3.224  -28.799 37.999 1.00 66.83  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F 2  86  ? -3.664  -28.576 39.372 1.00 66.23  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F 2  86  ? -4.463  -27.281 39.469 1.00 65.92  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F 2  86  ? -5.533  -27.249 40.074 1.00 65.92  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F 2  86  ? -2.451  -28.536 40.328 1.00 66.18  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F 2  86  ? -2.846  -28.014 41.684 1.00 66.52  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F 2  86  ? -1.836  -29.909 40.458 1.00 66.09  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F 2  87  ? -3.945  -26.224 38.854 1.00 65.60  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F 2  87  ? -4.627  -24.935 38.807 1.00 65.42  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F 2  87  ? -6.049  -25.027 38.228 1.00 65.76  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F 2  87  ? -6.945  -24.318 38.689 1.00 65.90  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F 2  87  ? -3.793  -23.889 38.046 1.00 65.10  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F 2  87  ? -4.567  -22.596 37.876 1.00 64.98  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F 2  87  ? -2.493  -23.625 38.781 1.00 64.79  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F 2  88  ? -6.256  -25.901 37.240 1.00 66.03  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F 2  88  ? -7.577  -26.069 36.629 1.00 66.42  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F 2  88  ? -8.482  -26.960 37.456 1.00 66.07  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F 2  88  ? -9.696  -26.776 37.457 1.00 66.02  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F 2  88  ? -7.486  -26.599 35.191 1.00 66.94  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F 2  88  ? -6.875  -25.632 34.210 1.00 68.89  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F 2  88  ? -5.985  -26.069 33.238 1.00 71.30  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F 2  88  ? -7.175  -24.274 34.265 1.00 71.48  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F 2  88  ? -5.405  -25.177 32.338 1.00 73.57  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F 2  88  ? -6.609  -23.372 33.378 1.00 73.57  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F 2  88  ? -5.728  -23.825 32.412 1.00 74.58  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F 2  88  ? -5.179  -22.909 31.530 1.00 76.02  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F 2  89  ? -7.886  -27.932 38.140 1.00 65.90  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F 2  89  ? -8.614  -28.780 39.070 1.00 65.76  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F 2  89  ? -9.096  -27.930 40.235 1.00 65.73  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F 2  89  ? -10.216 -28.106 40.715 1.00 65.93  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F 2  89  ? -7.738  -29.906 39.564 1.00 65.57  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F 2  90  ? -8.255  -26.995 40.669 1.00 65.59  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F 2  90  ? -8.595  -26.110 41.779 1.00 65.71  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F 2  90  ? -9.730  -25.142 41.451 1.00 65.95  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F 2  90  ? -10.646 -24.973 42.252 1.00 66.03  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F 2  90  ? -7.359  -25.358 42.285 1.00 65.59  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F 2  90  ? -6.346  -26.155 43.120 1.00 65.25  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F 2  90  ? -5.052  -25.375 43.281 1.00 64.38  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F 2  90  ? -6.907  -26.551 44.482 1.00 64.10  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F 2  91  ? -9.675  -24.513 40.281 1.00 66.27  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F 2  91  ? -10.754 -23.637 39.849 1.00 66.54  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F 2  91  ? -12.048 -24.426 39.618 1.00 66.82  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F 2  91  ? -13.142 -23.895 39.829 1.00 67.14  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F 2  91  ? -10.358 -22.848 38.605 1.00 66.46  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F 2  91  ? -11.384 -21.799 38.195 1.00 67.39  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F 2  91  ? -10.898 -20.923 37.047 1.00 69.46  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F 2  91  ? -10.105 -19.720 37.567 1.00 70.48  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F 2  91  ? -9.734  -18.749 36.495 1.00 71.35  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F 2  92  ? -11.925 -25.689 39.205 1.00 66.99  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F 2  92  ? -13.089 -26.557 38.990 1.00 67.31  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F 2  92  ? -13.864 -26.850 40.248 1.00 67.17  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F 2  92  ? -15.064 -27.055 40.196 1.00 67.35  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F 2  92  ? -12.677 -27.897 38.404 1.00 67.70  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F 2  92  ? -13.051 -28.073 36.956 1.00 69.26  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F 2  92  ? -13.396 -29.515 36.662 1.00 70.91  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F 2  92  ? -14.797 -29.786 36.956 1.00 72.72  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F 2  92  ? -15.231 -30.369 38.068 1.00 74.74  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F 2  92  ? -14.374 -30.760 39.002 1.00 75.13  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F 2  92  ? -16.532 -30.576 38.246 1.00 76.50  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F 2  93  ? -13.168 -26.907 41.374 1.00 67.09  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F 2  93  ? -13.798 -27.248 42.632 1.00 66.96  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F 2  93  ? -14.035 -26.025 43.480 1.00 66.63  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F 2  93  ? -14.402 -26.134 44.650 1.00 66.73  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F 2  93  ? -12.935 -28.247 43.377 1.00 67.25  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F 2  93  ? -13.165 -29.668 42.919 1.00 68.38  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F 2  93  ? -12.012 -30.565 43.256 1.00 70.01  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F 2  93  ? -11.371 -30.419 44.303 1.00 71.06  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F 2  93  ? -11.728 -31.503 42.367 1.00 70.88  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F 2  94  ? -13.819 -24.861 42.878 1.00 66.30  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F 2  94  ? -14.057 -23.586 43.532 1.00 66.08  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F 2  94  ? -13.028 -23.260 44.589 1.00 65.89  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F 2  94  ? -13.354 -22.638 45.596 1.00 66.14  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F 2  95  ? -11.791 -23.694 44.362 1.00 65.66  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F 2  95  ? -10.669 -23.363 45.237 1.00 65.41  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F 2  95  ? -9.600  -22.621 44.426 1.00 65.21  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F 2  95  ? -8.407  -22.895 44.581 1.00 65.29  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F 2  95  ? -10.053 -24.624 45.875 1.00 65.46  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F 2  95  ? -10.970 -25.533 46.713 1.00 65.87  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F 2  95  ? -11.408 -24.924 48.045 1.00 67.82  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F 2  95  ? -10.336 -24.214 48.750 1.00 69.65  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F 2  95  ? -10.509 -23.487 49.859 1.00 69.76  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F 2  95  ? -11.717 -23.366 50.405 1.00 69.28  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F 2  95  ? -9.469  -22.884 50.430 1.00 69.17  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F 2  96  ? -10.037 -21.692 43.570 1.00 64.89  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F 2  96  ? -9.160  -20.904 42.677 1.00 64.59  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F 2  96  ? -7.840  -20.459 43.307 1.00 64.54  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F 2  96  ? -7.812  -19.945 44.426 1.00 64.67  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F 2  96  ? -9.883  -19.654 42.163 1.00 64.42  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F 2  96  ? -11.141 -20.035 41.600 1.00 64.59  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F 2  96  ? -9.065  -18.954 41.110 1.00 64.25  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F 2  97  ? -6.753  -20.654 42.570 1.00 64.40  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F 2  97  ? -5.419  -20.334 43.056 1.00 64.22  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F 2  97  ? -4.717  -19.364 42.109 1.00 64.68  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F 2  97  ? -4.645  -19.611 40.905 1.00 64.87  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F 2  97  ? -4.594  -21.622 43.215 1.00 63.72  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F 2  97  ? -3.102  -21.536 43.555 1.00 62.55  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F 2  97  ? -2.870  -20.948 44.933 1.00 61.64  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F 2  97  ? -2.459  -22.894 43.463 1.00 61.65  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F 2  98  ? -4.213  -18.259 42.653 1.00 65.03  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F 2  98  ? -3.311  -17.393 41.906 1.00 65.46  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F 2  98  ? -1.864  -17.645 42.302 1.00 66.21  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F 2  98  ? -1.569  -17.899 43.470 1.00 66.18  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F 2  98  ? -3.586  -15.922 42.180 1.00 65.23  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F 2  98  ? -4.906  -15.355 41.724 1.00 64.37  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F 2  98  ? -5.819  -16.105 40.992 1.00 62.88  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F 2  98  ? -5.218  -14.030 42.010 1.00 63.74  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F 2  98  ? -7.016  -15.552 40.587 1.00 62.36  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F 2  98  ? -6.398  -13.476 41.606 1.00 63.13  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F 2  98  ? -7.292  -14.235 40.897 1.00 62.93  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F 2  98  ? -8.468  -13.647 40.509 1.00 64.73  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F 2  99  ? -0.964  -17.550 41.326 1.00 67.12  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F 2  99  ? 0.463   -17.499 41.601 1.00 68.27  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F 2  99  ? 1.288   -18.626 41.027 1.00 69.22  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F 2  99  ? 2.521   -18.596 41.118 1.00 69.39  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F 2  100 ? 0.616   -19.616 40.438 1.00 70.11  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F 2  100 ? 1.284   -20.808 39.899 1.00 70.77  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F 2  100 ? 0.924   -21.081 38.456 1.00 71.52  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F 2  100 ? 0.825   -22.239 38.051 1.00 71.79  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F 2  100 ? 0.948   -22.045 40.728 1.00 70.46  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F 2  100 ? 1.625   -22.082 42.039 1.00 69.88  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F 2  100 ? 0.981   -21.636 43.175 1.00 70.13  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F 2  100 ? 2.916   -22.551 42.142 1.00 70.24  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F 2  100 ? 1.615   -21.664 44.403 1.00 70.58  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F 2  100 ? 3.562   -22.579 43.366 1.00 71.05  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F 2  100 ? 2.908   -22.134 44.500 1.00 70.77  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F 2  101 ? 0.727   -20.026 37.676 1.00 72.36  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F 2  101 ? 0.394   -20.196 36.266 1.00 73.39  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F 2  101 ? -0.865  -19.461 35.854 1.00 74.01  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F 2  101 ? -1.423  -18.694 36.639 1.00 74.26  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F 2  102 ? -1.321  -19.733 34.631 1.00 74.36  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F 2  102 ? -2.303  -18.904 33.920 1.00 74.98  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F 2  102 ? -3.642  -18.595 34.580 1.00 75.37  ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F 2  102 ? -3.720  -17.921 35.610 1.00 75.72  ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F 2  102 ? -4.704  -18.984 34.078 1.00 75.40  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G 3  14  ? -34.583 -41.653 4.495  1.00 107.43 ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G 3  14  ? -33.994 -40.893 5.641  1.00 107.50 ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G 3  14  ? -34.198 -41.606 6.981  1.00 107.40 ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G 3  14  ? -35.256 -42.195 7.225  1.00 107.58 ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G 3  14  ? -34.567 -39.472 5.696  1.00 107.52 ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G 3  15  ? -33.181 -41.550 7.840  1.00 107.12 ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G 3  15  ? -33.266 -42.110 9.193  1.00 106.72 ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G 3  15  ? -32.578 -41.205 10.218 1.00 106.52 ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G 3  15  ? -31.456 -40.727 9.995  1.00 106.62 ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G 3  15  ? -32.678 -43.527 9.245  1.00 106.64 ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G 3  15  ? -33.082 -44.327 10.481 1.00 106.36 ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G 3  15  ? -34.554 -44.732 10.429 1.00 105.98 ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G 3  15  ? -35.020 -45.374 11.726 1.00 105.43 ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G 3  15  ? -34.335 -46.667 12.012 1.00 104.92 ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G 3  16  ? -33.262 -40.980 11.341 1.00 106.02 ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G 3  16  ? -32.779 -40.073 12.386 1.00 105.40 ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G 3  16  ? -31.539 -40.614 13.096 1.00 104.88 ? 16   THR G C     1 
ATOM   4541  O  O     . THR G 3  16  ? -31.454 -41.811 13.389 1.00 104.75 ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G 3  16  ? -33.875 -39.762 13.440 1.00 105.49 ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G 3  16  ? -34.343 -40.979 14.035 1.00 105.26 ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G 3  16  ? -35.050 -39.018 12.805 1.00 105.62 ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G 3  17  ? -30.588 -39.717 13.365 1.00 104.19 ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G 3  17  ? -29.362 -40.045 14.104 1.00 103.43 ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G 3  17  ? -29.651 -40.572 15.518 1.00 103.20 ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G 3  17  ? -28.844 -41.315 16.090 1.00 103.15 ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G 3  17  ? -28.428 -38.830 14.175 1.00 103.21 ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G 3  17  ? -27.813 -38.439 12.845 1.00 102.32 ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G 3  17  ? -26.557 -37.613 13.030 1.00 100.43 ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G 3  17  ? -26.828 -36.186 13.186 1.00 99.57  ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G 3  17  ? -25.900 -35.272 13.467 1.00 99.12  ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G 3  17  ? -24.631 -35.631 13.637 1.00 98.48  ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G 3  17  ? -26.242 -33.993 13.587 1.00 98.41  ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G 3  18  ? -30.806 -40.185 16.064 1.00 102.68 ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G 3  18  ? -31.249 -40.637 17.379 1.00 102.13 ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G 3  18  ? -31.680 -42.095 17.362 1.00 101.85 ? 18   SER G C     1 
ATOM   4559  O  O     . SER G 3  18  ? -31.416 -42.832 18.310 1.00 101.83 ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G 3  18  ? -32.382 -39.753 17.894 1.00 102.08 ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G 3  18  ? -31.930 -38.425 18.047 1.00 101.94 ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G 3  19  ? -32.343 -42.507 16.284 1.00 101.44 ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G 3  19  ? -32.716 -43.907 16.107 1.00 100.99 ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G 3  19  ? -31.491 -44.743 15.754 1.00 100.46 ? 19   SER G C     1 
ATOM   4565  O  O     . SER G 3  19  ? -31.408 -45.910 16.134 1.00 100.28 ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G 3  19  ? -33.778 -44.048 15.024 1.00 101.07 ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G 3  19  ? -33.337 -43.441 13.822 1.00 101.62 ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G 3  20  ? -30.549 -44.133 15.035 1.00 99.95  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G 3  20  ? -29.279 -44.777 14.682 1.00 99.62  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G 3  20  ? -28.467 -45.127 15.924 1.00 99.21  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G 3  20  ? -27.876 -46.206 16.006 1.00 99.18  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G 3  20  ? -28.432 -43.886 13.765 1.00 99.75  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G 3  20  ? -28.953 -43.717 12.349 1.00 100.08 ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G 3  20  ? -27.890 -43.093 11.457 1.00 100.84 ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G 3  20  ? -28.467 -42.256 10.405 1.00 101.75 ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G 3  20  ? -28.921 -42.707 9.236  1.00 102.09 ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G 3  20  ? -28.881 -44.005 8.946  1.00 102.06 ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G 3  20  ? -29.421 -41.853 8.351  1.00 102.05 ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G 3  21  ? -28.437 -44.203 16.881 1.00 98.71  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G 3  21  ? -27.739 -44.415 18.150 1.00 98.18  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G 3  21  ? -28.565 -45.264 19.121 1.00 97.68  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G 3  21  ? -28.032 -45.833 20.076 1.00 97.58  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G 3  21  ? -27.382 -43.082 18.779 1.00 98.23  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G 3  22  ? -29.866 -45.346 18.858 1.00 97.20  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G 3  22  ? -30.794 -46.102 19.694 1.00 96.36  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G 3  22  ? -31.310 -45.261 20.841 1.00 95.73  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G 3  22  ? -31.709 -45.799 21.873 1.00 95.90  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G 3  23  ? -31.311 -43.941 20.648 1.00 94.89  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G 3  23  ? -31.644 -42.980 21.703 1.00 93.96  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G 3  23  ? -33.002 -42.320 21.501 1.00 93.39  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G 3  23  ? -33.489 -42.210 20.374 1.00 93.44  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G 3  23  ? -30.568 -41.889 21.789 1.00 93.86  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G 3  23  ? -29.129 -42.275 22.142 1.00 93.52  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G 3  23  ? -28.186 -41.108 21.880 1.00 92.90  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G 3  23  ? -29.024 -42.748 23.586 1.00 93.17  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G 3  24  ? -33.600 -41.884 22.607 1.00 92.53  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G 3  24  ? -34.818 -41.081 22.587 1.00 91.70  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G 3  24  ? -34.487 -39.600 22.492 1.00 91.05  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G 3  24  ? -35.285 -38.810 21.994 1.00 91.06  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G 3  24  ? -35.644 -41.323 23.849 1.00 91.74  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G 3  24  ? -36.052 -42.759 24.052 1.00 92.22  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G 3  24  ? -36.598 -43.371 22.790 1.00 93.19  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G 3  24  ? -37.546 -42.856 22.197 1.00 93.91  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G 3  24  ? -35.996 -44.472 22.361 1.00 93.65  ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G 3  25  ? -33.307 -39.234 22.980 1.00 90.17  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G 3  25  ? -32.896 -37.841 23.040 1.00 89.23  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G 3  25  ? -32.286 -37.396 21.724 1.00 88.84  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G 3  25  ? -31.371 -38.047 21.216 1.00 88.90  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G 3  25  ? -31.944 -37.616 24.215 1.00 89.13  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G 3  25  ? -32.649 -37.261 25.493 1.00 88.29  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G 3  25  ? -33.450 -38.190 26.142 1.00 87.33  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G 3  25  ? -32.525 -35.989 26.034 1.00 87.80  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G 3  25  ? -34.106 -37.863 27.307 1.00 86.99  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G 3  25  ? -33.181 -35.651 27.203 1.00 87.46  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G 3  25  ? -33.974 -36.591 27.841 1.00 87.32  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G 3  26  ? -32.801 -36.281 21.167 1.00 88.35  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G 3  26  ? -32.518 -35.817 19.806 1.00 87.93  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G 3  26  ? -31.056 -35.460 19.557 1.00 87.53  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G 3  26  ? -30.606 -34.381 19.949 1.00 87.47  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G 3  26  ? -33.422 -34.587 19.658 1.00 87.91  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G 3  26  ? -33.665 -34.128 21.035 1.00 88.08  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G 3  26  ? -33.709 -35.361 21.874 1.00 88.23  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G 3  27  ? -30.335 -36.368 18.897 1.00 87.15  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G 3  27  ? -28.923 -36.159 18.552 1.00 86.89  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G 3  27  ? -28.741 -34.921 17.671 1.00 86.90  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G 3  27  ? -27.819 -34.131 17.879 1.00 86.76  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G 3  27  ? -28.295 -37.405 17.862 1.00 86.80  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G 3  27  ? -26.805 -37.194 17.619 1.00 86.43  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G 3  27  ? -28.508 -38.654 18.701 1.00 86.40  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G 3  28  ? -29.634 -34.761 16.697 1.00 86.99  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G 3  28  ? -29.623 -33.608 15.804 1.00 87.16  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G 3  28  ? -29.726 -32.279 16.529 1.00 87.22  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G 3  28  ? -28.968 -31.345 16.234 1.00 87.31  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G 3  29  ? -30.665 -32.199 17.474 1.00 87.14  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G 3  29  ? -30.851 -31.003 18.288 1.00 87.08  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G 3  29  ? -29.627 -30.758 19.150 1.00 87.26  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G 3  29  ? -29.123 -29.639 19.214 1.00 87.18  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G 3  29  ? -32.100 -31.129 19.164 1.00 87.02  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G 3  29  ? -32.526 -29.837 19.843 1.00 86.35  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G 3  29  ? -33.796 -30.033 20.649 1.00 85.79  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G 3  29  ? -34.994 -30.027 19.813 1.00 85.64  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G 3  29  ? -36.240 -29.956 20.276 1.00 85.59  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G 3  29  ? -36.472 -29.883 21.579 1.00 85.69  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G 3  29  ? -37.262 -29.952 19.431 1.00 85.69  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G 3  30  ? -29.145 -31.813 19.800 1.00 87.58  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G 3  30  ? -27.971 -31.708 20.659 1.00 87.96  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G 3  30  ? -26.756 -31.251 19.849 1.00 88.51  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G 3  30  ? -25.956 -30.454 20.340 1.00 88.62  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G 3  30  ? -27.698 -33.017 21.439 1.00 87.73  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G 3  30  ? -26.348 -32.973 22.124 1.00 87.50  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G 3  30  ? -28.787 -33.244 22.471 1.00 87.45  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G 3  31  ? -26.644 -31.727 18.606 1.00 89.10  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G 3  31  ? -25.587 -31.272 17.700 1.00 89.69  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G 3  31  ? -25.763 -29.795 17.406 1.00 89.85  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G 3  31  ? -24.816 -29.013 17.522 1.00 89.88  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G 3  31  ? -25.594 -32.049 16.383 1.00 89.87  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G 3  31  ? -24.284 -32.006 15.651 1.00 91.19  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G 3  31  ? -23.584 -30.836 15.433 1.00 92.07  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G 3  31  ? -23.548 -32.992 15.082 1.00 92.05  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G 3  31  ? -22.472 -31.107 14.773 1.00 91.98  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G 3  31  ? -22.426 -32.406 14.545 1.00 92.04  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G 3  32  ? -26.985 -29.430 17.026 1.00 90.16  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G 3  32  ? -27.346 -28.048 16.739 1.00 90.40  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G 3  32  ? -26.927 -27.138 17.894 1.00 90.67  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G 3  32  ? -26.150 -26.197 17.702 1.00 90.70  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G 3  32  ? -28.854 -27.948 16.484 1.00 90.27  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G 3  32  ? -29.329 -26.626 15.918 1.00 90.15  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G 3  32  ? -30.836 -26.532 16.031 1.00 90.40  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G 3  32  ? -31.252 -26.110 17.368 1.00 90.57  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G 3  32  ? -32.371 -26.497 17.984 1.00 90.53  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G 3  32  ? -33.211 -27.347 17.409 1.00 90.65  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G 3  32  ? -32.643 -26.042 19.197 1.00 90.51  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G 3  33  ? -27.415 -27.451 19.093 1.00 90.99  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G 3  33  ? -27.190 -26.616 20.267 1.00 91.28  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G 3  33  ? -25.720 -26.536 20.666 1.00 91.73  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G 3  33  ? -25.285 -25.529 21.226 1.00 91.85  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G 3  33  ? -28.067 -27.077 21.436 1.00 91.15  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G 3  33  ? -29.575 -26.815 21.293 1.00 90.66  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G 3  33  ? -30.366 -27.552 22.366 1.00 90.39  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G 3  33  ? -29.905 -25.325 21.315 1.00 90.06  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G 3  34  ? -24.961 -27.585 20.354 1.00 92.30  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G 3  34  ? -23.514 -27.617 20.597 1.00 92.89  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G 3  34  ? -22.732 -26.646 19.716 1.00 93.38  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G 3  34  ? -21.701 -26.121 20.133 1.00 93.29  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G 3  34  ? -22.963 -29.032 20.399 1.00 92.89  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G 3  34  ? -22.901 -29.988 21.594 1.00 92.88  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G 3  34  ? -22.918 -31.424 21.108 1.00 92.74  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G 3  34  ? -21.670 -29.726 22.461 1.00 92.76  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G 3  35  ? -23.221 -26.426 18.497 1.00 94.14  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G 3  35  ? -22.584 -25.510 17.553 1.00 94.92  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G 3  35  ? -22.845 -24.070 17.929 1.00 95.13  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G 3  35  ? -21.918 -23.272 18.061 1.00 95.22  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G 3  35  ? -23.116 -25.733 16.144 1.00 95.09  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G 3  35  ? -22.953 -27.129 15.644 1.00 96.25  ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G 3  35  ? -23.233 -27.175 14.170 1.00 98.44  ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G 3  35  ? -22.590 -28.335 13.569 1.00 100.75 ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G 3  35  ? -21.284 -28.431 13.317 1.00 101.82 ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G 3  35  ? -20.457 -27.432 13.615 1.00 102.16 ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G 3  35  ? -20.805 -29.537 12.767 1.00 102.13 ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G 3  36  ? -24.121 -23.745 18.098 1.00 95.52  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G 3  36  ? -24.531 -22.374 18.356 1.00 96.05  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G 3  36  ? -24.235 -21.972 19.797 1.00 96.14  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G 3  36  ? -24.495 -20.835 20.201 1.00 96.30  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G 3  36  ? -26.012 -22.169 17.994 1.00 96.16  ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G 3  36  ? -26.401 -22.808 16.658 1.00 96.76  ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G 3  36  ? -27.103 -21.835 15.711 1.00 97.84  ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G 3  36  ? -27.175 -22.423 14.291 1.00 98.33  ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G 3  36  ? -27.818 -21.511 13.292 1.00 98.41  ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G 3  37  ? -23.663 -22.907 20.553 1.00 96.22  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G 3  37  ? -23.336 -22.688 21.957 1.00 96.39  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G 3  37  ? -21.997 -22.024 22.228 1.00 96.48  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G 3  37  ? -21.640 -21.819 23.387 1.00 96.63  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G 3  38  ? -21.256 -21.694 21.170 1.00 96.52  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G 3  38  ? -19.952 -21.024 21.291 1.00 96.71  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G 3  38  ? -18.971 -21.756 22.209 1.00 96.66  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G 3  38  ? -18.194 -21.128 22.931 1.00 96.76  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G 3  38  ? -20.120 -19.573 21.768 1.00 96.83  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G 3  38  ? -20.942 -18.731 20.813 1.00 97.38  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G 3  38  ? -22.091 -18.393 21.103 1.00 97.77  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G 3  38  ? -20.360 -18.388 19.667 1.00 97.67  ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G 3  39  ? -19.007 -23.082 22.181 1.00 96.52  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G 3  39  ? -18.156 -23.873 23.059 1.00 96.36  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G 3  39  ? -16.768 -24.113 22.452 1.00 96.44  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G 3  39  ? -15.753 -23.990 23.144 1.00 96.47  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G 3  39  ? -18.862 -25.169 23.462 1.00 96.29  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G 3  39  ? -20.176 -24.940 24.187 1.00 96.02  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G 3  39  ? -21.368 -25.464 23.693 1.00 95.83  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G 3  39  ? -20.227 -24.187 25.360 1.00 95.95  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G 3  39  ? -22.576 -25.253 24.354 1.00 95.59  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G 3  39  ? -21.428 -23.968 26.024 1.00 95.77  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G 3  39  ? -22.597 -24.503 25.516 1.00 95.62  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G 3  39  ? -23.785 -24.287 26.175 1.00 95.73  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G 3  40  ? -16.730 -24.443 21.161 1.00 96.50  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G 3  40  ? -15.484 -24.439 20.382 1.00 96.50  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G 3  40  ? -15.778 -24.083 18.930 1.00 96.44  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G 3  40  ? -16.941 -23.898 18.564 1.00 96.46  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G 3  40  ? -14.774 -25.777 20.476 1.00 96.49  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G 3  41  ? -14.730 -23.976 18.112 1.00 96.41  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G 3  41  ? -14.887 -23.699 16.679 1.00 96.36  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G 3  41  ? -15.645 -24.813 15.969 1.00 96.02  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G 3  41  ? -16.440 -24.545 15.071 1.00 96.11  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G 3  41  ? -13.529 -23.498 15.993 1.00 96.46  ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G 3  41  ? -12.808 -22.205 16.356 1.00 97.57  ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G 3  41  ? -13.522 -20.960 15.848 1.00 98.99  ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G 3  41  ? -13.693 -20.827 14.614 1.00 99.38  ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G 3  41  ? -13.900 -20.109 16.685 1.00 99.84  ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G 3  42  ? -15.408 -26.054 16.393 1.00 95.65  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G 3  42  ? -15.870 -27.235 15.663 1.00 95.31  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G 3  42  ? -16.519 -28.302 16.542 1.00 94.55  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G 3  42  ? -16.054 -28.572 17.642 1.00 94.72  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G 3  42  ? -14.692 -27.875 14.927 1.00 95.66  ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G 3  42  ? -14.190 -27.113 13.715 1.00 96.96  ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G 3  42  ? -13.373 -28.043 12.848 1.00 99.43  ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G 3  42  ? -12.957 -27.425 11.593 1.00 101.38 ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G 3  42  ? -12.498 -28.104 10.544 1.00 102.79 ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G 3  42  ? -12.402 -29.432 10.590 1.00 103.09 ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G 3  42  ? -12.135 -27.458 9.444  1.00 103.96 ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G 3  43  ? -17.575 -28.929 16.034 1.00 93.55  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G 3  43  ? -18.243 -30.016 16.746 1.00 92.69  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G 3  43  ? -18.044 -31.339 16.013 1.00 92.16  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G 3  43  ? -18.470 -31.487 14.868 1.00 92.12  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G 3  43  ? -19.761 -29.746 16.918 1.00 92.77  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G 3  43  ? -20.459 -30.931 17.592 1.00 92.45  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G 3  43  ? -19.999 -28.459 17.703 1.00 92.67  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G 3  44  ? -17.400 -32.293 16.684 1.00 91.66  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G 3  44  ? -17.185 -33.644 16.148 1.00 90.92  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G 3  44  ? -18.483 -34.413 16.000 1.00 90.42  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G 3  44  ? -19.458 -34.120 16.687 1.00 90.55  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G 3  45  ? -18.494 -35.402 15.108 1.00 89.88  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G 3  45  ? -19.727 -36.104 14.730 1.00 89.27  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G 3  45  ? -20.337 -36.946 15.841 1.00 88.87  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G 3  45  ? -21.556 -37.070 15.927 1.00 88.84  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G 3  45  ? -19.491 -36.963 13.504 1.00 89.38  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G 3  46  ? -19.488 -37.530 16.679 1.00 88.48  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G 3  46  ? -19.947 -38.421 17.742 1.00 87.90  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G 3  46  ? -20.321 -37.704 19.024 1.00 87.43  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G 3  46  ? -21.147 -38.194 19.798 1.00 87.31  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G 3  47  ? -19.714 -36.539 19.245 1.00 86.88  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G 3  47  ? -19.913 -35.784 20.480 1.00 86.22  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G 3  47  ? -21.393 -35.608 20.853 1.00 85.77  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G 3  47  ? -21.760 -35.900 21.989 1.00 85.81  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G 3  47  ? -19.177 -34.441 20.435 1.00 86.14  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G 3  48  ? -22.252 -35.168 19.903 1.00 85.30  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G 3  48  ? -23.657 -35.010 20.287 1.00 84.87  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G 3  48  ? -24.337 -36.339 20.582 1.00 84.50  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G 3  48  ? -25.281 -36.382 21.367 1.00 84.45  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G 3  48  ? -24.291 -34.359 19.057 1.00 84.87  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G 3  48  ? -23.416 -34.726 17.938 1.00 85.09  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G 3  48  ? -22.034 -34.777 18.498 1.00 85.29  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G 3  49  ? -23.852 -37.410 19.957 1.00 84.13  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G 3  49  ? -24.372 -38.761 20.188 1.00 83.68  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G 3  49  ? -24.086 -39.187 21.631 1.00 83.26  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G 3  49  ? -24.984 -39.625 22.357 1.00 83.09  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G 3  49  ? -23.760 -39.785 19.190 1.00 83.61  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G 3  49  ? -24.273 -41.189 19.461 1.00 83.43  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G 3  49  ? -24.058 -39.380 17.760 1.00 83.60  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G 3  50  ? -22.825 -39.037 22.027 1.00 82.82  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G 3  50  ? -22.369 -39.332 23.378 1.00 82.45  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G 3  50  ? -23.160 -38.528 24.396 1.00 82.16  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G 3  50  ? -23.734 -39.083 25.339 1.00 82.14  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G 3  50  ? -20.888 -38.969 23.506 1.00 82.48  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G 3  50  ? -20.179 -39.666 24.634 1.00 82.37  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G 3  50  ? -19.249 -40.661 24.370 1.00 82.64  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G 3  50  ? -20.437 -39.333 25.964 1.00 82.41  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G 3  50  ? -18.591 -41.312 25.396 1.00 83.41  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G 3  50  ? -19.784 -39.974 27.004 1.00 82.66  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G 3  50  ? -18.861 -40.964 26.712 1.00 83.43  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G 3  50  ? -18.198 -41.613 27.725 1.00 83.67  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G 3  51  ? -23.173 -37.213 24.185 1.00 81.70  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G 3  51  ? -23.828 -36.265 25.072 1.00 81.15  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G 3  51  ? -25.317 -36.558 25.210 1.00 80.90  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G 3  51  ? -25.850 -36.535 26.320 1.00 81.04  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G 3  51  ? -23.591 -34.836 24.579 1.00 80.97  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G 3  51  ? -24.204 -33.655 25.327 1.00 80.92  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G 3  51  ? -23.959 -33.722 26.828 1.00 80.89  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G 3  51  ? -23.632 -32.382 24.751 1.00 81.11  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G 3  52  ? -25.980 -36.848 24.091 1.00 80.45  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G 3  52  ? -27.397 -37.205 24.112 1.00 79.98  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G 3  52  ? -27.630 -38.444 24.977 1.00 79.65  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G 3  52  ? -28.608 -38.511 25.720 1.00 79.53  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G 3  52  ? -27.920 -37.423 22.704 1.00 79.91  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G 3  53  ? -26.714 -39.406 24.885 1.00 79.29  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G 3  53  ? -26.792 -40.646 25.651 1.00 78.99  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G 3  53  ? -26.668 -40.371 27.141 1.00 78.83  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G 3  53  ? -27.461 -40.876 27.946 1.00 78.79  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G 3  53  ? -25.710 -41.612 25.201 1.00 78.96  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G 3  54  ? -25.666 -39.566 27.491 1.00 78.54  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G 3  54  ? -25.415 -39.162 28.874 1.00 78.14  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G 3  54  ? -26.646 -38.486 29.469 1.00 77.87  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G 3  54  ? -27.097 -38.855 30.553 1.00 77.86  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G 3  54  ? -24.187 -38.220 28.975 1.00 78.15  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G 3  54  ? -24.080 -37.602 30.366 1.00 77.84  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G 3  54  ? -22.915 -38.970 28.619 1.00 78.04  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G 3  55  ? -27.186 -37.510 28.743 1.00 77.53  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G 3  55  ? -28.377 -36.792 29.177 1.00 77.33  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G 3  55  ? -29.581 -37.724 29.300 1.00 77.28  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G 3  55  ? -30.344 -37.626 30.264 1.00 77.32  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G 3  55  ? -28.684 -35.615 28.241 1.00 77.25  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G 3  55  ? -27.728 -34.420 28.314 1.00 77.00  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G 3  55  ? -27.793 -33.592 27.051 1.00 77.06  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G 3  55  ? -28.022 -33.558 29.523 1.00 77.16  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G 3  56  ? -29.734 -38.634 28.337 1.00 77.12  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G 3  56  ? -30.845 -39.580 28.352 1.00 76.98  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G 3  56  ? -30.753 -40.484 29.561 1.00 76.74  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G 3  56  ? -31.689 -40.571 30.358 1.00 76.56  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G 3  56  ? -30.874 -40.433 27.086 1.00 77.13  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G 3  56  ? -32.023 -41.432 27.081 1.00 77.64  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G 3  56  ? -32.237 -42.097 25.745 1.00 78.31  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G 3  56  ? -32.010 -41.454 24.698 1.00 78.36  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G 3  56  ? -32.652 -43.272 25.747 1.00 79.56  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G 3  57  ? -29.613 -41.155 29.686 1.00 76.63  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G 3  57  ? -29.352 -42.017 30.829 1.00 76.52  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G 3  57  ? -29.780 -41.355 32.137 1.00 76.37  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G 3  57  ? -30.572 -41.923 32.896 1.00 76.46  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G 3  57  ? -27.872 -42.401 30.899 1.00 76.52  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G 3  57  ? -27.451 -42.877 32.271 1.00 76.48  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G 3  57  ? -28.129 -43.923 32.905 1.00 76.90  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G 3  57  ? -26.388 -42.282 32.937 1.00 75.89  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G 3  57  ? -27.761 -44.356 34.159 1.00 76.74  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G 3  57  ? -26.007 -42.716 34.191 1.00 76.20  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G 3  57  ? -26.700 -43.751 34.794 1.00 76.53  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G 3  57  ? -26.338 -44.185 36.043 1.00 77.29  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G 3  58  ? -29.252 -40.157 32.385 1.00 75.99  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G 3  58  ? -29.542 -39.416 33.604 1.00 75.58  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G 3  58  ? -31.036 -39.166 33.762 1.00 75.45  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G 3  58  ? -31.581 -39.342 34.852 1.00 75.57  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G 3  58  ? -28.757 -38.104 33.642 1.00 75.45  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G 3  58  ? -27.256 -38.208 33.938 1.00 75.33  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G 3  58  ? -26.520 -36.956 33.494 1.00 75.19  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G 3  58  ? -26.999 -38.475 35.412 1.00 75.01  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G 3  59  ? -31.698 -38.787 32.671 1.00 75.18  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G 3  59  ? -33.141 -38.561 32.693 1.00 75.01  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G 3  59  ? -33.851 -39.836 33.155 1.00 75.24  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G 3  59  ? -34.790 -39.782 33.953 1.00 75.10  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G 3  59  ? -33.670 -38.113 31.311 1.00 74.79  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G 3  59  ? -32.873 -37.033 30.824 1.00 74.48  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G 3  59  ? -35.105 -37.646 31.398 1.00 74.36  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G 3  60  ? -33.377 -40.979 32.663 1.00 75.47  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G 3  60  ? -33.948 -42.274 33.021 1.00 75.65  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G 3  60  ? -33.708 -42.601 34.495 1.00 75.73  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G 3  60  ? -34.627 -43.024 35.200 1.00 75.77  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G 3  60  ? -33.396 -43.379 32.116 1.00 75.61  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G 3  61  ? -32.477 -42.385 34.957 1.00 75.78  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G 3  61  ? -32.115 -42.631 36.354 1.00 75.80  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G 3  61  ? -33.043 -41.905 37.334 1.00 75.56  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G 3  61  ? -33.537 -42.517 38.280 1.00 75.32  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G 3  61  ? -30.651 -42.253 36.604 1.00 75.89  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G 3  61  ? -30.165 -42.472 38.034 1.00 76.54  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G 3  61  ? -29.840 -43.926 38.369 1.00 77.60  ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G 3  61  ? -29.717 -44.768 37.450 1.00 77.71  ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G 3  61  ? -29.687 -44.221 39.576 1.00 78.86  ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G 3  62  ? -33.282 -40.614 37.083 1.00 75.51  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G 3  62  ? -34.121 -39.769 37.952 1.00 75.42  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G 3  62  ? -35.616 -40.079 37.857 1.00 75.64  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G 3  62  ? -36.327 -40.018 38.861 1.00 75.58  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G 3  62  ? -33.864 -38.257 37.718 1.00 75.26  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G 3  62  ? -32.465 -37.889 38.217 1.00 75.03  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G 3  62  ? -34.927 -37.397 38.406 1.00 74.62  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G 3  62  ? -32.104 -36.427 38.096 1.00 74.96  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G 3  63  ? -36.090 -40.414 36.659 1.00 75.97  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G 3  63  ? -37.488 -40.814 36.479 1.00 76.18  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G 3  63  ? -37.752 -42.187 37.101 1.00 76.53  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G 3  63  ? -38.831 -42.432 37.644 1.00 76.39  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G 3  63  ? -37.885 -40.789 35.000 1.00 75.99  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G 3  63  ? -37.931 -39.410 34.336 1.00 75.47  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G 3  63  ? -37.982 -39.550 32.831 1.00 75.19  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G 3  63  ? -39.093 -38.573 34.845 1.00 74.84  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G 3  64  ? -36.758 -43.069 37.025 1.00 77.02  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G 3  64  ? -36.807 -44.361 37.700 1.00 77.67  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G 3  64  ? -37.082 -44.188 39.196 1.00 77.90  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G 3  64  ? -38.069 -44.705 39.713 1.00 77.98  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G 3  64  ? -35.502 -45.137 37.453 1.00 77.77  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G 3  64  ? -35.232 -46.332 38.376 1.00 78.73  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G 3  64  ? -36.268 -47.440 38.267 1.00 80.38  ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G 3  64  ? -36.901 -47.577 37.193 1.00 81.06  ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G 3  64  ? -36.438 -48.185 39.263 1.00 80.99  ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G 3  65  ? -36.221 -43.430 39.871 1.00 78.26  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G 3  65  ? -36.276 -43.281 41.324 1.00 78.49  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G 3  65  ? -37.481 -42.480 41.793 1.00 78.97  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G 3  65  ? -38.049 -42.774 42.842 1.00 79.11  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G 3  65  ? -34.977 -42.663 41.852 1.00 78.25  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G 3  65  ? -33.686 -43.443 41.597 1.00 77.64  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G 3  65  ? -32.497 -42.557 41.818 1.00 77.77  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G 3  65  ? -33.588 -44.673 42.478 1.00 77.60  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G 3  66  ? -37.864 -41.466 41.022 1.00 79.60  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G 3  66  ? -39.063 -40.693 41.321 1.00 80.31  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G 3  66  ? -40.308 -41.487 40.938 1.00 80.98  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G 3  66  ? -41.394 -41.251 41.469 1.00 80.91  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G 3  66  ? -39.034 -39.361 40.610 1.00 80.20  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G 3  67  ? -40.140 -42.425 40.006 1.00 81.86  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G 3  67  ? -41.190 -43.381 39.663 1.00 82.85  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G 3  67  ? -41.516 -44.232 40.876 1.00 83.52  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G 3  67  ? -42.681 -44.365 41.257 1.00 83.79  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G 3  68  ? -40.477 -44.798 41.486 1.00 84.00  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G 3  68  ? -40.611 -45.542 42.731 1.00 84.63  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G 3  68  ? -41.112 -44.658 43.863 1.00 84.83  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G 3  68  ? -41.915 -45.093 44.677 1.00 84.75  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G 3  68  ? -39.276 -46.180 43.125 1.00 84.86  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G 3  68  ? -38.706 -47.082 42.036 1.00 85.70  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G 3  68  ? -39.446 -47.633 41.211 1.00 86.50  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G 3  68  ? -37.379 -47.239 42.031 1.00 85.91  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G 3  69  ? -40.636 -43.415 43.899 1.00 85.31  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G 3  69  ? -41.033 -42.451 44.923 1.00 85.91  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G 3  69  ? -42.519 -42.111 44.844 1.00 86.32  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G 3  69  ? -43.151 -41.829 45.859 1.00 86.38  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G 3  69  ? -40.184 -41.184 44.829 1.00 85.84  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G 3  70  ? -43.069 -42.135 43.635 1.00 86.94  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G 3  70  ? -44.499 -41.950 43.443 1.00 87.45  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G 3  70  ? -45.241 -43.211 43.877 1.00 87.88  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G 3  70  ? -46.273 -43.122 44.541 1.00 88.15  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G 3  70  ? -44.804 -41.609 41.994 1.00 87.42  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G 3  71  ? -44.699 -44.375 43.514 1.00 88.23  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G 3  71  ? -45.279 -45.664 43.882 1.00 88.69  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G 3  71  ? -45.371 -45.808 45.405 1.00 88.82  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G 3  71  ? -46.438 -46.112 45.937 1.00 88.87  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G 3  71  ? -44.467 -46.809 43.267 1.00 88.87  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G 3  71  ? -45.151 -48.165 43.291 1.00 89.81  ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G 3  71  ? -44.162 -49.289 43.012 1.00 91.95  ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G 3  71  ? -44.678 -50.581 43.473 1.00 94.48  ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G 3  71  ? -43.933 -51.662 43.720 1.00 95.59  ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G 3  71  ? -42.613 -51.625 43.554 1.00 95.96  ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G 3  71  ? -44.509 -52.788 44.144 1.00 95.74  ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G 3  72  ? -44.261 -45.556 46.098 1.00 89.05  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G 3  72  ? -44.204 -45.632 47.561 1.00 89.18  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G 3  72  ? -45.306 -44.824 48.204 1.00 89.13  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G 3  72  ? -45.808 -45.194 49.258 1.00 89.35  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G 3  72  ? -42.871 -45.099 48.096 1.00 89.34  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G 3  72  ? -41.672 -45.853 47.563 1.00 89.87  ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G 3  72  ? -41.733 -47.098 47.452 1.00 91.03  ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G 3  72  ? -40.657 -45.187 47.262 1.00 89.99  ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G 3  73  ? -45.663 -43.711 47.571 1.00 89.13  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G 3  73  ? -46.672 -42.796 48.102 1.00 89.21  ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G 3  73  ? -48.055 -43.035 47.489 1.00 88.88  ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G 3  73  ? -48.894 -42.128 47.452 1.00 88.88  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G 3  73  ? -46.225 -41.336 47.917 1.00 89.44  ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G 3  73  ? -44.918 -41.016 48.652 1.00 90.28  ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G 3  73  ? -44.922 -40.312 49.663 1.00 91.62  ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G 3  73  ? -43.799 -41.534 48.144 1.00 90.41  ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G 3  74  ? -48.270 -44.267 47.016 1.00 88.39  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G 3  74  ? -49.538 -44.719 46.431 1.00 87.92  ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G 3  74  ? -49.976 -43.859 45.255 1.00 87.43  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G 3  74  ? -51.154 -43.537 45.136 1.00 87.52  ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G 3  74  ? -50.660 -44.745 47.485 1.00 88.07  ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G 3  74  ? -50.363 -45.516 48.772 1.00 88.62  ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G 3  74  ? -50.784 -46.981 48.675 1.00 89.02  ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G 3  74  ? -50.447 -47.730 49.954 1.00 88.53  ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G 3  74  ? -49.997 -49.116 49.660 1.00 88.10  ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G 3  75  ? -49.041 -43.479 44.389 1.00 86.86  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G 3  75  ? -49.373 -42.565 43.289 1.00 86.43  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G 3  75  ? -48.932 -43.024 41.895 1.00 85.97  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G 3  75  ? -48.200 -44.008 41.745 1.00 85.92  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G 3  75  ? -48.884 -41.150 43.594 1.00 86.47  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G 3  75  ? -49.724 -40.443 44.645 1.00 86.91  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G 3  75  ? -49.166 -39.076 44.947 1.00 87.80  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G 3  75  ? -50.217 -38.182 45.568 1.00 88.52  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G 3  75  ? -49.780 -36.753 45.515 1.00 89.20  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G 3  76  ? -49.408 -42.310 40.878 1.00 85.34  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G 3  76  ? -49.179 -42.698 39.485 1.00 84.66  ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G 3  76  ? -48.660 -41.529 38.640 1.00 83.91  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G 3  76  ? -48.208 -41.724 37.513 1.00 83.87  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G 3  76  ? -50.461 -43.296 38.825 1.00 84.84  ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G 3  76  ? -51.431 -42.261 38.610 1.00 85.01  ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G 3  76  ? -51.077 -44.410 39.684 1.00 84.75  ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G 3  77  ? -48.736 -40.321 39.193 1.00 82.91  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G 3  77  ? -48.237 -39.119 38.531 1.00 81.92  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G 3  77  ? -47.041 -38.569 39.305 1.00 80.97  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G 3  77  ? -47.126 -38.359 40.520 1.00 81.23  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G 3  77  ? -49.348 -38.064 38.468 1.00 82.15  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G 3  77  ? -49.042 -36.831 37.621 1.00 82.70  ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G 3  77  ? -50.272 -35.933 37.520 1.00 83.96  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G 3  77  ? -51.373 -36.574 36.793 1.00 84.77  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G 3  77  ? -52.637 -36.151 36.794 1.00 85.23  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G 3  77  ? -52.998 -35.074 37.482 1.00 85.07  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G 3  77  ? -53.548 -36.812 36.097 1.00 86.01  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G 3  78  ? -45.929 -38.344 38.616 1.00 79.38  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G 3  78  ? -44.788 -37.718 39.259 1.00 77.96  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G 3  78  ? -45.065 -36.227 39.437 1.00 77.48  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G 3  78  ? -45.271 -35.508 38.464 1.00 77.42  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G 3  78  ? -43.477 -37.969 38.484 1.00 77.81  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G 3  78  ? -43.006 -39.405 38.730 1.00 77.17  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G 3  78  ? -42.390 -36.945 38.876 1.00 77.00  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G 3  78  ? -42.141 -39.988 37.634 1.00 76.18  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G 3  79  ? -45.126 -35.792 40.695 1.00 76.66  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G 3  79  ? -45.095 -34.368 41.032 1.00 75.80  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G 3  79  ? -43.670 -33.977 41.476 1.00 75.28  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G 3  79  ? -42.827 -34.860 41.698 1.00 75.11  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G 3  79  ? -46.146 -33.972 42.116 1.00 75.66  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G 3  79  ? -46.065 -34.895 43.338 1.00 75.60  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G 3  79  ? -47.541 -33.923 41.518 1.00 75.44  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G 3  79  ? -46.591 -34.274 44.630 1.00 75.58  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G 3  80  ? -43.388 -32.659 41.581 1.00 74.60  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G 3  80  ? -42.089 -32.234 42.062 1.00 74.15  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G 3  80  ? -41.647 -32.941 43.341 1.00 73.70  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G 3  80  ? -40.493 -33.365 43.428 1.00 73.82  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G 3  80  ? -42.295 -30.745 42.302 1.00 74.13  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G 3  80  ? -43.202 -30.359 41.225 1.00 74.22  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G 3  80  ? -44.160 -31.509 41.076 1.00 74.59  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G 3  81  ? -42.541 -33.101 44.312 1.00 73.03  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G 3  81  ? -42.141 -33.770 45.543 1.00 72.39  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G 3  81  ? -41.415 -35.061 45.249 1.00 72.16  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G 3  81  ? -40.341 -35.292 45.787 1.00 72.33  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G 3  81  ? -43.317 -34.034 46.471 1.00 72.34  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G 3  81  ? -42.961 -34.893 47.682 1.00 71.65  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G 3  81  ? -41.916 -34.258 48.566 1.00 69.83  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G 3  81  ? -42.118 -34.659 49.949 1.00 70.27  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G 3  81  ? -41.386 -34.241 50.979 1.00 70.75  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G 3  81  ? -40.374 -33.401 50.797 1.00 70.16  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G 3  81  ? -41.672 -34.671 52.202 1.00 71.44  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G 3  82  ? -41.984 -35.888 44.381 1.00 71.97  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G 3  82  ? -41.378 -37.181 44.068 1.00 71.90  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G 3  82  ? -39.936 -37.047 43.569 1.00 71.57  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G 3  82  ? -39.044 -37.755 44.045 1.00 71.71  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G 3  82  ? -42.247 -37.986 43.098 1.00 71.96  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G 3  82  ? -43.626 -38.252 43.616 1.00 72.79  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G 3  82  ? -44.762 -37.996 42.878 1.00 73.28  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G 3  82  ? -44.052 -38.721 44.813 1.00 73.53  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G 3  82  ? -45.827 -38.310 43.593 1.00 73.70  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G 3  82  ? -45.425 -38.751 44.772 1.00 73.68  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G 3  83  ? -39.704 -36.119 42.643 1.00 71.02  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G 3  83  ? -38.356 -35.877 42.135 1.00 70.39  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G 3  83  ? -37.411 -35.459 43.251 1.00 70.06  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G 3  83  ? -36.239 -35.819 43.227 1.00 69.99  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G 3  83  ? -38.352 -34.823 41.023 1.00 70.38  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G 3  83  ? -39.094 -35.101 39.710 1.00 70.07  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G 3  83  ? -39.100 -33.842 38.869 1.00 69.67  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G 3  83  ? -38.498 -36.265 38.926 1.00 69.08  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G 3  84  ? -37.923 -34.707 44.226 1.00 69.70  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G 3  84  ? -37.122 -34.291 45.381 1.00 69.32  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G 3  84  ? -36.783 -35.463 46.310 1.00 69.31  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G 3  84  ? -35.635 -35.620 46.724 1.00 69.49  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G 3  84  ? -37.803 -33.159 46.151 1.00 69.10  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G 3  84  ? -37.103 -32.770 47.451 1.00 68.14  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G 3  84  ? -35.931 -31.823 47.262 1.00 66.87  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G 3  84  ? -35.274 -31.804 46.220 1.00 66.28  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G 3  84  ? -35.653 -31.041 48.291 1.00 66.41  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G 3  85  ? -37.767 -36.294 46.623 1.00 69.04  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G 3  85  ? -37.495 -37.515 47.367 1.00 68.95  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G 3  85  ? -36.447 -38.383 46.660 1.00 68.85  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G 3  85  ? -35.578 -38.962 47.305 1.00 68.73  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G 3  85  ? -38.786 -38.304 47.600 1.00 68.96  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G 3  85  ? -39.757 -37.719 48.631 1.00 69.21  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G 3  85  ? -41.139 -38.352 48.512 1.00 69.59  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G 3  85  ? -39.207 -37.878 50.049 1.00 70.01  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G 3  86  ? -36.527 -38.448 45.334 1.00 68.93  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G 3  86  ? -35.641 -39.288 44.525 1.00 68.99  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G 3  86  ? -34.195 -38.818 44.548 1.00 69.14  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G 3  86  ? -33.275 -39.629 44.635 1.00 69.22  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G 3  86  ? -36.138 -39.345 43.102 1.00 68.90  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G 3  87  ? -34.003 -37.505 44.468 1.00 69.26  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G 3  87  ? -32.674 -36.923 44.392 1.00 69.28  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G 3  87  ? -31.993 -36.918 45.754 1.00 69.42  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G 3  87  ? -30.890 -37.441 45.889 1.00 69.56  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G 3  87  ? -32.715 -35.504 43.777 1.00 69.29  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G 3  87  ? -31.398 -34.769 43.990 1.00 69.54  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G 3  87  ? -33.031 -35.589 42.293 1.00 69.08  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G 3  88  ? -32.660 -36.355 46.760 1.00 69.52  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G 3  88  ? -32.060 -36.184 48.084 1.00 69.65  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G 3  88  ? -31.864 -37.509 48.833 1.00 69.89  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G 3  88  ? -31.047 -37.594 49.751 1.00 69.91  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G 3  88  ? -32.874 -35.198 48.933 1.00 69.50  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G 3  88  ? -33.537 -34.053 48.157 1.00 69.48  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G 3  88  ? -32.741 -32.744 48.108 1.00 69.42  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G 3  88  ? -31.545 -32.820 47.267 1.00 69.79  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G 3  88  ? -31.167 -31.887 46.395 1.00 69.15  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G 3  88  ? -31.903 -30.799 46.202 1.00 68.81  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G 3  88  ? -30.057 -32.058 45.690 1.00 69.08  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G 3  89  ? -32.606 -38.540 48.439 1.00 70.27  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G 3  89  ? -32.454 -39.862 49.042 1.00 70.87  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G 3  89  ? -31.388 -40.717 48.378 1.00 71.55  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G 3  89  ? -31.058 -41.802 48.868 1.00 71.75  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G 3  89  ? -33.782 -40.610 49.072 1.00 70.56  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G 3  89  ? -34.607 -40.267 50.286 1.00 70.38  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G 3  89  ? -34.085 -40.144 51.395 1.00 69.23  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G 3  89  ? -35.910 -40.116 50.088 1.00 70.91  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G 3  90  ? -30.859 -40.233 47.259 1.00 72.26  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G 3  90  ? -29.784 -40.925 46.566 1.00 72.89  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G 3  90  ? -28.499 -40.126 46.688 1.00 72.95  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G 3  90  ? -28.433 -38.970 46.278 1.00 72.84  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G 3  90  ? -30.133 -41.163 45.098 1.00 73.11  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G 3  90  ? -29.044 -41.915 44.366 1.00 74.17  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G 3  90  ? -29.035 -43.163 44.442 1.00 75.81  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G 3  90  ? -28.190 -41.258 43.729 1.00 74.94  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G 3  91  ? -27.477 -40.767 47.242 1.00 73.27  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G 3  91  ? -26.220 -40.106 47.582 1.00 73.55  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G 3  91  ? -25.528 -39.433 46.395 1.00 73.23  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G 3  91  ? -24.956 -38.350 46.549 1.00 73.29  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G 3  91  ? -25.272 -41.102 48.249 1.00 73.83  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G 3  91  ? -24.121 -40.467 49.007 1.00 75.28  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G 3  91  ? -23.034 -41.470 49.325 1.00 77.59  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G 3  91  ? -22.348 -41.920 48.379 1.00 79.12  ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G 3  91  ? -22.867 -41.814 50.516 1.00 78.36  ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G 3  92  ? -25.586 -40.064 45.223 1.00 72.85  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G 3  92  ? -24.900 -39.529 44.045 1.00 72.45  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G 3  92  ? -25.688 -38.437 43.324 1.00 71.79  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G 3  92  ? -25.126 -37.399 42.971 1.00 71.55  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G 3  92  ? -24.458 -40.646 43.101 1.00 72.64  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G 3  92  ? -23.199 -41.350 43.597 1.00 73.89  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G 3  92  ? -22.651 -42.393 42.635 1.00 75.82  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G 3  92  ? -23.314 -42.708 41.618 1.00 76.94  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G 3  92  ? -21.544 -42.905 42.911 1.00 76.39  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G 3  93  ? -26.986 -38.667 43.131 1.00 71.15  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G 3  93  ? -27.879 -37.646 42.572 1.00 70.54  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G 3  93  ? -27.937 -36.398 43.443 1.00 70.20  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G 3  93  ? -27.997 -35.278 42.934 1.00 70.09  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G 3  93  ? -29.292 -38.190 42.372 1.00 70.33  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G 3  93  ? -29.549 -39.059 41.145 1.00 70.13  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G 3  93  ? -31.016 -39.427 41.103 1.00 69.63  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G 3  93  ? -29.120 -38.362 39.853 1.00 69.44  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G 3  94  ? -27.921 -36.605 44.757 1.00 69.76  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G 3  94  ? -27.918 -35.506 45.705 1.00 69.36  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G 3  94  ? -26.648 -34.664 45.621 1.00 69.02  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G 3  94  ? -26.693 -33.450 45.832 1.00 68.73  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G 3  94  ? -28.110 -36.019 47.129 1.00 69.39  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G 3  94  ? -27.948 -34.929 48.162 1.00 69.52  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G 3  94  ? -28.778 -34.022 48.260 1.00 69.43  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G 3  94  ? -26.866 -35.004 48.932 1.00 68.94  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G 3  95  ? -25.522 -35.307 45.318 1.00 68.65  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G 3  95  ? -24.265 -34.581 45.199 1.00 68.42  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G 3  95  ? -24.227 -33.790 43.905 1.00 68.04  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G 3  95  ? -23.731 -32.664 43.884 1.00 67.96  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G 3  95  ? -23.052 -35.506 45.287 1.00 68.56  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G 3  95  ? -21.747 -34.746 45.528 1.00 69.37  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G 3  95  ? -20.540 -35.506 45.003 1.00 71.36  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G 3  95  ? -19.419 -34.544 44.604 1.00 72.36  ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G 3  95  ? -18.391 -35.212 43.734 1.00 73.45  ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G 3  96  ? -24.754 -34.380 42.833 1.00 67.66  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G 3  96  ? -24.787 -33.720 41.535 1.00 67.21  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G 3  96  ? -25.674 -32.479 41.596 1.00 67.35  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G 3  96  ? -25.328 -31.421 41.064 1.00 67.55  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G 3  96  ? -25.278 -34.679 40.452 1.00 66.89  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G 3  96  ? -25.351 -34.103 39.037 1.00 66.26  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G 3  96  ? -23.971 -33.775 38.518 1.00 65.46  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G 3  96  ? -26.060 -35.063 38.108 1.00 65.92  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G 3  97  ? -26.813 -32.616 42.266 1.00 67.26  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G 3  97  ? -27.748 -31.515 42.432 1.00 67.06  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G 3  97  ? -27.582 -30.865 43.804 1.00 67.08  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G 3  97  ? -28.543 -30.371 44.389 1.00 67.17  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G 3  97  ? -29.185 -32.007 42.213 1.00 66.92  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G 3  97  ? -29.494 -32.648 40.853 1.00 66.61  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G 3  97  ? -30.940 -33.070 40.791 1.00 66.74  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G 3  97  ? -29.182 -31.713 39.693 1.00 66.29  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G 3  98  ? -26.348 -30.850 44.295 1.00 67.09  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G 3  98  ? -26.041 -30.363 45.634 1.00 67.43  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G 3  98  ? -26.263 -28.884 45.841 1.00 67.67  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G 3  98  ? -26.428 -28.427 46.972 1.00 67.68  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G 3  99  ? -26.266 -28.132 44.745 1.00 68.00  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G 3  99  ? -26.496 -26.690 44.801 1.00 68.22  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G 3  99  ? -27.665 -26.246 43.906 1.00 67.89  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G 3  99  ? -27.706 -25.111 43.422 1.00 67.71  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G 3  99  ? -25.202 -25.934 44.495 1.00 68.40  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G 3  99  ? -24.220 -25.964 45.647 1.00 70.06  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G 3  99  ? -22.831 -25.527 45.221 1.00 74.37  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G 3  99  ? -21.868 -25.676 46.318 1.00 77.80  ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G 3  99  ? -20.541 -25.711 46.177 1.00 79.36  ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G 3  99  ? -19.981 -25.606 44.972 1.00 79.69  ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G 3  99  ? -19.768 -25.859 47.253 1.00 80.05  ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G 3  100 ? -28.622 -27.154 43.726 1.00 67.66  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G 3  100 ? -29.835 -26.903 42.956 1.00 67.55  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G 3  100 ? -31.063 -27.017 43.851 1.00 67.73  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G 3  100 ? -31.146 -27.924 44.686 1.00 67.73  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G 3  100 ? -29.978 -27.924 41.806 1.00 67.42  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G 3  100 ? -31.384 -27.922 41.245 1.00 67.01  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G 3  100 ? -28.965 -27.649 40.714 1.00 67.27  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G 3  101 ? -32.018 -26.108 43.657 1.00 67.82  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G 3  101 ? -33.301 -26.159 44.357 1.00 68.04  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G 3  101 ? -34.421 -26.610 43.436 1.00 68.04  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G 3  101 ? -34.692 -25.968 42.431 1.00 67.90  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G 3  101 ? -33.663 -24.790 44.962 1.00 68.04  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G 3  101 ? -32.672 -24.435 45.931 1.00 68.86  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G 3  101 ? -35.023 -24.831 45.643 1.00 67.54  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G 3  102 ? -35.062 -27.721 43.786 1.00 68.44  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G 3  102 ? -36.251 -28.185 43.070 1.00 68.84  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G 3  102 ? -37.473 -27.446 43.616 1.00 69.37  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G 3  102 ? -37.841 -27.616 44.788 1.00 69.54  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G 3  102 ? -36.456 -29.720 43.205 1.00 68.66  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G 3  102 ? -35.329 -30.485 42.510 1.00 68.37  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G 3  102 ? -37.806 -30.142 42.634 1.00 68.37  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G 3  102 ? -35.341 -31.975 42.787 1.00 68.16  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G 3  103 ? -38.092 -26.616 42.779 1.00 69.78  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G 3  103 ? -39.261 -25.858 43.203 1.00 70.32  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G 3  103 ? -40.369 -26.810 43.635 1.00 70.90  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G 3  103 ? -40.586 -27.851 43.003 1.00 70.99  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G 3  103 ? -39.737 -24.950 42.102 1.00 70.25  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G 3  104 ? -41.044 -26.456 44.729 1.00 71.52  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G 3  104 ? -42.137 -27.257 45.292 1.00 72.07  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G 3  104 ? -41.736 -28.707 45.605 1.00 72.34  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G 3  104 ? -42.450 -29.654 45.257 1.00 72.40  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G 3  104 ? -43.368 -27.205 44.373 1.00 72.12  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G 3  104 ? -44.191 -25.932 44.511 1.00 72.58  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G 3  104 ? -45.026 -25.902 45.789 1.00 73.10  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G 3  104 ? -45.972 -26.678 45.948 1.00 72.56  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G 3  104 ? -44.679 -24.995 46.703 1.00 73.51  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G 3  105 ? -40.599 -28.868 46.276 1.00 72.64  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G 3  105 ? -40.054 -30.191 46.558 1.00 73.12  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G 3  105 ? -39.970 -30.534 48.029 1.00 73.56  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G 3  105 ? -39.793 -31.690 48.391 1.00 73.45  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G 3  106 ? -40.101 -29.525 48.880 1.00 74.29  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G 3  106 ? -39.997 -29.711 50.322 1.00 75.15  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G 3  106 ? -38.664 -30.286 50.748 1.00 75.83  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G 3  106 ? -37.659 -30.128 50.052 1.00 75.79  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G 3  107 ? -38.665 -30.957 51.897 1.00 76.70  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G 3  107 ? -37.452 -31.544 52.474 1.00 77.38  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G 3  107 ? -37.707 -32.983 52.935 1.00 78.09  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G 3  107 ? -38.862 -33.401 53.070 1.00 78.23  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G 3  107 ? -36.930 -30.702 53.655 1.00 77.21  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G 3  107 ? -36.627 -29.281 53.210 1.00 77.09  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G 3  107 ? -37.928 -30.693 54.794 1.00 77.23  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G 3  108 ? -36.634 -33.737 53.167 1.00 78.96  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G 3  108 ? -36.755 -35.106 53.672 1.00 79.87  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G 3  108 ? -37.159 -35.107 55.141 1.00 80.87  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G 3  108 ? -36.617 -34.329 55.936 1.00 80.98  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G 3  108 ? -35.446 -35.877 53.514 1.00 79.59  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G 3  108 ? -34.788 -35.969 52.141 1.00 79.20  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G 3  108 ? -33.554 -36.845 52.254 1.00 78.94  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G 3  108 ? -35.749 -36.509 51.085 1.00 78.67  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G 3  109 ? -38.118 -35.973 55.511 1.00 81.74  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G 3  109 ? -38.477 -36.091 56.914 1.00 82.46  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G 3  109 ? -37.255 -36.452 57.746 1.00 83.19  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G 3  109 ? -36.716 -37.554 57.602 1.00 83.38  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G 3  109 ? -39.491 -37.232 56.910 1.00 82.42  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G 3  109 ? -40.131 -37.122 55.583 1.00 82.11  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G 3  109 ? -39.002 -36.785 54.659 1.00 81.79  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G 3  110 ? -36.815 -35.500 58.572 1.00 83.91  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G 3  110 ? -35.688 -35.688 59.482 1.00 84.73  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G 3  110 ? -35.775 -34.781 60.705 1.00 85.26  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G 3  110 ? -35.918 -33.565 60.578 1.00 85.10  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G 3  110 ? -34.357 -35.458 58.756 1.00 84.80  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G 3  110 ? -33.152 -35.957 59.550 1.00 85.14  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G 3  110 ? -33.269 -36.836 60.414 1.00 85.18  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G 3  110 ? -31.980 -35.402 59.246 1.00 85.25  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G 3  111 ? -35.697 -35.395 61.884 1.00 86.24  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G 3  111 ? -35.643 -34.688 63.167 1.00 87.13  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G 3  111 ? -34.395 -35.143 63.920 1.00 87.98  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G 3  111 ? -34.149 -36.347 64.043 1.00 88.11  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G 3  111 ? -36.894 -34.974 64.048 1.00 86.96  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G 3  111 ? -38.170 -34.450 63.377 1.00 86.74  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G 3  111 ? -36.736 -34.350 65.436 1.00 86.81  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G 3  111 ? -39.469 -34.971 63.973 1.00 85.78  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G 3  112 ? -33.618 -34.180 64.417 1.00 89.02  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G 3  112 ? -32.417 -34.461 65.216 1.00 89.99  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G 3  112 ? -32.757 -35.218 66.499 1.00 90.64  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G 3  112 ? -33.615 -34.783 67.265 1.00 90.73  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G 3  112 ? -31.677 -33.160 65.549 1.00 90.00  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G 3  112 ? -31.000 -32.499 64.359 1.00 89.64  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G 3  112 ? -29.955 -33.388 63.733 1.00 89.58  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G 3  112 ? -29.152 -34.006 64.429 1.00 89.85  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G 3  112 ? -29.963 -33.467 62.412 1.00 89.93  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G 3  113 ? -32.074 -36.339 66.731 1.00 91.53  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G 3  113 ? -32.467 -37.292 67.779 1.00 92.52  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G 3  113 ? -32.344 -36.775 69.221 1.00 93.12  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G 3  113 ? -32.816 -37.416 70.160 1.00 93.12  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G 3  113 ? -31.713 -38.615 67.617 1.00 92.52  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G 3  113 ? -30.416 -38.534 68.178 1.00 92.84  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G 3  114 ? -31.715 -35.615 69.382 1.00 94.00  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G 3  114 ? -31.608 -34.959 70.683 1.00 94.83  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G 3  114 ? -32.809 -34.034 70.931 1.00 95.45  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G 3  114 ? -32.911 -33.398 71.980 1.00 95.63  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G 3  114 ? -30.269 -34.183 70.807 1.00 94.79  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3  114 ? -30.275 -32.945 69.921 1.00 95.03  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3  114 ? -29.974 -33.817 72.260 1.00 94.82  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3  115 ? -33.710 -33.965 69.955 1.00 96.25  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G 3  115 ? -34.931 -33.170 70.073 1.00 97.05  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G 3  115 ? -36.154 -34.061 70.327 1.00 97.77  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G 3  115 ? -37.252 -33.568 70.606 1.00 97.67  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G 3  115 ? -35.142 -32.319 68.815 1.00 96.95  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3  115 ? -34.079 -31.298 68.394 1.00 96.84  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3  115 ? -34.290 -30.890 66.945 1.00 96.78  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3  115 ? -34.088 -30.073 69.292 1.00 96.82  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G 3  116 ? -35.951 -35.373 70.226 1.00 98.79  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G 3  116 ? -37.010 -36.352 70.455 1.00 99.81  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G 3  116 ? -37.410 -36.408 71.931 1.00 100.76 ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G 3  116 ? -36.547 -36.299 72.809 1.00 100.76 ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G 3  116 ? -36.575 -37.741 69.973 1.00 99.62  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G 3  116 ? -36.372 -37.947 68.469 1.00 99.42  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G 3  116 ? -35.778 -39.329 68.199 1.00 99.42  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G 3  116 ? -37.681 -37.753 67.702 1.00 98.75  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G 3  117 ? -38.722 -36.577 72.208 1.00 101.75 ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G 3  117 ? -39.195 -36.652 73.590 1.00 102.44 ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G 3  117 ? -38.666 -37.912 74.267 1.00 103.18 ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G 3  117 ? -38.631 -38.986 73.648 1.00 103.31 ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G 3  117 ? -40.719 -36.705 73.443 1.00 102.46 ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G 3  117 ? -40.959 -37.253 72.080 1.00 102.16 ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G 3  117 ? -39.817 -36.775 71.237 1.00 101.84 ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G 3  118 ? -38.243 -37.766 75.521 1.00 103.93 ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G 3  118 ? -37.580 -38.850 76.248 1.00 104.70 ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G 3  118 ? -38.560 -39.952 76.679 1.00 105.01 ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G 3  118 ? -39.628 -39.672 77.229 1.00 105.24 ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G 3  118 ? -36.760 -38.286 77.415 1.00 104.75 ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G 3  118 ? -35.526 -37.523 76.929 1.00 105.30 ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G 3  118 ? -34.973 -36.557 77.961 1.00 106.25 ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G 3  118 ? -33.810 -35.762 77.374 1.00 106.56 ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G 3  118 ? -33.382 -34.640 78.257 1.00 107.20 ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G 3  119 ? -38.186 -41.200 76.403 1.00 105.28 ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G 3  119 ? -39.091 -42.346 76.531 1.00 105.43 ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G 3  119 ? -38.935 -43.076 77.863 1.00 105.33 ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G 3  119 ? -39.727 -42.882 78.785 1.00 105.19 ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G 3  119 ? -38.871 -43.317 75.367 1.00 105.56 ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G 3  119 ? -38.871 -42.648 73.988 1.00 106.11 ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G 3  119 ? -38.408 -43.599 72.886 1.00 107.06 ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G 3  119 ? -39.546 -44.486 72.393 1.00 107.18 ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G 3  119 ? -39.112 -45.378 71.286 1.00 107.35 ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H 4  31  ? -46.527 -17.208 20.148 1.00 102.89 ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H 4  31  ? -46.424 -17.610 18.712 1.00 102.85 ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H 4  31  ? -45.078 -18.266 18.401 1.00 102.63 ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H 4  31  ? -45.042 -19.345 17.800 1.00 102.60 ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H 4  31  ? -46.671 -16.409 17.787 1.00 102.89 ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H 4  31  ? -46.600 -16.728 16.292 1.00 103.24 ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H 4  31  ? -46.765 -15.478 15.433 1.00 103.94 ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H 4  31  ? -48.219 -14.996 15.384 1.00 104.42 ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H 4  31  ? -48.359 -13.658 14.730 1.00 104.26 ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H 4  32  ? -43.986 -17.615 18.811 1.00 102.35 ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H 4  32  ? -42.638 -18.121 18.538 1.00 102.24 ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H 4  32  ? -42.403 -19.476 19.212 1.00 102.16 ? 29   THR H C     1 
ATOM   5354  O  O     . THR H 4  32  ? -42.924 -19.743 20.300 1.00 102.05 ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H 4  32  ? -41.517 -17.094 18.906 1.00 102.22 ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H 4  32  ? -40.406 -17.247 18.013 1.00 101.91 ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H 4  32  ? -41.031 -17.272 20.342 1.00 102.35 ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H 4  33  ? -41.634 -20.325 18.536 1.00 102.08 ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H 4  33  ? -41.340 -21.675 19.009 1.00 102.02 ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H 4  33  ? -40.582 -21.666 20.329 1.00 101.68 ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H 4  33  ? -39.591 -20.945 20.487 1.00 101.86 ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H 4  33  ? -40.537 -22.449 17.961 1.00 102.18 ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H 4  33  ? -41.388 -23.165 16.925 1.00 102.99 ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H 4  33  ? -40.540 -23.680 15.774 1.00 104.39 ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H 4  33  ? -39.520 -24.639 16.202 1.00 105.35 ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H 4  33  ? -39.667 -25.962 16.183 1.00 106.05 ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H 4  33  ? -40.803 -26.513 15.759 1.00 106.05 ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H 4  33  ? -38.670 -26.737 16.592 1.00 106.34 ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H 4  34  ? -41.063 -22.461 21.279 1.00 101.10 ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H 4  34  ? -40.361 -22.643 22.538 1.00 100.31 ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H 4  34  ? -40.058 -24.126 22.715 1.00 99.68  ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H 4  34  ? -40.917 -24.915 23.123 1.00 99.60  ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H 4  34  ? -41.167 -22.073 23.710 1.00 100.39 ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H 4  34  ? -40.374 -21.112 24.601 1.00 100.65 ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H 4  34  ? -39.295 -21.819 25.434 1.00 100.72 ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H 4  34  ? -38.426 -20.821 26.207 1.00 100.49 ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H 4  34  ? -37.504 -20.030 25.334 1.00 99.30  ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H 4  35  ? -38.827 -24.491 22.370 1.00 98.88  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H 4  35  ? -38.358 -25.866 22.462 1.00 98.10  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H 4  35  ? -38.210 -26.338 23.902 1.00 97.38  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H 4  35  ? -38.055 -25.540 24.830 1.00 97.46  ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H 4  35  ? -37.035 -26.031 21.720 1.00 98.18  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H 4  35  ? -37.182 -26.131 20.215 1.00 99.05  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H 4  35  ? -35.878 -26.493 19.525 1.00 100.49 ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H 4  35  ? -35.929 -27.130 18.449 1.00 101.07 ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H 4  35  ? -34.801 -26.142 20.059 1.00 100.82 ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H 4  36  ? -38.257 -27.652 24.069 1.00 96.38  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H 4  36  ? -38.214 -28.285 25.371 1.00 95.34  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H 4  36  ? -37.623 -29.672 25.172 1.00 94.63  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H 4  36  ? -37.431 -30.098 24.034 1.00 94.71  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H 4  36  ? -39.633 -28.383 25.934 1.00 95.34  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H 4  36  ? -39.675 -29.205 27.084 1.00 95.39  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H 4  37  ? -37.315 -30.368 26.261 1.00 93.67  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H 4  37  ? -36.939 -31.778 26.164 1.00 92.78  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H 4  37  ? -38.131 -32.681 26.483 1.00 92.36  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H 4  37  ? -38.017 -33.909 26.423 1.00 92.21  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H 4  37  ? -35.749 -32.100 27.070 1.00 92.61  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H 4  37  ? -34.419 -31.605 26.544 1.00 92.08  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H 4  37  ? -33.877 -30.404 26.989 1.00 91.74  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H 4  37  ? -33.701 -32.339 25.602 1.00 91.47  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H 4  37  ? -32.654 -29.947 26.513 1.00 91.48  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H 4  37  ? -32.478 -31.889 25.116 1.00 91.00  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H 4  37  ? -31.962 -30.693 25.578 1.00 91.15  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H 4  37  ? -30.753 -30.236 25.109 1.00 91.31  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H 4  38  ? -39.274 -32.050 26.768 1.00 91.83  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H 4  38  ? -40.463 -32.698 27.339 1.00 91.37  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H 4  38  ? -40.925 -33.999 26.682 1.00 91.20  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H 4  38  ? -41.177 -34.980 27.384 1.00 91.17  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H 4  38  ? -41.619 -31.707 27.427 1.00 91.29  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H 4  39  ? -41.047 -34.018 25.356 1.00 91.01  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H 4  39  ? -41.494 -35.234 24.667 1.00 90.92  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H 4  39  ? -40.474 -36.374 24.773 1.00 91.00  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H 4  39  ? -40.845 -37.550 24.827 1.00 91.14  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H 4  39  ? -41.878 -34.996 23.184 1.00 90.85  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H 4  39  ? -40.807 -34.173 22.455 1.00 90.65  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H 4  39  ? -43.260 -34.353 23.092 1.00 90.99  ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H 4  39  ? -40.796 -34.381 20.950 1.00 90.08  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H 4  40  ? -39.196 -36.013 24.817 1.00 90.87  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H 4  40  ? -38.125 -36.985 24.941 1.00 90.77  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H 4  40  ? -37.965 -37.438 26.382 1.00 90.58  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H 4  40  ? -37.627 -38.592 26.634 1.00 90.63  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H 4  40  ? -36.822 -36.395 24.432 1.00 90.98  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H 4  40  ? -36.960 -35.708 23.101 1.00 91.81  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H 4  40  ? -36.922 -34.317 23.005 1.00 92.38  ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H 4  40  ? -37.139 -36.447 21.935 1.00 92.80  ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H 4  40  ? -37.047 -33.681 21.778 1.00 92.71  ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H 4  40  ? -37.261 -35.823 20.706 1.00 93.33  ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H 4  40  ? -37.215 -34.443 20.635 1.00 93.20  ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H 4  40  ? -37.340 -33.832 19.414 1.00 94.17  ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H 4  41  ? -38.195 -36.530 27.328 1.00 90.29  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H 4  41  ? -38.248 -36.911 28.734 1.00 90.02  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H 4  41  ? -39.409 -37.877 28.898 1.00 90.06  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H 4  41  ? -39.249 -38.925 29.517 1.00 90.16  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H 4  41  ? -38.431 -35.703 29.693 1.00 89.99  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H 4  41  ? -38.645 -36.179 31.119 1.00 89.82  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H 4  41  ? -37.233 -34.770 29.640 1.00 89.86  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H 4  42  ? -40.562 -37.530 28.318 1.00 90.06  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H 4  42  ? -41.771 -38.345 28.447 1.00 90.20  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H 4  42  ? -41.599 -39.735 27.845 1.00 90.11  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H 4  42  ? -42.009 -40.725 28.452 1.00 90.27  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H 4  42  ? -43.000 -37.648 27.847 1.00 90.31  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H 4  42  ? -44.325 -38.256 28.287 1.00 90.97  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H 4  42  ? -44.961 -37.817 29.451 1.00 91.46  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H 4  42  ? -44.940 -39.269 27.538 1.00 91.54  ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H 4  42  ? -46.170 -38.367 29.865 1.00 92.29  ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H 4  42  ? -46.153 -39.828 27.939 1.00 92.13  ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H 4  42  ? -46.764 -39.370 29.105 1.00 93.02  ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H 4  42  ? -47.967 -39.912 29.519 1.00 93.90  ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H 4  43  ? -40.992 -39.811 26.663 1.00 89.91  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H 4  43  ? -40.711 -41.099 26.038 1.00 89.87  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H 4  43  ? -39.938 -41.996 27.000 1.00 89.87  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H 4  43  ? -40.335 -43.138 27.248 1.00 89.94  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H 4  43  ? -39.928 -40.920 24.739 1.00 89.79  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H 4  43  ? -40.773 -40.520 23.553 1.00 89.88  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H 4  43  ? -39.890 -40.141 22.385 1.00 90.30  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H 4  43  ? -40.701 -39.872 21.131 1.00 90.42  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H 4  43  ? -39.806 -39.476 20.012 1.00 90.34  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H 4  44  ? -38.851 -41.451 27.548 1.00 89.90  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H 4  44  ? -37.969 -42.151 28.491 1.00 89.83  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H 4  44  ? -38.722 -42.583 29.755 1.00 90.00  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H 4  44  ? -38.451 -43.646 30.314 1.00 89.75  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H 4  44  ? -36.729 -41.281 28.857 1.00 89.66  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H 4  44  ? -35.865 -41.961 29.891 1.00 89.46  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H 4  44  ? -35.898 -40.986 27.628 1.00 89.38  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H 4  45  ? -39.673 -41.759 30.190 1.00 90.39  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H 4  45  ? -40.505 -42.090 31.334 1.00 90.94  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H 4  45  ? -41.288 -43.364 31.057 1.00 91.48  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H 4  45  ? -41.340 -44.261 31.899 1.00 91.73  ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H 4  45  ? -41.455 -40.943 31.674 1.00 90.76  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H 4  45  ? -42.497 -41.201 32.770 1.00 91.03  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H 4  45  ? -41.870 -41.613 34.105 1.00 90.30  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H 4  45  ? -43.379 -39.976 32.952 1.00 91.97  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H 4  46  ? -41.876 -43.441 29.865 1.00 92.05  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H 4  46  ? -42.688 -44.589 29.467 1.00 92.41  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H 4  46  ? -41.895 -45.891 29.357 1.00 92.72  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H 4  46  ? -42.411 -46.960 29.683 1.00 92.87  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H 4  46  ? -43.462 -44.284 28.183 1.00 92.30  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H 4  46  ? -44.594 -43.296 28.410 1.00 92.34  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H 4  46  ? -45.513 -43.799 29.514 1.00 92.66  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H 4  46  ? -46.182 -42.661 30.253 1.00 93.06  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H 4  46  ? -47.109 -43.161 31.308 1.00 92.93  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H 4  47  ? -40.642 -45.794 28.916 1.00 93.00  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H 4  47  ? -39.734 -46.941 28.906 1.00 93.33  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H 4  47  ? -39.430 -47.427 30.321 1.00 93.27  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H 4  47  ? -39.377 -48.629 30.577 1.00 93.40  ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H 4  47  ? -38.425 -46.583 28.211 1.00 93.43  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H 4  47  ? -38.542 -46.419 26.713 1.00 94.69  ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H 4  47  ? -37.213 -46.631 26.009 1.00 96.29  ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H 4  47  ? -36.363 -45.732 25.962 1.00 96.80  ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H 4  47  ? -37.026 -47.829 25.455 1.00 96.49  ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H 4  48  ? -39.247 -46.475 31.232 1.00 93.23  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H 4  48  ? -38.808 -46.750 32.600 1.00 92.96  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H 4  48  ? -39.969 -47.075 33.548 1.00 92.92  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H 4  48  ? -39.844 -47.941 34.410 1.00 92.81  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H 4  48  ? -37.879 -45.599 33.119 1.00 92.87  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H 4  48  ? -38.439 -44.899 34.346 1.00 92.65  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H 4  48  ? -36.458 -46.110 33.349 1.00 92.54  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H 4  49  ? -41.093 -46.388 33.364 1.00 93.02  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H 4  49  ? -42.305 -46.617 34.146 1.00 93.21  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H 4  49  ? -43.524 -46.414 33.235 1.00 93.17  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H 4  49  ? -44.120 -45.331 33.235 1.00 93.19  ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H 4  49  ? -42.367 -45.660 35.349 1.00 93.38  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H 4  49  ? -41.591 -46.122 36.548 1.00 93.90  ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H 4  49  ? -42.189 -46.711 37.642 1.00 94.19  ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H 4  49  ? -40.267 -46.063 36.833 1.00 94.16  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H 4  49  ? -41.266 -47.008 38.540 1.00 94.24  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H 4  49  ? -40.091 -46.627 38.073 1.00 94.04  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H 4  50  ? -43.901 -47.453 32.454 1.00 93.09  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H 4  50  ? -44.940 -47.315 31.425 1.00 92.94  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H 4  50  ? -46.283 -46.819 31.959 1.00 92.81  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H 4  50  ? -46.980 -46.073 31.268 1.00 92.88  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H 4  50  ? -45.083 -48.737 30.868 1.00 92.87  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H 4  50  ? -43.823 -49.416 31.214 1.00 92.98  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H 4  50  ? -43.398 -48.837 32.525 1.00 93.12  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H 4  51  ? -46.632 -47.221 33.179 1.00 92.52  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H 4  51  ? -47.920 -46.859 33.762 1.00 92.32  ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H 4  51  ? -47.865 -45.607 34.650 1.00 91.81  ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H 4  51  ? -48.873 -45.236 35.258 1.00 91.80  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H 4  51  ? -48.521 -48.053 34.523 1.00 92.65  ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H 4  51  ? -48.843 -49.238 33.606 1.00 93.59  ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H 4  51  ? -49.602 -49.057 32.623 1.00 94.34  ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H 4  51  ? -48.345 -50.356 33.880 1.00 94.46  ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H 4  52  ? -46.702 -44.955 34.710 1.00 91.15  ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H 4  52  ? -46.532 -43.732 35.514 1.00 90.57  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H 4  52  ? -46.501 -42.468 34.657 1.00 89.95  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H 4  52  ? -45.862 -42.436 33.604 1.00 90.12  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H 4  52  ? -45.248 -43.769 36.375 1.00 90.66  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H 4  52  ? -45.204 -44.978 37.140 1.00 91.16  ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H 4  52  ? -45.193 -42.584 37.329 1.00 90.63  ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H 4  53  ? -47.192 -41.431 35.125 1.00 89.12  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H 4  53  ? -47.219 -40.138 34.450 1.00 87.99  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H 4  53  ? -46.365 -39.108 35.163 1.00 87.17  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H 4  53  ? -45.622 -39.436 36.086 1.00 87.28  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H 4  54  ? -46.481 -37.859 34.730 1.00 86.23  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H 4  54  ? -45.686 -36.764 35.266 1.00 85.17  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H 4  54  ? -46.534 -35.501 35.268 1.00 84.65  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H 4  54  ? -47.203 -35.201 34.282 1.00 84.74  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H 4  54  ? -44.373 -36.566 34.439 1.00 85.13  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H 4  54  ? -43.481 -35.472 35.043 1.00 84.42  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H 4  54  ? -44.688 -36.296 32.961 1.00 85.28  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H 4  54  ? -42.010 -35.630 34.726 1.00 82.73  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H 4  55  ? -46.524 -34.778 36.381 1.00 83.99  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H 4  55  ? -47.209 -33.493 36.460 1.00 83.44  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H 4  55  ? -46.467 -32.467 35.618 1.00 82.98  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H 4  55  ? -45.283 -32.628 35.336 1.00 82.82  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H 4  55  ? -47.310 -33.013 37.911 1.00 83.57  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H 4  55  ? -46.107 -32.396 38.344 1.00 83.47  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H 4  56  ? -47.170 -31.414 35.222 1.00 82.59  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H 4  56  ? -46.586 -30.365 34.403 1.00 82.42  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H 4  56  ? -45.344 -29.789 35.061 1.00 82.16  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H 4  56  ? -44.292 -29.665 34.426 1.00 82.09  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H 4  56  ? -47.599 -29.249 34.172 1.00 82.45  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H 4  56  ? -47.280 -28.532 32.986 1.00 83.08  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H 4  57  ? -45.481 -29.450 36.340 1.00 81.81  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H 4  57  ? -44.408 -28.828 37.102 1.00 81.40  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H 4  57  ? -43.171 -29.725 37.217 1.00 80.89  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H 4  57  ? -42.040 -29.251 37.076 1.00 80.90  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H 4  57  ? -44.925 -28.379 38.471 1.00 81.56  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H 4  57  ? -45.749 -27.100 38.405 1.00 82.10  ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H 4  57  ? -46.344 -26.725 39.753 1.00 83.23  ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H 4  57  ? -46.885 -25.305 39.711 1.00 83.91  ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H 4  57  ? -47.988 -25.088 40.691 1.00 84.72  ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H 4  58  ? -43.394 -31.019 37.439 1.00 80.16  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H 4  58  ? -42.313 -32.001 37.483 1.00 79.42  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H 4  58  ? -41.574 -32.131 36.146 1.00 78.97  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H 4  58  ? -40.371 -32.364 36.121 1.00 78.84  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H 4  58  ? -42.843 -33.344 37.933 1.00 79.41  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H 4  59  ? -42.298 -31.977 35.041 1.00 78.59  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H 4  59  ? -41.704 -31.977 33.702 1.00 78.14  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H 4  59  ? -40.871 -30.718 33.461 1.00 78.08  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H 4  59  ? -39.835 -30.758 32.784 1.00 77.87  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H 4  59  ? -42.803 -32.089 32.643 1.00 78.07  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H 4  59  ? -42.310 -32.086 31.203 1.00 77.61  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H 4  59  ? -41.131 -33.394 30.821 1.00 76.98  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H 4  59  ? -42.158 -34.855 30.954 1.00 76.09  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H 4  60  ? -41.341 -29.602 34.019 1.00 77.95  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H 4  60  ? -40.640 -28.328 33.935 1.00 77.70  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H 4  60  ? -39.346 -28.352 34.750 1.00 77.53  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H 4  60  ? -38.409 -27.613 34.440 1.00 77.77  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H 4  60  ? -41.548 -27.187 34.396 1.00 77.75  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H 4  60  ? -40.852 -25.950 34.429 1.00 78.09  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H 4  61  ? -39.307 -29.193 35.789 1.00 77.10  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H 4  61  ? -38.087 -29.441 36.575 1.00 76.65  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H 4  61  ? -37.165 -30.413 35.846 1.00 76.59  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H 4  61  ? -35.949 -30.232 35.815 1.00 76.55  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H 4  61  ? -38.413 -29.987 37.979 1.00 76.50  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H 4  61  ? -39.044 -28.884 38.824 1.00 76.46  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H 4  61  ? -37.158 -30.538 38.668 1.00 76.03  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H 4  61  ? -40.024 -29.381 39.841 1.00 76.86  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H 4  62  ? -37.759 -31.445 35.261 1.00 76.57  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H 4  62  ? -37.022 -32.395 34.458 1.00 76.41  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H 4  62  ? -36.316 -31.681 33.327 1.00 76.44  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H 4  62  ? -35.132 -31.914 33.094 1.00 76.68  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H 4  62  ? -37.950 -33.472 33.906 1.00 76.40  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H 4  62  ? -38.282 -34.559 34.896 1.00 76.34  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H 4  62  ? -36.809 -35.161 35.727 1.00 77.24  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H 4  62  ? -35.994 -36.052 34.414 1.00 76.78  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H 4  63  ? -37.035 -30.801 32.637 1.00 76.27  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H 4  63  ? -36.452 -30.085 31.517 1.00 76.25  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H 4  63  ? -35.297 -29.198 31.965 1.00 76.20  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H 4  63  ? -34.218 -29.225 31.365 1.00 76.11  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H 4  63  ? -37.504 -29.261 30.781 1.00 76.35  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H 4  63  ? -37.003 -28.753 29.446 1.00 76.50  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H 4  63  ? -36.411 -29.508 28.671 1.00 76.82  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H 4  63  ? -37.228 -27.469 29.170 1.00 75.96  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H 4  64  ? -35.533 -28.432 33.031 1.00 76.14  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H 4  64  ? -34.509 -27.581 33.642 1.00 76.06  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H 4  64  ? -33.239 -28.374 33.911 1.00 75.88  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H 4  64  ? -32.141 -27.920 33.594 1.00 75.99  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H 4  64  ? -35.024 -26.966 34.946 1.00 75.97  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H 4  64  ? -36.152 -26.142 34.715 1.00 76.30  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H 4  65  ? -33.417 -29.563 34.480 1.00 75.64  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H 4  65  ? -32.329 -30.474 34.799 1.00 75.52  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H 4  65  ? -31.517 -30.866 33.572 1.00 75.63  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H 4  65  ? -30.285 -30.828 33.597 1.00 75.66  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H 4  65  ? -32.890 -31.720 35.484 1.00 75.50  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H 4  65  ? -31.929 -32.865 35.551 1.00 75.31  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H 4  65  ? -30.840 -32.824 36.409 1.00 75.24  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H 4  65  ? -32.122 -33.991 34.760 1.00 75.17  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H 4  65  ? -29.952 -33.883 36.470 1.00 75.42  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H 4  65  ? -31.242 -35.055 34.818 1.00 75.01  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H 4  65  ? -30.152 -35.000 35.671 1.00 75.17  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H 4  66  ? -32.211 -31.244 32.503 1.00 75.74  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H 4  66  ? -31.548 -31.650 31.269 1.00 75.73  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H 4  66  ? -30.720 -30.488 30.714 1.00 75.84  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H 4  66  ? -29.532 -30.650 30.432 1.00 75.93  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H 4  66  ? -32.548 -32.208 30.231 1.00 75.61  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H 4  66  ? -31.839 -32.571 28.947 1.00 75.65  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H 4  66  ? -33.253 -33.438 30.791 1.00 75.50  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H 4  67  ? -31.336 -29.313 30.601 1.00 75.93  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H 4  67  ? -30.616 -28.102 30.210 1.00 76.10  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H 4  67  ? -29.393 -27.827 31.082 1.00 76.02  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H 4  67  ? -28.329 -27.493 30.558 1.00 76.19  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H 4  67  ? -31.546 -26.888 30.226 1.00 76.30  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H 4  67  ? -32.524 -26.887 29.071 1.00 77.09  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H 4  67  ? -32.139 -27.058 27.910 1.00 78.27  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H 4  67  ? -33.798 -26.686 29.382 1.00 77.45  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H 4  68  ? -29.553 -27.973 32.400 1.00 75.77  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H 4  68  ? -28.483 -27.736 33.367 1.00 75.55  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H 4  68  ? -27.276 -28.599 33.044 1.00 75.60  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H 4  68  ? -26.189 -28.077 32.782 1.00 75.59  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H 4  68  ? -28.983 -28.016 34.789 1.00 75.54  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H 4  68  ? -27.918 -27.775 35.876 1.00 75.61  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H 4  68  ? -26.751 -27.431 35.579 1.00 75.99  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H 4  68  ? -28.266 -27.935 37.061 1.00 75.12  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H 4  69  ? -27.482 -29.914 33.046 1.00 75.66  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H 4  69  ? -26.409 -30.875 32.804 1.00 75.80  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H 4  69  ? -25.767 -30.669 31.437 1.00 75.80  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H 4  69  ? -24.545 -30.712 31.319 1.00 75.88  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H 4  69  ? -26.895 -32.335 32.959 1.00 75.93  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H 4  69  ? -25.786 -33.319 32.624 1.00 75.79  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H 4  69  ? -27.388 -32.581 34.377 1.00 76.39  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H 4  70  ? -26.581 -30.429 30.412 1.00 75.82  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H 4  70  ? -26.047 -30.117 29.089 1.00 75.96  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H 4  70  ? -25.074 -28.946 29.158 1.00 76.18  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H 4  70  ? -23.962 -29.028 28.635 1.00 76.05  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H 4  70  ? -27.163 -29.801 28.097 1.00 75.90  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H 4  70  ? -26.667 -29.440 26.722 1.00 75.70  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H 4  70  ? -26.662 -30.383 25.701 1.00 75.22  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H 4  70  ? -26.202 -28.154 26.449 1.00 75.64  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H 4  70  ? -26.210 -30.052 24.431 1.00 75.17  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H 4  70  ? -25.738 -27.815 25.186 1.00 75.55  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H 4  70  ? -25.745 -28.769 24.173 1.00 75.57  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H 4  71  ? -25.503 -27.864 29.809 1.00 76.57  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H 4  71  ? -24.693 -26.651 29.947 1.00 76.98  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H 4  71  ? -23.403 -26.895 30.728 1.00 76.87  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H 4  71  ? -22.371 -26.299 30.413 1.00 76.91  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H 4  71  ? -25.503 -25.512 30.580 1.00 77.15  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H 4  71  ? -26.495 -24.833 29.614 1.00 78.46  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H 4  71  ? -27.401 -23.782 30.281 1.00 80.10  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H 4  71  ? -27.502 -23.756 31.531 1.00 80.70  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H 4  71  ? -28.025 -22.982 29.544 1.00 80.27  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H 4  72  ? -23.466 -27.774 31.730 1.00 76.73  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H 4  72  ? -22.289 -28.115 32.536 1.00 76.65  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H 4  72  ? -21.267 -28.907 31.731 1.00 76.46  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H 4  72  ? -20.089 -28.544 31.690 1.00 76.36  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H 4  72  ? -22.669 -28.923 33.780 1.00 76.73  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H 4  72  ? -23.534 -28.219 34.800 1.00 77.15  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H 4  72  ? -23.473 -28.979 36.108 1.00 77.76  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H 4  72  ? -24.757 -29.009 36.803 1.00 78.27  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H 4  72  ? -24.939 -29.539 38.010 1.00 78.76  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H 4  72  ? -23.918 -30.078 38.672 1.00 78.72  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H 4  72  ? -26.143 -29.522 38.564 1.00 79.09  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H 4  73  ? -21.730 -29.990 31.104 1.00 76.30  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H 4  73  ? -20.866 -30.899 30.355 1.00 76.09  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H 4  73  ? -20.267 -30.220 29.130 1.00 76.28  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H 4  73  ? -19.076 -30.364 28.868 1.00 76.34  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H 4  73  ? -21.593 -32.194 29.959 1.00 75.90  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H 4  73  ? -22.074 -32.932 31.206 1.00 75.43  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H 4  73  ? -20.672 -33.097 29.159 1.00 75.95  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H 4  73  ? -22.800 -34.216 30.915 1.00 75.23  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H 4  74  ? -21.083 -29.474 28.391 1.00 76.54  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H 4  74  ? -20.575 -28.669 27.283 1.00 76.92  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H 4  74  ? -19.591 -27.615 27.785 1.00 77.26  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H 4  74  ? -18.567 -27.362 27.151 1.00 77.43  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H 4  74  ? -21.711 -28.017 26.523 1.00 76.95  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H 4  75  ? -19.903 -27.008 28.929 1.00 77.55  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H 4  75  ? -19.002 -26.054 29.575 1.00 77.87  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H 4  75  ? -17.616 -26.629 29.833 1.00 78.14  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H 4  75  ? -16.604 -26.007 29.490 1.00 78.20  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H 4  76  ? -17.571 -27.818 30.436 1.00 78.30  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H 4  76  ? -16.308 -28.501 30.718 1.00 78.36  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H 4  76  ? -15.616 -28.948 29.438 1.00 78.65  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H 4  76  ? -14.411 -28.732 29.269 1.00 78.73  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H 4  76  ? -16.519 -29.700 31.640 1.00 78.20  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H 4  76  ? -15.226 -30.246 32.213 1.00 77.95  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H 4  76  ? -14.491 -29.220 33.057 1.00 77.73  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H 4  76  ? -13.300 -28.960 32.787 1.00 76.73  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H 4  76  ? -15.113 -28.663 33.988 1.00 78.74  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H 4  77  ? -16.385 -29.568 28.543 1.00 78.91  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H 4  77  ? -15.876 -30.003 27.248 1.00 79.08  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H 4  77  ? -15.249 -28.825 26.520 1.00 79.30  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H 4  77  ? -14.188 -28.962 25.915 1.00 79.49  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H 4  77  ? -16.980 -30.621 26.419 1.00 78.93  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H 4  78  ? -15.902 -27.669 26.605 1.00 79.56  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H 4  78  ? -15.382 -26.436 26.043 1.00 80.05  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H 4  78  ? -14.014 -26.097 26.643 1.00 80.52  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H 4  78  ? -13.066 -25.805 25.909 1.00 80.62  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H 4  78  ? -16.380 -25.298 26.273 1.00 79.90  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H 4  78  ? -15.820 -24.034 25.962 1.00 80.51  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H 4  79  ? -13.918 -26.160 27.972 1.00 81.07  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H 4  79  ? -12.695 -25.800 28.692 1.00 81.62  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H 4  79  ? -11.531 -26.736 28.397 1.00 81.76  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H 4  79  ? -10.402 -26.282 28.210 1.00 81.71  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H 4  79  ? -12.942 -25.747 30.203 1.00 81.86  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H 4  79  ? -13.535 -24.444 30.692 1.00 82.64  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H 4  79  ? -13.818 -24.480 32.186 1.00 83.50  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H 4  79  ? -15.106 -23.847 32.455 1.00 84.77  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H 4  79  ? -16.229 -24.508 32.717 1.00 85.49  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H 4  79  ? -16.229 -25.834 32.783 1.00 85.81  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H 4  79  ? -17.356 -23.837 32.932 1.00 86.04  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H 4  80  ? -11.807 -28.037 28.366 1.00 82.04  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H 4  80  ? -10.787 -29.024 28.038 1.00 82.53  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H 4  80  ? -10.122 -28.677 26.714 1.00 83.13  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H 4  80  ? -8.895  -28.563 26.646 1.00 83.18  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H 4  80  ? -11.383 -30.432 27.988 1.00 82.36  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H 4  80  ? -11.620 -31.134 29.327 1.00 81.97  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H 4  80  ? -12.744 -32.157 29.214 1.00 81.42  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H 4  80  ? -10.339 -31.785 29.834 1.00 81.26  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H 4  81  ? -10.942 -28.480 25.680 1.00 83.93  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H 4  81  ? -10.468 -28.134 24.341 1.00 84.70  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H 4  81  ? -9.491  -26.963 24.363 1.00 85.48  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H 4  81  ? -8.381  -27.082 23.846 1.00 85.52  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H 4  81  ? -11.632 -27.845 23.427 1.00 84.58  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H 4  82  ? -9.898  -25.850 24.975 1.00 86.55  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H 4  82  ? -9.026  -24.680 25.164 1.00 87.81  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H 4  82  ? -7.672  -25.011 25.802 1.00 88.22  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H 4  82  ? -6.626  -24.640 25.260 1.00 88.32  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H 4  82  ? -9.722  -23.602 26.005 1.00 88.17  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H 4  82  ? -10.390 -22.533 25.196 1.00 89.66  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H 4  82  ? -9.693  -21.503 24.600 1.00 90.81  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H 4  82  ? -11.696 -22.327 24.897 1.00 90.73  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H 4  82  ? -10.540 -20.715 23.959 1.00 91.44  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H 4  82  ? -11.762 -21.192 24.125 1.00 91.30  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H 4  83  ? -7.701  -25.703 26.947 1.00 88.79  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H 4  83  ? -6.481  -26.035 27.702 1.00 89.34  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H 4  83  ? -5.499  -26.848 26.873 1.00 89.39  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H 4  83  ? -4.292  -26.812 27.114 1.00 89.52  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H 4  83  ? -6.791  -26.805 28.998 1.00 89.53  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H 4  83  ? -7.742  -26.117 29.959 1.00 90.35  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H 4  83  ? -7.867  -24.725 29.984 1.00 90.74  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H 4  83  ? -8.503  -26.864 30.862 1.00 90.97  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H 4  83  ? -8.734  -24.102 30.858 1.00 91.28  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H 4  83  ? -9.369  -26.247 31.751 1.00 91.41  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H 4  83  ? -9.478  -24.866 31.740 1.00 91.89  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H 4  83  ? -10.338 -24.234 32.606 1.00 93.26  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H 4  84  ? -6.026  -27.582 25.900 1.00 89.40  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H 4  84  ? -5.199  -28.396 25.029 1.00 89.39  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H 4  84  ? -5.015  -27.829 23.622 1.00 89.43  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H 4  84  ? -4.492  -28.515 22.737 1.00 89.62  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H 4  84  ? -5.754  -29.815 24.982 1.00 89.32  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H 4  84  ? -5.667  -30.502 26.319 1.00 89.05  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H 4  84  ? -4.643  -30.434 27.000 1.00 88.78  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H 4  84  ? -6.742  -31.162 26.710 1.00 89.12  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H 4  85  ? -5.429  -26.579 23.425 1.00 89.28  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H 4  85  ? -5.348  -25.928 22.118 1.00 89.22  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H 4  85  ? -5.912  -26.831 21.003 1.00 88.96  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H 4  85  ? -5.201  -27.230 20.075 1.00 88.76  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H 4  85  ? -3.907  -25.490 21.822 1.00 89.37  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H 4  85  ? -3.352  -24.464 22.807 1.00 89.89  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H 4  85  ? -1.825  -24.338 22.716 1.00 90.93  ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H 4  85  ? -1.091  -25.415 23.530 1.00 90.92  ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H 4  85  ? 0.388   -25.208 23.545 1.00 90.61  ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H 4  86  ? -7.193  -27.171 21.139 1.00 88.65  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H 4  86  ? -7.935  -27.930 20.138 1.00 88.41  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H 4  86  ? -9.189  -27.152 19.740 1.00 88.17  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H 4  86  ? -9.833  -26.521 20.581 1.00 88.20  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H 4  86  ? -8.329  -29.309 20.672 1.00 88.47  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H 4  86  ? -7.167  -30.186 21.117 1.00 89.12  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H 4  86  ? -6.565  -30.963 19.963 1.00 90.19  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H 4  86  ? -5.309  -31.616 20.338 1.00 91.45  ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H 4  86  ? -4.120  -31.014 20.369 1.00 92.04  ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H 4  86  ? -4.003  -29.728 20.059 1.00 92.57  ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H 4  86  ? -3.039  -31.698 20.718 1.00 92.11  ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H 4  87  ? -9.531  -27.194 18.456 1.00 87.79  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H 4  87  ? -10.665 -26.434 17.941 1.00 87.36  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H 4  87  ? -11.946 -27.267 17.911 1.00 87.00  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H 4  87  ? -13.035 -26.737 17.688 1.00 86.81  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H 4  87  ? -10.344 -25.874 16.552 1.00 87.47  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H 4  87  ? -9.194  -25.040 16.587 1.00 87.60  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H 4  88  ? -11.811 -28.568 18.152 1.00 86.71  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H 4  88  ? -12.961 -29.466 18.130 1.00 86.54  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H 4  88  ? -13.358 -29.981 19.518 1.00 86.32  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H 4  88  ? -12.506 -30.373 20.332 1.00 86.18  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H 4  88  ? -12.741 -30.692 17.205 1.00 86.64  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H 4  88  ? -11.760 -30.393 16.201 1.00 87.01  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H 4  88  ? -14.057 -31.111 16.548 1.00 86.42  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H 4  89  ? -14.666 -29.964 19.767 1.00 85.95  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H 4  89  ? -15.266 -30.677 20.881 1.00 85.60  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H 4  89  ? -15.692 -32.058 20.370 1.00 85.54  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H 4  89  ? -16.681 -32.198 19.643 1.00 85.43  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H 4  89  ? -16.455 -29.904 21.493 1.00 85.49  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H 4  89  ? -15.946 -28.654 22.208 1.00 85.25  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H 4  89  ? -17.230 -30.777 22.481 1.00 85.45  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H 4  89  ? -17.034 -27.717 22.638 1.00 84.98  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H 4  90  ? -14.907 -33.065 20.745 1.00 85.32  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H 4  90  ? -15.125 -34.440 20.322 1.00 85.00  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H 4  90  ? -15.787 -35.207 21.458 1.00 84.81  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H 4  90  ? -15.885 -34.697 22.571 1.00 84.91  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H 4  90  ? -13.791 -35.130 19.948 1.00 85.01  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H 4  90  ? -13.080 -35.482 21.138 1.00 85.08  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H 4  90  ? -12.913 -34.219 19.100 1.00 85.08  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H 4  91  ? -16.232 -36.431 21.179 1.00 84.59  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H 4  91  ? -16.847 -37.294 22.191 1.00 84.41  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H 4  91  ? -15.856 -37.666 23.301 1.00 84.28  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H 4  91  ? -16.256 -38.056 24.404 1.00 84.29  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H 4  91  ? -17.416 -38.555 21.543 1.00 84.40  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H 4  91  ? -16.375 -39.339 20.981 1.00 84.66  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H 4  92  ? -14.567 -37.549 22.996 1.00 83.95  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H 4  92  ? -13.522 -37.721 23.993 1.00 83.75  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H 4  92  ? -13.602 -36.609 25.041 1.00 83.26  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H 4  92  ? -13.512 -36.875 26.245 1.00 83.24  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H 4  92  ? -12.154 -37.724 23.320 1.00 84.02  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H 4  92  ? -11.014 -38.036 24.250 1.00 85.15  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H 4  92  ? -9.747  -38.257 23.469 1.00 87.44  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H 4  92  ? -8.651  -38.627 24.356 1.00 89.41  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H 4  92  ? -7.805  -37.760 24.902 1.00 90.35  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H 4  92  ? -7.920  -36.460 24.649 1.00 90.38  ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H 4  92  ? -6.840  -38.195 25.700 1.00 91.22  ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H 4  93  ? -13.770 -35.373 24.570 1.00 82.54  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H 4  93  ? -13.971 -34.224 25.445 1.00 81.83  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H 4  93  ? -15.195 -34.421 26.329 1.00 81.11  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H 4  93  ? -15.097 -34.275 27.546 1.00 81.20  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H 4  93  ? -14.090 -32.922 24.639 1.00 81.99  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H 4  93  ? -12.766 -32.183 24.403 1.00 82.47  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H 4  93  ? -11.808 -32.918 23.470 1.00 82.97  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H 4  93  ? -12.274 -33.551 22.498 1.00 83.17  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H 4  93  ? -10.580 -32.844 23.704 1.00 82.56  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H 4  94  ? -16.328 -34.774 25.719 1.00 80.17  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H 4  94  ? -17.590 -34.990 26.444 1.00 79.36  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H 4  94  ? -17.446 -36.041 27.537 1.00 79.01  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H 4  94  ? -18.060 -35.923 28.603 1.00 79.00  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H 4  94  ? -18.747 -35.399 25.495 1.00 79.23  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H 4  94  ? -19.124 -34.244 24.556 1.00 79.21  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H 4  94  ? -19.965 -35.878 26.280 1.00 78.78  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H 4  94  ? -19.854 -33.068 25.210 1.00 78.69  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H 4  95  ? -16.629 -37.058 27.265 1.00 78.44  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H 4  95  ? -16.375 -38.133 28.220 1.00 77.77  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H 4  95  ? -15.559 -37.655 29.427 1.00 77.43  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H 4  95  ? -15.969 -37.853 30.574 1.00 77.32  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H 4  95  ? -15.696 -39.318 27.533 1.00 77.65  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H 4  95  ? -15.355 -40.445 28.482 1.00 77.45  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H 4  95  ? -14.732 -41.622 27.787 1.00 77.35  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H 4  95  ? -13.521 -41.840 27.879 1.00 76.84  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H 4  95  ? -15.552 -42.391 27.078 1.00 77.37  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H 4  96  ? -14.414 -37.024 29.163 1.00 76.93  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H 4  96  ? -13.581 -36.458 30.223 1.00 76.47  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H 4  96  ? -14.375 -35.409 31.003 1.00 76.30  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H 4  96  ? -14.237 -35.298 32.221 1.00 76.43  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H 4  96  ? -12.276 -35.856 29.661 1.00 76.43  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H 4  96  ? -11.603 -36.837 28.867 1.00 76.27  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H 4  96  ? -11.350 -35.427 30.772 1.00 76.18  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H 4  97  ? -15.216 -34.659 30.294 1.00 75.99  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H 4  97  ? -16.158 -33.738 30.926 1.00 75.76  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H 4  97  ? -17.111 -34.469 31.884 1.00 75.56  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H 4  97  ? -17.323 -34.015 33.011 1.00 75.70  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H 4  97  ? -16.937 -32.953 29.873 1.00 75.63  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H 4  98  ? -17.668 -35.597 31.443 1.00 75.17  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H 4  98  ? -18.535 -36.419 32.294 1.00 74.89  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H 4  98  ? -17.796 -36.917 33.547 1.00 74.97  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H 4  98  ? -18.327 -36.842 34.664 1.00 74.76  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H 4  98  ? -19.184 -37.587 31.488 1.00 74.75  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H 4  98  ? -19.516 -38.782 32.367 1.00 74.36  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H 4  98  ? -20.433 -37.104 30.794 1.00 74.71  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H 4  99  ? -16.564 -37.390 33.358 1.00 75.04  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H 4  99  ? -15.762 -37.927 34.456 1.00 74.99  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H 4  99  ? -15.402 -36.871 35.502 1.00 74.94  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H 4  99  ? -15.220 -37.197 36.675 1.00 75.02  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H 4  99  ? -14.510 -38.630 33.925 1.00 74.91  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H 4  99  ? -14.745 -40.085 33.541 1.00 75.40  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H 4  99  ? -13.436 -40.843 33.313 1.00 76.65  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H 4  99  ? -13.665 -42.208 32.824 1.00 77.90  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H 4  99  ? -13.355 -42.651 31.602 1.00 78.59  ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H 4  99  ? -12.776 -41.850 30.706 1.00 78.67  ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H 4  99  ? -13.613 -43.913 31.275 1.00 78.49  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H 4  100 ? -15.324 -35.614 35.074 1.00 74.85  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H 4  100 ? -15.018 -34.496 35.966 1.00 74.86  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H 4  100 ? -16.232 -33.937 36.715 1.00 75.07  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H 4  100 ? -16.077 -33.299 37.757 1.00 74.96  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H 4  100 ? -14.342 -33.362 35.190 1.00 74.78  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H 4  100 ? -12.845 -33.451 34.894 1.00 74.28  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H 4  100 ? -12.453 -32.326 33.971 1.00 73.66  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H 4  100 ? -12.027 -33.397 36.170 1.00 73.46  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H 4  101 ? -17.430 -34.174 36.185 1.00 75.43  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H 4  101 ? -18.650 -33.606 36.760 1.00 75.85  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H 4  101 ? -19.471 -34.591 37.564 1.00 76.23  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H 4  101 ? -20.139 -34.202 38.517 1.00 76.37  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H 4  101 ? -19.543 -33.023 35.671 1.00 75.73  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H 4  101 ? -19.012 -31.806 34.934 1.00 76.14  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H 4  101 ? -19.812 -31.638 33.673 1.00 76.27  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H 4  101 ? -19.083 -30.556 35.805 1.00 76.99  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H 4  102 ? -19.446 -35.860 37.173 1.00 76.73  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H 4  102 ? -20.354 -36.836 37.774 1.00 77.15  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H 4  102 ? -19.686 -37.692 38.861 1.00 77.70  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H 4  102 ? -18.478 -37.945 38.808 1.00 77.64  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H 4  102 ? -21.040 -37.702 36.699 1.00 76.91  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H 4  102 ? -21.810 -37.032 35.551 1.00 76.07  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H 4  102 ? -22.584 -38.062 34.770 1.00 75.71  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H 4  102 ? -22.756 -35.970 36.037 1.00 75.42  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H 4  103 ? -20.473 -38.103 39.872 1.00 78.22  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H 4  103 ? -19.991 -38.957 40.946 1.00 78.82  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H 4  103 ? -19.823 -40.423 40.545 1.00 79.58  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H 4  103 ? -20.722 -41.014 39.944 1.00 79.52  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H 4  103 ? -21.088 -38.817 42.008 1.00 78.76  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H 4  103 ? -21.741 -37.524 41.703 1.00 78.15  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H 4  103 ? -21.773 -37.509 40.220 1.00 78.18  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H 4  104 ? -18.663 -40.983 40.891 1.00 80.42  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H 4  104 ? -18.339 -42.408 40.715 1.00 81.30  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H 4  104 ? -19.270 -43.250 39.867 1.00 81.82  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H 4  104 ? -19.155 -43.260 38.645 1.00 81.88  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H 4  105 ? -20.194 -43.953 40.523 1.00 82.47  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H 4  105 ? -21.120 -44.876 39.849 1.00 83.13  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H 4  105 ? -21.934 -44.190 38.760 1.00 83.35  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H 4  105 ? -22.214 -44.783 37.714 1.00 83.46  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H 4  105 ? -22.058 -45.566 40.854 1.00 83.11  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H 4  105 ? -21.387 -46.605 41.749 1.00 84.20  ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H 4  105 ? -20.757 -47.751 40.962 1.00 85.98  ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H 4  105 ? -21.498 -48.656 40.498 1.00 86.60  ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H 4  105 ? -19.512 -47.745 40.818 1.00 86.33  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H 4  106 ? -22.304 -42.938 39.012 1.00 83.65  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H 4  106 ? -23.058 -42.154 38.048 1.00 83.98  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H 4  106 ? -22.171 -41.800 36.859 1.00 84.33  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H 4  106 ? -22.618 -41.853 35.715 1.00 84.35  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H 4  106 ? -23.627 -40.899 38.710 1.00 83.83  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H 4  106 ? -25.059 -40.505 38.350 1.00 83.67  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H 4  106 ? -26.020 -41.687 38.472 1.00 83.57  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H 4  106 ? -25.515 -39.360 39.235 1.00 83.32  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H 4  107 ? -20.912 -41.465 37.139 1.00 84.76  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H 4  107 ? -19.936 -41.177 36.094 1.00 85.15  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H 4  107 ? -19.657 -42.411 35.249 1.00 85.53  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H 4  107 ? -19.687 -42.339 34.027 1.00 85.53  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H 4  107 ? -18.652 -40.638 36.695 1.00 85.14  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H 4  108 ? -19.404 -43.541 35.908 1.00 86.23  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H 4  108 ? -19.127 -44.808 35.225 1.00 86.93  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H 4  108 ? -20.240 -45.174 34.247 1.00 87.12  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H 4  108 ? -19.998 -45.316 33.045 1.00 87.13  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H 4  108 ? -18.920 -45.953 36.230 1.00 87.04  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H 4  108 ? -17.473 -46.166 36.704 1.00 88.02  ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H 4  108 ? -17.221 -47.657 37.043 1.00 89.31  ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H 4  108 ? -15.955 -47.893 37.887 1.00 89.18  ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H 4  108 ? -16.177 -47.682 39.354 1.00 88.95  ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H 4  109 ? -21.456 -45.310 34.771 1.00 87.45  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H 4  109 ? -22.603 -45.713 33.970 1.00 87.81  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H 4  109 ? -22.847 -44.783 32.786 1.00 87.76  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H 4  109 ? -23.141 -45.247 31.685 1.00 87.87  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H 4  109 ? -23.843 -45.832 34.848 1.00 87.99  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H 4  109 ? -23.956 -47.153 35.538 1.00 89.18  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H 4  109 ? -24.824 -48.137 35.116 1.00 90.38  ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H 4  109 ? -23.292 -47.664 36.602 1.00 90.13  ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H 4  109 ? -24.699 -49.193 35.898 1.00 90.79  ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H 4  109 ? -23.774 -48.933 36.806 1.00 90.97  ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H 4  110 ? -22.697 -43.479 33.018 1.00 87.72  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H 4  110 ? -22.824 -42.460 31.971 1.00 87.58  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H 4  110 ? -21.862 -42.694 30.809 1.00 87.66  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H 4  110 ? -22.269 -42.627 29.651 1.00 87.58  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H 4  110 ? -22.616 -41.078 32.552 1.00 87.44  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H 4  111 ? -20.595 -42.963 31.131 1.00 87.85  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H 4  111 ? -19.564 -43.274 30.137 1.00 87.92  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H 4  111 ? -19.949 -44.507 29.314 1.00 88.35  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H 4  111 ? -19.850 -44.493 28.087 1.00 88.35  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H 4  111 ? -18.163 -43.459 30.791 1.00 87.69  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H 4  111 ? -17.132 -43.889 29.768 1.00 87.56  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H 4  111 ? -17.707 -42.175 31.443 1.00 87.44  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H 4  112 ? -20.408 -45.558 29.991 1.00 88.90  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H 4  112 ? -20.824 -46.786 29.318 1.00 89.48  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H 4  112 ? -21.990 -46.528 28.369 1.00 89.85  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H 4  112 ? -22.005 -47.046 27.257 1.00 90.11  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H 4  112 ? -21.179 -47.880 30.331 1.00 89.42  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H 4  112 ? -22.484 -47.707 30.855 1.00 89.72  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H 4  113 ? -22.952 -45.722 28.811 1.00 90.29  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H 4  113 ? -24.079 -45.326 27.974 1.00 90.92  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H 4  113 ? -23.652 -44.390 26.849 1.00 91.45  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H 4  113 ? -24.192 -44.448 25.746 1.00 91.54  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H 4  113 ? -25.163 -44.657 28.815 1.00 90.88  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H 4  113 ? -25.948 -45.615 29.698 1.00 91.15  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H 4  113 ? -26.858 -46.541 28.908 1.00 91.70  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H 4  113 ? -27.323 -46.144 27.812 1.00 91.49  ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H 4  113 ? -27.108 -47.667 29.394 1.00 91.97  ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H 4  114 ? -22.677 -43.533 27.142 1.00 92.13  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H 4  114 ? -22.154 -42.572 26.175 1.00 92.81  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H 4  114 ? -21.353 -43.245 25.084 1.00 93.29  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H 4  114 ? -21.512 -42.923 23.912 1.00 93.36  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H 4  115 ? -20.486 -44.176 25.473 1.00 93.91  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H 4  115 ? -19.737 -44.991 24.516 1.00 94.57  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H 4  115 ? -20.684 -45.895 23.719 1.00 95.02  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H 4  115 ? -20.615 -45.934 22.486 1.00 94.96  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H 4  115 ? -18.627 -45.829 25.209 1.00 94.48  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H 4  115 ? -17.645 -44.947 25.765 1.00 94.56  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H 4  115 ? -17.938 -46.765 24.221 1.00 94.35  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H 4  116 ? -21.578 -46.591 24.424 1.00 95.62  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H 4  116 ? -22.482 -47.546 23.795 1.00 96.38  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H 4  116 ? -23.228 -46.901 22.638 1.00 97.13  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H 4  116 ? -23.283 -47.462 21.539 1.00 97.43  ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H 4  116 ? -23.470 -48.122 24.804 1.00 96.22  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H 4  116 ? -23.716 -49.617 24.626 1.00 96.20  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H 4  116 ? -24.895 -50.120 25.450 1.00 95.90  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H 4  116 ? -26.223 -49.822 24.762 1.00 95.89  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H 4  116 ? -27.394 -50.311 25.539 1.00 95.78  ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H 4  117 ? -23.777 -45.713 22.885 1.00 97.92  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H 4  117 ? -24.509 -44.961 21.867 1.00 98.66  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H 4  117 ? -23.639 -44.510 20.691 1.00 99.26  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H 4  117 ? -24.106 -44.508 19.553 1.00 99.30  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H 4  117 ? -25.221 -43.777 22.490 1.00 98.59  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H 4  118 ? -22.390 -44.128 20.965 1.00 100.16 ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H 4  118 ? -21.448 -43.721 19.909 1.00 101.11 ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H 4  118 ? -20.990 -44.922 19.072 1.00 101.98 ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H 4  118 ? -20.757 -44.789 17.867 1.00 102.10 ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H 4  118 ? -20.242 -42.908 20.471 1.00 100.95 ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H 4  118 ? -19.019 -43.004 19.569 1.00 100.99 ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H 4  118 ? -20.626 -41.455 20.654 1.00 100.81 ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H 4  119 ? -20.887 -46.086 19.712 1.00 103.04 ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H 4  119 ? -20.538 -47.339 19.029 1.00 104.07 ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H 4  119 ? -21.668 -47.849 18.115 1.00 104.78 ? 116  THR H C     1 
ATOM   6034  O  O     . THR H 4  119 ? -21.413 -48.239 16.970 1.00 104.94 ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H 4  119 ? -20.054 -48.420 20.047 1.00 104.06 ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H 4  119 ? -18.651 -48.244 20.287 1.00 104.03 ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H 4  119 ? -20.288 -49.843 19.540 1.00 104.18 ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H 4  120 ? -22.903 -47.831 18.614 1.00 105.63 ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H 4  120 ? -24.060 -48.264 17.832 1.00 106.53 ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H 4  120 ? -24.259 -47.370 16.601 1.00 107.16 ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H 4  120 ? -24.412 -47.868 15.479 1.00 107.18 ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H 4  120 ? -25.319 -48.267 18.704 1.00 106.53 ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H 4  120 ? -26.313 -49.368 18.364 1.00 106.73 ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H 4  120 ? -27.596 -49.234 19.180 1.00 106.93 ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H 4  120 ? -28.352 -50.559 19.283 1.00 106.65 ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H 4  120 ? -28.901 -51.019 17.977 1.00 106.53 ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H 4  121 ? -24.232 -46.056 16.830 1.00 107.96 ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H 4  121 ? -24.419 -45.035 15.792 1.00 108.84 ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H 4  121 ? -23.405 -45.142 14.647 1.00 109.61 ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H 4  121 ? -23.777 -45.003 13.477 1.00 109.76 ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H 4  121 ? -24.388 -43.642 16.437 1.00 108.75 ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H 4  121 ? -24.199 -42.468 15.495 1.00 108.60 ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H 4  121 ? -25.295 -41.806 14.948 1.00 108.34 ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H 4  121 ? -22.920 -41.998 15.184 1.00 108.55 ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H 4  121 ? -25.123 -40.722 14.096 1.00 108.55 ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H 4  121 ? -22.736 -40.918 14.334 1.00 108.59 ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H 4  121 ? -23.840 -40.284 13.795 1.00 108.74 ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H 4  121 ? -23.648 -39.212 12.954 1.00 109.27 ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H 4  122 ? -22.136 -45.379 14.990 1.00 110.46 ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H 4  122 ? -21.064 -45.564 14.003 1.00 111.34 ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H 4  122 ? -21.297 -46.814 13.148 1.00 112.03 ? 119  THR H C     1 
ATOM   6062  O  O     . THR H 4  122 ? -21.297 -46.740 11.914 1.00 112.12 ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H 4  122 ? -19.672 -45.626 14.686 1.00 111.25 ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H 4  122 ? -19.345 -44.335 15.207 1.00 111.56 ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H 4  122 ? -18.579 -46.050 13.707 1.00 111.25 ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H 4  123 ? -21.514 -47.948 13.815 1.00 112.86 ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H 4  123 ? -21.707 -49.233 13.145 1.00 113.70 ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H 4  123 ? -23.143 -49.401 12.637 1.00 114.33 ? 120  SER H C     1 
ATOM   6069  O  O     . SER H 4  123 ? -23.850 -50.349 13.001 1.00 114.52 ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H 4  123 ? -21.311 -50.379 14.078 1.00 113.65 ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H 4  123 ? -20.003 -50.184 14.585 1.00 113.80 ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H 4  124 ? -23.560 -48.458 11.796 1.00 114.99 ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H 4  124 ? -24.866 -48.476 11.155 1.00 115.62 ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H 4  124 ? -24.785 -47.607 9.908  1.00 116.08 ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H 4  124 ? -24.520 -46.402 10.002 1.00 116.18 ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H 4  124 ? -25.945 -47.958 12.108 1.00 115.60 ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H 4  125 ? -24.994 -48.231 8.748  1.00 116.55 ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H 4  125 ? -24.920 -47.543 7.450  1.00 117.00 ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H 4  125 ? -25.864 -46.330 7.348  1.00 117.07 ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H 4  125 ? -25.428 -45.181 7.482  1.00 117.03 ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H 4  125 ? -25.146 -48.529 6.287  1.00 117.09 ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H 4  125 ? -26.155 -49.636 6.575  1.00 117.66 ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H 4  125 ? -26.697 -50.262 5.296  1.00 118.48 ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H 4  125 ? -27.706 -51.361 5.618  1.00 118.76 ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H 4  125 ? -28.569 -51.705 4.453  1.00 118.84 ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H 4  125 ? -27.075 -46.459 7.145  1.00 117.20 ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I 5  1   ? 1.743   -1.047  93.434 1.00 168.40 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I 5  1   ? 2.933   -0.794  92.695 1.00 168.25 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I 5  1   ? 4.143   -1.437  93.358 1.00 168.27 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I 5  1   ? 3.872   -2.817  93.727 1.00 168.34 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I 5  1   ? 5.395   -1.472  92.494 1.00 168.26 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I 5  1   ? 6.517   -1.213  93.334 1.00 168.33 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I 5  1   ? 5.374   -2.886  91.914 1.00 168.34 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I 5  1   ? 4.728   -3.703  93.026 1.00 168.39 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I 5  1   ? 3.936   -4.834  92.537 1.00 168.41 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I 5  1   ? 2.740   -4.768  91.872 1.00 168.41 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I 5  1   ? 2.241   -5.937  91.548 1.00 168.37 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I 5  1   ? 3.172   -6.839  92.033 1.00 168.25 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I 5  1   ? 3.228   -8.251  92.011 1.00 168.10 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I 5  1   ? 2.283   -9.015  91.454 1.00 167.88 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I 5  1   ? 4.296   -8.849  92.585 1.00 168.11 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I 5  1   ? 5.244   -8.080  93.145 1.00 168.15 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I 5  1   ? 5.301   -6.748  93.226 1.00 168.16 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I 5  1   ? 4.226   -6.178  92.647 1.00 168.29 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I 5  2   ? 8.036   -1.514  92.921 1.00 168.58 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I 5  2   ? 8.861   -0.464  93.563 1.00 168.83 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I 5  2   ? 8.139   -1.713  91.455 1.00 168.53 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I 5  2   ? 8.297   -2.921  93.643 1.00 168.11 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I 5  2   ? 9.467   -3.138  94.434 1.00 167.51 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I 5  2   ? 10.385  -4.157  93.784 1.00 166.99 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I 5  2   ? 9.593   -5.273  93.305 1.00 167.12 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I 5  2   ? 11.187  -3.632  92.596 1.00 166.41 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I 5  2   ? 12.597  -3.612  92.939 1.00 165.50 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I 5  2   ? 10.762  -4.495  91.401 1.00 166.69 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I 5  2   ? 10.029  -5.684  92.027 1.00 167.01 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I 5  2   ? 8.825   -6.222  91.273 1.00 167.14 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I 5  2   ? 8.486   -7.561  91.407 1.00 167.12 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I 5  2   ? 9.103   -8.355  92.097 1.00 167.05 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I 5  2   ? 7.380   -7.954  90.689 1.00 167.16 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I 5  2   ? 6.585   -7.166  89.871 1.00 167.28 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I 5  2   ? 5.614   -7.623  89.273 1.00 167.23 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I 5  2   ? 6.985   -5.780  89.772 1.00 167.34 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I 5  2   ? 6.209   -4.822  88.914 1.00 167.32 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I 5  2   ? 8.066   -5.382  90.468 1.00 167.32 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I 5  3   ? 13.744  -4.642  92.475 1.00 164.94 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I 5  3   ? 14.970  -4.245  93.208 1.00 164.82 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I 5  3   ? 13.774  -4.655  90.992 1.00 165.05 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I 5  3   ? 13.269  -6.088  92.995 1.00 163.50 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I 5  3   ? 14.230  -7.080  93.417 1.00 161.30 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I 5  3   ? 14.347  -8.272  92.468 1.00 159.58 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I 5  3   ? 13.091  -8.503  91.770 1.00 159.38 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I 5  3   ? 15.410  -8.175  91.371 1.00 158.27 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I 5  3   ? 16.001  -9.467  91.165 1.00 156.19 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I 5  3   ? 14.579  -7.754  90.161 1.00 158.55 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I 5  3   ? 13.361  -8.642  90.388 1.00 158.90 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I 5  3   ? 12.128  -8.294  89.613 1.00 158.72 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I 5  3   ? 11.155  -9.281  89.370 1.00 158.59 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I 5  3   ? 11.322  -10.434 89.792 1.00 158.34 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I 5  3   ? 10.040  -8.938  88.667 1.00 158.72 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I 5  3   ? 9.878   -7.686  88.219 1.00 158.84 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I 5  3   ? 8.767   -7.395  87.531 1.00 158.65 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I 5  3   ? 10.855  -6.671  88.458 1.00 158.97 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I 5  3   ? 11.950  -7.017  89.149 1.00 158.85 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I 5  4   ? 17.194  -9.700  90.116 1.00 154.61 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I 5  4   ? 18.433  -9.311  90.822 1.00 154.81 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I 5  4   ? 16.859  -9.044  88.831 1.00 154.51 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I 5  4   ? 17.240  -11.288 89.855 1.00 152.72 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I 5  4   ? 16.086  -12.146 89.893 1.00 149.46 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I 5  4   ? 15.747  -12.827 88.563 1.00 146.95 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I 5  4   ? 14.657  -12.109 87.929 1.00 146.12 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I 5  4   ? 16.820  -12.969 87.477 1.00 145.51 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I 5  4   ? 16.585  -14.179 86.729 1.00 143.94 ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I 5  4   ? 16.565  -11.733 86.617 1.00 145.20 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I 5  4   ? 15.036  -11.724 86.623 1.00 145.36 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I 5  4   ? 14.379  -10.447 86.344 1.00 144.85 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I 5  4   ? 14.914  -9.191  86.440 1.00 144.77 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I 5  4   ? 14.077  -8.229  86.131 1.00 144.61 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I 5  4   ? 12.906  -8.896  85.813 1.00 144.28 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I 5  4   ? 11.634  -8.443  85.396 1.00 143.87 ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I 5  4   ? 11.337  -7.151  85.232 1.00 143.61 ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I 5  4   ? 10.677  -9.368  85.156 1.00 143.55 ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I 5  4   ? 10.979  -10.662 85.322 1.00 143.52 ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I 5  4   ? 12.135  -11.207 85.706 1.00 143.84 ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I 5  4   ? 13.071  -10.265 85.940 1.00 144.38 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I 5  5   ? 17.700  -15.314 86.484 1.00 142.54 ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I 5  5   ? 17.884  -16.057 87.751 1.00 142.26 ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I 5  5   ? 18.852  -14.664 85.816 1.00 142.36 ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I 5  5   ? 17.040  -16.307 85.408 1.00 141.14 ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I 5  5   ? 15.685  -16.789 85.506 1.00 138.50 ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I 5  5   ? 14.917  -16.645 84.191 1.00 136.26 ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I 5  5   ? 14.379  -15.302 84.062 1.00 135.45 ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I 5  5   ? 15.713  -16.912 82.909 1.00 134.94 ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I 5  5   ? 14.993  -17.793 82.052 1.00 133.25 ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I 5  5   ? 15.889  -15.539 82.264 1.00 134.55 ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I 5  5   ? 14.660  -14.795 82.770 1.00 134.59 ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I 5  5   ? 14.852  -13.350 82.873 1.00 133.82 ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I 5  5   ? 16.003  -12.692 83.212 1.00 133.51 ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I 5  5   ? 15.885  -11.387 83.227 1.00 133.24 ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I 5  5   ? 14.563  -11.171 82.875 1.00 132.89 ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I 5  5   ? 13.802  -9.995  82.707 1.00 132.38 ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I 5  5   ? 14.302  -8.772  82.891 1.00 132.11 ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I 5  5   ? 12.505  -10.122 82.350 1.00 132.22 ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I 5  5   ? 11.999  -11.349 82.167 1.00 132.49 ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I 5  5   ? 12.616  -12.526 82.295 1.00 132.91 ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I 5  5   ? 13.908  -12.370 82.653 1.00 133.25 ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I 5  6   ? 15.731  -18.576 80.859 1.00 132.05 ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I 5  6   ? 15.397  -20.012 81.012 1.00 132.06 ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I 5  6   ? 17.151  -18.149 80.799 1.00 131.88 ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I 5  6   ? 15.024  -18.007 79.535 1.00 130.07 ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I 5  6   ? 13.621  -17.709 79.459 1.00 126.45 ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I 5  6   ? 13.318  -16.642 78.409 1.00 123.48 ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I 5  6   ? 13.361  -15.314 79.004 1.00 122.48 ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I 5  6   ? 14.259  -16.577 77.199 1.00 121.89 ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I 5  6   ? 13.533  -16.239 76.030 1.00 120.21 ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I 5  6   ? 15.150  -15.398 77.549 1.00 121.69 ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I 5  6   ? 14.030  -14.501 78.063 1.00 121.51 ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I 5  6   ? 14.438  -13.167 78.611 1.00 120.55 ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I 5  6   ? 13.503  -12.151 78.624 1.00 119.83 ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I 5  6   ? 12.355  -12.277 78.239 1.00 119.57 ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I 5  6   ? 13.961  -10.962 79.124 1.00 119.45 ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I 5  6   ? 15.231  -10.690 79.594 1.00 119.75 ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I 5  6   ? 15.530  -9.582  80.021 1.00 120.03 ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I 5  6   ? 16.169  -11.790 79.548 1.00 119.88 ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I 5  6   ? 17.581  -11.614 80.032 1.00 119.76 ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I 5  6   ? 15.733  -12.961 79.061 1.00 120.19 ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I 5  7   ? 13.046  -17.332 74.974 1.00 118.77 ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I 5  7   ? 12.426  -18.466 75.700 1.00 118.97 ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I 5  7   ? 14.154  -17.571 74.025 1.00 118.95 ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I 5  7   ? 11.899  -16.531 74.209 1.00 117.59 ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I 5  7   ? 10.701  -16.188 74.903 1.00 115.88 ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I 5  7   ? 10.126  -14.854 74.443 1.00 114.59 ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I 5  7   ? 10.830  -13.747 75.061 1.00 113.44 ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I 5  7   ? 10.168  -14.584 72.943 1.00 114.37 ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I 5  7   ? 8.956   -13.927 72.603 1.00 114.52 ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I 5  7   ? 11.404  -13.697 72.788 1.00 113.50 ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I 5  7   ? 11.326  -12.877 74.069 1.00 112.33 ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I 5  7   ? 12.604  -12.375 74.547 1.00 110.83 ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I 5  7   ? 13.745  -13.093 74.776 1.00 110.44 ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I 5  7   ? 14.744  -12.365 75.216 1.00 110.17 ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I 5  7   ? 14.217  -11.086 75.284 1.00 109.95 ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I 5  7   ? 14.764  -9.845  75.677 1.00 109.80 ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I 5  7   ? 16.027  -9.708  76.092 1.00 109.91 ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I 5  7   ? 13.967  -8.751  75.628 1.00 109.35 ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I 5  7   ? 12.705  -8.896  75.206 1.00 109.10 ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I 5  7   ? 12.079  -10.007 74.817 1.00 109.35 ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I 5  7   ? 12.896  -11.074 74.877 1.00 110.01 ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I 5  8   ? 8.671   -13.364 71.137 1.00 114.96 ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I 5  8   ? 7.201   -13.241 71.015 1.00 115.17 ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I 5  8   ? 9.473   -14.117 70.142 1.00 114.58 ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I 5  8   ? 9.252   -11.891 71.233 1.00 115.67 ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I 5  8   ? 8.588   -10.948 72.060 1.00 116.72 ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I 5  8   ? 8.999   -9.560  71.628 1.00 117.48 ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I 5  8   ? 10.316  -9.281  72.165 1.00 117.05 ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I 5  8   ? 9.096   -9.393  70.114 1.00 118.56 ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I 5  8   ? 8.524   -8.133  69.763 1.00 120.53 ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I 5  8   ? 10.601  -9.477  69.845 1.00 117.77 ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I 5  8   ? 11.186  -8.886  71.126 1.00 116.64 ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I 5  8   ? 12.578  -9.317  71.483 1.00 115.65 ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I 5  8   ? 13.433  -8.389  72.053 1.00 115.11 ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I 5  8   ? 13.125  -7.231  72.283 1.00 114.45 ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I 5  8   ? 14.682  -8.874  72.355 1.00 115.02 ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I 5  8   ? 15.159  -10.160 72.150 1.00 115.26 ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I 5  8   ? 16.303  -10.480 72.460 1.00 115.33 ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I 5  8   ? 14.218  -11.085 71.553 1.00 115.47 ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I 5  8   ? 14.613  -12.510 71.279 1.00 115.41 ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I 5  8   ? 12.989  -10.624 71.256 1.00 115.57 ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I 5  9   ? 8.025   -7.752  68.286 1.00 121.74 ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I 5  9   ? 6.548   -7.835  68.286 1.00 121.99 ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I 5  9   ? 8.808   -8.501  67.273 1.00 121.43 ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I 5  9   ? 8.439   -6.209  68.195 1.00 122.97 ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I 5  9   ? 8.877   -5.492  69.353 1.00 125.16 ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I 5  9   ? 10.219  -4.827  69.109 1.00 127.02 ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I 5  9   ? 11.309  -5.675  69.544 1.00 127.07 ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I 5  9   ? 10.493  -4.517  67.644 1.00 128.61 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I 5  9   ? 10.321  -3.114  67.424 1.00 130.89 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I 5  9   ? 11.927  -4.996  67.399 1.00 128.28 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I 5  9   ? 12.447  -5.309  68.798 1.00 127.56 ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I 5  9   ? 13.455  -6.418  68.862 1.00 127.73 ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I 5  9   ? 14.731  -6.186  69.412 1.00 127.95 ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I 5  9   ? 15.031  -5.064  69.842 1.00 127.98 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I 5  9   ? 15.622  -7.213  69.458 1.00 128.06 ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I 5  9   ? 15.286  -8.421  68.988 1.00 128.15 ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I 5  9   ? 16.195  -9.400  69.057 1.00 128.45 ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I 5  9   ? 13.998  -8.678  68.425 1.00 127.89 ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I 5  9   ? 13.130  -7.658  68.382 1.00 127.69 ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I 5  10  ? 9.710   -2.521  66.063 1.00 132.37 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I 5  10  ? 8.530   -1.695  66.408 1.00 132.39 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I 5  10  ? 9.572   -3.608  65.060 1.00 132.09 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I 5  10  ? 10.900  -1.553  65.608 1.00 133.43 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I 5  10  ? 12.139  -2.132  65.234 1.00 135.44 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I 5  10  ? 13.309  -1.271  65.663 1.00 136.76 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I 5  10  ? 14.197  -2.051  66.508 1.00 136.86 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I 5  10  ? 14.133  -0.775  64.481 1.00 137.80 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I 5  10  ? 14.573  0.572   64.682 1.00 138.96 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I 5  10  ? 15.293  -1.765  64.425 1.00 137.69 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I 5  10  ? 15.439  -2.265  65.861 1.00 137.32 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I 5  10  ? 15.842  -3.719  65.941 1.00 137.30 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I 5  10  ? 17.111  -4.072  66.446 1.00 137.45 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I 5  10  ? 17.899  -3.197  66.834 1.00 137.44 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I 5  10  ? 17.452  -5.388  66.503 1.00 137.58 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I 5  10  ? 16.595  -6.326  66.082 1.00 137.49 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I 5  10  ? 16.983  -7.605  66.160 1.00 137.36 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I 5  10  ? 15.304  -5.990  65.563 1.00 137.31 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I 5  10  ? 14.976  -4.692  65.510 1.00 137.08 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I 5  11  ? 15.066  1.504   63.471 1.00 139.50 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I 5  11  ? 14.008  2.517   63.275 1.00 139.26 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I 5  11  ? 15.489  0.665   62.328 1.00 139.39 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I 5  11  ? 16.386  2.205   64.058 1.00 140.55 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I 5  11  ? 17.205  1.569   65.062 1.00 142.24 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I 5  11  ? 18.515  1.014   64.518 1.00 143.52 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I 5  11  ? 18.553  -0.430  64.689 1.00 143.73 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I 5  11  ? 18.767  1.278   63.033 1.00 144.68 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I 5  11  ? 20.035  1.915   62.821 1.00 145.96 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I 5  11  ? 18.709  -0.109  62.397 1.00 144.51 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I 5  11  ? 19.143  -1.012  63.544 1.00 144.09 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I 5  11  ? 18.725  -2.410  63.385 1.00 144.07 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I 5  11  ? 17.522  -2.861  62.916 1.00 144.01 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I 5  11  ? 17.402  -4.165  62.871 1.00 144.01 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I 5  11  ? 18.624  -4.613  63.337 1.00 144.15 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I 5  11  ? 19.145  -5.911  63.526 1.00 144.26 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I 5  11  ? 18.448  -7.019  63.255 1.00 144.20 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I 5  11  ? 20.406  -6.025  64.005 1.00 144.25 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I 5  11  ? 21.101  -4.910  64.272 1.00 144.17 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I 5  11  ? 20.716  -3.637  64.133 1.00 144.24 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I 5  11  ? 19.456  -3.550  63.657 1.00 144.18 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I 5  12  ? 20.267  2.954   61.617 1.00 146.53 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I 5  12  ? 20.698  4.228   62.239 1.00 146.75 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I 5  12  ? 19.095  2.944   60.707 1.00 146.10 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I 5  12  ? 21.502  2.300   60.832 1.00 146.87 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I 5  12  ? 22.796  2.265   61.436 1.00 147.45 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I 5  12  ? 23.427  0.888   61.336 1.00 147.76 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I 5  12  ? 22.428  -0.146  61.553 1.00 147.68 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I 5  12  ? 24.091  0.588   59.991 1.00 147.96 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I 5  12  ? 25.512  0.444   60.197 1.00 148.37 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I 5  12  ? 23.369  -0.673  59.504 1.00 147.91 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I 5  12  ? 22.809  -1.273  60.791 1.00 147.59 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I 5  12  ? 21.638  -2.220  60.602 1.00 147.08 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I 5  12  ? 21.716  -3.564  61.032 1.00 146.46 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I 5  12  ? 22.741  -3.993  61.578 1.00 145.91 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I 5  12  ? 20.645  -4.379  60.838 1.00 146.24 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I 5  12  ? 19.536  -3.911  60.251 1.00 146.23 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I 5  12  ? 18.509  -4.749  60.085 1.00 145.96 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I 5  12  ? 19.432  -2.558  59.804 1.00 146.43 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I 5  12  ? 20.493  -1.762  59.996 1.00 146.80 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I 5  13  ? 26.492  -0.502  59.344 1.00 148.85 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I 5  13  ? 27.877  -0.095  59.671 1.00 148.90 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I 5  13  ? 26.059  -0.485  57.928 1.00 148.95 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I 5  13  ? 26.208  -1.965  59.948 1.00 149.42 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I 5  13  ? 27.255  -2.917  60.212 1.00 150.03 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I 5  13  ? 27.256  -4.073  59.217 1.00 150.36 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I 5  13  ? 25.938  -4.685  59.155 1.00 150.42 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I 5  13  ? 27.615  -3.681  57.784 1.00 150.58 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I 5  13  ? 28.587  -4.551  57.200 1.00 150.90 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I 5  13  ? 26.287  -3.762  57.040 1.00 150.48 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I 5  13  ? 25.560  -4.863  57.802 1.00 150.33 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I 5  13  ? 24.057  -4.821  57.667 1.00 150.19 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I 5  13  ? 23.302  -6.011  57.680 1.00 150.05 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I 5  13  ? 23.869  -7.105  57.809 1.00 149.90 ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I 5  13  ? 21.948  -5.932  57.553 1.00 149.96 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I 5  13  ? 21.350  -4.743  57.415 1.00 149.91 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I 5  13  ? 20.020  -4.717  57.292 1.00 149.88 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I 5  13  ? 22.092  -3.524  57.394 1.00 149.90 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I 5  13  ? 23.423  -3.613  57.521 1.00 150.04 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I 5  14  ? 29.675  -3.926  56.200 1.00 151.21 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5  14  ? 30.654  -3.198  57.036 1.00 151.36 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5  14  ? 28.955  -3.217  55.117 1.00 151.23 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5  14  ? 30.409  -5.175  55.518 1.00 151.17 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5  14  ? 30.486  -6.451  56.150 1.00 151.11 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5  14  ? 29.723  -7.497  55.353 1.00 150.98 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5  14  ? 28.291  -7.310  55.530 1.00 151.06 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5  14  ? 29.978  -7.492  53.844 1.00 150.78 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5  14  ? 30.293  -8.814  53.410 1.00 150.38 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5  14  ? 28.652  -7.001  53.266 1.00 150.94 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5  14  ? 27.675  -7.569  54.286 1.00 150.95 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5  14  ? 26.303  -6.972  54.233 1.00 150.70 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5  14  ? 25.201  -7.796  54.383 1.00 150.60 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5  14  ? 25.271  -8.999  54.566 1.00 150.45 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5  14  ? 23.991  -7.150  54.312 1.00 150.66 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5  14  ? 23.775  -5.796  54.108 1.00 150.78 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5  14  ? 22.641  -5.325  54.063 1.00 150.73 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5  14  ? 24.969  -4.990  53.954 1.00 150.86 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5  14  ? 24.873  -3.507  53.724 1.00 150.98 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5  14  ? 26.157  -5.611  54.022 1.00 150.71 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I 5  15  ? 30.547  -9.195  51.872 1.00 150.21 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I 5  15  ? 31.860  -9.874  51.804 1.00 150.47 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I 5  15  ? 30.291  -8.025  50.997 1.00 150.13 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I 5  15  ? 29.381  -10.256 51.596 1.00 149.62 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I 5  15  ? 29.407  -11.582 52.130 1.00 148.58 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I 5  15  ? 28.241  -12.394 51.583 1.00 147.76 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I 5  15  ? 26.998  -11.650 51.675 1.00 147.52 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I 5  15  ? 28.360  -12.830 50.126 1.00 147.30 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I 5  15  ? 27.868  -14.169 50.024 1.00 146.91 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I 5  15  ? 27.508  -11.813 49.360 1.00 147.15 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I 5  15  ? 26.466  -11.373 50.391 1.00 147.05 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I 5  15  ? 26.129  -9.947  50.387 1.00 146.51 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I 5  15  ? 26.996  -8.884  50.270 1.00 146.35 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I 5  15  ? 26.411  -7.720  50.313 1.00 146.08 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I 5  15  ? 25.066  -8.022  50.476 1.00 145.66 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I 5  15  ? 23.943  -7.163  50.585 1.00 145.07 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I 5  15  ? 23.915  -5.927  50.562 1.00 144.51 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I 5  15  ? 22.755  -7.872  50.738 1.00 145.04 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I 5  15  ? 22.665  -9.244  50.777 1.00 145.31 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I 5  15  ? 21.435  -9.752  50.926 1.00 145.34 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I 5  15  ? 23.707  -10.064 50.675 1.00 145.56 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I 5  15  ? 24.876  -9.389  50.526 1.00 145.98 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I 5  16  ? 28.040  -15.058 48.700 1.00 146.66 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I 5  16  ? 28.022  -16.488 49.102 1.00 146.43 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I 5  16  ? 29.179  -14.522 47.921 1.00 146.70 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I 5  16  ? 26.705  -14.720 47.879 1.00 145.96 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I 5  16  ? 25.408  -14.999 48.420 1.00 144.36 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I 5  16  ? 24.303  -14.383 47.574 1.00 142.99 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I 5  16  ? 24.191  -12.962 47.841 1.00 142.71 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I 5  16  ? 24.476  -14.527 46.062 1.00 142.07 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I 5  16  ? 23.273  -15.034 45.512 1.00 141.13 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I 5  16  ? 24.763  -13.104 45.588 1.00 142.06 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I 5  16  ? 23.968  -12.301 46.613 1.00 142.09 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I 5  16  ? 24.342  -10.858 46.789 1.00 141.49 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I 5  16  ? 23.402  -9.980  47.351 1.00 140.98 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I 5  16  ? 22.287  -10.403 47.681 1.00 140.69 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I 5  16  ? 23.742  -8.676  47.515 1.00 140.77 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I 5  16  ? 24.951  -8.244  47.147 1.00 140.74 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I 5  16  ? 25.231  -6.953  47.332 1.00 140.71 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I 5  16  ? 25.927  -9.117  46.578 1.00 140.92 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I 5  16  ? 25.582  -10.402 46.421 1.00 141.29 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I 5  17  ? 23.126  -16.596 45.212 1.00 140.51 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5  17  ? 23.471  -17.349 46.441 1.00 140.57 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5  17  ? 23.839  -16.861 43.942 1.00 140.42 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5  17  ? 21.564  -16.775 44.935 1.00 139.73 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5  17  ? 20.620  -16.865 46.006 1.00 138.42 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5  17  ? 19.420  -15.963 45.751 1.00 137.31 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5  17  ? 19.864  -14.590 45.605 1.00 137.02 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5  17  ? 18.606  -16.262 44.496 1.00 136.68 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5  17  ? 17.238  -15.934 44.734 1.00 135.96 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5  17  ? 19.237  -15.334 43.459 1.00 136.68 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5  17  ? 19.574  -14.109 44.307 1.00 136.69 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5  17  ? 20.738  -13.336 43.881 1.00 136.45 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5  17  ? 21.829  -13.783 43.186 1.00 136.52 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5  17  ? 22.728  -12.857 42.955 1.00 136.51 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5  17  ? 22.193  -11.723 43.543 1.00 136.24 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5  17  ? 22.658  -10.394 43.648 1.00 136.02 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5  17  ? 23.822  -9.989  43.136 1.00 135.84 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5  17  ? 21.880  -9.498  44.299 1.00 135.96 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5  17  ? 20.710  -9.905  44.813 1.00 135.88 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5  17  ? 20.171  -11.126 44.774 1.00 136.18 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5  17  ? 20.966  -11.998 44.121 1.00 136.30 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I 5  18  ? 16.045  -16.570 43.872 1.00 135.23 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I 5  18  ? 15.500  -17.701 44.655 1.00 135.21 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I 5  18  ? 16.542  -16.810 42.496 1.00 135.26 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I 5  18  ? 14.942  -15.403 43.797 1.00 134.25 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I 5  18  ? 15.029  -14.196 44.570 1.00 132.90 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I 5  18  ? 15.233  -12.941 43.726 1.00 131.97 ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I 5  18  ? 16.629  -12.795 43.353 1.00 131.61 ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I 5  18  ? 14.437  -12.829 42.420 1.00 131.49 ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I 5  18  ? 13.634  -11.644 42.454 1.00 130.71 ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I 5  18  ? 15.518  -12.746 41.340 1.00 131.47 ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I 5  18  ? 16.662  -12.114 42.120 1.00 131.59 ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I 5  18  ? 17.986  -12.257 41.516 1.00 131.92 ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I 5  18  ? 18.541  -13.399 40.991 1.00 132.12 ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I 5  18  ? 19.744  -13.232 40.520 1.00 132.22 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I 5  18  ? 20.008  -11.887 40.737 1.00 132.23 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I 5  18  ? 21.165  -11.126 40.427 1.00 132.55 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I 5  18  ? 22.210  -11.516 39.882 1.00 132.88 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I 5  18  ? 21.032  -9.789  40.814 1.00 132.41 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I 5  18  ? 19.915  -9.261  41.425 1.00 132.16 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I 5  18  ? 19.964  -7.956  41.724 1.00 131.94 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I 5  18  ? 18.826  -9.967  41.718 1.00 132.15 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I 5  18  ? 18.937  -11.271 41.350 1.00 132.06 ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I 5  19  ? 12.366  -11.429 41.498 1.00 129.98 ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I 5  19  ? 11.157  -11.531 42.340 1.00 130.02 ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I 5  19  ? 12.521  -12.274 40.290 1.00 129.77 ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I 5  19  ? 12.503  -9.912  41.026 1.00 130.44 ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I 5  19  ? 12.872  -8.889  41.940 1.00 131.29 ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I 5  19  ? 13.787  -7.881  41.267 1.00 132.09 ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I 5  19  ? 15.045  -8.515  40.921 1.00 132.04 ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I 5  19  ? 13.241  -7.274  39.975 1.00 132.80 ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I 5  19  ? 13.380  -5.866  40.009 1.00 134.16 ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I 5  19  ? 14.111  -7.884  38.880 1.00 132.55 ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I 5  19  ? 15.421  -8.100  39.627 1.00 132.30 ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I 5  19  ? 16.296  -9.116  39.049 1.00 132.46 ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I 5  19  ? 15.992  -10.421 38.764 1.00 132.60 ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I 5  19  ? 16.987  -11.103 38.249 1.00 132.60 ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I 5  19  ? 18.018  -10.180 38.195 1.00 132.65 ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I 5  19  ? 19.352  -10.269 37.747 1.00 132.61 ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I 5  19  ? 19.877  -11.395 37.253 1.00 132.58 ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I 5  19  ? 20.123  -9.158  37.830 1.00 132.65 ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I 5  19  ? 19.591  -8.030  38.326 1.00 132.54 ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I 5  19  ? 18.352  -7.827  38.780 1.00 132.49 ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I 5  19  ? 17.610  -8.949  38.685 1.00 132.57 ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I 5  20  ? 12.324  -4.916  39.279 1.00 135.24 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I 5  20  ? 11.420  -4.390  40.321 1.00 135.20 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I 5  20  ? 11.760  -5.630  38.112 1.00 135.12 ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I 5  20  ? 13.226  -3.715  38.727 1.00 137.59 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I 5  20  ? 14.580  -3.531  39.157 1.00 141.11 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I 5  20  ? 15.572  -3.431  38.001 1.00 143.76 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I 5  20  ? 16.191  -4.714  37.714 1.00 144.26 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I 5  20  ? 15.020  -2.913  36.668 1.00 145.32 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I 5  20  ? 15.533  -1.586  36.443 1.00 147.65 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I 5  20  ? 15.474  -3.957  35.641 1.00 145.14 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I 5  20  ? 16.609  -4.671  36.367 1.00 144.85 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I 5  20  ? 16.885  -6.061  35.872 1.00 145.14 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I 5  20  ? 18.153  -6.391  35.423 1.00 145.21 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I 5  20  ? 19.091  -5.612  35.398 1.00 145.18 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I 5  20  ? 18.284  -7.693  34.992 1.00 145.47 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I 5  20  ? 17.302  -8.677  34.969 1.00 145.60 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I 5  20  ? 17.528  -9.817  34.565 1.00 145.60 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I 5  20  ? 16.001  -8.265  35.453 1.00 145.49 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I 5  20  ? 14.846  -9.224  35.483 1.00 145.31 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I 5  20  ? 15.862  -6.997  35.871 1.00 145.40 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I 5  21  ? 15.676  -0.890  35.003 1.00 149.53 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I 5  21  ? 15.952  0.548   35.227 1.00 149.52 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I 5  21  ? 14.533  -1.278  34.145 1.00 149.50 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I 5  21  ? 16.987  -1.609  34.435 1.00 151.24 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I 5  21  ? 18.294  -1.098  34.679 1.00 153.76 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I 5  21  ? 19.155  -1.339  33.452 1.00 155.67 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I 5  21  ? 19.340  -2.767  33.279 1.00 155.88 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I 5  21  ? 18.579  -0.815  32.135 1.00 156.96 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I 5  21  ? 19.602  -0.143  31.394 1.00 158.86 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I 5  21  ? 18.080  -2.078  31.431 1.00 156.64 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I 5  21  ? 19.081  -3.110  31.933 1.00 156.25 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I 5  21  ? 18.621  -4.496  31.877 1.00 156.21 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I 5  21  ? 17.473  -5.024  32.406 1.00 156.11 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I 5  21  ? 17.336  -6.312  32.196 1.00 156.07 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I 5  21  ? 18.473  -6.653  31.480 1.00 156.26 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I 5  21  ? 18.939  -7.876  30.944 1.00 156.31 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I 5  21  ? 18.275  -9.029  31.058 1.00 156.25 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I 5  21  ? 20.120  -7.868  30.281 1.00 156.37 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I 5  21  ? 20.793  -6.713  30.157 1.00 156.34 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I 5  21  ? 20.457  -5.507  30.619 1.00 156.17 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I 5  21  ? 19.277  -5.544  31.274 1.00 156.24 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I 5  22  ? 19.296  0.804   30.134 1.00 160.36 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I 5  22  ? 19.499  2.207   30.565 1.00 160.18 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I 5  22  ? 18.016  0.405   29.502 1.00 160.25 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I 5  22  ? 20.475  0.405   29.127 1.00 161.76 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I 5  22  ? 20.923  -0.948  29.020 1.00 163.68 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I 5  22  ? 21.135  -1.374  27.574 1.00 165.26 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I 5  22  ? 20.892  -2.800  27.473 1.00 165.52 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I 5  22  ? 20.246  -0.695  26.528 1.00 166.32 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I 5  22  ? 21.036  -0.134  25.436 1.00 167.98 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I 5  22  ? 19.211  -1.755  26.139 1.00 166.09 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I 5  22  ? 19.852  -3.082  26.554 1.00 165.88 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I 5  22  ? 18.918  -4.096  27.176 1.00 165.93 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I 5  22  ? 19.322  -5.443  27.311 1.00 165.90 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I 5  22  ? 20.442  -5.805  26.921 1.00 165.92 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I 5  22  ? 18.458  -6.333  27.873 1.00 165.75 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I 5  22  ? 17.253  -5.934  28.293 1.00 165.63 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I 5  22  ? 16.445  -6.845  28.843 1.00 165.42 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I 5  22  ? 16.821  -4.578  28.167 1.00 165.71 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I 5  22  ? 17.676  -3.707  27.610 1.00 165.86 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I 5  23  ? 21.528  -0.885  24.096 1.00 169.19 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I 5  23  ? 22.542  -0.018  23.454 1.00 169.27 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I 5  23  ? 20.327  -1.265  23.318 1.00 168.99 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I 5  23  ? 22.267  -2.209  24.621 1.00 170.04 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I 5  23  ? 23.471  -2.691  24.016 1.00 171.34 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I 5  23  ? 23.183  -3.796  23.010 1.00 172.38 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I 5  23  ? 22.193  -4.710  23.556 1.00 172.70 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I 5  23  ? 22.654  -3.312  21.658 1.00 172.95 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I 5  23  ? 23.450  -3.842  20.589 1.00 173.50 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I 5  23  ? 21.210  -3.812  21.609 1.00 173.02 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I 5  23  ? 21.201  -4.984  22.584 1.00 172.93 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I 5  23  ? 19.871  -5.210  23.262 1.00 172.93 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I 5  23  ? 19.618  -6.424  23.879 1.00 172.82 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I 5  23  ? 20.417  -7.344  23.916 1.00 172.69 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I 5  23  ? 18.374  -6.523  24.462 1.00 172.73 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I 5  23  ? 17.379  -5.557  24.494 1.00 172.72 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I 5  23  ? 16.301  -5.761  25.048 1.00 172.48 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I 5  23  ? 17.703  -4.310  23.830 1.00 172.84 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I 5  23  ? 16.721  -3.175  23.782 1.00 172.82 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I 5  23  ? 18.914  -4.202  23.258 1.00 172.92 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I 5  24  ? 23.069  -3.660  19.035 1.00 173.81 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I 5  24  ? 24.342  -3.557  18.285 1.00 173.83 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I 5  24  ? 22.037  -2.605  18.880 1.00 173.71 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I 5  24  ? 22.374  -5.057  18.692 1.00 173.38 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I 5  24  ? 23.105  -6.280  18.762 1.00 172.82 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I 5  24  ? 22.174  -7.426  18.426 1.00 172.45 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I 5  24  ? 21.224  -7.553  19.512 1.00 172.50 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I 5  24  ? 21.363  -7.187  17.154 1.00 172.15 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I 5  24  ? 21.710  -8.126  16.128 1.00 171.38 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I 5  24  ? 19.900  -7.309  17.582 1.00 172.43 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I 5  24  ? 19.963  -7.903  18.985 1.00 172.62 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I 5  24  ? 18.908  -7.393  19.862 1.00 172.75 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I 5  24  ? 18.732  -6.096  20.261 1.00 172.75 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I 5  24  ? 17.694  -5.919  21.042 1.00 172.83 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I 5  24  ? 17.145  -7.183  21.169 1.00 172.76 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I 5  24  ? 16.018  -7.670  21.872 1.00 172.68 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I 5  24  ? 15.216  -6.896  22.612 1.00 172.54 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I 5  24  ? 15.745  -8.993  21.784 1.00 172.71 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I 5  24  ? 16.544  -9.774  21.040 1.00 172.64 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I 5  24  ? 17.627  -9.430  20.339 1.00 172.65 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I 5  24  ? 17.879  -8.109  20.442 1.00 172.75 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I 5  25  ? 21.238  -7.906  14.608 1.00 170.68 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I 5  25  ? 22.239  -8.557  13.735 1.00 170.74 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I 5  25  ? 20.920  -6.473  14.408 1.00 170.66 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I 5  25  ? 19.862  -8.726  14.528 1.00 170.11 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I 5  25  ? 19.845  -10.131 14.788 1.00 169.04 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I 5  25  ? 18.486  -10.617 15.272 1.00 168.07 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I 5  25  ? 17.984  -9.782  16.348 1.00 168.01 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I 5  25  ? 17.383  -10.655 14.213 1.00 167.32 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I 5  25  ? 16.848  -11.976 14.128 1.00 166.11 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I 5  25  ? 16.340  -9.671  14.740 1.00 167.55 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I 5  25  ? 16.576  -9.812  16.240 1.00 168.02 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I 5  25  ? 15.917  -8.773  17.119 1.00 168.19 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I 5  25  ? 14.944  -9.166  18.062 1.00 168.08 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I 5  25  ? 14.629  -10.359 18.180 1.00 167.85 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I 5  25  ? 14.363  -8.214  18.839 1.00 168.12 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I 5  25  ? 14.708  -6.928  18.707 1.00 168.18 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I 5  25  ? 14.105  -6.034  19.496 1.00 168.28 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I 5  25  ? 15.689  -6.504  17.759 1.00 168.20 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I 5  25  ? 16.260  -7.449  16.996 1.00 168.29 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I 5  26  ? 16.232  -12.527 12.755 1.00 165.11 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I 5  26  ? 17.371  -12.969 11.921 1.00 165.16 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I 5  26  ? 15.292  -11.512 12.227 1.00 165.08 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I 5  26  ? 15.382  -13.826 13.171 1.00 163.61 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I 5  26  ? 14.816  -14.000 14.476 1.00 161.03 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I 5  26  ? 13.363  -13.549 14.576 1.00 159.12 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I 5  26  ? 13.290  -12.278 15.269 1.00 158.79 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I 5  26  ? 12.585  -13.351 13.271 1.00 157.81 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I 5  26  ? 11.447  -14.202 13.267 1.00 156.02 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I 5  26  ? 12.166  -11.881 13.298 1.00 157.95 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I 5  26  ? 12.124  -11.639 14.802 1.00 158.37 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I 5  26  ? 12.109  -10.217 15.290 1.00 158.36 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I 5  26  ? 11.462  -9.929  16.504 1.00 158.33 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I 5  26  ? 10.918  -10.841 17.138 1.00 158.49 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I 5  26  ? 11.440  -8.649  16.958 1.00 158.17 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I 5  26  ? 12.033  -7.681  16.259 1.00 158.07 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I 5  26  ? 11.981  -6.442  16.756 1.00 157.87 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I 5  26  ? 12.700  -7.947  15.023 1.00 158.31 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I 5  26  ? 12.716  -9.215  14.581 1.00 158.39 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I 5  27  ? 11.440  -15.542 12.395 1.00 154.56 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I 5  27  ? 12.431  -16.467 12.990 1.00 154.58 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I 5  27  ? 11.559  -15.153 10.972 1.00 154.61 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I 5  27  ? 9.960   -16.119 12.615 1.00 153.33 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I 5  27  ? 9.592   -16.777 13.829 1.00 151.25 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I 5  27  ? 8.395   -16.113 14.497 1.00 149.63 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I 5  27  ? 8.650   -14.701 14.722 1.00 149.38 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I 5  27  ? 7.073   -16.189 13.738 1.00 148.52 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I 5  27  ? 6.069   -16.526 14.679 1.00 146.94 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I 5  27  ? 6.890   -14.770 13.200 1.00 148.65 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I 5  27  ? 7.533   -13.943 14.309 1.00 149.02 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I 5  27  ? 8.015   -12.614 13.926 1.00 149.20 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I 5  27  ? 8.507   -12.223 12.710 1.00 149.29 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I 5  27  ? 8.875   -10.964 12.659 1.00 149.28 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I 5  27  ? 8.613   -10.491 13.932 1.00 149.18 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I 5  27  ? 8.783   -9.223  14.530 1.00 149.06 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I 5  27  ? 9.280   -8.168  13.882 1.00 148.83 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I 5  27  ? 8.420   -9.080  15.825 1.00 149.21 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I 5  27  ? 7.918   -10.140 16.476 1.00 149.26 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I 5  27  ? 7.714   -11.378 16.020 1.00 149.36 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I 5  27  ? 8.083   -11.493 14.729 1.00 149.28 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I 5  28  ? 4.658   -17.177 14.289 1.00 145.81 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I 5  28  ? 4.805   -18.644 14.418 1.00 145.80 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I 5  28  ? 4.155   -16.582 13.027 1.00 145.66 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I 5  28  ? 3.717   -16.659 15.476 1.00 144.57 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I 5  28  ? 4.267   -15.913 16.573 1.00 142.55 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I 5  28  ? 3.746   -14.482 16.633 1.00 140.95 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I 5  28  ? 4.538   -13.591 15.801 1.00 140.49 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I 5  28  ? 2.298   -14.292 16.182 1.00 140.13 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I 5  28  ? 1.592   -13.598 17.186 1.00 139.05 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I 5  28  ? 2.403   -13.449 14.915 1.00 139.97 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I 5  28  ? 3.645   -12.637 15.258 1.00 139.75 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I 5  28  ? 4.245   -11.920 14.133 1.00 138.85 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I 5  28  ? 4.422   -12.373 12.854 1.00 138.59 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I 5  28  ? 4.989   -11.501 12.058 1.00 138.41 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I 5  28  ? 5.195   -10.398 12.869 1.00 138.21 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I 5  28  ? 5.761   -9.129  12.626 1.00 137.93 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I 5  28  ? 6.239   -8.763  11.435 1.00 138.03 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I 5  28  ? 5.817   -8.251  13.651 1.00 137.70 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I 5  28  ? 5.337   -8.621  14.845 1.00 137.63 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I 5  28  ? 4.785   -9.783  15.192 1.00 137.91 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I 5  28  ? 4.741   -10.637 14.152 1.00 138.31 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I 5  29  ? 0.303   -14.264 17.839 1.00 138.23 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I 5  29  ? 0.762   -15.278 18.816 1.00 138.15 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I 5  29  ? -0.632  -14.628 16.747 1.00 138.17 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I 5  29  ? -0.325  -13.029 18.627 1.00 137.82 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I 5  29  ? -0.919  -11.998 17.871 1.00 137.22 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I 5  29  ? -0.281  -10.667 18.190 1.00 136.74 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I 5  29  ? 0.870   -10.462 17.333 1.00 136.46 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I 5  29  ? -1.249  -9.516  17.961 1.00 136.74 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I 5  29  ? -1.405  -8.773  19.162 1.00 136.86 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I 5  29  ? -0.630  -8.687  16.840 1.00 136.80 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I 5  29  ? 0.787   -9.217  16.663 1.00 136.48 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I 5  29  ? 1.139   -9.363  15.246 1.00 136.03 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I 5  29  ? 0.864   -10.429 14.433 1.00 135.84 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I 5  29  ? 1.294   -10.291 13.203 1.00 135.58 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I 5  29  ? 1.887   -9.043  13.201 1.00 135.39 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I 5  29  ? 2.536   -8.303  12.192 1.00 135.17 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I 5  29  ? 2.687   -8.750  10.945 1.00 135.34 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I 5  29  ? 3.022   -7.085  12.508 1.00 135.06 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I 5  29  ? 2.861   -6.637  13.759 1.00 135.12 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I 5  29  ? 2.274   -7.240  14.794 1.00 135.26 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I 5  29  ? 1.799   -8.452  14.448 1.00 135.55 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I 5  30  ? -2.700  -7.864  19.395 1.00 136.93 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I 5  30  ? -2.667  -7.415  20.804 1.00 136.86 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I 5  30  ? -3.886  -8.566  18.854 1.00 136.67 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I 5  30  ? -2.422  -6.608  18.456 1.00 137.03 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I 5  30  ? -1.423  -5.656  18.795 1.00 137.59 ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I 5  30  ? -1.500  -4.499  17.821 1.00 138.05 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I 5  30  ? -0.927  -4.908  16.555 1.00 138.26 ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I 5  30  ? -2.920  -4.018  17.540 1.00 138.30 ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I 5  30  ? -2.971  -2.612  17.732 1.00 138.82 ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I 5  30  ? -3.210  -4.463  16.105 1.00 138.33 ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I 5  30  ? -1.832  -4.699  15.490 1.00 138.27 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I 5  30  ? -1.749  -5.849  14.577 1.00 138.26 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I 5  30  ? -2.347  -7.073  14.725 1.00 138.10 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I 5  30  ? -2.092  -7.924  13.759 1.00 138.00 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I 5  30  ? -1.270  -7.208  12.905 1.00 138.14 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I 5  30  ? -0.654  -7.542  11.681 1.00 137.99 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I 5  30  ? -0.786  -8.738  11.103 1.00 137.96 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I 5  30  ? 0.108   -6.602  11.074 1.00 137.99 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I 5  30  ? 0.241   -5.402  11.657 1.00 137.97 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I 5  30  ? -0.292  -4.971  12.804 1.00 138.10 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I 5  30  ? -1.042  -5.928  13.391 1.00 138.26 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I 5  31  ? -4.293  -1.742  17.485 1.00 139.70 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I 5  31  ? -4.401  -0.773  18.597 1.00 139.74 ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I 5  31  ? -5.449  -2.621  17.181 1.00 139.17 ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I 5  31  ? -3.859  -0.954  16.157 1.00 140.91 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I 5  31  ? -2.473  -0.613  15.915 1.00 141.98 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I 5  31  ? -2.161  -0.314  14.449 1.00 142.69 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I 5  31  ? -1.815  -1.527  13.730 1.00 142.59 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I 5  31  ? -3.292  0.360   13.678 1.00 143.06 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I 5  31  ? -2.945  1.713   13.395 1.00 143.80 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I 5  31  ? -3.475  -0.470  12.408 1.00 142.90 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I 5  31  ? -2.355  -1.505  12.423 1.00 142.70 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I 5  31  ? -2.804  -2.860  12.093 1.00 142.75 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I 5  31  ? -3.550  -3.684  12.896 1.00 142.66 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I 5  31  ? -3.811  -4.846  12.373 1.00 142.75 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I 5  31  ? -3.207  -4.796  11.127 1.00 142.72 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I 5  31  ? -3.157  -5.776  10.104 1.00 142.69 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I 5  31  ? -3.657  -6.908  10.103 1.00 142.43 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I 5  31  ? -2.445  -5.336  8.989  1.00 143.11 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I 5  31  ? -1.850  -4.097  8.882  1.00 143.50 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I 5  31  ? -1.205  -3.845  7.732  1.00 143.65 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I 5  31  ? -1.889  -3.170  9.840  1.00 143.40 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I 5  31  ? -2.582  -3.580  10.935 1.00 142.91 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I 5  32  ? -4.076  2.800   13.080 1.00 144.43 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I 5  32  ? -3.519  4.122   13.433 1.00 144.35 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I 5  32  ? -5.352  2.356   13.688 1.00 144.25 ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I 5  32  ? -4.239  2.702   11.490 1.00 146.11 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I 5  32  ? -3.113  2.870   10.614 1.00 148.52 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I 5  32  ? -3.400  2.402   9.194  1.00 150.28 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I 5  32  ? -3.490  0.956   9.151  1.00 150.42 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I 5  32  ? -4.696  2.936   8.593  1.00 151.62 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I 5  32  ? -4.389  3.915   7.605  1.00 153.75 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I 5  32  ? -5.407  1.725   7.988  1.00 151.16 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I 5  32  ? -4.445  0.558   8.188  1.00 150.69 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I 5  32  ? -5.093  -0.713  8.667  1.00 150.60 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I 5  32  ? -5.025  -1.859  7.893  1.00 150.59 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I 5  32  ? -4.472  -1.918  6.811  1.00 150.74 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I 5  32  ? -5.649  -2.957  8.436  1.00 150.52 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I 5  32  ? -6.315  -3.031  9.648  1.00 150.42 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I 5  32  ? -6.837  -4.071  10.039 1.00 150.22 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I 5  32  ? -6.348  -1.803  10.410 1.00 150.52 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I 5  32  ? -7.036  -1.740  11.743 1.00 150.65 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I 5  32  ? -5.747  -0.724  9.887  1.00 150.63 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I 5  33  ? -5.497  4.949   7.077  1.00 155.59 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I 5  33  ? -4.778  6.183   6.682  1.00 155.54 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I 5  33  ? -6.608  5.020   8.058  1.00 155.44 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I 5  33  ? -6.065  4.229   5.764  1.00 156.44 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I 5  33  ? -5.193  3.734   4.745  1.00 157.67 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I 5  33  ? -5.921  2.748   3.848  1.00 158.56 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I 5  33  ? -5.952  1.442   4.484  1.00 158.77 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I 5  33  ? -7.375  3.114   3.535  1.00 159.18 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I 5  33  ? -7.577  3.170   2.116  1.00 159.99 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I 5  33  ? -8.188  2.008   4.209  1.00 159.11 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I 5  33  ? -7.200  0.850   4.186  1.00 159.05 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I 5  33  ? -7.511  -0.230  5.128  1.00 159.05 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I 5  33  ? -7.772  -0.130  6.476  1.00 158.98 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I 5  33  ? -8.021  -1.273  7.051  1.00 158.92 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I 5  33  ? -7.923  -2.198  6.019  1.00 158.92 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I 5  33  ? -8.096  -3.606  6.028  1.00 158.80 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I 5  33  ? -8.374  -4.337  6.988  1.00 158.60 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I 5  33  ? -7.911  -4.168  4.763  1.00 158.81 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I 5  33  ? -7.599  -3.453  3.627  1.00 158.85 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I 5  33  ? -7.458  -4.153  2.493  1.00 158.91 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I 5  33  ? -7.438  -2.135  3.605  1.00 158.90 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I 5  33  ? -7.614  -1.571  4.829  1.00 158.99 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I 5  34  ? -8.999  3.518   1.456  1.00 160.50 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I 5  34  ? -8.740  4.286   0.218  1.00 160.60 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I 5  34  ? -9.903  4.084   2.484  1.00 160.52 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I 5  34  ? -9.547  2.067   1.069  1.00 160.52 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I 5  34  ? -9.082  1.380   -0.092 1.00 160.75 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I 5  34  ? -9.884  0.104   -0.289 1.00 161.01 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I 5  34  ? -9.797  -0.686  0.926  1.00 161.34 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I 5  34  ? -11.374 0.310   -0.567 1.00 160.95 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I 5  34  ? -11.855 -0.614  -1.549 1.00 160.30 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I 5  34  ? -12.023 0.069   0.794  1.00 161.28 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I 5  34  ? -11.097 -0.986  1.397  1.00 161.67 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I 5  34  ? -11.095 -1.048  2.905  1.00 162.04 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I 5  34  ? -10.896 -2.264  3.543  1.00 162.04 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I 5  34  ? -10.711 -3.321  2.963  1.00 161.89 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I 5  34  ? -10.919 -2.200  4.916  1.00 162.13 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I 5  34  ? -11.116 -1.073  5.701  1.00 162.32 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I 5  34  ? -11.114 -1.131  6.928  1.00 162.47 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I 5  34  ? -11.319 0.163   4.977  1.00 162.33 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I 5  34  ? -11.545 1.457   5.706  1.00 162.26 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I 5  34  ? -11.299 0.114   3.636  1.00 162.26 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I 5  35  ? -13.106 -0.235  -2.480 1.00 159.65 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I 5  35  ? -12.617 0.718   -3.499 1.00 159.64 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I 5  35  ? -14.247 0.133   -1.612 1.00 159.42 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I 5  35  ? -13.497 -1.605  -3.213 1.00 159.48 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I 5  35  ? -12.687 -2.778  -3.126 1.00 159.00 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I 5  35  ? -13.407 -3.917  -2.414 1.00 158.62 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I 5  35  ? -13.287 -3.763  -0.972 1.00 158.57 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I 5  35  ? -14.905 -4.068  -2.702 1.00 158.27 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I 5  35  ? -15.189 -5.445  -3.014 1.00 157.68 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I 5  35  ? -15.553 -3.586  -1.402 1.00 158.37 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I 5  35  ? -14.533 -4.106  -0.397 1.00 158.37 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I 5  35  ? -14.646 -3.559  0.959  1.00 158.13 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I 5  35  ? -14.422 -2.270  1.365  1.00 157.99 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I 5  35  ? -14.597 -2.070  2.650  1.00 157.69 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I 5  35  ? -14.964 -3.319  3.122  1.00 157.69 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I 5  35  ? -15.294 -3.788  4.410  1.00 157.55 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I 5  35  ? -15.297 -2.998  5.484  1.00 157.56 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I 5  35  ? -15.619 -5.094  4.553  1.00 157.45 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I 5  35  ? -15.613 -5.882  3.468  1.00 157.57 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I 5  35  ? -15.320 -5.555  2.206  1.00 157.69 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I 5  35  ? -15.001 -4.249  2.097  1.00 157.84 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I 5  36  ? -16.666 -6.076  -3.018 1.00 157.05 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I 5  36  ? -16.618 -7.318  -3.825 1.00 156.88 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I 5  36  ? -17.644 -5.016  -3.362 1.00 157.00 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I 5  36  ? -16.876 -6.455  -1.477 1.00 156.41 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I 5  36  ? -16.734 -7.798  -1.015 1.00 155.38 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I 5  36  ? -17.840 -8.143  -0.032 1.00 154.41 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I 5  36  ? -17.708 -7.300  1.146  1.00 154.31 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I 5  36  ? -19.265 -7.956  -0.566 1.00 153.52 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I 5  36  ? -20.033 -9.167  -0.360 1.00 152.08 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I 5  36  ? -19.767 -6.732  0.200  1.00 153.79 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I 5  36  ? -18.983 -6.811  1.507  1.00 154.14 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I 5  36  ? -18.837 -5.501  2.231  1.00 154.11 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I 5  36  ? -19.026 -5.446  3.604  1.00 153.97 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I 5  36  ? -19.307 -6.412  4.293  1.00 153.71 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I 5  36  ? -18.865 -4.194  4.152  1.00 154.08 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I 5  36  ? -18.545 -3.017  3.485  1.00 154.23 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I 5  36  ? -18.426 -1.944  4.076  1.00 154.14 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I 5  36  ? -18.365 -3.145  2.053  1.00 154.25 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I 5  36  ? -18.019 -1.954  1.204  1.00 154.19 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I 5  36  ? -18.517 -4.362  1.507  1.00 154.21 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I 5  37  ? -21.626 -9.262  -0.131 1.00 150.87 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I 5  37  ? -22.080 -10.556 -0.689 1.00 150.91 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I 5  37  ? -22.297 -8.016  -0.570 1.00 150.73 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I 5  37  ? -21.724 -9.351  1.464  1.00 149.54 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I 5  37  ? -21.072 -10.400 2.190  1.00 147.03 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I 5  37  ? -21.520 -10.413 3.644  1.00 145.19 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I 5  37  ? -21.231 -9.131  4.261  1.00 144.80 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I 5  37  ? -23.008 -10.688 3.859  1.00 143.93 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I 5  37  ? -23.150 -11.704 4.857  1.00 142.01 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I 5  37  ? -23.604 -9.336  4.266  1.00 143.97 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I 5  37  ? -22.404 -8.558  4.809  1.00 144.39 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I 5  37  ? -22.411 -7.075  4.507  1.00 144.31 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I 5  37  ? -22.386 -6.171  5.556  1.00 144.41 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I 5  37  ? -22.362 -6.491  6.733  1.00 144.71 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I 5  37  ? -22.392 -4.850  5.175  1.00 144.28 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I 5  37  ? -22.420 -4.344  3.887  1.00 144.12 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I 5  37  ? -22.425 -3.135  3.667  1.00 144.14 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I 5  37  ? -22.444 -5.335  2.835  1.00 144.03 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I 5  37  ? -22.480 -4.912  1.394  1.00 143.90 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I 5  37  ? -22.435 -6.631  3.192  1.00 144.13 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I 5  38  ? -24.567 -12.359 5.234  1.00 140.60 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I 5  38  ? -24.290 -13.719 5.748  1.00 140.54 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I 5  38  ? -25.511 -12.187 4.104  1.00 140.54 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I 5  38  ? -25.073 -11.431 6.443  1.00 138.97 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I 5  38  ? -24.205 -11.109 7.546  1.00 135.64 ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I 5  38  ? -24.800 -10.059 8.474  1.00 132.99 ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I 5  38  ? -24.620 -8.720  7.936  1.00 132.34 ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I 5  38  ? -26.295 -10.211 8.761  1.00 131.44 ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I 5  38  ? -26.503 -10.197 10.167 1.00 129.16 ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I 5  38  ? -26.919 -8.992  8.085  1.00 131.51 ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I 5  38  ? -25.788 -7.982  8.230  1.00 132.01 ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I 5  38  ? -25.907 -6.775  7.338  1.00 132.19 ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I 5  38  ? -26.067 -5.522  7.908  1.00 132.18 ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I 5  38  ? -26.113 -5.321  9.108  1.00 132.09 ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I 5  38  ? -26.172 -4.488  7.007  1.00 132.27 ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I 5  38  ? -26.132 -4.573  5.623  1.00 132.38 ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I 5  38  ? -26.237 -3.576  4.911  1.00 132.47 ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I 5  38  ? -25.965 -5.909  5.090  1.00 132.26 ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I 5  38  ? -25.913 -6.145  3.608  1.00 132.08 ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I 5  38  ? -25.863 -6.928  5.960  1.00 132.33 ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I 5  39  ? -26.652 -11.547 11.011 1.00 127.33 ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I 5  39  ? -25.541 -12.461 10.659 1.00 127.26 ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I 5  39  ? -28.058 -11.993 10.898 1.00 127.19 ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I 5  39  ? -26.424 -11.042 12.505 1.00 126.74 ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I 5  39  ? -25.242 -10.335 12.840 1.00 126.10 ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I 5  39  ? -25.520 -9.183  13.792 1.00 125.83 ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I 5  39  ? -25.935 -8.002  13.061 1.00 125.83 ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I 5  39  ? -26.594 -9.425  14.843 1.00 125.66 ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I 5  39  ? -26.132 -8.879  16.072 1.00 125.18 ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I 5  39  ? -27.835 -8.712  14.300 1.00 125.93 ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I 5  39  ? -27.261 -7.636  13.387 1.00 126.24 ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I 5  39  ? -27.966 -7.500  12.118 1.00 127.24 ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I 5  39  ? -28.514 -8.502  11.349 1.00 127.72 ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I 5  39  ? -29.075 -8.079  10.251 1.00 127.89 ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I 5  39  ? -28.881 -6.706  10.292 1.00 128.12 ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I 5  39  ? -29.274 -5.708  9.370  1.00 128.58 ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I 5  39  ? -29.887 -5.869  8.305  1.00 128.99 ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I 5  39  ? -28.886 -4.429  9.788  1.00 128.64 ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I 5  39  ? -28.202 -4.158  10.957 1.00 128.24 ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I 5  39  ? -27.905 -2.877  11.210 1.00 128.20 ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I 5  39  ? -27.830 -5.087  11.826 1.00 128.06 ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I 5  39  ? -28.201 -6.332  11.433 1.00 127.82 ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I 5  40  ? -27.000 -8.951  17.410 1.00 124.75 ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I 5  40  ? -26.049 -8.825  18.534 1.00 124.80 ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I 5  40  ? -27.893 -10.131 17.342 1.00 124.71 ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I 5  40  ? -27.917 -7.641  17.323 1.00 124.92 ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I 5  40  ? -27.366 -6.322  17.311 1.00 125.66 ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I 5  40  ? -28.445 -5.269  17.080 1.00 126.72 ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I 5  40  ? -28.988 -5.395  15.740 1.00 127.13 ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I 5  40  ? -29.659 -5.317  18.007 1.00 127.45 ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I 5  40  ? -30.030 -3.995  18.368 1.00 128.39 ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I 5  40  ? -30.746 -5.970  17.158 1.00 127.24 ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I 5  40  ? -30.401 -5.365  15.804 1.00 127.23 ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I 5  40  ? -30.936 -6.058  14.632 1.00 127.35 ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I 5  40  ? -31.263 -7.390  14.504 1.00 127.49 ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I 5  40  ? -31.712 -7.705  13.319 1.00 127.45 ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I 5  40  ? -31.678 -6.505  12.616 1.00 127.24 ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I 5  40  ? -32.046 -6.216  11.278 1.00 127.08 ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I 5  40  ? -32.486 -6.998  10.423 1.00 127.30 ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I 5  40  ? -31.855 -4.868  10.961 1.00 126.66 ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I 5  40  ? -31.368 -3.920  11.832 1.00 126.39 ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I 5  40  ? -31.250 -2.673  11.361 1.00 126.22 ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I 5  40  ? -31.021 -4.176  13.085 1.00 126.62 ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I 5  40  ? -31.200 -5.483  13.410 1.00 127.10 ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I 5  41  ? -30.054 -3.563  19.907 1.00 129.19 ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I 5  41  ? -28.678 -3.712  20.431 1.00 129.07 ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I 5  41  ? -31.181 -4.269  20.562 1.00 128.77 ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I 5  41  ? -30.408 -2.003  19.838 1.00 130.10 ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I 5  41  ? -29.671 -1.113  18.993 1.00 131.61 ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I 5  41  ? -30.588 -0.268  18.118 1.00 132.75 ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I 5  41  ? -31.056 -1.057  16.995 1.00 132.78 ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I 5  41  ? -31.820 0.301   18.824 1.00 133.79 ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I 5  41  ? -31.764 1.748   18.780 1.00 135.26 ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I 5  41  ? -33.011 -0.365  18.123 1.00 133.46 ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I 5  41  ? -32.443 -0.885  16.806 1.00 133.30 ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I 5  41  ? -32.977 -2.180  16.378 1.00 133.76 ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I 5  41  ? -33.087 -3.317  17.135 1.00 133.89 ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I 5  41  ? -33.594 -4.345  16.496 1.00 133.85 ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I 5  41  ? -33.830 -3.853  15.225 1.00 133.96 ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I 5  41  ? -34.363 -4.451  14.064 1.00 133.89 ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I 5  41  ? -34.761 -5.726  14.022 1.00 133.68 ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I 5  41  ? -34.473 -3.683  12.954 1.00 134.09 ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I 5  41  ? -34.072 -2.401  13.006 1.00 134.01 ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I 5  41  ? -33.551 -1.731  14.037 1.00 133.97 ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I 5  41  ? -33.455 -2.519  15.128 1.00 134.00 ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I 5  42  ? -33.012 2.725   18.528 1.00 136.30 ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I 5  42  ? -32.522 4.114   18.676 1.00 136.11 ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I 5  42  ? -34.168 2.272   19.339 1.00 136.16 ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I 5  42  ? -33.311 2.443   16.983 1.00 137.22 ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I 5  42  ? -33.698 3.474   16.100 1.00 138.81 ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I 5  42  ? -35.014 3.105   15.447 1.00 140.15 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I 5  42  ? -35.073 1.674   15.196 1.00 140.38 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I 5  42  ? -36.242 3.462   16.280 1.00 140.98 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I 5  42  ? -37.076 4.309   15.504 1.00 142.32 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I 5  42  ? -36.906 2.114   16.548 1.00 140.93 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I 5  42  ? -36.413 1.271   15.376 1.00 140.87 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I 5  42  ? -36.495 -0.173  15.611 1.00 141.13 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I 5  42  ? -36.047 -0.856  16.708 1.00 141.31 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I 5  42  ? -36.255 -2.149  16.664 1.00 141.43 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I 5  42  ? -36.891 -2.333  15.450 1.00 141.35 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I 5  42  ? -37.382 -3.487  14.801 1.00 141.34 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I 5  42  ? -37.297 -4.713  15.325 1.00 141.26 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I 5  42  ? -37.971 -3.332  13.593 1.00 141.33 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I 5  42  ? -38.058 -2.102  13.068 1.00 141.31 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I 5  42  ? -37.632 -0.946  13.584 1.00 141.35 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I 5  42  ? -37.050 -1.128  14.786 1.00 141.26 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I 5  43  ? -38.182 5.279   16.139 1.00 143.33 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I 5  43  ? -37.504 6.541   16.508 1.00 143.50 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I 5  43  ? -38.965 4.534   17.153 1.00 143.28 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I 5  43  ? -39.140 5.568   14.888 1.00 143.89 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I 5  43  ? -39.091 4.733   13.724 1.00 144.93 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I 5  43  ? -40.206 3.698   13.703 1.00 145.61 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I 5  43  ? -39.695 2.391   14.084 1.00 145.81 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I 5  43  ? -41.400 3.973   14.625 1.00 145.91 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I 5  43  ? -42.597 4.092   13.857 1.00 146.33 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I 5  43  ? -41.449 2.745   15.528 1.00 146.06 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I 5  43  ? -40.805 1.708   14.619 1.00 146.24 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I 5  43  ? -40.441 0.465   15.304 1.00 146.68 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I 5  43  ? -39.681 0.315   16.433 1.00 146.69 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I 5  43  ? -39.538 -0.929  16.823 1.00 146.68 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I 5  43  ? -40.263 -1.648  15.889 1.00 146.83 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I 5  43  ? -40.519 -3.027  15.739 1.00 146.97 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I 5  43  ? -40.037 -3.953  16.573 1.00 147.32 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I 5  43  ? -41.287 -3.420  14.697 1.00 146.88 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I 5  43  ? -41.773 -2.492  13.860 1.00 146.72 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I 5  43  ? -41.603 -1.169  13.901 1.00 146.75 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I 5  43  ? -40.832 -0.807  14.947 1.00 146.81 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I 5  44  ? -43.905 4.832   14.416 1.00 146.57 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I 5  44  ? -44.106 6.059   13.616 1.00 146.59 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I 5  44  ? -43.818 4.924   15.891 1.00 146.58 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I 5  44  ? -45.082 3.807   14.071 1.00 146.98 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I 5  44  ? -45.105 3.077   12.843 1.00 147.37 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I 5  44  ? -45.681 1.684   13.050 1.00 147.71 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I 5  44  ? -44.733 0.856   13.781 1.00 147.87 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I 5  44  ? -46.999 1.610   13.831 1.00 147.79 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I 5  44  ? -47.942 0.811   13.102 1.00 147.69 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I 5  44  ? -46.575 0.978   15.156 1.00 147.93 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I 5  44  ? -45.491 0.038   14.650 1.00 148.03 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I 5  44  ? -44.648 -0.592  15.725 1.00 148.12 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I 5  44  ? -44.699 -1.988  15.918 1.00 147.99 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I 5  44  ? -45.430 -2.688  15.204 1.00 147.82 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I 5  44  ? -43.934 -2.543  16.895 1.00 148.02 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I 5  44  ? -43.152 -1.770  17.658 1.00 148.18 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I 5  44  ? -42.419 -2.365  18.603 1.00 148.37 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I 5  44  ? -43.087 -0.351  17.484 1.00 148.17 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I 5  44  ? -43.843 0.188   16.517 1.00 148.17 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I 5  45  ? -49.225 0.096   13.751 1.00 147.62 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I 5  45  ? -50.250 0.034   12.684 1.00 147.69 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I 5  45  ? -49.566 0.730   15.047 1.00 147.49 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I 5  45  ? -48.677 -1.383  14.047 1.00 147.71 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I 5  45  ? -49.411 -2.549  13.652 1.00 147.56 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I 5  45  ? -49.877 -3.361  14.853 1.00 147.31 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I 5  45  ? -48.781 -3.565  15.786 1.00 147.58 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I 5  45  ? -51.008 -2.754  15.684 1.00 146.91 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I 5  45  ? -51.830 -3.805  16.155 1.00 146.08 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I 5  45  ? -50.265 -2.129  16.859 1.00 147.17 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I 5  45  ? -49.249 -3.245  17.084 1.00 147.50 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I 5  45  ? -48.089 -2.946  17.989 1.00 147.51 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I 5  45  ? -47.409 -4.008  18.562 1.00 147.37 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I 5  45  ? -47.690 -5.183  18.379 1.00 147.03 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I 5  45  ? -46.367 -3.634  19.374 1.00 147.38 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I 5  45  ? -45.938 -2.349  19.668 1.00 147.39 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I 5  45  ? -44.984 -2.141  20.413 1.00 147.26 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I 5  45  ? -46.691 -1.288  19.039 1.00 147.47 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I 5  45  ? -46.331 0.151   19.277 1.00 147.55 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I 5  45  ? -47.715 -1.633  18.241 1.00 147.49 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I 5  46  ? -53.201 -4.190  15.438 1.00 145.50 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I 5  46  ? -53.022 -4.087  13.971 1.00 145.47 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I 5  46  ? -54.277 -3.437  16.125 1.00 145.48 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I 5  46  ? -53.361 -5.734  15.817 1.00 144.71 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I 5  46  ? -52.329 -6.676  15.516 1.00 143.23 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I 5  46  ? -52.091 -7.632  16.678 1.00 142.09 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I 5  46  ? -51.136 -7.054  17.607 1.00 142.10 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I 5  46  ? -53.305 -8.017  17.525 1.00 141.10 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I 5  46  ? -53.178 -9.380  17.926 1.00 139.40 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I 5  46  ? -53.205 -7.071  18.723 1.00 141.44 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I 5  46  ? -51.689 -7.037  18.911 1.00 141.93 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I 5  46  ? -51.137 -5.876  19.611 1.00 141.95 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I 5  46  ? -51.574 -4.571  19.571 1.00 141.72 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I 5  46  ? -50.859 -3.762  20.302 1.00 141.60 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I 5  46  ? -49.884 -4.578  20.861 1.00 141.69 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I 5  46  ? -48.820 -4.264  21.744 1.00 141.60 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I 5  46  ? -48.523 -3.161  22.224 1.00 141.45 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I 5  46  ? -48.060 -5.389  22.068 1.00 141.70 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I 5  46  ? -48.297 -6.662  21.597 1.00 141.82 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I 5  46  ? -47.461 -7.622  22.018 1.00 141.94 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I 5  46  ? -49.287 -6.968  20.767 1.00 141.86 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I 5  46  ? -50.040 -5.883  20.443 1.00 141.85 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I 5  47  ? -54.435 -10.369 18.025 1.00 137.82 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I 5  47  ? -54.395 -11.222 16.815 1.00 137.51 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I 5  47  ? -55.643 -9.570  18.338 1.00 137.62 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I 5  47  ? -54.129 -11.271 19.319 1.00 136.35 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I 5  47  ? -52.795 -11.544 19.776 1.00 133.81 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I 5  47  ? -52.648 -11.312 21.272 1.00 132.00 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I 5  47  ? -52.416 -9.900  21.521 1.00 131.73 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I 5  47  ? -53.855 -11.710 22.127 1.00 130.91 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I 5  47  ? -53.481 -12.646 23.142 1.00 129.42 ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I 5  47  ? -54.341 -10.394 22.732 1.00 131.06 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I 5  47  ? -53.068 -9.548  22.725 1.00 131.37 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I 5  47  ? -53.261 -8.046  22.798 1.00 131.11 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I 5  47  ? -52.154 -7.189  22.957 1.00 131.02 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I 5  47  ? -51.012 -7.661  23.034 1.00 130.87 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I 5  47  ? -52.362 -5.845  23.023 1.00 131.08 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I 5  47  ? -53.601 -5.344  22.939 1.00 131.13 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I 5  47  ? -53.758 -4.018  23.010 1.00 130.98 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I 5  47  ? -54.740 -6.192  22.780 1.00 131.23 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I 5  47  ? -54.522 -7.514  22.717 1.00 131.25 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I 5  48  ? -53.654 -14.226 22.910 1.00 128.09 ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I 5  48  ? -52.620 -14.635 21.935 1.00 128.09 ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I 5  48  ? -55.080 -14.500 22.623 1.00 128.49 ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I 5  48  ? -53.328 -14.919 24.318 1.00 126.33 ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I 5  48  ? -53.199 -14.181 25.522 1.00 123.76 ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I 5  48  ? -51.736 -13.850 25.786 1.00 121.87 ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I 5  48  ? -51.456 -12.474 25.407 1.00 121.38 ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I 5  48  ? -51.302 -13.976 27.243 1.00 120.56 ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I 5  48  ? -49.933 -14.389 27.338 1.00 118.18 ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I 5  48  ? -51.500 -12.564 27.780 1.00 120.77 ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I 5  48  ? -51.293 -11.668 26.562 1.00 121.04 ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I 5  48  ? -52.244 -10.501 26.531 1.00 121.00 ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I 5  48  ? -51.749 -9.219  26.702 1.00 121.01 ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I 5  48  ? -50.571 -8.963  26.875 1.00 121.18 ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I 5  48  ? -52.692 -8.224  26.660 1.00 120.84 ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I 5  48  ? -54.053 -8.374  26.473 1.00 121.00 ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I 5  48  ? -54.795 -7.398  26.457 1.00 121.15 ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I 5  48  ? -54.516 -9.739  26.302 1.00 121.06 ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I 5  48  ? -55.968 -10.060 26.087 1.00 121.11 ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I 5  48  ? -53.600 -10.717 26.342 1.00 121.01 ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I 5  49  ? -49.411 -15.267 28.573 1.00 115.79 ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I 5  49  ? -48.032 -15.698 28.254 1.00 115.72 ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I 5  49  ? -50.441 -16.277 28.906 1.00 115.65 ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I 5  49  ? -49.359 -14.221 29.777 1.00 114.26 ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I 5  49  ? -48.414 -13.153 29.794 1.00 111.91 ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I 5  49  ? -48.862 -12.093 30.786 1.00 110.26 ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I 5  49  ? -50.020 -11.379 30.272 1.00 110.36 ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I 5  49  ? -49.298 -12.616 32.155 1.00 108.85 ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I 5  49  ? -48.958 -11.660 33.144 1.00 106.30 ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I 5  49  ? -50.810 -12.691 32.015 1.00 109.52 ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I 5  49  ? -50.988 -11.356 31.301 1.00 110.30 ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I 5  49  ? -52.365 -11.047 30.787 1.00 110.89 ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I 5  49  ? -52.772 -9.707  30.722 1.00 111.01 ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I 5  49  ? -51.994 -8.814  31.075 1.00 111.14 ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I 5  49  ? -54.021 -9.426  30.267 1.00 111.40 ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I 5  49  ? -54.843 -10.413 29.892 1.00 111.55 ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I 5  49  ? -56.059 -10.079 29.454 1.00 111.73 ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I 5  49  ? -54.453 -11.786 29.954 1.00 111.48 ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I 5  49  ? -53.220 -12.051 30.409 1.00 111.40 ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I 5  50  ? -47.703 -11.910 34.088 1.00 103.96 ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I 5  50  ? -46.492 -12.014 33.245 1.00 103.76 ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I 5  50  ? -48.071 -12.993 35.024 1.00 104.16 ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I 5  50  ? -47.641 -10.559 34.924 1.00 103.26 ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I 5  50  ? -47.174 -9.361  34.322 1.00 102.56 ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I 5  50  ? -48.083 -8.218  34.713 1.00 101.98 ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I 5  50  ? -49.381 -8.471  34.131 1.00 101.57 ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I 5  50  ? -48.308 -8.103  36.216 1.00 102.10 ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I 5  50  ? -47.942 -6.801  36.654 1.00 102.66 ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I 5  50  ? -49.794 -8.425  36.412 1.00 101.73 ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I 5  50  ? -50.370 -8.067  35.049 1.00 101.39 ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I 5  50  ? -51.669 -8.711  34.646 1.00 100.92 ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I 5  50  ? -52.813 -7.916  34.432 1.00 100.59 ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I 5  50  ? -52.753 -6.690  34.594 1.00 100.48 ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I 5  50  ? -53.974 -8.511  34.052 1.00 100.33 ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I 5  50  ? -54.027 -9.833  33.879 1.00 100.36 ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I 5  50  ? -55.193 -10.367 33.507 1.00 100.04 ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I 5  50  ? -52.880 -10.659 34.087 1.00 100.80 ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I 5  50  ? -51.734 -10.065 34.458 1.00 100.83 ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I 5  51  ? -47.537 -6.540  38.181 1.00 103.70 ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I 5  51  ? -46.193 -5.929  38.197 1.00 103.13 ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I 5  51  ? -47.825 -7.753  38.977 1.00 103.45 ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I 5  51  ? -48.604 -5.443  38.636 1.00 105.63 ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I 5  51  ? -48.549 -4.113  38.115 1.00 107.80 ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I 5  51  ? -49.850 -3.367  38.368 1.00 109.09 ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I 5  51  ? -50.957 -4.072  37.758 1.00 108.93 ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I 5  51  ? -50.213 -3.167  39.835 1.00 110.36 ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I 5  51  ? -50.629 -1.816  39.993 1.00 112.60 ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I 5  51  ? -51.335 -4.175  40.086 1.00 110.00 ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I 5  51  ? -51.971 -4.324  38.709 1.00 109.59 ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I 5  51  ? -52.503 -5.655  38.424 1.00 109.92 ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I 5  51  ? -51.878 -6.855  38.639 1.00 109.99 ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I 5  51  ? -52.590 -7.896  38.280 1.00 110.03 ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I 5  51  ? -53.762 -7.344  37.793 1.00 110.06 ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I 5  51  ? -54.933 -7.922  37.257 1.00 110.19 ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I 5  51  ? -55.095 -9.243  37.126 1.00 109.77 ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I 5  51  ? -55.927 -7.087  36.862 1.00 110.54 ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I 5  51  ? -55.761 -5.760  36.994 1.00 110.19 ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I 5  51  ? -54.706 -5.106  37.489 1.00 110.02 ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I 5  51  ? -53.731 -5.960  37.872 1.00 110.05 ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I 5  52  ? -51.053 -1.185  41.401 1.00 114.19 ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I 5  52  ? -50.722 0.256   41.342 1.00 113.92 ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I 5  52  ? -50.496 -2.018  42.492 1.00 113.84 ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I 5  52  ? -52.648 -1.363  41.394 1.00 115.95 ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I 5  52  ? -53.459 -0.941  40.291 1.00 118.48 ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I 5  52  ? -54.894 -1.427  40.440 1.00 120.76 ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I 5  52  ? -54.992 -2.797  39.979 1.00 121.22 ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I 5  52  ? -55.443 -1.436  41.869 1.00 122.54 ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I 5  52  ? -56.488 -0.478  42.009 1.00 125.44 ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I 5  52  ? -55.973 -2.852  42.094 1.00 122.08 ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I 5  52  ? -56.049 -3.416  40.683 1.00 121.49 ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I 5  52  ? -55.920 -4.913  40.630 1.00 121.19 ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I 5  52  ? -56.906 -5.660  40.010 1.00 121.13 ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I 5  52  ? -57.895 -5.185  39.476 1.00 121.14 ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I 5  52  ? -56.686 -7.016  40.025 1.00 121.03 ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I 5  52  ? -55.615 -7.689  40.587 1.00 120.78 ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I 5  52  ? -55.531 -8.911  40.535 1.00 120.88 ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I 5  52  ? -54.621 -6.853  41.223 1.00 120.70 ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I 5  52  ? -53.405 -7.447  41.872 1.00 120.45 ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I 5  52  ? -54.822 -5.527  41.213 1.00 120.93 ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I 5  53  ? -57.008 0.022   43.446 1.00 127.69 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I 5  53  ? -57.099 1.494   43.360 1.00 127.72 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I 5  53  ? -56.188 -0.577  44.524 1.00 127.44 ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I 5  53  ? -58.483 -0.606  43.550 1.00 129.70 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I 5  53  ? -59.253 -0.925  42.381 1.00 133.09 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I 5  53  ? -60.351 -1.955  42.635 1.00 135.80 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I 5  53  ? -59.845 -3.290  42.356 1.00 136.26 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I 5  53  ? -60.942 -2.017  44.049 1.00 137.60 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I 5  53  ? -62.355 -2.251  43.981 1.00 139.80 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I 5  53  ? -60.222 -3.211  44.668 1.00 137.33 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I 5  53  ? -60.154 -4.131  43.452 1.00 136.97 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I 5  53  ? -59.155 -5.252  43.531 1.00 137.20 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I 5  53  ? -59.418 -6.439  42.827 1.00 137.15 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I 5  53  ? -60.457 -6.537  42.159 1.00 136.96 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I 5  53  ? -58.521 -7.458  42.894 1.00 137.10 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I 5  53  ? -57.408 -7.325  43.624 1.00 137.15 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I 5  53  ? -56.562 -8.358  43.656 1.00 137.14 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I 5  53  ? -57.117 -6.127  44.351 1.00 137.09 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I 5  53  ? -58.008 -5.127  44.275 1.00 137.12 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I 5  54  ? -63.361 -1.714  45.111 1.00 141.10 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I 5  54  ? -63.384 -0.236  45.005 1.00 140.93 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I 5  54  ? -62.995 -2.347  46.401 1.00 140.88 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I 5  54  ? -64.784 -2.307  44.652 1.00 141.98 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I 5  54  ? -64.900 -3.344  43.659 1.00 143.53 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I 5  54  ? -65.773 -4.517  44.099 1.00 144.74 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I 5  54  ? -64.963 -5.722  44.135 1.00 144.94 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I 5  54  ? -66.441 -4.427  45.474 1.00 145.57 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I 5  54  ? -67.730 -5.062  45.452 1.00 146.67 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I 5  54  ? -65.454 -5.149  46.387 1.00 145.55 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I 5  54  ? -64.819 -6.187  45.466 1.00 145.39 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I 5  54  ? -63.399 -6.401  45.748 1.00 145.58 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I 5  54  ? -62.511 -5.500  46.277 1.00 145.60 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I 5  54  ? -61.295 -5.963  46.427 1.00 145.47 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I 5  54  ? -61.387 -7.262  45.964 1.00 145.42 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I 5  54  ? -60.435 -8.295  45.854 1.00 145.27 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I 5  54  ? -59.159 -8.147  46.225 1.00 144.94 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I 5  54  ? -60.849 -9.481  45.350 1.00 145.41 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I 5  54  ? -62.133 -9.622  44.979 1.00 145.52 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I 5  54  ? -63.118 -8.722  45.035 1.00 145.61 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I 5  54  ? -62.676 -7.553  45.542 1.00 145.59 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I 5  55  ? -68.622 -5.318  46.769 1.00 147.47 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I 5  55  ? -70.038 -5.169  46.365 1.00 147.41 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I 5  55  ? -68.108 -4.500  47.894 1.00 147.43 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I 5  55  ? -68.328 -6.862  47.100 1.00 148.01 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I 5  55  ? -68.703 -7.900  46.183 1.00 148.54 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I 5  55  ? -68.069 -9.243  46.526 1.00 148.82 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I 5  55  ? -66.637 -9.102  46.721 1.00 148.85 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I 5  55  ? -68.594 -9.941  47.779 1.00 149.00 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I 5  55  ? -68.672 -11.344 47.522 1.00 149.52 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I 5  55  ? -67.531 -9.619  48.828 1.00 148.78 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I 5  55  ? -66.267 -9.649  47.973 1.00 148.79 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I 5  55  ? -65.134 -8.871  48.480 1.00 148.66 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I 5  55  ? -65.155 -7.589  48.965 1.00 148.56 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I 5  55  ? -63.982 -7.138  49.340 1.00 148.25 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I 5  55  ? -63.128 -8.195  49.081 1.00 148.14 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I 5  55  ? -61.739 -8.356  49.258 1.00 147.88 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I 5  55  ? -60.955 -7.398  49.762 1.00 147.74 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I 5  55  ? -61.188 -9.540  48.900 1.00 147.76 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I 5  55  ? -61.976 -10.498 48.393 1.00 147.66 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I 5  55  ? -63.293 -10.463 48.182 1.00 147.92 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I 5  55  ? -63.816 -9.274  48.548 1.00 148.32 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I 5  56  ? -69.677 -12.316 48.310 1.00 150.03 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I 5  56  ? -70.672 -12.809 47.332 1.00 150.14 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I 5  56  ? -70.129 -11.638 49.549 1.00 149.93 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I 5  56  ? -68.748 -13.552 48.735 1.00 149.83 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I 5  56  ? -67.862 -14.194 47.805 1.00 149.26 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I 5  56  ? -66.677 -14.867 48.494 1.00 148.67 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I 5  56  ? -65.627 -13.895 48.749 1.00 148.88 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I 5  56  ? -66.986 -15.551 49.828 1.00 148.04 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I 5  56  ? -66.695 -16.949 49.723 1.00 146.79 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I 5  56  ? -66.108 -14.837 50.858 1.00 148.37 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I 5  56  ? -65.053 -14.120 50.022 1.00 148.89 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I 5  56  ? -64.646 -12.843 50.616 1.00 149.17 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I 5  56  ? -65.464 -11.812 50.997 1.00 149.29 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I 5  56  ? -64.834 -10.783 51.510 1.00 149.29 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I 5  56  ? -63.506 -11.162 51.467 1.00 149.23 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I 5  56  ? -62.323 -10.507 51.868 1.00 149.29 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I 5  56  ? -62.309 -9.285  52.408 1.00 149.34 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I 5  56  ? -61.152 -11.158 51.691 1.00 149.40 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I 5  56  ? -61.169 -12.385 51.148 1.00 149.43 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I 5  56  ? -62.217 -13.103 50.733 1.00 149.30 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I 5  56  ? -63.368 -12.430 50.922 1.00 149.23 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I 5  57  ? -66.771 -17.966 50.968 1.00 145.78 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I 5  57  ? -67.162 -19.292 50.437 1.00 145.86 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I 5  57  ? -67.558 -17.356 52.066 1.00 145.82 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I 5  57  ? -65.245 -18.044 51.444 1.00 144.36 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I 5  57  ? -64.167 -18.080 50.499 1.00 141.88 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I 5  57  ? -62.828 -17.942 51.204 1.00 139.93 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I 5  57  ? -62.587 -16.549 51.534 1.00 139.59 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I 5  57  ? -62.716 -18.727 52.509 1.00 138.67 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I 5  57  ? -61.567 -19.557 52.469 1.00 136.60 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I 5  57  ? -62.606 -17.666 53.602 1.00 138.89 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I 5  57  ? -62.071 -16.457 52.848 1.00 139.28 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I 5  57  ? -62.485 -15.176 53.412 1.00 139.30 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I 5  57  ? -63.765 -14.719 53.557 1.00 139.45 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I 5  57  ? -63.841 -13.524 54.090 1.00 139.76 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I 5  57  ? -62.522 -13.166 54.310 1.00 139.48 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I 5  57  ? -61.919 -12.006 54.856 1.00 139.32 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I 5  57  ? -62.609 -10.951 55.299 1.00 139.16 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I 5  57  ? -60.571 -11.972 54.936 1.00 139.23 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I 5  57  ? -59.872 -13.027 54.492 1.00 139.42 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I 5  57  ? -60.327 -14.165 53.961 1.00 139.54 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I 5  57  ? -61.672 -14.177 53.899 1.00 139.43 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I 5  58  ? -61.465 -20.893 53.344 1.00 134.83 ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I 5  58  ? -61.450 -22.027 52.391 1.00 134.36 ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I 5  58  ? -62.471 -20.849 54.433 1.00 134.85 ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I 5  58  ? -60.017 -20.763 54.020 1.00 133.39 ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I 5  58  ? -59.300 -19.524 54.034 1.00 131.00 ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I 5  58  ? -58.632 -19.229 55.375 1.00 129.39 ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I 5  58  ? -59.069 -17.930 55.852 1.00 129.13 ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I 5  58  ? -58.897 -20.173 56.549 1.00 128.17 ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I 5  58  ? -57.814 -20.084 57.476 1.00 126.23 ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I 5  58  ? -60.156 -19.563 57.157 1.00 128.54 ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I 5  58  ? -59.766 -18.087 57.076 1.00 128.76 ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I 5  58  ? -60.852 -17.108 57.113 1.00 128.44 ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I 5  58  ? -62.197 -17.308 56.899 1.00 128.34 ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I 5  58  ? -62.904 -16.216 57.001 1.00 128.27 ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I 5  58  ? -61.968 -15.233 57.303 1.00 128.20 ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I 5  58  ? -62.133 -13.843 57.539 1.00 128.20 ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I 5  58  ? -63.181 -13.185 57.519 1.00 128.12 ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I 5  58  ? -60.922 -13.200 57.814 1.00 128.01 ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I 5  58  ? -59.699 -13.829 57.861 1.00 127.77 ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I 5  58  ? -58.642 -13.054 58.139 1.00 127.66 ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I 5  58  ? -59.529 -15.129 57.645 1.00 127.76 ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I 5  58  ? -60.700 -15.766 57.375 1.00 128.10 ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I 5  59  ? -56.496 -20.994 57.400 1.00 124.67 ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I 5  59  ? -56.322 -21.510 56.023 1.00 124.85 ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I 5  59  ? -56.556 -21.936 58.540 1.00 124.45 ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I 5  59  ? -55.323 -19.950 57.697 1.00 122.97 ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I 5  59  ? -55.085 -18.835 56.848 1.00 120.92 ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I 5  59  ? -54.254 -17.755 57.537 1.00 119.97 ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I 5  59  ? -55.101 -16.794 58.219 1.00 120.35 ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I 5  59  ? -53.262 -18.127 58.633 1.00 119.01 ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I 5  59  ? -52.364 -17.022 58.755 1.00 116.67 ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I 5  59  ? -54.176 -18.219 59.853 1.00 119.59 ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I 5  59  ? -55.058 -16.992 59.624 1.00 120.30 ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I 5  59  ? -56.465 -17.096 59.987 1.00 120.75 ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I 5  59  ? -57.276 -18.200 59.871 1.00 121.11 ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I 5  59  ? -58.505 -17.983 60.244 1.00 121.29 ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I 5  59  ? -58.511 -16.646 60.618 1.00 121.05 ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I 5  59  ? -59.572 -15.848 61.105 1.00 121.08 ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I 5  59  ? -60.746 -16.195 61.300 1.00 121.13 ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I 5  59  ? -59.165 -14.537 61.371 1.00 121.02 ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I 5  59  ? -57.885 -14.058 61.180 1.00 120.82 ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I 5  59  ? -57.679 -12.768 61.484 1.00 120.59 ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I 5  59  ? -56.881 -14.798 60.717 1.00 120.72 ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I 5  59  ? -57.264 -16.079 60.459 1.00 120.85 ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I 5  60  ? -50.895 -17.122 59.374 1.00 114.68 ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I 5  60  ? -49.966 -16.717 58.299 1.00 114.32 ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I 5  60  ? -50.717 -18.419 60.069 1.00 114.33 ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I 5  60  ? -50.937 -15.986 60.497 1.00 114.10 ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I 5  60  ? -51.239 -14.630 60.169 1.00 113.50 ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I 5  60  ? -51.651 -13.819 61.393 1.00 113.13 ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I 5  60  ? -52.981 -14.208 61.833 1.00 113.52 ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I 5  60  ? -50.769 -13.930 62.633 1.00 112.76 ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I 5  60  ? -50.714 -12.671 63.294 1.00 112.20 ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I 5  60  ? -51.503 -14.969 63.482 1.00 113.19 ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I 5  60  ? -52.961 -14.609 63.194 1.00 113.23 ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I 5  60  ? -54.008 -15.690 63.342 1.00 113.00 ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I 5  60  ? -55.333 -15.318 63.626 1.00 112.76 ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I 5  60  ? -55.607 -14.121 63.770 1.00 112.39 ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I 5  60  ? -56.287 -16.284 63.742 1.00 112.84 ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I 5  60  ? -55.969 -17.573 63.581 1.00 112.63 ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I 5  60  ? -56.942 -18.482 63.704 1.00 112.30 ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I 5  60  ? -54.630 -17.975 63.285 1.00 112.78 ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I 5  60  ? -53.697 -17.015 63.171 1.00 112.91 ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I 5  61  ? -49.469 -11.687 63.098 1.00 111.92 ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I 5  61  ? -49.573 -11.073 61.754 1.00 111.82 ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I 5  61  ? -48.259 -12.430 63.500 1.00 111.91 ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I 5  61  ? -49.688 -10.559 64.209 1.00 112.55 ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I 5  61  ? -50.756 -9.618  64.130 1.00 113.10 ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I 5  61  ? -51.495 -9.479  65.454 1.00 113.64 ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I 5  61  ? -52.369 -10.616 65.666 1.00 113.61 ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I 5  61  ? -50.633 -9.344  66.703 1.00 114.09 ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I 5  61  ? -51.037 -8.135  67.308 1.00 115.79 ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I 5  61  ? -50.963 -10.575 67.552 1.00 113.60 ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I 5  61  ? -52.301 -11.063 67.002 1.00 113.67 ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I 5  61  ? -52.491 -12.514 66.932 1.00 114.28 ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I 5  61  ? -51.560 -13.467 66.609 1.00 114.77 ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I 5  61  ? -52.014 -14.700 66.606 1.00 114.65 ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I 5  61  ? -53.346 -14.549 66.941 1.00 114.88 ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I 5  61  ? -54.391 -15.483 67.109 1.00 115.11 ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I 5  61  ? -54.226 -16.799 66.943 1.00 115.08 ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I 5  61  ? -55.613 -15.010 67.450 1.00 115.36 ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I 5  61  ? -55.775 -13.686 67.614 1.00 115.22 ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I 5  61  ? -54.867 -12.713 67.482 1.00 115.01 ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I 5  61  ? -53.661 -13.212 67.142 1.00 114.72 ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I 5  62  ? -50.239 -7.370  68.465 1.00 117.42 ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I 5  62  ? -50.540 -5.934  68.274 1.00 117.44 ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I 5  62  ? -48.827 -7.814  68.504 1.00 117.17 ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I 5  62  ? -50.981 -7.902  69.785 1.00 118.83 ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I 5  62  ? -52.411 -7.816  69.888 1.00 120.92 ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I 5  62  ? -53.024 -8.854  70.817 1.00 122.35 ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I 5  62  ? -53.069 -10.158 70.195 1.00 122.32 ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I 5  62  ? -52.284 -9.099  72.121 1.00 123.50 ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I 5  62  ? -52.778 -8.177  73.082 1.00 125.59 ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I 5  62  ? -52.646 -10.545 72.476 1.00 122.93 ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I 5  62  ? -53.307 -11.099 71.216 1.00 122.12 ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I 5  62  ? -52.771 -12.423 70.780 1.00 121.83 ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I 5  62  ? -53.633 -13.494 70.619 1.00 121.69 ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I 5  62  ? -54.832 -13.430 70.812 1.00 121.68 ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I 5  62  ? -53.032 -14.662 70.215 1.00 121.54 ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I 5  62  ? -51.685 -14.858 69.963 1.00 121.54 ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I 5  62  ? -51.258 -15.949 69.606 1.00 121.67 ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I 5  62  ? -50.835 -13.699 70.149 1.00 121.63 ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I 5  62  ? -49.355 -13.763 69.913 1.00 121.49 ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I 5  62  ? -51.413 -12.556 70.542 1.00 121.78 ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I 5  63  ? -51.946 -7.783  74.392 1.00 127.23 ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I 5  63  ? -51.648 -6.340  74.274 1.00 127.22 ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I 5  63  ? -50.839 -8.743  74.609 1.00 127.10 ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I 5  63  ? -53.015 -8.003  75.565 1.00 128.62 ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I 5  63  ? -53.846 -9.171  75.600 1.00 130.67 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I 5  63  ? -53.568 -10.088 76.787 1.00 132.02 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I 5  63  ? -53.185 -11.404 76.304 1.00 132.45 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I 5  63  ? -52.485 -9.668  77.782 1.00 132.69 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I 5  63  ? -52.992 -9.927  79.107 1.00 133.53 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I 5  63  ? -51.281 -10.509 77.357 1.00 132.78 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I 5  63  ? -51.940 -11.787 76.853 1.00 132.91 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I 5  63  ? -51.191 -12.508 75.821 1.00 133.46 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I 5  63  ? -50.192 -12.028 75.004 1.00 133.67 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I 5  63  ? -49.716 -12.916 74.175 1.00 133.76 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I 5  63  ? -50.446 -14.063 74.453 1.00 133.86 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I 5  63  ? -50.379 -15.355 73.870 1.00 134.00 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I 5  63  ? -49.635 -15.751 72.961 1.00 133.86 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I 5  63  ? -51.298 -16.234 74.447 1.00 134.21 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I 5  63  ? -52.175 -15.902 75.457 1.00 134.17 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I 5  63  ? -52.991 -16.872 75.891 1.00 134.28 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I 5  63  ? -52.247 -14.696 76.007 1.00 134.04 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I 5  63  ? -51.358 -13.827 75.461 1.00 133.78 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I 5  64  ? -52.146 -10.363 80.404 1.00 134.16 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I 5  64  ? -52.830 -9.758  81.566 1.00 134.46 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I 5  64  ? -50.703 -10.086 80.215 1.00 134.06 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I 5  64  ? -52.376 -11.948 80.441 1.00 133.99 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I 5  64  ? -53.703 -12.492 80.475 1.00 134.02 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I 5  64  ? -53.722 -13.920 81.003 1.00 134.11 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I 5  64  ? -53.186 -14.817 79.994 1.00 134.17 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I 5  64  ? -52.918 -14.176 82.280 1.00 134.16 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I 5  64  ? -53.612 -15.107 83.131 1.00 133.78 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I 5  64  ? -51.589 -14.727 81.758 1.00 134.45 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I 5  64  ? -52.001 -15.438 80.468 1.00 134.52 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I 5  64  ? -50.946 -15.433 79.383 1.00 134.53 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I 5  64  ? -50.759 -16.572 78.618 1.00 134.47 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I 5  64  ? -51.402 -17.599 78.763 1.00 134.44 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I 5  64  ? -49.778 -16.465 77.659 1.00 134.30 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I 5  64  ? -48.979 -15.367 77.390 1.00 134.04 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I 5  64  ? -48.132 -15.393 76.502 1.00 133.68 ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I 5  64  ? -49.222 -14.210 78.224 1.00 134.10 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I 5  64  ? -48.431 -12.948 78.045 1.00 134.14 ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I 5  64  ? -50.178 -14.297 79.163 1.00 134.28 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I 5  65  ? -52.979 -15.682 84.492 1.00 133.46 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I 5  65  ? -54.101 -16.093 85.369 1.00 133.51 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I 5  65  ? -51.964 -14.722 84.993 1.00 133.53 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I 5  65  ? -52.201 -16.990 84.000 1.00 132.22 ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I 5  65  ? -52.879 -18.217 83.748 1.00 130.51 ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I 5  65  ? -51.871 -19.277 83.340 1.00 129.47 ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I 5  65  ? -51.084 -18.779 82.227 1.00 129.58 ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I 5  65  ? -50.871 -19.666 84.430 1.00 128.45 ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I 5  65  ? -51.057 -21.033 84.801 1.00 126.31 ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I 5  65  ? -49.483 -19.413 83.825 1.00 128.99 ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I 5  65  ? -49.774 -19.307 82.328 1.00 129.41 ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I 5  65  ? -48.822 -18.466 81.494 1.00 129.25 ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I 5  65  ? -48.198 -19.045 80.399 1.00 129.14 ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I 5  65  ? -48.354 -20.207 80.061 1.00 129.33 ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I 5  65  ? -47.363 -18.205 79.699 1.00 128.82 ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I 5  65  ? -47.092 -16.875 79.966 1.00 128.69 ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I 5  65  ? -46.326 -16.215 79.273 1.00 128.42 ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I 5  65  ? -47.774 -16.326 81.114 1.00 128.97 ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I 5  65  ? -47.560 -14.892 81.506 1.00 129.00 ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I 5  65  ? -48.595 -17.134 81.811 1.00 129.17 ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I 5  66  ? -50.515 -21.587 86.205 1.00 124.84 ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I 5  66  ? -51.470 -22.618 86.673 1.00 124.73 ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I 5  66  ? -50.171 -20.429 87.065 1.00 124.50 ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I 5  66  ? -49.137 -22.303 85.816 1.00 123.33 ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I 5  66  ? -49.107 -23.496 85.028 1.00 120.35 ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I 5  66  ? -47.740 -23.686 84.389 1.00 118.01 ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I 5  66  ? -47.340 -22.469 83.703 1.00 117.71 ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I 5  66  ? -46.609 -24.023 85.362 1.00 116.35 ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I 5  66  ? -45.872 -25.138 84.880 1.00 114.22 ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I 5  66  ? -45.747 -22.762 85.369 1.00 116.67 ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I 5  66  ? -45.967 -22.241 83.951 1.00 117.03 ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I 5  66  ? -45.667 -20.782 83.696 1.00 116.71 ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I 5  66  ? -45.677 -20.300 82.372 1.00 116.40 ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I 5  66  ? -45.928 -21.078 81.439 1.00 116.17 ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I 5  66  ? -45.410 -18.982 82.149 1.00 115.98 ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I 5  66  ? -45.139 -18.161 83.171 1.00 115.70 ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I 5  66  ? -44.883 -16.878 82.898 1.00 115.03 ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I 5  66  ? -45.123 -18.629 84.521 1.00 116.10 ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I 5  66  ? -45.390 -19.927 84.734 1.00 116.48 ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I 5  67  ? -46.221 -26.637 85.321 1.00 112.91 ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I 5  67  ? -47.695 -26.772 85.359 1.00 113.40 ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I 5  67  ? -45.402 -26.972 86.510 1.00 112.67 ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I 5  67  ? -45.676 -27.529 84.106 1.00 111.45 ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I 5  67  ? -46.164 -27.377 82.765 1.00 108.57 ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I 5  67  ? -45.071 -27.604 81.725 1.00 106.44 ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I 5  67  ? -44.347 -26.375 81.486 1.00 105.61 ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I 5  67  ? -44.001 -28.639 82.060 1.00 105.70 ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I 5  67  ? -43.664 -29.359 80.879 1.00 104.74 ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I 5  67  ? -42.829 -27.817 82.597 1.00 105.27 ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I 5  67  ? -42.986 -26.497 81.857 1.00 105.52 ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I 5  67  ? -42.679 -25.324 82.667 1.00 105.50 ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I 5  67  ? -42.681 -25.241 84.031 1.00 105.71 ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I 5  67  ? -42.379 -24.053 84.495 1.00 105.67 ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I 5  67  ? -42.171 -23.303 83.355 1.00 105.39 ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I 5  67  ? -41.821 -21.954 83.170 1.00 105.43 ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I 5  67  ? -41.619 -21.113 84.186 1.00 105.26 ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I 5  67  ? -41.681 -21.506 81.904 1.00 105.44 ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I 5  67  ? -41.885 -22.361 80.894 1.00 105.24 ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I 5  67  ? -42.224 -23.649 80.944 1.00 105.29 ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I 5  67  ? -42.351 -24.065 82.217 1.00 105.38 ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I 5  68  ? -42.605 -30.564 80.876 1.00 104.13 ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I 5  68  ? -42.964 -31.443 79.745 1.00 104.51 ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I 5  68  ? -42.479 -31.165 82.221 1.00 103.92 ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I 5  68  ? -41.227 -29.809 80.562 1.00 103.52 ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I 5  68  ? -41.094 -28.847 79.509 1.00 102.52 ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I 5  68  ? -39.778 -28.080 79.602 1.00 101.85 ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I 5  68  ? -39.928 -26.912 80.460 1.00 101.98 ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I 5  68  ? -38.571 -28.861 80.153 1.00 101.15 ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I 5  68  ? -37.367 -28.518 79.486 1.00 99.14  ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I 5  68  ? -38.451 -28.331 81.573 1.00 101.73 ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I 5  68  ? -38.774 -26.869 81.280 1.00 102.20 ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I 5  68  ? -38.939 -26.048 82.478 1.00 102.43 ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I 5  68  ? -39.248 -26.477 83.749 1.00 102.62 ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I 5  68  ? -39.306 -25.517 84.625 1.00 102.54 ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I 5  68  ? -39.009 -24.382 83.887 1.00 102.55 ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I 5  68  ? -38.920 -23.035 84.299 1.00 102.77 ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I 5  68  ? -39.097 -22.580 85.433 1.00 103.20 ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I 5  68  ? -38.596 -22.179 83.248 1.00 102.85 ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I 5  68  ? -38.380 -22.584 81.950 1.00 102.91 ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I 5  68  ? -38.076 -21.619 81.069 1.00 103.01 ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I 5  68  ? -38.455 -23.850 81.550 1.00 102.63 ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I 5  68  ? -38.775 -24.689 82.567 1.00 102.41 ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I 5  69  ? -36.914 -29.194 78.117 1.00 97.12  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I 5  69  ? -38.100 -29.340 77.239 1.00 96.67  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I 5  69  ? -36.057 -30.358 78.441 1.00 97.03  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I 5  69  ? -35.968 -28.051 77.534 1.00 95.42  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I 5  69  ? -36.538 -26.848 77.039 1.00 93.25  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I 5  69  ? -35.643 -25.659 77.329 1.00 91.45  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I 5  69  ? -35.904 -25.193 78.674 1.00 91.26  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I 5  69  ? -34.145 -25.936 77.233 1.00 90.48  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I 5  69  ? -33.534 -24.948 76.405 1.00 88.68  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I 5  69  ? -33.667 -25.870 78.681 1.00 90.75  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I 5  69  ? -34.685 -24.945 79.335 1.00 91.17  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I 5  69  ? -34.881 -25.209 80.790 1.00 91.37  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I 5  69  ? -34.923 -24.151 81.715 1.00 91.02  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I 5  69  ? -34.797 -22.983 81.328 1.00 90.80  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I 5  69  ? -35.105 -24.444 83.028 1.00 90.98  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I 5  69  ? -35.240 -25.714 83.426 1.00 91.34  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I 5  69  ? -35.415 -25.963 84.727 1.00 91.28  ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I 5  69  ? -35.203 -26.801 82.504 1.00 91.91  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I 5  69  ? -35.024 -26.505 81.211 1.00 91.89  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I 5  70  ? -31.992 -25.014 75.982 1.00 86.95  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I 5  70  ? -31.920 -24.704 74.541 1.00 87.37  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I 5  70  ? -31.357 -26.241 76.525 1.00 86.31  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I 5  70  ? -31.409 -23.751 76.743 1.00 86.81  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I 5  70  ? -31.870 -22.465 76.381 1.00 86.90  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I 5  70  ? -31.351 -21.447 77.374 1.00 87.43  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I 5  70  ? -31.787 -21.787 78.713 1.00 87.66  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I 5  70  ? -29.836 -21.349 77.420 1.00 87.76  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I 5  70  ? -29.521 -19.976 77.391 1.00 88.39  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I 5  70  ? -29.443 -22.020 78.734 1.00 87.92  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I 5  70  ? -30.691 -21.848 79.600 1.00 88.46  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I 5  70  ? -30.971 -22.954 80.596 1.00 89.31  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I 5  70  ? -31.434 -22.647 81.873 1.00 89.37  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I 5  70  ? -31.634 -21.511 82.277 1.00 89.35  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I 5  70  ? -31.659 -23.738 82.680 1.00 89.06  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I 5  70  ? -31.475 -25.070 82.352 1.00 89.49  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I 5  70  ? -31.700 -25.970 83.150 1.00 89.84  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I 5  70  ? -30.991 -25.325 81.014 1.00 89.75  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I 5  70  ? -30.744 -26.728 80.537 1.00 90.18  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I 5  70  ? -30.773 -24.272 80.213 1.00 89.56  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I 5  71  ? -28.032 -19.475 77.139 1.00 88.49  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I 5  71  ? -28.123 -18.176 76.442 1.00 88.79  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I 5  71  ? -27.233 -20.599 76.616 1.00 88.53  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I 5  71  ? -27.501 -19.184 78.604 1.00 90.37  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I 5  71  ? -28.033 -18.103 79.369 1.00 92.28  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I 5  71  ? -27.526 -18.248 80.787 1.00 93.62  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I 5  71  ? -28.055 -19.478 81.342 1.00 93.86  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I 5  71  ? -26.006 -18.356 80.881 1.00 94.68  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I 5  71  ? -25.569 -17.570 81.959 1.00 96.50  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I 5  71  ? -25.746 -19.841 81.127 1.00 94.44  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I 5  71  ? -26.995 -20.204 81.919 1.00 94.29  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I 5  71  ? -27.324 -21.621 81.920 1.00 94.41  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I 5  71  ? -27.290 -22.513 80.879 1.00 94.79  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I 5  71  ? -27.638 -23.723 81.214 1.00 94.96  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I 5  71  ? -27.915 -23.625 82.570 1.00 95.05  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I 5  71  ? -28.341 -24.610 83.493 1.00 95.08  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I 5  71  ? -28.566 -25.809 83.280 1.00 94.77  ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I 5  71  ? -28.502 -24.078 84.775 1.00 95.38  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I 5  71  ? -28.281 -22.757 85.114 1.00 95.46  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I 5  71  ? -28.483 -22.409 86.389 1.00 96.06  ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I 5  71  ? -27.883 -21.828 84.260 1.00 95.10  ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I 5  71  ? -27.724 -22.335 83.014 1.00 94.91  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I 5  72  ? -24.057 -17.074 82.051 1.00 98.13  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I 5  72  ? -24.007 -15.762 81.370 1.00 98.10  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I 5  72  ? -23.159 -18.182 81.660 1.00 97.91  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I 5  72  ? -23.844 -16.837 83.616 1.00 100.40 ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I 5  72  ? -24.967 -16.550 84.446 1.00 103.76 ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I 5  72  ? -24.871 -17.253 85.788 1.00 105.98 ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I 5  72  ? -25.363 -18.614 85.698 1.00 106.45 ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I 5  72  ? -23.468 -17.343 86.368 1.00 107.60 ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I 5  72  ? -23.576 -16.933 87.727 1.00 110.09 ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I 5  72  ? -23.084 -18.815 86.197 1.00 107.14 ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I 5  72  ? -24.441 -19.502 86.295 1.00 106.87 ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I 5  72  ? -24.570 -20.774 85.589 1.00 107.21 ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I 5  72  ? -24.364 -21.001 84.255 1.00 107.28 ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I 5  72  ? -24.570 -22.244 83.890 1.00 107.36 ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I 5  72  ? -24.938 -22.879 85.064 1.00 107.18 ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I 5  72  ? -25.293 -24.212 85.356 1.00 107.06 ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I 5  72  ? -25.323 -25.175 84.434 1.00 107.18 ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I 5  72  ? -25.608 -24.524 86.634 1.00 107.37 ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I 5  72  ? -25.577 -23.558 87.562 1.00 107.50 ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I 5  72  ? -25.262 -22.268 87.404 1.00 107.59 ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I 5  72  ? -24.951 -21.988 86.122 1.00 107.33 ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I 5  73  ? -22.326 -16.411 88.582 1.00 111.54 ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I 5  73  ? -22.797 -15.244 89.364 1.00 111.29 ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I 5  73  ? -21.145 -16.277 87.694 1.00 111.61 ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I 5  73  ? -22.070 -17.644 89.569 1.00 111.56 ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I 5  73  ? -23.157 -18.451 90.008 1.00 112.09 ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I 5  73  ? -22.649 -19.690 90.720 1.00 112.91 ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I 5  73  ? -22.890 -20.873 89.920 1.00 113.23 ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I 5  73  ? -21.163 -19.695 91.056 1.00 113.38 ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I 5  73  ? -21.076 -20.089 92.413 1.00 114.21 ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I 5  73  ? -20.553 -20.709 90.087 1.00 113.19 ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I 5  73  ? -21.719 -21.658 89.834 1.00 113.11 ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I 5  73  ? -21.746 -22.280 88.514 1.00 113.06 ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I 5  73  ? -21.443 -21.705 87.310 1.00 113.15 ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I 5  73  ? -21.571 -22.510 86.283 1.00 113.14 ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I 5  73  ? -22.003 -23.695 86.852 1.00 113.30 ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I 5  73  ? -22.326 -24.956 86.304 1.00 113.54 ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I 5  73  ? -22.260 -25.226 84.996 1.00 113.43 ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I 5  73  ? -22.727 -25.932 87.154 1.00 113.80 ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I 5  73  ? -22.792 -25.665 88.468 1.00 113.68 ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I 5  73  ? -22.510 -24.520 89.096 1.00 113.47 ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I 5  73  ? -22.118 -23.570 88.227 1.00 113.18 ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I 5  74  ? -19.712 -20.083 93.246 1.00 114.73 ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I 5  74  ? -20.042 -19.573 94.599 1.00 114.89 ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I 5  74  ? -18.644 -19.427 92.452 1.00 114.40 ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I 5  74  ? -19.401 -21.654 93.336 1.00 114.32 ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I 5  74  ? -20.419 -22.583 93.733 1.00 113.81 ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I 5  74  ? -19.959 -24.016 93.533 1.00 113.58 ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I 5  74  ? -20.196 -24.409 92.158 1.00 113.63 ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I 5  74  ? -18.473 -24.244 93.790 1.00 113.66 ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I 5  74  ? -18.296 -25.234 94.789 1.00 114.28 ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I 5  74  ? -17.881 -24.667 92.443 1.00 113.19 ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I 5  74  ? -19.104 -25.176 91.690 1.00 112.75 ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I 5  74  ? -19.020 -25.079 90.189 1.00 111.64 ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I 5  74  ? -19.310 -26.197 89.428 1.00 111.08 ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I 5  74  ? -19.634 -27.278 89.895 1.00 110.75 ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I 5  74  ? -19.204 -26.003 88.072 1.00 110.82 ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I 5  74  ? -18.849 -24.844 87.405 1.00 110.48 ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I 5  74  ? -18.792 -24.796 86.178 1.00 110.05 ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I 5  74  ? -18.560 -23.713 88.256 1.00 110.68 ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I 5  74  ? -18.159 -22.393 87.665 1.00 110.66 ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I 5  74  ? -18.660 -23.884 89.585 1.00 111.14 ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I 5  75  ? -16.866 -25.412 95.493 1.00 114.81 ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I 5  75  ? -17.125 -25.738 96.914 1.00 114.73 ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I 5  75  ? -16.007 -24.255 95.147 1.00 114.51 ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I 5  75  ? -16.256 -26.697 94.751 1.00 115.47 ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I 5  75  ? -16.952 -27.951 94.754 1.00 115.92 ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I 5  75  ? -16.471 -28.857 93.634 1.00 116.06 ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I 5  75  ? -16.688 -28.217 92.350 1.00 115.87 ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I 5  75  ? -14.983 -29.199 93.682 1.00 116.45 ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I 5  75  ? -14.805 -30.614 93.724 1.00 117.27 ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I 5  75  ? -14.411 -28.585 92.405 1.00 115.90 ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I 5  75  ? -15.634 -28.602 91.498 1.00 115.42 ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I 5  75  ? -15.590 -27.681 90.315 1.00 115.00 ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I 5  75  ? -15.808 -28.182 89.015 1.00 114.63 ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I 5  75  ? -16.031 -29.387 88.844 1.00 114.25 ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I 5  75  ? -15.764 -27.321 87.962 1.00 114.47 ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I 5  75  ? -15.521 -26.021 88.167 1.00 114.41 ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I 5  75  ? -15.486 -25.209 87.108 1.00 114.17 ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I 5  75  ? -15.299 -25.489 89.474 1.00 114.66 ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I 5  75  ? -15.344 -26.345 90.505 1.00 114.92 ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I 5  76  ? -13.623 -31.234 94.612 1.00 117.88 ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I 5  76  ? -14.086 -31.242 96.015 1.00 118.19 ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I 5  76  ? -12.361 -30.537 94.259 1.00 117.52 ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I 5  76  ? -13.506 -32.755 94.123 1.00 117.81 ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I 5  76  ? -14.608 -33.494 93.577 1.00 117.40 ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I 5  76  ? -14.181 -34.316 92.361 1.00 116.96 ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I 5  76  ? -14.344 -33.532 91.149 1.00 116.91 ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I 5  76  ? -12.731 -34.802 92.354 1.00 116.59 ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I 5  76  ? -12.660 -36.141 91.861 1.00 116.18 ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I 5  76  ? -12.019 -33.802 91.443 1.00 116.46 ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I 5  76  ? -13.117 -33.441 90.450 1.00 116.72 ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I 5  76  ? -12.968 -32.096 89.893 1.00 116.60 ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I 5  76  ? -12.679 -30.946 90.576 1.00 116.60 ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I 5  76  ? -12.597 -29.878 89.819 1.00 116.59 ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I 5  76  ? -12.849 -30.357 88.543 1.00 116.54 ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I 5  76  ? -12.909 -29.723 87.280 1.00 116.20 ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I 5  76  ? -12.713 -28.414 87.099 1.00 115.63 ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I 5  76  ? -13.182 -30.495 86.204 1.00 116.31 ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I 5  76  ? -13.382 -31.812 86.381 1.00 116.39 ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I 5  76  ? -13.354 -32.518 87.514 1.00 116.24 ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I 5  76  ? -13.079 -31.726 88.570 1.00 116.51 ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I 5  77  ? -11.255 -36.897 91.661 1.00 115.85 ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I 5  77  ? -11.364 -38.272 92.207 1.00 115.68 ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I 5  77  ? -10.153 -36.009 92.114 1.00 115.73 ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I 5  77  ? -11.152 -36.990 90.070 1.00 115.19 ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I 5  77  ? -12.266 -37.289 89.230 1.00 113.57 ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I 5  77  ? -11.827 -37.142 87.784 1.00 112.26 ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I 5  77  ? -11.564 -35.744 87.503 1.00 112.14 ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I 5  77  ? -10.546 -37.886 87.422 1.00 111.32 ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I 5  77  ? -10.707 -38.424 86.119 1.00 110.20 ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I 5  77  ? -9.465  -36.803 87.488 1.00 111.48 ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I 5  77  ? -10.237 -35.569 87.036 1.00 112.04 ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I 5  77  ? -9.756  -34.280 87.539 1.00 112.47 ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I 5  77  ? -9.230  -34.005 88.782 1.00 112.92 ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I 5  77  ? -8.897  -32.754 88.952 1.00 113.04 ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I 5  77  ? -9.227  -32.153 87.743 1.00 113.07 ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I 5  77  ? -9.094  -30.803 87.329 1.00 112.93 ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I 5  77  ? -8.642  -29.859 87.984 1.00 112.96 ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I 5  77  ? -9.544  -30.591 86.024 1.00 112.81 ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I 5  77  ? -10.061 -31.580 85.218 1.00 113.12 ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I 5  77  ? -10.445 -31.204 83.992 1.00 113.57 ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I 5  77  ? -10.192 -32.852 85.589 1.00 113.17 ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I 5  77  ? -9.759  -33.074 86.862 1.00 112.99 ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I 5  78  ? -9.718  -39.529 85.513 1.00 109.49 ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I 5  78  ? -10.473 -40.800 85.484 1.00 109.48 ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I 5  78  ? -8.408  -39.452 86.206 1.00 109.13 ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I 5  78  ? -9.491  -39.055 83.993 1.00 108.44 ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I 5  78  ? -9.974  -37.790 83.492 1.00 106.14 ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I 5  78  ? -8.892  -36.936 82.827 1.00 104.36 ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I 5  78  ? -8.498  -35.835 83.692 1.00 104.21 ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I 5  78  ? -7.575  -37.618 82.444 1.00 103.04 ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I 5  78  ? -7.157  -37.129 81.177 1.00 100.51 ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I 5  78  ? -6.616  -37.169 83.538 1.00 103.28 ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I 5  78  ? -7.087  -35.730 83.667 1.00 103.68 ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I 5  78  ? -6.647  -34.993 84.884 1.00 103.78 ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I 5  78  ? -6.555  -33.591 84.838 1.00 103.92 ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I 5  78  ? -6.828  -32.987 83.791 1.00 104.08 ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I 5  78  ? -6.162  -32.925 85.955 1.00 103.90 ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I 5  78  ? -5.876  -33.603 87.073 1.00 104.20 ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I 5  78  ? -5.494  -32.905 88.148 1.00 104.52 ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I 5  78  ? -5.968  -35.028 87.140 1.00 104.10 ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I 5  78  ? -6.356  -35.674 86.034 1.00 103.84 ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I 5  79  ? -7.374  -38.023 79.875 1.00 98.62  ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I 5  79  ? -8.435  -39.014 80.164 1.00 99.10  ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I 5  79  ? -6.026  -38.468 79.456 1.00 98.40  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I 5  79  ? -7.965  -37.043 78.753 1.00 96.62  ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I 5  79  ? -8.620  -35.815 79.038 1.00 92.95  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I 5  79  ? -7.900  -34.646 78.368 1.00 90.52  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I 5  79  ? -7.169  -33.907 79.377 1.00 90.45  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I 5  79  ? -6.848  -34.935 77.294 1.00 88.67  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I 5  79  ? -6.614  -33.763 76.519 1.00 85.66  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I 5  79  ? -5.620  -35.152 78.157 1.00 89.57  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I 5  79  ? -5.793  -33.930 79.051 1.00 91.08  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I 5  79  ? -5.031  -33.910 80.329 1.00 93.12  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I 5  79  ? -4.806  -32.687 80.932 1.00 93.70  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I 5  79  ? -5.182  -31.620 80.480 1.00 93.62  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I 5  79  ? -4.108  -32.761 82.106 1.00 94.46  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I 5  79  ? -3.628  -33.900 82.728 1.00 95.30  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I 5  79  ? -3.008  -33.838 83.787 1.00 96.97  ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I 5  79  ? -3.901  -35.147 82.051 1.00 94.60  ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I 5  79  ? -3.425  -36.447 82.626 1.00 94.95  ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I 5  79  ? -4.583  -35.093 80.900 1.00 93.98  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I 5  80  ? -6.967  -33.570 74.974 1.00 82.39  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I 5  80  ? -8.420  -33.302 74.879 1.00 81.46  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I 5  80  ? -6.320  -34.650 74.190 1.00 81.77  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I 5  80  ? -6.187  -32.218 74.659 1.00 81.65  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I 5  80  ? -6.275  -31.119 75.557 1.00 81.55  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I 5  80  ? -4.939  -30.418 75.785 1.00 81.81  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I 5  80  ? -4.247  -30.938 76.949 1.00 82.62  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I 5  80  ? -3.901  -30.417 74.668 1.00 81.73  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I 5  80  ? -3.334  -29.135 74.707 1.00 80.73  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I 5  80  ? -2.890  -31.467 75.118 1.00 82.53  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I 5  80  ? -2.900  -31.230 76.621 1.00 83.30  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I 5  80  ? -2.526  -32.369 77.451 1.00 84.68  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I 5  80  ? -2.711  -33.709 77.205 1.00 85.12  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I 5  80  ? -2.281  -34.480 78.163 1.00 85.45  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I 5  80  ? -1.786  -33.591 79.106 1.00 85.81  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I 5  80  ? -1.185  -33.830 80.365 1.00 86.21  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I 5  80  ? -0.972  -34.929 80.902 1.00 86.77  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I 5  80  ? -0.824  -32.640 81.005 1.00 86.01  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I 5  80  ? -1.026  -31.378 80.484 1.00 86.14  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I 5  80  ? -0.625  -30.327 81.209 1.00 86.47  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I 5  80  ? -1.584  -31.145 79.308 1.00 86.05  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I 5  80  ? -1.935  -32.292 78.681 1.00 85.43  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I 5  81  ? -2.504  -28.504 73.507 1.00 80.23  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I 5  81  ? -3.431  -27.612 72.777 1.00 80.83  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I 5  81  ? -1.777  -29.578 72.792 1.00 80.28  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I 5  81  ? -1.454  -27.587 74.290 1.00 79.46  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I 5  81  ? -1.933  -26.763 75.356 1.00 78.76  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I 5  81  ? -0.808  -26.122 76.152 1.00 78.16  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I 5  81  ? -0.249  -27.028 77.138 1.00 78.17  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I 5  81  ? 0.368   -25.624 75.336 1.00 77.70  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I 5  81  ? 0.748   -24.416 75.967 1.00 77.68  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I 5  81  ? 1.386   -26.767 75.441 1.00 77.73  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I 5  81  ? 1.068   -27.419 76.787 1.00 78.20  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I 5  81  ? 1.047   -28.881 76.830 1.00 78.36  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I 5  81  ? 0.590   -29.734 75.864 1.00 78.95  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I 5  81  ? 0.661   -31.003 76.184 1.00 79.05  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I 5  81  ? 1.197   -30.983 77.457 1.00 78.96  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I 5  81  ? 1.527   -32.017 78.357 1.00 78.87  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I 5  81  ? 1.344   -33.311 78.071 1.00 79.31  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I 5  81  ? 2.047   -31.665 79.553 1.00 78.35  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I 5  81  ? 2.224   -30.365 79.829 1.00 78.14  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I 5  81  ? 1.951   -29.307 79.065 1.00 78.45  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I 5  81  ? 1.436   -29.685 77.879 1.00 78.70  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I 5  82  ? 2.050   -23.594 75.557 1.00 78.48  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I 5  82  ? 1.820   -22.175 75.920 1.00 77.61  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I 5  82  ? 2.478   -23.983 74.190 1.00 78.37  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I 5  82  ? 3.153   -24.215 76.521 1.00 79.59  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I 5  82  ? 3.170   -24.016 77.923 1.00 80.04  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I 5  82  ? 4.426   -24.666 78.473 1.00 80.55  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I 5  82  ? 4.275   -26.102 78.407 1.00 79.84  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I 5  82  ? 5.713   -24.334 77.725 1.00 81.20  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I 5  82  ? 6.648   -23.796 78.641 1.00 83.86  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I 5  82  ? 6.168   -25.673 77.149 1.00 80.78  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I 5  82  ? 5.508   -26.685 78.070 1.00 79.94  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I 5  82  ? 5.195   -27.974 77.461 1.00 80.00  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I 5  82  ? 4.753   -28.194 76.189 1.00 80.00  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I 5  82  ? 4.532   -29.454 75.918 1.00 80.30  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I 5  82  ? 4.844   -30.111 77.095 1.00 80.39  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I 5  82  ? 4.825   -31.474 77.463 1.00 80.32  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I 5  82  ? 4.461   -32.456 76.636 1.00 80.57  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I 5  82  ? 5.199   -31.798 78.718 1.00 80.38  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I 5  82  ? 5.574   -30.821 79.555 1.00 80.25  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I 5  82  ? 5.631   -29.511 79.323 1.00 80.31  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I 5  82  ? 5.255   -29.214 78.062 1.00 80.33  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I 5  83  ? 8.089   -23.259 78.195 1.00 86.49  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I 5  83  ? 8.492   -22.256 79.206 1.00 86.03  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I 5  83  ? 8.056   -22.910 76.754 1.00 86.79  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I 5  83  ? 9.034   -24.534 78.330 1.00 88.22  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I 5  83  ? 9.061   -25.255 79.546 1.00 92.39  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I 5  83  ? 9.934   -26.484 79.420 1.00 95.29  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I 5  83  ? 9.158   -27.559 78.842 1.00 95.28  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I 5  83  ? 11.155  -26.309 78.524 1.00 97.85  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I 5  83  ? 12.292  -26.845 79.177 1.00 102.11 ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I 5  83  ? 10.792  -27.111 77.278 1.00 96.99  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I 5  83  ? 9.990   -28.226 77.927 1.00 95.80  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I 5  83  ? 9.146   -29.030 77.019 1.00 95.75  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I 5  83  ? 8.688   -30.282 77.459 1.00 96.13  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I 5  83  ? 8.983   -30.699 78.587 1.00 96.21  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I 5  83  ? 7.920   -31.022 76.625 1.00 96.34  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I 5  83  ? 7.614   -30.556 75.415 1.00 96.33  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I 5  83  ? 6.852   -31.334 74.642 1.00 96.61  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I 5  83  ? 8.067   -29.281 74.950 1.00 96.01  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I 5  83  ? 8.826   -28.558 75.778 1.00 95.49  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I 5  84  ? 13.762  -26.301 78.861 1.00 105.52 ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I 5  84  ? 13.882  -24.999 79.555 1.00 104.89 ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I 5  84  ? 14.017  -26.396 77.404 1.00 105.10 ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I 5  84  ? 14.703  -27.394 79.560 1.00 109.16 ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I 5  84  ? 14.175  -28.335 80.506 1.00 115.08 ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I 5  84  ? 14.499  -29.777 80.135 1.00 119.49 ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I 5  84  ? 13.437  -30.320 79.305 1.00 120.88 ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I 5  84  ? 15.812  -29.988 79.377 1.00 121.97 ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I 5  84  ? 16.580  -31.044 79.958 1.00 124.98 ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I 5  84  ? 15.375  -30.337 77.958 1.00 122.36 ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I 5  84  ? 13.992  -30.946 78.165 1.00 122.28 ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I 5  84  ? 13.128  -30.737 77.003 1.00 123.14 ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I 5  84  ? 13.003  -29.590 76.262 1.00 123.36 ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I 5  84  ? 12.159  -29.684 75.263 1.00 123.63 ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I 5  84  ? 11.700  -30.987 75.351 1.00 123.72 ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I 5  84  ? 10.781  -31.722 74.574 1.00 123.67 ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I 5  84  ? 10.146  -31.206 73.520 1.00 123.14 ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I 5  84  ? 10.544  -33.008 74.927 1.00 124.07 ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I 5  84  ? 11.188  -33.528 75.987 1.00 124.09 ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I 5  84  ? 12.075  -32.935 76.792 1.00 123.82 ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I 5  84  ? 12.289  -31.656 76.416 1.00 123.63 ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I 5  85  ? 18.115  -31.300 79.549 1.00 127.31 ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I 5  85  ? 18.857  -31.622 80.790 1.00 127.53 ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I 5  85  ? 18.595  -30.199 78.674 1.00 126.88 ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I 5  85  ? 18.009  -32.626 78.664 1.00 128.37 ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I 5  85  ? 17.447  -33.840 79.169 1.00 130.22 ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I 5  85  ? 17.259  -34.815 78.018 1.00 131.68 ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I 5  85  ? 16.151  -34.361 77.190 1.00 132.55 ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I 5  85  ? 18.469  -34.936 77.085 1.00 132.08 ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I 5  85  ? 18.775  -36.299 76.758 1.00 132.05 ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I 5  85  ? 18.045  -34.136 75.854 1.00 132.37 ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I 5  85  ? 16.548  -34.425 75.833 1.00 132.83 ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I 5  85  ? 15.721  -33.509 74.963 1.00 133.31 ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I 5  85  ? 14.588  -34.011 74.342 1.00 133.62 ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I 5  85  ? 14.196  -35.162 74.461 1.00 133.64 ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I 5  85  ? 13.909  -33.101 73.565 1.00 133.82 ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I 5  85  ? 14.237  -31.774 73.341 1.00 133.70 ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I 5  85  ? 13.548  -31.056 72.622 1.00 133.56 ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I 5  85  ? 15.431  -31.311 74.018 1.00 133.69 ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I 5  85  ? 15.904  -29.894 73.868 1.00 133.76 ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I 5  85  ? 16.105  -32.188 74.781 1.00 133.52 ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I 5  86  ? 20.272  -36.696 76.340 1.00 131.93 ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I 5  86  ? 21.064  -36.663 77.589 1.00 132.20 ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I 5  86  ? 20.685  -35.869 75.181 1.00 131.91 ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I 5  86  ? 20.193  -38.217 75.840 1.00 131.43 ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I 5  86  ? 18.982  -38.822 75.392 1.00 130.47 ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I 5  86  ? 18.796  -38.767 73.877 1.00 129.76 ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I 5  86  ? 18.177  -37.522 73.473 1.00 130.06 ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I 5  86  ? 20.023  -38.929 72.975 1.00 128.81 ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I 5  86  ? 19.749  -40.043 72.117 1.00 126.67 ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I 5  86  ? 20.105  -37.597 72.216 1.00 129.45 ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I 5  86  ? 18.629  -37.217 72.173 1.00 130.37 ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I 5  86  ? 18.272  -35.819 71.962 1.00 131.34 ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I 5  86  ? 18.777  -34.727 72.624 1.00 131.93 ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I 5  86  ? 18.250  -33.594 72.250 1.00 132.30 ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I 5  86  ? 17.324  -33.956 71.283 1.00 132.17 ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I 5  86  ? 16.449  -33.147 70.514 1.00 132.17 ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I 5  86  ? 16.320  -31.915 70.548 1.00 131.89 ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I 5  86  ? 15.675  -33.908 69.636 1.00 132.37 ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I 5  86  ? 15.743  -35.281 69.518 1.00 132.33 ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I 5  86  ? 14.921  -35.844 68.622 1.00 132.41 ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I 5  86  ? 16.557  -36.050 70.235 1.00 132.19 ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I 5  86  ? 17.319  -35.325 71.096 1.00 131.95 ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I 5  87  ? 20.841  -40.719 71.162 1.00 125.07 ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I 5  87  ? 20.573  -42.176 71.194 1.00 125.10 ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I 5  87  ? 22.179  -40.187 71.511 1.00 125.09 ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I 5  87  ? 20.479  -40.141 69.714 1.00 123.53 ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I 5  87  ? 19.760  -40.932 68.770 1.00 120.62 ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I 5  87  ? 19.254  -40.090 67.608 1.00 118.15 ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I 5  87  ? 18.863  -38.773 68.070 1.00 117.76 ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I 5  87  ? 20.254  -39.882 66.467 1.00 116.36 ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I 5  87  ? 19.692  -40.284 65.218 1.00 113.65 ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I 5  87  ? 20.498  -38.375 66.473 1.00 116.80 ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I 5  87  ? 19.171  -37.872 67.034 1.00 117.48 ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I 5  87  ? 19.172  -36.479 67.582 1.00 117.72 ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I 5  87  ? 18.299  -35.523 67.034 1.00 117.87 ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I 5  87  ? 17.541  -35.837 66.104 1.00 118.14 ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I 5  87  ? 18.311  -34.264 67.547 1.00 117.71 ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I 5  87  ? 19.140  -33.946 68.547 1.00 117.42 ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I 5  87  ? 19.113  -32.693 69.010 1.00 116.89 ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I 5  87  ? 20.032  -34.903 69.120 1.00 117.79 ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I 5  87  ? 20.011  -36.144 68.613 1.00 117.87 ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I 5  88  ? 19.332  -41.804 64.860 1.00 111.54 ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I 5  88  ? 19.034  -42.569 66.093 1.00 111.30 ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I 5  88  ? 20.373  -42.285 63.933 1.00 111.54 ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I 5  88  ? 17.994  -41.643 64.001 1.00 110.66 ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I 5  88  ? 16.746  -41.249 64.600 1.00 108.89 ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I 5  88  ? 15.825  -40.530 63.615 1.00 107.20 ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I 5  88  ? 16.280  -39.163 63.446 1.00 106.93 ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I 5  88  ? 15.732  -41.112 62.202 1.00 106.22 ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I 5  88  ? 14.419  -40.914 61.652 1.00 104.19 ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I 5  88  ? 16.799  -40.326 61.444 1.00 106.46 ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I 5  88  ? 16.725  -38.960 62.119 1.00 106.98 ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I 5  88  ? 18.016  -38.208 62.161 1.00 107.61 ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I 5  88  ? 17.989  -36.838 62.470 1.00 108.06 ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I 5  88  ? 16.906  -36.281 62.700 1.00 108.37 ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I 5  88  ? 19.161  -36.152 62.508 1.00 108.20 ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I 5  88  ? 20.315  -36.772 62.253 1.00 107.99 ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I 5  88  ? 21.430  -36.039 62.307 1.00 107.91 ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I 5  88  ? 20.367  -38.166 61.936 1.00 108.02 ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I 5  88  ? 19.207  -38.837 61.905 1.00 107.82 ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I 5  89  ? 13.967  -41.450 60.202 1.00 102.27 ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I 5  89  ? 12.985  -42.532 60.418 1.00 101.85 ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I 5  89  ? 15.151  -41.678 59.343 1.00 102.22 ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I 5  89  ? 13.200  -40.199 59.572 1.00 101.22 ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I 5  89  ? 12.952  -39.005 60.311 1.00 99.17  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I 5  89  ? 13.117  -37.795 59.413 1.00 97.90  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I 5  89  ? 14.440  -37.232 59.584 1.00 97.79  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I 5  89  ? 12.946  -38.061 57.922 1.00 97.44  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I 5  89  ? 11.907  -37.209 57.466 1.00 96.80  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I 5  89  ? 14.315  -37.755 57.313 1.00 97.55  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I 5  89  ? 14.969  -36.838 58.338 1.00 97.76  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I 5  89  ? 16.469  -36.934 58.441 1.00 98.02  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I 5  89  ? 17.225  -35.782 58.580 1.00 98.19  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I 5  89  ? 16.754  -34.654 58.613 1.00 98.42  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I 5  89  ? 18.581  -36.002 58.675 1.00 98.06  ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I 5  89  ? 19.242  -37.219 58.648 1.00 97.81  ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I 5  89  ? 20.458  -37.312 58.739 1.00 97.75  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I 5  89  ? 18.401  -38.376 58.503 1.00 98.16  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I 5  89  ? 19.006  -39.750 58.458 1.00 98.71  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I 5  89  ? 17.077  -38.180 58.412 1.00 98.32  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I 5  90  ? 11.466  -37.031 55.937 1.00 96.37  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I 5  90  ? 9.986   -37.095 55.917 1.00 96.03  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I 5  90  ? 12.267  -37.899 55.039 1.00 96.15  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I 5  90  ? 11.930  -35.534 55.669 1.00 95.71  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I 5  90  ? 11.657  -34.545 56.646 1.00 95.31  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I 5  90  ? 12.537  -33.351 56.374 1.00 95.23  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I 5  90  ? 13.915  -33.757 56.547 1.00 95.50  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I 5  90  ? 12.407  -32.798 54.959 1.00 95.04  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I 5  90  ? 12.179  -31.396 55.028 1.00 94.74  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I 5  90  ? 13.732  -33.171 54.294 1.00 95.39  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I 5  90  ? 14.682  -33.233 55.484 1.00 96.02  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I 5  90  ? 15.898  -34.104 55.333 1.00 96.69  ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I 5  90  ? 17.151  -33.561 55.556 1.00 96.73  ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I 5  90  ? 17.339  -32.393 55.858 1.00 96.74  ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I 5  90  ? 18.188  -34.451 55.405 1.00 96.72  ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I 5  90  ? 18.102  -35.794 55.066 1.00 96.83  ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I 5  90  ? 19.095  -36.506 54.957 1.00 97.36  ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I 5  90  ? 16.769  -36.299 54.852 1.00 96.70  ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I 5  90  ? 16.547  -37.735 54.479 1.00 96.65  ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I 5  90  ? 15.748  -35.442 54.995 1.00 96.93  ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I 5  91  ? 11.888  -30.499 53.734 1.00 95.09  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I 5  91  ? 10.862  -29.509 54.120 1.00 94.46  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I 5  91  ? 11.700  -31.341 52.526 1.00 94.41  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I 5  91  ? 13.284  -29.749 53.550 1.00 97.15  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I 5  91  ? 13.941  -29.080 54.628 1.00 99.94  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I 5  91  ? 15.347  -28.673 54.218 1.00 102.29 ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I 5  91  ? 16.193  -29.849 54.125 1.00 102.63 ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I 5  91  ? 15.441  -27.971 52.863 1.00 104.06 ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I 5  91  ? 16.311  -26.847 52.950 1.00 106.61 ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I 5  91  ? 15.994  -29.047 51.928 1.00 103.63 ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I 5  91  ? 16.881  -29.829 52.888 1.00 103.26 ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I 5  91  ? 17.190  -31.240 52.484 1.00 103.57 ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I 5  91  ? 18.486  -31.700 52.623 1.00 103.91 ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I 5  91  ? 19.404  -31.020 53.050 1.00 104.10 ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I 5  91  ? 18.678  -33.006 52.237 1.00 103.92 ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I 5  91  ? 17.729  -33.878 51.739 1.00 103.50 ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I 5  91  ? 18.007  -35.029 51.422 1.00 103.71 ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I 5  91  ? 16.398  -33.340 51.620 1.00 103.43 ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I 5  91  ? 15.290  -34.199 51.088 1.00 103.90 ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I 5  91  ? 16.193  -32.067 51.992 1.00 103.48 ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I 5  92  ? 16.254  -25.674 51.861 1.00 108.55 ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I 5  92  ? 15.953  -24.431 52.604 1.00 108.15 ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I 5  92  ? 15.415  -26.093 50.712 1.00 108.15 ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I 5  92  ? 17.753  -25.594 51.308 1.00 111.41 ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I 5  92  ? 18.878  -26.059 52.056 1.00 115.25 ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I 5  92  ? 19.910  -26.672 51.124 1.00 118.21 ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I 5  92  ? 19.625  -28.083 50.938 1.00 118.77 ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I 5  92  ? 19.959  -26.060 49.725 1.00 120.48 ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I 5  92  ? 21.285  -25.600 49.464 1.00 124.16 ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I 5  92  ? 19.530  -27.197 48.794 1.00 119.81 ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I 5  92  ? 19.910  -28.435 49.602 1.00 119.14 ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I 5  92  ? 19.174  -29.709 49.258 1.00 119.08 ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I 5  92  ? 19.837  -30.923 49.315 1.00 118.82 ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I 5  92  ? 21.005  -31.045 49.628 1.00 118.68 ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I 5  92  ? 19.077  -32.019 48.985 1.00 118.89 ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I 5  92  ? 17.742  -32.033 48.613 1.00 119.19 ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I 5  92  ? 17.161  -33.079 48.335 1.00 119.10 ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I 5  92  ? 17.101  -30.735 48.568 1.00 119.43 ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I 5  92  ? 15.654  -30.600 48.177 1.00 119.51 ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I 5  92  ? 17.838  -29.657 48.891 1.00 119.45 ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I 5  93  ? 21.647  -24.594 48.267 1.00 126.65 ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I 5  93  ? 22.461  -23.500 48.845 1.00 126.56 ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I 5  93  ? 20.433  -24.278 47.479 1.00 126.44 ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I 5  93  ? 22.561  -25.518 47.337 1.00 129.13 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I 5  93  ? 23.923  -25.811 47.652 1.00 132.68 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I 5  93  ? 24.452  -26.867 46.693 1.00 135.48 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I 5  93  ? 23.659  -28.076 46.843 1.00 136.15 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I 5  93  ? 24.404  -26.496 45.208 1.00 137.11 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I 5  93  ? 25.617  -26.912 44.568 1.00 139.39 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I 5  93  ? 23.176  -27.252 44.705 1.00 137.05 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I 5  93  ? 23.213  -28.505 45.573 1.00 137.01 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I 5  93  ? 21.912  -29.166 45.683 1.00 137.67 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I 5  93  ? 20.701  -28.577 45.963 1.00 137.71 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I 5  93  ? 19.705  -29.417 45.987 1.00 137.91 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I 5  93  ? 20.287  -30.644 45.698 1.00 138.11 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I 5  93  ? 19.700  -31.929 45.585 1.00 138.38 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I 5  93  ? 18.508  -32.234 45.722 1.00 138.68 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I 5  93  ? 20.639  -32.916 45.279 1.00 138.40 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I 5  93  ? 21.984  -32.683 45.100 1.00 138.48 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I 5  93  ? 22.737  -33.754 44.812 1.00 138.63 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I 5  93  ? 22.549  -31.483 45.210 1.00 138.38 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I 5  93  ? 21.646  -30.509 45.507 1.00 138.07 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I 5  94  ? 25.877  -26.857 42.981 1.00 141.08 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I 5  94  ? 26.597  -25.596 42.699 1.00 141.02 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I 5  94  ? 24.639  -27.163 42.228 1.00 140.96 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I 5  94  ? 26.867  -28.101 42.782 1.00 142.15 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I 5  94  ? 26.737  -29.288 43.577 1.00 143.93 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I 5  94  ? 26.519  -30.544 42.744 1.00 145.47 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I 5  94  ? 25.181  -31.062 42.978 1.00 145.93 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I 5  94  ? 26.653  -30.406 41.226 1.00 146.53 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I 5  94  ? 27.393  -31.523 40.717 1.00 147.94 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I 5  94  ? 25.199  -30.415 40.758 1.00 146.56 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I 5  94  ? 24.639  -31.445 41.729 1.00 146.56 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I 5  94  ? 23.177  -31.516 41.795 1.00 146.88 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I 5  94  ? 22.309  -30.537 42.199 1.00 146.84 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I 5  94  ? 21.047  -30.892 42.156 1.00 146.76 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I 5  94  ? 21.088  -32.193 41.683 1.00 147.01 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I 5  94  ? 20.078  -33.141 41.407 1.00 147.15 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I 5  94  ? 18.780  -32.887 41.582 1.00 147.35 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I 5  94  ? 20.449  -34.359 40.944 1.00 147.23 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I 5  94  ? 21.754  -34.614 40.770 1.00 147.33 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I 5  94  ? 22.794  -33.803 40.994 1.00 147.34 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I 5  94  ? 22.392  -32.597 41.454 1.00 147.11 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I 5  95  ? 27.871  -31.651 39.190 1.00 148.95 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I 5  95  ? 29.300  -32.032 39.232 1.00 149.18 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I 5  95  ? 27.463  -30.441 38.439 1.00 148.71 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I 5  95  ? 27.003  -32.884 38.641 1.00 150.05 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I 5  95  ? 27.504  -34.226 38.616 1.00 151.58 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I 5  95  ? 26.553  -35.146 37.864 1.00 152.98 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I 5  95  ? 25.173  -34.877 38.246 1.00 153.45 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I 5  95  ? 26.591  -35.040 36.338 1.00 153.75 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I 5  95  ? 26.517  -36.353 35.771 1.00 154.67 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I 5  95  ? 25.336  -34.222 36.031 1.00 153.86 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I 5  95  ? 24.390  -34.824 37.065 1.00 153.78 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I 5  95  ? 23.102  -34.073 37.302 1.00 153.71 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I 5  95  ? 21.897  -34.763 37.289 1.00 153.33 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I 5  95  ? 21.794  -35.963 37.097 1.00 152.84 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I 5  95  ? 20.791  -33.982 37.517 1.00 153.25 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I 5  95  ? 20.763  -32.617 37.750 1.00 153.42 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I 5  95  ? 19.711  -32.020 37.943 1.00 153.51 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I 5  95  ? 22.048  -31.953 37.749 1.00 153.61 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I 5  95  ? 22.152  -30.473 37.989 1.00 153.63 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I 5  95  ? 23.138  -32.704 37.528 1.00 153.75 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I 5  96  ? 26.573  -36.613 34.185 1.00 155.46 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I 5  96  ? 27.937  -36.252 33.733 1.00 155.65 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I 5  96  ? 25.405  -35.968 33.545 1.00 155.27 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I 5  96  ? 26.380  -38.204 34.085 1.00 155.31 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I 5  96  ? 25.933  -38.837 32.881 1.00 155.08 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I 5  96  ? 24.551  -39.445 33.070 1.00 154.98 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I 5  96  ? 23.724  -38.555 33.874 1.00 155.43 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I 5  96  ? 23.759  -39.705 31.787 1.00 154.64 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I 5  96  ? 23.042  -40.958 31.889 1.00 153.61 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I 5  96  ? 22.841  -38.487 31.732 1.00 155.11 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I 5  96  ? 22.494  -38.351 33.208 1.00 155.63 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I 5  96  ? 21.916  -37.053 33.545 1.00 156.29 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I 5  96  ? 22.532  -35.827 33.459 1.00 156.63 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I 5  96  ? 21.776  -34.829 33.818 1.00 156.92 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I 5  96  ? 20.570  -35.429 34.163 1.00 156.84 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I 5  96  ? 19.364  -34.845 34.631 1.00 156.68 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I 5  96  ? 19.124  -33.647 34.837 1.00 156.59 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I 5  96  ? 18.374  -35.802 34.865 1.00 156.42 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I 5  96  ? 18.533  -37.156 34.672 1.00 156.39 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I 5  96  ? 17.467  -37.919 34.953 1.00 156.11 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I 5  96  ? 19.659  -37.718 34.234 1.00 156.56 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I 5  96  ? 20.637  -36.800 33.999 1.00 156.65 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I 5  97  ? 21.694  -41.325 31.080 1.00 152.69 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I 5  97  ? 21.515  -42.793 31.169 1.00 152.57 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I 5  97  ? 21.725  -40.687 29.744 1.00 152.40 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I 5  97  ? 20.549  -40.619 31.951 1.00 151.84 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I 5  97  ? 19.328  -41.295 32.257 1.00 150.38 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I 5  97  ? 18.125  -40.561 31.681 1.00 149.07 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I 5  97  ? 18.339  -39.126 31.719 1.00 149.13 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I 5  97  ? 17.776  -40.895 30.232 1.00 147.90 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I 5  97  ? 16.366  -41.084 30.120 1.00 146.04 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I 5  97  ? 18.255  -39.674 29.446 1.00 148.33 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I 5  97  ? 18.014  -38.563 30.463 1.00 148.88 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I 5  97  ? 18.805  -37.338 30.326 1.00 149.11 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I 5  97  ? 20.059  -37.168 29.780 1.00 149.31 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I 5  97  ? 20.488  -35.934 29.827 1.00 149.30 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I 5  97  ? 19.457  -35.242 30.450 1.00 149.27 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I 5  97  ? 19.339  -33.868 30.783 1.00 149.29 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I 5  97  ? 20.160  -32.962 30.581 1.00 149.36 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I 5  97  ? 18.122  -33.583 31.409 1.00 149.17 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I 5  97  ? 17.144  -34.517 31.677 1.00 149.10 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I 5  97  ? 16.036  -34.079 32.284 1.00 149.15 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I 5  97  ? 17.244  -35.802 31.372 1.00 149.05 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I 5  97  ? 18.420  -36.094 30.764 1.00 149.13 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I 5  98  ? 15.789  -42.484 29.606 1.00 144.68 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I 5  98  ? 16.290  -43.533 30.526 1.00 144.62 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I 5  98  ? 16.065  -42.565 28.154 1.00 144.70 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I 5  98  ? 14.199  -42.359 29.759 1.00 143.15 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I 5  98  ? 13.539  -42.469 31.023 1.00 140.56 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I 5  98  ? 12.557  -41.321 31.213 1.00 138.55 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I 5  98  ? 13.264  -40.060 31.076 1.00 138.33 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I 5  98  ? 11.391  -41.283 30.225 1.00 137.00 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I 5  98  ? 10.159  -41.030 30.908 1.00 134.75 ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I 5  98  ? 11.751  -40.154 29.260 1.00 137.51 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I 5  98  ? 12.620  -39.240 30.119 1.00 138.24 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I 5  98  ? 13.644  -38.497 29.379 1.00 138.56 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I 5  98  ? 14.671  -39.016 28.639 1.00 138.60 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I 5  98  ? 15.440  -38.107 28.087 1.00 138.85 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I 5  98  ? 14.881  -36.905 28.491 1.00 138.84 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I 5  98  ? 15.224  -35.553 28.245 1.00 138.95 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I 5  98  ? 16.268  -35.182 27.495 1.00 138.97 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I 5  98  ? 14.451  -34.589 28.800 1.00 138.93 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I 5  98  ? 13.404  -34.951 29.555 1.00 138.71 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I 5  98  ? 12.987  -36.184 29.852 1.00 138.76 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I 5  98  ? 13.771  -37.126 29.289 1.00 138.74 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I 5  99  ? 8.735   -41.400 30.263 1.00 133.08 ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I 5  99  ? 7.849   -41.910 31.333 1.00 132.89 ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I 5  99  ? 8.966   -42.216 29.052 1.00 133.34 ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I 5  99  ? 8.168   -39.990 29.774 1.00 131.58 ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I 5  99  ? 8.119   -38.867 30.646 1.00 129.40 ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I 5  99  ? 8.079   -37.584 29.837 1.00 127.85 ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I 5  99  ? 9.351   -37.389 29.159 1.00 127.80 ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I 5  99  ? 7.008   -37.538 28.749 1.00 126.91 ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I 5  99  ? 6.403   -36.253 28.765 1.00 125.67 ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I 5  99  ? 7.819   -37.740 27.468 1.00 127.24 ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I 5  99  ? 9.075   -36.954 27.841 1.00 127.69 ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I 5  99  ? 10.248  -37.104 26.965 1.00 127.85 ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I 5  99  ? 10.688  -38.236 26.317 1.00 127.83 ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I 5  99  ? 11.765  -38.053 25.604 1.00 127.67 ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I 5  99  ? 12.065  -36.711 25.785 1.00 127.78 ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I 5  99  ? 13.127  -35.934 25.257 1.00 127.83 ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I 5  99  ? 14.036  -36.303 24.505 1.00 127.63 ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I 5  99  ? 13.078  -34.605 25.683 1.00 128.20 ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I 5  99  ? 12.111  -34.092 26.522 1.00 128.34 ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I 5  99  ? 12.217  -32.792 26.831 1.00 128.47 ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I 5  99  ? 11.110  -34.812 27.027 1.00 128.26 ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I 5  99  ? 11.144  -36.111 26.618 1.00 127.98 ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I 5  100 ? 4.865   -36.005 29.124 1.00 124.44 ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I 5  100 ? 4.654   -36.437 30.518 1.00 124.62 ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I 5  100 ? 4.025   -36.567 28.045 1.00 124.57 ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I 5  100 ? 4.760   -34.410 29.049 1.00 124.66 ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I 5  100 ? 5.719   -33.597 29.728 1.00 125.19 ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I 5  100 ? 6.428   -32.638 28.788 1.00 125.70 ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I 5  100 ? 7.373   -33.328 27.929 1.00 125.18 ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I 5  100 ? 5.499   -31.858 27.864 1.00 126.68 ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I 5  100 ? 5.735   -30.475 28.077 1.00 128.84 ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I 5  100 ? 5.892   -32.308 26.457 1.00 125.85 ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I 5  100 ? 7.351   -32.700 26.663 1.00 125.05 ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I 5  100 ? 7.949   -33.630 25.644 1.00 124.43 ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I 5  100 ? 9.149   -33.285 24.991 1.00 124.28 ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I 5  100 ? 9.715   -32.213 25.242 1.00 124.26 ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I 5  100 ? 9.674   -34.149 24.083 1.00 124.14 ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I 5  100 ? 9.061   -35.307 23.820 1.00 124.05 ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I 5  100 ? 9.619   -36.119 22.918 1.00 123.90 ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I 5  100 ? 7.843   -35.676 24.467 1.00 124.05 ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I 5  100 ? 7.332   -34.819 25.361 1.00 124.11 ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I 5  101 ? 4.618   -29.368 27.782 1.00 130.69 ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I 5  101 ? 4.638   -28.413 28.915 1.00 130.38 ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I 5  101 ? 3.354   -30.042 27.390 1.00 130.38 ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I 5  101 ? 5.202   -28.634 26.483 1.00 132.21 ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I 5  101 ? 6.557   -28.167 26.420 1.00 133.76 ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I 5  101 ? 7.067   -28.130 24.986 1.00 135.06 ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I 5  101 ? 7.336   -29.472 24.505 1.00 134.99 ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I 5  101 ? 6.119   -27.517 23.955 1.00 136.23 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I 5  101 ? 6.860   -26.697 23.070 1.00 138.63 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I 5  101 ? 5.576   -28.731 23.210 1.00 135.66 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I 5  101 ? 6.857   -29.549 23.178 1.00 135.08 ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I 5  101 ? 6.713   -30.946 22.792 1.00 135.06 ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I 5  101 ? 5.685   -31.800 23.083 1.00 135.18 ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I 5  101 ? 5.846   -33.008 22.597 1.00 135.11 ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I 5  101 ? 7.065   -32.942 21.940 1.00 135.09 ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I 5  101 ? 7.812   -33.890 21.206 1.00 134.99 ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I 5  101 ? 7.414   -35.150 21.012 1.00 134.84 ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I 5  101 ? 8.993   -33.497 20.678 1.00 135.05 ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I 5  101 ? 9.399   -32.233 20.867 1.00 134.98 ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I 5  101 ? 8.785   -31.254 21.535 1.00 135.01 ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I 5  101 ? 7.613   -31.675 22.051 1.00 135.09 ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I 5  102 ? 6.237   -25.332 22.523 1.00 140.48 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I 5  102 ? 6.273   -24.378 23.652 1.00 140.67 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I 5  102 ? 4.956   -25.642 21.844 1.00 140.14 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I 5  102 ? 7.273   -24.845 21.400 1.00 142.34 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I 5  102 ? 8.690   -25.057 21.496 1.00 144.70 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I 5  102 ? 9.285   -25.491 20.159 1.00 146.56 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I 5  102 ? 9.109   -26.919 19.987 1.00 146.69 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I 5  102 ? 8.688   -24.837 18.914 1.00 147.99 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I 5  102 ? 9.721   -24.390 18.039 1.00 150.36 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I 5  102 ? 7.825   -25.919 18.266 1.00 147.54 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I 5  102 ? 8.456   -27.210 18.767 1.00 146.93 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I 5  102 ? 7.482   -28.264 19.035 1.00 146.88 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I 5  102 ? 6.308   -28.145 19.743 1.00 146.93 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I 5  102 ? 5.635   -29.258 19.828 1.00 146.98 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I 5  102 ? 6.412   -30.179 19.135 1.00 146.70 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I 5  102 ? 6.192   -31.558 18.888 1.00 146.40 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I 5  102 ? 5.232   -32.253 19.249 1.00 145.92 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I 5  102 ? 7.226   -32.130 18.144 1.00 146.57 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I 5  102 ? 8.336   -31.450 17.691 1.00 146.65 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I 5  102 ? 9.230   -32.161 16.988 1.00 146.61 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I 5  102 ? 8.553   -30.157 17.916 1.00 146.75 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I 5  102 ? 7.555   -29.583 18.641 1.00 146.80 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I 5  103 ? 9.383   -23.341 16.874 1.00 152.38 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I 5  103 ? 10.635  -22.609 16.569 1.00 152.26 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I 5  103 ? 8.162   -22.592 17.260 1.00 152.38 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I 5  103 ? 8.996   -24.284 15.637 1.00 153.36 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I 5  103 ? 10.023  -24.900 14.873 1.00 155.05 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I 5  103 ? 9.503   -26.042 14.015 1.00 156.37 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I 5  103 ? 8.720   -26.980 14.795 1.00 156.36 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I 5  103 ? 8.601   -25.659 12.839 1.00 157.36 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I 5  103 ? 9.374   -25.633 11.622 1.00 158.96 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I 5  103 ? 7.527   -26.751 12.845 1.00 157.01 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I 5  103 ? 8.096   -27.777 13.815 1.00 156.57 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I 5  103 ? 7.056   -28.694 14.385 1.00 156.52 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I 5  103 ? 7.019   -30.016 13.966 1.00 156.37 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I 5  103 ? 7.796   -30.500 13.161 1.00 156.28 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I 5  103 ? 6.024   -30.771 14.539 1.00 156.29 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I 5  103 ? 5.080   -30.347 15.462 1.00 156.37 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I 5  103 ? 4.230   -31.111 15.909 1.00 156.48 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I 5  103 ? 5.169   -28.957 15.854 1.00 156.42 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I 5  103 ? 4.203   -28.374 16.846 1.00 156.32 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I 5  103 ? 6.138   -28.208 15.304 1.00 156.57 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I 5  104 ? 8.742   -25.719 10.145 1.00 159.98 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I 5  104 ? 9.794   -25.296 9.190  1.00 160.15 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I 5  104 ? 7.426   -25.032 10.134 1.00 159.71 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I 5  104 ? 8.487   -27.291 9.984  1.00 160.61 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I 5  104 ? 9.420   -28.156 9.342  1.00 161.82 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I 5  104 ? 8.678   -29.359 8.784  1.00 162.96 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I 5  104 ? 7.843   -29.927 9.831  1.00 163.07 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I 5  104 ? 7.747   -29.049 7.609  1.00 163.75 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I 5  104 ? 7.883   -30.025 6.570  1.00 165.00 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I 5  104 ? 6.360   -29.099 8.241  1.00 163.52 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I 5  104 ? 6.557   -30.176 9.301  1.00 163.27 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I 5  104 ? 5.510   -30.168 10.384 1.00 163.24 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I 5  104 ? 4.911   -31.358 10.773 1.00 163.10 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I 5  104 ? 5.177   -32.450 10.299 1.00 162.94 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I 5  104 ? 3.966   -31.227 11.762 1.00 163.06 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I 5  104 ? 3.565   -30.057 12.388 1.00 163.09 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I 5  104 ? 2.707   -30.060 13.265 1.00 163.08 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I 5  104 ? 4.224   -28.849 11.935 1.00 163.10 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I 5  104 ? 3.881   -27.511 12.527 1.00 163.02 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I 5  104 ? 5.151   -28.964 10.972 1.00 163.21 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I 5  105 ? 7.263   -29.787 5.107  1.00 165.95 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I 5  105 ? 8.068   -28.729 4.458  1.00 165.98 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I 5  105 ? 5.795   -29.634 5.222  1.00 165.79 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I 5  105 ? 7.527   -31.174 4.349  1.00 166.81 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I 5  105 ? 7.690   -32.404 5.066  1.00 168.12 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I 5  105 ? 6.370   -33.101 5.373  1.00 169.00 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I 5  105 ? 5.683   -32.489 6.498  1.00 169.53 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I 5  105 ? 5.333   -33.178 4.242  1.00 169.20 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I 5  105 ? 5.289   -34.534 3.751  1.00 168.87 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I 5  105 ? 4.033   -32.720 4.914  1.00 169.65 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I 5  105 ? 4.358   -32.963 6.384  1.00 170.10 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I 5  105 ? 3.415   -32.338 7.388  1.00 170.77 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I 5  105 ? 2.573   -33.163 8.122  1.00 171.11 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I 5  105 ? 2.542   -34.379 8.015  1.00 171.27 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I 5  105 ? 1.750   -32.509 9.009  1.00 171.27 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I 5  105 ? 1.679   -31.144 9.236  1.00 171.41 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I 5  105 ? 0.897   -30.671 10.056 1.00 171.45 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I 5  105 ? 2.579   -30.335 8.436  1.00 171.44 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I 5  105 ? 2.601   -28.838 8.578  1.00 171.51 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I 5  105 ? 3.390   -30.963 7.564  1.00 171.16 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I 5  106 ? 4.088   -35.176 2.894  1.00 168.48 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I 5  106 ? 4.655   -36.341 2.174  1.00 168.41 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I 5  106 ? 3.410   -34.109 2.124  1.00 168.49 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I 5  106 ? 3.073   -35.688 4.026  1.00 167.87 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I 5  106 ? 2.438   -36.963 3.938  1.00 167.03 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I 5  106 ? 0.996   -36.906 4.421  1.00 166.44 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I 5  106 ? 0.813   -35.830 5.385  1.00 166.53 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I 5  106 ? -0.047  -36.684 3.325  1.00 165.77 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I 5  106 ? -1.140  -37.592 3.491  1.00 164.63 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I 5  106 ? -0.496  -35.246 3.562  1.00 166.12 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I 5  106 ? -0.417  -35.202 5.086  1.00 166.56 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I 5  106 ? -0.495  -33.833 5.705  1.00 166.81 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I 5  106 ? -1.461  -33.571 6.698  1.00 166.86 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I 5  106 ? -2.240  -34.467 7.058  1.00 166.81 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I 5  106 ? -1.519  -32.325 7.243  1.00 166.78 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I 5  106 ? -0.672  -31.372 6.840  1.00 166.66 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I 5  106 ? -0.772  -30.166 7.407  1.00 166.53 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I 5  106 ? 0.315   -31.616 5.835  1.00 166.75 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I 5  106 ? 0.367   -32.845 5.302  1.00 166.81 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I 5  107 ? -1.902  -38.187 2.215  1.00 163.59 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I 5  107 ? -1.097  -39.327 1.723  1.00 163.62 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I 5  107 ? -2.230  -37.054 1.322  1.00 163.77 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I 5  107 ? -3.294  -38.754 2.762  1.00 162.16 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I 5  107 ? -3.398  -39.424 4.013  1.00 160.19 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I 5  107 ? -4.517  -38.804 4.833  1.00 158.71 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I 5  107 ? -4.157  -37.445 5.187  1.00 158.72 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I 5  107 ? -5.873  -38.720 4.126  1.00 157.55 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I 5  107 ? -6.890  -39.337 4.921  1.00 155.72 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I 5  107 ? -6.115  -37.218 3.954  1.00 157.85 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I 5  107 ? -5.326  -36.656 5.130  1.00 158.36 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I 5  107 ? -4.964  -35.198 5.040  1.00 158.43 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I 5  107 ? -5.635  -34.274 5.858  1.00 158.45 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I 5  107 ? -6.513  -34.674 6.633  1.00 158.48 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I 5  107 ? -5.304  -32.957 5.778  1.00 158.48 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I 5  107 ? -4.350  -32.552 4.933  1.00 158.56 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I 5  107 ? -4.064  -31.246 4.893  1.00 158.54 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I 5  107 ? -3.653  -33.474 4.091  1.00 158.62 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I 5  107 ? -3.988  -34.771 4.178  1.00 158.56 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I 5  108 ? -7.253  -40.891 4.755  1.00 154.23 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I 5  108 ? -6.052  -41.693 5.086  1.00 154.06 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I 5  108 ? -7.918  -41.063 3.444  1.00 154.09 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I 5  108 ? -8.365  -41.130 5.883  1.00 152.88 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I 5  108 ? -8.026  -41.124 7.272  1.00 150.54 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I 5  108 ? -8.911  -40.169 8.060  1.00 148.87 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I 5  108 ? -8.764  -38.817 7.554  1.00 148.48 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I 5  108 ? -10.410 -40.472 8.042  1.00 147.94 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I 5  108 ? -10.893 -40.412 9.392  1.00 146.47 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I 5  108 ? -10.994 -39.389 7.129  1.00 147.97 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I 5  108 ? -10.037 -38.231 7.377  1.00 148.16 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I 5  108 ? -9.910  -37.271 6.287  1.00 148.09 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I 5  108 ? -9.888  -37.529 4.945  1.00 148.17 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I 5  108 ? -9.747  -36.456 4.204  1.00 148.37 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I 5  108 ? -9.663  -35.423 5.123  1.00 148.42 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I 5  108 ? -9.502  -34.024 4.984  1.00 148.58 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I 5  108 ? -9.399  -33.410 3.800  1.00 148.62 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I 5  108 ? -9.461  -33.275 6.112  1.00 148.58 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I 5  108 ? -9.568  -33.890 7.299  1.00 148.47 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I 5  108 ? -9.718  -35.192 7.552  1.00 148.39 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I 5  108 ? -9.760  -35.911 6.414  1.00 148.25 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I 5  109 ? -12.438 -40.536 9.808  1.00 145.18 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I 5  109 ? -12.490 -41.249 11.104 1.00 144.89 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I 5  109 ? -13.209 -41.067 8.659  1.00 145.24 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I 5  109 ? -12.876 -39.009 10.031 1.00 143.98 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I 5  109 ? -12.048 -38.087 10.750 1.00 142.04 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I 5  109 ? -12.608 -36.673 10.703 1.00 140.73 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I 5  109 ? -12.191 -36.019 9.474  1.00 140.59 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I 5  109 ? -14.133 -36.555 10.757 1.00 140.02 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I 5  109 ? -14.472 -35.531 11.681 1.00 139.13 ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I 5  109 ? -14.501 -36.167 9.327  1.00 140.18 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I 5  109 ? -13.298 -35.307 8.956  1.00 140.15 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I 5  109 ? -13.140 -35.074 7.521  1.00 139.50 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I 5  109 ? -13.259 -36.002 6.525  1.00 139.39 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I 5  109 ? -13.069 -35.518 5.325  1.00 139.39 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I 5  109 ? -12.809 -34.177 5.543  1.00 139.28 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I 5  109 ? -12.522 -33.109 4.665  1.00 139.40 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I 5  109 ? -12.450 -33.254 3.336  1.00 139.35 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I 5  109 ? -12.304 -31.886 5.205  1.00 139.42 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I 5  109 ? -12.371 -31.746 6.537  1.00 139.23 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I 5  109 ? -12.638 -32.678 7.457  1.00 139.15 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I 5  109 ? -12.849 -33.883 6.894  1.00 139.18 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I 5  110 ? -15.967 -35.214 12.166 1.00 138.41 ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I 5  110 ? -16.244 -36.108 13.314 1.00 138.27 ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I 5  110 ? -16.887 -35.187 11.004 1.00 138.15 ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I 5  110 ? -15.835 -33.710 12.706 1.00 137.94 ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I 5  110 ? -14.633 -32.934 12.535 1.00 137.05 ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I 5  110 ? -14.912 -31.608 11.843 1.00 136.42 ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I 5  110 ? -14.590 -31.727 10.430 1.00 136.68 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I 5  110 ? -16.367 -31.142 11.914 1.00 135.97 ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I 5  110 ? -16.462 -29.735 12.140 1.00 135.27 ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I 5  110 ? -16.903 -31.528 10.541 1.00 136.46 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I 5  110 ? -15.685 -31.231 9.679  1.00 136.99 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I 5  110 ? -15.774 -31.825 8.341  1.00 137.31 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I 5  110 ? -16.103 -33.116 8.014  1.00 137.37 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I 5  110 ? -16.116 -33.358 6.725  1.00 137.28 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I 5  110 ? -15.780 -32.138 6.165  1.00 137.43 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I 5  110 ? -15.619 -31.718 4.827  1.00 137.62 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I 5  110 ? -15.788 -32.533 3.784  1.00 137.73 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I 5  110 ? -15.273 -30.429 4.603  1.00 137.73 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I 5  110 ? -15.101 -29.612 5.654  1.00 137.71 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I 5  110 ? -15.224 -29.890 6.954  1.00 137.47 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I 5  110 ? -15.570 -31.179 7.143  1.00 137.36 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I 5  111 ? -17.877 -28.984 12.099 1.00 134.63 ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I 5  111 ? -17.995 -28.152 13.312 1.00 134.46 ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I 5  111 ? -18.920 -29.984 11.789 1.00 134.33 ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I 5  111 ? -17.746 -28.018 10.834 1.00 135.83 ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I 5  111 ? -16.712 -27.031 10.758 1.00 137.23 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I 5  111 ? -16.824 -26.194 9.488  1.00 138.20 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I 5  111 ? -16.705 -27.046 8.317  1.00 137.98 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I 5  111 ? -18.128 -25.408 9.331  1.00 138.98 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I 5  111 ? -17.836 -24.071 8.916  1.00 140.85 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I 5  111 ? -18.915 -26.190 8.279  1.00 138.30 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I 5  111 ? -17.812 -26.852 7.456  1.00 137.72 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I 5  111 ? -18.207 -28.168 6.830  1.00 137.10 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I 5  111 ? -18.134 -28.302 5.451  1.00 136.87 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I 5  111 ? -17.760 -27.416 4.698  1.00 136.97 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I 5  111 ? -18.514 -29.534 4.972  1.00 136.40 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I 5  111 ? -18.953 -30.619 5.710  1.00 136.20 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I 5  111 ? -19.268 -31.674 5.171  1.00 135.99 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I 5  111 ? -19.011 -30.418 7.142  1.00 136.23 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I 5  111 ? -19.475 -31.519 8.051  1.00 135.96 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I 5  111 ? -18.640 -29.221 7.626  1.00 136.52 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I 5  112 ? -18.978 -22.961 8.739  1.00 142.22 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I 5  112 ? -18.370 -21.638 8.994  1.00 142.37 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I 5  112 ? -20.167 -23.367 9.521  1.00 142.15 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I 5  112 ? -19.333 -23.083 7.180  1.00 144.14 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I 5  112 ? -18.363 -22.824 6.147  1.00 146.45 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I 5  112 ? -18.991 -22.859 4.758  1.00 148.10 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I 5  112 ? -19.093 -24.232 4.300  1.00 148.30 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I 5  112 ? -20.395 -22.261 4.676  1.00 149.31 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I 5  112 ? -20.461 -21.212 3.708  1.00 151.15 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I 5  112 ? -21.310 -23.433 4.320  1.00 148.93 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I 5  112 ? -20.362 -24.466 3.725  1.00 148.55 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I 5  112 ? -20.767 -25.838 4.025  1.00 148.59 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I 5  112 ? -20.974 -26.380 5.264  1.00 148.65 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I 5  112 ? -21.337 -27.641 5.245  1.00 148.70 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I 5  112 ? -21.372 -27.954 3.898  1.00 148.78 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I 5  112 ? -21.686 -29.145 3.205  1.00 148.90 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I 5  112 ? -22.037 -30.281 3.818  1.00 148.61 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I 5  112 ? -21.625 -29.123 1.853  1.00 149.10 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I 5  112 ? -21.272 -27.983 1.236  1.00 149.11 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I 5  112 ? -20.955 -26.804 1.782  1.00 148.97 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I 5  112 ? -21.023 -26.853 3.128  1.00 148.77 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I 5  113 ? -21.625 -20.109 3.791  1.00 152.54 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I 5  113 ? -21.170 -18.938 3.005  1.00 152.37 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I 5  113 ? -22.015 -19.916 5.208  1.00 152.35 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I 5  113 ? -22.847 -20.848 3.056  1.00 153.71 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I 5  113 ? -23.119 -20.624 1.672  1.00 155.68 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I 5  113 ? -23.514 -21.884 0.916  1.00 157.05 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I 5  113 ? -23.302 -23.081 1.702  1.00 157.32 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I 5  113 ? -24.986 -21.960 0.528  1.00 158.04 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I 5  113 ? -25.200 -21.370 -0.755 1.00 159.31 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I 5  113 ? -25.289 -23.458 0.506  1.00 157.94 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I 5  113 ? -24.020 -24.107 1.045  1.00 157.68 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I 5  113 ? -24.307 -25.275 1.951  1.00 157.71 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I 5  113 ? -24.371 -26.573 1.402  1.00 157.61 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I 5  113 ? -24.185 -26.750 0.189  1.00 157.34 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I 5  113 ? -24.632 -27.623 2.224  1.00 157.59 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I 5  113 ? -24.830 -27.420 3.530  1.00 157.53 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I 5  113 ? -25.082 -28.490 4.289  1.00 157.47 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I 5  113 ? -24.777 -26.112 4.110  1.00 157.51 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I 5  113 ? -24.518 -25.080 3.293  1.00 157.57 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I 5  114 ? -26.674 -20.949 -1.222 1.00 160.26 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I 5  114 ? -26.546 -20.032 -2.375 1.00 160.38 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I 5  114 ? -27.429 -20.514 -0.025 1.00 160.38 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I 5  114 ? -27.308 -22.328 -1.720 1.00 160.95 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I 5  114 ? -26.788 -23.027 -2.852 1.00 162.37 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I 5  114 ? -27.513 -24.352 -3.031 1.00 163.46 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I 5  114 ? -27.173 -25.247 -1.935 1.00 163.71 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I 5  114 ? -29.040 -24.247 -3.037 1.00 164.08 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I 5  114 ? -29.622 -25.082 -4.042 1.00 164.72 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I 5  114 ? -29.409 -24.733 -1.639 1.00 164.03 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I 5  114 ? -28.371 -25.831 -1.466 1.00 163.99 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I 5  114 ? -28.240 -26.287 -0.084 1.00 164.13 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I 5  114 ? -28.017 -25.515 1.024  1.00 164.18 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I 5  114 ? -27.953 -26.194 2.144  1.00 164.14 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I 5  114 ? -28.154 -27.502 1.740  1.00 164.12 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I 5  114 ? -28.203 -28.714 2.455  1.00 164.08 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I 5  114 ? -28.044 -28.768 3.779  1.00 164.05 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I 5  114 ? -28.421 -29.857 1.759  1.00 163.96 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I 5  114 ? -28.584 -29.791 0.429  1.00 163.85 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I 5  114 ? -28.556 -28.707 -0.350 1.00 164.03 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I 5  114 ? -28.337 -27.585 0.370  1.00 164.12 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I 5  115 ? -31.149 -24.874 -4.496 1.00 165.14 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I 5  115 ? -31.169 -23.696 -5.394 1.00 165.20 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I 5  115 ? -32.024 -24.884 -3.299 1.00 164.86 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I 5  115 ? -31.482 -26.198 -5.345 1.00 164.83 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I 5  115 ? -30.839 -27.456 -5.080 1.00 164.17 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I 5  115 ? -31.634 -28.392 -4.173 1.00 163.54 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I 5  115 ? -31.153 -28.274 -2.805 1.00 163.43 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I 5  115 ? -33.157 -28.199 -4.120 1.00 163.03 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I 5  115 ? -33.838 -29.384 -4.617 1.00 162.13 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I 5  115 ? -33.424 -27.875 -2.651 1.00 163.24 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I 5  115 ? -32.244 -28.541 -1.952 1.00 163.45 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I 5  115 ? -31.996 -28.046 -0.542 1.00 163.53 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I 5  115 ? -31.921 -28.953 0.536  1.00 163.42 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I 5  115 ? -32.044 -30.171 0.339  1.00 163.41 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I 5  115 ? -31.705 -28.466 1.790  1.00 163.25 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I 5  115 ? -31.571 -27.151 1.994  1.00 163.17 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I 5  115 ? -31.359 -26.723 3.242  1.00 162.94 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I 5  115 ? -31.647 -26.212 0.922  1.00 163.36 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I 5  115 ? -31.861 -26.701 -0.309 1.00 163.56 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I 5  116 ? -35.020 -30.212 -3.894 1.00 161.23 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I 5  116 ? -35.675 -31.025 -4.943 1.00 161.35 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I 5  116 ? -35.861 -29.314 -3.070 1.00 161.06 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I 5  116 ? -34.203 -31.184 -2.918 1.00 160.39 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I 5  116 ? -34.229 -32.600 -3.102 1.00 159.11 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I 5  116 ? -35.015 -33.276 -1.989 1.00 158.20 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I 5  116 ? -34.673 -32.663 -0.717 1.00 157.99 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I 5  116 ? -36.538 -33.208 -2.118 1.00 157.64 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I 5  116 ? -37.088 -34.527 -1.868 1.00 156.69 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I 5  116 ? -36.929 -32.120 -1.112 1.00 157.63 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I 5  116 ? -35.847 -32.255 -0.041 1.00 157.70 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I 5  116 ? -35.552 -31.017 0.782  1.00 157.45 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I 5  116 ? -35.198 -31.159 2.115  1.00 157.14 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I 5  116 ? -35.103 -32.230 2.686  1.00 156.88 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I 5  116 ? -34.947 -29.984 2.778  1.00 157.09 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I 5  116 ? -35.011 -28.701 2.263  1.00 157.33 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I 5  116 ? -34.763 -27.717 2.955  1.00 157.36 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I 5  116 ? -35.387 -28.612 0.868  1.00 157.44 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I 5  116 ? -35.498 -27.276 0.189  1.00 157.37 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I 5  116 ? -35.631 -29.756 0.206  1.00 157.49 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I 5  117 ? -38.517 -34.861 -1.204 1.00 155.83 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I 5  117 ? -38.821 -36.275 -1.518 1.00 155.58 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I 5  117 ? -39.506 -33.813 -1.549 1.00 155.77 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I 5  117 ? -38.201 -34.752 0.358  1.00 155.27 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I 5  117 ? -37.181 -35.561 0.957  1.00 154.12 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I 5  117 ? -37.299 -35.546 2.473  1.00 153.02 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I 5  117 ? -37.063 -34.203 2.969  1.00 152.90 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I 5  117 ? -38.665 -35.966 3.008  1.00 152.33 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I 5  117 ? -38.502 -36.825 4.126  1.00 151.18 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I 5  117 ? -39.325 -34.646 3.399  1.00 152.54 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I 5  117 ? -38.125 -33.802 3.815  1.00 152.87 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I 5  117 ? -38.318 -32.306 3.713  1.00 152.93 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I 5  117 ? -38.213 -31.521 4.852  1.00 152.92 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I 5  117 ? -37.976 -31.957 5.967  1.00 152.89 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I 5  117 ? -38.402 -30.175 4.643  1.00 152.98 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I 5  117 ? -38.678 -29.544 3.441  1.00 153.09 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I 5  117 ? -38.829 -28.327 3.366  1.00 153.19 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I 5  117 ? -38.774 -30.416 2.291  1.00 153.08 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I 5  117 ? -39.073 -29.856 0.930  1.00 153.09 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I 5  117 ? -38.592 -31.733 2.480  1.00 153.01 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I 5  118 ? -39.629 -37.889 4.534  1.00 150.48 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I 5  118 ? -39.054 -39.237 4.312  1.00 150.40 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I 5  118 ? -40.922 -37.511 3.915  1.00 150.35 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I 5  118 ? -39.790 -37.660 6.107  1.00 149.87 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I 5  118 ? -38.650 -37.433 6.935  1.00 148.70 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I 5  118 ? -38.913 -36.349 7.967  1.00 147.68 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I 5  118 ? -38.858 -35.031 7.363  1.00 147.92 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I 5  118 ? -40.297 -36.361 8.607  1.00 146.66 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I 5  118 ? -40.523 -37.444 9.549  1.00 144.54 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I 5  118 ? -40.348 -34.965 9.217  1.00 147.47 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I 5  118 ? -39.536 -34.129 8.226  1.00 148.20 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I 5  118 ? -40.392 -33.142 7.467  1.00 148.85 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I 5  118 ? -40.584 -31.877 8.000  1.00 149.11 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I 5  118 ? -40.094 -31.505 9.052  1.00 149.04 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I 5  118 ? -41.382 -31.046 7.248  1.00 149.48 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I 5  118 ? -42.000 -31.339 6.042  1.00 149.57 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I 5  118 ? -42.696 -30.514 5.451  1.00 149.55 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I 5  118 ? -41.765 -32.678 5.540  1.00 149.46 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I 5  118 ? -42.380 -33.125 4.244  1.00 149.51 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I 5  118 ? -40.988 -33.502 6.268  1.00 149.21 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I 5  119 ? -39.593 -37.896 10.779 1.00 142.82 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I 5  119 ? -38.194 -38.044 10.318 1.00 142.51 ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I 5  119 ? -40.270 -39.049 11.410 1.00 142.72 ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I 5  119 ? -39.709 -36.687 11.813 1.00 142.30 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I 5  119 ? -38.569 -35.902 12.147 1.00 141.46 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I 5  119 ? -38.961 -34.783 13.087 1.00 140.72 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I 5  119 ? -39.631 -33.726 12.358 1.00 140.76 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I 5  119 ? -39.883 -35.206 14.223 1.00 140.25 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I 5  119 ? -39.160 -34.921 15.416 1.00 139.44 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I 5  119 ? -41.161 -34.377 14.030 1.00 140.63 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I 5  119 ? -40.744 -33.246 13.087 1.00 140.96 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I 5  119 ? -41.769 -32.769 12.072 1.00 141.31 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I 5  119 ? -41.957 -31.409 11.854 1.00 141.36 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I 5  119 ? -41.360 -30.526 12.446 1.00 141.13 ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I 5  119 ? -42.898 -31.103 10.898 1.00 141.66 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I 5  119 ? -43.654 -31.989 10.143 1.00 141.80 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I 5  119 ? -44.472 -31.600 9.313  1.00 142.07 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I 5  119 ? -43.409 -33.390 10.410 1.00 141.68 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I 5  119 ? -44.155 -34.463 9.670  1.00 141.75 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I 5  119 ? -42.496 -33.702 11.344 1.00 141.54 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I 5  120 ? -39.642 -35.279 16.901 1.00 138.43 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I 5  120 ? -38.453 -35.761 17.639 1.00 138.04 ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I 5  120 ? -40.866 -36.112 16.852 1.00 138.71 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I 5  120 ? -40.037 -33.832 17.448 1.00 137.66 ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I 5  120 ? -39.164 -32.739 17.194 1.00 136.94 ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I 5  120 ? -39.866 -31.413 17.392 1.00 136.47 ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I 5  120 ? -40.871 -31.240 16.367 1.00 136.84 ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I 5  120 ? -40.569 -31.230 18.731 1.00 135.89 ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I 5  120 ? -40.228 -29.935 19.193 1.00 134.54 ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I 5  120 ? -42.057 -31.379 18.400 1.00 136.55 ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I 5  120 ? -42.117 -30.915 16.946 1.00 137.22 ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I 5  120 ? -43.139 -31.537 16.101 1.00 137.90 ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I 5  120 ? -43.529 -32.857 16.082 1.00 138.00 ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I 5  120 ? -44.457 -33.114 15.203 1.00 138.19 ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I 5  120 ? -44.698 -31.889 14.593 1.00 138.38 ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I 5  120 ? -45.604 -31.541 13.558 1.00 138.73 ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I 5  120 ? -46.402 -32.278 12.958 1.00 139.01 ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I 5  120 ? -45.531 -30.183 13.229 1.00 138.88 ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I 5  120 ? -44.685 -29.270 13.825 1.00 138.61 ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I 5  120 ? -44.752 -28.006 13.378 1.00 138.54 ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I 5  120 ? -43.833 -29.587 14.797 1.00 138.48 ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I 5  120 ? -43.891 -30.907 15.131 1.00 138.26 ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I 5  121 ? -40.495 -29.441 20.686 1.00 133.52 ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I 5  121 ? -39.268 -28.745 21.129 1.00 133.43 ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I 5  121 ? -41.040 -30.554 21.494 1.00 133.58 ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I 5  121 ? -41.666 -28.376 20.469 1.00 133.81 ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I 5  121 ? -41.461 -27.237 19.632 1.00 134.12 ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I 5  121 ? -42.768 -26.545 19.281 1.00 134.46 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I 5  121 ? -43.545 -27.379 18.385 1.00 134.53 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I 5  121 ? -43.678 -26.228 20.467 1.00 134.71 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I 5  121 ? -44.091 -24.867 20.395 1.00 135.04 ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I 5  121 ? -44.850 -27.193 20.293 1.00 134.77 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I 5  121 ? -44.895 -27.272 18.775 1.00 135.07 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I 5  121 ? -45.653 -28.387 18.211 1.00 135.87 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I 5  121 ? -45.747 -29.682 18.672 1.00 136.05 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I 5  121 ? -46.511 -30.442 17.935 1.00 136.29 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I 5  121 ? -46.949 -29.597 16.919 1.00 136.74 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I 5  121 ? -47.806 -29.849 15.813 1.00 137.05 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I 5  121 ? -48.361 -30.916 15.511 1.00 137.21 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I 5  121 ? -47.996 -28.711 15.016 1.00 137.10 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I 5  121 ? -47.425 -27.477 15.256 1.00 136.94 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I 5  121 ? -47.718 -26.496 14.387 1.00 136.87 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I 5  121 ? -46.625 -27.230 16.290 1.00 136.73 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I 5  121 ? -46.430 -28.328 17.076 1.00 136.49 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I 5  122 ? -44.724 -24.116 21.659 1.00 135.40 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I 5  122 ? -43.926 -22.893 21.888 1.00 135.26 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I 5  122 ? -44.908 -25.087 22.760 1.00 135.39 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I 5  122 ? -46.175 -23.698 21.135 1.00 136.71 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I 5  122 ? -46.313 -22.908 19.954 1.00 138.75 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I 5  122 ? -47.610 -23.217 19.228 1.00 140.21 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I 5  122 ? -47.689 -24.629 18.928 1.00 140.35 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I 5  122 ? -48.873 -22.902 20.016 1.00 141.43 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I 5  122 ? -49.389 -21.673 19.521 1.00 143.84 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I 5  122 ? -49.811 -24.083 19.747 1.00 140.84 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I 5  122 ? -49.047 -24.963 18.764 1.00 140.42 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I 5  122 ? -49.211 -26.442 18.989 1.00 140.33 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I 5  122 ? -49.622 -27.257 17.946 1.00 140.14 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I 5  122 ? -49.873 -26.856 16.823 1.00 140.21 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I 5  122 ? -49.739 -28.588 18.266 1.00 139.88 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I 5  122 ? -49.491 -29.178 19.493 1.00 139.94 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I 5  122 ? -49.632 -30.385 19.661 1.00 139.86 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I 5  122 ? -49.065 -28.277 20.544 1.00 140.25 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I 5  122 ? -48.762 -28.781 21.929 1.00 140.27 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I 5  122 ? -48.947 -26.974 20.242 1.00 140.31 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I 5  123 ? -50.632 -20.901 20.179 1.00 145.63 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I 5  123 ? -50.140 -19.575 20.616 1.00 145.52 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I 5  123 ? -51.319 -21.787 21.151 1.00 145.36 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I 5  123 ? -51.604 -20.678 18.923 1.00 147.33 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I 5  123 ? -51.625 -21.579 17.807 1.00 149.86 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I 5  123 ? -52.933 -22.350 17.700 1.00 151.77 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I 5  123 ? -52.668 -23.771 17.812 1.00 152.21 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I 5  123 ? -53.992 -22.046 18.761 1.00 153.03 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I 5  123 ? -55.255 -21.835 18.134 1.00 154.68 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I 5  123 ? -53.997 -23.293 19.642 1.00 153.02 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I 5  123 ? -53.721 -24.334 18.567 1.00 152.96 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I 5  123 ? -53.327 -25.669 19.014 1.00 153.38 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I 5  123 ? -52.773 -26.051 20.208 1.00 153.40 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I 5  123 ? -52.534 -27.340 20.291 1.00 153.58 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I 5  123 ? -52.956 -27.834 19.066 1.00 153.76 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I 5  123 ? -52.981 -29.133 18.509 1.00 153.90 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I 5  123 ? -52.541 -30.212 19.161 1.00 153.89 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I 5  123 ? -53.475 -29.280 17.256 1.00 153.98 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I 5  123 ? -53.920 -28.198 16.599 1.00 153.83 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I 5  123 ? -53.950 -26.933 17.019 1.00 153.72 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I 5  123 ? -53.452 -26.818 18.268 1.00 153.63 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I 5  124 ? -56.242 -20.712 18.707 1.00 156.18 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I 5  124 ? -55.661 -19.390 18.378 1.00 156.10 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I 5  124 ? -56.550 -21.070 20.112 1.00 156.15 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I 5  124 ? -57.589 -20.877 17.858 1.00 157.16 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I 5  124 ? -57.705 -21.837 16.813 1.00 158.60 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I 5  124 ? -58.424 -23.089 17.288 1.00 159.67 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I 5  124 ? -57.472 -24.016 17.867 1.00 160.01 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I 5  124 ? -59.517 -22.899 18.345 1.00 160.16 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I 5  124 ? -60.790 -23.148 17.731 1.00 160.65 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I 5  124 ? -59.158 -23.909 19.444 1.00 160.29 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I 5  124 ? -58.230 -24.863 18.699 1.00 160.33 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I 5  124 ? -57.340 -25.675 19.531 1.00 160.55 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I 5  124 ? -56.630 -25.287 20.645 1.00 160.70 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I 5  124 ? -55.918 -26.247 21.172 1.00 160.76 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I 5  124 ? -56.170 -27.344 20.356 1.00 160.58 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I 5  124 ? -55.682 -28.675 20.430 1.00 160.43 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I 5  124 ? -54.898 -29.156 21.261 1.00 160.22 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I 5  124 ? -56.188 -29.476 19.403 1.00 160.45 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I 5  124 ? -57.064 -29.043 18.428 1.00 160.40 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I 5  124 ? -57.452 -29.946 17.517 1.00 160.37 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I 5  124 ? -57.528 -27.801 18.351 1.00 160.40 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I 5  124 ? -57.044 -27.007 19.342 1.00 160.53 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I 5  125 ? -62.184 -23.159 18.530 1.00 160.94 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I 5  125 ? -63.249 -22.836 17.552 1.00 160.95 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I 5  125 ? -62.045 -22.335 19.756 1.00 160.74 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I 5  125 ? -62.336 -24.696 18.964 1.00 160.97 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I 5  125 ? -62.188 -25.760 18.012 1.00 160.90 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I 5  125 ? -62.342 -27.135 18.646 1.00 160.91 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I 5  125 ? -61.055 -27.644 19.071 1.00 160.81 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I 5  125 ? -63.220 -27.195 19.892 1.00 161.08 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I 5  125 ? -64.551 -27.581 19.536 1.00 161.35 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I 5  125 ? -62.550 -28.243 20.777 1.00 160.98 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I 5  125 ? -61.294 -28.659 20.020 1.00 160.96 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I 5  125 ? -60.109 -28.811 20.928 1.00 161.28 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I 5  125 ? -59.401 -30.004 20.951 1.00 161.23 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I 5  125 ? -59.671 -30.972 20.258 1.00 160.83 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I 5  125 ? -58.340 -30.018 21.833 1.00 161.35 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I 5  125 ? -57.926 -28.992 22.677 1.00 161.41 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I 5  125 ? -56.956 -29.119 23.423 1.00 161.30 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I 5  125 ? -58.711 -27.775 22.605 1.00 161.47 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I 5  125 ? -58.382 -26.582 23.459 1.00 161.28 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I 5  125 ? -59.747 -27.750 21.748 1.00 161.49 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I 5  126 ? -65.771 -27.525 20.581 1.00 161.21 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I 5  126 ? -67.015 -27.396 19.790 1.00 161.10 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I 5  126 ? -65.463 -26.498 21.602 1.00 161.23 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I 5  126 ? -65.726 -28.964 21.299 1.00 161.16 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I 5  126 ? -65.828 -30.185 20.552 1.00 160.84 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I 5  126 ? -65.019 -31.329 21.157 1.00 160.70 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I 5  126 ? -63.716 -30.882 21.624 1.00 160.95 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I 5  126 ? -65.674 -32.061 22.332 1.00 160.22 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I 5  126 ? -65.839 -33.456 21.962 1.00 159.18 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I 5  126 ? -64.732 -31.783 23.507 1.00 160.50 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I 5  126 ? -63.396 -31.605 22.793 1.00 161.02 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I 5  126 ? -62.388 -30.896 23.585 1.00 161.39 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I 5  126 ? -62.452 -29.611 24.055 1.00 161.56 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I 5  126 ? -61.399 -29.240 24.746 1.00 161.63 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I 5  126 ? -60.582 -30.358 24.734 1.00 161.56 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I 5  126 ? -59.308 -30.616 25.293 1.00 161.47 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I 5  126 ? -58.621 -29.712 26.000 1.00 161.25 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I 5  126 ? -58.767 -31.841 25.093 1.00 161.44 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I 5  126 ? -59.463 -32.743 24.385 1.00 161.36 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I 5  126 ? -60.659 -32.619 23.808 1.00 161.46 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I 5  126 ? -61.175 -31.391 24.021 1.00 161.50 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I 5  127 ? -65.378 -34.763 22.784 1.00 158.22 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I 5  127 ? -65.976 -35.922 22.080 1.00 158.13 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I 5  127 ? -65.681 -34.572 24.223 1.00 158.09 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I 5  127 ? -63.781 -34.796 22.592 1.00 156.94 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I 5  127 ? -63.066 -36.005 22.292 1.00 154.88 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I 5  127 ? -62.420 -36.648 23.518 1.00 153.24 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I 5  127 ? -61.613 -35.680 24.247 1.00 153.10 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I 5  127 ? -63.385 -37.266 24.534 1.00 152.00 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I 5  127 ? -63.021 -38.642 24.753 1.00 149.99 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I 5  127 ? -63.239 -36.371 25.768 1.00 152.29 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I 5  127 ? -61.801 -35.882 25.635 1.00 152.66 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I 5  127 ? -61.478 -34.615 26.394 1.00 152.55 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I 5  127 ? -60.252 -34.491 27.031 1.00 152.42 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I 5  127 ? -59.391 -35.357 27.025 1.00 152.20 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I 5  127 ? -60.069 -33.294 27.690 1.00 152.34 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I 5  127 ? -60.958 -32.231 27.778 1.00 152.22 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I 5  127 ? -60.690 -31.202 28.394 1.00 151.82 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I 5  127 ? -62.217 -32.424 27.092 1.00 152.41 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I 5  127 ? -63.271 -31.353 27.107 1.00 152.40 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I 5  127 ? -62.410 -33.587 26.446 1.00 152.52 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I 5  128 ? -63.423 -39.489 26.059 1.00 148.46 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I 5  128 ? -63.256 -40.924 25.733 1.00 148.43 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I 5  128 ? -64.728 -39.014 26.572 1.00 148.55 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I 5  128 ? -62.289 -39.063 27.107 1.00 146.89 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I 5  128 ? -60.908 -39.359 26.865 1.00 144.00 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I 5  128 ? -60.096 -39.338 28.152 1.00 141.71 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I 5  128 ? -59.922 -37.966 28.586 1.00 141.45 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I 5  128 ? -60.698 -40.104 29.332 1.00 140.01 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I 5  128 ? -59.731 -41.010 29.864 1.00 137.12 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I 5  128 ? -61.097 -39.025 30.340 1.00 140.47 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I 5  128 ? -60.168 -37.876 29.976 1.00 141.22 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I 5  128 ? -60.720 -36.518 30.277 1.00 141.64 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I 5  128 ? -60.127 -35.747 31.287 1.00 141.85 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I 5  128 ? -59.164 -36.204 31.915 1.00 141.85 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I 5  128 ? -60.629 -34.510 31.549 1.00 142.07 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I 5  128 ? -61.671 -34.041 30.853 1.00 141.98 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I 5  128 ? -62.125 -32.820 31.152 1.00 141.90 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I 5  128 ? -62.291 -34.810 29.820 1.00 141.99 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I 5  128 ? -61.788 -36.029 29.569 1.00 141.88 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I 5  129 ? -60.114 -42.155 30.921 1.00 134.89 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I 5  129 ? -59.305 -43.353 30.594 1.00 134.75 ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I 5  129 ? -61.586 -42.266 31.019 1.00 134.94 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I 5  129 ? -59.595 -41.535 32.300 1.00 133.20 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I 5  129 ? -58.198 -41.285 32.499 1.00 130.10 ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I 5  129 ? -57.939 -40.560 33.808 1.00 127.33 ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I 5  129 ? -58.553 -39.245 33.768 1.00 127.12 ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I 5  129 ? -58.476 -41.254 35.059 1.00 125.29 ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I 5  129 ? -57.483 -41.217 36.082 1.00 121.79 ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I 5  129 ? -59.707 -40.420 35.420 1.00 125.93 ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I 5  129 ? -59.270 -39.029 34.964 1.00 126.78 ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I 5  129 ? -60.362 -38.024 34.690 1.00 127.23 ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I 5  129 ? -60.169 -36.700 35.047 1.00 127.37 ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I 5  129 ? -59.160 -36.278 35.584 1.00 127.37 ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I 5  129 ? -61.220 -35.864 34.752 1.00 127.52 ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I 5  129 ? -62.417 -36.203 34.146 1.00 127.57 ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I 5  129 ? -63.290 -35.365 33.933 1.00 127.75 ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I 5  129 ? -62.559 -37.600 33.793 1.00 127.59 ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I 5  129 ? -63.808 -38.108 33.131 1.00 127.71 ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I 5  129 ? -61.539 -38.426 34.076 1.00 127.52 ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I 5  130 ? -56.373 -42.362 36.246 1.00 118.77 ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I 5  130 ? -55.755 -42.636 34.930 1.00 118.53 ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I 5  130 ? -56.986 -43.459 37.021 1.00 118.98 ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I 5  130 ? -55.289 -41.677 37.199 1.00 117.19 ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I 5  130 ? -54.523 -40.560 36.756 1.00 114.72 ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I 5  130 ? -54.154 -39.617 37.893 1.00 112.77 ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I 5  130 ? -55.213 -38.653 38.118 1.00 112.36 ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I 5  130 ? -53.866 -40.221 39.258 1.00 111.98 ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I 5  130 ? -52.789 -39.472 39.826 1.00 110.82 ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I 5  130 ? -55.190 -40.077 40.015 1.00 112.05 ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I 5  130 ? -55.875 -38.882 39.351 1.00 112.06 ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I 5  130 ? -57.296 -39.028 39.016 1.00 111.63 ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I 5  130 ? -57.963 -40.175 38.668 1.00 111.55 ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I 5  130 ? -59.223 -39.991 38.402 1.00 111.52 ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I 5  130 ? -59.416 -38.630 38.574 1.00 111.61 ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I 5  130 ? -60.591 -37.843 38.424 1.00 111.86 ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I 5  130 ? -61.731 -38.218 38.092 1.00 111.57 ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I 5  130 ? -60.343 -36.492 38.701 1.00 111.82 ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I 5  130 ? -59.116 -35.976 39.074 1.00 111.54 ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I 5  130 ? -59.049 -34.659 39.303 1.00 111.57 ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I 5  130 ? -58.018 -36.708 39.215 1.00 111.53 ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I 5  130 ? -58.235 -38.022 38.950 1.00 111.55 ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I 5  131 ? -52.140 -39.803 41.254 1.00 109.90 ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I 5  131 ? -50.701 -39.457 41.189 1.00 109.53 ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I 5  131 ? -52.546 -41.160 41.692 1.00 109.68 ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I 5  131 ? -52.893 -38.752 42.188 1.00 109.47 ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I 5  131 ? -53.067 -37.397 41.788 1.00 109.25 ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I 5  131 ? -54.120 -36.740 42.658 1.00 109.32 ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I 5  131 ? -55.442 -37.062 42.158 1.00 109.56 ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I 5  131 ? -54.119 -37.194 44.113 1.00 109.73 ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I 5  131 ? -54.392 -36.072 44.930 1.00 109.92 ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I 5  131 ? -55.258 -38.210 44.166 1.00 110.00 ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I 5  131 ? -56.242 -37.503 43.239 1.00 109.94 ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I 5  131 ? -57.410 -38.309 42.730 1.00 110.11 ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I 5  131 ? -58.573 -37.637 42.312 1.00 110.19 ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I 5  131 ? -58.629 -36.402 42.360 1.00 110.06 ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I 5  131 ? -59.623 -38.366 41.853 1.00 110.47 ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I 5  131 ? -59.550 -39.699 41.802 1.00 110.50 ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I 5  131 ? -60.615 -40.362 41.340 1.00 110.74 ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I 5  131 ? -58.381 -40.406 42.224 1.00 110.39 ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I 5  131 ? -57.350 -39.678 42.677 1.00 110.24 ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I 5  132 ? -53.233 -35.438 45.818 1.00 109.66 ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I 5  132 ? -52.123 -35.097 44.902 1.00 109.85 ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I 5  132 ? -53.007 -36.326 46.983 1.00 109.02 ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I 5  132 ? -53.892 -34.084 46.353 1.00 110.43 ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I 5  132 ? -54.068 -32.949 45.513 1.00 111.68 ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I 5  132 ? -55.398 -32.261 45.797 1.00 113.10 ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I 5  132 ? -56.496 -33.141 45.446 1.00 112.95 ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I 5  132 ? -55.654 -31.826 47.239 1.00 114.04 ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I 5  132 ? -56.332 -30.568 47.249 1.00 115.93 ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I 5  132 ? -56.523 -32.945 47.810 1.00 113.51 ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I 5  132 ? -57.265 -33.473 46.584 1.00 113.05 ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I 5  132 ? -57.423 -34.925 46.532 1.00 112.82 ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I 5  132 ? -56.539 -35.869 46.976 1.00 112.84 ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I 5  132 ? -56.935 -37.104 46.791 1.00 112.73 ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I 5  132 ? -58.166 -36.962 46.174 1.00 112.53 ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I 5  132 ? -59.107 -37.902 45.714 1.00 112.25 ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I 5  132 ? -58.919 -39.220 45.821 1.00 112.60 ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I 5  132 ? -60.243 -37.442 45.146 1.00 111.91 ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I 5  132 ? -60.424 -36.120 45.046 1.00 111.95 ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I 5  132 ? -59.610 -35.141 45.443 1.00 112.33 ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I 5  132 ? -58.486 -35.628 46.004 1.00 112.60 ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I 5  133 ? -56.329 -29.585 48.521 1.00 117.68 ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I 5  133 ? -55.948 -28.229 48.073 1.00 117.55 ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I 5  133 ? -55.613 -30.216 49.656 1.00 117.37 ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I 5  133 ? -57.884 -29.544 48.867 1.00 119.48 ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I 5  133 ? -58.389 -30.517 49.748 1.00 121.76 ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I 5  133 ? -59.872 -30.741 49.556 1.00 123.16 ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I 5  133 ? -60.082 -31.996 48.866 1.00 123.38 ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I 5  133 ? -60.594 -30.854 50.889 1.00 124.31 ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I 5  133 ? -61.868 -30.228 50.843 1.00 125.94 ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I 5  133 ? -60.692 -32.354 51.143 1.00 124.06 ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I 5  133 ? -60.691 -32.937 49.733 1.00 123.84 ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I 5  133 ? -59.987 -34.218 49.627 1.00 123.85 ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I 5  133 ? -58.674 -34.507 49.928 1.00 123.79 ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I 5  133 ? -58.348 -35.754 49.723 1.00 123.53 ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I 5  133 ? -59.521 -36.329 49.258 1.00 123.50 ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I 5  133 ? -59.792 -37.659 48.866 1.00 123.40 ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I 5  133 ? -59.009 -38.614 48.861 1.00 123.50 ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I 5  133 ? -61.116 -37.831 48.453 1.00 123.70 ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I 5  133 ? -62.062 -36.823 48.431 1.00 123.85 ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I 5  133 ? -63.290 -37.143 48.012 1.00 123.62 ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I 5  133 ? -61.823 -35.571 48.796 1.00 123.71 ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I 5  133 ? -60.536 -35.398 49.193 1.00 123.73 ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I 5  134 ? -62.465 -29.598 52.191 1.00 127.50 ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I 5  134 ? -63.064 -28.288 51.843 1.00 127.30 ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I 5  134 ? -61.433 -29.673 53.256 1.00 127.22 ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I 5  134 ? -63.627 -30.630 52.584 1.00 128.07 ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I 5  134 ? -64.673 -30.942 51.666 1.00 129.10 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I 5  134 ? -65.274 -32.304 51.964 1.00 129.96 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I 5  134 ? -64.368 -33.340 51.511 1.00 129.91 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I 5  134 ? -65.548 -32.601 53.440 1.00 130.57 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I 5  134 ? -66.965 -32.661 53.669 1.00 131.53 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I 5  134 ? -64.841 -33.934 53.708 1.00 130.20 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I 5  134 ? -64.578 -34.482 52.310 1.00 129.70 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I 5  134 ? -63.392 -35.329 52.218 1.00 129.09 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I 5  134 ? -62.106 -34.965 52.535 1.00 129.10 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I 5  134 ? -61.229 -35.911 52.362 1.00 128.92 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I 5  134 ? -61.982 -36.977 51.895 1.00 128.64 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I 5  134 ? -61.570 -38.283 51.534 1.00 128.45 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I 5  134 ? -60.423 -38.750 51.559 1.00 128.22 ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I 5  134 ? -62.639 -39.074 51.112 1.00 128.17 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I 5  134 ? -63.945 -38.648 51.052 1.00 128.02 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I 5  134 ? -64.836 -39.551 50.623 1.00 127.93 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I 5  134 ? -64.345 -37.425 51.388 1.00 128.22 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I 5  134 ? -63.317 -36.641 51.801 1.00 128.58 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I 5  135 ? -67.581 -32.920 55.129 1.00 132.21 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I 5  135 ? -68.990 -32.464 55.124 1.00 132.35 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I 5  135 ? -66.651 -32.394 56.153 1.00 132.32 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I 5  135 ? -67.540 -34.513 55.223 1.00 132.66 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I 5  135 ? -68.398 -35.320 54.418 1.00 133.31 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I 5  135 ? -68.335 -36.758 54.897 1.00 133.61 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I 5  135 ? -67.184 -37.383 54.278 1.00 133.34 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I 5  135 ? -68.155 -36.891 56.411 1.00 133.93 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I 5  135 ? -69.378 -37.317 57.061 1.00 134.51 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I 5  135 ? -66.979 -37.851 56.575 1.00 133.64 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I 5  135 ? -66.643 -38.332 55.168 1.00 133.14 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I 5  135 ? -65.162 -38.450 54.972 1.00 132.53 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I 5  135 ? -64.626 -39.558 54.342 1.00 132.00 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I 5  135 ? -65.283 -40.481 53.900 1.00 131.89 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I 5  135 ? -63.259 -39.546 54.240 1.00 131.95 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I 5  135 ? -62.392 -38.568 54.699 1.00 132.24 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I 5  135 ? -61.178 -38.659 54.550 1.00 132.39 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I 5  135 ? -63.012 -37.438 55.350 1.00 132.31 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I 5  135 ? -62.184 -36.308 55.890 1.00 132.15 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I 5  135 ? -64.347 -37.439 55.454 1.00 132.48 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I 5  136 ? -69.479 -38.542 58.099 1.00 134.91 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I 5  136 ? -70.907 -38.721 58.446 1.00 135.04 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I 5  136 ? -68.507 -38.330 59.198 1.00 134.69 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I 5  136 ? -68.992 -39.778 57.196 1.00 134.94 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I 5  136 ? -69.769 -40.962 57.020 1.00 135.12 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I 5  136 ? -69.252 -42.051 57.939 1.00 135.21 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I 5  136 ? -67.818 -42.174 57.756 1.00 135.20 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I 5  136 ? -69.503 -41.765 59.419 1.00 135.48 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I 5  136 ? -70.276 -42.839 60.019 1.00 135.72 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I 5  136 ? -68.116 -41.477 60.013 1.00 135.46 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I 5  136 ? -67.129 -42.047 58.989 1.00 135.10 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I 5  136 ? -65.896 -41.265 58.778 1.00 134.56 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I 5  136 ? -65.711 -39.905 58.922 1.00 134.24 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I 5  136 ? -64.497 -39.499 58.660 1.00 133.72 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I 5  136 ? -63.822 -40.666 58.323 1.00 133.75 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I 5  136 ? -62.467 -40.867 57.943 1.00 133.54 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I 5  136 ? -61.570 -40.021 57.826 1.00 133.65 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I 5  136 ? -62.185 -42.210 57.683 1.00 133.03 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I 5  136 ? -63.100 -43.231 57.783 1.00 132.88 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I 5  136 ? -62.649 -44.458 57.495 1.00 132.74 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I 5  136 ? -64.369 -43.062 58.135 1.00 133.24 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I 5  136 ? -64.666 -41.760 58.391 1.00 133.90 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I 5  137 ? -69.714 -44.013 60.961 1.00 135.68 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I 5  137 ? -70.821 -44.982 61.142 1.00 135.58 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I 5  137 ? -69.095 -43.391 62.157 1.00 135.34 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I 5  137 ? -68.579 -44.697 60.051 1.00 135.43 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I 5  137 ? -68.294 -46.105 60.090 1.00 134.60 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I 5  137 ? -66.994 -46.379 60.836 1.00 133.67 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I 5  137 ? -66.054 -45.285 60.619 1.00 133.56 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I 5  137 ? -67.146 -46.515 62.355 1.00 133.00 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I 5  137 ? -66.368 -47.616 62.860 1.00 131.74 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I 5  137 ? -66.629 -45.170 62.869 1.00 133.06 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I 5  137 ? -65.500 -44.929 61.874 1.00 133.06 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I 5  137 ? -64.939 -43.571 61.886 1.00 132.41 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I 5  137 ? -65.557 -42.390 62.238 1.00 132.11 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I 5  137 ? -64.779 -41.345 62.155 1.00 131.76 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I 5  137 ? -63.561 -41.863 61.730 1.00 131.62 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I 5  137 ? -62.326 -41.216 61.462 1.00 131.36 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I 5  137 ? -62.060 -40.010 61.551 1.00 131.48 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I 5  137 ? -61.337 -42.114 61.050 1.00 130.91 ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I 5  137 ? -61.524 -43.471 60.914 1.00 130.94 ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I 5  137 ? -60.472 -44.192 60.510 1.00 130.73 ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I 5  137 ? -62.671 -44.089 61.163 1.00 131.34 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I 5  137 ? -63.644 -43.230 61.564 1.00 131.83 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I 5  138 ? -66.430 -48.063 64.406 1.00 130.59 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I 5  138 ? -67.685 -48.819 64.594 1.00 130.71 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I 5  138 ? -66.130 -46.894 65.267 1.00 130.26 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I 5  138 ? -65.223 -49.098 64.577 1.00 129.49 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I 5  138 ? -64.604 -49.726 63.463 1.00 127.91 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I 5  138 ? -63.123 -49.390 63.443 1.00 126.92 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I 5  138 ? -62.943 -47.971 63.175 1.00 126.62 ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I 5  138 ? -62.379 -49.678 64.748 1.00 126.20 ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I 5  138 ? -61.274 -50.559 64.502 1.00 125.55 ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I 5  138 ? -61.936 -48.295 65.228 1.00 126.08 ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I 5  138 ? -61.827 -47.532 63.917 1.00 125.94 ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I 5  138 ? -61.860 -46.081 64.103 1.00 125.26 ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I 5  138 ? -62.941 -45.310 64.440 1.00 124.81 ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I 5  138 ? -62.670 -44.032 64.550 1.00 124.47 ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I 5  138 ? -61.317 -43.958 64.270 1.00 124.53 ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I 5  138 ? -60.416 -42.873 64.217 1.00 124.34 ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I 5  138 ? -60.786 -41.612 64.460 1.00 124.11 ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I 5  138 ? -59.123 -43.137 63.905 1.00 124.24 ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I 5  138 ? -58.756 -44.406 63.661 1.00 124.17 ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I 5  138 ? -59.515 -45.506 63.680 1.00 124.38 ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I 5  138 ? -60.796 -45.212 63.993 1.00 124.80 ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I 5  139 ? -60.234 -50.972 65.656 1.00 125.16 ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I 5  139 ? -59.495 -52.177 65.210 1.00 125.21 ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I 5  139 ? -60.928 -50.984 66.968 1.00 124.96 ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I 5  139 ? -59.247 -49.719 65.646 1.00 123.67 ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I 5  139 ? -58.078 -49.725 64.852 1.00 121.24 ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I 5  139 ? -57.104 -48.716 65.423 1.00 119.36 ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I 5  139 ? -57.779 -47.439 65.563 1.00 118.94 ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I 5  139 ? -56.527 -49.030 66.802 1.00 117.92 ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I 5  139 ? -55.156 -48.692 66.726 1.00 116.54 ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I 5  139 ? -57.285 -48.080 67.732 1.00 117.67 ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I 5  139 ? -57.396 -46.879 66.799 1.00 117.61 ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I 5  139 ? -58.367 -45.789 67.121 1.00 116.54 ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I 5  139 ? -57.896 -44.491 67.110 1.00 116.35 ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I 5  139 ? -56.734 -44.196 66.873 1.00 116.43 ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I 5  139 ? -58.839 -43.535 67.400 1.00 115.95 ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I 5  139 ? -60.176 -43.745 67.681 1.00 115.82 ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I 5  139 ? -60.933 -42.812 67.925 1.00 115.71 ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I 5  139 ? -60.607 -45.127 67.665 1.00 115.93 ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I 5  139 ? -62.037 -45.483 67.956 1.00 115.75 ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I 5  139 ? -59.695 -46.072 67.384 1.00 116.06 ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I 5  140 ? -54.037 -49.366 67.643 1.00 115.61 ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I 5  140 ? -53.868 -50.763 67.180 1.00 115.57 ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I 5  140 ? -54.381 -49.068 69.053 1.00 115.82 ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I 5  140 ? -52.705 -48.546 67.280 1.00 114.20 ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I 5  140 ? -52.730 -47.445 66.357 1.00 112.01 ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I 5  140 ? -52.324 -46.111 66.975 1.00 110.10 ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I 5  140 ? -53.482 -45.317 67.355 1.00 109.46 ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I 5  140 ? -51.421 -46.154 68.201 1.00 108.89 ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I 5  140 ? -50.311 -45.343 67.870 1.00 107.72 ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I 5  140 ? -52.272 -45.570 69.333 1.00 108.45 ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I 5  140 ? -53.242 -44.662 68.586 1.00 108.28 ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I 5  140 ? -54.557 -44.448 69.196 1.00 107.33 ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I 5  140 ? -55.474 -45.412 69.518 1.00 107.04 ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I 5  140 ? -56.584 -44.944 70.033 1.00 106.71 ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I 5  140 ? -56.391 -43.575 70.045 1.00 106.47 ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I 5  140 ? -57.208 -42.507 70.472 1.00 106.26 ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I 5  140 ? -58.426 -42.697 70.984 1.00 106.50 ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I 5  140 ? -56.731 -41.249 70.351 1.00 105.73 ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I 5  140 ? -55.510 -41.077 69.834 1.00 105.88 ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I 5  140 ? -54.652 -42.003 69.396 1.00 106.34 ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I 5  140 ? -55.151 -43.246 69.529 1.00 106.65 ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I 5  141 ? -48.976 -45.285 68.746 1.00 107.02 ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I 5  141 ? -47.818 -45.341 67.824 1.00 106.95 ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I 5  141 ? -49.075 -46.259 69.858 1.00 106.68 ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I 5  141 ? -49.069 -43.807 69.347 1.00 105.42 ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I 5  141 ? -49.500 -42.723 68.530 1.00 103.30 ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I 5  141 ? -49.607 -41.438 69.334 1.00 102.13 ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I 5  141 ? -50.945 -41.256 69.873 1.00 101.82 ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I 5  141 ? -48.656 -41.322 70.519 1.00 101.61 ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I 5  141 ? -48.072 -40.025 70.457 1.00 100.90 ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I 5  141 ? -49.553 -41.536 71.743 1.00 101.37 ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I 5  141 ? -50.894 -40.988 71.265 1.00 100.92 ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I 5  141 ? -52.132 -41.582 71.907 1.00 99.88  ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I 5  141 ? -53.162 -40.742 72.293 1.00 99.29  ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I 5  141 ? -53.137 -39.529 72.162 1.00 98.51  ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I 5  141 ? -54.246 -41.383 72.848 1.00 99.40  ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I 5  141 ? -54.413 -42.745 73.055 1.00 99.35  ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I 5  141 ? -55.433 -43.204 73.567 1.00 99.12  ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I 5  141 ? -53.303 -43.570 72.630 1.00 99.30  ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I 5  141 ? -53.345 -45.062 72.796 1.00 99.16  ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I 5  141 ? -52.241 -42.956 72.081 1.00 99.60  ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I 5  142 ? -47.027 -39.490 71.541 1.00 99.88  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I 5  142 ? -46.145 -38.533 70.845 1.00 99.80  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I 5  142 ? -46.455 -40.648 72.273 1.00 99.66  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I 5  142 ? -47.969 -38.665 72.536 1.00 99.74  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I 5  142 ? -48.859 -37.674 72.017 1.00 99.23  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I 5  142 ? -49.605 -36.947 73.125 1.00 98.98  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I 5  142 ? -50.743 -37.736 73.549 1.00 98.63  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I 5  142 ? -48.802 -36.659 74.388 1.00 99.30  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I 5  142 ? -49.090 -35.330 74.800 1.00 100.26 ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I 5  142 ? -49.292 -37.707 75.390 1.00 98.51  ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I 5  142 ? -50.740 -37.896 74.955 1.00 97.47  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I 5  142 ? -51.366 -39.229 75.267 1.00 95.88  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I 5  142 ? -52.675 -39.259 75.712 1.00 94.88  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I 5  142 ? -53.352 -38.261 75.879 1.00 94.12  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I 5  142 ? -53.168 -40.518 75.962 1.00 94.76  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I 5  142 ? -52.502 -41.727 75.810 1.00 94.94  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I 5  142 ? -53.033 -42.807 76.061 1.00 94.75  ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I 5  142 ? -51.140 -41.625 75.340 1.00 95.10  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I 5  142 ? -50.316 -42.864 75.141 1.00 95.37  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I 5  142 ? -50.646 -40.401 75.091 1.00 95.40  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I 5  143 ? -48.223 -34.575 75.917 1.00 100.85 ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I 5  143 ? -48.074 -33.163 75.490 1.00 100.83 ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I 5  143 ? -47.033 -35.382 76.272 1.00 100.23 ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I 5  143 ? -49.232 -34.615 77.146 1.00 101.75 ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I 5  143 ? -50.485 -33.943 77.040 1.00 103.09 ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I 5  143 ? -51.329 -34.208 78.273 1.00 103.69 ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I 5  143 ? -51.863 -35.560 78.221 1.00 103.34 ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I 5  143 ? -50.556 -34.080 79.580 1.00 104.20 ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I 5  143 ? -51.348 -33.323 80.491 1.00 105.85 ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I 5  143 ? -50.339 -35.534 80.005 1.00 103.45 ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I 5  143 ? -51.577 -36.217 79.433 1.00 102.73 ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I 5  143 ? -51.409 -37.654 79.214 1.00 101.72 ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I 5  143 ? -50.275 -38.322 78.811 1.00 101.31 ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I 5  143 ? -50.431 -39.614 78.720 1.00 101.03 ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I 5  143 ? -51.755 -39.821 79.092 1.00 101.05 ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I 5  143 ? -52.505 -41.024 79.189 1.00 100.83 ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I 5  143 ? -52.127 -42.182 78.957 1.00 100.20 ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I 5  143 ? -53.819 -40.786 79.606 1.00 101.09 ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I 5  143 ? -54.341 -39.538 79.892 1.00 101.33 ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I 5  143 ? -55.624 -39.494 80.278 1.00 101.43 ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I 5  143 ? -53.648 -38.404 79.807 1.00 101.06 ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I 5  143 ? -52.369 -38.621 79.401 1.00 101.22 ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I 5  144 ? -50.864 -32.949 81.976 1.00 106.67 ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I 5  144 ? -50.737 -31.473 82.042 1.00 106.33 ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I 5  144 ? -49.720 -33.813 82.348 1.00 106.56 ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I 5  144 ? -52.096 -33.415 82.888 1.00 106.59 ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I 5  144 ? -53.475 -33.292 82.500 1.00 106.26 ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I 5  144 ? -54.270 -34.375 83.208 1.00 106.22 ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I 5  144 ? -53.978 -35.641 82.564 1.00 105.64 ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I 5  144 ? -53.892 -34.534 84.683 1.00 107.22 ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I 5  144 ? -55.002 -34.442 85.584 1.00 108.86 ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I 5  144 ? -53.255 -35.914 84.771 1.00 106.60 ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I 5  144 ? -53.821 -36.631 83.554 1.00 105.22 ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I 5  144 ? -52.919 -37.701 83.132 1.00 103.85 ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I 5  144 ? -51.611 -37.604 82.732 1.00 103.35 ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I 5  144 ? -51.051 -38.755 82.441 1.00 102.54 ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I 5  144 ? -52.062 -39.670 82.674 1.00 102.42 ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I 5  144 ? -52.123 -41.072 82.554 1.00 102.06 ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I 5  144 ? -51.092 -41.817 82.145 1.00 101.98 ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I 5  144 ? -53.289 -41.676 82.869 1.00 101.79 ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I 5  144 ? -54.326 -40.932 83.279 1.00 102.01 ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I 5  144 ? -54.387 -39.611 83.430 1.00 102.29 ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I 5  144 ? -53.215 -39.038 83.108 1.00 102.78 ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I 5  145 ? -54.786 -34.060 87.136 1.00 109.47 ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I 5  145 ? -55.719 -32.940 87.393 1.00 109.40 ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I 5  145 ? -53.342 -33.898 87.434 1.00 109.21 ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I 5  145 ? -55.256 -35.359 87.947 1.00 109.62 ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I 5  145 ? -56.377 -36.146 87.542 1.00 110.04 ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I 5  145 ? -56.121 -37.619 87.824 1.00 110.37 ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I 5  145 ? -55.154 -38.140 86.878 1.00 110.03 ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I 5  145 ? -55.526 -37.938 89.199 1.00 110.31 ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I 5  145 ? -56.550 -38.262 90.144 1.00 110.06 ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I 5  145 ? -54.605 -39.134 88.944 1.00 109.98 ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I 5  145 ? -54.665 -39.344 87.428 1.00 109.60 ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I 5  145 ? -53.336 -39.724 86.828 1.00 109.12 ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I 5  145 ? -53.070 -41.060 86.568 1.00 108.81 ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I 5  145 ? -53.853 -41.969 86.779 1.00 108.99 ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I 5  145 ? -51.830 -41.315 86.036 1.00 108.25 ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I 5  145 ? -50.844 -40.392 85.745 1.00 108.20 ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I 5  145 ? -49.771 -40.746 85.269 1.00 108.08 ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I 5  145 ? -51.174 -39.009 86.039 1.00 108.29 ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I 5  145 ? -50.192 -37.903 85.777 1.00 107.85 ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I 5  145 ? -52.384 -38.748 86.564 1.00 108.71 ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J 6  1   ? -49.482 -51.360 83.136 1.00 139.95 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J 6  1   ? -50.841 -50.987 82.929 1.00 140.25 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J 6  1   ? -51.599 -50.895 84.244 1.00 140.54 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J 6  1   ? -50.750 -50.303 85.262 1.00 140.70 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J 6  1   ? -52.857 -50.036 84.189 1.00 140.75 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J 6  1   ? -54.000 -50.861 83.998 1.00 141.03 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J 6  1   ? -52.883 -49.355 85.555 1.00 140.71 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J 6  1   ? -51.399 -49.197 85.867 1.00 140.71 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J 6  1   ? -50.783 -47.945 85.402 1.00 140.65 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J 6  1   ? -49.628 -47.825 84.670 1.00 140.66 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J 6  1   ? -49.291 -46.588 84.389 1.00 140.44 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J 6  1   ? -50.292 -45.837 84.981 1.00 140.36 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J 6  1   ? -50.518 -44.445 85.053 1.00 140.23 ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J 6  1   ? -49.706 -43.545 84.489 1.00 140.10 ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J 6  1   ? -51.615 -44.012 85.718 1.00 140.14 ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J 6  1   ? -52.431 -44.915 86.283 1.00 140.15 ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J 6  1   ? -52.320 -46.246 86.285 1.00 140.25 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J 6  1   ? -51.222 -46.652 85.613 1.00 140.43 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J 6  2   ? -55.374 -50.270 83.420 1.00 141.19 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J 6  2   ? -56.300 -51.411 83.254 1.00 141.48 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J 6  2   ? -55.071 -49.435 82.239 1.00 141.17 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J 6  2   ? -55.888 -49.329 84.610 1.00 140.99 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J 6  2   ? -57.197 -49.491 85.149 1.00 140.98 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J 6  2   ? -58.086 -48.327 84.744 1.00 140.80 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J 6  2   ? -57.317 -47.100 84.836 1.00 140.94 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J 6  2   ? -58.663 -48.385 83.326 1.00 140.52 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J 6  2   ? -60.076 -48.052 83.242 1.00 140.01 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J 6  2   ? -57.782 -47.431 82.520 1.00 140.78 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J 6  2   ? -57.286 -46.444 83.582 1.00 141.06 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J 6  2   ? -55.913 -45.865 83.348 1.00 141.02 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J 6  2   ? -55.669 -44.550 83.702 1.00 140.92 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J 6  2   ? -56.501 -43.810 84.207 1.00 140.91 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J 6  2   ? -54.388 -44.126 83.439 1.00 140.85 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J 6  2   ? -53.352 -44.852 82.873 1.00 140.84 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J 6  2   ? -52.242 -44.369 82.679 1.00 140.88 ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J 6  2   ? -53.669 -46.214 82.525 1.00 140.95 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J 6  2   ? -52.624 -47.099 81.905 1.00 140.82 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J 6  2   ? -54.916 -46.643 82.777 1.00 141.06 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J 6  3   ? -60.861 -46.943 84.115 1.00 139.78 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J 6  3   ? -60.573 -47.167 85.551 1.00 139.78 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J 6  3   ? -62.271 -46.951 83.658 1.00 139.69 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J 6  3   ? -60.214 -45.548 83.653 1.00 138.51 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J 6  3   ? -60.734 -44.291 84.103 1.00 136.48 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J 6  3   ? -60.558 -43.200 83.052 1.00 134.86 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J 6  3   ? -59.182 -43.159 82.586 1.00 134.46 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J 6  3   ? -61.415 -43.334 81.790 1.00 133.74 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J 6  3   ? -61.918 -42.056 81.407 1.00 132.33 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J 6  3   ? -60.428 -43.842 80.747 1.00 133.80 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J 6  3   ? -59.212 -43.026 81.177 1.00 133.95 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J 6  3   ? -57.885 -43.417 80.587 1.00 133.53 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J 6  3   ? -56.831 -42.488 80.626 1.00 133.09 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J 6  3   ? -57.016 -41.380 81.145 1.00 132.53 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J 6  3   ? -55.630 -42.836 80.092 1.00 133.08 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J 6  3   ? -55.461 -44.043 79.538 1.00 133.32 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J 6  3   ? -54.262 -44.338 79.027 1.00 133.10 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J 6  3   ? -56.519 -45.004 79.485 1.00 133.57 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J 6  3   ? -57.700 -44.650 80.016 1.00 133.60 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J 6  4   ? -63.462 -41.904 81.030 1.00 131.30 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J 6  4   ? -64.211 -41.844 82.305 1.00 131.40 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J 6  4   ? -63.758 -42.952 80.024 1.00 131.47 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J 6  4   ? -63.613 -40.489 80.295 1.00 129.68 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J 6  4   ? -63.014 -39.295 80.789 1.00 127.36 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J 6  4   ? -62.231 -38.609 79.679 1.00 125.62 ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J 6  4   ? -60.977 -39.315 79.460 1.00 124.64 ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J 6  4   ? -62.930 -38.555 78.316 1.00 125.01 ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J 6  4   ? -62.682 -37.299 77.690 1.00 125.02 ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J 6  4   ? -62.240 -39.678 77.543 1.00 124.20 ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J 6  4   ? -60.819 -39.466 78.061 1.00 123.47 ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J 6  4   ? -59.828 -40.496 77.716 1.00 121.85 ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J 6  4   ? -60.014 -41.848 77.568 1.00 121.15 ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J 6  4   ? -58.923 -42.506 77.243 1.00 120.26 ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J 6  4   ? -57.953 -41.519 77.164 1.00 119.94 ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J 6  4   ? -56.575 -41.553 76.858 1.00 119.03 ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J 6  4   ? -55.915 -42.674 76.564 1.00 118.50 ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J 6  4   ? -55.894 -40.386 76.867 1.00 118.72 ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J 6  4   ? -56.548 -39.254 77.164 1.00 119.09 ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J 6  4   ? -57.836 -39.095 77.467 1.00 119.75 ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J 6  4   ? -58.492 -40.274 77.451 1.00 120.63 ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J 6  5   ? -63.719 -36.076 77.734 1.00 124.96 ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J 6  5   ? -63.912 -35.682 79.150 1.00 125.13 ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J 6  5   ? -64.883 -36.423 76.886 1.00 125.00 ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J 6  5   ? -62.911 -34.915 76.984 1.00 124.02 ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J 6  5   ? -61.593 -34.558 77.420 1.00 122.55 ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J 6  5   ? -60.553 -34.678 76.311 1.00 121.23 ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J 6  5   ? -60.039 -36.026 76.159 1.00 120.65 ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J 6  5   ? -61.006 -34.240 74.922 1.00 120.34 ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J 6  5   ? -60.168 -33.150 74.583 1.00 119.99 ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J 6  5   ? -60.782 -35.469 74.038 1.00 119.88 ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J 6  5   ? -59.680 -36.194 74.804 1.00 119.76 ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J 6  5   ? -59.529 -37.634 74.566 1.00 119.07 ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J 6  5   ? -60.501 -38.597 74.655 1.00 118.74 ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J 6  5   ? -60.078 -39.816 74.404 1.00 118.17 ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J 6  5   ? -58.730 -39.648 74.136 1.00 117.78 ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J 6  5   ? -57.707 -40.557 73.794 1.00 117.07 ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J 6  5   ? -57.908 -41.868 73.669 1.00 116.97 ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J 6  5   ? -56.466 -40.073 73.589 1.00 116.72 ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J 6  5   ? -56.260 -38.755 73.714 1.00 117.19 ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J 6  5   ? -57.138 -37.799 74.031 1.00 117.78 ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J 6  5   ? -58.370 -38.311 74.233 1.00 118.32 ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J 6  6   ? -60.544 -32.077 73.456 1.00 119.66 ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J 6  6   ? -60.031 -30.759 73.903 1.00 119.66 ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J 6  6   ? -61.977 -32.217 73.109 1.00 119.78 ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J 6  6   ? -59.671 -32.606 72.213 1.00 118.31 ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J 6  6   ? -58.230 -32.657 72.284 1.00 115.68 ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J 6  6   ? -57.615 -33.582 71.239 1.00 113.40 ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J 6  6   ? -57.803 -34.979 71.610 1.00 112.46 ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J 6  6   ? -58.161 -33.438 69.816 1.00 112.33 ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J 6  6   ? -57.098 -33.508 68.872 1.00 111.65 ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J 6  6   ? -59.031 -34.681 69.689 1.00 111.86 ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J 6  6   ? -58.108 -35.659 70.411 1.00 111.44 ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J 6  6   ? -58.660 -37.046 70.620 1.00 110.53 ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J 6  6   ? -57.819 -38.136 70.475 1.00 109.66 ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J 6  6   ? -56.635 -38.051 70.204 1.00 108.94 ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J 6  6   ? -58.425 -39.355 70.669 1.00 109.46 ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J 6  6   ? -59.755 -39.593 70.982 1.00 109.61 ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J 6  6   ? -60.193 -40.727 71.137 1.00 109.46 ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J 6  6   ? -60.586 -38.419 71.116 1.00 109.95 ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J 6  6   ? -62.048 -38.548 71.453 1.00 109.89 ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J 6  6   ? -60.004 -37.221 70.926 1.00 110.45 ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J 6  7   ? -56.638 -32.277 67.958 1.00 110.80 ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J 6  7   ? -56.391 -31.100 68.824 1.00 110.57 ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J 6  7   ? -57.570 -32.182 66.815 1.00 110.91 ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J 6  7   ? -55.247 -32.814 67.377 1.00 109.89 ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J 6  7   ? -54.232 -33.279 68.268 1.00 108.80 ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J 6  7   ? -53.671 -34.622 67.831 1.00 107.93 ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J 6  7   ? -54.605 -35.695 68.128 1.00 107.37 ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J 6  7   ? -53.373 -34.719 66.340 1.00 107.66 ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J 6  7   ? -52.073 -35.263 66.138 1.00 107.26 ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J 6  7   ? -54.486 -35.624 65.807 1.00 107.49 ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J 6  7   ? -54.751 -36.532 66.997 1.00 106.64 ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J 6  7   ? -56.094 -37.112 67.015 1.00 105.60 ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J 6  7   ? -57.273 -36.425 67.110 1.00 105.01 ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J 6  7   ? -58.335 -37.194 67.113 1.00 104.73 ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J 6  7   ? -57.821 -38.474 67.010 1.00 104.52 ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J 6  7   ? -58.438 -39.740 66.963 1.00 104.45 ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J 6  7   ? -59.765 -39.902 67.015 1.00 104.43 ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J 6  7   ? -57.640 -40.830 66.858 1.00 104.29 ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J 6  7   ? -56.313 -40.656 66.803 1.00 104.02 ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J 6  7   ? -55.621 -39.515 66.843 1.00 104.36 ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J 6  7   ? -56.439 -38.448 66.947 1.00 104.79 ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J 6  8   ? -51.502 -35.396 64.653 1.00 106.98 ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J 6  8   ? -50.032 -35.494 64.748 1.00 107.05 ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J 6  8   ? -52.128 -34.360 63.800 1.00 106.82 ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J 6  8   ? -52.062 -36.821 64.206 1.00 107.83 ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J 6  8   ? -51.500 -38.004 64.764 1.00 108.40 ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J 6  8   ? -52.055 -39.229 64.066 1.00 108.67 ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J 6  8   ? -53.470 -39.356 64.355 1.00 108.71 ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J 6  8   ? -51.932 -39.229 62.545 1.00 108.98 ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J 6  8   ? -51.352 -40.475 62.183 1.00 109.90 ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J 6  8   ? -53.379 -39.084 62.059 1.00 108.57 ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J 6  8   ? -54.128 -39.792 63.183 1.00 108.24 ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J 6  8   ? -55.607 -39.522 63.332 1.00 107.57 ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J 6  8   ? -56.472 -40.587 63.535 1.00 107.04 ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J 6  8   ? -56.124 -41.752 63.591 1.00 106.98 ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J 6  8   ? -57.791 -40.242 63.671 1.00 106.79 ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J 6  8   ? -58.329 -38.967 63.630 1.00 107.18 ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J 6  8   ? -59.536 -38.774 63.765 1.00 107.47 ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J 6  8   ? -57.376 -37.898 63.419 1.00 107.26 ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J 6  8   ? -57.831 -36.467 63.355 1.00 107.33 ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J 6  8   ? -56.081 -38.221 63.285 1.00 107.34 ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J 6  9   ? -50.667 -40.772 60.766 1.00 110.27 ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J 6  9   ? -49.279 -41.219 61.030 1.00 109.84 ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J 6  9   ? -50.937 -39.642 59.849 1.00 110.03 ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J 6  9   ? -51.510 -42.026 60.239 1.00 110.66 ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J 6  9   ? -51.688 -43.197 61.044 1.00 111.33 ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J 6  9   ? -52.924 -43.965 60.606 1.00 111.92 ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J 6  9   ? -54.119 -43.263 61.040 1.00 111.63 ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J 6  9   ? -53.050 -44.149 59.091 1.00 112.27 ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J 6  9   ? -52.945 -45.530 58.739 1.00 113.22 ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J 6  9   ? -54.418 -43.568 58.732 1.00 111.79 ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J 6  9   ? -55.129 -43.496 60.080 1.00 111.23 ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J 6  9   ? -56.180 -42.428 60.167 1.00 110.38 ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J 6  9   ? -57.530 -42.803 60.268 1.00 110.12 ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J 6  9   ? -57.832 -44.004 60.287 1.00 110.00 ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J 6  9   ? -58.478 -41.831 60.347 1.00 109.83 ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J 6  9   ? -58.124 -40.544 60.324 1.00 109.67 ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J 6  9   ? -59.101 -39.636 60.403 1.00 109.59 ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J 6  9   ? -56.758 -40.138 60.216 1.00 109.75 ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J 6  9   ? -55.832 -41.104 60.142 1.00 110.06 ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J 6  10  ? -52.485 -45.980 57.267 1.00 113.93 ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J 6  10  ? -51.479 -47.051 57.438 1.00 113.88 ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J 6  10  ? -52.142 -44.766 56.485 1.00 113.44 ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J 6  10  ? -53.811 -46.629 56.634 1.00 114.10 ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J 6  10  ? -54.741 -47.391 57.422 1.00 114.22 ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J 6  10  ? -56.171 -47.223 56.926 1.00 114.34 ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J 6  10  ? -56.740 -45.970 57.396 1.00 114.19 ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J 6  10  ? -56.323 -47.211 55.406 1.00 114.64 ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J 6  10  ? -57.320 -48.131 54.992 1.00 115.49 ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J 6  10  ? -56.746 -45.782 55.084 1.00 114.34 ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J 6  10  ? -57.519 -45.428 56.348 1.00 113.71 ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J 6  10  ? -57.769 -43.954 56.542 1.00 112.76 ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J 6  10  ? -58.994 -43.532 57.085 1.00 112.42 ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J 6  10  ? -59.846 -44.370 57.408 1.00 112.46 ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J 6  10  ? -59.216 -42.203 57.247 1.00 112.29 ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J 6  10  ? -58.281 -41.315 56.894 1.00 112.31 ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J 6  10  ? -58.556 -40.018 57.078 1.00 112.29 ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J 6  10  ? -57.029 -41.720 56.335 1.00 112.16 ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J 6  10  ? -56.823 -43.033 56.178 1.00 112.28 ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J 6  11  ? -57.099 -48.938 53.629 1.00 116.09 ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J 6  11  ? -56.184 -50.060 53.937 1.00 115.87 ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J 6  11  ? -56.754 -47.972 52.558 1.00 116.01 ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J 6  11  ? -58.546 -49.520 53.274 1.00 116.17 ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J 6  11  ? -59.584 -49.674 54.241 1.00 115.97 ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J 6  11  ? -60.901 -49.136 53.701 1.00 115.85 ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J 6  11  ? -61.058 -47.769 54.147 1.00 115.42 ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J 6  11  ? -61.041 -49.124 52.177 1.00 116.15 ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J 6  11  ? -62.233 -49.820 51.783 1.00 117.15 ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J 6  11  ? -61.053 -47.638 51.806 1.00 115.50 ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J 6  11  ? -61.527 -46.967 53.089 1.00 114.58 ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J 6  11  ? -60.985 -45.630 53.310 1.00 113.32 ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J 6  11  ? -59.684 -45.226 53.166 1.00 112.97 ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J 6  11  ? -59.490 -43.957 53.441 1.00 112.70 ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J 6  11  ? -60.752 -43.498 53.796 1.00 112.35 ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J 6  11  ? -61.236 -42.232 54.200 1.00 111.75 ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J 6  11  ? -60.460 -41.153 54.319 1.00 111.27 ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J 6  11  ? -62.551 -42.115 54.484 1.00 111.57 ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J 6  11  ? -63.336 -43.195 54.365 1.00 111.78 ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J 6  11  ? -62.999 -44.433 53.995 1.00 111.93 ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J 6  11  ? -61.685 -44.519 53.722 1.00 112.49 ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J 6  12  ? -62.657 -49.962 50.239 1.00 118.05 ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J 6  12  ? -63.373 -51.245 50.052 1.00 117.83 ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J 6  12  ? -61.468 -49.662 49.405 1.00 117.99 ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J 6  12  ? -63.711 -48.774 50.055 1.00 118.43 ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J 6  12  ? -64.684 -48.476 51.061 1.00 119.42 ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J 6  12  ? -65.436 -47.209 50.699 1.00 120.09 ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J 6  12  ? -64.711 -46.061 51.221 1.00 120.28 ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J 6  12  ? -65.587 -46.985 49.191 1.00 120.58 ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J 6  12  ? -66.955 -46.733 48.839 1.00 121.11 ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J 6  12  ? -64.671 -45.793 48.906 1.00 120.43 ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J 6  12  ? -64.715 -45.046 50.235 1.00 119.97 ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J 6  12  ? -63.573 -44.078 50.410 1.00 119.24 ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J 6  12  ? -63.834 -42.737 50.760 1.00 118.92 ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J 6  12  ? -65.000 -42.354 50.935 1.00 118.85 ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J 6  12  ? -62.785 -41.881 50.901 1.00 118.44 ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J 6  12  ? -61.534 -42.311 50.705 1.00 118.16 ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J 6  12  ? -60.544 -41.430 50.857 1.00 117.86 ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J 6  12  ? -61.246 -43.663 50.345 1.00 118.46 ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J 6  12  ? -62.284 -44.502 50.210 1.00 118.81 ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J 6  13  ? -67.390 -46.305 47.352 1.00 121.32 ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J 6  13  ? -68.767 -46.808 47.142 1.00 121.03 ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J 6  13  ? -66.317 -46.691 46.402 1.00 120.83 ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J 6  13  ? -67.422 -44.701 47.430 1.00 121.82 ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J 6  13  ? -68.214 -43.995 48.399 1.00 122.43 ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J 6  13  ? -68.353 -42.515 48.053 1.00 123.09 ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J 6  13  ? -67.146 -41.801 48.431 1.00 122.63 ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J 6  13  ? -68.586 -42.201 46.576 1.00 123.96 ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J 6  13  ? -69.566 -41.179 46.413 1.00 126.25 ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J 6  13  ? -67.221 -41.740 46.076 1.00 123.07 ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J 6  13  ? -66.625 -41.091 47.321 1.00 121.94 ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J 6  13  ? -65.118 -41.110 47.360 1.00 120.48 ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J 6  13  ? -64.406 -39.901 47.414 1.00 119.74 ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J 6  13  ? -65.027 -38.832 47.432 1.00 119.75 ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J 6  13  ? -63.047 -39.929 47.449 1.00 118.99 ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J 6  13  ? -62.403 -41.099 47.429 1.00 118.71 ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J 6  13  ? -61.069 -41.089 47.464 1.00 118.23 ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J 6  13  ? -63.102 -42.340 47.371 1.00 119.14 ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J 6  13  ? -64.441 -42.300 47.339 1.00 119.80 ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J 6  14  ? -70.266 -40.967 44.984 1.00 128.09 ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J 6  14  ? -71.663 -40.543 45.233 1.00 128.28 ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J 6  14  ? -70.001 -42.161 44.146 1.00 127.81 ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J 6  14  ? -69.443 -39.746 44.352 1.00 128.96 ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J 6  14  ? -69.687 -38.388 44.737 1.00 130.32 ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J 6  14  ? -68.654 -37.467 44.105 1.00 131.30 ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J 6  14  ? -67.317 -37.873 44.508 1.00 131.39 ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J 6  14  ? -68.646 -37.454 42.574 1.00 131.85 ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J 6  14  ? -68.599 -36.115 42.104 1.00 132.46 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J 6  14  ? -67.372 -38.206 42.198 1.00 131.66 ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J 6  14  ? -66.477 -37.814 43.370 1.00 131.32 ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J 6  14  ? -65.279 -38.685 43.570 1.00 130.79 ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J 6  14  ? -64.056 -38.099 43.840 1.00 130.53 ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J 6  14  ? -63.882 -36.894 43.930 1.00 130.38 ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J 6  14  ? -63.023 -38.989 44.005 1.00 130.33 ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J 6  14  ? -63.086 -40.372 43.929 1.00 130.31 ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J 6  14  ? -62.093 -41.075 44.095 1.00 130.12 ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J 6  14  ? -64.396 -40.919 43.643 1.00 130.46 ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J 6  14  ? -64.607 -42.403 43.531 1.00 130.51 ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J 6  14  ? -65.412 -40.060 43.479 1.00 130.59 ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J 6  15  ? -69.882 -35.509 41.376 1.00 132.83 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J 6  15  ? -71.022 -35.613 42.318 1.00 132.89 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J 6  15  ? -69.944 -36.151 40.041 1.00 132.60 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J 6  15  ? -69.525 -33.960 41.172 1.00 132.43 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J 6  15  ? -69.028 -33.151 42.244 1.00 131.75 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J 6  15  ? -67.953 -32.196 41.745 1.00 131.26 ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J 6  15  ? -66.648 -32.823 41.765 1.00 130.76 ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J 6  15  ? -68.159 -31.654 40.330 1.00 131.08 ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J 6  15  ? -68.112 -30.211 40.396 1.00 131.32 ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J 6  15  ? -67.116 -32.374 39.461 1.00 130.49 ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J 6  15  ? -66.090 -32.901 40.466 1.00 130.15 ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J 6  15  ? -65.673 -34.295 40.324 1.00 129.44 ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J 6  15  ? -66.400 -35.363 39.851 1.00 129.13 ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J 6  15  ? -65.739 -36.487 39.871 1.00 128.90 ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J 6  15  ? -64.500 -36.150 40.402 1.00 128.80 ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J 6  15  ? -63.357 -36.952 40.668 1.00 128.46 ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J 6  15  ? -63.214 -38.168 40.481 1.00 128.27 ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J 6  15  ? -62.305 -36.206 41.209 1.00 128.13 ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J 6  15  ? -62.350 -34.853 41.462 1.00 127.95 ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J 6  15  ? -61.248 -34.300 41.983 1.00 127.54 ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J 6  15  ? -63.411 -34.093 41.219 1.00 128.38 ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J 6  15  ? -64.446 -34.802 40.691 1.00 128.99 ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J 6  16  ? -66.984 -29.245 39.796 1.00 131.41 ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J 6  16  ? -67.316 -27.883 40.279 1.00 131.38 ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J 6  16  ? -66.892 -29.502 38.339 1.00 131.42 ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J 6  16  ? -65.622 -29.727 40.498 1.00 131.04 ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J 6  16  ? -64.474 -28.873 40.563 1.00 130.31 ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J 6  16  ? -63.364 -29.296 39.607 1.00 129.68 ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J 6  16  ? -63.301 -30.732 39.433 1.00 129.29 ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J 6  16  ? -63.458 -28.716 38.196 1.00 129.59 ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J 6  16  ? -62.211 -28.122 37.890 1.00 130.39 ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J 6  16  ? -63.717 -29.929 37.307 1.00 128.98 ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J 6  16  ? -62.932 -30.969 38.092 1.00 128.80 ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J 6  16  ? -63.173 -32.416 37.791 1.00 128.48 ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J 6  16  ? -62.256 -33.350 38.299 1.00 128.26 ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J 6  16  ? -61.289 -32.959 38.966 1.00 128.33 ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J 6  16  ? -62.450 -34.669 38.047 1.00 128.04 ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J 6  16  ? -63.500 -35.068 37.328 1.00 127.86 ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J 6  16  ? -63.632 -36.382 37.119 1.00 127.64 ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J 6  16  ? -64.450 -34.137 36.801 1.00 128.01 ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J 6  16  ? -64.251 -32.834 37.055 1.00 128.28 ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J 6  17  ? -61.938 -26.561 38.118 1.00 131.15 ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J 6  17  ? -62.730 -26.075 39.274 1.00 131.02 ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J 6  17  ? -62.071 -25.908 36.797 1.00 131.39 ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J 6  17  ? -60.387 -26.522 38.503 1.00 131.78 ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J 6  17  ? -59.891 -27.116 39.705 1.00 132.42 ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J 6  17  ? -58.553 -27.802 39.459 1.00 132.84 ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J 6  17  ? -58.769 -29.093 38.832 1.00 132.79 ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J 6  17  ? -57.572 -27.057 38.557 1.00 133.09 ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J 6  17  ? -56.249 -27.232 39.062 1.00 133.77 ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J 6  17  ? -57.774 -27.700 37.182 1.00 132.79 ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J 6  17  ? -58.226 -29.118 37.525 1.00 132.65 ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J 6  17  ? -59.255 -29.674 36.647 1.00 132.43 ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J 6  17  ? -60.193 -28.996 35.918 1.00 132.40 ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J 6  17  ? -60.994 -29.771 35.227 1.00 132.54 ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J 6  17  ? -60.555 -31.050 35.526 1.00 132.43 ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J 6  17  ? -60.986 -32.332 35.115 1.00 132.22 ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J 6  17  ? -62.001 -32.529 34.273 1.00 132.12 ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J 6  17  ? -60.326 -33.409 35.595 1.00 132.18 ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J 6  17  ? -59.301 -33.216 36.438 1.00 132.29 ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J 6  17  ? -58.808 -32.065 36.898 1.00 132.44 ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J 6  17  ? -59.483 -31.009 36.401 1.00 132.46 ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J 6  18  ? -54.961 -26.619 38.331 1.00 134.41 ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J 6  18  ? -53.996 -26.227 39.382 1.00 134.30 ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J 6  18  ? -55.396 -25.621 37.325 1.00 134.31 ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J 6  18  ? -54.377 -27.875 37.530 1.00 134.36 ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J 6  18  ? -54.065 -29.106 38.179 1.00 134.23 ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J 6  18  ? -53.963 -30.220 37.151 1.00 134.33 ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J 6  18  ? -55.256 -30.414 36.523 1.00 134.32 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J 6  18  ? -52.982 -29.976 36.005 1.00 134.50 ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J 6  18  ? -52.227 -31.156 35.761 1.00 135.13 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J 6  18  ? -53.885 -29.648 34.816 1.00 134.27 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J 6  18  ? -55.051 -30.571 35.134 1.00 134.17 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J 6  18  ? -56.293 -30.321 34.401 1.00 134.06 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J 6  18  ? -56.884 -29.118 34.087 1.00 134.02 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J 6  18  ? -58.001 -29.242 33.422 1.00 133.86 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J 6  18  ? -58.160 -30.614 33.283 1.00 133.86 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J 6  18  ? -59.184 -31.362 32.650 1.00 133.86 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J 6  18  ? -60.193 -30.940 32.069 1.00 133.86 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J 6  18  ? -58.959 -32.738 32.743 1.00 133.83 ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J 6  18  ? -57.878 -33.317 33.370 1.00 133.65 ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J 6  18  ? -57.816 -34.653 33.367 1.00 133.51 ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J 6  18  ? -56.915 -32.628 33.964 1.00 133.73 ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J 6  18  ? -57.120 -31.289 33.884 1.00 133.92 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J 6  19  ? -50.769 -31.069 35.115 1.00 135.68 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J 6  19  ? -49.807 -31.238 36.223 1.00 135.82 ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J 6  19  ? -50.719 -29.877 34.240 1.00 135.62 ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J 6  19  ? -50.673 -32.336 34.150 1.00 136.60 ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J 6  19  ? -50.848 -33.648 34.657 1.00 138.20 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J 6  19  ? -51.815 -34.425 33.786 1.00 139.48 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J 6  19  ? -52.994 -33.626 33.535 1.00 139.40 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J 6  19  ? -51.267 -34.814 32.417 1.00 140.61 ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J 6  19  ? -51.022 -36.217 32.380 1.00 143.12 ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J 6  19  ? -52.358 -34.395 31.432 1.00 140.16 ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J 6  19  ? -53.552 -34.074 32.324 1.00 139.61 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J 6  19  ? -54.430 -33.040 31.775 1.00 139.36 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J 6  19  ? -54.271 -31.683 31.860 1.00 139.34 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J 6  19  ? -55.218 -30.993 31.269 1.00 139.14 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J 6  19  ? -56.054 -31.968 30.757 1.00 138.99 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J 6  19  ? -57.247 -31.893 30.015 1.00 139.00 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J 6  19  ? -57.804 -30.731 29.662 1.00 139.16 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J 6  19  ? -57.842 -33.054 29.656 1.00 139.00 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J 6  19  ? -57.275 -34.214 30.017 1.00 138.75 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J 6  19  ? -56.155 -34.407 30.712 1.00 138.74 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J 6  19  ? -55.586 -33.236 31.054 1.00 139.02 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J 6  20  ? -50.080 -36.875 31.260 1.00 145.23 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J 6  20  ? -49.585 -38.177 31.761 1.00 145.44 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J 6  20  ? -49.089 -35.865 30.827 1.00 145.03 ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J 6  20  ? -51.108 -37.146 30.061 1.00 147.17 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J 6  20  ? -52.237 -38.008 30.243 1.00 150.10 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J 6  20  ? -53.193 -37.934 29.063 1.00 152.48 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J 6  20  ? -53.904 -36.668 29.060 1.00 153.11 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J 6  20  ? -52.530 -38.061 27.692 1.00 153.95 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J 6  20  ? -53.180 -39.079 26.936 1.00 156.11 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J 6  20  ? -52.729 -36.682 27.067 1.00 153.91 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J 6  20  ? -54.045 -36.265 27.714 1.00 153.84 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J 6  20  ? -54.382 -34.800 27.630 1.00 154.26 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J 6  20  ? -55.600 -34.414 27.094 1.00 154.60 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J 6  20  ? -56.442 -35.193 26.677 1.00 154.96 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J 6  20  ? -55.813 -33.058 27.063 1.00 154.71 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J 6  20  ? -54.951 -32.067 27.499 1.00 154.82 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J 6  20  ? -55.254 -30.879 27.419 1.00 155.16 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J 6  20  ? -53.693 -32.532 28.048 1.00 154.67 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J 6  20  ? -52.664 -31.563 28.561 1.00 154.51 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J 6  20  ? -53.475 -33.856 28.084 1.00 154.39 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J 6  21  ? -52.380 -40.329 26.330 1.00 157.64 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J 6  21  ? -52.646 -41.491 27.205 1.00 157.55 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J 6  21  ? -50.985 -39.911 26.064 1.00 157.62 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J 6  21  ? -53.098 -40.559 24.915 1.00 159.24 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J 6  21  ? -54.508 -40.786 24.836 1.00 161.57 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J 6  21  ? -55.204 -39.819 23.884 1.00 163.18 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J 6  21  ? -55.061 -38.438 24.314 1.00 163.36 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J 6  21  ? -54.734 -39.857 22.426 1.00 164.30 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J 6  21  ? -55.813 -40.367 21.619 1.00 166.09 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J 6  21  ? -54.350 -38.401 22.140 1.00 164.07 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J 6  21  ? -55.229 -37.670 23.145 1.00 163.71 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J 6  21  ? -54.879 -36.268 23.377 1.00 163.72 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J 6  21  ? -53.714 -35.774 23.896 1.00 163.73 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J 6  21  ? -53.682 -34.464 23.987 1.00 163.76 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J 6  21  ? -54.913 -34.066 23.490 1.00 163.83 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J 6  21  ? -55.511 -32.795 23.312 1.00 163.83 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J 6  21  ? -54.911 -31.644 23.633 1.00 163.71 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J 6  21  ? -56.757 -32.750 22.785 1.00 163.91 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J 6  21  ? -57.364 -33.902 22.457 1.00 163.98 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J 6  21  ? -56.907 -35.151 22.583 1.00 163.94 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J 6  21  ? -55.665 -35.168 23.107 1.00 163.83 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J 6  22  ? -56.082 -40.020 20.073 1.00 167.58 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J 6  22  ? -56.900 -41.130 19.533 1.00 167.68 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J 6  22  ? -54.804 -39.679 19.406 1.00 167.35 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J 6  22  ? -56.990 -38.699 20.157 1.00 168.93 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J 6  22  ? -58.204 -38.569 19.408 1.00 170.95 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J 6  22  ? -58.117 -37.438 18.392 1.00 172.51 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J 6  22  ? -57.491 -36.268 18.990 1.00 172.78 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J 6  22  ? -57.306 -37.742 17.131 1.00 173.50 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J 6  22  ? -57.955 -37.170 15.982 1.00 174.99 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J 6  22  ? -55.973 -37.065 17.441 1.00 173.35 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J 6  22  ? -56.502 -35.794 18.096 1.00 173.14 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J 6  22  ? -55.498 -34.939 18.823 1.00 173.21 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J 6  22  ? -55.865 -33.648 19.253 1.00 173.24 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J 6  22  ? -57.010 -33.224 19.039 1.00 173.27 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J 6  22  ? -54.944 -32.888 19.906 1.00 173.29 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J 6  22  ? -53.713 -33.365 20.129 1.00 173.45 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J 6  22  ? -52.843 -32.585 20.777 1.00 173.53 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J 6  22  ? -53.316 -34.670 19.700 1.00 173.39 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J 6  22  ? -54.230 -35.410 19.058 1.00 173.29 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J 6  23  ? -57.339 -37.302 14.504 1.00 176.27 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J 6  23  ? -57.291 -38.746 14.179 1.00 176.32 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J 6  23  ? -56.098 -36.496 14.429 1.00 176.21 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J 6  23  ? -58.427 -36.593 13.560 1.00 176.82 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J 6  23  ? -59.001 -35.313 13.867 1.00 177.62 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J 6  23  ? -58.184 -34.123 13.370 1.00 178.31 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J 6  23  ? -57.234 -33.747 14.396 1.00 178.40 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J 6  23  ? -57.329 -34.294 12.109 1.00 178.71 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J 6  23  ? -58.101 -34.004 10.910 1.00 179.04 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J 6  23  ? -56.148 -33.343 12.350 1.00 178.68 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J 6  23  ? -56.312 -32.866 13.793 1.00 178.45 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J 6  23  ? -55.039 -32.835 14.592 1.00 178.28 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J 6  23  ? -54.797 -31.767 15.441 1.00 178.20 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J 6  23  ? -55.563 -30.829 15.590 1.00 178.12 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J 6  23  ? -53.605 -31.836 16.123 1.00 178.14 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J 6  23  ? -52.652 -32.839 16.048 1.00 178.11 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J 6  23  ? -51.617 -32.791 16.707 1.00 177.93 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J 6  23  ? -52.963 -33.924 15.141 1.00 178.22 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J 6  23  ? -52.017 -35.077 14.961 1.00 178.20 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J 6  23  ? -54.125 -33.869 14.469 1.00 178.21 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J 6  24  ? -57.610 -33.128 9.647  1.00 179.25 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J 6  24  ? -58.556 -33.399 8.541  1.00 179.23 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J 6  24  ? -56.160 -33.335 9.411  1.00 179.13 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J 6  24  ? -57.845 -31.632 10.172 1.00 179.29 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J 6  24  ? -57.951 -30.535 9.267  1.00 179.31 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J 6  24  ? -56.666 -29.725 9.221  1.00 179.32 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J 6  24  ? -55.847 -29.989 10.395 1.00 179.31 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J 6  24  ? -55.780 -29.992 8.000  1.00 179.21 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J 6  24  ? -55.620 -28.768 7.244  1.00 178.83 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J 6  24  ? -54.490 -30.548 8.609  1.00 179.29 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J 6  24  ? -54.503 -29.893 9.983  1.00 179.37 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J 6  24  ? -53.608 -30.521 10.953 1.00 179.47 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J 6  24  ? -53.293 -31.849 11.047 1.00 179.51 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J 6  24  ? -52.451 -32.130 12.012 1.00 179.57 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J 6  24  ? -52.190 -30.899 12.591 1.00 179.52 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J 6  24  ? -51.368 -30.512 13.670 1.00 179.48 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J 6  24  ? -50.637 -31.382 14.371 1.00 179.34 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J 6  24  ? -51.326 -29.198 14.000 1.00 179.48 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J 6  24  ? -52.061 -28.328 13.290 1.00 179.40 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J 6  24  ? -52.869 -28.576 12.255 1.00 179.50 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J 6  24  ? -52.892 -29.891 11.950 1.00 179.54 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J 6  25  ? -54.261 -28.270 6.540  1.00 178.51 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J 6  25  ? -54.625 -27.177 5.609  1.00 178.42 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J 6  25  ? -53.511 -29.434 6.017  1.00 178.47 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J 6  25  ? -53.433 -27.653 7.761  1.00 178.08 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J 6  25  ? -53.834 -26.433 8.382  1.00 177.46 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J 6  25  ? -52.618 -25.707 8.933  1.00 177.03 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J 6  25  ? -51.965 -26.549 9.918  1.00 177.02 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J 6  25  ? -51.558 -25.350 7.894  1.00 176.73 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J 6  25  ? -51.095 -24.020 8.108  1.00 176.24 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J 6  25  ? -50.450 -26.377 8.119  1.00 176.80 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J 6  25  ? -50.594 -26.705 9.605  1.00 176.90 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J 6  25  ? -50.153 -28.092 10.016 1.00 176.84 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J 6  25  ? -49.285 -28.260 11.113 1.00 176.75 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J 6  25  ? -48.871 -27.274 11.739 1.00 176.64 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J 6  25  ? -48.902 -29.518 11.466 1.00 176.67 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J 6  25  ? -49.351 -30.578 10.786 1.00 176.59 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J 6  25  ? -48.943 -31.788 11.181 1.00 176.39 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J 6  25  ? -50.236 -30.434 9.672  1.00 176.69 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J 6  25  ? -50.607 -29.191 9.329  1.00 176.80 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J 6  26  ? -51.245 -22.883 6.985  1.00 175.82 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J 6  26  ? -52.187 -21.862 7.500  1.00 175.77 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J 6  26  ? -51.511 -23.528 5.678  1.00 175.85 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J 6  26  ? -49.770 -22.259 6.925  1.00 174.99 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J 6  26  ? -49.136 -21.761 8.104  1.00 173.40 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J 6  26  ? -47.838 -22.494 8.405  1.00 172.19 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J 6  26  ? -48.064 -23.915 8.594  1.00 171.84 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J 6  26  ? -46.758 -22.395 7.325  1.00 171.50 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J 6  26  ? -45.641 -21.643 7.813  1.00 170.59 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J 6  26  ? -46.393 -23.853 7.043  1.00 171.56 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J 6  26  ? -46.799 -24.487 8.367  1.00 171.78 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J 6  26  ? -46.854 -25.989 8.432  1.00 171.99 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J 6  26  ? -46.560 -26.632 9.651  1.00 172.05 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J 6  26  ? -46.259 -25.963 10.649 1.00 172.12 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J 6  26  ? -46.600 -27.990 9.708  1.00 171.99 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J 6  26  ? -46.925 -28.701 8.625  1.00 171.97 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J 6  26  ? -46.955 -30.033 8.742  1.00 171.72 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J 6  26  ? -47.232 -28.072 7.377  1.00 172.11 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J 6  26  ? -47.180 -26.730 7.326  1.00 172.12 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J 6  27  ? -45.324 -20.178 7.234  1.00 169.79 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J 6  27  ? -46.479 -19.298 7.532  1.00 169.88 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J 6  27  ? -44.857 -20.334 5.837  1.00 169.75 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J 6  27  ? -44.070 -19.669 8.089  1.00 168.71 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J 6  27  ? -44.122 -19.552 9.512  1.00 166.64 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J 6  27  ? -43.043 -20.405 10.161 1.00 165.00 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J 6  27  ? -43.382 -21.807 10.007 1.00 164.19 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J 6  27  ? -41.627 -20.230 9.608  1.00 164.40 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J 6  27  ? -40.745 -20.110 10.720 1.00 164.33 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J 6  27  ? -41.399 -21.508 8.801  1.00 163.84 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J 6  27  ? -42.248 -22.519 9.563  1.00 163.59 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J 6  27  ? -42.687 -23.672 8.773  1.00 163.03 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J 6  27  ? -42.924 -23.711 7.426  1.00 162.84 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J 6  27  ? -43.307 -24.885 6.983  1.00 162.59 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J 6  27  ? -43.329 -25.675 8.116  1.00 162.30 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J 6  27  ? -43.651 -27.032 8.322  1.00 161.92 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J 6  27  ? -44.029 -27.852 7.341  1.00 161.59 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J 6  27  ? -43.564 -27.521 9.578  1.00 161.97 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J 6  27  ? -43.182 -26.698 10.565 1.00 162.24 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J 6  27  ? -42.854 -25.406 10.491 1.00 162.52 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J 6  27  ? -42.947 -24.946 9.229  1.00 162.61 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J 6  28  ? -39.174 -19.764 10.654 1.00 164.06 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J 6  28  ? -39.035 -18.297 10.820 1.00 164.14 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J 6  28  ? -38.533 -20.446 9.502  1.00 163.76 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J 6  28  ? -38.655 -20.471 11.996 1.00 162.92 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J 6  28  ? -39.469 -21.450 12.668 1.00 161.13 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J 6  28  ? -38.953 -22.870 12.474 1.00 159.59 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J 6  28  ? -39.728 -23.599 11.481 1.00 159.27 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J 6  28  ? -37.494 -22.974 12.026 1.00 158.64 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J 6  28  ? -36.832 -23.924 12.837 1.00 156.99 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J 6  28  ? -37.605 -23.474 10.592 1.00 158.80 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J 6  28  ? -38.791 -24.402 10.794 1.00 158.96 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J 6  28  ? -39.320 -25.008 9.573  1.00 158.81 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J 6  28  ? -39.462 -24.444 8.335  1.00 158.76 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J 6  28  ? -39.958 -25.259 7.435  1.00 158.61 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J 6  28  ? -40.142 -26.441 8.129  1.00 158.57 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J 6  28  ? -40.637 -27.705 7.748  1.00 158.58 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J 6  28  ? -41.055 -27.983 6.511  1.00 158.61 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J 6  28  ? -40.695 -28.672 8.691  1.00 158.60 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J 6  28  ? -40.277 -28.398 9.934  1.00 158.52 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J 6  28  ? -39.792 -27.250 10.407 1.00 158.58 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J 6  28  ? -39.752 -26.306 9.448  1.00 158.63 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J 6  29  ? -36.095 -23.503 14.191 1.00 155.68 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J 6  29  ? -36.613 -24.398 15.252 1.00 155.65 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J 6  29  ? -36.201 -22.036 14.369 1.00 155.55 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J 6  29  ? -34.557 -23.847 13.875 1.00 154.59 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J 6  29  ? -34.178 -24.937 13.030 1.00 152.70 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J 6  29  ? -34.669 -26.264 13.597 1.00 151.37 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J 6  29  ? -35.882 -26.704 12.930 1.00 150.86 ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J 6  29  ? -33.704 -27.430 13.495 1.00 150.65 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J 6  29  ? -33.902 -28.253 14.626 1.00 149.85 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J 6  29  ? -34.133 -28.125 12.208 1.00 150.72 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J 6  29  ? -35.608 -27.783 12.054 1.00 150.73 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J 6  29  ? -35.954 -27.398 10.681 1.00 150.67 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J 6  29  ? -35.778 -26.172 10.100 1.00 150.54 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J 6  29  ? -36.179 -26.096 8.854  1.00 150.20 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J 6  29  ? -36.645 -27.369 8.588  1.00 150.09 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J 6  29  ? -37.205 -27.946 7.431  1.00 149.90 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J 6  29  ? -37.385 -27.269 6.295  1.00 149.78 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J 6  29  ? -37.571 -29.246 7.486  1.00 149.95 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J 6  29  ? -37.386 -29.920 8.630  1.00 150.12 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J 6  29  ? -36.871 -29.484 9.782  1.00 150.32 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J 6  29  ? -36.515 -28.188 9.698  1.00 150.38 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J 6  30  ? -33.054 -29.584 14.866 1.00 149.38 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J 6  30  ? -33.173 -29.889 16.306 1.00 149.46 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J 6  30  ? -31.718 -29.442 14.239 1.00 149.29 ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J 6  30  ? -33.888 -30.674 14.049 1.00 149.42 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J 6  30  ? -33.693 -32.059 14.284 1.00 149.59 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J 6  30  ? -33.490 -32.775 12.964 1.00 149.87 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J 6  30  ? -33.962 -31.931 11.879 1.00 150.08 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J 6  30  ? -32.037 -33.124 12.650 1.00 150.07 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J 6  30  ? -31.953 -34.504 12.284 1.00 150.42 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J 6  30  ? -31.693 -32.192 11.489 1.00 150.14 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J 6  30  ? -33.050 -32.052 10.809 1.00 150.28 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J 6  30  ? -33.163 -30.907 9.901  1.00 150.25 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J 6  30  ? -32.658 -29.649 10.084 1.00 150.15 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J 6  30  ? -32.907 -28.817 9.104  1.00 150.09 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J 6  30  ? -33.619 -29.587 8.204  1.00 150.22 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J 6  30  ? -34.174 -29.292 6.945  1.00 150.27 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J 6  30  ? -34.085 -28.085 6.378  1.00 150.24 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J 6  30  ? -34.826 -30.286 6.298  1.00 150.39 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J 6  30  ? -34.910 -31.495 6.873  1.00 150.23 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J 6  30  ? -34.430 -31.889 8.053  1.00 150.15 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J 6  30  ? -33.789 -30.879 8.675  1.00 150.22 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J 6  31  ? -30.567 -35.283 12.053 1.00 150.70 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J 6  31  ? -30.363 -36.210 13.187 1.00 150.59 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J 6  31  ? -29.505 -34.310 11.712 1.00 150.47 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J 6  31  ? -30.873 -36.145 10.739 1.00 151.82 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J 6  31  ? -32.202 -36.294 10.216 1.00 153.03 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J 6  31  ? -32.227 -36.277 8.694  1.00 153.91 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J 6  31  ? -32.409 -34.919 8.215  1.00 154.04 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J 6  31  ? -30.970 -36.807 8.000  1.00 154.55 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J 6  31  ? -31.329 -37.793 7.025  1.00 155.37 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J 6  31  ? -30.338 -35.561 7.374  1.00 154.43 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J 6  31  ? -31.582 -34.730 7.085  1.00 154.47 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J 6  31  ? -31.361 -33.297 6.889  1.00 154.73 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J 6  31  ? -30.961 -32.382 7.832  1.00 154.79 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J 6  31  ? -30.857 -31.166 7.372  1.00 154.81 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J 6  31  ? -31.214 -31.277 6.036  1.00 154.88 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J 6  31  ? -31.287 -30.287 5.025  1.00 155.00 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J 6  31  ? -31.043 -29.078 5.125  1.00 155.10 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J 6  31  ? -31.689 -30.813 3.796  1.00 155.21 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J 6  31  ? -31.986 -32.140 3.576  1.00 155.30 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J 6  31  ? -32.354 -32.472 2.329  1.00 155.48 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J 6  31  ? -31.918 -33.079 4.515  1.00 155.18 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J 6  31  ? -31.528 -32.582 5.720  1.00 154.94 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J 6  32  ? -30.296 -38.923 6.546  1.00 155.93 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J 6  32  ? -30.966 -40.232 6.688  1.00 155.71 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J 6  32  ? -28.993 -38.696 7.212  1.00 155.98 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J 6  32  ? -30.095 -38.599 4.991  1.00 156.97 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J 6  32  ? -31.181 -38.175 4.161  1.00 158.39 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J 6  32  ? -30.696 -37.540 2.862  1.00 159.44 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J 6  32  ? -30.534 -36.109 3.052  1.00 159.67 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J 6  32  ? -29.372 -38.068 2.292  1.00 160.04 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J 6  32  ? -29.566 -38.503 0.930  1.00 160.74 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J 6  32  ? -28.419 -36.879 2.436  1.00 160.12 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J 6  32  ? -29.374 -35.693 2.366  1.00 160.09 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J 6  32  ? -28.866 -34.438 3.002  1.00 160.33 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J 6  32  ? -29.162 -33.221 2.419  1.00 160.52 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J 6  32  ? -29.822 -33.093 1.403  1.00 160.72 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J 6  32  ? -28.652 -32.133 3.085  1.00 160.74 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J 6  32  ? -27.892 -32.137 4.244  1.00 160.92 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J 6  32  ? -27.482 -31.100 4.757  1.00 161.14 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J 6  32  ? -27.614 -33.442 4.802  1.00 160.85 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J 6  32  ? -26.800 -33.587 6.057  1.00 160.63 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J 6  32  ? -28.111 -34.512 4.162  1.00 160.67 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J 6  33  ? -28.405 -38.716 -0.166 1.00 161.28 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J 6  33  ? -28.759 -39.927 -0.940 1.00 161.28 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J 6  33  ? -27.064 -38.629 0.458  1.00 161.35 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J 6  33  ? -28.601 -37.426 -1.093 1.00 161.78 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J 6  33  ? -27.924 -37.317 -2.343 1.00 162.56 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J 6  33  ? -27.055 -36.071 -2.422 1.00 163.11 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J 6  33  ? -27.112 -35.300 -1.194 1.00 163.43 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J 6  33  ? -25.572 -36.346 -2.660 1.00 163.34 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J 6  33  ? -25.289 -36.152 -4.054 1.00 163.51 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J 6  33  ? -24.846 -35.367 -1.730 1.00 163.44 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J 6  33  ? -25.958 -34.488 -1.169 1.00 163.51 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J 6  33  ? -25.676 -34.017 0.189  1.00 163.52 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J 6  33  ? -25.526 -34.787 1.319  1.00 163.57 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J 6  33  ? -25.269 -34.098 2.394  1.00 163.54 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J 6  33  ? -25.243 -32.781 1.954  1.00 163.58 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J 6  33  ? -25.010 -31.580 2.674  1.00 163.63 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J 6  33  ? -24.773 -31.445 3.882  1.00 163.60 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J 6  33  ? -25.071 -30.453 1.855  1.00 163.65 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J 6  33  ? -25.322 -30.484 0.502  1.00 163.61 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J 6  33  ? -25.342 -29.298 -0.121 1.00 163.54 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J 6  33  ? -25.545 -31.602 -0.185 1.00 163.59 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J 6  33  ? -25.490 -32.713 0.598  1.00 163.53 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J 6  34  ? -23.860 -35.725 -4.652 1.00 163.83 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J 6  34  ? -23.871 -36.096 -6.086 1.00 164.11 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J 6  34  ? -22.768 -36.239 -3.789 1.00 163.75 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J 6  34  ? -23.918 -34.129 -4.520 1.00 163.63 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J 6  34  ? -23.566 -33.270 -5.604 1.00 163.41 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J 6  34  ? -22.379 -32.399 -5.237 1.00 163.16 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J 6  34  ? -22.499 -31.999 -3.848 1.00 163.40 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J 6  34  ? -21.025 -33.092 -5.388 1.00 162.94 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J 6  34  ? -20.239 -32.463 -6.431 1.00 162.56 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J 6  34  ? -20.410 -33.077 -3.986 1.00 163.26 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J 6  34  ? -21.218 -32.005 -3.252 1.00 163.56 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J 6  34  ? -21.326 -32.163 -1.742 1.00 163.74 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J 6  34  ? -21.754 -31.092 -0.967 1.00 163.60 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J 6  34  ? -22.068 -30.001 -1.416 1.00 163.40 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J 6  34  ? -21.807 -31.345 0.383  1.00 163.53 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J 6  34  ? -21.483 -32.524 1.035  1.00 163.62 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J 6  34  ? -21.572 -32.627 2.255  1.00 163.53 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J 6  34  ? -21.040 -33.603 0.176  1.00 163.68 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J 6  34  ? -20.655 -34.940 0.741  1.00 163.67 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J 6  34  ? -20.985 -33.372 -1.145 1.00 163.77 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J 6  35  ? -19.176 -31.266 -6.266 1.00 162.36 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J 6  35  ? -18.788 -30.858 -7.636 1.00 162.42 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J 6  35  ? -18.116 -31.704 -5.331 1.00 162.23 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J 6  35  ? -20.013 -30.075 -5.589 1.00 162.03 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J 6  35  ? -19.753 -28.701 -5.901 1.00 161.47 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J 6  35  ? -18.852 -28.028 -4.871 1.00 161.08 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J 6  35  ? -19.085 -28.573 -3.542 1.00 161.03 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J 6  35  ? -17.349 -28.153 -5.135 1.00 160.72 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J 6  35  ? -16.748 -26.847 -5.117 1.00 160.19 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J 6  35  ? -16.856 -29.061 -4.007 1.00 160.67 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J 6  35  ? -17.840 -28.735 -2.891 1.00 160.73 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J 6  35  ? -17.941 -29.778 -1.867 1.00 160.35 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J 6  35  ? -18.039 -31.126 -2.080 1.00 160.18 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J 6  35  ? -18.112 -31.842 -0.985 1.00 159.99 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J 6  35  ? -18.056 -30.898 0.022  1.00 159.89 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J 6  35  ? -18.087 -31.019 1.423  1.00 159.78 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J 6  35  ? -18.192 -32.200 2.039  1.00 159.65 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J 6  35  ? -18.009 -29.886 2.159  1.00 159.81 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J 6  35  ? -17.905 -28.708 1.523  1.00 159.75 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J 6  35  ? -17.868 -28.470 0.209  1.00 159.78 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J 6  35  ? -17.947 -29.617 -0.496 1.00 160.02 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J 6  36  ? -15.169 -26.598 -4.945 1.00 159.84 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J 6  36  ? -14.866 -25.266 -5.514 1.00 159.80 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J 6  36  ? -14.429 -27.779 -5.447 1.00 159.75 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J 6  36  ? -15.000 -26.532 -3.351 1.00 159.25 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J 6  36  ? -15.750 -25.592 -2.570 1.00 158.27 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J 6  36  ? -15.181 -25.426 -1.168 1.00 157.43 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J 6  36  ? -15.458 -26.615 -0.383 1.00 156.98 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J 6  36  ? -13.673 -25.189 -1.100 1.00 157.20 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J 6  36  ? -13.417 -24.052 -0.287 1.00 157.27 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J 6  36  ? -13.115 -26.469 -0.482 1.00 156.87 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J 6  36  ? -14.296 -26.989 0.328  1.00 156.62 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J 6  36  ? -14.274 -28.479 0.535  1.00 156.08 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J 6  36  ? -14.276 -28.986 1.823  1.00 155.74 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J 6  36  ? -14.303 -28.293 2.825  1.00 155.42 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J 6  36  ? -14.249 -30.358 1.898  1.00 155.57 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J 6  36  ? -14.217 -31.255 0.842  1.00 155.52 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J 6  36  ? -14.195 -32.468 1.021  1.00 155.44 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J 6  36  ? -14.213 -30.664 -0.475 1.00 155.62 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J 6  36  ? -14.181 -31.528 -1.704 1.00 155.61 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J 6  36  ? -14.241 -29.325 -0.563 1.00 155.87 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J 6  37  ? -11.988 -23.323 -0.229 1.00 157.44 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J 6  37  ? -12.104 -22.047 -0.971 1.00 157.30 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J 6  37  ? -10.909 -24.285 -0.569 1.00 157.28 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J 6  37  ? -11.859 -22.967 1.326  1.00 157.37 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J 6  37  ? -12.924 -23.229 2.254  1.00 156.73 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J 6  37  ? -12.405 -23.896 3.517  1.00 156.11 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J 6  37  ? -12.566 -25.331 3.398  1.00 155.94 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J 6  37  ? -10.925 -23.649 3.807  1.00 155.88 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J 6  37  ? -10.781 -22.877 4.998  1.00 155.47 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J 6  37  ? -10.306 -25.043 3.920  1.00 156.03 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J 6  37  ? -11.511 -25.957 4.093  1.00 156.23 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J 6  37  ? -11.299 -27.335 3.541  1.00 156.62 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J 6  37  ? -11.708 -28.444 4.264  1.00 156.84 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J 6  37  ? -12.254 -28.389 5.353  1.00 157.01 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J 6  37  ? -11.457 -29.650 3.651  1.00 156.91 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J 6  37  ? -10.849 -29.859 2.422  1.00 157.07 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J 6  37  ? -10.673 -30.989 1.971  1.00 157.13 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J 6  37  ? -10.441 -28.659 1.722  1.00 157.13 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J 6  37  ? -9.770  -28.736 0.379  1.00 157.32 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J 6  37  ? -10.683 -27.477 2.308  1.00 156.90 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J 6  38  ? -9.343  -22.570 5.642  1.00 155.26 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J 6  38  ? -9.472  -21.312 6.412  1.00 155.25 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J 6  38  ? -8.293  -22.685 4.603  1.00 155.06 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J 6  38  ? -9.154  -23.788 6.663  1.00 155.10 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J 6  38  ? -10.211 -24.163 7.560  1.00 154.57 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J 6  38  ? -9.871  -25.410 8.365  1.00 154.00 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J 6  38  ? -10.014 -26.604 7.542  1.00 153.97 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J 6  38  ? -8.461  -25.458 8.956  1.00 153.62 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J 6  38  ? -8.519  -25.931 10.294 1.00 152.68 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J 6  38  ? -7.755  -26.473 8.065  1.00 153.89 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J 6  38  ? -8.902  -27.441 7.789  1.00 154.08 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J 6  38  ? -8.657  -28.384 6.642  1.00 154.22 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J 6  38  ? -9.045  -29.711 6.743  1.00 154.15 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J 6  38  ? -9.599  -30.191 7.718  1.00 154.10 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J 6  38  ? -8.761  -30.472 5.634  1.00 154.17 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J 6  38  ? -8.140  -30.057 4.465  1.00 154.24 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J 6  38  ? -7.937  -30.832 3.535  1.00 154.23 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J 6  38  ? -7.758  -28.660 4.427  1.00 154.29 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J 6  38  ? -7.077  -28.068 3.226  1.00 154.45 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J 6  38  ? -8.030  -27.907 5.501  1.00 154.30 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J 6  39  ? -8.420  -24.952 11.554 1.00 151.73 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J 6  39  ? -9.338  -23.807 11.347 1.00 151.75 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J 6  39  ? -6.985  -24.725 11.830 1.00 151.74 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J 6  39  ? -8.999  -25.874 12.721 1.00 151.16 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J 6  39  ? -9.943  -26.893 12.413 1.00 150.49 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J 6  39  ? -9.548  -28.270 12.930 1.00 150.17 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J 6  39  ? -8.859  -29.027 11.901 1.00 150.29 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J 6  39  ? -8.628  -28.303 14.146 1.00 149.80 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J 6  39  ? -9.000  -29.392 15.001 1.00 148.45 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J 6  39  ? -7.234  -28.470 13.535 1.00 150.23 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J 6  39  ? -7.531  -29.315 12.302 1.00 150.65 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J 6  39  ? -6.694  -29.062 11.135 1.00 151.33 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J 6  39  ? -6.006  -27.919 10.784 1.00 151.70 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J 6  39  ? -5.359  -28.029 9.653  1.00 151.82 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J 6  39  ? -5.645  -29.322 9.225  1.00 151.81 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J 6  39  ? -5.231  -30.024 8.063  1.00 151.96 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J 6  39  ? -4.500  -29.622 7.145  1.00 152.12 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J 6  39  ? -5.752  -31.322 8.029  1.00 151.90 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J 6  39  ? -6.570  -31.871 8.994  1.00 151.68 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J 6  39  ? -6.975  -33.130 8.801  1.00 151.72 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J 6  39  ? -6.964  -31.227 10.083 1.00 151.52 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J 6  39  ? -6.465  -29.966 10.129 1.00 151.59 ? -34  DG  J C4    1 
ATOM   9849  P  P     . DG  J 6  40  ? -8.439  -29.505 16.497 1.00 147.23 ? -33  DG  J P     1 
ATOM   9850  O  OP1   . DG  J 6  40  ? -9.564  -29.847 17.390 1.00 147.19 ? -33  DG  J OP1   1 
ATOM   9851  O  OP2   . DG  J 6  40  ? -7.621  -28.306 16.788 1.00 147.11 ? -33  DG  J OP2   1 
ATOM   9852  O  "O5'" . DG  J 6  40  ? -7.460  -30.762 16.408 1.00 146.72 ? -33  DG  J "O5'" 1 
ATOM   9853  C  "C5'" . DG  J 6  40  ? -7.952  -32.035 16.009 1.00 146.31 ? -33  DG  J "C5'" 1 
ATOM   9854  C  "C4'" . DG  J 6  40  ? -6.813  -32.907 15.513 1.00 146.23 ? -33  DG  J "C4'" 1 
ATOM   9855  O  "O4'" . DG  J 6  40  ? -6.151  -32.258 14.398 1.00 146.09 ? -33  DG  J "O4'" 1 
ATOM   9856  C  "C3'" . DG  J 6  40  ? -5.724  -33.191 16.546 1.00 146.44 ? -33  DG  J "C3'" 1 
ATOM   9857  O  "O3'" . DG  J 6  40  ? -5.378  -34.575 16.509 1.00 146.63 ? -33  DG  J "O3'" 1 
ATOM   9858  C  "C2'" . DG  J 6  40  ? -4.558  -32.308 16.099 1.00 146.37 ? -33  DG  J "C2'" 1 
ATOM   9859  C  "C1'" . DG  J 6  40  ? -4.752  -32.342 14.588 1.00 146.16 ? -33  DG  J "C1'" 1 
ATOM   9860  N  N9    . DG  J 6  40  ? -4.101  -31.283 13.815 1.00 146.12 ? -33  DG  J N9    1 
ATOM   9861  C  C8    . DG  J 6  40  ? -3.725  -30.020 14.220 1.00 146.03 ? -33  DG  J C8    1 
ATOM   9862  N  N7    . DG  J 6  40  ? -3.165  -29.314 13.275 1.00 145.93 ? -33  DG  J N7    1 
ATOM   9863  C  C5    . DG  J 6  40  ? -3.171  -30.159 12.171 1.00 146.06 ? -33  DG  J C5    1 
ATOM   9864  C  C6    . DG  J 6  40  ? -2.696  -29.953 10.849 1.00 146.07 ? -33  DG  J C6    1 
ATOM   9865  O  O6    . DG  J 6  40  ? -2.157  -28.938 10.381 1.00 145.97 ? -33  DG  J O6    1 
ATOM   9866  N  N1    . DG  J 6  40  ? -2.898  -31.079 10.042 1.00 146.11 ? -33  DG  J N1    1 
ATOM   9867  C  C2    . DG  J 6  40  ? -3.487  -32.257 10.460 1.00 146.02 ? -33  DG  J C2    1 
ATOM   9868  N  N2    . DG  J 6  40  ? -3.603  -33.238 9.555  1.00 146.16 ? -33  DG  J N2    1 
ATOM   9869  N  N3    . DG  J 6  40  ? -3.935  -32.459 11.692 1.00 145.95 ? -33  DG  J N3    1 
ATOM   9870  C  C4    . DG  J 6  40  ? -3.744  -31.375 12.490 1.00 146.07 ? -33  DG  J C4    1 
ATOM   9871  P  P     . DA  J 6  41  ? -5.398  -35.472 17.835 1.00 146.51 ? -32  DA  J P     1 
ATOM   9872  O  OP1   . DA  J 6  41  ? -6.814  -35.725 18.187 1.00 146.40 ? -32  DA  J OP1   1 
ATOM   9873  O  OP2   . DA  J 6  41  ? -4.483  -34.852 18.821 1.00 146.15 ? -32  DA  J OP2   1 
ATOM   9874  O  "O5'" . DA  J 6  41  ? -4.731  -36.841 17.346 1.00 146.89 ? -32  DA  J "O5'" 1 
ATOM   9875  C  "C5'" . DA  J 6  41  ? -5.313  -37.609 16.294 1.00 147.71 ? -32  DA  J "C5'" 1 
ATOM   9876  C  "C4'" . DA  J 6  41  ? -4.241  -38.234 15.419 1.00 148.57 ? -32  DA  J "C4'" 1 
ATOM   9877  O  "O4'" . DA  J 6  41  ? -3.688  -37.231 14.527 1.00 148.52 ? -32  DA  J "O4'" 1 
ATOM   9878  C  "C3'" . DA  J 6  41  ? -3.068  -38.852 16.181 1.00 149.45 ? -32  DA  J "C3'" 1 
ATOM   9879  O  "O3'" . DA  J 6  41  ? -2.964  -40.248 15.821 1.00 150.95 ? -32  DA  J "O3'" 1 
ATOM   9880  C  "C2'" . DA  J 6  41  ? -1.876  -37.960 15.813 1.00 149.19 ? -32  DA  J "C2'" 1 
ATOM   9881  C  "C1'" . DA  J 6  41  ? -2.284  -37.381 14.461 1.00 148.71 ? -32  DA  J "C1'" 1 
ATOM   9882  N  N9    . DA  J 6  41  ? -1.672  -36.087 14.131 1.00 148.40 ? -32  DA  J N9    1 
ATOM   9883  C  C8    . DA  J 6  41  ? -1.333  -35.080 14.997 1.00 148.16 ? -32  DA  J C8    1 
ATOM   9884  N  N7    . DA  J 6  41  ? -0.802  -34.030 14.419 1.00 147.97 ? -32  DA  J N7    1 
ATOM   9885  C  C5    . DA  J 6  41  ? -0.792  -34.363 13.074 1.00 148.06 ? -32  DA  J C5    1 
ATOM   9886  C  C6    . DA  J 6  41  ? -0.352  -33.672 11.920 1.00 147.97 ? -32  DA  J C6    1 
ATOM   9887  N  N6    . DA  J 6  41  ? 0.184   -32.449 11.952 1.00 147.70 ? -32  DA  J N6    1 
ATOM   9888  N  N1    . DA  J 6  41  ? -0.483  -34.288 10.722 1.00 148.13 ? -32  DA  J N1    1 
ATOM   9889  C  C2    . DA  J 6  41  ? -1.018  -35.518 10.680 1.00 148.21 ? -32  DA  J C2    1 
ATOM   9890  N  N3    . DA  J 6  41  ? -1.465  -36.264 11.696 1.00 148.27 ? -32  DA  J N3    1 
ATOM   9891  C  C4    . DA  J 6  41  ? -1.323  -35.629 12.877 1.00 148.23 ? -32  DA  J C4    1 
ATOM   9892  P  P     . DA  J 6  42  ? -1.617  -41.046 15.453 1.00 152.08 ? -31  DA  J P     1 
ATOM   9893  O  OP1   . DA  J 6  42  ? -1.974  -42.485 15.461 1.00 152.04 ? -31  DA  J OP1   1 
ATOM   9894  O  OP2   . DA  J 6  42  ? -0.500  -40.568 16.305 1.00 151.90 ? -31  DA  J OP2   1 
ATOM   9895  O  "O5'" . DA  J 6  42  ? -1.347  -40.585 13.941 1.00 152.69 ? -31  DA  J "O5'" 1 
ATOM   9896  C  "C5'" . DA  J 6  42  ? -0.614  -41.401 13.026 1.00 153.58 ? -31  DA  J "C5'" 1 
ATOM   9897  C  "C4'" . DA  J 6  42  ? 0.780   -40.850 12.783 1.00 154.16 ? -31  DA  J "C4'" 1 
ATOM   9898  O  "O4'" . DA  J 6  42  ? 0.757   -39.406 12.713 1.00 154.24 ? -31  DA  J "O4'" 1 
ATOM   9899  C  "C3'" . DA  J 6  42  ? 1.769   -41.143 13.899 1.00 154.68 ? -31  DA  J "C3'" 1 
ATOM   9900  O  "O3'" . DA  J 6  42  ? 2.318   -42.472 13.753 1.00 155.71 ? -31  DA  J "O3'" 1 
ATOM   9901  C  "C2'" . DA  J 6  42  ? 2.771   -39.991 13.808 1.00 154.55 ? -31  DA  J "C2'" 1 
ATOM   9902  C  "C1'" . DA  J 6  42  ? 2.076   -38.954 12.925 1.00 154.49 ? -31  DA  J "C1'" 1 
ATOM   9903  N  N9    . DA  J 6  42  ? 2.052   -37.616 13.518 1.00 154.79 ? -31  DA  J N9    1 
ATOM   9904  C  C8    . DA  J 6  42  ? 1.615   -37.276 14.768 1.00 154.80 ? -31  DA  J C8    1 
ATOM   9905  N  N7    . DA  J 6  42  ? 1.720   -35.998 15.040 1.00 155.02 ? -31  DA  J N7    1 
ATOM   9906  C  C5    . DA  J 6  42  ? 2.267   -35.454 13.890 1.00 155.30 ? -31  DA  J C5    1 
ATOM   9907  C  C6    . DA  J 6  42  ? 2.628   -34.131 13.530 1.00 155.61 ? -31  DA  J C6    1 
ATOM   9908  N  N6    . DA  J 6  42  ? 2.479   -33.081 14.346 1.00 155.86 ? -31  DA  J N6    1 
ATOM   9909  N  N1    . DA  J 6  42  ? 3.150   -33.924 12.297 1.00 155.55 ? -31  DA  J N1    1 
ATOM   9910  C  C2    . DA  J 6  42  ? 3.300   -34.976 11.480 1.00 155.45 ? -31  DA  J C2    1 
ATOM   9911  N  N3    . DA  J 6  42  ? 2.997   -36.259 11.707 1.00 155.34 ? -31  DA  J N3    1 
ATOM   9912  C  C4    . DA  J 6  42  ? 2.479   -36.438 12.939 1.00 155.12 ? -31  DA  J C4    1 
ATOM   9913  P  P     . DA  J 6  43  ? 3.604   -42.915 12.893 1.00 156.64 ? -30  DA  J P     1 
ATOM   9914  O  OP1   . DA  J 6  43  ? 3.197   -44.104 12.109 1.00 156.54 ? -30  DA  J OP1   1 
ATOM   9915  O  OP2   . DA  J 6  43  ? 4.740   -43.019 13.835 1.00 156.61 ? -30  DA  J OP2   1 
ATOM   9916  O  "O5'" . DA  J 6  43  ? 3.927   -41.712 11.884 1.00 157.16 ? -30  DA  J "O5'" 1 
ATOM   9917  C  "C5'" . DA  J 6  43  ? 5.086   -41.762 11.051 1.00 157.74 ? -30  DA  J "C5'" 1 
ATOM   9918  C  "C4'" . DA  J 6  43  ? 6.157   -40.754 11.451 1.00 158.28 ? -30  DA  J "C4'" 1 
ATOM   9919  O  "O4'" . DA  J 6  43  ? 5.598   -39.629 12.183 1.00 158.50 ? -30  DA  J "O4'" 1 
ATOM   9920  C  "C3'" . DA  J 6  43  ? 7.294   -41.293 12.324 1.00 158.60 ? -30  DA  J "C3'" 1 
ATOM   9921  O  "O3'" . DA  J 6  43  ? 8.523   -41.201 11.582 1.00 158.80 ? -30  DA  J "O3'" 1 
ATOM   9922  C  "C2'" . DA  J 6  43  ? 7.272   -40.382 13.559 1.00 158.67 ? -30  DA  J "C2'" 1 
ATOM   9923  C  "C1'" . DA  J 6  43  ? 6.648   -39.119 12.976 1.00 158.77 ? -30  DA  J "C1'" 1 
ATOM   9924  N  N9    . DA  J 6  43  ? 6.154   -38.123 13.938 1.00 159.04 ? -30  DA  J N9    1 
ATOM   9925  C  C8    . DA  J 6  43  ? 5.521   -38.346 15.132 1.00 159.10 ? -30  DA  J C8    1 
ATOM   9926  N  N7    . DA  J 6  43  ? 5.196   -37.251 15.779 1.00 159.20 ? -30  DA  J N7    1 
ATOM   9927  C  C5    . DA  J 6  43  ? 5.647   -36.229 14.958 1.00 159.30 ? -30  DA  J C5    1 
ATOM   9928  C  C6    . DA  J 6  43  ? 5.613   -34.818 15.073 1.00 159.39 ? -30  DA  J C6    1 
ATOM   9929  N  N6    . DA  J 6  43  ? 5.073   -34.178 16.114 1.00 159.60 ? -30  DA  J N6    1 
ATOM   9930  N  N1    . DA  J 6  43  ? 6.155   -34.081 14.077 1.00 159.44 ? -30  DA  J N1    1 
ATOM   9931  C  C2    . DA  J 6  43  ? 6.698   -34.721 13.031 1.00 159.58 ? -30  DA  J C2    1 
ATOM   9932  N  N3    . DA  J 6  43  ? 6.789   -36.038 12.813 1.00 159.47 ? -30  DA  J N3    1 
ATOM   9933  C  C4    . DA  J 6  43  ? 6.243   -36.749 13.821 1.00 159.25 ? -30  DA  J C4    1 
ATOM   9934  P  P     . DC  J 6  44  ? 9.956   -41.666 12.148 1.00 158.86 ? -29  DC  J P     1 
ATOM   9935  O  OP1   . DC  J 6  44  ? 10.704  -42.266 11.020 1.00 158.84 ? -29  DC  J OP1   1 
ATOM   9936  O  OP2   . DC  J 6  44  ? 9.760   -42.458 13.387 1.00 158.84 ? -29  DC  J OP2   1 
ATOM   9937  O  "O5'" . DC  J 6  44  ? 10.648  -40.278 12.553 1.00 158.21 ? -29  DC  J "O5'" 1 
ATOM   9938  C  "C5'" . DC  J 6  44  ? 10.997  -39.307 11.565 1.00 157.34 ? -29  DC  J "C5'" 1 
ATOM   9939  C  "C4'" . DC  J 6  44  ? 11.459  -38.010 12.207 1.00 156.86 ? -29  DC  J "C4'" 1 
ATOM   9940  O  "O4'" . DC  J 6  44  ? 10.390  -37.453 13.013 1.00 156.86 ? -29  DC  J "O4'" 1 
ATOM   9941  C  "C3'" . DC  J 6  44  ? 12.669  -38.136 13.131 1.00 156.64 ? -29  DC  J "C3'" 1 
ATOM   9942  O  "O3'" . DC  J 6  44  ? 13.701  -37.263 12.686 1.00 156.25 ? -29  DC  J "O3'" 1 
ATOM   9943  C  "C2'" . DC  J 6  44  ? 12.150  -37.731 14.512 1.00 156.67 ? -29  DC  J "C2'" 1 
ATOM   9944  C  "C1'" . DC  J 6  44  ? 10.962  -36.843 14.152 1.00 156.77 ? -29  DC  J "C1'" 1 
ATOM   9945  N  N1    . DC  J 6  44  ? 9.920   -36.676 15.240 1.00 156.60 ? -29  DC  J N1    1 
ATOM   9946  C  C2    . DC  J 6  44  ? 9.412   -35.396 15.543 1.00 156.52 ? -29  DC  J C2    1 
ATOM   9947  O  O2    . DC  J 6  44  ? 9.812   -34.401 14.922 1.00 156.68 ? -29  DC  J O2    1 
ATOM   9948  N  N3    . DC  J 6  44  ? 8.480   -35.275 16.526 1.00 156.29 ? -29  DC  J N3    1 
ATOM   9949  C  C4    . DC  J 6  44  ? 8.056   -36.353 17.191 1.00 156.21 ? -29  DC  J C4    1 
ATOM   9950  N  N4    . DC  J 6  44  ? 7.137   -36.178 18.143 1.00 156.18 ? -29  DC  J N4    1 
ATOM   9951  C  C5    . DC  J 6  44  ? 8.551   -37.661 16.903 1.00 156.23 ? -29  DC  J C5    1 
ATOM   9952  C  C6    . DC  J 6  44  ? 9.469   -37.771 15.934 1.00 156.40 ? -29  DC  J C6    1 
ATOM   9953  P  P     . DT  J 6  45  ? 15.210  -37.438 13.193 1.00 155.94 ? -28  DT  J P     1 
ATOM   9954  O  OP1   . DT  J 6  45  ? 16.094  -37.101 12.055 1.00 155.96 ? -28  DT  J OP1   1 
ATOM   9955  O  OP2   . DT  J 6  45  ? 15.347  -38.754 13.862 1.00 155.90 ? -28  DT  J OP2   1 
ATOM   9956  O  "O5'" . DT  J 6  45  ? 15.330  -36.304 14.318 1.00 155.75 ? -28  DT  J "O5'" 1 
ATOM   9957  C  "C5'" . DT  J 6  45  ? 15.362  -34.914 13.973 1.00 155.28 ? -28  DT  J "C5'" 1 
ATOM   9958  C  "C4'" . DT  J 6  45  ? 15.282  -34.023 15.205 1.00 154.79 ? -28  DT  J "C4'" 1 
ATOM   9959  O  "O4'" . DT  J 6  45  ? 14.011  -34.220 15.884 1.00 154.84 ? -28  DT  J "O4'" 1 
ATOM   9960  C  "C3'" . DT  J 6  45  ? 16.367  -34.248 16.259 1.00 154.35 ? -28  DT  J "C3'" 1 
ATOM   9961  O  "O3'" . DT  J 6  45  ? 16.823  -32.989 16.747 1.00 153.39 ? -28  DT  J "O3'" 1 
ATOM   9962  C  "C2'" . DT  J 6  45  ? 15.627  -35.033